5DD8A

The crystal structure of hucr mutant (hucr-e48q) from deinococcus radiodurans
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
156
Chain Sequence
b'DTAALLERIRSDWARLNHGPSAGPMLTLLLLQRLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Histidine switch controlling pH-dependent protein folding and DNA binding in a transcription factor at the core of synthetic network devices.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription regulator
total genus 53
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd8A00
2TDXA 5AIQA 1GVJA 4IHSA 4S05A 3TDZC 1ZG1A 5DUKA 5LGUA 2EB7A 4NB5A 3NQOA 2XAQA 1KU2A 2F5CA 1YYVA 1KGSA 3GFLA 3GX4X 2H09A 4H0EA 4RB2C 5L3CA 2DFIA 5CVJA 4HV6A 1O3RA 4EJUA 1LB2A 4BAYA 1G3WA 1D5VA 4PGGA 4MQ9F 3C18A 3CLOA 4L9NA 3T0YA 1QPMA 1HW5A 5DUIA 2ZFWA 1ON1A 4CICA 3R0JA 1S6LA 4G7HF 2HTJA 3S2WA 1PP7U 2H94A 1P4AA 4UHTA 5BPIA 3HRSA 3CTAA 1LNWA 1IUYA 5LEKA 3EYIA 4UVBA 5H6RA 4HZFA 3IWFA 4DNCA 4BHCA 2LF7A 4G94A 2E7WA 3DP7A 2RGVA 1XSDA 4P5OA 4OIPF 1E2XA 3GVAA 1KQ0A 1YLFA 3C1DA 1LEAA 3L2CA 4RAZA 3E5QA 1T6SA 2ESNA 3BJOA 2ETHA 3D0SA 1DP7P 5FD5A 1IN6A 2EFOA 3JAMZ 4EM0B 3LQRA 2NS0A 3MCZA 2P7CB 3GXOA 2STWA 3KP4A 4LK0F 3MEXA 4HA8A 3WTTC 3ZMTA 1BN5A 4CZZA 5JFRA 2HYFA 1ZHFA 1IF1A 4O6JA 4F7ZA 4IPAA 4NQWA 2DTRA 3FXRA 4HX7A 3GFIA 2YX4A 1LQ1A 1SD5A 3P7NA 2EK5A 5HS8A 2L02A 4M6YA 1FLIA 2JSCA 1YFHA 1AOYA 4MGRA 1Z6TA 4MTEA 3KFWX 4RB1A 2Y75A 4P96A 3GLXA 2VC1A 2XROA 2XUBA 2NAZA 1WQ2A 3Q9SA 5LGTA 1O7FA 3KETA 4MNUA 3R60A 4BNCA 2STTA 2CGPA 2GZWA 3KEQA 4U0VA 4M71A 5HOOA 3OV8A 1TQPA 2QBYB 2XAGA 2M45A 5D5VB 3ZPLA 4A5NA 3I59A 1K79A 3EYYA 3N97A 2M30A 2V9VA 3DV8A 4ENMA 1G6NA 1FBSA 4FT8A 4G6QA 5ICCA 2FNPA 1SAXA 2HKOA 1R58A 3ZMVA 2G7HA 2QVOA 1ZREA 3WTUC 2RVCA 1W7PA 5FD6A 2EFPA 1ZG5A 1XCBA 3C7JA 3K1NA 4WXHA 4EGYA 4ZYDA 4A6DA 4IHTA 3QP6A 1W4MA 5J8CA 3BDDA 2IA2A 4M74A 1R1VA 2VODA 3FMQA 3DF8A 3Q5FA 1IXRC 3QPHA 4HX8A 1TQMA 2IRFG 1YQAA 4UNOA 4G9YA 2Q8KA 5LHHA 3BJAA 4I0AA 1KU9A 2BGCA 1J5YA 1YS6A 1YS7A 4N0BA 2XAJA 1JGSA 1LJ9A 3HSRA 5BMZA 5BOXA 5JI6A 4MTDA 5BQTA 2OQRA 2G7UA 5HS9A 2D1VA 2J5OA 2JZYA 1P6RA 4LLLA 1U5TB 1U6GA 2K86A 4LFUA 1HSJA 1IRFA 3KP2A 2LNBA 1J2XA 4LGWA 5E20A 2RQPA 5J8FA 2EFWA 3HTUA 1XMAA 1MJBA 2BE5F 5CJ9A 5EEGA 1UB9A 3FXQA 5D8LB 2QENA 4LLNA 1FSEA 2UWMA 2MLKA 3JSOA 2O6GE 2VBXA 3ECHA 1T2KA 3R6SA 1GXPA 3ROUA 2IPQX 3I5UA 3WTZA 3M7GA 3K69A 4A2UA 1I1SA 5F6FA 1MGTA 4CDGA 2F5EA 5CYVA 3IHUA 5DEQA 2VOPA 1ZGJA 4L9JA 3F23A 1P4XA 1JE8A 1J59A 2K4JA 2E1CA 5E1WA 2J5PA 1SMTA 1IZ1A 2JT1A 3WTWC 2FMYA 4AIHA 1CF7B 2CFXA 4A0YA 5ILUA 2YR2A 2XVCA 4PGHA 1B1BA 1FWZA 2LKPA 4ZH4F 3HRUA 2EA4A 2IJLA 1XSVA 2XAFA 2G9WA 1TQIA 3WE3A 3I71A 3KCCA 3E6DA 3HTSB 2B0LA 2GIVA 3MQ0A 1SFEA 1BJAA 4M6XA 1R36A 3JTGA 2JTVA 1ODDA 3KEOA 1BM9A 3SZTA 1D8KA 2MC3A 2FU4A 2P6SA 3F21A 1QO0D 4Q47A 4WXCA 2RNJA 1BI3A 4EJWA 5LGNA 4I0BA 2L01A 2X0LA 3KP5A 1K78A 3VFZA 2KIFA 3DFGA 3FMRA 2VBWA 5KVRA 1KYWA 4CGZA 1UCRA 4ON0A 4I01A 3ECOA 1LEBA 2AXLA 4G7ZF 5HLGA 1ZRDA 1IW7F 4KMFA 2MBFA 2L54A 4AIJA 2UXXA 1F4KA 4R1HA 4ZZLA 1XD7A 1REPC 4RB3C 3GO5A 4L9VA 3J7AO 4RAYA 2GA1A 4YG2F 2OQGA 3T5XA 1F1ZA 2L4MA 1JHFA 5L3DA 2ADUA 2DBBA 3BJ6A 2DO7A 4XRFA 2CWEA 3CO6C 3DXJF 4RGXA 4UVCA 4IRHA 2PQ8A 3IKVA 3ISPA 4Q4ZF 4HBLA 1I1GA 3T8RA 1DUXC 1QQIA 1TTYA 5HDGA 2FF4A 2FMLA 2HWVA 1B9MA 4MQVA 4L0YB 4ZYGA 5D5UB 1FNNA 5E17F 4S04A 3F72A 1HXDA 2ELHA 1MDMA 3HYIA 2QLZA 4RGUA 3QRFF 1J9IA 1Z6RA 3RTRA 3BY6A 3JAMK 1TLHB 2A3SA 2HS5A 1SFUA 4Y13A 1D8JA 4ESBA 5H6QA 2E1NA 2COMA 4B09A 1LVAA 5HS7A 4A6EA 4I02A 2OD5A 2ZNYA 3ZQ7A 1YO5C 1IRGA 1JHHA 1QGPA 4HAMA 1XDUA 4L0ZB 1BIBA 2HTSA 2K27A 1LDJA 2A68F 1Y0UA 3DPTA 1Z05A 3LWFA 3DQVC 1BI0A 1S7AA 2NNNA 2Z99A 1RZ4A 2A6EF 4I09A 2NNYA 5HVQC 4IJAA 4XLNF 4OIOF 1P2FA 2ZJ2A 1R00A 3BZ6A 1IAWA 4AVPA 1G4DA 4A5MA 2ZMEB 5D5WB 2DPUA 3J81K 4KFCA 5JVTA 4QLCU 2VBYA 3KZYA 2HZTA 3M1EA 2UXNA 1T38A 2ISYA 5IT9K 2FBIA 1F5TA 3FHZA 1OYIA 1W7PD 3WG9A 3CUQB 4HV5A 3GW2A 1T0FA 1YG2A 1HKTA 1IN5A 4XSXF 3WU0A 2KKOA 4HQEA 5LRRA 2XAHA 3P9IA 3WTXC 5D8KB 2OA4A 1FP2A 1STZA 1L0OC 3FM3A 1BC8C 1YW8A 4GGGA 1IN7A 5CVIA 4A0XA 1XB4A 1R5GA 4LK1F 5FO5A 3DPLC 1ZYRF 2PN6A 2WV0A 2QWWA 2QBYA 4YFKF 1W5TA 4P9FA 1ON2A 4KUMA 1T39A 1ZG3A 3BROA 1UHWA 3HHGA 1OMIA 4I7HA 3D5LA 2KRFA 4U0WA 3RIRA 1I5ZA 3KLNA 2P7VB 3VEPA 5TJJA 3K1MA 3NRVA 3COAC 1KU3A 3V4GA 3GUDA 2LDUA 1ZRCA 2EWNA 2K7LA 4E70A 2WWYA 3KP3A 2HEOA 3R4KA 3LFKA 4IVNA 3IWZA 4GO1A 4YIIA 2JPBA 1RUOA 5CVUA 1HW2A 1FP1D 3WU1B 3LSTA 4UXNA 4NHJA 4AIKA 2CW0F 1ZGAA 3M8EA 3WGGA 5BPDA 3FWEA 4P9UA 5KK1A 5K5QA 1VTNC 3ZMDA 4HQMA 2D1HA 3O2PE 5DCMB 3J81Z 2RN7A 1XGOA 4A0ZA 5IT9Z 1WI9A 2PG4A 2P5KA 2FOKA 1NHAA 4OMZA 3U2RA 4L5JA 2IA0A 4M72A 2XHKA 1XGSA 3TKYA 3ELKA 3EDPA 1GXQA 2OAZA 1A04A 3BPXA 3QU3A 2NRAC 4EMSA 4KN4X 3WGHA 2ESHA 2QQ9A 1FBUA 2IA1A 2V6CA 1TNTA 3ERED 3TO6A 5L3BA 2F5FA 1KQ8A 5ICFA 4BHPA 2WTEA 3E5UA 2RV8A 1WRJA 5JR3A 1QBJA 5K5OA 1SD6A 3WE2A 3QU6A 2FE3A 5F64A 4JK1X 4LG0B 2Z5UA 3V8JA 3CDHA 1USSA 1XN7A 1L3LA 3FF5A 2LSOA 3E5XA 4CYDA 1HSTA 4UUVA 4KIBA 4LB5A 1U78A 4QWQA 1FC3A 3TQNA 3LAJA 1RIOH 3V7RA 3K2ZA 5LBQA 2HQNA 3TOBA 1W7PB 3F8NA 4LB6B 4R8HA 3L7WA 4M9XA 3LA7A 4LJZF 4EQQA 4IF4A 4MHGA 1SD7A 1RI7A 1CF7A 4EV0A 2DT5A 4HX4A 3M9AA 1U2WA 3W6KB 1B6AA 2Z33A 2WC2A 1O3TA 2Y0MA 1ZLKA 3BPVA 4PZJA 3R61A 1RNLA 2C6YA 2YSRA 5ERIA 4KIFA 2JRTA 1G3YA 4XLPF 1FSHA 2DLLA 2PJPA 2KIMA 3P9KA 2ZNZA 4Q48A 2IW5A 4D0PA 2BEOA 4JBAA 3TO9A 2XGXA 2A5YB 4RGSA 4KMUX 5A2QZ 1IXSB 1O57A 2ZBKA 1FPQA 2BV6A 4RGRA 3F8CA 2FSWA 4IXAA 3WGIA 3KP6A 2VXZA 5CVVA 5BS6A 4IRIA 1B59A 4GCVA 4B8XA 4P55A 3QAHA 3W6JB 3F8FA 3SXYA 1K7AA 2P4WA 3T1BA 1BOAA 2ZCWA 3CJNA 3V7CA 4KNYA 4MEYF 3RYPA 5DD4A 4WXDA 4TV7A 3WTYC 5E1XA 1YW9A 1KYZA 1TNSA 3B73A 3BWGA 3N4MA 3CUQC 1EV7A 5CLSA 3WTVC 1T98A 4EGZA 3VOEA 5H20A 