5DD8A

The crystal structure of hucr mutant (hucr-e48q) from deinococcus radiodurans
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLQRLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histidine switch controlling pH-dependent protein folding and DNA binding in a transcription factor at the core of synthetic network devices.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, MarR family
total genus 53
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd8A00
4XLNF 3ZMDA 2H6BA 3F22A 4AIJA 3C7JA 1DPRA 4N0BA 4RB3C 1UHWA 5IT3A 1P2FA 3MZHA 3QP5A 3F8CA 3ABUA 4I09A 3J80K 1YTYA 1LVAA 1PP7U 4FX4A 1B1BA 2LF7A 2GXGA 1W5TA 2P6TA 4AIHA 2G9WA 1FY7A 4LGWA 3ZPLA 4TV7A 5K1YA 1SFXA 2EB7A 4AIKA 5DUKA 5JHUA 1RUNA 4UHTA 5FO5A 2E7XA 2JSCA 4KIFA 3J81Z 4A0ZA 4ETSA 3KP6A 4BQAA 3GEZA 2CSOA 5ICGA 3CUQC 4UVBA 3HOTA 2HQRA 2A07F 2FBIA 3EDPA 5JFRA 2E7WA 4HX4A 2DAOA 3HTUA 3R60A 2P5KA 2GA2A 3COAC 3GXOA 2ZBKA 3U2RA 1O3SA 3FWEA 3I5UA 4D0PA 4MQ9F 3I53A 2E1CA 3DFGA 1YW7A 4NQWA 2Z3YA 3FMSA 3WTSC 2R3SA 3GFIA 1ZG5A 1KU9A 3TO9A 5L3DA 3CO7C 5CVVA 4GYGA 1HW2A 1IW7F 2CG4A 4FX0A 3R0JA 4I0AA 3LQQA 1TBXA 3RKWA 4N9HA 4G6QA 2K4BA 3JSOA 1U5TC 1FX7A 2D2WA 1Q1HA 4JQFA 3LAPA 2YSRA 1TNTA 2VODA 4KNYA 3E97A 4CICA 2KRFA 4ASNA 2KJBA 4EM1A 3WTTC 3J7AO 4GCVA 3DF8A 2DFIA 3MCZA 1I1GA 4HX7A 3RTRA 1G3SA 3DV8A 1QPMA 4A5MA 2HYGD 2QQAA 1RUOA 1QGPA 3QU3A 1HXDA 3O6BB 3BROA 4KIGA 2ISZA 2NYXA 5ICFA 2B0LA 4OU0A 1ZARA 4YIFA 3K0LA 2XKOA 4AVPA 2XROA 3O2PE 3GW2A 2PMHA 1IUYA 4I98B 2DI3A 2XHKA 1MJ9A 2PBIA 1MZBA 3F21A 5LHIA 2DW4A 3M9AA 1XN7A 1HQCA 3FXRA 2HDCA 3CDHA 4KA4A 2WV0A 1IN5A 2BE5F 2W85A 1XGMA 2XV4S 3JTHA 2RV8A 3L2CA 1P4WA 3HHGA 2C6YA 3NQOA 3RDIA 1TQPA 1H0MA 4DNCA 5ILSA 1YFHA 1K6OA 2PG4A 5J8CA 3ABTA 5HS8A 2QM3A 4ON0A 4JK1X 5HLGA 1AWCA 4HQMA 4IJAA 1L3LA 2QWWA 3Q5FA 1A04A 3ZP5A 4YIIA 4Z2YA 2HGCA 3KFWX 3IKVA 3KP5A 4WXCA 4U7BA 2DO7A 3IRQA 4GYIA 5L3BA 3WTXC 3WE2A 2O8XA 1U6GA 2JZYA 2PI0A 1HW1A 3K1MA 3QP6A 1I5ZA 5DCFA 4ESFA 2EFQA 2L01A 3EQLF 2KJCA 3KCCA 4RGSA 5BS6A 4PGHA 3P9CA 4RGXA 1J5YA 2PQ8A 1AOYA 4R8HA 4MTEA 1KA8A 2VXZA 3QPTA 2M30A 5HS9A 3V8LA 1FBSA 2PFBA 1G3YA 3R61A 4RGUA 4EMSA 1F5TA 3KE2A 2QZ8A 3SQNA 2Q8KA 4WX9A 3L00A 2A68F 1SAXA 2MC3A 5EEHA 2VONA 3L7WA 1XMAA 1UFMA 4HBLA 4PCQA 1FYMA 1EH7A 1O3TA 1S3JA 3U1DA 3HYIA 3E5QA 2QVOA 3GFJA 4BNCA 3GYHX 1S29A 2P7VB 2HEOA 1Y0UA 2FBHA 4OMZA 1FOKA 3T0YA 3BPVA 4HX8A 2JTVA 4L9VA 5CLSA 1L0OC 4GO1A 1U5TA 3CLOA 5L3FA 3H3UA 2IA1A 4E70A 4O5VA 4PZJA 2M5WA 3CUOA 5LHHA 5LGTA 3ZMTA 2HZTA 3M8EA 1O3QA 3ML6A 5CYVA 2GXBA 2A69F 2D1VA 3C18A 2FF4A 1JGSA 4S05A 2STTA 1BI2A 1SD7A 2A61A 1R7JA 2FMLA 1JHFA 4G6DA 1GVJA 4HDVA 3OOPA 5IT9Z 3ECHA 1LEAA 3N97A 1FSHA 1U5TB 2R7FA 1HSTA 1QZZA 3T8RA 4HV6A 5CVRA 5HVQC 4IHSA 2PMUA 4PDKA 1ZREA 3TQNA 5DUIA 2CYYA 1OYYA 1J0RA 2BYVE 2OA4A 1OMIA 2W84A 4R1HA 3EYIA 4G7HF 4NB5A 4EV0A 2V9VA 3F6OA 1WKMA 3E6MA 4OINF 4RB2C 4U0WA 2LF8A 5E8IA 2ZMEB 3W6JB 2O3FA 4L5IA 3KEOA 3WU1B 3WG9A 1DP7P 1ZG1A 2V6CA 1LQ1A 2H09A 3H3ZA 4LLLA 1YQAA 2XKPA 4ENKA 1MJAA 3IRRA 5E1ZB 2P5LC 2IVMA 1D3YA 4M6YA 4B09A 2VT2A 4BHBA 1ON1A 5BQTA 5FB2A 3GFLA 3I59B 2KKOA 2FSWA 3VFZA 1I6XA 3T8TA 1HKSA 5JVTA 4M9XA 5DV5A 3TOAA 4EM0B 1PP8F 3I0TA 1T98A 3ELKA 3QU6A 3V8JA 2EV5A 3EUHA 5BOXA 1FYLA 1V3FA 4L18B 5D5WB 4G8XA 3I4PA 5CVIA 3F8FA 5DD8A 3F8BA 2IPQX 4HV5A 3HTSB 3TDZC 5E18F 3K1NA 4EGZA 2R7DA 3HOSA 2MLKA 4BXUA 3RI4A 1WQ2A 4A2UA 2FMYA 4LFUA 3RYPA 5FLXZ 3JTGA 2FA5A 2A6EF 1UHMA 5D6EA 3V7CA 2HR3A 1W7PB 1EH6A 4Y13A 1U8RA 2RDPA 2IA0A 3MZYA 1XMKA 4ESJA 3ZMUA 3ZN0A 3MQ0A 1SD5A 1P4AA 1X3UA 4LG0A 4ESBA 1KGSA 1ZRCA 3DKWA 4EVIA 4IRIA 1J59A 1OYWA 2MA3A 1QNTA 3BP8A 1MDMA 2W24A 1LEBA 2Z99A 1EV7A 1KQ0A 2ZKZA 5AONA 4P55A 4CO8A 3IL2A 2G7HA 2GA1A 1ULYA 1FSEA 4CDGA 1LDDA 2JT1A 3IKTA 2HYFA 2H27A 2F5CA 3CJNA 1ZG3A 4M71A 2ADUA 4Q5SF 1IXSB 4EJWA 4M6XA 2CWEA 1XSDA 3RPUA 1O7LA 2HOEA 4ZZDA 1FWZA 4IF4A 1GXPA 4EJVA 1KQ8A 3WE3A 1PDNC 1Z9CA 1ZAOA 3M8FA 2E1NA 1ZGAA 2BV6A 1UCRA 2K27A 2EFOA 2MH2A 4HZFA 4KT5C 5JR3A 5AIPA 1U2WA 3DEUA 2IW5A 4I7HA 3RIRA 1G6NA 3BOQA 4MEYF 4QWQA 5ILUA 3J80Z 2XAQA 3MAJA 4PGGA 3FX3A 5DCMB 2YR2A 5LHGA 3R4KA 2DTRA 2MBFA 1RZ4A 4DQ2A 2VOOA 3GX4X 2DBBA 4BAYA 4WCGA 3L09A 3RJPA 1LDKB 3N4MA 3D0SA 2OQGA 5DCMA 1KU2A 3ROUA 2UXXA 2RVCA 3E3VA 5E17F 2P4WA 1H9GA 3IWZA 1CF7B 1DUXC 4ENNA 3NEUA 2YX7A 1RI7A 1WWXA 4O6JA 2STWA 5DEQA 1K7AA 2VT3A 3RPQA 5DDGA 4BH9A 2ZNZA 1G3TA 2KIUA 3BJ6A 1HSJA 4EQQA 4HYEA 4NHJA 3KLOA 1PUEE 2Y48A 1HBXG 4MGRA 3OV8A 4H0EA 1IXCA 4ZYGA 1ZLKA 5ILVA 3E6DA 4EJUA 3TGNA 4HF0A 5D5XB 2DQLA 2V1DA 2EV0A 2H6CA 4HF1A 2DLLA 3DP7A 5FFZA 4G94A 1SFEA 2FNAA 3GLXA 1ON2A 1SD4A 2W25A 2ZO4A 2AS5F 1TQMA 4MTDA 2IJLA 3KP2A 2BGCA 1T39A 4KN4X 2OD5A 1TNSA 2EV6A 2VC0A 4HAMA 2DK5A 3ERED 3EYYA 3JAMK 2YX4A 3U9GA 4UVAA 2IA2A 5BPDA 2ZXJA 4K2EA 1ZGJA 1OYIA 1B6AA 1J7KA 3SXYA 1ZN2A 4M74A 1IN4A 4LK0F 4Q4ZF 2YU3A 3KETA 4Q47A 1RNLA 3PQKA 1F1ZA 5LRSA 3I64A 3F23A 1R23A 3B73A 2OZ6A 3M7GA 4KN7X 2FBKA 3HSFA 4RB0A 3I54A 5L3GA 3LA2A 5LEKA 2EA4A 3Q9SA 4WXHA 5ICEA 3HSRA 3JAMZ 3FHZA 3P7NA 5D4RA 3WGGA 1LDJA 4L9JA 4ZZLA 2IT0A 4U7DA 2ZNYA 2L4MA 2GIVA 5L3EA 1P92A 3RYRA 4UUVA 1SFUA 4UV8A 5FLXK 4LLNA 1DDNA 4A6DA 3LQRA 4BHPA 1R1UA 1ZRFA 2ISYA 2L54A 2Q0OA 1WI9A 4HW0A 3ULQB 1V4RA 3F72A 5HLHA 1IN7A 3KLNA 2QBYA 4A6EA 1R58A 5ED4A 2MH9A 3BJAA 5CVJA 2KIMA 1UB9A 4U88A 3C3WA 4HF2A 4KMUX 1LNWA 5FGMA 1R00A 1HKTA 1B59A 4UXNA 3FM5A 2O6GE 2DPUA 3ECOA 4M73A 5DYMA 5IT9K 4FHTA 2PEXA 3JW4A 1R1VA 4OIRF 2GWRA 3HRSA 1EH8A 4KICA 1RIOH 4KMFA 4OIOF 1IN6A 3F3XA 1B9MA 2XASA 2QENA 2RC4A 2CO5A 1MD0A 3KEQA 1BI0A 1P6RA 2HKOA 2XAJA 4RAYA 3KZYA 2A3SA 4I0BA 2UZKA 3FMRA 4L9NA 4BYYA 1YW9A 2G7UA 1OKRA 2HFHA 3J81K 1IF1A 2X0LA 2CFXA 5D6FA 2JPCA 2FEZA 3ZQ7A 2P5VA 5E1WA 4IHTA 3HIFA 1I27A 4AWXB 3HUGA 1BM9A 4IPAA 1D5VA 4EM2A 2WC2A 2HTJA 3PQJA 5J8FA 1YW8A 4HLYA 3K2ZA 2J5PA 2V1XA 3BY6A 1Z05A 4YG2F 1ZH5A 1K78A 4GGGA 1HW5A 3QAHA 1K78B 2P6SA 5KK1A 1C0WA 3E5XA 2OZUA 5CVUA 1VTNC 1XSXA 2VBWA 2K86A 3SFZA 4Y17A 1CF7A 4UNOA 1S7OA 1ZHFA 1B4AA 2QYOA 1S6LA 2OU2A 1T0FA 5D5VB 4S04A 1TLHB 4KFCA 3ZMZA 1O57A 1T2KA 4M9SA 5J6XA 1W5SA 2UXNA 2XAHA 2F2EA 2FU4A 4G7ZF 5A2QK 2O03A 2RQPA 3FXQA 2LKPA 4LLGF 3V4GA 4OMYA 1F4KA 1Z7UA 2Y75A 2ESNA 3WGHA 5AIQA 1F9NA 2X4HA 3GUDA 5LLQA 3TDUC 1QQIA 1WSUA 1FBUA 4WXDA 3E5UA 5DD4A 4IXAA 3DXJF 1FC3A 1SMYF 1Z6RA 5F1RA 1S8NA 2NRAC 2EK5A 2VBZA 4ZYDA 5BMZA 1IRGA 2V79A 2DT5A 3Q9VA 1KQ9A 3VEPA 1XGNA 2COMA 1LB2A 1XCVA 3FMQA 3BDDA 2WWYA 3C1DA 3P9KA 2YPRA 4G7OF 4LB5A 1Z1DA 2DK8A 3CTAA 1JHHA 3CUQB 3H92A 2J5OA 1BIAA 2ACJA 2EFNA 2EJRA 2LSOA 3O3KA 2ESHA 4ZYEA 4MEXF 3LA3A 2RGVA 2CW0F 5BPIA 1YO5C 5TJJA 3JSPA 4OOIA 4I02A 3V8KA 3WU0A 2L02A 2O0YA 5E1XA 3FF5A 3TO7A 5LGNA 2XVCA 1W7PD 3FZVA 3KP4A 2AXLA 2NNNA 4XSXF 1E17A 1FYKA 4KIBA 4WWCA 1XD7A 2KIFA 2GAUA 3ZN1A 4L9TA 1O3RA 2MD5A 2WTEA 5HDNA 2Q2EA 5LRRA 2BBYA 2F5FA 2VE8A 1MDMB 2ZCWA 4WF2A 3RKYA 2XAFA 3CUQA 1R5GA 1OR7A 2A6HF 5E20A 3F8MA 2M8EA 4MQVA 4CGZA 3LFKA 3GZ6A 2M1BA 3WTVC 1P4XA 2Z33A 1MKMA 5HS7A 3REOA 4OIPF 4HDUA 2QQBA 1BN5A 1U3EM 4CYDA 1KU3A 4IRHA 1S7AA 3R0AA 4LB6B 1R36A 3EETA 3DPLC 4QLCU 3HHHA 3LAJA 4XLPF 2QBYB 3VB2A 3KP7A 1SMTA 1XDUA 4YFNF 5HOOA 2L3DA 5ERIA 3QOPA 1SD6A 2NS0A 2NNYA 2LDUA 6PAXA 5K5RA 4U0YA 1LJ9A 3R6SA 1K79A 4XBFA 4YFKF 5LGUA 4CXFA 3F6VA 4IVNA 4M72A 1Z6TA 2HKXA 4WK8F 1YG2A 3HSEA 4L5JA 4XSZF 3ZMVA 1W4MA 2ELHA 2VOPA 2ZFWA 5JI6A 3RKXA 3BZ6A 4MNUA 2V1UA 2FE3A 5H6RA 5L3CA 1WRJA 2M87A 3CO6C 2Y0MA 3WTUC 2HQNA 2H94A 1O7FA 2OBPA 4Q48A 2RN7A 4M9ZA 1FLIA 3DQVC 5FD6A 5D8KB 1R1TA 4CZZA 1KYZA 3T5XA 1CGPA 1R22A 1D8JA 4UVCA 1HKQA 2VE9A 3K69A 3G3ZA 2XAGA 1IZ1A 2RNJA 3I58A 3WODF 3WTWC 4ENJA 2HWVA 3WTZA 4LMYA 2ZJ2A 3I71A 1KU7A 2IP2A 1NHAA 3HRUA 4R79A 3WTYC 2MLGA 4RAZA 3HRMA 3K1PA 3QPHA 3NRVA 1ZLJA 1FT9A 3LSTA 4B8XA 3GVAA 2ETHA 2EFWA 1TQIA 2LNBA 2IRFG 2M45A 1FP2A 1BIBA 4IRGA 2OQRA 4EJOA 3IHUA 1FP1D 1XB4A 2K4JA 3D5LA 1OPCA 4LJZF 2PN6A 4RGRA 1E2XA 4LG0B 5D8LB 2UWMA 2O61A 3DPTA 5F64A 4XRFA 1MJBA 3HRTA 1B9NA 1IRFA 1QBJA 2L4AA 5HDGA 2EFPA 2EWNA 3B02A 3FM3A 4O3MA 4I01A 5LEJA 2P7CB 3SZPA 1XDSA 1MGTA 2FNPA 1U78A 1TW3A 3M1EA 2QUFA 3QRFF 4G9YA 5A2QZ 4KUMA 3G73A 2GQQA 2PJPA 4BHCA 2DU9A 2CQKA 4A0YA 3BPXA 2K02A 1YS6A 1XCBA 1YIOA 2RKHA 2QQ9A 3LA7A 1T6SA 3T1BA 1TW2A 1USSA 5K5QA 1H9TA 1XSVA 5FFXA 5CJ9A 3I59A 4RB1A 3KZZA 5D5UB 2JPBA 5E8GA 1G3WA 4EGYA 1QO0D 3V7SA 3MFKA 3KP3A 3LWFA 1JE8A 1KYWA 1FBQA 2W57A 2CGPA 4P9FA 2EA2A 2XIGA 3VOEA 3GFMA 3MEXA 1DPUA 4JBAA 4A0XA 4A12A 1JXSA 3ZMSA 1ODDA 3SHFA 2FRHA 1D8KA 1TTYA 1Z91A 2P8TA 3E6CC 4P9UA 4I2OA 1STZA 1IXRC 4HLXA 1ONVA 2JRTA 4UV9A 2DQRA 4U0VA 5EEGA 4LD5A 4MHGA 4LK1F 4HOBA 2F5EA 3AAFA 5F6FA 2XUBA 5FD5A 5HDKA 3BWGA 4AD9A 2XRNA 3K9TA 3SZTA 4RS8A 3V7RA 4YFXF 1J2XA 3VODA 4A5NA 1T38A 4L0ZB 2FOKA 3TKYA 4Y15A 5K5OA 3PFIA 1BBYA 4CHUA 4EJTA 5ICCA 3TO6A 5LBQA 3W6KB 1IN8A 4KYWA 4OIQF 5KVRA 2D45A 2VBYA 3TOBA 1BI1A 1ZYRF 3L9FA 2K7LA 2VC1A 2FQ3A 3F8NA 1GXQA 2XGXA 2DPDA 1YS7A 2VN2A 2QLZA 1BJAA 1FZPB 2FXAA 1W7PA 2GZWA 1BI3A 2D1HA 3FXUA 3IC7A 2NAZA 1XGSA 5H6QA 4HQEA 2PLYA 3S2WA 2F5DA 5TRDA 4P96A 1BC8C 1ZRDA 1QZYA 1J75A 1R5HA 2HTSA 1IAWA 1BOAA 4P5OA 1J9IA 4HA8A 3GO5A 1XGOA 5D4SA 2Z9OA 5HLIA 3E6BA 3BJOA 2A5YB 1G4DA 1I1SA 3GF2A 4FT8A 3GZ5A 4ENMA 1BC7C 2ZMEA 4N9IA 1USTA 1FNNA 2TDXA 4L0YB 3MWMA 1YLFA 1YYVA 1GHCA 3GWZA 4F7ZA 4GXOA 3WGIA 5H20A 2VBXA 3ISPA 4KDPA 4ZH4F 1REPC 2HS5A 2Z5UA 3IWFA 3P9IA 4ZYHA 2OAZA 2BEOA 1FPQA
chains in the Genus database with same CATH superfamily
2V6EA 4XLNF 2ELJA 3ZMDA 1DP3A 2H6BA 3F22A 1NH3A 4AIJA 3C7JA 2XF7A 2XB5A 2V26A 1DPRA 1YOVB 4N0BA 2R7VA 4RB3C 1UHWA 4CSWA 5IT3A 1P2FA 2K9NA 3MZHA 5EF6A 3QP5A 3F8CA 3ABUA 1F36A 2F4OB 2DA4A 4I09A 4IQ4A 4BJ5C 3J80K 1YTYA 4DYQA 5M5YJ 3S16J 1FTZA 1JT6A 2XSJC 1LVAA 1PP7U 4FX4A 3SYTA 1B1BA 2LF7A 2GXGA 1W5TA 2P6TA 4AIHA 1JI8A 3PIPF 2G9WA 1FY7A 4LGWA 3ZPLA 2IGMA 3OS2A 4TV7A 1B72A 2JVHA 3HB9A 1QVUA 2L9NA 2WY8Q 5K1YA 1SFXA 3K70C 2EB7A 2R0QC 2DA5A 2EIMH 4AIKA 1WPKA 4PSWA 2JA8J 5DUKA 1IRXA 5JHUA 1JUSA 1QHHD 5J4VA 4XLCA 1RUNA 2OJED 4UHTA 5FO5A 2E7XA 1W0TA 2JSCA 1AHDP 4KIFA 3J81Z 4A0ZA 4ETSA 3KP6A 4BQAA 3GEZA 1BOBA 1MH3A 3OIOA 3QODA 2CSOA 5ICGA 1N77A 3CUQC 4UVBA 3HOTA 2HQRA 3OYCA 1ZELA 2A07F 4BBSJ 5DTDA 2CQ7A 2FBIA 4B4CA 3EDPA 5JFRA 2E7WA 2PMZN 5KCMA 1ITYA 2KT0A 1I3QJ 4A69C 3LFUA 4HX4A 2DAOA 2CMPA 3HTUA 2P5KA 3R60A 4FCYA 2TRTA 2YUSA 2FUG2 2GA2A 1W36C 3LSRA 2ZJPF 2ZC2A 3GXOA 3COAC 2ZBKA 5FRMA 4Y52J 4A3GJ 2ZFUA 2CH0A 3GLLA 3U2RA 4M3EA 1O3SA 3FWEA 3I5UA 3S93A 4D0PA 3AG3H 2O7OA 4EATA 2XAUA 4MQ9F 3I53A 2E1CA 2W00A 4RDUA 5M5WJ 2CUJA 3DFGA 2VIXA 5HODA 1HOMA 1LPQA 1YW7A 4NQWA 2Z3YA 3FMSA 3WTSC 2R3SA 3BR0A 2X6WA 3GFIA 2HZDA 3ZQQA 1Z0XA 1ZG5A 1U8BA 2A6TA 1KU9A 3TO9A 5L3DA 4A3LJ 1KONA 3CO7C 1D1CA 1SVOA 5CVVA 5F0FA 1FMVA 2Z1DA 4GYGA 2R5ZB 1HW2A 1IW7F 2R7WA 2CG4A 2AXTC 4FX0A 5FKOA 4W1UA 2KLOA 4FE4A 3R0JA 2KIQA 2PJRA 4I0AA 3LQQA 5IP7J 1TBXA 3RKWA 4N9HA 3C2BA 4G6QA 1WJEA 1XX5A 2MSYA 2K4BA 3JSOA 1VQNI 1U5TC 1FX7A 3BQYA 2D2WA 1Q1HA 2L7KA 4JQFA 2LP0A 5IY5H 3LAPA 1ACIA 2UV1A 3CJRB 2YSRA 1X4PA 1TNTA 3PUBA 1OCOH 2VODA 2XDVA 4KNYA 3E97A 2NOGA 1H8AC 2EZLA 2VPLA 4CICA 2IGOA 2KRFA 4ASNA 5LD2C 2HVQA 1ETOA 2KJBA 2L7FP 2VPRA 4GCVA 4EM1A 3WTTC 3J7AO 1E0EA 1DU6A 4Y3OA 2M8GX 3DF8A 3OYDA 2DFIA 3MCZA 1V5GA 3W3CA 3M1CA 1IV8A 1I1GA 3CESA 2VUMJ 4J01A 2F48A 4HX7A 3RTRA 1G3SA 4BQNA 1J09A 3U1KA 2E5NA 3DV8A 3RQ4A 1QPMA 2JWTA 1E3OC 4A5MA 2HYGD 2LVSA 2QQAA 1RUOA 2HI3A 1QGPA 5H2FC 1WJBA 3QU3A 1HLVA 1HXDA 3MKLA 3O6BB 3BROA 4KIGA 5B66C 1RKTA 3TL4X 4A3FJ 3UR3C 5CQEA 2ISZA 2NYXA 3OL4A 5ICFA 2B0LA 2QA4I 1SVLA 4OU0A 1ZARA 2QSFX 5KAFC 5IYCJ 4YIFA 3K0LA 2XKOA 2I8DA 4AVPA 2XROA 1Z67A 4UUTA 3OYLA 3O2PE 3GW2A 3JRDA 3H35A 3HGGA 2PMHA 1IUYA 4I98B 2DI3A 2XHKA 4RM3A 1MJ9A 2PBIA 3FXJA 1MZBA 3F21A 3OSGA 5LHIA 2DW4A 1PJRA 3DEWA 3M9AA 4E7LA 1XN7A 3AG4H 1HQCA 3FXRA 4A3MJ 2O8KA 1MMDA 3MKWB 2HDCA 3CDHA 4C9YA 2E2JJ 4KA4A 2WV0A 5F08A 3RCOA 1IN5A 3LSGA 2BE5F 3GTQJ 2W85A 1XGMA 2XV4S 3JTHA 2RV8A 3L2CA 1P4WA 1SAUA 3HHGA 2C6YA 1VFCA 3NQOA 4XKVA 3RDIA 3BR2A 3DEEA 2VJIA 1TQPA 1FOWA 2JA2A 1H0MA 4DNCA 5ILSA 1YFHA 4KISA 1K6OA 2PG4A 5J8CA 3ABTA 3CF5F 1A5JA 2QKLB 5HS8A 3ESWB 2QM3A 4CCJA 2JVGA 4CCNA 5BNGA 4ON0A 4JK1X 5EJCA 3ABLH 5HLGA 1B72B 1AWCA 4A3CJ 3BTLA 2M7BA 4XKBA 4HQMA 4IJAA 2G0EA 2VI6A 1L3LA 5IYDJ 1UZCA 2QWWA 3Q5FA 1A04A 3ZP5A 4YIIA 4I76A 2K9QA 4Z2YA 3FKIJ 2HGCA 3KFWX 3L2QA 2NVQJ 3IKVA 1LKXA 3KP5A 4WXCA 4U7BA 1UG2A 2DO7A 4YIRX 3IRQA 4GYIA 5L3BA 4ZTFA 3WTXC 1TWHJ 2AHQA 4XN3A 3WE2A 2O8XA 1U6GA 1YHQI 2JZYA 2PI0A 1HW1A 1VQMI 2CFOA 3K1MA 3QP6A 2Y31A 3HG9A 2HPMA 1I5ZA 4KT6A 5DCFA 4ESFA 2PJRB 2EFQA 2L01A 3EQLF 5CQGA 2KJCA 3KCCA 4RGSA 5BS6A 4PGHA 2DDBA 2JSPA 3P9CA 4RGXA 1J5YA 2IEKA 2V9KA 3DTKA 4CCLA 5J40A 3PIOF 1H89C 5GP9A 2PQ8A 1AOYA 4R8HA 4MTEA 3BCAA 1BR4A 1KA8A 2VXZA 3QYFA 1MIJA 3QPTA 2M30A 4II3A 5FJ8J 1HA8A 5HS9A 3V8LA 5HNHA 1PYVA 1FBSA 2LY9A 2PFBA 3VSKA 4DJAA 1G3YA 3PNVA 3VYSB 3R61A 4PUSA 1MMGA 4RGUA 4EMSA 1F5TA 3S1QJ 3KE2A 2HPIA 2QZ8A 1QA6A 1VZ0A 2QGUA 2HVSA 3SQNA 4D1QA 2Q8KA 2BOLA 4FQGA 2ZXIA 4WX9A 3L1PA 2HXIA 2KFDA 3OWTA 3L00A 1D5YA 2KDOA 3QYEA 1X2NA 2A68F 1S9HA 2DFHA 1SAXA 4E7HA 2MC3A 4AIDA 5EEHA 2VONA 1GV5A 2XRLA 1R49A 2COBA 3L7WA 4A3EJ 3I9V2 1XMAA 1UFMA 4AYBA 4HBLA 4PCQA 3E7LA 4XONA 3N05A 1FYMA 1EH7A 1O3TA 1OCPA 1S3JA 3PM1A 4BEHB 2DYSH 3U1DA 5TGTA 3HYIA 2B7EA 3E5QA 2JRMA 2QVOA 4XRSG 2BY0A 3CCVI 3GFJA 4BNCA 3GYHX 1S29A 2P7VB 5K7HA 2HEOA 1Y0UA 1UHSA 3WHBA 2NXNB 3PO2J 1YJWI 1MSFC 2P81A 2FBHA 1LFUP 4OMZA 3AL0B 2WY7Q 1FOKA 3T0YA 2V4JC 3BPVA 4HX8A 2JTVA 3PFYA 4L9VA 3ZXSA 1WH5A 1OJLA 5CLSA 1IDYA 1L0OC 1VQLI 4GO1A 1U5TA 3CLOA 2OTJI 2E1MC 3ERMA 1JT0A 5L3FA 3H3UA 5IPAA 4UB6C 2IGNA 2IA1A 4E70A 4PJMA 5LFAA 1MNEA 1ZKGA 4O5VA 5E3OA 4PZJA 3ZQHA 4Y33A 4BE2A 3FXLA 2M5WA 3S3OA 1HCRA 3CUOA 4BXFA 3PO3J 4PFOA 5LHHA 5LGTA 3ZMTA 2HZTA 3M8EA 1HDDC 1POGA 1O3QA 1IO2A 3ML6A 4V2GA 3NARA 5CYVA 4G6TB 2GXBA 1I39A 2A69F 3OR2C 3FXKA 3VWBA 2D1VA 3C18A 1VQKI 2FF4A 1JGSA 4S05A 1IRZA 1TL8A 2V7FA 1Y56A 1MSEC 2STTA 1BI2A 4MFEA 2RQQA 4D5CA 1SD7A 2A61A 1R7JA 2DODA 3JR9A 2FMLA 1JHFA 2KL4A 1IV6A 2X1DA 4G6DA 5CPRB 1GVJA 2LR8A 3OOPA 4HDVA 5IT9Z 3FXMA 3ECHA 1FIAA 1LEAA 3N97A 1FSHA 2JA6J 1U5TB 3H3VK 2R7FA 1X3WB 3G1LA 1HSTA 1QZZA 4NC7A 3T8RA 4HV6A 2DMUA 4JX6A 5CVRA 2PMUA 4B48A 4FISA 4PDKA 5HVQC 3A01B 1ZREA 4IHSA 3TQNA 5DUIA 2CW8A 2MGQA 3TBIA 2K85A 3BCBA 2CYYA 1OYYA 1J0RA 2BYVE 3KX2A 2OA4A 1W36D 1OMIA 2W84A 4R1HA 3TMOA 3EYIA 4G7HF 2K9MA 4NB5A 4P1WA 4EV0A 4YEJA 2E60A 2V9VA 3HOUJ 2DXIA 5E3NA 3F6OA 2EH3A 1WKMA 3E6MA 4OINF 4RB2C 4B47A 2CUEA 1NK2P 2HQ5A 4GRIA 2RNGA 4U0WA 2LF8A 1VQ6I 5E8IA 3PNTA 5C4JJ 2ZMEB 4BXXJ 2CU7A 3W6JB 2B63J 2OUMA 3G71I 1UG0A 2O3FA 4L5IA 3KEOA 4C2MJ 3WU1B 1DGWY 3WG9A 1VNDA 4CCKA 1DP7P 3EUKL 4OAYA 1ZG1A 4CCMA 2V6CA 4ZDPA 1QVTA 1LQ1A 2H09A 2LG4A 2MC4A 3H3ZA 3FK6A 1YQAA 2XKPA 4LLLA 4CA0A 4ENKA 1MJAA 3IRRA 5E1ZB 2P5LC 2IVMA 1A6IA 2E5ZA 1D3YA 4ZDLA 1DGRM 4M6YA 4B09A 2VT2A 4BHBA 4IOCF 1ON1A 4IL6C 5BQTA 3GFLA 4BY7J 3I59B 5FB2A 4XICA 2KKOA 2FSWA 2LTPA 1ZQ3P 4W97A 2DFEA 1FEXA 3VFZA 2CS3A 2HU9A 5EZGA 3CCJI 1I6XA 3T8TA 1HKSA 2LOOA 3BG3A 5J1UA 3RSNA 5JVTA 4M9XA 5DV5A 1X2MA 3TOAA 4EM0B 1PP8F 2X85A 3I0TA 1T8IA 1T98A 4Z6YA 3ELKA 4BACA 1YX5A 2ID3A 3QU6A 3V8JA 2EV5A 3EUHA 5BOXA 1R9TJ 4ZTJA 1O4XA 2BY1A 2E36A 1FYLA 1V3FA 3HJEA 4L18B 5D5WB 4G8XA 3I4PA 3JREA 1K4TA 4BE0A 1ERDA 1QPIA 4F92B 5FKKA 2FOWA 3QPLA 5CVIA 3F8FA 5DD8A 3F8BA 2IPQX 4HV5A 3CMEI 3TDZC 1MBFA 5E18F 3HTSB 3M3YJ 3ZRGA 2DA2A 2VKEA 1GLNA 2O9LA 1PVEA 3K1NA 4EGZA 3WG7H 2R7DA 3HOSA 2HYJA 3BTJA 2MLKA 2GIZA 2QCOA 3FBNB 4BXUA 3RI4A 1WQ2A 1WGXA 3DBHB 4A2UA 2FMYA 4LFUA 3RYPA 1ETWA 5FLXZ 3JTGA 2HOAA 2FA5A 2A6EF 2GOXB 4C2UA 4RLQA 4RBOA 1UHMA 5D6EA 3V7CA 2HR3A 4XM3A 1W7PB 3CCUI 3KIOA 1EH6A 4Y13A 1U8RA 2AO9A 2CV0A 2DOEA 2LFBA 3BZKA 2RDPA 1MBHA 1XTAA 2IA0A 3K4JA 1TWCJ 3MN2A 3MZYA 1XMKA 4OAZA 4ESJA 3ZMUA 3ZN0A 2KQRA 3MQ0A 1SD5A 1P4AA 1X3UA 4FE7A 2IS1A 3JRFA 1MBJA 4LG0A 1WJFA 2NS7A 4ESBA 3DLLF 1ZR2A 1KGSA 2NVYJ 1ZRCA 3G1OA 3DKWA 4EVIA 4IRIA 3H9JA 2QQ8A 1J59A 1OYWA 3G1MA 2MA3A 1QNTA 3BP8A 3OIQA 1MDMA 2W24A 3HEFA 3A2KA 5FRNA 1LEBA 1N75A 2Z99A 1EV7A 1KQ0A 4QSHA 3OYHA 2M2EA 3PUFA 2ZKZA 5AONA 2LY2A 4P55A 4CO8A 1LFBA 1U9NA 3H0DA 3IL2A 5GAEJ 5JLWA 4BDZA 2G7HA 1UMQA 2GA1A 4PFPA 1ULYA 1MMSA 2WAEA 1TWFJ 3KYLA 2R7SA 1FSEA 4CDGA 1LDDA 2JT1A 3SEZA 1QZEA 3IKTA 2HYFA 2X9DA 2H27A 4UUSA 3CCEI 2LKXA 2F5CA 3CJNA 1ZG3A 4M71A 2ADUA 4Q5SF 1V54H 3VYTB 1IXSB 2NS8A 4HPQA 4EJWA 5FKLA 4M6XA 1EA3A 2CV2A 3LOCA 2UUZA 3LSHA 2CWEA 2R92J 1MNDA 3ZQFA 1XSDA 3RPUA 1O7LA 3Q0VA 3LSKA 2HOEA 3HZJA 1FWZA 4IF4A 4ZZDA 3OYEA 1LUJB 2CQNA 2JUCA 1GXPA 4EJVA 4CUGA 4UUSB 1KQ8A 3OYJA 3WE3A 1PDNC 4M3FA 4XRMA 1Z9CA 3ABKH 5F04A 1QHGA 1SVMA 5J3LA 1ZAOA 1X4OA 3HOZJ 3S2HJ 3M8FA 1OCZH 2MYSA 3BTCA 2E1NA 1ZGAA 2BV6A 1UCRA 2K27A 2E1MB 4AC0A 2EFOA 3H5NA 1VQ4I 2WAQN 2MH2A 4HZFA 4KT5C 2LREA 4DYCA 9ANTA 5JR3A 5AIPA 4XLAA 1U2WA 2BVMA 3DEUA 2IW5A 4I7HA 5FROA 4XOTA 3O8HA 4II2A 1AKHB 4F55A 3RIRA 1G6NA 3BOQA 5DM7F 4MEYF 3S14J 4QWQA 4DOZA 5ILUA 3PL8A 1TT5B 1G59A 2GOMA 3J80Z 2XAQA 3SEQA 1IJWC 3MAJA 5KAIC 1OR7C 4PGGA 3JRBA 3FX3A 4XLHA 5DCMB 3G2BA 2OTLI 2YR2A 5LHGA 1NG6A 3R4KA 2ME0A 2Z16A 2DTRA 1A6QA 2MBFA 2B9SA 1RZ4A 2W4SA 4D7NA 5DM6F 4D9JA 4DQ2A 3K4KA 2VOOA 1YJ9I 3GX4X 2DBBA 3FIWA 1N78A 4BAYA 3VSLA 4WCGA 1NK3P 1NG7A 2DYRH 3L09A 3RJPA 3LSIA 1LDKB 1BL0A 3N4MA 3D0SA 2OQGA 1A31A 4IOAF 5DCMA 4IEJA 1KU2A 2AQEA 2E71A 2DA6A 1SFOJ 3ROUA 2UXXA 3E0JB 2RVCA 1LE8B 4YELA 3E3VA 5E17F 2P4WA 2BHZA 3VDXA 1X1BA 1IGNA 4B1RA 1H9GA 2WBMA 4A3BJ 1D0XA 2BXZA 1WJ5A 5EEAA 4V19K 2LBFB 3IWZA 1CF7B 1DUXC 1WHUA 3NEUA 4ENNA 2YX7A 4HEA2 3FHNA 1RI7A 1WWXA 3MZ8A 4O6JA 4BY1J 1D1AA 2L7MP 2STWA 5DEQA 1XMXA 1K7AA 1ENHA 2VT3A 3RPQA 2QKMB 3TW7A 1N25A 2F4IA 3EUHC 4RM2A 1BW5A 1MMNA 2LMDA 3CDLA 5DDGA 2V9PA 4XK4A 2ZB9A 4BH9A 2ZNZA 1G3TA 3CP2A 2OF7A 4QIWN 2KIUA 3BJ6A 3S8PA 1B8IA 3D5SC 1HSJA 4EQQA 4HYEA 1BR2A 4BQQA 4NHJA 3DBLB 1DQUA 2I5UA 4UB8C 1I6HJ 2KRHA 3JRGA 3KLOA 1PUEE 2Y48A 4FTHA 1HBXG 4RAGA 2HNHA 4IHWA 5K7ZA 4MGRA 3OV8A 1FOXA 3W2WA 4H0EA 3GTLJ 1IXCA 4ZYGA 4ZC3A 4XL9A 1ZLKA 3FISA 5ILVA 3E6DA 3CCQI 4EJUA 1LFPA 4HF0A 3TGNA 5GADJ 3AG1H 3K4LA 5D5XB 3QQAA 2BHYA 3OL3A 2DQLA 2V1DA 2EV0A 2H6CA 4HF1A 3I56I 1Z7LA 4KITB 2DLLA 1JKRC 3DP7A 3DCFA 4X0GA 4M3DA 5FFZA 4BL0B 4G94A 1MNMC 1SFEA 2FNAA 3GLXA 1ON2A 3GTMJ 3IAS2 3OYIA 2NVXJ 1SD4A 3HGYA 2W25A 2ZO4A 2AS5F 1TQMA 4MTDA 2IJLA 3KP2A 1WFXA 2BGCA 1T39A 1PUFB 4KN4X 2OD5A 1TNSA 1X19A 2YS9A 3ZGKA 1K6YA 2EV6A 2BZTA 2VC0A 4MO7A 3FDYA 1VQPI 4HAMA 2DK5A 3ERED 3EYYA 3JAMK 3CCYA 2YX4A 3U9GA 4UVAA 5EGOA 2IA2A 1ZGWA 5BPDA 5KHDA 1YRNA 2Y69H 2ZXJA 4K2EA 1SANA 1ZGJA 2JA5J 1OYIA 4BU2A 1B6AA 1J7KA 3SXYA 1ZN2A 4M74A 1Y8QB 1IN4A 4LK0F 4Q4ZF 2YU3A 2NVUB 3KETA 4C3JJ 4JYKA 1ETXA 2E35A 3CMAI 2DT6A 5GAHJ 2O5RA 1T95A 4Q47A 3RPUD 2IXSA 2DOFA 1RNLA 1WH7A 2A05A 3PQKA 1F1ZA 4QTRA 5LRSA 1GDTA 3I64A 3F23A 2R7XA 2R4GA 1R23A 3Q0UA 3B73A 2OZ6A 3M7GA 4KN7X 2FBKA 3HSFA 4RB0A 3I54A 1SC7A 5L3GA 4H4KC 3LA2A 5EG0A 4C30A 2WADA 3AG2H 4XMYA 5LEKA 3BLYA 4A3DJ 2EA4A 3Q9SA 4WXHA 5ICEA 4HSRA 3OS1A 1LE8A 3F0CA 3HSRA 3JAMZ 3FHZA 1QRYA 2K5CA 3P7NA 5D4RA 3WGGA 4XR6A 4LIUA 1LDJA 4ANJA 2TCTA 2LBFA 3A1YA 1YRNB 3CJTB 2E34A 3IUOA 4L9JA 4ZZLA 4IKFA 2FQ4A 2IT0A 4U7DA 1MBGA 2DN0A 5IP9J 3GZNB 2ZNYA 3OYMA 2JA7J 5GAGJ 4FASD 3K70D 2L4MA 2Y9YA 2GIVA 5L3EA 1HDPA 1P92A 3HOWJ 3RYRA 1YITI 4UUVA 1SFUA 4UV8A 5FLXK 4D7MA 4LLNA 1DDNA 4A6DA 3LQRA 4BHPA 1R1UA 2L5QA 2DA3A 1QU3A 1ZRFA 2ISYA 3DKXA 1V5FA 3VPRA 2L54A 2Q0OA 4HNVA 2WAQA 1WI9A 2R5YB 4HW0A 4PJNA 4PJ0C 2W48A 3ULQB 1V4RA 3F72A 5HLHA 2H1LA 1IN7A 3GCMA 4XNFA 1FIPA 3ZOBA 2OCEA 1YI2I 2WV1A 3KLNA 2QBYA 2EQRA 4A6EA 2H8WA 4LOCA 1R58A 3L2VA 2R7RA 5ED4A 2DMQA 2MH9A 3BJAA 2ICWG 3QWLA 4NC6A 4ZYAA 3BTIA 5CVJA 4DZJA 2PMZA 3H9QA 2KIMA 4M6VA 5TISC 2GLOA 4XRSA 1X1DA 1UB9A 2VXDA 2X6OA 4U88A 3C3WA 4X1EA 3S32A 5GTIC 4HF2A 3OOUA 4KMUX 3QPSA 1LNWA 5FGMA 1M1EB 1R00A 1WJDA 2E19A 3OMYA 4MLOA 1H88C 2HDDA 3BR3A 3CDIA 1A35A 1HKTA 1B59A 4AM3A 4UXNA 2A5WA 3FM5A 2O6GE 2DPUA 3JCUC 4BJ6C 3ECOA 2DDAA 4M73A 3HPGA 4XKCA 5DYMA 1X58A 3LSPA 5IT9K 2L2OA 2ZXHA 4JOMA 2FD5A 4FHTA 1D0ZA 2PEXA 1YIJI 3JW4A 1R1VA 5B1BH 4OIRF 2GWRA 3HRSA 1EH8A 4KICA 1DU0A 1RIOH 4KMFA 1ETKA 4OIOF 1IN6A 3F3XA 1B9MA 2ZJRF 2XASA 2H1KA 2PX9A 4E7SA 2QENA 1JJ8C 2RC4A 3B6CA 3ONQA 3PJRA 2JJ7A 3GMEA 2CO5A 2BXYA 1MD0A 3KEQA 2PLYA 3AFHA 5B1AH 1BI0A 3S1RJ 1P6RA 4PJJA 3K2AA 2HXOA 2HKOA 1EKEA 2DA1A 1W5CC 2XAJA 4RAYA 3KZYA 3BZCA 2A3SA 1OCCH 4IO9F 5F27A 4I0BA 3IV5A 5EG0B 2XSDC 2UZKA 3FMRA 4L9NA 4BYYA 3SDBA 1YW9A 3A0HC 2G7UA 5J1YA 1BA5A 2VQCA 1OKRA 2HFHA 1I3AA 1UJ8A 3J81K 2WA0A 4B43A 1IF1A 2X0LA 2CFXA 2BVLA 5D6FA 2X1EA 2JPCA 2FEZA 3BR5A 4M3BA 3ZQ7A 4CYCB 3ZQCA 2P5VA 3CJQB 2M3AA 5E1WA 4NC8A 4IHTA 3HIFA 4B3XA 3HUGB 2XGDA 4XKWA 4IQJA 3MMYB 1I27A 5E3MA 4AWXB 1JTXA 3HUGA 3CCMI 2Z2SB 3H36A 1BM9A 2Q1ZB 2MG4A 4IPAA 1TP4A 1D5VA 2CUFA 3ZQLA 4EM2A 4I99C 2DA7A 2WC2A 2HTJA 3HOYJ 1XG1A 1FJLA 3DTIA 3PQJA 5J8FA 2DCEA 1IC8A 1YW8A 4HLYA 3HOXJ 2KDZA 4IZZA 2EIKH 3K2ZA 3Q0WA 2J5PA 2V1XA 3BY6A 1Z05A 4YG2F 1ZH5A 4AVZA 2Y0SN 3HC7A 1K78A 4GGGA 4BEHA 1HW5A 4YRVA 2DOAA 1YE9A 3QAHA 1K78B 4JP0A 2P6SA 2ECCA 5KK1A 3E1SA 3C2HA 2HVRA 1HC8A 1C0WA 1MBEA 3E5XA 2OZUA 4A3JJ 5CVUA 1VTNC 1XSXA 3KEYA 2HDWA 4RMNA 4E7KA 2BW3A 2XGEA 2VBWA 2K86A 3SFZA 4Y17A 1CF7A 2BW3B 4UNOA 1S7OA 5K7FA 3CZ6A 3JRCA 1P9QC 1ZHFA 5F0HA 4J19A 1B4AA 2QYOA 1S6LA 3OS0A 2OU2A 4PJLA 1T0FA 5D5VB 4UY8I 2CRGA 4S04A 1TLHB 4KFCA 2EZHA 3ZMZA 1X3ZB 1O57A 1T2KA 4M9SA 1U0JA 5J6XA 5EZHA 1W5SA 2K9LA 2UXNA 2XAHA 1Y8RB 2F2EA 5GTHC 3GTPJ 2R93J 2FU4A 2XGCA 3GTJJ 4G7ZF 3C2GA 3K4MA 5A2QK 2R7TA 4MFDA 2O03A 2RQPA 3FXQA 1FTTA 2LKPA 4LLGF 3V4GA 4OMYA 1AA7A 4XN0A 2ZSIB 1F4KA 1Z7UA 2Y75A 4F52A 3CD6I 5EYRA 2ESNA 4XQFA 3WGHA 3OYGA 5AIQA 1F9NA 2X4HA 3J7ZI 3GUDA 2DJIA 4NBQA 3ZQGA 5LLQA 2VKHA 3LL7A 4B44A 3TDUC 4HSTA 5IP6A 4N4OB 1QQIA 1WSUA 1FBUA 3W2AA 4WXDA 3E5UA 2KMUA 3P5JA 4JX5A 3H0GJ 4IXAA 3M07A 5DD4A 2K3FA 4BKXA 3DXJF 3PNYA 1FC3A 1SMYF 1Z6RA 2HQAA 3HOVJ 1R6RA 1GV2A 5F1RA 1S8NA 2XPUA 2ZXWH 3OY9A 1XPXA 2NRAC 2EK5A 4Y7NJ 2R7UA 2VBZA 4ZYDA 1ETVA 2NVTJ 5BMZA 4BDYA 4BBRJ 1IRGA 2V79A 1ZR4A 4NNJA 2DT5A 1G8XA 3Q9VA 4GDFA 1KQ9A 5J1RA 4LG3A 3VEPA 1XGNA 4PK4A 2COMA 5J4YA 3H1CA 2VJ5A 1RR7A 2EBIA 3A01A 3H5AA 1LB2A 3CQZJ 1TZLA 1XCVA 5HNFA 3FMQA 3BDDA 2WWYA 1T08B 3M8JA 3C1DA 2CJJA 4BJTA 2CW7A 2YPRA 3P9KA 4G7OF 4LB5A 2F5VA 1Z1DA 2DK8A 2Q2EB 3CF2A 3H9GA 3CTAA 2EILH 2KPMA 2EZIA 1IDZA 3ABMH 3FKJA 4CH7A 1JHHA 3CUQB 3H92A 2J5OA 3K4NA 5HLTA 4F91B 1BIAA 1U9OA 3L2WA 2ACJA 2EFNA 2EJRA 3DU5A 2LSOA 3O3KA 2ESHA 4NUBA 4ZYEA 2EINH 1TWGJ 3LA3A 4MEXF 2H8RA 2RGVA 5EDNA 3HKZN 3LSMA 2CW0F 2VLAA 5BPIA 1YO5C 5F1JA 5TJJA 3JSPA 4OOIA 2CV1A 1Z21A 4I02A 2V1NA 1SFKA 3V8KA 3WU0A 4G12A 2L02A 2O0YA 4XLFA 2N8GA 3F9KA 4AU7A 3S2DJ 5E1XA 1VQ9I 4DIQA 3FF5A 4OWRB 3TO7A 3FK7A 5LGNA 2XVCA 4C3IJ 3W2VA 2IS2A 1MBKA 2IBDA 4F3QA 2WB1A 1W7PD 3FZVA 3KP4A 3A4CA 3SZGA 2AXLA 2NNNA 2IS4A 5E79C 1G2HA 2HOTA 2OCCH 4XSXF 1E17A 3KZIC 1FYKA 2LRDA 4KIBA 4WWCA 1XD7A 2KIFA 1MW7A 2GAUA 1Y39A 3LNQA 3ZN1A 4L9TA 4L5EA 3RZOJ 3L2RA 1O3RA 2MD5A 2WTEA 2W7NA 5HDNA 2Q2EA 5LRRA 2E2IJ 2BBYA 3S1NJ 4LIVA 2F5FA 2LKSA 2VE8A 2VL8A 3OR1C 1MDMB 2ZCWA 3B6AA 4WF2A 3RKYA 3CUQA 2XAFA 1R5GA 1OR7A 2M7AA 1RR8C 2A6HF 3HXLA 5E20A 2ZMEC 2M8EA 3F8MA 3V42A 