2GQQA 2O8XA 1B9NA 1ZH5A 3G3ZA 2DPDA 4KIGA 2HKXA 4PCQA 1PP8F 1W5SA 3ZN1A 2QZ8A 2ACJA 3AAFA 3GEZA 2V79A 1SMYF 5K1YA 4OIQF 3SFZA 4HLXA 5DYMA 1XMKA 4XSZF 2DQLA 1ZLJA 2RC4A 3MWMA 4OMYA 1R22A 2PLYA 3Q9VA 2ZKZA 2R7FA 2OZ6A 1P92A 1Z91A 2FA5A 2W84A 1FYMA 4RS8A 1V4RA 3FZVA 5DCFA 2W85A 1OYYA 3RDIA 1LDKB 1H0MA 4XBFA 3IL2A 4N9IA 4KT5C 5DD8A 3ZMUA 1K78B 1MD0A 3F8BA 5ICGA 4M9SA 2HDCA 2UZKA 1U3EM 5D6FA 5HLHA 4WCGA 3HSEA 3KZZA 4BXUA 3ABUA 1Z1DA 4KN7X 5E18F 1H9TA 5D6EA 4Q5SF 1FT9A 4HW0A 5K5RA 2QQBA 3DEUA 4KICA 3QPTA 1YIOA 2M87A 3F6VA 5D4SA 3E6BA 4ENJA 1O3QA 1H9GA 2V1XA 3JSPA 4WF2A 5ILVA 3V7SA 2HOEA 2VBZA 5LHIA 5FFZA 5ILSA 4G8XA 2PEXA 1UHMA 2ZMEA 1XCVA 1ZARA 5F1RA 1USTA 3RKYA 2GWRA 1HKSA 1C0WA 3JTHA 4GXOA 2Z3YA 1IXCA 2MD5A 5HLIA 4IRGA 5ICEA 4Z2YA 3CUQA 1OR7A 4BHBA 3VB2A 2FBHA 2DAOA 5HDNA 3U9GA 1ULYA 3SZPA 2VE8A 3MAJA 1DPUA 2F2EA 2K02A 3HOSA 2VT3A 1U5TC 3WODF 1PDNC 1XSXA 3HRMA 5E1ZB 2MH2A 1MDMB 5HDKA 2Z9OA 5AIPA 4KDPA 4UVAA 3O6BB 2FEZA 3WTSC 2EFQA 3TO7A 5IT3A 4BH9A 1R1TA 3ZN0A 3MZHA 1MZBA 4ASNA 2QYOA 2YX7A 2LF8A 4ENNA 3K0LA 1WWXA 2AS5F 2PFBA 1ZN2A 4ETSA 3L09A 3TDUC 2XIGA 2FXAA 1S8NA 4L9TA 3LA2A 3TGNA 3IRQA 2IP2A 4EVIA 2DI3A 3IC7A 2OBPA 2EV6A 3RJPA 1K6OA 2O61A 3HHHA 4OOIA 5DCMA 2HYGD 1DDNA 3IRRA 4G7OF 2XRNA 1BI1A 3E97A 3HRTA 2MLGA 1Z7UA 1F9NA 5LRSA 3J80K 3RPQA 4UV8A 3RPUA 4A12A 4HOBA 1ONVA 1HW1A 2XKPA 5EEHA 4GYIA 2A6HF 5LEJA 1XDSA 1G3TA 1V3FA 2L3DA 4N9HA 4AD9A 3OOPA 4OIRF 3L00A 1MKMA 2XKOA 2DQRA 1I6XA 2HR3A 4O5VA 2HQRA 3E3VA 3I58A 4LMYA 1AWCA 5AONA 1J75A 4MEXF 2YU3A 2PI0A 2DK8A 2K4BA 3FMSA 2ISZA 3PQJA 3QP5A 1R1UA 4CO8A 1WSUA 3ZMZA 2M8EA 1FYKA 1HBXG 4AWXB 3F22A 5FB2A 3V8KA 3EQLF 2HGCA 2H6BA 4ESJA 1UFMA 3PFIA 5E8IA 3LA3A 2X4HA 4FHTA 1RUNA 2RKHA 2Q2EA 4R79A 4HDVA 1Z9CA 2NYXA 3GYHX 4LG0A 1P4WA 3QOPA 4ZYHA 3F6OA 3GZ5A 2R7DA 2VC0A 3ZMSA 1U5TA 2EV5A 2CYYA 2XASA 4Y15A 1KA8A 3FX3A 1FX7A 1S29A 5D5XB 3MFKA 1FBQA 4HYEA 4UV9A 1E17A 5LLQA 1TW2A 1OYWA 3RI4A 1BI2A 4M73A 4OU0A 2P6TA 4M9ZA 3GF2A 3LQQA 5A2QK 3J80Z 2P5VA 4RB0A 2W57A 2VE9A 1BBYA 1SD4A 4WK8F 3RYRA 1R5HA 4DQ2A 1YW7A 5E8GA 4HLYA 2HFHA 4Y17A 4YFXF 2KJBA 2OZUA 4FX4A 2GA2A 4EM1A 1S3JA 3I59B 1XGNA 1SFXA 4GYGA 4KYWA 3NEUA 5LHGA 1U8RA 2A07F 4HF1A 1CGPA 1O7LA 3ABTA 2QUFA 2DK5A 2KJCA 1R7JA 5JHUA 1B4AA 2QQAA 5J6XA 5L3EA 4WWCA 3PQKA 2EJRA 1YTYA 1QZZA 1ZRFA 1R23A 5TRDA 3F3XA 4L18B 1QNTA 2H27A 1Q1HA 4HDUA 3K1PA 2CQKA 1BIAA 2XV4S 2OU2A 2Q0OA 3E6MA 4BYYA 2IT0A 2V1UA 3C3WA 4EJOA 3HSFA 5CVRA 3SHFA 3M8FA 3REOA 4BQAA 2QM3A 4I98B 1OPCA 2PMHA 3U1DA 2JPCA 3K9TA 2O3FA 3BP8A 5ED4A 3SQNA 1J7KA 4OINF 3EETA 1I27A 4JQFA 3I0TA 3I53A 2V1DA 1TBXA 3ULQB 3CUOA 1JXSA 3O3KA 1ZAOA 3CO7C 4K2EA 2L4AA 2F5DA 1EH8A 4U7DA 3T8TA 2A69F 2O03A 4HF0A 2ZXJA 3E6CC 2MA3A 3V8LA 2GXBA 2D45A 2GAUA 2W24A 2IVMA 5L3GA 3F8MA 4ESFA 4FX0A 2PBIA 1FY7A 1WKMA 2M5WA 3MZYA 3ZP5A 3R0AA 4U7BA 5FLXK 2M1BA 2FRHA 2BBYA 1FZPB 4ENKA 1PUEE 4EM2A 1EH7A 2EV0A 4CHUA 1IN4A 2BYVE 1FOKA 1XGMA 2A61A 3L9FA 2KIUA 1KU7A 3FXUA 4L5IA 3P9CA 2FNAA 4U0YA 5DDGA 2VT2A 3I54A 1S7OA 4LD5A 3B02A 5DV5A 3BOQA 3RKXA 1G3SA 3GFJA 5L3FA 3H3UA 2CO5A 2O0YA 2P8TA 2W25A 3TOAA 1MJAA 3HIFA 1QZYA 2VONA 4I2OA 1IN8A 2FBKA 3KP7A 2DW4A 3JW4A 3GWZA 1GHCA 3IKTA 2H6CA 1J0RA 2R3SA 5FFXA 4ZZDA 2Y48A 3I4PA 4PDKA 2PMUA 3H92A 2GXGA 4O3MA 3EUHA 2CSOA 2FQ3A 4YIFA 2VN2A 3RKWA 4EJTA 2MH9A 2ZO4A 1KQ9A 2RDPA 4ZYEA 5FLXZ 4KA4A 3HOTA 1LDDA 3KLOA 1OKRA 1X3UA 3ML6A 2EA2A 2YPRA 4WX9A 4LLGF 2CG4A 2VOOA 1O3SA 3H3ZA 3GFMA 3I64A 1BC7C 1HKQA 2EFNA 3HUGA 1FYLA 1EH6A 3GZ6A 3KE2A 4U88A 3FM5A 3VODA 1HQCA 3G73A 4CXFA 1DPRA 2D2WA 1D3YA 6PAXA 1TW3A 4YFNF 4HF2A 1MJ9A 2P5LC 2E7XA 5FGMA 2DU9A 4G6DA 5D4RA 3DKWA 3LAPA 4EJVA
chains in the Genus database with same CATH superfamily
1VI0A 2A5WA 2TDXA 5AIQA 1GVJA 4BJTA 4IHSA 1V5EA 3FBNB 4S05A 4XLAA 4E4HA 3TDZC 1FEXA 2K9MA 1T8IA 1ZG1A 5DUKA 1MSFC 4OWRB 5LGUA 2EB7A 3BR6A 3FDYA 4LOCA 3ZQFA 4BUPA 4YIRX 1TWHJ 4NB5A 3NQOA 2XAQA 1KU2A 5EZHA 2F5CA 1YYVA 3HBLA 4JX6A 1KGSA 2JA2A 4CCNA 2P0WA 3GFLA 1H89C 3GX4X 2H09A 4H0EA 4RB2C 4A3JJ 5L3CA 1UELB 2BZTA 1Z0XA 5EYRA 2DFIA 5CVJA 4HV6A 1O3RA 1VNDA 3OYHA 1WH7A 3ZCOA 4EJUA 1LB2A 2PX9A 2CW8A 4BAYA 4EEFG 2E1MC 1G3WA 1D5VA 4PGGA 4MQ9F 3C18A 3H9GA 3CCMI 5DTDA 3CLOA 4L9NA 3T0YA 1QPMA 3OYIA 1ETWA 4JX5A 1HW5A 2DN0A 1TWGJ 1X1CA 1OCCH 3OL3A 3KYLA 5DUIA 2ZFWA 1PUFA 1ON1A 4CICA 3R0JA 2KPMA 4KT6A 1S6LA 4G7HF 2CS3A 2HTJA 3S2WA 4A3BJ 1PP7U 1POGA 2H94A 1P4AA 2V9PA 4UHTA 5BPIA 3HRSA 3CTAA 5IYBJ 1LNWA 3CC4I 2CQNA 1IUYA 4RA2A 2V1NA 2BW3A 2XAUA 5EDNA 1G59A 5LEKA 3EYIA 2V4JC 5EEAA 4UVBA 4HEA2 3WU2C 1DU0A 5H6RA 4HZFA 3IWFA 4DNCA 4C3HJ 4BHCA 2LF7A 4G94A 2E7WA 4UY8I 2VKVA 3DP7A 2R5ZA 2LK2A 2RGVA 1XSDA 1EF4A 3BQZA 2K85A 3PSIA 4P5OA 4OIPF 1D0YA 4CYCB 1E2XA 3H5NA 3GVAA 1KQ0A 1YLFA 1TT0A 2BOLA 3C1DA 4FE7A 1LEAA 3AG1H 3HOYJ 3L2CA 4XLEA 4RAZA 3E5QA 1I50J 2XGEA 1T6SA 3IH4A 2ESNA 2DA7A 3BJOA 2ETHA 3D0SA 1DP7P 5FD5A 1IN6A 2JVHA 1FJLA 2EFOA 3JAMZ 4EM0B 1LFUP 3LQRA 3BR0A 2NS0A 3MCZA 2P7CB 3GXOA 1XC5A 2STWA 5F0FA 3KP4A 1TWAJ 2R92J 1NK2P 4LK0F 4E7KA 3MEXA 5FROA 2ECBA 5C3EJ 1BW6A 3IH2A 4HA8A 3WTTC 1GUUA 3ZMTA 4KJZA 3RSNA 1BN5A 5EGOA 3GTOJ 2KP6A 4CZZA 3KIOA 4B3XA 2HYFA 5JFRA 1ZHFA 3PNYA 1IF1A 2IGMA 4O6JA 1JJ6C 2R7WA 4F7ZA 2HOTA 2VB6A 1FTTA 4IPAA 4NQWA 2DTRA 3FXRA 4HX7A 3GFIA 2CRGA 2YX4A 1LQ1A 1SD5A 3H5AA 5CQGA 3F0CA 2F5VA 2DA3A 4A3FJ 1WI3A 3P7NA 2EK5A 2R5YB 3BR1A 5HS8A 2L02A 4M6YA 1FLIA 5F0HA 2JSCA 3LSRA 5F27A 1YFHA 1AOYA 1I6HJ 4MGRA 5FKNA 5HODA 5GADJ 1Z6TA 1VQ7I 4MTEA 3KFWX 4CZCA 4FASD 2JUGA 4RB1A 3HKZA 2Y75A 1JKPC 4I76A 4GDFA 3QYFA 4P96A 4B1RA 3I9V2 2NOGA 5M5XJ 3GLXA 2LG4A 2VC1A 2VQCA 1R5ID 2XROA 2XUBA 2R7ZJ 2NAZA 1WQ2A 3Q9SA 1Y56A 5LGTA 1O7FA 3OWTA 1S72I 3KETA 2WADA 3LSJA 4ZTFA 4MNUA 2KMUA 3R60A 4BNCA 2LBFA 2STTA 2CGPA 2GZWA 3KEQA 4U0VA 