3A03A 4MQVA 4CGZA 2M4GA 4J00A 3J7AY 3BR6A 3LFKA 3GZ6A 4CYCA 2XPVA 2VQGA 3WHCA 3ZR8X 4AUXA 2JN6A 2M1BA 4RA2A 2JUGA 4Y4RA 3VYUB 4PSXA 1P4XA 3WTVC 2DJNA 1XS9A 3OYKA 2VKDA 2Z33A 4F93B 3I3LA 1GVDA 1MKMA 3BG9A 5HS7A 3DPUA 3DLAA 3HL2A 3REOA 2ZJQF 2CQQA 3NAUA 4OIPF 4HDUA 2QQBA 1BN5A 1U3EM 4CYDA 1KU3A 4IRHA 1S7AA 3R0AA 3A02A 4DBQA 4LB6B 1Y1VJ 5C4XJ 1R36A 3EETA 3LMMA 1IG7A 3DPLC 3TEDA 2P0WA 4QLCU 3HHHA 3LAJA 4XLPF 1Y6IA 3U21A 3VB2A 2QBYB 1OCRH 3HBLA 3KP7A 1SMTA 4N4NB 1XDUA 4YFNF 5HOOA 2L3DA 1BJZA 5ERIA 3MVPA 3QOPA 5JLXA 2IS6A 1SD6A 2NS0A 2WB1N 3QOEA 1RETA 2X6XA 2NNYA 2LYCA 2LDUA 6PAXA 5K5RA 4IHVA 4U0YA 2VQHA 3Q3SA 1LJ9A 3R6SA 1K79A 4XBFA 4YFKF 5LGUA 4CXFA 3F6VA 4IVNA 4M72A 1Z6TA 2HKXA 3J7YJ 3GBGA 1R71A 4WK8F 1YG2A 3HSEA 4L5JA 4XSZF 5M5XJ 3OYFA 3ZMVA 1W4MA 2ELHA 2L7ZA 3SJMA 2VOPA 2ZFWA 5JI6A 3RKXA 3TP3A 2M0CA 3BZ6A 3FXOA 3HDDA 2JK3A 4MNUA 2VB6A 2V1UA 2FE3A 1Z3XA 5H6RA 5L3CA 3S17J 3CC4I 1WRJA 3JRHA 2EPFA 2M87A 3CO6C 2FX0A 2Y0MA 1X1CA 2I10A 2XB0X 3WTUC 2HQNA 1VQOI 2EIJH 2K9SA 2H94A 1TC3C 3ZQIA 1O7FA 2OBPA 4XLEA 2MD0A 4Q48A 2RN7A 4M9ZA 3TW6A 1FLIA 3CP8A 2LY1A 1S5LC 4DYRA 2GXAA 3DQVC 5FD6A 5D8KB 2LK2A 3BC8A 1R1TA 3LSJA 4CZZA 1KYZA 2Y2ZA 3T5XA 1CGPA 4M3GA 1VI0A 1R22A 4GFBA 1D8JA 1LVKA 1D1BA 4UVCA 1OFCX 2DMPA 2X1CA 1HKQA 5IYBJ 1P7JA 3RKQA 2VE9A 3K69A 3G3ZA 2XAGA 1IZ1A 1AKHA 3MD2A 2RNJA 3I58A 5J47A 2L9RA 3WODF 3WTWC 4ENJA 4C3HJ 2HWVA 3WTZA 1EF4A 4LMYA 4BGDA 4HRIA 4A93J 2ZJ2A 3I71A 3DBRB 2L0KA 2IP2A 1KU7A 1NHAA 4LITA 3GTGJ 3HRUA 4R79A 1MMAA 1OLTA 3WTYC 3MKYB 2MLGA 4BS9A 3NWTA 4RAZA 2E2HJ 3HRMA 2D5VA 2KZGA 3K1PA 3QPHA 4XOPA 3NRVA 1ZLJA 4S0HB 1UAAA 1FT9A 4BE1A 2ELKA 3LSTA 3O8GA 4B8XA 3GVAA 2X6YA 2ETHA 3IH2A 2EFWA 1TQIA 2LNBA 3CCSI 2IRFG 2VQLA 2MABA 2X48A 2M45A 1FP2A 1BIBA 4IRGA 1TWAJ 2OQRA 3BG6A 4CCOA 1GUUA 4EJOA 1IUFA 3IHUA 4ABZA 1EJ9A 4IHYA 3ZCOA 5CKTA 1BW6A 1FP1D 1AU7A 1XB4A 2VJJA 3OIPA 2K4JA 3UKGA 3D5LA 1Q1VA 3K10A 1OPCA 1RESA 4LJZF 4CZCA 2PN6A 2IGKA 4ITVA 3S3MA 2DTZA 2K3PA 3CCRI 2M4KA 3EPZA 4MIMA 2LD5A 2NOJB 2GBYA 3DWLE 1V55H 4RGRA 1WJCA 1E2XA 3PSFA 4LG0B 5IOZA 4AYBN 5D8LB 2YU9J 3CC2I 2HOSA 2ID6A 3AKZA 2UWMA 2O61A 3DPTA 3NWSA 5F64A 4XRFA 4D5FA 1MJBA 3HRTA 1WI3A 4DW6A 1B9NA 1IRFA 1QBJA 4HG2A 2L4AA 4XORA 5HDGA 2BY3A 2EFPA 5C44J 4B3AA 2CQXA 4E7IA 1K4SA 2EWNA 3B02A 3D1NI 1OQYA 3FM3A 1OISA 4O3MA 3CLQA 4I01A 5LEJA 2QEXI 2XC7A 1JKOC 1R4MB 1NTCA 4A3IJ 2P7CB 3SZPA 5M3FJ 3IH4A 1S72I 3BR1A 1XDSA 1FMWA 4A3KJ 1MGTA 2AQFA 4NQWB 2FNPA 1HF0A 1U78A 1TW3A 2VKVA 2QUFA 3M1EA 4G9YA 3TP0A 3QRFF 5FLVA 5A2QZ 4KUMA 2EZKA 3G73A 3ASNH 2GQQA 2PJPA 4RAFA 4BHCA 2DU9A 3S15J 2JQ7A 2CQKA 4A0YA 3BPXA 1CQTA 3KPHA 2K02A 1YS6A 5JHFA 2R5ZA 1E3PA 1XCBA 1YIOA 1D0YA 2QQ9A 2RKHA 1T6SA 2VJ4A 3LA7A 2F4MB 4X6AJ 2DMNA 2MW8A 3T1BA 2BY2A 1TW2A 1USSA 5K5QA 1H9TA 4IHXA 2IAIA 1XSVA 3I55I 5FFXA 2X51A 3BT9A 5CJ9A 3JRIA 1WJAA 3I59A 3BG5A 2XF5A 4DBRA 5JVGF 3KZZA 4RB1A 2RAEA 5D5UB 2JPBA 2LC2A 5E8GA 1G3WA 3S1MJ 4EGYA 1WCMJ 4C2TA 1QO0D 3V7SA 5B3SH 3MFKA 1WVRA 3KP3A 1R5ID 3LWFA 1JE8A 2L9VA 2ME6A 1KYWA 3SFIA 1FBQA 4E4HA 2W57A 3IP4B 2CGPA 2RREA 4P9FA 2LLKA 2EA2A 4HNTA 2DMTA 1R4NB 2XIGA 3VOEA 2JMWA 3GFMA 3MEXA 3OYAA 1DPUA 5B5EC 1ORKA 4JBAA 4A0XA 3G6EI 4A12A 3GTKJ 1JXSA 3ZMSA 2DT7B 1ZTRA 1ODDA 3PSIA 3SHFA 2FRHA 3RQIA 4ZJZA 1RPWA 1D8KA 2E1OA 4I6ZA 5KNLA 4QPOA 5FKMA 1TTYA 2OV7A 4BUPA 1VQ7I 2KHMA 3I4NJ 1X1PA 1Z91A 5FKNA 2P8TA 3E6CC 1K61A 4P9UA 2KISA 3OYNA 1APLC 4I2OA 3HKZA 1STZA 1IXRC 1JKQC 5FLMJ 4HLXA 1ONVA 2JRTA 4UV9A 2L9SA 4JX4A 2DQRA 1X1AA 3HM5A 4U0VA 2R7QA 1E3HA 3DTEA 5GPAA 5EEGA 4LD5A 2MFZA 4MHGA 2M9HA 1VQ5I 2M34A 4FETA 4E7ZA 2R5YA 4V2FA 3QYBA 4LK1F 4HOBA 2F5EA 3DU6A 1W0UA 1A36A 3AAFA 5F6FA 2XF6A 1GT0C 1XC5A 2XUBA 1P7IA 1I50J 5FD5A 5HDKA 3BWGA 4AD9A 2XRNA 4RLFA 3L2UA 3K9TA 1RRJA 3SZTA 2F6CA 4RS8A 3V7RA 4YFXF 1J2XA 3VODA 4A5NA 5IOYA 1Y1WJ 3CMMA 1T38A 1PUFA 1T56A 2FOKA 3BQZA 3K6GA 4L0ZB 2ZSHB 2R7OA 3TKYA 4KJZA 4Y15A 2KRCA 3CC7I 2Y30A 5K5OA 1TT0A 1Y0NA 2W1OA 3D5RC 3PFIA 3JRAA 3X2QH 5M3MJ 1YJNI 3M4OJ 1BBYA 4CHUA 3UNGC 2GM4A 4EJTA 5ICCA 2LH9A 3TO6A 1RKWA 5LBQA 3W6KB 1IN8A 2DFFA 3WU2C 5KVRA 5GPCA 4KYWA 4OIQF 3AL0C 1V5EA 2KZVA 3G4SI 3CMYA 4IX7A 1VQ8I 3H5RA 1JGGA 2D45A 2QSHX 5C3EJ 2VBYA 3TOBA 1BI1A 1ZYRF 5E3LA 2R7ZJ 1MH4A 3L9FA 1T0FC 2K7LA 2VC1A 2FQ3A 3F8NA 1GXQA 2XGXA 3S3NA 1YS7A 2VN2A 2DPDA 2QLZA 1BJAA 3K7AJ 2FXAA 1FZPB 1W7PA 2GZWA 1JKPC 2XPWA 1BI3A 2D1HA 4U87A 3CCLI 3RZDJ 1SEUA 3FXUA 3EUAA 1T33A 2FJ1A 3IAM2 2NAZA 1XGSA 3IC7A 5H6QA 3SDGA 2Y0SA 2KP6A 2F5DA 3S2WA 3VYRB 4P96A 1Z3YA 4HQEA 5TRDA 1BC8C 1QZYA 1J75A 1ZRDA 1R5HA 2HTSA 3W6VA 1IAWA 1BOAA 2W82A 3HPHA 4P5OA 1K83J 1J9IA 2QF7A 4HA8A 3GO5A 1KZHA 1JUMA 1BR1A 1XGOA 5D4SA 2WAFA 2Z9OA 5HLIA 2OPTA 3E6BA 1YX3A 3BJOA 4HNUA 2K40A 4XIDA 2A5YB 3KYDB 3MKZA 1G4DA 3A0BC 1I1SA 1B8IB 1OCTC 1S7EA 3KYCB 4E7JA 3GF2A 4FT8A 1Z77A 3GZ5A 2M0MA 4ENMA 1BC7C 2ZMEA 1JUPA 4N9IA 1W1WE 1USTA 3OYBA 2OC6A 3I4MJ 4BQOA 1FNNA 2TDXA 4L0YB 1ZK8A 3MWMA 3OSFA 1ETQA 2Y9ZA 1YLFA 1YYVA 3K4CA 1GHCA 1FOYA 4DZPA 4NDLA 2VASA 3GWZA 4F7ZA 1JTYA 3DKYA 3IH3A 4GXOA 4EEFG 1JJ6C 3FBIB 5F0CA 1F43A 5DS9A 3WGIA 5H20A 2VBXA 4ZDOA 4DGWB 1WZ2A 3ISPA 4KDPA 3GTOJ 4E6KG 4ZH4F 1REPC 1UELB 5EGOB 1RC9A 2HS5A 2Z5UA 2ECBA 3IWFA 3P9IA 2QSGX 4ZYHA 2OAZA 2BEOA 1VF9A 3K4BA 1ETYA 2CUZA 3ASOH 4QPQA 1FPQA 3BG7A
chains in the Genus database with same CATH topology
4XLNF 3ZMDA 2H6BA 3F22A 4AIJA 3C7JA 1DPRA 4N0BA 4RB3C 1UHWA 5IT3A 1P2FA 3MZHA 3QP5A 3F8CA 3ABUA 4I09A 3J80K 1YTYA 1LVAA 1PP7U 4FX4A 1B1BA 2LF7A 2GXGA 1W5TA 2P6TA 4AIHA 2G9WA 1FY7A 4LGWA 3ZPLA 4TV7A 5K1YA 1SFXA 2EB7A 4AIKA 5DUKA 5JHUA 1RUNA 4UHTA 5FO5A 2E7XA 2JSCA 4KIFA 3J81Z 4A0ZA 4ETSA 3KP6A 4BQAA 3GEZA 2CSOA 5ICGA 3CUQC 4UVBA 3HOTA 2HQRA 2A07F 2FBIA 3EDPA 5JFRA 2E7WA 4HX4A 2DAOA 3HTUA 3R60A 2P5KA 2GA2A 3COAC 3GXOA 2ZBKA 3U2RA 1O3SA 3FWEA 3I5UA 4D0PA 4MQ9F 3I53A 2E1CA 3DFGA 1YW7A 4NQWA 2Z3YA 3FMSA 3WTSC 2R3SA 3GFIA 1ZG5A 1KU9A 3TO9A 5L3DA 3CO7C 5CVVA 4GYGA 1HW2A 1IW7F 2CG4A 4FX0A 3R0JA 4I0AA 3LQQA 1TBXA 3RKWA 4N9HA 4G6QA 2K4BA 3JSOA 1U5TC 1FX7A 2D2WA 1Q1HA 4JQFA 3LAPA 2YSRA 1TNTA 2VODA 4KNYA 3E97A 4CICA 2KRFA 4ASNA 2KJBA 4EM1A 3WTTC 3J7AO 4GCVA 3DF8A 2DFIA 3MCZA 1I1GA 4HX7A 3RTRA 1G3SA 3DV8A 1QPMA 4A5MA 2HYGD 2QQAA 1RUOA 1QGPA 3QU3A 1HXDA 3O6BB 3BROA 4KIGA 2ISZA 2NYXA 5ICFA 2B0LA 4OU0A 1ZARA 4YIFA 3K0LA 2XKOA 4AVPA 2XROA 3O2PE 3GW2A 2PMHA 1IUYA 4I98B 2DI3A 2XHKA 1MJ9A 2PBIA 1MZBA 3F21A 5LHIA 2DW4A 3M9AA 1XN7A 1HQCA 3FXRA 2HDCA 3CDHA 4KA4A 2WV0A 1IN5A 2BE5F 2W85A 1XGMA 2XV4S 3JTHA 2RV8A 3L2CA 1P4WA 3HHGA 2C6YA 3NQOA 3RDIA 1TQPA 1H0MA 4DNCA 5ILSA 1YFHA 1K6OA 2PG4A 5J8CA 3ABTA 5HS8A 2QM3A 4ON0A 4JK1X 5HLGA 1AWCA 4HQMA 4IJAA 1L3LA 2QWWA 3Q5FA 1A04A 3ZP5A 4YIIA 4Z2YA 2HGCA 3KFWX 3IKVA 3KP5A 4WXCA 4U7BA 2DO7A 3IRQA 4GYIA 5L3BA 3WTXC 3WE2A 2O8XA 1U6GA 2JZYA 2PI0A 1HW1A 3K1MA 3QP6A 1I5ZA 5DCFA 4ESFA 2EFQA 2L01A 3EQLF 2KJCA 3KCCA 4RGSA 5BS6A 4PGHA 3P9CA 4RGXA 1J5YA 2PQ8A 1AOYA 4R8HA 4MTEA 1KA8A 2VXZA 3QPTA 2M30A 5HS9A 3V8LA 1FBSA 2PFBA 1G3YA 3R61A 4RGUA 4EMSA 1F5TA 3KE2A 2QZ8A 3SQNA 2Q8KA 4WX9A 3L00A 2A68F 1SAXA 2MC3A 5EEHA 2VONA 3L7WA 1XMAA 1UFMA 4HBLA 4PCQA 1FYMA 1EH7A 1O3TA 1S3JA 3U1DA 3HYIA 3E5QA 2QVOA 3GFJA 4BNCA 3GYHX 1S29A 2P7VB 2HEOA 1Y0UA 2FBHA 4OMZA 1FOKA 3T0YA 3BPVA 4HX8A 2JTVA 4L9VA 5CLSA 1L0OC 4GO1A 1U5TA 3CLOA 5L3FA 3H3UA 2IA1A 4E70A 4O5VA 4PZJA 2M5WA 3CUOA 5LHHA 5LGTA 3ZMTA 2HZTA 3M8EA 1O3QA 3ML6A 5CYVA 2GXBA 2A69F 2D1VA 3C18A 2FF4A 1JGSA 4S05A 2STTA 1BI2A 1SD7A 2A61A 1R7JA 2FMLA 1JHFA 4G6DA 1GVJA 4HDVA 3OOPA 5IT9Z 3ECHA 1LEAA 3N97A 1FSHA 1U5TB 2R7FA 1HSTA 1QZZA 3T8RA 4HV6A 5CVRA 5HVQC 4IHSA 2PMUA 4PDKA 1ZREA 3TQNA 5DUIA 2CYYA 1OYYA 1J0RA 2BYVE 2OA4A 1OMIA 2W84A 4R1HA 3EYIA 4G7HF 4NB5A 4EV0A 2V9VA 3F6OA 1WKMA 3E6MA 4OINF 4RB2C 4U0WA 2LF8A 5E8IA 2ZMEB 3W6JB 2O3FA 4L5IA 3KEOA 3WU1B 3WG9A 1DP7P 1ZG1A 2V6CA 1LQ1A 2H09A 3H3ZA 4LLLA 1YQAA 2XKPA 4ENKA 1MJAA 3IRRA 5E1ZB 2P5LC 2IVMA 1D3YA 4M6YA 4B09A 2VT2A 4BHBA 1ON1A 5BQTA 5FB2A 3GFLA 3I59B 2KKOA 2FSWA 3VFZA 1I6XA 3T8TA 1HKSA 5JVTA 4M9XA 5DV5A 3TOAA 4EM0B 1PP8F 3I0TA 1T98A 3ELKA 3QU6A 3V8JA 2EV5A 3EUHA 5BOXA 1FYLA 1V3FA 4L18B 5D5WB 4G8XA 3I4PA 5CVIA 3F8FA 5DD8A 3F8BA 2IPQX 4HV5A 3HTSB 3TDZC 5E18F 3K1NA 4EGZA 2R7DA 3HOSA 2MLKA 4BXUA 3RI4A 1WQ2A 4A2UA 2FMYA 4LFUA 3RYPA 5FLXZ 3JTGA 2FA5A 2A6EF 1UHMA 5D6EA 3V7CA 2HR3A 1W7PB 1EH6A 4Y13A 1U8RA 2RDPA 2IA0A 3MZYA 1XMKA 4ESJA 3ZMUA 3ZN0A 3MQ0A 1SD5A 1P4AA 1X3UA 4LG0A 4ESBA 1KGSA 1ZRCA 3DKWA 4EVIA 4IRIA 1J59A 1OYWA 2MA3A 1QNTA 3BP8A 1MDMA 2W24A 1LEBA 2Z99A 1EV7A 1KQ0A 2ZKZA 5AONA 4P55A 4CO8A 3IL2A 2G7HA 2GA1A 1ULYA 1FSEA 4CDGA 1LDDA 2JT1A 3IKTA 2HYFA 2H27A 2F5CA 3CJNA 1ZG3A 4M71A 2ADUA 4Q5SF 1IXSB 4EJWA 4M6XA 2CWEA 1XSDA 3RPUA 1O7LA 2HOEA 4ZZDA 1FWZA 4IF4A 1GXPA 4EJVA 1KQ8A 3WE3A 1PDNC 1Z9CA 1ZAOA 3M8FA 2E1NA 1ZGAA 2BV6A 1UCRA 2K27A 2EFOA 2MH2A 4HZFA 4KT5C 5JR3A 5AIPA 1U2WA 3DEUA 2IW5A 4I7HA 3RIRA 1G6NA 3BOQA 4MEYF 4QWQA 5ILUA 3J80Z 2XAQA 3MAJA 4PGGA 3FX3A 5DCMB 2YR2A 5LHGA 3R4KA 2DTRA 2MBFA 1RZ4A 4DQ2A 2VOOA 3GX4X 2DBBA 4BAYA 4WCGA 3L09A 3RJPA 1LDKB 3N4MA 3D0SA 2OQGA 5DCMA 1KU2A 3ROUA 2UXXA 2RVCA 3E3VA 5E17F 2P4WA 1H9GA 3IWZA 1CF7B 1DUXC 4ENNA 3NEUA 2YX7A 1RI7A 1WWXA 4O6JA 2STWA 5DEQA 1K7AA 2VT3A 3RPQA 5DDGA 4BH9A 2ZNZA 1G3TA 2KIUA 3BJ6A 1HSJA 4EQQA 4HYEA 4NHJA 3KLOA 1PUEE 2Y48A 1HBXG 4MGRA 3OV8A 4H0EA 1IXCA 4ZYGA 1ZLKA 5ILVA 3E6DA 4EJUA 3TGNA 4HF0A 5D5XB 2DQLA 2V1DA 2EV0A 2H6CA 4HF1A 2DLLA 3DP7A 5FFZA 4G94A 1SFEA 2FNAA 3GLXA 1ON2A 1SD4A 2W25A 2ZO4A 2AS5F 1TQMA 4MTDA 2IJLA 3KP2A 2BGCA 1T39A 4KN4X 2OD5A 1TNSA 2EV6A 2VC0A 4HAMA 2DK5A 3ERED 3EYYA 3JAMK 2YX4A 3U9GA 4UVAA 2IA2A 5BPDA 2ZXJA 4K2EA 1ZGJA 1OYIA 1B6AA 1J7KA 3SXYA 1ZN2A 4M74A 1IN4A 4LK0F 4Q4ZF 2YU3A 3KETA 4Q47A 1RNLA 3PQKA 1F1ZA 5LRSA 3I64A 3F23A 1R23A 3B73A 2OZ6A 3M7GA 4KN7X 2FBKA 3HSFA 4RB0A 3I54A 5L3GA 3LA2A 5LEKA 2EA4A 3Q9SA 4WXHA 5ICEA 3HSRA 3JAMZ 3FHZA 3P7NA 5D4RA 3WGGA 1LDJA 4L9JA 4ZZLA 2IT0A 4U7DA 2ZNYA 2L4MA 2GIVA 5L3EA 1P92A 3RYRA 4UUVA 1SFUA 4UV8A 5FLXK 4LLNA 1DDNA 4A6DA 3LQRA 4BHPA 1R1UA 1ZRFA 2ISYA 2L54A 2Q0OA 1WI9A 4HW0A 3ULQB 1V4RA 3F72A 5HLHA 1IN7A 3KLNA 2QBYA 4A6EA 1R58A 5ED4A 2MH9A 3BJAA 5CVJA 2KIMA 1UB9A 4U88A 3C3WA 4HF2A 4KMUX 1LNWA 5FGMA 1R00A 1HKTA 1B59A 4UXNA 3FM5A 2O6GE 2DPUA 3ECOA 4M73A 5DYMA 5IT9K 4FHTA 2PEXA 3JW4A 1R1VA 4OIRF 2GWRA 3HRSA 1EH8A 4KICA 1RIOH 4KMFA 4OIOF 1IN6A 3F3XA 1B9MA 2XASA 2QENA 2RC4A 2CO5A 1MD0A 3KEQA 1BI0A 1P6RA 2HKOA 2XAJA 4RAYA 3KZYA 2A3SA 4I0BA 2UZKA 3FMRA 4L9NA 4BYYA 1YW9A 2G7UA 1OKRA 2HFHA 3J81K 1IF1A 2X0LA 2CFXA 5D6FA 2JPCA 2FEZA 3ZQ7A 2P5VA 5E1WA 4IHTA 3HIFA 1I27A 4AWXB 3HUGA 1BM9A 4IPAA 1D5VA 4EM2A 2WC2A 2HTJA 3PQJA 5J8FA 1YW8A 4HLYA 3K2ZA 2J5PA 2V1XA 3BY6A 1Z05A 4YG2F 1ZH5A 1K78A 4GGGA 1HW5A 3QAHA 1K78B 2P6SA 5KK1A 1C0WA 3E5XA 2OZUA 5CVUA 1VTNC 1XSXA 2VBWA 2K86A 3SFZA 4Y17A 1CF7A 4UNOA 1S7OA 1ZHFA 1B4AA 2QYOA 1S6LA 2OU2A 1T0FA 5D5VB 4S04A 1TLHB 4KFCA 3ZMZA 1O57A 1T2KA 4M9SA 5J6XA 1W5SA 2UXNA 2XAHA 2F2EA 2FU4A 4G7ZF 5A2QK 2O03A 2RQPA 3FXQA 2LKPA 4LLGF 3V4GA 4OMYA 1F4KA 1Z7UA 2Y75A 2ESNA 3WGHA 5AIQA 1F9NA 2X4HA 3GUDA 5LLQA 3TDUC 1QQIA 1WSUA 1FBUA 4WXDA 3E5UA 5DD4A 4IXAA 3DXJF 1FC3A 1SMYF 1Z6RA 5F1RA 1S8NA 2NRAC 2EK5A 2VBZA 4ZYDA 5BMZA 1IRGA 2V79A 2DT5A 3Q9VA 1KQ9A 3VEPA 1XGNA 2COMA 1LB2A 1XCVA 3FMQA 3BDDA 2WWYA 3C1DA 3P9KA 2YPRA 4G7OF 4LB5A 1Z1DA 2DK8A 3CTAA 1JHHA 3CUQB 3H92A 2J5OA 1BIAA 2ACJA 2EFNA 2EJRA 2LSOA 3O3KA 2ESHA 4ZYEA 4MEXF 3LA3A 2RGVA 2CW0F 5BPIA 1YO5C 5TJJA 3JSPA 4OOIA 4I02A 3V8KA 3WU0A 2L02A 2O0YA 5E1XA 3FF5A 3TO7A 5LGNA 2XVCA 1W7PD 3FZVA 3KP4A 2AXLA 2NNNA 4XSXF 1E17A 1FYKA 4KIBA 4WWCA 1XD7A 2KIFA 2GAUA 