1Z77A 4M71A 5HOOA 3RCOA 3OV8A 1V5GA 1TQPA 2QBYB 4IQ4A 2XAGA 2M45A 5D5VB 4E6KG 2MD0A 3ZPLA 2WY8Q 4A5NA 3I59A 2VQHA 1K79A 3HOUJ 4BXXJ 3EYYA 3N97A 2M30A 2V9VA 3DV8A 5E3OA 4MLOA 4ENMA 2HVSA 1G6NA 1FBSA 4FT8A 4G6QA 5ICCA 2FNPA 1P7IA 4UUSA 5HNFA 1SAXA 1XMXA 2HKOA 2FUG2 1R58A 3ZMVA 1JTXA 1YX3A 1FIAA 2G7HA 2QVOA 5C4JJ 4PSXA 5F0CA 1GLNA 3LSIA 5B66C 4DGWB 2BVLA 1ZREA 3Q0UA 3SYTA 1ORKA 3WTUC 2DA6A 2RVCA 1W7PA 3BLYA 5FD6A 5KAFC 2XRLA 2EFPA 1ZG5A 1XCBA 3C7JA 1WH5A 3AKZA 3K1NA 1DU6A 4WXHA 5JLXA 1IRZA 2VJIA 4N4OB 1T56A 2CUFA 4EGYA 4ZYDA 1FMWA 3QQAA 4A6DA 3QP6A 2QSGX 1B8IB 4IHTA 1W4MA 3OYEA 3MN2A 5J8CA 2DMNA 2DCEA 3BDDA 2IA2A 4M74A 3HPGA 3U21A 3DTKA 1R1VA 4XL9A 2VODA 3FMQA 4DYCA 2IS1A 4GRIA 2BVMA 3DF8A 2AO9A 2KRCA 2JA7J 2GBYA 3Q5FA 1QZEA 1IXRC 3QPHA 5IOZA 3L2UA 1TWFJ 4HX8A 2VKEA 1TQMA 2IRFG 4FETA 2E36A 3LSKA 1YQAA 2Z16A 4L5EA 2KL4A 4UNOA 2L7FP 1ZQ3P 4G9YA 2Q8KA 5LHHA 2V6EA 3BJAA 1X3WB 4I0AA 4EATA 2ELJA 1KU9A 5DS9A 1OLTA 2BGCA 2CUJA 1N78A 1J5YA 2LP0A 1YS6A 5KCMA 1YS7A 2DFFA 2BY2A 4N0BA 3ZQLA 2E2HJ 2XAJA 3K6GA 1JGSA 1MNEA 5K7ZA 1LJ9A 3HSRA 5BMZA 5BOXA 3ZOBA 5JI6A 4MTDA 5BQTA 2OQRA 3BR3A 3PO2J 2G7UA 5HS9A 2D1VA 2J5OA 1FOWA 2JZYA 1P6RA 2X1DA 4LLLA 1U5TB 3HOXJ 2JA6J 1U6GA 3KX2A 3NWSA 4AIDA 2KT0A 3H1CA 3OYCA 3HJEA 4IHVA 3CC2I 2K86A 2VJ5A 1HSJA 2YUSA 1EA3A 4LFUA 5BNGA 2XPWA 1IRFA 3KP2A 3TP0A 4B44A 1X1PA 2LNBA 5GAHJ 3G6EI 1J2XA 4LGWA 2DOEA 5KHDA 3X2QH 5E20A 2RQPA 3HC7A 3B6CA 3BCBA 3GTPJ 5J8FA 4ANJA 2JUCA 2EFWA 2VPLA 3HTUA 5GAGJ 2OPTA 1KONA 1XMAA 1MJBA 1G2HA 2KHMA 3CP8A 1Z67A 1GV2A 5CJ9A 5EEGA 3JRGA 1TL8A 1UB9A 3FXQA 5D8LB 1SAUA 3LSGA 1IV6A 5E3LA 2QENA 1XS9A 4LLNA 1FSEA 2DJIA 3V42A 2UWMA 4XIDA 2MLKA 3K4MA 2W48A 3JSOA 2O6GE 4M3GA 4JOMA 5EG0B 1T33A 2IBDA 2MW8A 3HZJA 1OFCX 2VBXA 3ECHA 3M3YJ 1T2KA 3QPLA 3R6SA 3RZDJ 1GXPA 1OCTC 1PVEA 4YELA 1X2MA 1WJAA 3ROUA 2IPQX 3H5RA 3I5UA 3WTZA 3M7GA 2QF7A 3K69A 4ZC3A 1PJRA 4A2UA 1I1SA 2CFOA 5F6FA 1MGTA 3JRFA 4CDGA 3VPRA 3K4JA 2F5EA 3FXKA 5CYVA 3IHUA 1VQLI 3ASNH 3PUFA 5DEQA 2NVUB 1I3AA 2VOPA 1ZGJA 4FE4A 4BS9A 4YRVA 4D5CA 2XGDA 4L9JA 3F23A 2K3FA 2UV1A 2XPUA 4XKCA 1P4XA 2L9SA 3I55I 1ETKA 3VWBA 1JE8A 1BR1A 1J59A 2XC7A 2K4JA 4C2MJ 2E1CA 1A5JA 5E1WA 2J5PA 1ITYA 3HL2A 1SMTA 3MD2A 1IZ1A 2JT1A 1GVDA 2NVQJ 3WTWC 2FMYA 4AIHA 2WAEA 1CF7B 2CFXA 4A0YA 2DT7B 5ILUA 2YR2A 2XVCA 3OYFA 5FLMJ 4PGHA 3K70D 3SZGA 1HA8A 1B1BA 1FWZA 5GPCA 2LKPA 2LKXA 4ZH4F 3HRUA 5E79C 2EA4A 2IJLA 1XSVA 2XAFA 2HI3A 1R6RA 1N25A 3OS1A 2G9WA 2FQ4A 1TQIA 1XPXA 2CU7A 1XX5A 3WE3A 2L7MP 2K3PA 5J1RA 3DTIA 1QVUA 3I71A 4II3A 3KCCA 3E6DA 3HTSB 3E7LA 2B0LA 2GIVA 3MQ0A 3A4CA 1SFEA 3NARA 1RESA 1BA5A 3EUAA 1BJAA 1SVMA 1Z3XA 2ELKA 4M6XA 3JREA 1R36A 4XN3A 5IP7J 3JTGA 4A3EJ 2JTVA 1ODDA 2R7VA 3K10A 3KEOA 2QSFX 1BM9A 3SZTA 1IRXA 1D8KA 2MC3A 2FU4A 2P6SA 3O8GA 3F21A 1QO0D 1QVTA 5FKOA 4Q47A 1H88C 3QODA 4WXCA 2O7OA 2RNJA 1BI3A 3ASOH 3I3LA 4EJWA 5LGNA 1U9NA 4I0BA 2L01A 3A2KA 2X0LA 3KP5A 1ZR2A 1K78A 3VFZA 2KIFA 1OISA 3DFGA 2R7OA 5B5EC 3FMRA 3TBIA 2VBWA 1X1BA 5KVRA 1KYWA 4CGZA 3K4CA 1WJBA 2X6OA 3CLQA 1A31A 1WJFA 3OYLA 1UCRA 4ON0A 4I01A 3ECOA 1LEBA 2E2IJ 2VL8A 2AXLA 3VYUB 1KZHA 2QA4I 1AHDP 3IAM2 4G7ZF 4XOPA 5HLGA 2CV0A 1ZRDA 1IW7F 4B43A 3RKQA 4KMFA 1YRNB 2XF7A 2GLOA 1QHHD 3IP4B 1FIPA 2BHYA 3GBGA 2MBFA 4DBQA 2L54A 1Z3YA 4AIJA 2UXXA 1F4KA 4R1HA 1MBKA 4ZZLA 1R9TJ 4E7IA 1XD7A 3OYGA 1REPC 3A02A 1TWCJ 4RB3C 1Y8QB 3GO5A 2BY0A 2NS7A 4CCMA 5J40A 4L9VA 3J7AO 1T0FC 4RAYA 2GA1A 4YG2F 2KRHA 3JRAA 2LLKA 2OQGA 3T5XA 4YEJA 3OYDA 1F1ZA 2L4MA 1JHFA 2LTPA 4PJMA 5L3DA 5F04A 2KIQA 2ADUA 2DBBA 3VDXA 1HOMA 3BJ6A 2DO7A 3GCMA 4XRFA 4QIWN 2CWEA 3CO6C 1TP4A 1UG2A 3JR9A 3DXJF 4RGXA 4UVCA 4IRHA 2PQ8A 3IKVA 3PJRA 4W97A 2XB5A 4FTHA 1LE8A 3M1CA 3ISPA 3PM1A 4CCJA 2KQRA 4Q4ZF 4IEJA 4HBLA 3S16J 1I1GA 3T8RA 4QTRA 1QU3A 1DUXC 1QQIA 2DMUA 3CCVI 4ZTJA 1R49A 1DGRM 1TTYA 5HDGA 3BTLA 2H8RA 2JQ7A 2FF4A 1K4SA 1YIJI 2JWTA 2F4IA 2FMLA 2HWVA 1B9MA 1BW5A 3M8JA 1DQUA 4V19K 4MQVA 3RZOJ 3VYTB 2W4SA 3W2VA 4BKXA 4XM3A 4F3QA 4ZYGA 4L0YB 5D5UB 1FNNA 5E17F 1P7JA 4S04A 2X9DA 3F72A 1HXDA 2ELHA 3MKLA 1MDMA 3HYIA 2QLZA 4RGUA 4XQFA 3QRFF 3QOEA 1J9IA 3U1KA 1Z6RA 2DOAA 3PIOF 3AFHA 3HPHA 2ZXHA 3RTRA 3BY6A 3JAMK 1TLHB 2A3SA 2HS5A 5K7FA 1SFUA 1UMQA 4F92B 2L9VA 2QCOA 1X3ZB 4UUTA 3GTQJ 4Y13A 1D8JA 4ESBA 3G1OA 4A3IJ 5H6QA 1N75A 1LVKA 3IV5A 1X1AA 1VQ5I 3PNVA 2LREA 2Q1ZB 2E1NA 2COMA 2JMWA 4PJNA 4B09A 1ENHA 2HPIA 1LVAA 5HS7A 4A6EA 3LSPA 4I02A 2OD5A 2ZNYA 3ZQ7A 2KDOA 3EPZA 1W5CC 5B1AH 1YO5C 3CJRB 1IRGA 2M2EA 1JHHA 1QGPA 4HAMA 2L2OA 2W82A 4CYCA 1XDUA 3A01A 3SEQA 1Y0NA 4L0ZB 1BIBA 1TZLA 2HTSA 3Q0WA 2K27A 2LVSA 1LDJA 2A68F 3BR2A 3D1NI 1Y0UA 1CQTA 1MMGA 3DPTA 4XN0A 2ZB9A 4A3CJ 1LFPA 4AU7A 1Z05A 3LWFA 3DQVC 1BI0A 4LITA 1S7AA 3HUGB 2KZGA 2K9NA 3BG7A 2NNNA 2EZHA 2Z99A 2X48A 1RZ4A 2DOFA 2A6EF 4I09A 2BXZA 2XGCA 3I56I 2NNYA 2HPMA 1WGXA 2IXSA 5HVQC 2WBMA 4IJAA 4XLNF 4OIOF 1ETXA 4BY7J 1P2FA 1FTZA 4DIQA 2ZJ2A 4HRIA 1R00A 3HOWJ 3H36A 1MMDA 3BZ6A 5DM7F 4BDYA 1IAWA 2QGUA 4CA0A 4AVPA 2EBIA 1G4DA 4A5MA 2ZMEB 5D5WB 4XLCA 2DPUA 4OAYA 3J81K 2M7AA 4XLFA 4IOCF 4KFCA 5JVTA 2X1CA 4QLCU 1IGNA 4XK4A 2VBYA 3KZYA 2HZTA 3M1EA 2UXNA 1T38A 3S1NJ 2ISYA 5IT9K 5EJCA 2FBIA 1F5TA 3FHZA 1OYIA 2VQLA 1W7PD 2R7QA 2DDAA 2LKSA 2R5YA 2MABA 4RDUA 3WG9A 3CUQB 4HV5A 1DP3A 3GW2A 2LY1A 2EZIA 3H35A 2FOWA 1T0FA 4BQNA 1OCPA 1YG2A 1HKTA 1IN5A 1S7EA 3LSMA 2JVGA 3CESA 4XSXF 3WU0A 2KKOA 2JA8J 4HQEA 2K5CA 1V5FA 5LRRA 2L5QA 2XAHA 3F9KA 3P9IA 4E7SA 3WTXC 5D8KB 4DZPA 2Z2SB 2OA4A 1WHUA 4D1QA 1BR2A 3G1MA 2HZDA 1FP2A 1STZA 3B6AA 1L0OC 3FM3A 5FRNA 1BC8C 2VQGA 1YW8A 3CCYA 4GGGA 4LG3A 5JHFA 3OY9A 1JT0A 1IN7A 5CVIA 2HVRA 2CUEA 2FX0A 1XB4A 1ZKGA 4W1UA 4A0XA 5HLTA 3O8HA 3AL0B 4E7HA 1R5GA 1Z21A 4LK1F 5FO5A 3DPLC 1APLC 3MZ8A 3OYKA 1MNDA 1WJEA 1ZYRF 2OUMA 1PUFB 1I3QJ 2PN6A 3QWLA 2WV0A 3ERMA 1Y39A 2QWWA 2QBYA 3HGGA 4A3DJ 4YFKF 1W5TA 1GDTA 4P9FA 1ON2A 4KUMA 1T39A 1ZG3A 3BROA 1UHWA 3HHGA 1OMIA 2KFDA 3BCAA 4I7HA 3ESWB 3D5LA 2KRFA 3GLLA 4U0WA 2BW3B 1I5ZA 1MH4A 4MIMA 3RIRA 3KLNA 1MMSA 3CC7I 3JRCA 4XNFA 2P7VB 4CCKA 3VEPA 1VQ6I 3HEFA 5TJJA 5J47A 3K1MA 2X6YA 3NRVA 5M5YJ 3COAC 1KU3A 3V4GA 2DXIA 3GUDA 3CF5F 2TCTA 2R5ZB 3AG3H 2LDUA 1ZRCA 2EWNA 2K7LA 4IKFA 1FMVA 4E70A 3KP3A 2WWYA 2HEOA 3R4KA 2DMQA 1WPKA 3LFKA 3MMYB 5B1BH 4IVNA 1VQPI 2EILH 1OCZH 2LR8A 3IWZA 4GO1A 4ITVA 4YIIA 5J4VA 2JPBA 3K7AJ 3LMMA 1RUOA 5CVUA 2L7ZA 1HW2A 1FP1D 3WU1B 2Y2ZA 3LSTA 3SJMA 4UXNA 4NHJA 4AIKA 1UHSA 2CW0F 1ZGAA 1X19A 2RNGA 3M8EA 3WGGA 5BPDA 4BE1A 3FWEA 4JP0A 3S93A 5KK1A 4P9UA 1B8IA 5K5QA 2A6TA 3ZMDA 4C3IJ 4HQMA 1VTNC 1XTAA 2D1HA 2IGOA 5LD2C 1B72A 2X1EA 1SVOA 3JRDA 3O2PE 5DCMB 3J81Z 3S1RJ 2RN7A 2LY2A 5K7HA 3M07A 1XGOA 4A0ZA 5IOYA 5IT9Z 1ETYA 1WI9A 1LFBA 2PG4A 2P5KA 3MKYB 2FOKA 1NHAA 2HYJA 4XKWA 1HDDC 1VQ8I 4OMZA 5GTIC 3U2RA 1AA7A 2G0EA 1BR4A 4L5JA 2IA0A 1IO2A 4M72A 2ZJPF 1I39A 2N8GA 4XONA 1HC8A 2XHKA 1YITI 1R4MB 1XGSA 2HQAA 3PL8A 2QQ8A 4NQWB 3TKYA 3ONQA 3ELKA 1RETA 3EDPA 1GXQA 2OAZA 1A04A 5JLWA 3BPXA 3QU3A 1JUPA 1WJDA 3CMEI 4A3KJ 3BG9A 1K61A 2NRAC 2XB0X 4KN4X 4EMSA 3WGHA 2ESHA 2QQ9A 1FBUA 1MMNA 2VPRA 4X0GA 4BJ6C 2IA1A 3DTEA 2EQRA 2V6CA 2FJ1A 3C2GA 3CD6I 1TNTA 3CJQB 3ERED 1UJ8A 4N4NB 3TO6A 4RAFA 5L3BA 2F5FA 1S9HA 1JJ8C 1X4PA 1KQ8A 1WCMJ 4XORA 2ID3A 3KZIC 5TISC 4C2UA 5ICFA 4BHPA 3TW6A 1AKHB 2L9RA 3L2VA 4J01A 2WTEA 3HOVJ 3E5UA 2NVXJ 3CCJI 2RV8A 1WJCA 4BQQA 2R93J 1WRJA 2VJJA 5JR3A 1QBJA 5K5OA 1SD6A 3WE2A 3BQYA 1GV5A 3QYEA 3QU6A 2Q2EB 2ZSIB 2LBFB 4A93J 4X1EA 4PK4A 2FE3A 3ZR8X 1D5YA 5F64A 1D0XA 4JK1X 3DKXA 2Z5UA 5EG0A 3V8JA 4LG0B 4BQOA 2DYSH 2E19A 2R4GA 3CDHA 1USSA 4MO7A 1XN7A 1Y1WJ 1L3LA 4RLFA 3FXOA 1XG1A 4I99C 4DOZA 5IPAA 1SANA 3I4MJ 3FF5A 2LSOA 3E5XA 1UZCA 4PJLA 4CYDA 1HSTA 4UUVA 4KIBA 4XKBA 4LB5A 1W36C 2HDWA 2RREA 1U78A 4QWQA 1FC3A 2K9QA 1JKRC 3Q0VA 3TQNA 4FQGA 4M3BA 2EH3A 3LAJA 1G8XA 1RIOH 3V7RA 5J1UA 3EUKL 3K2ZA 5LBQA 2AXTC 2HQNA 3TOBA 1W7PB 3FKJA 1E0EA 1RKWA 2XSJC 3CZ6A 3F8NA 4A3GJ 4LB6B 4R8HA 1S5LC 3L7WA 4M9XA 3LA7A 5EZGA 1IDYA 4LJZF 4RAGA 3KPHA 4EQQA 4IF4A 4BACA 4MHGA 5IP6A 3ZQCA 2EIJH 3I4NJ 1SD7A 1RI7A 3WHBA 1GT0C 4EV0A 1CF7A 2DT5A 4HX4A 3M9AA 1U2WA 1NK3P 3BTCA 2VASA 4BEHB 3W6KB 2VXDA 1B6AA 3K2AA 4HNTA 3OYAA 1HDPA 2Z33A 1JT6A 2WC2A 1D1CA 1O3TA 3S3MA 2M0MA 2E34A 2JK3A 2HNHA 2Y0MA 3MKZA 1ZLKA 3BPVA 4PZJA 3R61A 1RNLA 2C6YA 1A36A 4IHWA 2WA0A 2YSRA 5ERIA 1RR8C 4KIFA 2COBA 4CSWA 1NTCA 3FHNA 3OMYA 3W3CA 1RKTA 2JRTA 1RRJA 1IJWC 1G3YA 4XLPF 1FSHA 2R7XA 3VSKA 2DLLA 2QKMB 2PJPA 3AG4H 2KIMA 1YX5A 3P9KA 2ZNZA 4Q48A 2D5VA 2IW5A 4D0PA 2BEOA 4XLHA 2ZSHB 3FK6A 4LIUA 3IAS2 1Q1VA 4JBAA 3OIOA 2XGXA 2A5YB 3TO9A 4ZJZA 5M3MJ 4RGSA 2GXAA 4KMUX 5A2QZ 1IXSB 3UR3C 2TRTA 2WV1A 4AM3A 2X51A 3K70C 2LRDA 1O57A 2ZBKA 1VQOI 2EIKH 5F1JA 2ME0A 3C2HA 1JTYA 3H9JA 1FPQA 1U0JA 2BV6A 3NAUA 4RGRA 3F8CA 2FSWA 2E5NA 2R7SA 3MKWB 1NG6A 4IXAA 4XRSA 3WGIA 3KP6A 2W00A 4PFOA 3DU5A 2VXZA 5GTHC 3CCSI 3CCUI 5CVVA 4ZDPA 5BS6A 4IRIA 1B59A 4GCVA 5KAIC 4HNVA 4B8XA 3G4SI 4P55A 3QAHA 2CV2A 1F36A 2Y0SN 4IHXA 3CCLI 1YJ9I 3W6JB 4XRSG 2ZMEC 3F8FA 3SXYA 1K7AA 3CMYA 2P4WA 3OOUA 3T1BA 1YRNA 1BOAA 2W1OA 1A6IA 2ZCWA 3JRBA 3CDLA 3CJNA 3V7CA 4KNYA 4MEYF 3BG6A 3RYPA 4A3MJ 5DD4A 4WXDA 4C3JJ 3LL7A 4TV7A 3WTYC 4NC7A 5E1XA 1RC9A 1YW9A 1KYZA 3GTMJ 1TNSA 1VF9A 2Y69H 3B73A 3BWGA 2VI6A 3N4MA 3CUQC 4CCLA 1OR7C 3RQIA 2JRMA 1R4NB 4FCYA 2JN6A 3DEEA 1EV7A 5CLSA 1WFXA 3CCQI 3WTVC 2MC4A 1R71A 3ZQGA 1T98A 4EGZA 4Y33A 3VOEA 5H20A 2GQQA 2O8XA 4BXFA 3CDIA 1B9NA 3C2BA 4AC0A 5IP9J 2W7NA 1ZH5A 2VJ4A 3G3ZA 2DPDA 4KIGA 2HKXA 4PCQA 3GTLJ 3CF2A 2PJRA 3KEYA 1DGWY 1PP8F 1W5SA 3ZN1A 2QZ8A 2ACJA 3AAFA 2VKDA 3GEZA 5GPAA 3AL0C 2YU9J 1SVLA 2M9HA 2V79A 2JA5J 2OF7A 2OCEA 1SMYF 5K1YA 5H2FC 3OS0A 4OIQF 4CH7A 2O5RA 3SFZA 5IYCJ 3A0BC 4HLXA 5DYMA 1XMKA 4XSZF 2DQLA 3NWTA 4JX4A 4B3AA 1VQKI 1ZLJA 3S17J 2RC4A 3MWMA 4OMYA 2WAQN 1R22A 3D5RC 2PLYA 1ETOA 3Q9VA 4GFBA 2ZKZA 2KISA 2P81A 2R7FA 3VSLA 1Y1VJ 2RQQA 2OZ6A 1SFKA 1P92A 3GTJJ 1Z91A 2FA5A 3QYBA 3K4NA 3OIQA 2W84A 1FYMA 4RS8A 3G2BA 4DYQA 1V4RA 2BXYA 3FZVA 4IX7A 4HNUA 5DCFA 2W85A 3PFYA 1OYYA 3RDIA 3DBHB 3SEZA 1LDKB 1H0MA 4AVZA 4XBFA 3DBRB 3IL2A 4N9IA 3W6VA 2BY3A 4KT5C 5DD8A 2CQQA 3BTJA 1OCRH 1V55H 3ZMUA 1K78B 3MVPA 1MD0A 3F8BA 5ICGA 4M9SA 3PSFA 3OR1C 3OYNA 2HDCA 1QHGA 2UZKA 3OSFA 5GAEJ 3DEWA 3D5SC 1U3EM 3PO3J 5D6FA 5HLHA 4WCGA 4I6ZA 3HSEA 3G71I 3KZZA 4BXUA 3ABUA 1Z1DA 4KN7X 5E18F 1H9TA 5D6EA 9ANTA 3FXMA 2DA1A 1BOBA 4Q5SF 3WG7H 3OS2A 1MBHA 1FT9A 4HW0A 5K5RA 2QQBA 3DEUA 4KICA 2GOXB 4IQJA 4NBQA 3QPTA 5FRMA 1YIOA 2M87A 2WAFA 3F6VA 4DBRA 4P1WA 2XPVA 3SDGA 2OV7A 5D4SA 3E6BA 4ENJA 1O3QA 3A03A 2ZXWH 3S14J 5GP9A 1H9GA 2V1XA 3JSPA 4WF2A 5FJ8J 5ILVA 3V7SA 2HOEA 1IDZA 2JSPA 2VBZA 3JRIA 2H1LA 1BJZA 2V7FA 3GZNB 5LHIA 5FFZA 5ILSA 2DTZA 1QPIA 4G8XA 1E3PA 2PEXA 1UHMA 2CH0A 1XCVA 2ZMEA 1ZARA 3VYRB 1MMAA 1MH3A 2M7BA 5F1RA 1USTA 3RKYA 3HOZJ 4F52A 2HVQA 1IV8A 2GWRA 1HKSA 1ETVA 4CUGA 1H8AC 1ERDA 2CV1A 3GMEA 4MFDA 5E3MA 1C0WA 3JTHA 4KISA 4GXOA 2JJ7A 2Y0SA 4NNJA 2Z3YA 1HCRA 1IXCA 4B47A 3WHCA 2M4GA 2MD5A 3HDDA 5HLIA 2MFZA 4IRGA 1T95A 3J7YJ 2X6XA 1NH3A 1LE8B 4F91B 3BC8A 3ZQHA 5ICEA 4Z2YA 3CUQA 2MYSA 4M3FA 1OR7A 4AYBN 3LAPA 4PJ0C 4BHBA 3VB2A 3OYJA 2FBHA 2DAOA 3E0JB 1MW7A 5C4XJ 5HDNA 3U9GA 1ULYA 3SZPA 2VE8A 3MAJA 1DPUA 4A69C 2F2EA 2K02A 3HOSA 3GTKJ 4NUBA 2OCCH 2OC6A 2VT3A 1U5TC 2R0QC 3ABMH 2B63J 4UB8C 3WODF 4ABZA 1PDNC 1MBFA 1XSXA 3HRMA 5E1ZB 2MH2A 4G6TB 1MDMB 5HDKA 4XICA 3L2RA 2Z9OA 1VQMI 1Z7LA 5AIPA 4KDPA 2EINH 1IUFA 2F48A 3LFUA 4UVAA 1E3HA 3O6BB 2V26A 2FEZA 3DLAA 3WTSC 2EFQA 1X4OA 3TO7A 4HSTA 5IT3A 1YI2I 2E5ZA 1QA6A 5DM6F 4BH9A 3DLLF 