3ZN1A 4L9TA 1O3RA 2MD5A 2WTEA 5HDNA 2Q2EA 5LRRA 2BBYA 2F5FA 2VE8A 1MDMB 2ZCWA 4WF2A 3RKYA 2XAFA 3CUQA 1R5GA 1OR7A 2A6HF 5E20A 3F8MA 2M8EA 4MQVA 4CGZA 3LFKA 3GZ6A 2M1BA 3WTVC 1P4XA 2Z33A 1MKMA 5HS7A 3REOA 4OIPF 4HDUA 2QQBA 1BN5A 1U3EM 4CYDA 1KU3A 4IRHA 1S7AA 3R0AA 4LB6B 1R36A 3EETA 3DPLC 4QLCU 3HHHA 3LAJA 4XLPF 2QBYB 3VB2A 3KP7A 1SMTA 1XDUA 4YFNF 5HOOA 2L3DA 5ERIA 3QOPA 1SD6A 2NS0A 2NNYA 2LDUA 6PAXA 5K5RA 4U0YA 1LJ9A 3R6SA 1K79A 4XBFA 4YFKF 5LGUA 4CXFA 3F6VA 4IVNA 4M72A 1Z6TA 2HKXA 4WK8F 1YG2A 3HSEA 4L5JA 4XSZF 3ZMVA 1W4MA 2ELHA 2VOPA 2ZFWA 5JI6A 3RKXA 3BZ6A 4MNUA 2V1UA 2FE3A 5H6RA 5L3CA 1WRJA 2M87A 3CO6C 2Y0MA 3WTUC 2HQNA 2H94A 1O7FA 2OBPA 4Q48A 2RN7A 4M9ZA 1FLIA 3DQVC 5FD6A 5D8KB 1R1TA 4CZZA 1KYZA 3T5XA 1CGPA 1R22A 1D8JA 4UVCA 1HKQA 2VE9A 3K69A 3G3ZA 2XAGA 1IZ1A 2RNJA 3I58A 3WODF 3WTWC 4ENJA 2HWVA 3WTZA 4LMYA 2ZJ2A 3I71A 1KU7A 2IP2A 1NHAA 3HRUA 4R79A 3WTYC 2MLGA 4RAZA 3HRMA 3K1PA 3QPHA 3NRVA 1ZLJA 1FT9A 3LSTA 4B8XA 3GVAA 2ETHA 2EFWA 1TQIA 2LNBA 2IRFG 2M45A 1FP2A 1BIBA 4IRGA 2OQRA 4EJOA 3IHUA 1FP1D 1XB4A 2K4JA 3D5LA 1OPCA 4LJZF 2PN6A 4RGRA 1E2XA 4LG0B 5D8LB 2UWMA 2O61A 3DPTA 5F64A 4XRFA 1MJBA 3HRTA 1B9NA 1IRFA 1QBJA 2L4AA 5HDGA 2EFPA 2EWNA 3B02A 3FM3A 4O3MA 4I01A 5LEJA 2P7CB 3SZPA 1XDSA 1MGTA 2FNPA 1U78A 1TW3A 3M1EA 2QUFA 3QRFF 4G9YA 5A2QZ 4KUMA 3G73A 2GQQA 2PJPA 4BHCA 2DU9A 2CQKA 4A0YA 3BPXA 2K02A 1YS6A 1XCBA 1YIOA 2RKHA 2QQ9A 3LA7A 1T6SA 3T1BA 1TW2A 1USSA 5K5QA 1H9TA 1XSVA 5FFXA 5CJ9A 3I59A 4RB1A 3KZZA 5D5UB 2JPBA 5E8GA 1G3WA 4EGYA 1QO0D 3V7SA 3MFKA 3KP3A 3LWFA 1JE8A 1KYWA 1FBQA 2W57A 2CGPA 4P9FA 2EA2A 2XIGA 3VOEA 3GFMA 3MEXA 1DPUA 4JBAA 4A0XA 4A12A 1JXSA 3ZMSA 1ODDA 3SHFA 2FRHA 1D8KA 1TTYA 1Z91A 2P8TA 3E6CC 4P9UA 4I2OA 1STZA 1IXRC 4HLXA 1ONVA 2JRTA 4UV9A 2DQRA 4U0VA 5EEGA 4LD5A 4MHGA 4LK1F 4HOBA 2F5EA 3AAFA 5F6FA 2XUBA 5FD5A 5HDKA 3BWGA 4AD9A 2XRNA 3K9TA 3SZTA 4RS8A 3V7RA 4YFXF 1J2XA 3VODA 4A5NA 1T38A 4L0ZB 2FOKA 3TKYA 4Y15A 5K5OA 3PFIA 1BBYA 4CHUA 4EJTA 5ICCA 3TO6A 5LBQA 3W6KB 1IN8A 4KYWA 4OIQF 5KVRA 2D45A 2VBYA 3TOBA 1BI1A 1ZYRF 3L9FA 2K7LA 2VC1A 2FQ3A 3F8NA 1GXQA 2XGXA 2DPDA 1YS7A 2VN2A 2QLZA 1BJAA 1FZPB 2FXAA 1W7PA 2GZWA 1BI3A 2D1HA 3FXUA 3IC7A 2NAZA 1XGSA 5H6QA 4HQEA 2PLYA 3S2WA 2F5DA 5TRDA 4P96A 1BC8C 1ZRDA 1QZYA 1J75A 1R5HA 2HTSA 1IAWA 1BOAA 4P5OA 1J9IA 4HA8A 3GO5A 1XGOA 5D4SA 2Z9OA 5HLIA 3E6BA 3BJOA 2A5YB 1G4DA 1I1SA 3GF2A 4FT8A 3GZ5A 4ENMA 1BC7C 2ZMEA 4N9IA 1USTA 1FNNA 2TDXA 4L0YB 3MWMA 1YLFA 1YYVA 1GHCA 3GWZA 4F7ZA 4GXOA 3WGIA 5H20A 2VBXA 3ISPA 4KDPA 4ZH4F 1REPC 2HS5A 2Z5UA 3IWFA 3P9IA 4ZYHA 2OAZA 2BEOA 1FPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLN F;  3ZMD A;  2H6B A;  3F22 A;  4AIJ A;  3C7J A;  1DPR A;  4N0B A;  4RB3 C;  1UHW A;  5IT3 A;  1P2F A;  3MZH A;  3QP5 A;  3F8C A;  3ABU A;  4I09 A;  3J80 K;  1YTY A;  1LVA A;  1PP7 U;  4FX4 A;  1B1B A;  2LF7 A;  2GXG A;  1W5T A;  2P6T A;  4AIH A;  2G9W A;  1FY7 A;  4LGW A;  3ZPL A;  4TV7 A;  5K1Y A;  1SFX A;  2EB7 A;  4AIK A;  5DUK A;  5JHU A;  1RUN A;  4UHT A;  5FO5 A;  2E7X A;  2JSC A;  4KIF A;  3J81 Z;  4A0Z A;  4ETS A;  3KP6 A;  4BQA A;  3GEZ A;  2CSO A;  5ICG A;  3CUQ C;  4UVB A;  3HOT A;  2HQR A;  2A07 F;  2FBI A;  3EDP A;  5JFR A;  2E7W A;  4HX4 A;  2DAO A;  3HTU A;  3R60 A;  2P5K A;  2GA2 A;  3COA C;  3GXO A;  2ZBK A;  3U2R A;  1O3S A;  3FWE A;  3I5U A;  4D0P A;  4MQ9 F;  3I53 A;  2E1C A;  3DFG A;  1YW7 A;  4NQW A;  2Z3Y A;  3FMS A;  3WTS C;  2R3S A;  3GFI A;  1ZG5 A;  1KU9 A;  3TO9 A;  5L3D A;  3CO7 C;  5CVV A;  4GYG A;  1HW2 A;  1IW7 F;  2CG4 A;  4FX0 A;  3R0J A;  4I0A A;  3LQQ A;  1TBX A;  3RKW A;  4N9H A;  4G6Q A;  2K4B A;  3JSO A;  1U5T C;  1FX7 A;  2D2W A;  1Q1H A;  4JQF A;  3LAP A;  2YSR A;  1TNT A;  2VOD A;  4KNY A;  3E97 A;  4CIC A;  2KRF A;  4ASN A;  2KJB A;  4EM1 A;  3WTT C;  3J7A O;  4GCV A;  3DF8 A;  2DFI A;  3MCZ A;  1I1G A;  4HX7 A;  3RTR A;  1G3S A;  3DV8 A;  1QPM A;  4A5M A;  2HYG D;  2QQA A;  1RUO A;  1QGP A;  3QU3 A;  1HXD A;  3O6B B;  3BRO A;  4KIG A;  2ISZ A;  2NYX A;  5ICF A;  2B0L A;  4OU0 A;  1ZAR A;  4YIF A;  3K0L A;  2XKO A;  4AVP A;  2XRO A;  3O2P E;  3GW2 A;  2PMH A;  1IUY A;  4I98 B;  2DI3 A;  2XHK A;  1MJ9 A;  2PBI A;  1MZB A;  3F21 A;  5LHI A;  2DW4 A;  3M9A A;  1XN7 A;  1HQC A;  3FXR A;  2HDC A;  3CDH A;  4KA4 A;  2WV0 A;  1IN5 A;  2BE5 F;  2W85 A;  1XGM A;  2XV4 S;  3JTH A;  2RV8 A;  3L2C A;  1P4W A;  3HHG A;  2C6Y A;  3NQO A;  3RDI A;  1TQP A;  1H0M A;  4DNC A;  5ILS A;  1YFH A;  1K6O A;  2PG4 A;  5J8C A;  3ABT A;  5HS8 A;  2QM3 A;  4ON0 A;  4JK1 X;  5HLG A;  1AWC A;  4HQM A;  4IJA A;  1L3L A;  2QWW A;  3Q5F A;  1A04 A;  3ZP5 A;  4YII A;  4Z2Y A;  2HGC A;  3KFW X;  3IKV A;  3KP5 A;  4WXC A;  4U7B A;  2DO7 A;  3IRQ A;  4GYI A;  5L3B A;  3WTX C;  3WE2 A;  2O8X A;  1U6G A;  2JZY A;  2PI0 A;  1HW1 A;  3K1M A;  3QP6 A;  1I5Z A;  5DCF A;  4ESF A;  2EFQ A;  2L01 A;  3EQL F;  2KJC A;  3KCC A;  4RGS A;  5BS6 A;  4PGH A;  3P9C A;  4RGX A;  1J5Y A;  2PQ8 A;  1AOY A;  4R8H A;  4MTE A;  1KA8 A;  2VXZ A;  3QPT A;  2M30 A;  5HS9 A;  3V8L A;  1FBS A;  2PFB A;  1G3Y A;  3R61 A;  4RGU A;  4EMS A;  1F5T A;  3KE2 A;  2QZ8 A;  3SQN A;  2Q8K A;  4WX9 A;  3L00 A;  2A68 F;  1SAX A;  2MC3 A;  5EEH A;  2VON A;  3L7W A;  1XMA A;  1UFM A;  4HBL A;  4PCQ A;  1FYM A;  1EH7 A;  1O3T A;  1S3J A;  3U1D A;  3HYI A;  3E5Q A;  2QVO A;  3GFJ A;  4BNC A;  3GYH X;  1S29 A;  2P7V B;  2HEO A;  1Y0U A;  2FBH A;  4OMZ A;  1FOK A;  3T0Y A;  3BPV A;  4HX8 A;  2JTV A;  4L9V A;  5CLS A;  1L0O C;  4GO1 A;  1U5T A;  3CLO A;  5L3F A;  3H3U A;  2IA1 A;  4E70 A;  4O5V A;  4PZJ A;  2M5W A;  3CUO A;  5LHH A;  5LGT A;  3ZMT A;  2HZT A;  3M8E A;  1O3Q A;  3ML6 A;  5CYV A;  2GXB A;  2A69 F;  2D1V A;  3C18 A;  2FF4 A;  1JGS A;  4S05 A;  2STT A;  1BI2 A;  1SD7 A;  2A61 A;  1R7J A;  2FML A;  1JHF A;  4G6D A;  1GVJ A;  4HDV A;  3OOP A;  5IT9 Z;  3ECH A;  1LEA A;  3N97 A;  1FSH A;  1U5T B;  2R7F A;  1HST A;  1QZZ A;  3T8R A;  4HV6 A;  5CVR A;  5HVQ C;  4IHS A;  2PMU A;  4PDK A;  1ZRE A;  3TQN A;  5DUI A;  2CYY A;  1OYY A;  1J0R A;  2BYV E;  2OA4 A;  1OMI A;  2W84 A;  4R1H A;  3EYI A;  4G7H F;  4NB5 A;  4EV0 A;  2V9V A;  3F6O A;  1WKM A;  3E6M A;  4OIN F;  4RB2 C;  4U0W A;  2LF8 A;  5E8I A;  2ZME B;  3W6J B;  2O3F A;  4L5I A;  3KEO A;  3WU1 B;  3WG9 A;  1DP7 P;  1ZG1 A;  2V6C A;  1LQ1 A;  2H09 A;  3H3Z A;  4LLL A;  1YQA A;  2XKP A;  4ENK A;  1MJA A;  3IRR A;  5E1Z B;  2P5L C;  2IVM A;  1D3Y A;  4M6Y A;  4B09 A;  2VT2 A;  4BHB A;  1ON1 A;  5BQT A;  5FB2 A;  3GFL A;  3I59 B;  2KKO A;  2FSW A;  3VFZ A;  1I6X A;  3T8T A;  1HKS A;  5JVT A;  4M9X A;  5DV5 A;  3TOA A;  4EM0 B;  1PP8 F;  3I0T A;  1T98 A;  3ELK A;  3QU6 A;  3V8J A;  2EV5 A;  3EUH A;  5BOX A;  1FYL A;  1V3F A;  4L18 B;  5D5W B;  4G8X A;  3I4P A;  5CVI A;  3F8F A;  5DD8 A;  3F8B A;  2IPQ X;  4HV5 A;  3HTS B;  3TDZ C;  5E18 F;  3K1N A;  4EGZ A;  2R7D A;  3HOS A;  2MLK A;  4BXU A;  3RI4 A;  1WQ2 A;  4A2U A;  2FMY A;  4LFU A;  3RYP A;  5FLX Z;  3JTG A;  2FA5 A;  2A6E F;  1UHM A;  5D6E A;  3V7C A;  2HR3 A;  1W7P B;  1EH6 A;  4Y13 A;  1U8R A;  2RDP A;  2IA0 A;  3MZY A;  1XMK A;  4ESJ A;  3ZMU A;  3ZN0 A;  3MQ0 A;  1SD5 A;  1P4A A;  1X3U A;  4LG0 A;  4ESB A;  1KGS A;  1ZRC A;  3DKW A;  4EVI A;  4IRI A;  1J59 A;  1OYW A;  2MA3 A;  1QNT A;  3BP8 A;  1MDM A;  2W24 A;  1LEB A;  2Z99 A;  1EV7 A;  1KQ0 A;  2ZKZ A;  5AON A;  4P55 A;  4CO8 A;  3IL2 A;  2G7H A;  2GA1 A;  1ULY A;  1FSE A;  4CDG A;  1LDD A;  2JT1 A;  3IKT A;  2HYF A;  2H27 A;  2F5C A;  3CJN A;  1ZG3 A;  4M71 A;  2ADU A;  4Q5S F;  1IXS B;  4EJW A;  4M6X A;  2CWE A;  1XSD A;  3RPU A;  1O7L A;  2HOE A;  4ZZD A;  1FWZ A;  4IF4 A;  1GXP A;  4EJV A;  1KQ8 A;  3WE3 A;  1PDN C;  1Z9C A;  1ZAO A;  3M8F A;  2E1N A;  1ZGA A;  2BV6 A;  1UCR A;  2K27 A;  2EFO A;  2MH2 A;  4HZF A;  4KT5 C;  5JR3 A;  5AIP A;  1U2W A;  3DEU A;  2IW5 A;  4I7H A;  3RIR A;  1G6N A;  3BOQ A;  4MEY F;  4QWQ A;  5ILU A;  3J80 Z;  2XAQ A;  3MAJ A;  4PGG A;  3FX3 A;  5DCM B;  2YR2 A;  5LHG A;  3R4K A;  2DTR A;  2MBF A;  1RZ4 A;  4DQ2 A;  2VOO A;  3GX4 X;  2DBB A;  4BAY A;  4WCG A;  3L09 A;  3RJP A;  1LDK B;  3N4M A;  3D0S A;  2OQG A;  5DCM A;  1KU2 A;  3ROU A;  2UXX A;  2RVC A;  3E3V A;  5E17 F;  2P4W A;  1H9G A;  3IWZ A;  1CF7 B;  1DUX C;  4ENN A;  3NEU A;  2YX7 A;  1RI7 A;  1WWX A;  4O6J A;  2STW A;  5DEQ A;  1K7A A;  2VT3 A;  3RPQ A;  5DDG A;  4BH9 A;  2ZNZ A;  1G3T A;  2KIU A;  3BJ6 A;  1HSJ A;  4EQQ A;  4HYE A;  4NHJ A;  3KLO A;  1PUE E;  2Y48 A;  1HBX G;  4MGR A;  3OV8 A;  4H0E A;  1IXC A;  4ZYG A;  1ZLK A;  5ILV A;  3E6D A;  4EJU A;  3TGN A;  4HF0 A;  5D5X B;  2DQL A;  2V1D A;  2EV0 A;  2H6C A;  4HF1 A;  2DLL A;  3DP7 A;  5FFZ A;  4G94 A;  1SFE A;  2FNA A;  3GLX A;  1ON2 A;  1SD4 A;  2W25 A;  2ZO4 A;  2AS5 F;  1TQM A;  4MTD A;  2IJL A;  3KP2 A;  2BGC A;  1T39 A;  4KN4 X;  2OD5 A;  1TNS A;  2EV6 A;  2VC0 A;  4HAM A;  2DK5 A;  3ERE D;  3EYY A;  3JAM K;  2YX4 A;  3U9G A;  4UVA A;  2IA2 A;  5BPD A;  2ZXJ A;  4K2E A;  1ZGJ A;  1OYI A;  1B6A A;  1J7K A;  3SXY A;  1ZN2 A;  4M74 A;  1IN4 A;  4LK0 F;  4Q4Z F;  2YU3 A;  3KET A;  4Q47 A;  1RNL A;  3PQK A;  1F1Z A;  5LRS A;  3I64 A;  3F23 A;  1R23 A;  3B73 A;  2OZ6 A;  3M7G A;  4KN7 X;  2FBK A;  3HSF A;  4RB0 A;  3I54 A;  5L3G A;  3LA2 A;  5LEK A;  2EA4 A;  3Q9S A;  4WXH A;  5ICE A;  3HSR A;  3JAM Z;  3FHZ A;  3P7N A;  5D4R A;  3WGG A;  1LDJ A;  4L9J A;  4ZZL A;  2IT0 A;  4U7D A;  2ZNY A;  2L4M A;  2GIV A;  5L3E A;  1P92 A;  3RYR A;  4UUV A;  1SFU A;  4UV8 A;  5FLX K;  4LLN A;  1DDN A;  4A6D A;  3LQR A;  4BHP A;  1R1U A;  1ZRF A;  2ISY A;  2L54 A;  2Q0O A;  1WI9 A;  4HW0 A;  3ULQ B;  1V4R A;  3F72 A;  5HLH A;  1IN7 A;  3KLN A;  2QBY A;  4A6E A;  1R58 A;  5ED4 A;  2MH9 A;  3BJA A;  5CVJ A;  2KIM A;  1UB9 A;  4U88 A;  3C3W A;  4HF2 A;  4KMU X;  1LNW A;  5FGM A;  1R00 A;  1HKT A;  1B59 A;  4UXN A;  3FM5 A;  2O6G E;  2DPU A;  3ECO A;  4M73 A;  5DYM A;  5IT9 K;  4FHT A;  2PEX A;  3JW4 A;  1R1V A;  4OIR F;  2GWR A;  3HRS A;  1EH8 A;  4KIC A;  1RIO H;  4KMF A;  4OIO F;  1IN6 A;  3F3X A;  1B9M A;  2XAS A;  2QEN A;  2RC4 A;  2CO5 A;  1MD0 A;  3KEQ A;  1BI0 A;  1P6R A;  2HKO A;  2XAJ A;  4RAY A;  3KZY A;  2A3S A;  4I0B A;  2UZK A;  3FMR A;  4L9N A;  4BYY A;  1YW9 A;  2G7U A;  1OKR A;  2HFH A;  3J81 K;  1IF1 A;  2X0L A;  2CFX A;  5D6F A;  2JPC A;  2FEZ A;  3ZQ7 A;  2P5V A;  5E1W A;  4IHT A;  3HIF A;  1I27 A;  4AWX B;  3HUG A;  1BM9 A;  4IPA A;  1D5V A;  4EM2 A;  2WC2 A;  2HTJ A;  3PQJ A;  5J8F A;  1YW8 A;  4HLY A;  3K2Z A;  2J5P A;  2V1X A;  3BY6 A;  1Z05 A;  4YG2 F;  1ZH5 A;  1K78 A;  4GGG A;  1HW5 A;  3QAH A;  1K78 B;  2P6S A;  5KK1 A;  1C0W A;  3E5X A;  2OZU A;  5CVU A;  1VTN C;  1XSX A;  2VBW A;  2K86 A;  3SFZ A;  4Y17 A;  1CF7 A;  4UNO A;  1S7O A;  1ZHF A;  1B4A A;  2QYO A;  1S6L A;  2OU2 A;  1T0F A;  5D5V B;  4S04 A;  1TLH B;  4KFC A;  3ZMZ A;  1O57 A;  1T2K A;  4M9S A;  5J6X A;  1W5S A;  2UXN A;  2XAH A;  2F2E A;  2FU4 A;  4G7Z F;  5A2Q K;  2O03 A;  2RQP A;  3FXQ A;  2LKP A;  4LLG F;  3V4G A;  4OMY A;  1F4K A;  1Z7U A;  2Y75 A;  2ESN A;  3WGH A;  5AIQ A;  1F9N A;  2X4H A;  3GUD A;  5LLQ A;  3TDU C;  1QQI A;  1WSU A;  1FBU A;  4WXD A;  3E5U A;  5DD4 A;  4IXA A;  3DXJ F;  1FC3 A;  1SMY F;  1Z6R A;  5F1R A;  1S8N A;  2NRA C;  2EK5 A;  2VBZ A;  4ZYD A;  5BMZ A;  1IRG A;  2V79 A;  2DT5 A;  3Q9V A;  1KQ9 A;  3VEP A;  1XGN A;  2COM A;  1LB2 A;  1XCV A;  3FMQ A;  3BDD A;  2WWY A;  3C1D A;  3P9K A;  2YPR A;  4G7O F;  4LB5 A;  1Z1D A;  2DK8 A;  3CTA A;  1JHH A;  3CUQ B;  3H92 A;  2J5O A;  1BIA A;  2ACJ A;  2EFN A;  2EJR A;  2LSO A;  3O3K A;  2ESH A;  4ZYE A;  4MEX F;  3LA3 A;  2RGV A;  2CW0 F;  5BPI A;  1YO5 C;  5TJJ A;  3JSP A;  4OOI A;  4I02 A;  3V8K A;  3WU0 A;  2L02 A;  2O0Y A;  5E1X A;  3FF5 A;  3TO7 A;  5LGN A;  2XVC A;  1W7P D;  3FZV A;  3KP4 A;  2AXL A;  2NNN A;  4XSX F;  1E17 A;  1FYK A;  4KIB A;  4WWC A;  1XD7 A;  2KIF A;  2GAU A;  3ZN1 A;  4L9T A;  1O3R A;  2MD5 A;  2WTE A;  5HDN A;  2Q2E A;  5LRR A;  2BBY A;  2F5F A;  2VE8 A;  1MDM B;  2ZCW A;  4WF2 A;  3RKY A;  2XAF A;  3CUQ A;  1R5G A;  1OR7 A;  2A6H F;  5E20 A;  3F8M A;  2M8E A;  4MQV A;  4CGZ A;  3LFK A;  3GZ6 A;  2M1B A;  3WTV C;  1P4X A;  2Z33 A;  1MKM A;  5HS7 A;  3REO A;  4OIP F;  4HDU A;  2QQB A;  1BN5 A;  1U3E M;  4CYD A;  1KU3 A;  4IRH A;  1S7A A;  3R0A A;  4LB6 B;  1R36 A;  3EET A;  3DPL C;  4QLC U;  3HHH A;  3LAJ A;  4XLP F;  2QBY B;  3VB2 A;  3KP7 A;  1SMT A;  1XDU A;  4YFN F;  5HOO A;  2L3D A;  5ERI A;  3QOP A;  1SD6 A;  2NS0 A;  2NNY A;  2LDU A;  6PAX A;  5K5R A;  4U0Y A;  1LJ9 A;  3R6S A;  1K79 A;  4XBF A;  4YFK F;  5LGU A;  4CXF A;  3F6V A;  4IVN A;  4M72 A;  1Z6T A;  2HKX A;  4WK8 F;  1YG2 A;  3HSE A;  4L5J A;  4XSZ F;  3ZMV A;  1W4M A;  2ELH A;  2VOP A;  2ZFW A;  5JI6 A;  3RKX A;  3BZ6 A;  4MNU A;  2V1U A;  2FE3 A;  5H6R A;  5L3C A;  1WRJ A;  2M87 A;  3CO6 C;  2Y0M A;  3WTU C;  2HQN A;  2H94 A;  1O7F A;  2OBP A;  4Q48 A;  2RN7 A;  4M9Z A;  1FLI A;  3DQV C;  5FD6 A;  5D8K B;  1R1T A;  4CZZ A;  1KYZ A;  3T5X A;  1CGP A;  1R22 A;  1D8J A;  4UVC A;  1HKQ A;  2VE9 A;  3K69 A;  3G3Z A;  2XAG A;  1IZ1 A;  2RNJ A;  3I58 A;  3WOD F;  3WTW C;  4ENJ A;  2HWV A;  3WTZ A;  4LMY A;  2ZJ2 A;  3I71 A;  1KU7 A;  2IP2 A;  1NHA A;  3HRU A;  4R79 A;  3WTY C;  2MLG A;  4RAZ A;  3HRM A;  3K1P A;  3QPH A;  3NRV A;  1ZLJ A;  1FT9 A;  3LST A;  4B8X A;  3GVA A;  2ETH A;  2EFW A;  1TQI A;  2LNB A;  2IRF G;  2M45 A;  1FP2 A;  1BIB A;  4IRG A;  2OQR A;  4EJO A;  3IHU A;  1FP1 D;  1XB4 A;  2K4J A;  3D5L A;  1OPC A;  4LJZ F;  2PN6 A;  4RGR A;  1E2X A;  4LG0 B;  5D8L B;  2UWM A;  2O61 A;  3DPT A;  5F64 A;  4XRF A;  1MJB A;  3HRT A;  1B9N A;  1IRF A;  1QBJ A;  2L4A A;  5HDG A;  2EFP A;  2EWN A;  3B02 A;  3FM3 A;  4O3M A;  4I01 A;  5LEJ A;  2P7C B;  3SZP A;  1XDS A;  1MGT A;  2FNP A;  1U78 A;  1TW3 A;  3M1E A;  2QUF A;  3QRF F;  4G9Y A;  5A2Q Z;  4KUM A;  3G73 A;  2GQQ A;  2PJP A;  4BHC A;  2DU9 A;  2CQK A;  4A0Y A;  3BPX A;  2K02 A;  1YS6 A;  1XCB A;  1YIO A;  2RKH A;  2QQ9 A;  3LA7 A;  1T6S A;  3T1B A;  1TW2 A;  1USS A;  5K5Q A;  1H9T A;  1XSV A;  5FFX A;  5CJ9 A;  3I59 A;  4RB1 A;  3KZZ A;  5D5U B;  2JPB A;  5E8G A;  1G3W A;  4EGY A;  1QO0 D;  3V7S A;  3MFK A;  3KP3 A;  3LWF A;  1JE8 A;  1KYW A;  1FBQ A;  2W57 A;  2CGP A;  4P9F A;  2EA2 A;  2XIG A;  3VOE A;  3GFM A;  3MEX A;  1DPU A;  4JBA A;  4A0X A;  4A12 A;  1JXS A;  3ZMS A;  1ODD A;  3SHF A;  2FRH A;  1D8K A;  1TTY A;  1Z91 A;  2P8T A;  3E6C C;  4P9U A;  4I2O A;  1STZ A;  1IXR C;  4HLX A;  1ONV A;  2JRT A;  4UV9 A;  2DQR A;  4U0V A;  5EEG A;  4LD5 A;  4MHG A;  4LK1 F;  4HOB A;  2F5E A;  3AAF A;  5F6F A;  2XUB A;  5FD5 A;  5HDK A;  3BWG A;  4AD9 A;  2XRN A;  3K9T A;  3SZT A;  4RS8 A;  3V7R A;  4YFX F;  1J2X A;  3VOD A;  4A5N A;  1T38 A;  4L0Z B;  2FOK A;  3TKY A;  4Y15 A;  5K5O A;  3PFI A;  1BBY A;  4CHU A;  4EJT A;  5ICC A;  3TO6 A;  5LBQ A;  3W6K B;  1IN8 A;  4KYW A;  4OIQ F;  5KVR A;  2D45 A;  2VBY A;  3TOB A;  1BI1 A;  1ZYR F;  3L9F A;  2K7L A;  2VC1 A;  2FQ3 A;  3F8N A;  1GXQ A;  2XGX A;  2DPD A;  1YS7 A;  2VN2 A;  2QLZ A;  1BJA A;  1FZP B;  2FXA A;  1W7P A;  2GZW A;  1BI3 A;  2D1H A;  3FXU A;  3IC7 A;  2NAZ A;  1XGS A;  5H6Q A;  4HQE A;  2PLY A;  3S2W A;  2F5D A;  5TRD A;  4P96 A;  1BC8 C;  1ZRD A;  1QZY A;  1J75 A;  1R5H A;  2HTS A;  1IAW A;  1BOA A;  4P5O A;  1J9I A;  4HA8 A;  3GO5 A;  1XGO A;  5D4S A;  2Z9O A;  5HLI A;  3E6B A;  3BJO A;  2A5Y B;  1G4D A;  1I1S A;  3GF2 A;  4FT8 A;  3GZ5 A;  4ENM A;  1BC7 C;  2ZME A;  4N9I A;  1UST A;  1FNN A;  2TDX A;  4L0Y B;  3MWM A;  1YLF A;  1YYV A;  1GHC A;  3GWZ A;  4F7Z A;  4GXO A;  3WGI A;  5H20 A;  2VBX A;  3ISP A;  4KDP A;  4ZH4 F;  1REP C;  2HS5 A;  2Z5U A;  3IWF A;  3P9I A;  4ZYH A;  2OAZ A;  2BEO A;  1FPQ A; 
#chains in the Genus database with same CATH topology
 2V6E A;  4XLN F;  2ELJ A;  3ZMD A;  1DP3 A;  2H6B A;  3F22 A;  1NH3 A;  4AIJ A;  3C7J A;  2XF7 A;  2XB5 A;  2V26 A;  1DPR A;  1YOV B;  4N0B A;  2R7V A;  4RB3 C;  1UHW A;  4CSW A;  5IT3 A;  1P2F A;  2K9N A;  3MZH A;  5EF6 A;  3QP5 A;  3F8C A;  3ABU A;  1F36 A;  2F4O B;  2DA4 A;  4I09 A;  4IQ4 A;  4BJ5 C;  3J80 K;  1YTY A;  4DYQ A;  5M5Y J;  3S16 J;  1FTZ A;  1JT6 A;  2XSJ C;  1LVA A;  1PP7 U;  4FX4 A;  3SYT A;  1B1B A;  2LF7 A;  2GXG A;  1W5T A;  2P6T A;  4AIH A;  1JI8 A;  3PIP F;  2G9W A;  1FY7 A;  4LGW A;  3ZPL A;  2IGM A;  3OS2 A;  4TV7 A;  1B72 A;  2JVH A;  3HB9 A;  1QVU A;  2L9N A;  2WY8 Q;  5K1Y A;  1SFX A;  3K70 C;  2EB7 A;  2R0Q C;  2DA5 A;  2EIM H;  4AIK A;  1WPK A;  4PSW A;  2JA8 J;  5DUK A;  1IRX A;  5JHU A;  1JUS A;  1QHH D;  5J4V A;  4XLC A;  1RUN A;  2OJE D;  4UHT A;  5FO5 A;  2E7X A;  1W0T A;  2JSC A;  1AHD P;  4KIF A;  3J81 Z;  4A0Z A;  4ETS A;  3KP6 A;  4BQA A;  3GEZ A;  1BOB A;  1MH3 A;  3OIO A;  3QOD A;  2CSO A;  5ICG A;  1N77 A;  3CUQ C;  4UVB A;  3HOT A;  2HQR A;  3OYC A;  1ZEL A;  2A07 F;  4BBS J;  5DTD A;  2CQ7 A;  2FBI A;  4B4C A;  3EDP A;  5JFR A;  2E7W A;  2PMZ N;  5KCM A;  1ITY A;  2KT0 A;  1I3Q J;  4A69 C;  3LFU A;  4HX4 A;  2DAO A;  2CMP A;  3HTU A;  2P5K A;  3R60 A;  4FCY A;  2TRT A;  2YUS A;  2FUG 2;  2GA2 A;  1W36 C;  3LSR A;  2ZJP F;  2ZC2 A;  3GXO A;  3COA C;  2ZBK A;  5FRM A;  4Y52 J;  4A3G J;  2ZFU A;  2CH0 A;  3GLL A;  3U2R A;  4M3E A;  1O3S A;  3FWE A;  3I5U A;  3S93 A;  4D0P A;  3AG3 H;  2O7O A;  4EAT A;  2XAU A;  4MQ9 F;  3I53 A;  2E1C A;  2W00 A;  4RDU A;  5M5W J;  2CUJ A;  3DFG A;  2VIX A;  5HOD A;  1HOM A;  1LPQ A;  1YW7 A;  4NQW A;  2Z3Y A;  3FMS A;  3WTS C;  2R3S A;  3BR0 A;  2X6W A;  3GFI A;  2HZD A;  3ZQQ A;  1Z0X A;  1ZG5 A;  1U8B A;  2A6T A;  1KU9 A;  3TO9 A;  5L3D A;  4A3L J;  1KON A;  3CO7 C;  1D1C A;  1SVO A;  5CVV A;  5F0F A;  1FMV A;  2Z1D A;  4GYG A;  2R5Z B;  1HW2 A;  1IW7 F;  2R7W A;  2CG4 A;  2AXT C;  4FX0 A;  5FKO A;  4W1U A;  2KLO A;  4FE4 A;  3R0J A;  2KIQ A;  2PJR A;  4I0A A;  3LQQ A;  5IP7 J;  1TBX A;  3RKW A;  4N9H A;  3C2B A;  4G6Q A;  1WJE A;  1XX5 A;  2MSY A;  2K4B A;  3JSO A;  1VQN I;  1U5T C;  1FX7 A;  3BQY A;  2D2W A;  1Q1H A;  2L7K A;  4JQF A;  2LP0 A;  5IY5 H;  3LAP A;  1ACI A;  2UV1 A;  3CJR B;  2YSR A;  1X4P A;  1TNT A;  3PUB A;  1OCO H;  2VOD A;  2XDV A;  4KNY A;  3E97 A;  2NOG A;  1H8A C;  2EZL A;  2VPL A;  4CIC A;  2IGO A;  2KRF A;  4ASN A;  5LD2 C;  2HVQ A;  1ETO A;  2KJB A;  2L7F P;  2VPR A;  4GCV A;  4EM1 A;  3WTT C;  3J7A O;  1E0E A;  1DU6 A;  4Y3O A;  2M8G X;  3DF8 A;  3OYD A;  2DFI A;  3MCZ A;  1V5G A;  3W3C A;  3M1C A;  1IV8 A;  1I1G A;  3CES A;  2VUM J;  4J01 A;  2F48 A;  4HX7 A;  3RTR A;  1G3S A;  4BQN A;  1J09 A;  3U1K A;  2E5N A;  3DV8 A;  3RQ4 A;  1QPM A;  2JWT A;  1E3O C;  4A5M A;  2HYG D;  2LVS A;  2QQA A;  1RUO A;  2HI3 A;  1QGP A;  5H2F C;  1WJB A;  3QU3 A;  1HLV A;  1HXD A;  3MKL A;  3O6B B;  3BRO A;  4KIG A;  5B66 C;  1RKT A;  3TL4 X;  4A3F J;  3UR3 C;  5CQE A;  2ISZ A;  2NYX A;  3OL4 A;  5ICF A;  2B0L A;  2QA4 I;  1SVL A;  4OU0 A;  1ZAR A;  2QSF X;  5KAF C;  5IYC J;  4YIF A;  3K0L A;  2XKO A;  2I8D A;  4AVP A;  2XRO A;  1Z67 A;  4UUT A;  3OYL A;  3O2P E;  3GW2 A;  3JRD A;  3H35 A;  3HGG A;  2PMH A;  1IUY A;  4I98 B;  2DI3 A;  2XHK A;  4RM3 A;  1MJ9 A;  2PBI A;  3FXJ A;  1MZB A;  3F21 A;  3OSG A;  5LHI A;  2DW4 A;  1PJR A;  3DEW A;  3M9A A;  4E7L A;  1XN7 A;  3AG4 H;  1HQC A;  3FXR A;  4A3M J;  2O8K A;  1MMD A;  3MKW B;  2HDC A;  3CDH A;  4C9Y A;  2E2J J;  4KA4 A;  2WV0 A;  5F08 A;  3RCO A;  1IN5 A;  3LSG A;  2BE5 F;  3GTQ J;  2W85 A;  1XGM A;  2XV4 S;  3JTH A;  2RV8 A;  3L2C A;  1P4W A;  1SAU A;  3HHG A;  2C6Y A;  1VFC A;  3NQO A;  4XKV A;  3RDI A;  3BR2 A;  3DEE A;  2VJI A;  1TQP A;  1FOW A;  2JA2 A;  1H0M A;  4DNC A;  5ILS A;  1YFH A;  4KIS A;  1K6O A;  2PG4 A;  5J8C A;  3ABT A;  3CF5 F;  1A5J A;  2QKL B;  5HS8 A;  3ESW B;  2QM3 A;  4CCJ A;  2JVG A;  4CCN A;  5BNG A;  4ON0 A;  4JK1 X;  5EJC A;  3ABL H;  5HLG A;  1B72 B;  1AWC A;  4A3C J;  3BTL A;  2M7B A;  4XKB A;  4HQM A;  4IJA A;  2G0E A;  2VI6 A;  1L3L A;  5IYD J;  1UZC A;  2QWW A;  3Q5F A;  1A04 A;  3ZP5 A;  4YII A;  4I76 A;  2K9Q A;  4Z2Y A;  3FKI J;  2HGC A;  3KFW X;  3L2Q A;  2NVQ J;  3IKV A;  1LKX A;  3KP5 A;  4WXC A;  4U7B A;  1UG2 A;  2DO7 A;  4YIR X;  3IRQ A;  4GYI A;  5L3B A;  4ZTF A;  3WTX C;  1TWH J;  2AHQ A;  4XN3 A;  3WE2 A;  2O8X A;  1U6G A;  1YHQ I;  2JZY A;  2PI0 A;  1HW1 A;  1VQM I;  2CFO A;  3K1M A;  3QP6 A;  2Y31 A;  3HG9 A;  2HPM A;  1I5Z A;  4KT6 A;  5DCF A;  4ESF A;  2PJR B;  2EFQ A;  2L01 A;  3EQL F;  5CQG A;  2KJC A;  3KCC A;  4RGS A;  5BS6 A;  4PGH A;  2DDB A;  2JSP A;  3P9C A;  4RGX A;  1J5Y A;  2IEK A;  2V9K A;  3DTK A;  4CCL A;  5J40 A;  3PIO F;  1H89 C;  5GP9 A;  2PQ8 A;  1AOY A;  4R8H A;  4MTE A;  3BCA A;  1BR4 A;  1KA8 A;  2VXZ A;  3QYF A;  1MIJ A;  3QPT A;  2M30 A;  4II3 A;  5FJ8 J;  1HA8 A;  5HS9 A;  3V8L A;  5HNH A;  1PYV A;  1FBS A;  2LY9 A;  2PFB A;  3VSK A;  4DJA A;  1G3Y A;  3PNV A;  3VYS B;  3R61 A;  4PUS A;  1MMG A;  4RGU A;  4EMS A;  1F5T A;  3S1Q J;  3KE2 A;  2HPI A;  2QZ8 A;  1QA6 A;  1VZ0 A;  2QGU A;  2HVS A;  3SQN A;  4D1Q A;  2Q8K A;  2BOL A;  4FQG A;  2ZXI A;  4WX9 A;  3L1P A;  2HXI A;  2KFD A;  3OWT A;  3L00 A;  1D5Y A;  2KDO A;  3QYE A;  1X2N A;  2A68 F;  1S9H A;  2DFH A;  1SAX A;  4E7H A;  2MC3 A;  4AID A;  5EEH A;  2VON A;  1GV5 A;  2XRL A;  1R49 A;  2COB A;  3L7W A;  4A3E J;  3I9V 2;  1XMA A;  1UFM A;  4AYB A;  4HBL A;  4PCQ A;  3E7L A;  4XON A;  3N05 A;  1FYM A;  1EH7 A;  1O3T A;  1OCP A;  1S3J A;  3PM1 A;  4BEH B;  2DYS H;  3U1D A;  5TGT A;  3HYI A;  2B7E A;  3E5Q A;  2JRM A;  2QVO A;  4XRS G;  2BY0 A;  3CCV I;  3GFJ A;  4BNC A;  3GYH X;  1S29 A;  2P7V B;  5K7H A;  2HEO A;  1Y0U A;  1UHS A;  3WHB A;  2NXN B;  3PO2 J;  1YJW I;  1MSF C;  2P81 A;  2FBH A;  1LFU P;  4OMZ A;  3AL0 B;  2WY7 Q;  1FOK A;  3T0Y A;  2V4J C;  3BPV A;  4HX8 A;  2JTV A;  3PFY A;  4L9V A;  3ZXS A;  1WH5 A;  1OJL A;  5CLS A;  1IDY A;  1L0O C;  1VQL I;  4GO1 A;  1U5T A;  3CLO A;  2OTJ I;  2E1M C;  3ERM A;  1JT0 A;  5L3F A;  3H3U A;  5IPA A;  4UB6 C;  2IGN A;  2IA1 A;  4E70 A;  4PJM A;  5LFA A;  1MNE A;  1ZKG A;  4O5V A;  5E3O A;  4PZJ A;  3ZQH A;  4Y33 A;  4BE2 A;  3FXL A;  2M5W A;  3S3O A;  1HCR A;  3CUO A;  4BXF A;  3PO3 J;  4PFO A;  5LHH A;  5LGT A;  3ZMT A;  2HZT A;  3M8E A;  1HDD C;  1POG A;  1O3Q A;  1IO2 A;  3ML6 A;  4V2G A;  3NAR A;  5CYV A;  4G6T B;  2GXB A;  1I39 A;  2A69 F;  3OR2 C;  3FXK A;  3VWB A;  2D1V A;  3C18 A;  1VQK I;  2FF4 A;  1JGS A;  4S05 A;  1IRZ A;  1TL8 A;  2V7F A;  1Y56 A;  1MSE C;  2STT A;  1BI2 A;  4MFE A;  2RQQ A;  4D5C A;  1SD7 A;  2A61 A;  1R7J A;  2DOD A;  3JR9 A;  2FML A;  1JHF A;  2KL4 A;  1IV6 A;  2X1D A;  4G6D A;  5CPR B;  1GVJ A;  2LR8 A;  3OOP A;  4HDV A;  5IT9 Z;  3FXM A;  3ECH A;  1FIA A;  1LEA A;  3N97 A;  1FSH A;  2JA6 J;  1U5T B;  3H3V K;  2R7F A;  1X3W B;  3G1L A;  1HST A;  1QZZ A;  4NC7 A;  3T8R A;  4HV6 A;  2DMU A;  4JX6 A;  5CVR A;  2PMU A;  4B48 A;  4FIS A;  4PDK A;  