2LFBA 1IC8A 4V2GA 1JI8A 1ACIA 1R1TA 2MGQA 1VFCA 3ZN0A 3PUBA 3MZHA 2CMPA 1MZBA 3BT9A 2CQXA 3JCUC 4ASNA 4BJ5C 2QYOA 2IS4A 2YX7A 2DA5A 1M1EB 2LF8A 1WVRA 5B3SH 4ENNA 2VLAA 3K0LA 1WWXA 2AS5F 4M3DA 2PFBA 2WAQA 1YOVB 2K9LA 1ZN2A 4ETSA 3L09A 1AU7A 2R7RA 3A01B 1MSEC 3TDUC 1MNMC 2CUZA 3LOCA 2XIGA 2FXAA 1S8NA 3AG2H 4L9TA 1VZ0A 3LA2A 1MBJA 3TGNA 3DWLE 4CCOA 2E35A 3IRQA 2IP2A 4EVIA 2VIXA 2DI3A 3IC7A 4KITB 2DFEA 2OBPA 2EV6A 3BTIA 4H4KC 2GIZA 3RJPA 1K6OA 1Y6IA 1W0TA 2O61A 3HHHA 4OOIA 5DCMA 5EF6A 2HYGD 1X58A 1DDNA 3IRRA 4G7OF 2XRNA 1BI1A 3FXLA 3E97A 4IOAF 3HRTA 2MLGA 1Z7UA 1K83J 2CW7A 1YE9A 1F9NA 5LRSA 3J80K 2ZFUA 3RPQA 4LIVA 4UV8A 3RPUA 2B7EA 1UG0A 4DYRA 4HOBA 4A12A 4A3LJ 1NG7A 1ONVA 3OR2C 4Y4RA 1HW1A 2XKPA 5EEHA 4GYIA 2DT6A 2A6HF 2NOJB 3TP3A 5LEJA 2LOOA 2OJED 1EJ9A 1XDSA 3PIPF 1G3TA 1V3FA 2L3DA 4N9HA 4AD9A 3BG5A 3OOPA 4OIRF 2L9NA 1ZTRA 3L00A 1MKMA 2XKOA 4X6AJ 2DQRA 1I6XA 2HR3A 4NC6A 2F4MB 4O5VA 5J1YA 4U87A 2HQRA 3S8PA 3E3VA 1OCOH 3S2DJ 3I58A 4LMYA 1AWCA 5C44J 5AONA 1WZ2A 5FKLA 1D0ZA 1J75A 4MEXF 2YU3A 5JVGF 2PI0A 2DK8A 3K4BA 3BZCA 2L7KA 2DFHA 2DMTA 2K4BA 2MSYA 3FMSA 4QPQA 2RAEA 2ISZA 2BHZA 3PQJA 3QP5A 1R1UA 4CO8A 1WSUA 3ZMZA 1W1WE 5HNHA 1MIJA 2EIMH 2M8EA 4JYKA 1FYKA 1HBXG 2OTJI 4AWXB 2HOAA 3F22A 1Y8RB 5FB2A 1AKHA 3V8KA 3EQLF 1HLVA 2HGCA 2H6BA 2GOMA 4ESJA 4EJVA 1UFMA 3S32A 3PFIA 1ZGWA 5E8IA 2ZJRF 2O8KA 3LA3A 2NVTJ 2X4HA 3E1SA 4FHTA 1RUNA 5EGOB 2RKHA 2Q2EA 4RLQA 1FOYA 3HXLA 4MFEA 4R79A 4HDVA 1Z9CA 1LKXA 3HGYA 2NYXA 3GYHX 3CMAI 4LG0A 3ZXSA 2DA2A 1N77A 1P4WA 3QOPA 4ZYHA 2HQ5A 3DKYA 3H0GJ 1OQYA 4BGDA 3FXJA 3F6OA 4XKVA 3GZ5A 4HG2A 1U8BA 2LMDA 3ZQIA 2R7DA 4Z6YA 2VC0A 2OTLI 1VQ9I 2NVYJ 3ZMSA 4AYBA 1U5TA 2XF5A 2EV5A 2CYYA 1J09A 3KYDB 2XASA 2LY9A 4BE2A 4Y15A 1KA8A 2EZLA 3FX3A 4BBSJ 1FX7A 4ZDOA 1S29A 5D5XB 2E2JJ 1U9OA 3MFKA 5M3FJ 5IY5H 4D9JA 4J19A 1FBQA 4RMNA 1F43A 4HYEA 1LUJB 4UV9A 1E17A 5LLQA 1TW2A 2PMZN 4DZJA 1OYWA 3RI4A 1BI2A 3OYBA 3FISA 2LC2A 4M73A 1ZELA 4OU0A 1VQ4I 2IS6A 5IYDJ 2P6TA 4M9ZA 3GF2A 1SEUA 3LQQA 5A2QK 3ZGKA 3J80Z 2P5VA 4RB0A 2W57A 2VE9A 1BBYA 1SD4A 2IEKA 4WK8F 2IGKA 3RYRA 1B72B 1JUSA 1R5HA 3ABKH 4DQ2A 1YW7A 5E8GA 4BEHA 4HLYA 2HFHA 4Y17A 5LFAA 4YFXF 3TW7A 2KJBA 2OZUA 4FX4A 2GA2A 4EM1A 1JUMA 5CKTA 1S3JA 4B48A 3I59B 4BU2A 1XGNA 1SFXA 3FK7A 2K9SA 1JGGA 4ZYAA 4E7JA 2M34A 4GYGA 4C30A 4KYWA 2DJNA 3NEUA 5E3NA 4UUSB 3S2HJ 2E1MB 5LHGA 1U8RA 3S3NA 2CQ7A 2MG4A 2A07F 4OAZA 4HF1A 1CGPA 1O7LA 2Y30A 3ABTA 2QUFA 2DK5A 2KJCA 4DJAA 3A0HC 4B4CA 1R7JA 5JHUA 1B4AA 2QQAA 2XF6A 2HXIA 2M4KA 5J6XA 5L3EA 4WWCA 3CP2A 3PQKA 3OYMA 2EJRA 1YTYA 1QZZA 1QRYA 1ZRFA 2FD5A 5KNLA 1R23A 2AHQA 2QKLB 3CQZJ 2EZKA 3F3XA 5TRDA 4L18B 2E1OA 2AQFA 3K4LA 3FBIB 1QNTA 2H27A 1Q1HA 4HDUA 3K1PA 2CQKA 3DBLB 1BIAA 2XV4S 3H9QA 1W36D 1YJWI 3H3VK 2ID6A 2OU2A 2Q0OA 3S15J 3E6MA 4BYYA 4HSRA 5FKMA 2E60A 1JKOC 2IT0A 2ZXIA 3H0DA 2V1UA 4G12A 3C3WA 3EUHC 4EJOA 2WB1N 3FIWA 1JKQC 3HM5A 3HSFA 5CVRA 2BY1A 3SHFA 3M8FA 3REOA 4BQAA 2QM3A 4I98B 3IH3A 4M6VA 1OPCA 2PMHA 4E7LA 3U1DA 3OL4A 3ZRGA 2DYRH 1A6QA 2JPCA 1TT5B 5F08A 3CCEI 3GTGJ 3K9TA 4Y52J 2IAIA 3SFIA 2O3FA 1X2NA 1SC7A 4PFPA 3JRHA 2M0CA 3BP8A 5ED4A 3SQNA 1W0UA 1J7KA 3UKGA 1WJ5A 4OINF 5M5WJ 3EETA 1IG7A 1I27A 4JQFA 4XRMA 3I0TA 3LSHA 5FKKA 1YHQI 3I53A 3CJTB 2V1DA 3Q3SA 1TBXA 3ULQB 3CUOA 1JXSA 1T08B 1ZAOA 2HXOA 3O3KA 3CO7C 1BL0A 2IGNA 4K2EA 4PUSA 1UAAA 4C2TA 4F55A 2L4AA 2F5DA 4RM3A 2KDZA 4NC8A 1EH8A 4U7DA 3T8TA 2A69F 2HDDA 1OJLA 2O03A 4AUXA 2F6CA 3S1MJ 4HF0A 1X1DA 2ZXJA 1PYVA 3E6CC 2MA3A 3V8LA 2GXBA 2D45A 2E71A 2HOSA 1ETQA 2GAUA 2O9LA 1E3OC 2W24A 4C9YA 2IVMA 5L3GA 2Y31A 3L2WA 3F8MA 4ESFA 4XMYA 4D5FA 1A35A 4FX0A 2PBIA 1FY7A 1WKMA 2GM4A 1K4TA 2M5WA 3S3OA 3DU6A 3MZYA 4II2A 3ZP5A 1FOXA 2R7TA 3R0AA 4U7BA 2X85A 5FLXK 2M1BA 2FRHA 2BBYA 1FZPB 2QEXI 4ENKA 1PUEE 4EM2A 1EH7A 4FISA 4RM2A 4Y3OA 2DDBA 2H1KA 2EV0A 2KLOA 2HU9A 3ABLH 5J4YA 4CHUA 1IN4A 5J3LA 3IUOA 3W2WA 3J7ZI 2BYVE 1FOKA 1VQNI 2PMZA 1XGMA 2A61A 2LH9A 3FKIJ 3CCRI 3L9FA 2KIUA 1KU7A 4S0HB 3M4OJ 2DA4A 1MBEA 3FXUA 2VUMJ 4L5IA 5TGTA 3BR5A 3P9CA 2FNAA 4U0YA 1EKEA 2V9KA 1ZR4A 2M3AA 5DDGA 3N05A 2VT2A 2DODA 4ZDLA 3I54A 1S7OA 3P5JA 4LD5A 3B02A 5DV5A 4QSHA 3TMOA 3BOQA 3RKXA 3TL4X 1G3SA 3GFJA 5L3FA 3H3UA 2LYCA 1ZK8A 3KYCB 3QPSA 3HG9A 2Z1DA 4XR6A 2CO5A 2O0YA 2P8TA 2W25A 2M8GX 4IHYA 3TOAA 3OSGA 3S1QJ 1MJAA 4BDZA 2K40A 2QSHX 3BG3A 3HIFA 1QZYA 4BE0A 3OIPA 2I5UA 2VONA 4I2OA 1IN8A 2FBKA 2XDVA 3KP7A 2DW4A 4IZZA 3JW4A 1TC3C 3L2QA 3GWZA 1GHCA 3TEDA 4HPQA 4RBOA 3IKTA 2H6CA 4IL6C 1J0RA 1MBGA 2CJJA 2R3SA 4D7MA 2ICWG 2IS2A 3CMMA 2B9SA 5CQEA 5FFXA 4ZZDA 2Y48A 2NS8A 3DPUA 2I10A 2ZC2A 3I4PA 3ZQQA 2DMPA 3SDBA 4PDKA 2PMUA 2X6WA 2Y9YA 3H92A 4PJJA 2GXGA 3DCFA 4O3MA 2YS9A 2UUZA 3EUHA 4IO9F 2CSOA 1YJNI 2FQ3A 2ZJQF 2LD5A 4YIFA 2VN2A 1V54H 2I8DA 3PNTA 3RKWA 3BZKA 1O4XA 4EJTA 2MH9A 1D1BA 2ZO4A 4E7ZA 4F93B 3K4KA 1KQ9A 2WB1A 2RDPA 3UNGC 4ZYEA 2L0KA 4XOTA 4BY1J 5FLXZ 2KZVA 4KA4A 3HOTA 4DW6A 4BL0B 1LDDA 3W2AA 3KLOA 1SFOJ 1LPQA 1OKRA 1RPWA 1X3UA 3ML6A 3L1PA 2EA2A 2PJRB 2NXNB 2H8WA 4NDLA 2YPRA 4WX9A 2EPFA 3A1YA 3HB9A 3J7AY 2WY7Q 4LLGF 1P9QC 2CG4A 2VOOA 1O3SA 3H3ZA 3VYSB 3GFMA 3I64A 1BC7C 5FLVA 1HKQA 4PSWA 2EFNA 4M3EA 3HUGA 1FYLA 2A05A 1EH6A 2R7UA 2ECCA 3GZ6A 4Y7NJ 2ME6A 4J00A 2VKHA 3KE2A 4D7NA 4U88A 3FM5A 4UB6C 4V2FA 3VODA 1HQCA 4BBRJ 3G73A 3G1LA 4CXFA 3LNQA 1DPRA 2D2WA 1HF0A 1D3YA 2AQEA 1TW3A 4YFNF 6PAXA 3HKZN 4HF2A 2Y9ZA 2XSDC 4QPOA 1MJ9A 3RPUD 5CPRB 2P5LC 2E7XA 3RQ4A 1RR7A 5FGMA 2F4OB 1K6YA 2DU9A 4G6DA 5D4RA 3DKWA 1D1AA 2BE5F
chains in the Genus database with same CATH topology