5HVQ C;  3A01 B;  1ZRE A;  4IHS A;  3TQN A;  5DUI A;  2CW8 A;  2MGQ A;  3TBI A;  2K85 A;  3BCB A;  2CYY A;  1OYY A;  1J0R A;  2BYV E;  3KX2 A;  2OA4 A;  1W36 D;  1OMI A;  2W84 A;  4R1H A;  3TMO A;  3EYI A;  4G7H F;  2K9M A;  4NB5 A;  4P1W A;  4EV0 A;  4YEJ A;  2E60 A;  2V9V A;  3HOU J;  2DXI A;  5E3N A;  3F6O A;  2EH3 A;  1WKM A;  3E6M A;  4OIN F;  4RB2 C;  4B47 A;  2CUE A;  1NK2 P;  2HQ5 A;  4GRI A;  2RNG A;  4U0W A;  2LF8 A;  1VQ6 I;  5E8I A;  3PNT A;  5C4J J;  2ZME B;  4BXX J;  2CU7 A;  3W6J B;  2B63 J;  2OUM A;  3G71 I;  1UG0 A;  2O3F A;  4L5I A;  3KEO A;  4C2M J;  3WU1 B;  1DGW Y;  3WG9 A;  1VND A;  4CCK A;  1DP7 P;  3EUK L;  4OAY A;  1ZG1 A;  4CCM A;  2V6C A;  4ZDP A;  1QVT A;  1LQ1 A;  2H09 A;  2LG4 A;  2MC4 A;  3H3Z A;  3FK6 A;  1YQA A;  2XKP A;  4LLL A;  4CA0 A;  4ENK A;  1MJA A;  3IRR A;  5E1Z B;  2P5L C;  2IVM A;  1A6I A;  2E5Z A;  1D3Y A;  4ZDL A;  1DGR M;  4M6Y A;  4B09 A;  2VT2 A;  4BHB A;  4IOC F;  1ON1 A;  4IL6 C;  5BQT A;  3GFL A;  4BY7 J;  3I59 B;  5FB2 A;  4XIC A;  2KKO A;  2FSW A;  2LTP A;  1ZQ3 P;  4W97 A;  2DFE A;  1FEX A;  3VFZ A;  2CS3 A;  2HU9 A;  5EZG A;  3CCJ I;  1I6X A;  3T8T A;  1HKS A;  2LOO A;  3BG3 A;  5J1U A;  3RSN A;  5JVT A;  4M9X A;  5DV5 A;  1X2M A;  3TOA A;  4EM0 B;  1PP8 F;  2X85 A;  3I0T A;  1T8I A;  1T98 A;  4Z6Y A;  3ELK A;  4BAC A;  1YX5 A;  2ID3 A;  3QU6 A;  3V8J A;  2EV5 A;  3EUH A;  5BOX A;  1R9T J;  4ZTJ A;  1O4X A;  2BY1 A;  2E36 A;  1FYL A;  1V3F A;  3HJE A;  4L18 B;  5D5W B;  4G8X A;  3I4P A;  3JRE A;  1K4T A;  4BE0 A;  1ERD A;  1QPI A;  4F92 B;  5FKK A;  2FOW A;  3QPL A;  5CVI A;  3F8F A;  5DD8 A;  3F8B A;  2IPQ X;  4HV5 A;  3CME I;  3TDZ C;  1MBF A;  5E18 F;  3HTS B;  3M3Y J;  3ZRG A;  2DA2 A;  2VKE A;  1GLN A;  2O9L A;  1PVE A;  3K1N A;  4EGZ A;  3WG7 H;  2R7D A;  3HOS A;  2HYJ A;  3BTJ A;  2MLK A;  2GIZ A;  2QCO A;  3FBN B;  4BXU A;  3RI4 A;  1WQ2 A;  1WGX A;  3DBH B;  4A2U A;  2FMY A;  4LFU A;  3RYP A;  1ETW A;  5FLX Z;  3JTG A;  2HOA A;  2FA5 A;  2A6E F;  2GOX B;  4C2U A;  4RLQ A;  4RBO A;  1UHM A;  5D6E A;  3V7C A;  2HR3 A;  4XM3 A;  1W7P B;  3CCU I;  3KIO A;  1EH6 A;  4Y13 A;  1U8R A;  2AO9 A;  2CV0 A;  2DOE A;  2LFB A;  3BZK A;  2RDP A;  1MBH A;  1XTA A;  2IA0 A;  3K4J A;  1TWC J;  3MN2 A;  3MZY A;  1XMK A;  4OAZ A;  4ESJ A;  3ZMU A;  3ZN0 A;  2KQR A;  3MQ0 A;  1SD5 A;  1P4A A;  1X3U A;  4FE7 A;  2IS1 A;  3JRF A;  1MBJ A;  4LG0 A;  1WJF A;  2NS7 A;  4ESB A;  3DLL F;  1ZR2 A;  1KGS A;  2NVY J;  1ZRC A;  3G1O A;  3DKW A;  4EVI A;  4IRI A;  3H9J A;  2QQ8 A;  1J59 A;  1OYW A;  3G1M A;  2MA3 A;  1QNT A;  3BP8 A;  3OIQ A;  1MDM A;  2W24 A;  3HEF A;  3A2K A;  5FRN A;  1LEB A;  1N75 A;  2Z99 A;  1EV7 A;  1KQ0 A;  4QSH A;  3OYH A;  2M2E A;  3PUF A;  2ZKZ A;  5AON A;  2LY2 A;  4P55 A;  4CO8 A;  1LFB A;  1U9N A;  3H0D A;  3IL2 A;  5GAE J;  5JLW A;  4BDZ A;  2G7H A;  1UMQ A;  2GA1 A;  4PFP A;  1ULY A;  1MMS A;  2WAE A;  1TWF J;  3KYL A;  2R7S A;  1FSE A;  4CDG A;  1LDD A;  2JT1 A;  3SEZ A;  1QZE A;  3IKT A;  2HYF A;  2X9D A;  2H27 A;  4UUS A;  3CCE I;  2LKX A;  2F5C A;  3CJN A;  1ZG3 A;  4M71 A;  2ADU A;  4Q5S F;  1V54 H;  3VYT B;  1IXS B;  2NS8 A;  4HPQ A;  4EJW A;  5FKL A;  4M6X A;  1EA3 A;  2CV2 A;  3LOC A;  2UUZ A;  3LSH A;  2CWE A;  2R92 J;  1MND A;  3ZQF A;  1XSD A;  3RPU A;  1O7L A;  3Q0V A;  3LSK A;  2HOE A;  3HZJ A;  1FWZ A;  4IF4 A;  4ZZD A;  3OYE A;  1LUJ B;  2CQN A;  2JUC A;  1GXP A;  4EJV A;  4CUG A;  4UUS B;  1KQ8 A;  3OYJ A;  3WE3 A;  1PDN C;  4M3F A;  4XRM A;  1Z9C A;  3ABK H;  5F04 A;  1QHG A;  1SVM A;  5J3L A;  1ZAO A;  1X4O A;  3HOZ J;  3S2H J;  3M8F A;  1OCZ H;  2MYS A;  3BTC A;  2E1N A;  1ZGA A;  2BV6 A;  1UCR A;  2K27 A;  2E1M B;  4AC0 A;  2EFO A;  3H5N A;  1VQ4 I;  2WAQ N;  2MH2 A;  4HZF A;  4KT5 C;  2LRE A;  4DYC A;  9ANT A;  5JR3 A;  5AIP A;  4XLA A;  1U2W A;  2BVM A;  3DEU A;  2IW5 A;  4I7H A;  5FRO A;  4XOT A;  3O8H A;  4II2 A;  1AKH B;  4F55 A;  3RIR A;  1G6N A;  3BOQ A;  5DM7 F;  4MEY F;  3S14 J;  4QWQ A;  4DOZ A;  5ILU A;  3PL8 A;  1TT5 B;  1G59 A;  2GOM A;  3J80 Z;  2XAQ A;  3SEQ A;  1IJW C;  3MAJ A;  5KAI C;  1OR7 C;  4PGG A;  3JRB A;  3FX3 A;  4XLH A;  5DCM B;  3G2B A;  2OTL I;  2YR2 A;  5LHG A;  1NG6 A;  3R4K A;  2ME0 A;  2Z16 A;  2DTR A;  1A6Q A;  2MBF A;  2B9S A;  1RZ4 A;  2W4S A;  4D7N A;  5DM6 F;  4D9J A;  4DQ2 A;  3K4K A;  2VOO A;  1YJ9 I;  3GX4 X;  2DBB A;  3FIW A;  1N78 A;  4BAY A;  3VSL A;  4WCG A;  1NK3 P;  1NG7 A;  2DYR H;  3L09 A;  3RJP A;  3LSI A;  1LDK B;  1BL0 A;  3N4M A;  3D0S A;  2OQG A;  1A31 A;  4IOA F;  5DCM A;  4IEJ A;  1KU2 A;  2AQE A;  2E71 A;  2DA6 A;  1SFO J;  3ROU A;  2UXX A;  3E0J B;  2RVC A;  1LE8 B;  4YEL A;  3E3V A;  5E17 F;  2P4W A;  2BHZ A;  3VDX A;  1X1B A;  1IGN A;  4B1R A;  1H9G A;  2WBM A;  4A3B J;  1D0X A;  2BXZ A;  1WJ5 A;  5EEA A;  4V19 K;  2LBF B;  3IWZ A;  1CF7 B;  1DUX C;  1WHU A;  3NEU A;  4ENN A;  2YX7 A;  4HEA 2;  3FHN A;  1RI7 A;  1WWX A;  3MZ8 A;  4O6J A;  4BY1 J;  1D1A A;  2L7M P;  2STW A;  5DEQ A;  1XMX A;  1K7A A;  1ENH A;  2VT3 A;  3RPQ A;  2QKM B;  3TW7 A;  1N25 A;  2F4I A;  3EUH C;  4RM2 A;  1BW5 A;  1MMN A;  2LMD A;  3CDL A;  5DDG A;  2V9P A;  4XK4 A;  2ZB9 A;  4BH9 A;  2ZNZ A;  1G3T A;  3CP2 A;  2OF7 A;  4QIW N;  2KIU A;  3BJ6 A;  3S8P A;  1B8I A;  3D5S C;  1HSJ A;  4EQQ A;  4HYE A;  1BR2 A;  4BQQ A;  4NHJ A;  3DBL B;  1DQU A;  2I5U A;  4UB8 C;  1I6H J;  2KRH A;  3JRG A;  3KLO A;  1PUE E;  2Y48 A;  4FTH A;  1HBX G;  4RAG A;  2HNH A;  4IHW A;  5K7Z A;  4MGR A;  3OV8 A;  1FOX A;  3W2W A;  4H0E A;  3GTL J;  1IXC A;  4ZYG A;  4ZC3 A;  4XL9 A;  1ZLK A;  3FIS A;  5ILV A;  3E6D A;  3CCQ I;  4EJU A;  1LFP A;  4HF0 A;  3TGN A;  5GAD J;  3AG1 H;  3K4L A;  5D5X B;  3QQA A;  2BHY A;  3OL3 A;  2DQL A;  2V1D A;  2EV0 A;  2H6C A;  4HF1 A;  3I56 I;  1Z7L A;  4KIT B;  2DLL A;  1JKR C;  3DP7 A;  3DCF A;  4X0G A;  4M3D A;  5FFZ A;  4BL0 B;  4G94 A;  1MNM C;  1SFE A;  2FNA A;  3GLX A;  1ON2 A;  3GTM J;  3IAS 2;  3OYI A;  2NVX J;  1SD4 A;  3HGY A;  2W25 A;  2ZO4 A;  2AS5 F;  1TQM A;  4MTD A;  2IJL A;  3KP2 A;  1WFX A;  2BGC A;  1T39 A;  1PUF B;  4KN4 X;  2OD5 A;  1TNS A;  1X19 A;  2YS9 A;  3ZGK A;  1K6Y A;  2EV6 A;  2BZT A;  2VC0 A;  4MO7 A;  3FDY A;  1VQP I;  4HAM A;  2DK5 A;  3ERE D;  3EYY A;  3JAM K;  3CCY A;  2YX4 A;  3U9G A;  4UVA A;  5EGO A;  2IA2 A;  1ZGW A;  5BPD A;  5KHD A;  1YRN A;  2Y69 H;  2ZXJ A;  4K2E A;  1SAN A;  1ZGJ A;  2JA5 J;  1OYI A;  4BU2 A;  1B6A A;  1J7K A;  3SXY A;  1ZN2 A;  4M74 A;  1Y8Q B;  1IN4 A;  4LK0 F;  4Q4Z F;  2YU3 A;  2NVU B;  3KET A;  4C3J J;  4JYK A;  1ETX A;  2E35 A;  3CMA I;  2DT6 A;  5GAH J;  2O5R A;  1T95 A;  4Q47 A;  3RPU D;  2IXS A;  2DOF A;  1RNL A;  1WH7 A;  2A05 A;  3PQK A;  1F1Z A;  4QTR A;  5LRS A;  1GDT A;  3I64 A;  3F23 A;  2R7X A;  2R4G A;  1R23 A;  3Q0U A;  3B73 A;  2OZ6 A;  3M7G A;  4KN7 X;  2FBK A;  3HSF A;  4RB0 A;  3I54 A;  1SC7 A;  5L3G A;  4H4K C;  3LA2 A;  5EG0 A;  4C30 A;  2WAD A;  3AG2 H;  4XMY A;  5LEK A;  3BLY A;  4A3D J;  2EA4 A;  3Q9S A;  4WXH A;  5ICE A;  4HSR A;  3OS1 A;  1LE8 A;  3F0C A;  3HSR A;  3JAM Z;  3FHZ A;  1QRY A;  2K5C A;  3P7N A;  5D4R A;  3WGG A;  4XR6 A;  4LIU A;  1LDJ A;  4ANJ A;  2TCT A;  2LBF A;  3A1Y A;  1YRN B;  3CJT B;  2E34 A;  3IUO A;  4L9J A;  4ZZL A;  4IKF A;  2FQ4 A;  2IT0 A;  4U7D A;  1MBG A;  2DN0 A;  5IP9 J;  3GZN B;  2ZNY A;  3OYM A;  2JA7 J;  5GAG J;  4FAS D;  3K70 D;  2L4M A;  2Y9Y A;  2GIV A;  5L3E A;  1HDP A;  1P92 A;  3HOW J;  3RYR A;  1YIT I;  4UUV A;  1SFU A;  4UV8 A;  5FLX K;  4D7M A;  4LLN A;  1DDN A;  4A6D A;  3LQR A;  4BHP A;  1R1U A;  2L5Q A;  2DA3 A;  1QU3 A;  1ZRF A;  2ISY A;  3DKX A;  1V5F A;  3VPR A;  2L54 A;  2Q0O A;  4HNV A;  2WAQ A;  1WI9 A;  2R5Y B;  4HW0 A;  4PJN A;  4PJ0 C;  2W48 A;  3ULQ B;  1V4R A;  3F72 A;  5HLH A;  2H1L A;  1IN7 A;  3GCM A;  4XNF A;  1FIP A;  3ZOB A;  2OCE A;  1YI2 I;  2WV1 A;  3KLN A;  2QBY A;  2EQR A;  4A6E A;  2H8W A;  4LOC A;  1R58 A;  3L2V A;  2R7R A;  5ED4 A;  2DMQ A;  2MH9 A;  3BJA A;  2ICW G;  3QWL A;  4NC6 A;  4ZYA A;  3BTI A;  5CVJ A;  4DZJ A;  2PMZ A;  3H9Q A;  2KIM A;  4M6V A;  5TIS C;  2GLO A;  4XRS A;  1X1D A;  1UB9 A;  2VXD A;  2X6O A;  4U88 A;  3C3W A;  4X1E A;  3S32 A;  5GTI C;  4HF2 A;  3OOU A;  4KMU X;  3QPS A;  1LNW A;  5FGM A;  1M1E B;  1R00 A;  1WJD A;  2E19 A;  3OMY A;  4MLO A;  1H88 C;  2HDD A;  3BR3 A;  3CDI A;  1A35 A;  1HKT A;  1B59 A;  4AM3 A;  4UXN A;  2A5W A;  3FM5 A;  2O6G E;  2DPU A;  3JCU C;  4BJ6 C;  3ECO A;  2DDA A;  4M73 A;  3HPG A;  4XKC A;  5DYM A;  1X58 A;  3LSP A;  5IT9 K;  2L2O A;  2ZXH A;  4JOM A;  2FD5 A;  4FHT A;  1D0Z A;  2PEX A;  1YIJ I;  3JW4 A;  1R1V A;  5B1B H;  4OIR F;  2GWR A;  3HRS A;  1EH8 A;  4KIC A;  1DU0 A;  1RIO H;  4KMF A;  1ETK A;  4OIO F;  1IN6 A;  3F3X A;  1B9M A;  2ZJR F;  2XAS A;  2H1K A;  2PX9 A;  4E7S A;  2QEN A;  1JJ8 C;  2RC4 A;  3B6C A;  3ONQ A;  3PJR A;  2JJ7 A;  3GME A;  2CO5 A;  2BXY A;  1MD0 A;  3KEQ A;  2PLY A;  3AFH A;  5B1A H;  1BI0 A;  3S1R J;  1P6R A;  4PJJ A;  3K2A A;  2HXO A;  2HKO A;  1EKE A;  2DA1 A;  1W5C C;  2XAJ A;  4RAY A;  3KZY A;  3BZC A;  2A3S A;  1OCC H;  4IO9 F;  5F27 A;  4I0B A;  3IV5 A;  5EG0 B;  2XSD C;  2UZK A;  3FMR A;  4L9N A;  4BYY A;  3SDB A;  1YW9 A;  3A0H C;  2G7U A;  5J1Y A;  1BA5 A;  2VQC A;  1OKR A;  2HFH A;  1I3A A;  1UJ8 A;  3J81 K;  2WA0 A;  4B43 A;  1IF1 A;  2X0L A;  2CFX A;  2BVL A;  5D6F A;  2X1E A;  2JPC A;  2FEZ A;  3BR5 A;  4M3B A;  3ZQ7 A;  4CYC B;  3ZQC A;  2P5V A;  3CJQ B;  2M3A A;  5E1W A;  4NC8 A;  4IHT A;  3HIF A;  4B3X A;  3HUG B;  2XGD A;  4XKW A;  4IQJ A;  3MMY B;  1I27 A;  5E3M A;  4AWX B;  1JTX A;  3HUG A;  3CCM I;  2Z2S B;  3H36 A;  1BM9 A;  2Q1Z B;  2MG4 A;  4IPA A;  1TP4 A;  1D5V A;  2CUF A;  3ZQL A;  4EM2 A;  4I99 C;  2DA7 A;  2WC2 A;  2HTJ A;  3HOY J;  1XG1 A;  1FJL A;  3DTI A;  3PQJ A;  5J8F A;  2DCE A;  1IC8 A;  1YW8 A;  4HLY A;  3HOX J;  2KDZ A;  4IZZ A;  2EIK H;  3K2Z A;  3Q0W A;  2J5P A;  2V1X A;  3BY6 A;  1Z05 A;  4YG2 F;  1ZH5 A;  4AVZ A;  2Y0S N;  3HC7 A;  1K78 A;  4GGG A;  4BEH A;  1HW5 A;  4YRV A;  2DOA A;  1YE9 A;  3QAH A;  1K78 B;  4JP0 A;  2P6S A;  2ECC A;  5KK1 A;  3E1S A;  3C2H A;  2HVR A;  1HC8 A;  1C0W A;  1MBE A;  3E5X A;  2OZU A;  4A3J J;  5CVU A;  1VTN C;  1XSX A;  3KEY A;  2HDW A;  4RMN A;  4E7K A;  2BW3 A;  2XGE A;  2VBW A;  2K86 A;  3SFZ A;  4Y17 A;  1CF7 A;  2BW3 B;  4UNO A;  1S7O A;  5K7F A;  3CZ6 A;  3JRC A;  1P9Q C;  1ZHF A;  5F0H A;  4J19 A;  1B4A A;  2QYO A;  1S6L A;  3OS0 A;  2OU2 A;  4PJL A;  1T0F A;  5D5V B;  4UY8 I;  2CRG A;  4S04 A;  1TLH B;  4KFC A;  2EZH A;  3ZMZ A;  1X3Z B;  1O57 A;  1T2K A;  4M9S A;  1U0J A;  5J6X A;  5EZH A;  1W5S A;  2K9L A;  2UXN A;  2XAH A;  1Y8R B;  2F2E A;  5GTH C;  3GTP J;  2R93 J;  2FU4 A;  2XGC A;  3GTJ J;  4G7Z F;  3C2G A;  3K4M A;  5A2Q K;  2R7T A;  4MFD A;  2O03 A;  2RQP A;  3FXQ A;  1FTT A;  2LKP A;  4LLG F;  3V4G A;  4OMY A;  1AA7 A;  4XN0 A;  2ZSI B;  1F4K A;  1Z7U A;  2Y75 A;  4F52 A;  3CD6 I;  5EYR A;  2ESN A;  4XQF A;  3WGH A;  3OYG A;  5AIQ A;  1F9N A;  2X4H A;  3J7Z I;  3GUD A;  2DJI A;  4NBQ A;  3ZQG A;  5LLQ A;  2VKH A;  3LL7 A;  4B44 A;  3TDU C;  4HST A;  5IP6 A;  4N4O B;  1QQI A;  1WSU A;  1FBU A;  3W2A A;  4WXD A;  3E5U A;  2KMU A;  3P5J A;  4JX5 A;  3H0G J;  4IXA A;  3M07 A;  5DD4 A;  2K3F A;  4BKX A;  3DXJ F;  3PNY A;  1FC3 A;  1SMY F;  1Z6R A;  2HQA A;  3HOV J;  1R6R A;  1GV2 A;  5F1R A;  1S8N A;  2XPU A;  2ZXW H;  3OY9 A;  1XPX A;  2NRA C;  2EK5 A;  4Y7N J;  2R7U A;  2VBZ A;  4ZYD A;  1ETV A;  2NVT J;  5BMZ A;  4BDY A;  4BBR J;  1IRG A;  2V79 A;  1ZR4 A;  4NNJ A;  2DT5 A;  1G8X A;  3Q9V A;  4GDF A;  1KQ9 A;  5J1R A;  4LG3 A;  3VEP A;  1XGN A;  4PK4 A;  2COM A;  5J4Y A;  3H1C A;  2VJ5 A;  1RR7 A;  2EBI A;  3A01 A;  3H5A A;  1LB2 A;  3CQZ J;  1TZL A;  1XCV A;  5HNF A;  3FMQ A;  3BDD A;  2WWY A;  1T08 B;  3M8J A;  3C1D A;  2CJJ A;  4BJT A;  2CW7 A;  2YPR A;  3P9K A;  4G7O F;  4LB5 A;  2F5V A;  1Z1D A;  2DK8 A;  2Q2E B;  3CF2 A;  3H9G A;  3CTA A;  2EIL H;  2KPM A;  2EZI A;  1IDZ A;  3ABM H;  3FKJ A;  4CH7 A;  1JHH A;  3CUQ B;  3H92 A;  2J5O A;  3K4N A;  5HLT A;  4F91 B;  1BIA A;  1U9O A;  3L2W A;  2ACJ A;  2EFN A;  2EJR A;  3DU5 A;  2LSO A;  3O3K A;  2ESH A;  4NUB A;  4ZYE A;  2EIN H;  1TWG J;  3LA3 A;  4MEX F;  2H8R A;  2RGV A;  5EDN A;  3HKZ N;  3LSM A;  2CW0 F;  2VLA A;  5BPI A;  1YO5 C;  5F1J A;  5TJJ A;  3JSP A;  4OOI A;  2CV1 A;  1Z21 A;  4I02 A;  2V1N A;  1SFK A;  3V8K A;  3WU0 A;  4G12 A;  2L02 A;  2O0Y A;  4XLF A;  2N8G A;  3F9K A;  4AU7 A;  3S2D J;  5E1X A;  1VQ9 I;  4DIQ A;  3FF5 A;  4OWR B;  3TO7 A;  3FK7 A;  5LGN A;  2XVC A;  4C3I J;  3W2V A;  2IS2 A;  1MBK A;  2IBD A;  4F3Q A;  2WB1 A;  1W7P D;  3FZV A;  3KP4 A;  3A4C A;  3SZG A;  2AXL A;  2NNN A;  2IS4 A;  5E79 C;  1G2H A;  2HOT A;  2OCC H;  4XSX F;  1E17 A;  3KZI C;  1FYK A;  2LRD A;  4KIB A;  4WWC A;  1XD7 A;  2KIF A;  1MW7 A;  2GAU A;  1Y39 A;  3LNQ A;  3ZN1 A;  4L9T A;  4L5E A;  3RZO J;  3L2R A;  1O3R A;  2MD5 A;  2WTE A;  2W7N A;  5HDN A;  2Q2E A;  5LRR A;  2E2I J;  2BBY A;  3S1N J;  4LIV A;  2F5F A;  2LKS A;  2VE8 A;  2VL8 A;  3OR1 C;  1MDM B;  2ZCW A;  3B6A A;  4WF2 A;  3RKY A;  3CUQ A;  2XAF A;  1R5G A;  1OR7 A;  2M7A A;  1RR8 C;  2A6H F;  3HXL A;  5E20 A;  2ZME C;  2M8E A;  3F8M A;  3V42 A;  3A03 A;  4MQV A;  4CGZ A;  2M4G A;  4J00 A;  3J7A Y;  3BR6 A;  3LFK A;  3GZ6 A;  4CYC A;  2XPV A;  2VQG A;  3WHC A;  3ZR8 X;  4AUX A;  2JN6 A;  2M1B A;  4RA2 A;  2JUG A;  4Y4R A;  3VYU B;  4PSX A;  1P4X A;  3WTV C;  2DJN A;  1XS9 A;  3OYK A;  2VKD A;  2Z33 A;  4F93 B;  3I3L A;  1GVD A;  1MKM A;  3BG9 A;  5HS7 A;  3DPU A;  3DLA A;  3HL2 A;  3REO A;  2ZJQ F;  2CQQ A;  3NAU A;  4OIP F;  4HDU A;  2QQB A;  1BN5 A;  1U3E M;  4CYD A;  1KU3 A;  4IRH A;  1S7A A;  3R0A A;  3A02 A;  4DBQ A;  4LB6 B;  1Y1V J;  5C4X J;  1R36 A;  3EET A;  3LMM A;  1IG7 A;  3DPL C;  3TED A;  2P0W A;  4QLC U;  3HHH A;  3LAJ A;  4XLP F;  1Y6I A;  3U21 A;  3VB2 A;  2QBY B;  1OCR H;  3HBL A;  3KP7 A;  1SMT A;  4N4N B;  1XDU A;  4YFN F;  5HOO A;  2L3D A;  1BJZ A;  5ERI A;  3MVP A;  3QOP A;  5JLX A;  2IS6 A;  1SD6 A;  2NS0 A;  2WB1 N;  3QOE A;  1RET A;  2X6X A;  2NNY A;  2LYC A;  2LDU A;  6PAX A;  5K5R A;  4IHV A;  4U0Y A;  2VQH A;  3Q3S A;  1LJ9 A;  3R6S A;  1K79 A;  4XBF A;  4YFK F;  5LGU A;  4CXF A;  3F6V A;  4IVN A;  4M72 A;  1Z6T A;  2HKX A;  3J7Y J;  3GBG A;  1R71 A;  4WK8 F;  1YG2 A;  3HSE A;  4L5J A;  4XSZ F;  5M5X J;  3OYF A;  3ZMV A;  1W4M A;  2ELH A;  2L7Z A;  3SJM A;  2VOP A;  2ZFW A;  5JI6 A;  3RKX A;  3TP3 A;  2M0C A;  3BZ6 A;  3FXO A;  3HDD A;  2JK3 A;  4MNU A;  2VB6 A;  2V1U A;  2FE3 A;  1Z3X A;  5H6R A;  5L3C A;  3S17 J;  3CC4 I;  1WRJ A;  3JRH A;  2EPF A;  2M87 A;  3CO6 C;  2FX0 A;  2Y0M A;  1X1C A;  2I10 A;  2XB0 X;  3WTU C;  2HQN A;  1VQO I;  2EIJ H;  2K9S A;  2H94 A;  1TC3 C;  3ZQI A;  1O7F A;  2OBP A;  4XLE A;  2MD0 A;  4Q48 A;  2RN7 A;  4M9Z A;  3TW6 A;  1FLI A;  3CP8 A;  2LY1 A;  1S5L C;  4DYR A;  2GXA A;  3DQV C;  5FD6 A;  5D8K B;  2LK2 A;  3BC8 A;  1R1T A;  3LSJ A;  4CZZ A;  1KYZ A;  2Y2Z A;  3T5X A;  1CGP A;  4M3G A;  1VI0 A;  1R22 A;  4GFB A;  1D8J A;  1LVK A;  1D1B A;  4UVC A;  1OFC X;  2DMP A;  2X1C A;  1HKQ A;  5IYB J;  1P7J A;  3RKQ A;  2VE9 A;  3K69 A;  3G3Z A;  2XAG A;  1IZ1 A;  1AKH A;  3MD2 A;  2RNJ A;  3I58 A;  5J47 A;  2L9R A;  3WOD F;  3WTW C;  4ENJ A;  4C3H J;  2HWV A;  3WTZ A;  1EF4 A;  4LMY A;  4BGD A;  4HRI A;  4A93 J;  2ZJ2 A;  3I71 A;  3DBR B;  2L0K A;  2IP2 A;  1KU7 A;  1NHA A;  4LIT A;  3GTG J;  3HRU A;  4R79 A;  1MMA A;  1OLT A;  3WTY C;  3MKY B;  2MLG A;  4BS9 A;  3NWT A;  4RAZ A;  2E2H J;  3HRM A;  2D5V A;  2KZG A;  3K1P A;  3QPH A;  4XOP A;  3NRV A;  1ZLJ A;  4S0H B;  1UAA A;  1FT9 A;  4BE1 A;  2ELK A;  3LST A;  3O8G A;  4B8X A;  3GVA A;  2X6Y A;  2ETH A;  3IH2 A;  2EFW A;  1TQI A;  2LNB A;  3CCS I;  2IRF G;  2VQL A;  2MAB A;  2X48 A;  2M45 A;  1FP2 A;  1BIB A;  4IRG A;  1TWA J;  2OQR A;  3BG6 A;  4CCO A;  1GUU A;  4EJO A;  1IUF A;  3IHU A;  4ABZ A;  1EJ9 A;  4IHY A;  3ZCO A;  5CKT A;  1BW6 A;  1FP1 D;  1AU7 A;  1XB4 A;  2VJJ A;  3OIP A;  2K4J A;  3UKG A;  3D5L A;  1Q1V A;  3K10 A;  1OPC A;  1RES A;  4LJZ F;  4CZC A;  2PN6 A;  2IGK A;  4ITV A;  3S3M A;  2DTZ A;  2K3P A;  3CCR I;  2M4K A;  3EPZ A;  4MIM A;  2LD5 A;  2NOJ B;  2GBY A;  3DWL E;  1V55 H;  4RGR A;  1WJC A;  1E2X A;  3PSF A;  4LG0 B;  5IOZ A;  4AYB N;  5D8L B;  2YU9 J;  3CC2 I;  2HOS A;  2ID6 A;  3AKZ A;  2UWM A;  2O61 A;  3DPT A;  3NWS A;  5F64 A;  4XRF A;  4D5F A;  1MJB A;  3HRT A;  1WI3 A;  4DW6 A;  1B9N A;  1IRF A;  1QBJ A;  4HG2 A;  2L4A A;  4XOR A;  5HDG A;  2BY3 A;  2EFP A;  5C44 J;  4B3A A;  2CQX A;  4E7I A;  1K4S A;  2EWN A;  3B02 A;  3D1N I;  1OQY A;  3FM3 A;  1OIS A;  4O3M A;  3CLQ A;  4I01 A;  5LEJ A;  2QEX I;  2XC7 A;  1JKO C;  1R4M B;  1NTC A;  4A3I J;  2P7C B;  3SZP A;  5M3F J;  3IH4 A;  1S72 I;  3BR1 A;  1XDS A;  1FMW A;  4A3K J;  1MGT A;  2AQF A;  4NQW B;  2FNP A;  1HF0 A;  1U78 A;  1TW3 A;  2VKV A;  2QUF A;  3M1E A;  4G9Y A;  3TP0 A;  3QRF F;  5FLV A;  5A2Q Z;  4KUM A;  2EZK A;  3G73 A;  3ASN H;  2GQQ A;  2PJP A;  4RAF A;  4BHC A;  2DU9 A;  3S15 J;  2JQ7 A;  2CQK A;  4A0Y A;  3BPX A;  1CQT A;  3KPH A;  2K02 A;  1YS6 A;  5JHF A;  2R5Z A;  1E3P A;  1XCB A;  1YIO A;  1D0Y A;  2QQ9 A;  2RKH A;  1T6S A;  2VJ4 A;  3LA7 A;  2F4M B;  4X6A J;  2DMN A;  2MW8 A;  3T1B A;  2BY2 A;  1TW2 A;  1USS A;  5K5Q A;  1H9T A;  4IHX A;  2IAI A;  1XSV A;  3I55 I;  5FFX A;  2X51 A;  3BT9 A;  5CJ9 A;  3JRI A;  1WJA A;  3I59 A;  3BG5 A;  2XF5 A;  4DBR A;  5JVG F;  3KZZ A;  4RB1 A;  2RAE A;  5D5U B;  2JPB A;  2LC2 A;  5E8G A;  1G3W A;  3S1M J;  4EGY A;  1WCM J;  4C2T A;  1QO0 D;  3V7S A;  5B3S H;  3MFK A;  1WVR A;  3KP3 A;  1R5I D;  3LWF A;  1JE8 A;  2L9V A;  2ME6 A;  1KYW A;  3SFI A;  1FBQ A;  4E4H A;  2W57 A;  3IP4 B;  2CGP A;  2RRE A;  4P9F A;  2LLK A;  2EA2 A;  4HNT A;  2DMT A;  1R4N B;  2XIG A;  3VOE A;  2JMW A;  3GFM A;  3MEX A;  3OYA A;  1DPU A;  5B5E C;  1ORK A;  4JBA A;  4A0X A;  3G6E I;  4A12 A;  3GTK J;  1JXS A;  3ZMS A;  2DT7 B;  1ZTR A;  1ODD A;  3PSI A;  3SHF A;  2FRH A;  3RQI A;  4ZJZ A;  1RPW A;  1D8K A;  2E1O A;  4I6Z A;  5KNL A;  4QPO A;  5FKM A;  1TTY A;  2OV7 A;  4BUP A;  1VQ7 I;  2KHM A;  3I4N J;  1X1P A;  1Z91 A;  5FKN A;  2P8T A;  3E6C C;  1K61 A;  4P9U A;  2KIS A;  3OYN A;  1APL C;  4I2O A;  3HKZ A;  1STZ A;  1IXR C;  1JKQ C;  5FLM J;  4HLX A;  1ONV A;  2JRT A;  4UV9 A;  2L9S A;  4JX4 A;  2DQR A;  1X1A A;  3HM5 A;  4U0V A;  2R7Q A;  1E3H A;  3DTE A;  5GPA A;  5EEG A;  4LD5 A;  2MFZ A;  4MHG A;  2M9H A;  1VQ5 I;  2M34 A;  4FET A;  4E7Z A;  2R5Y A;  4V2F A;  3QYB A;  4LK1 F;  4HOB A;  2F5E A;  3DU6 A;  1W0U A;  1A36 A;  3AAF A;  5F6F A;  2XF6 A;  1GT0 C;  1XC5 A;  2XUB A;  1P7I A;  1I50 J;  5FD5 A;  5HDK A;  3BWG A;  4AD9 A;  2XRN A;  4RLF A;  3L2U A;  3K9T A;  1RRJ A;  3SZT A;  2F6C A;  4RS8 A;  3V7R A;  4YFX F;  1J2X A;  3VOD A;  4A5N A;  5IOY A;  1Y1W J;  3CMM A;  1T38 A;  1PUF A;  1T56 A;  2FOK A;  3BQZ A;  3K6G A;  4L0Z B;  2ZSH B;  2R7O A;  3TKY A;  4KJZ A;  4Y15 A;  2KRC A;  3CC7 I;  2Y30 A;  5K5O A;  1TT0 A;  1Y0N A;  2W1O A;  3D5R C;  3PFI A;  3JRA A;  3X2Q H;  5M3M J;  1YJN I;  3M4O J;  1BBY A;  4CHU A;  3UNG C;  2GM4 A;  4EJT A;  5ICC A;  2LH9 A;  3TO6 A;  1RKW A;  5LBQ A;  3W6K B;  1IN8 A;  2DFF A;  3WU2 C;  5KVR A;  5GPC A;  4KYW A;  4OIQ F;  3AL0 C;  1V5E A;  2KZV A;  3G4S I;  3CMY A;  4IX7 A;  1VQ8 I;  3H5R A;  1JGG A;  2D45 A;  2QSH X;  5C3E J;  2VBY A;  3TOB A;  1BI1 A;  1ZYR F;  5E3L A;  2R7Z J;  1MH4 A;  3L9F A;  1T0F C;  2K7L A;  2VC1 A;  2FQ3 A;  3F8N A;  1GXQ A;  2XGX A;  3S3N A;  1YS7 A;  2VN2 A;  2DPD A;  2QLZ A;  1BJA A;  3K7A J;  2FXA A;  1FZP B;  1W7P A;  2GZW A;  1JKP C;  2XPW A;  1BI3 A;  2D1H A;  4U87 A;  3CCL I;  3RZD J;  1SEU A;  3FXU A;  3EUA A;  1T33 A;  2FJ1 A;  3IAM 2;  2NAZ A;  1XGS A;  3IC7 A;  5H6Q A;  3SDG A;  2Y0S A;  2KP6 A;  2F5D A;  3S2W A;  3VYR B;  4P96 A;  1Z3Y A;  4HQE A;  5TRD A;  1BC8 C;  1QZY A;  1J75 A;  1ZRD A;  1R5H A;  2HTS A;  3W6V A;  1IAW A;  1BOA A;  2W82 A;  3HPH A;  4P5O A;  1K83 J;  1J9I A;  2QF7 A;  4HA8 A;  3GO5 A;  1KZH A;  1JUM A;  1BR1 A;  1XGO A;  5D4S A;  2WAF A;  2Z9O A;  5HLI A;  2OPT A;  3E6B A;  1YX3 A;  3BJO A;  4HNU A;  2K40 A;  4XID A;  2A5Y B;  3KYD B;  3MKZ A;  1G4D A;  3A0B C;  1I1S A;  1B8I B;  1OCT C;  1S7E A;  3KYC B;  4E7J A;  3GF2 A;  4FT8 A;  1Z77 A;  3GZ5 A;  2M0M A;  4ENM A;  1BC7 C;  2ZME A;  1JUP A;  4N9I A;  1W1W E;  1UST A;  3OYB A;  2OC6 A;  3I4M J;  4BQO A;  1FNN A;  2TDX A;  4L0Y B;  1ZK8 A;  3MWM A;  3OSF A;  1ETQ A;  2Y9Z A;  1YLF A;  1YYV A;  3K4C A;  1GHC A;  1FOY A;  4DZP A;  4NDL A;  2VAS A;  3GWZ A;  4F7Z A;  1JTY A;  3DKY A;  3IH3 A;  4GXO A;  4EEF G;  1JJ6 C;  3FBI B;  5F0C A;  1F43 A;  5DS9 A;  3WGI A;  5H20 A;  2VBX A;  4ZDO A;  4DGW B;  1WZ2 A;  3ISP A;  4KDP A;  3GTO J;  4E6K G;  4ZH4 F;  1REP C;  1UEL B;  5EGO B;  1RC9 A;  2HS5 A;  2Z5U A;  2ECB A;  3IWF A;  3P9I A;  2QSG X;  4ZYH A;  2OAZ A;  2BEO A;  1VF9 A;  3K4B A;  1ETY A;  2CUZ A;  3ASO H;  4QPQ A;  1FPQ A;  3BG7 A; 
#chains in the Genus database with same CATH homology
 4XLN F;  3ZMD A;  2H6B A;  3F22 A;  4AIJ A;  3C7J A;  1DPR A;  4N0B A;  4RB3 C;  1UHW A;  5IT3 A;  1P2F A;  3MZH A;  3QP5 A;  3F8C A;  3ABU A;  4I09 A;  3J80 K;  1YTY A;  1LVA A;  1PP7 U;  4FX4 A;  1B1B A;  2LF7 A;  2GXG A;  1W5T A;  2P6T A;  4AIH A;  2G9W A;  1FY7 A;  4LGW A;  3ZPL A;  4TV7 A;  5K1Y A;  1SFX A;  2EB7 A;  4AIK A;  5DUK A;  5JHU A;  1RUN A;  4UHT A;  5FO5 A;  2E7X A;  2JSC A;  4KIF A;  3J81 Z;  4A0Z A;  4ETS A;  3KP6 A;  4BQA A;  3GEZ A;  2CSO A;  5ICG A;  3CUQ C;  4UVB A;  3HOT A;  2HQR A;  2A07 F;  2FBI A;  3EDP A;  5JFR A;  2E7W A;  4HX4 A;  2DAO A;  3HTU A;  3R60 A;  2P5K A;  2GA2 A;  3COA C;  3GXO A;  2ZBK A;  3U2R A;  1O3S A;  3FWE A;  3I5U A;  4D0P A;  4MQ9 F;  3I53 A;  2E1C A;  3DFG A;  1YW7 A;  4NQW A;  2Z3Y A;  3FMS A;  3WTS C;  2R3S A;  3GFI A;  1ZG5 A;  1KU9 A;  3TO9 A;  5L3D A;  3CO7 C;  5CVV A;  4GYG A;  1HW2 A;  1IW7 F;  2CG4 A;  4FX0 A;  3R0J A;  4I0A A;  3LQQ A;  1TBX A;  3RKW A;  4N9H A;  4G6Q A;  2K4B A;  3JSO A;  1U5T C;  1FX7 A;  2D2W A;  1Q1H A;  4JQF A;  3LAP A;  2YSR A;  1TNT A;  2VOD A;  4KNY A;  3E97 A;  4CIC A;  2KRF A;  4ASN A;  2KJB A;  4EM1 A;  3WTT C;  3J7A O;  4GCV A;  3DF8 A;  2DFI A;  3MCZ A;  1I1G A;  4HX7 A;  3RTR A;  1G3S A;  3DV8 A;  1QPM A;  4A5M A;  2HYG D;  2QQA A;  1RUO A;  1QGP A;  3QU3 A;  1HXD A;  3O6B B;  3BRO A;  4KIG A;  2ISZ A;  2NYX A;  5ICF A;  2B0L A;  4OU0 A;  1ZAR A;  4YIF A;  3K0L A;  2XKO A;  4AVP A;  2XRO A;  3O2P E;  3GW2 A;  2PMH A;  1IUY A;  4I98 B;  2DI3 A;  2XHK A;  1MJ9 A;  2PBI A;  1MZB A;  3F21 A;  5LHI A;  2DW4 A;  3M9A A;  1XN7 A;  1HQC A;  3FXR A;  2HDC A;  3CDH A;  4KA4 A;  2WV0 A;  1IN5 A;  2BE5 F;  2W85 A;  1XGM A;  2XV4 S;  3JTH A;  2RV8 