2TDXA 5AIQA 1GVJA 4IHSA 4S05A 3TDZC 1ZG1A 5DUKA 5LGUA 2EB7A 4NB5A 3NQOA 2XAQA 1KU2A 2F5CA 1YYVA 1KGSA 3GFLA 3GX4X 2H09A 4H0EA 4RB2C 5L3CA 2DFIA 5CVJA 4HV6A 1O3RA 4EJUA 1LB2A 4BAYA 1G3WA 1D5VA 4PGGA 4MQ9F 3C18A 3CLOA 4L9NA 3T0YA 1QPMA 1HW5A 5DUIA 2ZFWA 1ON1A 4CICA 3R0JA 1S6LA 4G7HF 2HTJA 3S2WA 1PP7U 2H94A 1P4AA 4UHTA 5BPIA 3HRSA 3CTAA 1LNWA 1IUYA 5LEKA 3EYIA 4UVBA 5H6RA 4HZFA 3IWFA 4DNCA 4BHCA 2LF7A 4G94A 2E7WA 3DP7A 2RGVA 1XSDA 4P5OA 4OIPF 1E2XA 3GVAA 1KQ0A 1YLFA 3C1DA 1LEAA 3L2CA 4RAZA 3E5QA 1T6SA 2ESNA 3BJOA 2ETHA 3D0SA 1DP7P 5FD5A 1IN6A 2EFOA 3JAMZ 4EM0B 3LQRA 2NS0A 3MCZA 2P7CB 3GXOA 2STWA 3KP4A 4LK0F 3MEXA 4HA8A 3WTTC 3ZMTA 1BN5A 4CZZA 5JFRA 2HYFA 1ZHFA 1IF1A 4O6JA 4F7ZA 4IPAA 4NQWA 2DTRA 3FXRA 4HX7A 3GFIA 2YX4A 1LQ1A 1SD5A 3P7NA 2EK5A 5HS8A 2L02A 4M6YA 1FLIA 2JSCA 1YFHA 1AOYA 4MGRA 1Z6TA 4MTEA 3KFWX 4RB1A 2Y75A 4P96A 3GLXA 2VC1A 2XROA 2XUBA 2NAZA 1WQ2A 3Q9SA 5LGTA 1O7FA 3KETA 4MNUA 3R60A 4BNCA 2STTA 2CGPA 2GZWA 3KEQA 4U0VA 4M71A 5HOOA 3OV8A 1TQPA 2QBYB 2XAGA 2M45A 5D5VB 3ZPLA 4A5NA 3I59A 1K79A 3EYYA 3N97A 2M30A 2V9VA 3DV8A 4ENMA 1G6NA 1FBSA 4FT8A 4G6QA 5ICCA 2FNPA 1SAXA 2HKOA 1R58A 3ZMVA 2G7HA 2QVOA 1ZREA 3WTUC 2RVCA 1W7PA 5FD6A 2EFPA 1ZG5A 1XCBA 3C7JA 3K1NA 4WXHA 4EGYA 4ZYDA 4A6DA 4IHTA 3QP6A 1W4MA 5J8CA 3BDDA 2IA2A 4M74A 1R1VA 2VODA 3FMQA 3DF8A 3Q5FA 1IXRC 3QPHA 4HX8A 1TQMA 2IRFG 1YQAA 4UNOA 4G9YA 2Q8KA 5LHHA 3BJAA 4I0AA 1KU9A 2BGCA 1J5YA 1YS6A 1YS7A 4N0BA 2XAJA 1JGSA 1LJ9A 3HSRA 5BMZA 5BOXA 5JI6A 4MTDA 5BQTA 2OQRA 2G7UA 5HS9A 2D1VA 2J5OA 2JZYA 1P6RA 4LLLA 1U5TB 1U6GA 2K86A 4LFUA 1HSJA 1IRFA 3KP2A 2LNBA 1J2XA 4LGWA 5E20A 2RQPA 5J8FA 2EFWA 3HTUA 1XMAA 1MJBA 2BE5F 5CJ9A 5EEGA 1UB9A 3FXQA 5D8LB 2QENA 4LLNA 1FSEA 2UWMA 2MLKA 3JSOA 2O6GE 2VBXA 3ECHA 1T2KA 3R6SA 1GXPA 3ROUA 2IPQX 3I5UA 3WTZA 3M7GA 3K69A 4A2UA 1I1SA 5F6FA 1MGTA 4CDGA 2F5EA 5CYVA 3IHUA 5DEQA 2VOPA 1ZGJA 4L9JA 3F23A 1P4XA 1JE8A 1J59A 2K4JA 2E1CA 5E1WA 2J5PA 1SMTA 1IZ1A 2JT1A 3WTWC 2FMYA 4AIHA 1CF7B 2CFXA 4A0YA 5ILUA 2YR2A 2XVCA 4PGHA 1B1BA 1FWZA 2LKPA 4ZH4F 3HRUA 2EA4A 2IJLA 1XSVA 2XAFA 2G9WA 1TQIA 3WE3A 3I71A 3KCCA 3E6DA 3HTSB 2B0LA 2GIVA 3MQ0A 1SFEA 1BJAA 4M6XA 1R36A 3JTGA 2JTVA 1ODDA 3KEOA 1BM9A 3SZTA 1D8KA 2MC3A 2FU4A 2P6SA 3F21A 1QO0D 4Q47A 4WXCA 2RNJA 1BI3A 4EJWA 5LGNA 4I0BA 2L01A 2X0LA 3KP5A 1K78A 3VFZA 2KIFA 3DFGA 3FMRA 2VBWA 5KVRA 1KYWA 4CGZA 1UCRA 4ON0A 4I01A 3ECOA 1LEBA 2AXLA 4G7ZF 5HLGA 1ZRDA 1IW7F 4KMFA 2MBFA 2L54A 4AIJA 2UXXA 1F4KA 4R1HA 4ZZLA 1XD7A 1REPC 4RB3C 3GO5A 4L9VA 3J7AO 4RAYA 2GA1A 4YG2F 2OQGA 3T5XA 1F1ZA 2L4MA 1JHFA 5L3DA 2ADUA 2DBBA 3BJ6A 2DO7A 4XRFA 2CWEA 3CO6C 3DXJF 4RGXA 4UVCA 4IRHA 2PQ8A 3IKVA 3ISPA 4Q4ZF 4HBLA 1I1GA 3T8RA 1DUXC 1QQIA 1TTYA 5HDGA 2FF4A 2FMLA 2HWVA 1B9MA 4MQVA 4L0YB 4ZYGA 5D5UB 1FNNA 5E17F 4S04A 3F72A 1HXDA 2ELHA 1MDMA 3HYIA 2QLZA 4RGUA 3QRFF 1J9IA 1Z6RA 3RTRA 3BY6A 3JAMK 1TLHB 2A3SA 2HS5A 1SFUA 4Y13A 1D8JA 4ESBA 5H6QA 2E1NA 2COMA 4B09A 1LVAA 5HS7A 4A6EA 4I02A 2OD5A 2ZNYA 3ZQ7A 1YO5C 1IRGA 1JHHA 1QGPA 4HAMA 1XDUA 4L0ZB 1BIBA 2HTSA 2K27A 1LDJA 2A68F 1Y0UA 3DPTA 1Z05A 3LWFA 3DQVC 1BI0A 1S7AA 2NNNA 2Z99A 1RZ4A 2A6EF 4I09A 2NNYA 5HVQC 4IJAA 4XLNF 4OIOF 1P2FA 2ZJ2A 1R00A 3BZ6A 1IAWA 4AVPA 1G4DA 4A5MA 2ZMEB 5D5WB 2DPUA 3J81K 4KFCA 5JVTA 4QLCU 2VBYA 3KZYA 2HZTA 3M1EA 2UXNA 1T38A 2ISYA 5IT9K 2FBIA 1F5TA 3FHZA 1OYIA 1W7PD 3WG9A 3CUQB 4HV5A 3GW2A 1T0FA 1YG2A 1HKTA 1IN5A 4XSXF 3WU0A 2KKOA 4HQEA 5LRRA 2XAHA 3P9IA 3WTXC 5D8KB 2OA4A 1FP2A 1STZA 1L0OC 3FM3A 1BC8C 1YW8A 4GGGA 1IN7A 5CVIA 4A0XA 1XB4A 1R5GA 4LK1F 5FO5A 3DPLC 1ZYRF 2PN6A 2WV0A 2QWWA 2QBYA 4YFKF 1W5TA 4P9FA 1ON2A 4KUMA 1T39A 1ZG3A 3BROA 1UHWA 3HHGA 1OMIA 4I7HA 3D5LA 2KRFA 4U0WA 3RIRA 1I5ZA 3KLNA 2P7VB 3VEPA 5TJJA 3K1MA 3NRVA 3COAC 1KU3A 3V4GA 3GUDA 2LDUA 1ZRCA 2EWNA 2K7LA 4E70A 2WWYA 3KP3A 2HEOA 3R4KA 3LFKA 4IVNA 3IWZA 4GO1A 4YIIA 2JPBA 1RUOA 5CVUA 1HW2A 1FP1D 3WU1B 3LSTA 4UXNA 4NHJA 4AIKA 2CW0F 1ZGAA 3M8EA 3WGGA 5BPDA 3FWEA 4P9UA 5KK1A 5K5QA 1VTNC 3ZMDA 4HQMA 2D1HA 3O2PE 5DCMB 3J81Z 2RN7A 1XGOA 4A0ZA 5IT9Z 1WI9A 2PG4A 2P5KA 2FOKA 1NHAA 4OMZA 3U2RA 4L5JA 2IA0A 4M72A 2XHKA 1XGSA 3TKYA 3ELKA 3EDPA 1GXQA 2OAZA 1A04A 3BPXA 3QU3A 2NRAC 4EMSA 4KN4X 3WGHA 2ESHA 2QQ9A 1FBUA 2IA1A 2V6CA 1TNTA 3ERED 3TO6A 5L3BA 2F5FA 1KQ8A 5ICFA 4BHPA 2WTEA 3E5UA 2RV8A 1WRJA 5JR3A 1QBJA 5K5OA 1SD6A 3WE2A 3QU6A 2FE3A 5F64A 4JK1X 4LG0B 2Z5UA 3V8JA 3CDHA 1USSA 1XN7A 1L3LA 3FF5A 2LSOA 3E5XA 4CYDA 1HSTA 4UUVA 4KIBA 4LB5A 1U78A 4QWQA 1FC3A 3TQNA 3LAJA 1RIOH 3V7RA 3K2ZA 5LBQA 2HQNA 3TOBA 1W7PB 3F8NA 4LB6B 4R8HA 3L7WA 4M9XA 3LA7A 4LJZF 4EQQA 4IF4A 4MHGA 1SD7A 1RI7A 1CF7A 4EV0A 2DT5A 4HX4A 3M9AA 1U2WA 3W6KB 1B6AA 2Z33A 2WC2A 1O3TA 2Y0MA 1ZLKA 3BPVA 4PZJA 3R61A 1RNLA 2C6YA 2YSRA 5ERIA 4KIFA 2JRTA 1G3YA 4XLPF 1FSHA 2DLLA 2PJPA 2KIMA 3P9KA 2ZNZA 4Q48A 2IW5A 4D0PA 2BEOA 4JBAA 3TO9A 2XGXA 2A5YB 4RGSA 4KMUX 5A2QZ 1IXSB 1O57A 2ZBKA 1FPQA 2BV6A 4RGRA 3F8CA 2FSWA 4IXAA 3WGIA 3KP6A 2VXZA 5CVVA 5BS6A 4IRIA 1B59A 4GCVA 4B8XA 4P55A 3QAHA 3W6JB 3F8FA 3SXYA 1K7AA 2P4WA 3T1BA 1BOAA 2ZCWA 3CJNA 3V7CA 4KNYA 4MEYF 3RYPA 5DD4A 4WXDA 4TV7A 3WTYC 5E1XA 1YW9A 1KYZA 1TNSA 3B73A 3BWGA 3N4MA 3CUQC 1EV7A 5CLSA 3WTVC 1T98A 4EGZA 3VOEA 5H20A 2GQQA 2O8XA 1B9NA 1ZH5A 3G3ZA 2DPDA 4KIGA 2HKXA 4PCQA 1PP8F 1W5SA 3ZN1A 2QZ8A 2ACJA 3AAFA 3GEZA 2V79A 1SMYF 5K1YA 4OIQF 3SFZA 4HLXA 5DYMA 1XMKA 4XSZF 2DQLA 1ZLJA 2RC4A 3MWMA 4OMYA 1R22A 2PLYA 3Q9VA 2ZKZA 2R7FA 2OZ6A 1P92A 1Z91A 2FA5A 2W84A 1FYMA 4RS8A 1V4RA 3FZVA 5DCFA 2W85A 1OYYA 3RDIA 1LDKB 1H0MA 4XBFA 3IL2A 4N9IA 4KT5C 5DD8A 3ZMUA 1K78B 1MD0A 3F8BA 5ICGA 4M9SA 2HDCA 2UZKA 1U3EM 5D6FA 5HLHA 4WCGA 3HSEA 3KZZA 4BXUA 3ABUA 1Z1DA 4KN7X 5E18F 1H9TA 5D6EA 4Q5SF 1FT9A 4HW0A 5K5RA 2QQBA 3DEUA 4KICA 3QPTA 1YIOA 2M87A 3F6VA 5D4SA 3E6BA 4ENJA 1O3QA 1H9GA 2V1XA 3JSPA 4WF2A 5ILVA 3V7SA 2HOEA 2VBZA 5LHIA 5FFZA 5ILSA 4G8XA 2PEXA 1UHMA 2ZMEA 1XCVA 1ZARA 5F1RA 1USTA 3RKYA 2GWRA 1HKSA 1C0WA 3JTHA 4GXOA 2Z3YA 1IXCA 2MD5A 5HLIA 4IRGA 5ICEA 4Z2YA 3CUQA 1OR7A 4BHBA 3VB2A 2FBHA 2DAOA 5HDNA 3U9GA 1ULYA 3SZPA 2VE8A 3MAJA 1DPUA 2F2EA 2K02A 3HOSA 2VT3A 1U5TC 3WODF 1PDNC 1XSXA 3HRMA 5E1ZB 2MH2A 1MDMB 5HDKA 2Z9OA 5AIPA 4KDPA 4UVAA 3O6BB 2FEZA 3WTSC 2EFQA 3TO7A 5IT3A 4BH9A 1R1TA 3ZN0A 3MZHA 1MZBA 4ASNA 2QYOA 2YX7A 2LF8A 4ENNA 3K0LA 1WWXA 2AS5F 2PFBA 1ZN2A 4ETSA 3L09A 3TDUC 2XIGA 2FXAA 1S8NA 4L9TA 3LA2A 3TGNA 3IRQA 2IP2A 4EVIA 2DI3A 3IC7A 2OBPA 2EV6A 3RJPA 1K6OA 2O61A 3HHHA 4OOIA 5DCMA 2HYGD 1DDNA 3IRRA 4G7OF 2XRNA 1BI1A 3E97A 3HRTA 2MLGA 1Z7UA 1F9NA 5LRSA 3J80K 3RPQA 4UV8A 3RPUA 4A12A 4HOBA 1ONVA 1HW1A 2XKPA 5EEHA 4GYIA 2A6HF 5LEJA 1XDSA 1G3TA 1V3FA 2L3DA 4N9HA 4AD9A 3OOPA 4OIRF 3L00A 1MKMA 2XKOA 2DQRA 1I6XA 2HR3A 4O5VA 2HQRA 3E3VA 3I58A 4LMYA 1AWCA 5AONA 1J75A 4MEXF 2YU3A 2PI0A 2DK8A 2K4BA 3FMSA 2ISZA 3PQJA 3QP5A 1R1UA 4CO8A 1WSUA 3ZMZA 2M8EA 1FYKA 1HBXG 4AWXB 3F22A 5FB2A 3V8KA 3EQLF 2HGCA 2H6BA 4ESJA 1UFMA 3PFIA 5E8IA 3LA3A 2X4HA 4FHTA 1RUNA 2RKHA 2Q2EA 4R79A 4HDVA 1Z9CA 2NYXA 3GYHX 4LG0A 1P4WA 3QOPA 4ZYHA 3F6OA 3GZ5A 2R7DA 2VC0A 3ZMSA 1U5TA 2EV5A 2CYYA 2XASA 4Y15A 1KA8A 3FX3A 1FX7A 1S29A 5D5XB 3MFKA 1FBQA 4HYEA 4UV9A 1E17A 5LLQA 1TW2A 1OYWA 3RI4A 1BI2A 4M73A 4OU0A 2P6TA 4M9ZA 3GF2A 3LQQA 5A2QK 3J80Z 2P5VA 4RB0A 2W57A 2VE9A 1BBYA 1SD4A 4WK8F 3RYRA 1R5HA 4DQ2A 1YW7A 5E8GA 4HLYA 2HFHA 4Y17A 4YFXF 2KJBA 2OZUA 4FX4A 2GA2A 4EM1A 1S3JA 3I59B 1XGNA 1SFXA 4GYGA 4KYWA 3NEUA 5LHGA 1U8RA 2A07F 4HF1A 1CGPA 1O7LA 3ABTA 2QUFA 2DK5A 2KJCA 1R7JA 5JHUA 1B4AA 2QQAA 5J6XA 5L3EA 4WWCA 3PQKA 2EJRA 1YTYA 1QZZA 1ZRFA 1R23A 5TRDA 3F3XA 4L18B 1QNTA 2H27A 1Q1HA 4HDUA 3K1PA 2CQKA 1BIAA 2XV4S 2OU2A 2Q0OA 3E6MA 4BYYA 2IT0A 2V1UA 3C3WA 4EJOA 3HSFA 5CVRA 3SHFA 3M8FA 3REOA 4BQAA 2QM3A 4I98B 1OPCA 2PMHA 3U1DA 2JPCA 3K9TA 2O3FA 3BP8A 5ED4A 3SQNA 1J7KA 4OINF 3EETA 1I27A 4JQFA 3I0TA 3I53A 2V1DA 1TBXA 3ULQB 3CUOA 1JXSA 3O3KA 1ZAOA 3CO7C 4K2EA 2L4AA 2F5DA 1EH8A 4U7DA 3T8TA 2A69F 2O03A 4HF0A 2ZXJA 3E6CC 2MA3A 3V8LA 2GXBA 2D45A 2GAUA 2W24A 2IVMA 5L3GA 3F8MA 4ESFA 4FX0A 2PBIA 1FY7A 1WKMA 2M5WA 3MZYA 3ZP5A 3R0AA 4U7BA 5FLXK 2M1BA 2FRHA 2BBYA 1FZPB 4ENKA 1PUEE 4EM2A 1EH7A 2EV0A 4CHUA 1IN4A 2BYVE 1FOKA 1XGMA 2A61A 3L9FA 2KIUA 1KU7A 3FXUA 4L5IA 3P9CA 2FNAA 4U0YA 5DDGA 2VT2A 3I54A 1S7OA 4LD5A 3B02A 5DV5A 3BOQA 3RKXA 1G3SA 3GFJA 5L3FA 3H3UA 2CO5A 2O0YA 2P8TA 2W25A 3TOAA 1MJAA 3HIFA 1QZYA 2VONA 4I2OA 1IN8A 2FBKA 3KP7A 2DW4A 3JW4A 3GWZA 1GHCA 3IKTA 2H6CA 1J0RA 2R3SA 5FFXA 4ZZDA 2Y48A 3I4PA 4PDKA 2PMUA 3H92A 2GXGA 4O3MA 3EUHA 2CSOA 2FQ3A 4YIFA 2VN2A 3RKWA 4EJTA 2MH9A 2ZO4A 1KQ9A 2RDPA 4ZYEA 5FLXZ 4KA4A 3HOTA 1LDDA 3KLOA 1OKRA 1X3UA 3ML6A 2EA2A 2YPRA 4WX9A 4LLGF 2CG4A 2VOOA 1O3SA 3H3ZA 3GFMA 3I64A 1BC7C 1HKQA 2EFNA 3HUGA 1FYLA 1EH6A 3GZ6A 3KE2A 4U88A 3FM5A 3VODA 1HQCA 3G73A 4CXFA 1DPRA 2D2WA 1D3YA 6PAXA 1TW3A 4YFNF 4HF2A 1MJ9A 2P5LC 2E7XA 5FGMA 2DU9A 4G6DA 5D4RA 3DKWA 3LAPA 4EJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TDX A;  5AIQ A;  1GVJ A;  4IHS A;  4S05 A;  3TDZ C;  1ZG1 A;  5DUK A;  5LGU A;  2EB7 A;  4NB5 A;  3NQO A;  2XAQ A;  1KU2 A;  2F5C A;  1YYV A;  1KGS A;  3GFL A;  3GX4 X;  2H09 A;  4H0E A;  4RB2 C;  5L3C A;  2DFI A;  5CVJ A;  4HV6 A;  1O3R A;  4EJU A;  1LB2 A;  4BAY A;  1G3W A;  1D5V A;  4PGG A;  4MQ9 F;  3C18 A;  3CLO A;  4L9N A;  3T0Y A;  1QPM A;  1HW5 A;  5DUI A;  2ZFW A;  1ON1 A;  4CIC A;  3R0J A;  1S6L A;  4G7H F;  2HTJ A;  3S2W A;  1PP7 U;  2H94 A;  1P4A A;  4UHT A;  5BPI A;  3HRS A;  3CTA A;  1LNW A;  1IUY A;  5LEK A;  3EYI A;  4UVB A;  5H6R A;  4HZF A;  3IWF A;  4DNC A;  4BHC A;  2LF7 A;  4G94 A;  2E7W A;  3DP7 A;  2RGV A;  1XSD A;  4P5O A;  4OIP F;  1E2X A;  3GVA A;  1KQ0 A;  1YLF A;  3C1D A;  1LEA A;  3L2C A;  4RAZ A;  3E5Q A;  1T6S A;  2ESN A;  3BJO A;  2ETH A;  3D0S A;  1DP7 P;  5FD5 A;  1IN6 A;  2EFO A;  3JAM Z;  4EM0 B;  3LQR A;  2NS0 A;  3MCZ A;  2P7C B;  3GXO A;  2STW A;  3KP4 A;  4LK0 F;  3MEX A;  4HA8 A;  3WTT C;  3ZMT A;  1BN5 A;  4CZZ A;  5JFR A;  2HYF A;  1ZHF A;  1IF1 A;  4O6J A;  4F7Z A;  4IPA A;  4NQW A;  2DTR A;  3FXR A;  4HX7 A;  3GFI A;  2YX4 A;  1LQ1 A;  1SD5 A;  3P7N A;  2EK5 A;  5HS8 A;  2L02 A;  4M6Y A;  1FLI A;  2JSC A;  1YFH A;  1AOY A;  4MGR A;  1Z6T A;  4MTE A;  3KFW X;  4RB1 A;  2Y75 A;  4P96 A;  3GLX A;  2VC1 A;  2XRO A;  2XUB A;  2NAZ A;  1WQ2 A;  3Q9S A;  5LGT A;  1O7F A;  3KET A;  4MNU A;  3R60 A;  4BNC A;  2STT A;  2CGP A;  2GZW A;  3KEQ A;  4U0V A;  4M71 A;  5HOO A;  3OV8 A;  1TQP A;  2QBY B;  2XAG A;  2M45 A;  5D5V B;  3ZPL A;  4A5N A;  3I59 A;  1K79 A;  3EYY A;  3N97 A;  2M30 A;  2V9V A;  3DV8 A;  4ENM A;  1G6N A;  1FBS A;  4FT8 A;  4G6Q A;  5ICC A;  2FNP A;  1SAX A;  2HKO A;  1R58 A;  3ZMV A;  2G7H A;  2QVO A;  1ZRE A;  3WTU C;  2RVC A;  1W7P A;  5FD6 A;  2EFP A;  1ZG5 A;  1XCB A;  3C7J A;  3K1N A;  4WXH A;  4EGY A;  4ZYD A;  4A6D A;  4IHT A;  3QP6 A;  1W4M A;  5J8C A;  3BDD A;  2IA2 A;  4M74 A;  1R1V A;  2VOD A;  3FMQ A;  3DF8 A;  3Q5F A;  1IXR C;  3QPH A;  4HX8 A;  1TQM A;  2IRF G;  1YQA A;  4UNO A;  4G9Y A;  2Q8K A;  5LHH A;  3BJA A;  4I0A A;  1KU9 A;  2BGC A;  1J5Y A;  1YS6 A;  1YS7 A;  4N0B A;  2XAJ A;  1JGS A;  1LJ9 A;  3HSR A;  5BMZ A;  5BOX A;  5JI6 A;  4MTD A;  5BQT A;  2OQR A;  2G7U A;  5HS9 A;  2D1V A;  2J5O A;  2JZY A;  1P6R A;  4LLL A;  1U5T B;  1U6G A;  2K86 A;  4LFU A;  1HSJ A;  1IRF A;  3KP2 A;  2LNB A;  1J2X A;  4LGW A;  5E20 A;  2RQP A;  5J8F A;  2EFW A;  3HTU A;  1XMA A;  1MJB A;  2BE5 F;  5CJ9 A;  5EEG A;  1UB9 A;  3FXQ A;  5D8L B;  2QEN A;  4LLN A;  1FSE A;  2UWM A;  2MLK A;  3JSO A;  2O6G E;  2VBX A;  3ECH A;  1T2K A;  3R6S A;  1GXP A;  3ROU A;  2IPQ X;  3I5U A;  3WTZ A;  3M7G A;  3K69 A;  4A2U A;  1I1S A;  5F6F A;  1MGT A;  4CDG A;  2F5E A;  5CYV A;  3IHU A;  5DEQ A;  