A;  3L2C A;  1P4W A;  3HHG A;  2C6Y A;  3NQO A;  3RDI A;  1TQP A;  1H0M A;  4DNC A;  5ILS A;  1YFH A;  1K6O A;  2PG4 A;  5J8C A;  3ABT A;  5HS8 A;  2QM3 A;  4ON0 A;  4JK1 X;  5HLG A;  1AWC A;  4HQM A;  4IJA A;  1L3L A;  2QWW A;  3Q5F A;  1A04 A;  3ZP5 A;  4YII A;  4Z2Y A;  2HGC A;  3KFW X;  3IKV A;  3KP5 A;  4WXC A;  4U7B A;  2DO7 A;  3IRQ A;  4GYI A;  5L3B A;  3WTX C;  3WE2 A;  2O8X A;  1U6G A;  2JZY A;  2PI0 A;  1HW1 A;  3K1M A;  3QP6 A;  1I5Z A;  5DCF A;  4ESF A;  2EFQ A;  2L01 A;  3EQL F;  2KJC A;  3KCC A;  4RGS A;  5BS6 A;  4PGH A;  3P9C A;  4RGX A;  1J5Y A;  2PQ8 A;  1AOY A;  4R8H A;  4MTE A;  1KA8 A;  2VXZ A;  3QPT A;  2M30 A;  5HS9 A;  3V8L A;  1FBS A;  2PFB A;  1G3Y A;  3R61 A;  4RGU A;  4EMS A;  1F5T A;  3KE2 A;  2QZ8 A;  3SQN A;  2Q8K A;  4WX9 A;  3L00 A;  2A68 F;  1SAX A;  2MC3 A;  5EEH A;  2VON A;  3L7W A;  1XMA A;  1UFM A;  4HBL A;  4PCQ A;  1FYM A;  1EH7 A;  1O3T A;  1S3J A;  3U1D A;  3HYI A;  3E5Q A;  2QVO A;  3GFJ A;  4BNC A;  3GYH X;  1S29 A;  2P7V B;  2HEO A;  1Y0U A;  2FBH A;  4OMZ A;  1FOK A;  3T0Y A;  3BPV A;  4HX8 A;  2JTV A;  4L9V A;  5CLS A;  1L0O C;  4GO1 A;  1U5T A;  3CLO A;  5L3F A;  3H3U A;  2IA1 A;  4E70 A;  4O5V A;  4PZJ A;  2M5W A;  3CUO A;  5LHH A;  5LGT A;  3ZMT A;  2HZT A;  3M8E A;  1O3Q A;  3ML6 A;  5CYV A;  2GXB A;  2A69 F;  2D1V A;  3C18 A;  2FF4 A;  1JGS A;  4S05 A;  2STT A;  1BI2 A;  1SD7 A;  2A61 A;  1R7J A;  2FML A;  1JHF A;  4G6D A;  1GVJ A;  4HDV A;  3OOP A;  5IT9 Z;  3ECH A;  1LEA A;  3N97 A;  1FSH A;  1U5T B;  2R7F A;  1HST A;  1QZZ A;  3T8R A;  4HV6 A;  5CVR A;  5HVQ C;  4IHS A;  2PMU A;  4PDK A;  1ZRE A;  3TQN A;  5DUI A;  2CYY A;  1OYY A;  1J0R A;  2BYV E;  2OA4 A;  1OMI A;  2W84 A;  4R1H A;  3EYI A;  4G7H F;  4NB5 A;  4EV0 A;  2V9V A;  3F6O A;  1WKM A;  3E6M A;  4OIN F;  4RB2 C;  4U0W A;  2LF8 A;  5E8I A;  2ZME B;  3W6J B;  2O3F A;  4L5I A;  3KEO A;  3WU1 B;  3WG9 A;  1DP7 P;  1ZG1 A;  2V6C A;  1LQ1 A;  2H09 A;  3H3Z A;  4LLL A;  1YQA A;  2XKP A;  4ENK A;  1MJA A;  3IRR A;  5E1Z B;  2P5L C;  2IVM A;  1D3Y A;  4M6Y A;  4B09 A;  2VT2 A;  4BHB A;  1ON1 A;  5BQT A;  5FB2 A;  3GFL A;  3I59 B;  2KKO A;  2FSW A;  3VFZ A;  1I6X A;  3T8T A;  1HKS A;  5JVT A;  4M9X A;  5DV5 A;  3TOA A;  4EM0 B;  1PP8 F;  3I0T A;  1T98 A;  3ELK A;  3QU6 A;  3V8J A;  2EV5 A;  3EUH A;  5BOX A;  1FYL A;  1V3F A;  4L18 B;  5D5W B;  4G8X A;  3I4P A;  5CVI A;  3F8F A;  5DD8 A;  3F8B A;  2IPQ X;  4HV5 A;  3HTS B;  3TDZ C;  5E18 F;  3K1N A;  4EGZ A;  2R7D A;  3HOS A;  2MLK A;  4BXU A;  3RI4 A;  1WQ2 A;  4A2U A;  2FMY A;  4LFU A;  3RYP A;  5FLX Z;  3JTG A;  2FA5 A;  2A6E F;  1UHM A;  5D6E A;  3V7C A;  2HR3 A;  1W7P B;  1EH6 A;  4Y13 A;  1U8R A;  2RDP A;  2IA0 A;  3MZY A;  1XMK A;  4ESJ A;  3ZMU A;  3ZN0 A;  3MQ0 A;  1SD5 A;  1P4A A;  1X3U A;  4LG0 A;  4ESB A;  1KGS A;  1ZRC A;  3DKW A;  4EVI A;  4IRI A;  1J59 A;  1OYW A;  2MA3 A;  1QNT A;  3BP8 A;  1MDM A;  2W24 A;  1LEB A;  2Z99 A;  1EV7 A;  1KQ0 A;  2ZKZ A;  5AON A;  4P55 A;  4CO8 A;  3IL2 A;  2G7H A;  2GA1 A;  1ULY A;  1FSE A;  4CDG A;  1LDD A;  2JT1 A;  3IKT A;  2HYF A;  2H27 A;  2F5C A;  3CJN A;  1ZG3 A;  4M71 A;  2ADU A;  4Q5S F;  1IXS B;  4EJW A;  4M6X A;  2CWE A;  1XSD A;  3RPU A;  1O7L A;  2HOE A;  4ZZD A;  1FWZ A;  4IF4 A;  1GXP A;  4EJV A;  1KQ8 A;  3WE3 A;  1PDN C;  1Z9C A;  1ZAO A;  3M8F A;  2E1N A;  1ZGA A;  2BV6 A;  1UCR A;  2K27 A;  2EFO A;  2MH2 A;  4HZF A;  4KT5 C;  5JR3 A;  5AIP A;  1U2W A;  3DEU A;  2IW5 A;  4I7H A;  3RIR A;  1G6N A;  3BOQ A;  4MEY F;  4QWQ A;  5ILU A;  3J80 Z;  2XAQ A;  3MAJ A;  4PGG A;  3FX3 A;  5DCM B;  2YR2 A;  5LHG A;  3R4K A;  2DTR A;  2MBF A;  1RZ4 A;  4DQ2 A;  2VOO A;  3GX4 X;  2DBB A;  4BAY A;  4WCG A;  3L09 A;  3RJP A;  1LDK B;  3N4M A;  3D0S A;  2OQG A;  5DCM A;  1KU2 A;  3ROU A;  2UXX A;  2RVC A;  3E3V A;  5E17 F;  2P4W A;  1H9G A;  3IWZ A;  1CF7 B;  1DUX C;  4ENN A;  3NEU A;  2YX7 A;  1RI7 A;  1WWX A;  4O6J A;  2STW A;  5DEQ A;  1K7A A;  2VT3 A;  3RPQ A;  5DDG A;  4BH9 A;  2ZNZ A;  1G3T A;  2KIU A;  3BJ6 A;  1HSJ A;  4EQQ A;  4HYE A;  4NHJ A;  3KLO A;  1PUE E;  2Y48 A;  1HBX G;  4MGR A;  3OV8 A;  4H0E A;  1IXC A;  4ZYG A;  1ZLK A;  5ILV A;  3E6D A;  4EJU A;  3TGN A;  4HF0 A;  5D5X B;  2DQL A;  2V1D A;  2EV0 A;  2H6C A;  4HF1 A;  2DLL A;  3DP7 A;  5FFZ A;  4G94 A;  1SFE A;  2FNA A;  3GLX A;  1ON2 A;  1SD4 A;  2W25 A;  2ZO4 A;  2AS5 F;  1TQM A;  4MTD A;  2IJL A;  3KP2 A;  2BGC A;  1T39 A;  4KN4 X;  2OD5 A;  1TNS A;  2EV6 A;  2VC0 A;  4HAM A;  2DK5 A;  3ERE D;  3EYY A;  3JAM K;  2YX4 A;  3U9G A;  4UVA A;  2IA2 A;  5BPD A;  2ZXJ A;  4K2E A;  1ZGJ A;  1OYI A;  1B6A A;  1J7K A;  3SXY A;  1ZN2 A;  4M74 A;  1IN4 A;  4LK0 F;  4Q4Z F;  2YU3 A;  3KET A;  4Q47 A;  1RNL A;  3PQK A;  1F1Z A;  5LRS A;  3I64 A;  3F23 A;  1R23 A;  3B73 A;  2OZ6 A;  3M7G A;  4KN7 X;  2FBK A;  3HSF A;  4RB0 A;  3I54 A;  5L3G A;  3LA2 A;  5LEK A;  2EA4 A;  3Q9S A;  4WXH A;  5ICE A;  3HSR A;  3JAM Z;  3FHZ A;  3P7N A;  5D4R A;  3WGG A;  1LDJ A;  4L9J A;  4ZZL A;  2IT0 A;  4U7D A;  2ZNY A;  2L4M A;  2GIV A;  5L3E A;  1P92 A;  3RYR A;  4UUV A;  1SFU A;  4UV8 A;  5FLX K;  4LLN A;  1DDN A;  4A6D A;  3LQR A;  4BHP A;  1R1U A;  1ZRF A;  2ISY A;  2L54 A;  2Q0O A;  1WI9 A;  4HW0 A;  3ULQ B;  1V4R A;  3F72 A;  5HLH A;  1IN7 A;  3KLN A;  2QBY A;  4A6E A;  1R58 A;  5ED4 A;  2MH9 A;  3BJA A;  5CVJ A;  2KIM A;  1UB9 A;  4U88 A;  3C3W A;  4HF2 A;  4KMU X;  1LNW A;  5FGM A;  1R00 A;  1HKT A;  1B59 A;  4UXN A;  3FM5 A;  2O6G E;  2DPU A;  3ECO A;  4M73 A;  5DYM A;  5IT9 K;  4FHT A;  2PEX A;  3JW4 A;  1R1V A;  4OIR F;  2GWR A;  3HRS A;  1EH8 A;  4KIC A;  1RIO H;  4KMF A;  4OIO F;  1IN6 A;  3F3X A;  1B9M A;  2XAS A;  2QEN A;  2RC4 A;  2CO5 A;  1MD0 A;  3KEQ A;  1BI0 A;  1P6R A;  2HKO A;  2XAJ A;  4RAY A;  3KZY A;  2A3S A;  4I0B A;  2UZK A;  3FMR A;  4L9N A;  4BYY A;  1YW9 A;  2G7U A;  1OKR A;  2HFH A;  3J81 K;  1IF1 A;  2X0L A;  2CFX A;  5D6F A;  2JPC A;  2FEZ A;  3ZQ7 A;  2P5V A;  5E1W A;  4IHT A;  3HIF A;  1I27 A;  4AWX B;  3HUG A;  1BM9 A;  4IPA A;  1D5V A;  4EM2 A;  2WC2 A;  2HTJ A;  3PQJ A;  5J8F A;  1YW8 A;  4HLY A;  3K2Z A;  2J5P A;  2V1X A;  3BY6 A;  1Z05 A;  4YG2 F;  1ZH5 A;  1K78 A;  4GGG A;  1HW5 A;  3QAH A;  1K78 B;  2P6S A;  5KK1 A;  1C0W A;  3E5X A;  2OZU A;  5CVU A;  1VTN C;  1XSX A;  2VBW A;  2K86 A;  3SFZ A;  4Y17 A;  1CF7 A;  4UNO A;  1S7O A;  1ZHF A;  1B4A A;  2QYO A;  1S6L A;  2OU2 A;  1T0F A;  5D5V B;  4S04 A;  1TLH B;  4KFC A;  3ZMZ A;  1O57 A;  1T2K A;  4M9S A;  5J6X A;  1W5S A;  2UXN A;  2XAH A;  2F2E A;  2FU4 A;  4G7Z F;  5A2Q K;  2O03 A;  2RQP A;  3FXQ A;  2LKP A;  4LLG F;  3V4G A;  4OMY A;  1F4K A;  1Z7U A;  2Y75 A;  2ESN A;  3WGH A;  5AIQ A;  1F9N A;  2X4H A;  3GUD A;  5LLQ A;  3TDU C;  1QQI A;  1WSU A;  1FBU A;  4WXD A;  3E5U A;  5DD4 A;  4IXA A;  3DXJ F;  1FC3 A;  1SMY F;  1Z6R A;  5F1R A;  1S8N A;  2NRA C;  2EK5 A;  2VBZ A;  4ZYD A;  5BMZ A;  1IRG A;  2V79 A;  2DT5 A;  3Q9V A;  1KQ9 A;  3VEP A;  1XGN A;  2COM A;  1LB2 A;  1XCV A;  3FMQ A;  3BDD A;  2WWY A;  3C1D A;  3P9K A;  2YPR A;  4G7O F;  4LB5 A;  1Z1D A;  2DK8 A;  3CTA A;  1JHH A;  3CUQ B;  3H92 A;  2J5O A;  1BIA A;  2ACJ A;  2EFN A;  2EJR A;  2LSO A;  3O3K A;  2ESH A;  4ZYE A;  4MEX F;  3LA3 A;  2RGV A;  2CW0 F;  5BPI A;  1YO5 C;  5TJJ A;  3JSP A;  4OOI A;  4I02 A;  3V8K A;  3WU0 A;  2L02 A;  2O0Y A;  5E1X A;  3FF5 A;  3TO7 A;  5LGN A;  2XVC A;  1W7P D;  3FZV A;  3KP4 A;  2AXL A;  2NNN A;  4XSX F;  1E17 A;  1FYK A;  4KIB A;  4WWC A;  1XD7 A;  2KIF A;  2GAU A;  3ZN1 A;  4L9T A;  1O3R A;  2MD5 A;  2WTE A;  5HDN A;  2Q2E A;  5LRR A;  2BBY A;  2F5F A;  2VE8 A;  1MDM B;  2ZCW A;  4WF2 A;  3RKY A;  2XAF A;  3CUQ A;  1R5G A;  1OR7 A;  2A6H F;  5E20 A;  3F8M A;  2M8E A;  4MQV A;  4CGZ A;  3LFK A;  3GZ6 A;  2M1B A;  3WTV C;  1P4X A;  2Z33 A;  1MKM A;  5HS7 A;  3REO A;  4OIP F;  4HDU A;  2QQB A;  1BN5 A;  1U3E M;  4CYD A;  1KU3 A;  4IRH A;  1S7A A;  3R0A A;  4LB6 B;  1R36 A;  3EET A;  3DPL C;  4QLC U;  3HHH A;  3LAJ A;  4XLP F;  2QBY B;  3VB2 A;  3KP7 A;  1SMT A;  1XDU A;  4YFN F;  5HOO A;  2L3D A;  5ERI A;  3QOP A;  1SD6 A;  2NS0 A;  2NNY A;  2LDU A;  6PAX A;  5K5R A;  4U0Y A;  1LJ9 A;  3R6S A;  1K79 A;  4XBF A;  4YFK F;  5LGU A;  4CXF A;  3F6V A;  4IVN A;  4M72 A;  1Z6T A;  2HKX A;  4WK8 F;  1YG2 A;  3HSE A;  4L5J A;  4XSZ F;  3ZMV A;  1W4M A;  2ELH A;  2VOP A;  2ZFW A;  5JI6 A;  3RKX A;  3BZ6 A;  4MNU A;  2V1U A;  2FE3 A;  5H6R A;  5L3C A;  1WRJ A;  2M87 A;  3CO6 C;  2Y0M A;  3WTU C;  2HQN A;  2H94 A;  1O7F A;  2OBP A;  4Q48 A;  2RN7 A;  4M9Z A;  1FLI A;  3DQV C;  5FD6 A;  5D8K B;  1R1T A;  4CZZ A;  1KYZ A;  3T5X A;  1CGP A;  1R22 A;  1D8J A;  4UVC A;  1HKQ A;  2VE9 A;  3K69 A;  3G3Z A;  2XAG A;  1IZ1 A;  2RNJ A;  3I58 A;  3WOD F;  3WTW C;  4ENJ A;  2HWV A;  3WTZ A;  4LMY A;  2ZJ2 A;  3I71 A;  1KU7 A;  2IP2 A;  1NHA A;  3HRU A;  4R79 A;  3WTY C;  2MLG A;  4RAZ A;  3HRM A;  3K1P A;  3QPH A;  3NRV A;  1ZLJ A;  1FT9 A;  3LST A;  4B8X A;  3GVA A;  2ETH A;  2EFW A;  1TQI A;  2LNB A;  2IRF G;  2M45 A;  1FP2 A;  1BIB A;  4IRG A;  2OQR A;  4EJO A;  3IHU A;  1FP1 D;  1XB4 A;  2K4J A;  3D5L A;  1OPC A;  4LJZ F;  2PN6 A;  4RGR A;  1E2X A;  4LG0 B;  5D8L B;  2UWM A;  2O61 A;  3DPT A;  5F64 A;  4XRF A;  1MJB A;  3HRT A;  1B9N A;  1IRF A;  1QBJ A;  2L4A A;  5HDG A;  2EFP A;  2EWN A;  3B02 A;  3FM3 A;  4O3M A;  4I01 A;  5LEJ A;  2P7C B;  3SZP A;  1XDS A;  1MGT A;  2FNP A;  1U78 A;  1TW3 A;  3M1E A;  2QUF A;  3QRF F;  4G9Y A;  5A2Q Z;  4KUM A;  3G73 A;  2GQQ A;  2PJP A;  4BHC A;  2DU9 A;  2CQK A;  4A0Y A;  3BPX A;  2K02 A;  1YS6 A;  1XCB A;  1YIO A;  2RKH A;  2QQ9 A;  3LA7 A;  1T6S A;  3T1B A;  1TW2 A;  1USS A;  5K5Q A;  1H9T A;  1XSV A;  5FFX A;  5CJ9 A;  3I59 A;  4RB1 A;  3KZZ A;  5D5U B;  2JPB A;  5E8G A;  1G3W A;  4EGY A;  1QO0 D;  3V7S A;  3MFK A;  3KP3 A;  3LWF A;  1JE8 A;  1KYW A;  1FBQ A;  2W57 A;  2CGP A;  4P9F A;  2EA2 A;  2XIG A;  3VOE A;  3GFM A;  3MEX A;  1DPU A;  4JBA A;  4A0X A;  4A12 A;  1JXS A;  3ZMS A;  1ODD A;  3SHF A;  2FRH A;  1D8K A;  1TTY A;  1Z91 A;  2P8T A;  3E6C C;  4P9U A;  4I2O A;  1STZ A;  1IXR C;  4HLX A;  1ONV A;  2JRT A;  4UV9 A;  2DQR A;  4U0V A;  5EEG A;  4LD5 A;  4MHG A;  4LK1 F;  4HOB A;  2F5E A;  3AAF A;  5F6F A;  2XUB A;  5FD5 A;  5HDK A;  3BWG A;  4AD9 A;  2XRN A;  3K9T A;  3SZT A;  4RS8 A;  3V7R A;  4YFX F;  1J2X A;  3VOD A;  4A5N A;  1T38 A;  4L0Z B;  2FOK A;  3TKY A;  4Y15 A;  5K5O A;  3PFI A;  1BBY A;  4CHU A;  4EJT A;  5ICC A;  3TO6 A;  5LBQ A;  3W6K B;  1IN8 A;  4KYW A;  4OIQ F;  5KVR A;  2D45 A;  2VBY A;  3TOB A;  1BI1 A;  1ZYR F;  3L9F A;  2K7L A;  2VC1 A;  2FQ3 A;  3F8N A;  1GXQ A;  2XGX A;  2DPD A;  1YS7 A;  2VN2 A;  2QLZ A;  1BJA A;  1FZP B;  2FXA A;  1W7P A;  2GZW A;  1BI3 A;  2D1H A;  3FXU A;  3IC7 A;  2NAZ A;  1XGS A;  5H6Q A;  4HQE A;  2PLY A;  3S2W A;  2F5D A;  5TRD A;  4P96 A;  1BC8 C;  1ZRD A;  1QZY A;  1J75 A;  1R5H A;  2HTS A;  1IAW A;  1BOA A;  4P5O A;  1J9I A;  4HA8 A;  3GO5 A;  1XGO A;  5D4S A;  2Z9O A;  5HLI A;  3E6B A;  3BJO A;  2A5Y B;  1G4D A;  1I1S A;  3GF2 A;  4FT8 A;  3GZ5 A;  4ENM A;  1BC7 C;  2ZME A;  4N9I A;  1UST A;  1FNN A;  2TDX A;  4L0Y B;  3MWM A;  1YLF A;  1YYV A;  1GHC A;  3GWZ A;  4F7Z A;  4GXO A;  3WGI A;  5H20 A;  2VBX A;  3ISP A;  4KDP A;  4ZH4 F;  1REP C;  2HS5 A;  2Z5U A;  3IWF A;  3P9I A;  4ZYH A;  2OAZ A;  2BEO A;  1FPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...