2VOP A;  1ZGJ A;  4L9J A;  3F23 A;  1P4X A;  1JE8 A;  1J59 A;  2K4J A;  2E1C A;  5E1W A;  2J5P A;  1SMT A;  1IZ1 A;  2JT1 A;  3WTW C;  2FMY A;  4AIH A;  1CF7 B;  2CFX A;  4A0Y A;  5ILU A;  2YR2 A;  2XVC A;  4PGH A;  1B1B A;  1FWZ A;  2LKP A;  4ZH4 F;  3HRU A;  2EA4 A;  2IJL A;  1XSV A;  2XAF A;  2G9W A;  1TQI A;  3WE3 A;  3I71 A;  3KCC A;  3E6D A;  3HTS B;  2B0L A;  2GIV A;  3MQ0 A;  1SFE A;  1BJA A;  4M6X A;  1R36 A;  3JTG A;  2JTV A;  1ODD A;  3KEO A;  1BM9 A;  3SZT A;  1D8K A;  2MC3 A;  2FU4 A;  2P6S A;  3F21 A;  1QO0 D;  4Q47 A;  4WXC A;  2RNJ A;  1BI3 A;  4EJW A;  5LGN A;  4I0B A;  2L01 A;  2X0L A;  3KP5 A;  1K78 A;  3VFZ A;  2KIF A;  3DFG A;  3FMR A;  2VBW A;  5KVR A;  1KYW A;  4CGZ A;  1UCR A;  4ON0 A;  4I01 A;  3ECO A;  1LEB A;  2AXL A;  4G7Z F;  5HLG A;  1ZRD A;  1IW7 F;  4KMF A;  2MBF A;  2L54 A;  4AIJ A;  2UXX A;  1F4K A;  4R1H A;  4ZZL A;  1XD7 A;  1REP C;  4RB3 C;  3GO5 A;  4L9V A;  3J7A O;  4RAY A;  2GA1 A;  4YG2 F;  2OQG A;  3T5X A;  1F1Z A;  2L4M A;  1JHF A;  5L3D A;  2ADU A;  2DBB A;  3BJ6 A;  2DO7 A;  4XRF A;  2CWE A;  3CO6 C;  3DXJ F;  4RGX A;  4UVC A;  4IRH A;  2PQ8 A;  3IKV A;  3ISP A;  4Q4Z F;  4HBL A;  1I1G A;  3T8R A;  1DUX C;  1QQI A;  1TTY A;  5HDG A;  2FF4 A;  2FML A;  2HWV A;  1B9M A;  4MQV A;  4L0Y B;  4ZYG A;  5D5U B;  1FNN A;  5E17 F;  4S04 A;  3F72 A;  1HXD A;  2ELH A;  1MDM A;  3HYI A;  2QLZ A;  4RGU A;  3QRF F;  1J9I A;  1Z6R A;  3RTR A;  3BY6 A;  3JAM K;  1TLH B;  2A3S A;  2HS5 A;  1SFU A;  4Y13 A;  1D8J A;  4ESB A;  5H6Q A;  2E1N A;  2COM A;  4B09 A;  1LVA A;  5HS7 A;  4A6E A;  4I02 A;  2OD5 A;  2ZNY A;  3ZQ7 A;  1YO5 C;  1IRG A;  1JHH A;  1QGP A;  4HAM A;  1XDU A;  4L0Z B;  1BIB A;  2HTS A;  2K27 A;  1LDJ A;  2A68 F;  1Y0U A;  3DPT A;  1Z05 A;  3LWF A;  3DQV C;  1BI0 A;  1S7A A;  2NNN A;  2Z99 A;  1RZ4 A;  2A6E F;  4I09 A;  2NNY A;  5HVQ C;  4IJA A;  4XLN F;  4OIO F;  1P2F A;  2ZJ2 A;  1R00 A;  3BZ6 A;  1IAW A;  4AVP A;  1G4D A;  4A5M A;  2ZME B;  5D5W B;  2DPU A;  3J81 K;  4KFC A;  5JVT A;  4QLC U;  2VBY A;  3KZY A;  2HZT A;  3M1E A;  2UXN A;  1T38 A;  2ISY A;  5IT9 K;  2FBI A;  1F5T A;  3FHZ A;  1OYI A;  1W7P D;  3WG9 A;  3CUQ B;  4HV5 A;  3GW2 A;  1T0F A;  1YG2 A;  1HKT A;  1IN5 A;  4XSX F;  3WU0 A;  2KKO A;  4HQE A;  5LRR A;  2XAH A;  3P9I A;  3WTX C;  5D8K B;  2OA4 A;  1FP2 A;  1STZ A;  1L0O C;  3FM3 A;  1BC8 C;  1YW8 A;  4GGG A;  1IN7 A;  5CVI A;  4A0X A;  1XB4 A;  1R5G A;  4LK1 F;  5FO5 A;  3DPL C;  1ZYR F;  2PN6 A;  2WV0 A;  2QWW A;  2QBY A;  4YFK F;  1W5T A;  4P9F A;  1ON2 A;  4KUM A;  1T39 A;  1ZG3 A;  3BRO A;  1UHW A;  3HHG A;  1OMI A;  4I7H A;  3D5L A;  2KRF A;  4U0W A;  3RIR A;  1I5Z A;  3KLN A;  2P7V B;  3VEP A;  5TJJ A;  3K1M A;  3NRV A;  3COA C;  1KU3 A;  3V4G A;  3GUD A;  2LDU A;  1ZRC A;  2EWN A;  2K7L A;  4E70 A;  2WWY A;  3KP3 A;  2HEO A;  3R4K A;  3LFK A;  4IVN A;  3IWZ A;  4GO1 A;  4YII A;  2JPB A;  1RUO A;  5CVU A;  1HW2 A;  1FP1 D;  3WU1 B;  3LST A;  4UXN A;  4NHJ A;  4AIK A;  2CW0 F;  1ZGA A;  3M8E A;  3WGG A;  5BPD A;  3FWE A;  4P9U A;  5KK1 A;  5K5Q A;  1VTN C;  3ZMD A;  4HQM A;  2D1H A;  3O2P E;  5DCM B;  3J81 Z;  2RN7 A;  1XGO A;  4A0Z A;  5IT9 Z;  1WI9 A;  2PG4 A;  2P5K A;  2FOK A;  1NHA A;  4OMZ A;  3U2R A;  4L5J A;  2IA0 A;  4M72 A;  2XHK A;  1XGS A;  3TKY A;  3ELK A;  3EDP A;  1GXQ A;  2OAZ A;  1A04 A;  3BPX A;  3QU3 A;  2NRA C;  4EMS A;  4KN4 X;  3WGH A;  2ESH A;  2QQ9 A;  1FBU A;  2IA1 A;  2V6C A;  1TNT A;  3ERE D;  3TO6 A;  5L3B A;  2F5F A;  1KQ8 A;  5ICF A;  4BHP A;  2WTE A;  3E5U A;  2RV8 A;  1WRJ A;  5JR3 A;  1QBJ A;  5K5O A;  1SD6 A;  3WE2 A;  3QU6 A;  2FE3 A;  5F64 A;  4JK1 X;  4LG0 B;  2Z5U A;  3V8J A;  3CDH A;  1USS A;  1XN7 A;  1L3L A;  3FF5 A;  2LSO A;  3E5X A;  4CYD A;  1HST A;  4UUV A;  4KIB A;  4LB5 A;  1U78 A;  4QWQ A;  1FC3 A;  3TQN A;  3LAJ A;  1RIO H;  3V7R A;  3K2Z A;  5LBQ A;  2HQN A;  3TOB A;  1W7P B;  3F8N A;  4LB6 B;  4R8H A;  3L7W A;  4M9X A;  3LA7 A;  4LJZ F;  4EQQ A;  4IF4 A;  4MHG A;  1SD7 A;  1RI7 A;  1CF7 A;  4EV0 A;  2DT5 A;  4HX4 A;  3M9A A;  1U2W A;  3W6K B;  1B6A A;  2Z33 A;  2WC2 A;  1O3T A;  2Y0M A;  1ZLK A;  3BPV A;  4PZJ A;  3R61 A;  1RNL A;  2C6Y A;  2YSR A;  5ERI A;  4KIF A;  2JRT A;  1G3Y A;  4XLP F;  1FSH A;  2DLL A;  2PJP A;  2KIM A;  3P9K A;  2ZNZ A;  4Q48 A;  2IW5 A;  4D0P A;  2BEO A;  4JBA A;  3TO9 A;  2XGX A;  2A5Y B;  4RGS A;  4KMU X;  5A2Q Z;  1IXS B;  1O57 A;  2ZBK A;  1FPQ A;  2BV6 A;  4RGR A;  3F8C A;  2FSW A;  4IXA A;  3WGI A;  3KP6 A;  2VXZ A;  5CVV A;  5BS6 A;  4IRI A;  1B59 A;  4GCV A;  4B8X A;  4P55 A;  3QAH A;  3W6J B;  3F8F A;  3SXY A;  1K7A A;  2P4W A;  3T1B A;  1BOA A;  2ZCW A;  3CJN A;  3V7C A;  4KNY A;  4MEY F;  3RYP A;  5DD4 A;  4WXD A;  4TV7 A;  3WTY C;  5E1X A;  1YW9 A;  1KYZ A;  1TNS A;  3B73 A;  3BWG A;  3N4M A;  3CUQ C;  1EV7 A;  5CLS A;  3WTV C;  1T98 A;  4EGZ A;  3VOE A;  5H20 A;  2GQQ A;  2O8X A;  1B9N A;  1ZH5 A;  3G3Z A;  2DPD A;  4KIG A;  2HKX A;  4PCQ A;  1PP8 F;  1W5S A;  3ZN1 A;  2QZ8 A;  2ACJ A;  3AAF A;  3GEZ A;  2V79 A;  1SMY F;  5K1Y A;  4OIQ F;  3SFZ A;  4HLX A;  5DYM A;  1XMK A;  4XSZ F;  2DQL A;  1ZLJ A;  2RC4 A;  3MWM A;  4OMY A;  1R22 A;  2PLY A;  3Q9V A;  2ZKZ A;  2R7F A;  2OZ6 A;  1P92 A;  1Z91 A;  2FA5 A;  2W84 A;  1FYM A;  4RS8 A;  1V4R A;  3FZV A;  5DCF A;  2W85 A;  1OYY A;  3RDI A;  1LDK B;  1H0M A;  4XBF A;  3IL2 A;  4N9I A;  4KT5 C;  5DD8 A;  3ZMU A;  1K78 B;  1MD0 A;  3F8B A;  5ICG A;  4M9S A;  2HDC A;  2UZK A;  1U3E M;  5D6F A;  5HLH A;  4WCG A;  3HSE A;  3KZZ A;  4BXU A;  3ABU A;  1Z1D A;  4KN7 X;  5E18 F;  1H9T A;  5D6E A;  4Q5S F;  1FT9 A;  4HW0 A;  5K5R A;  2QQB A;  3DEU A;  4KIC A;  3QPT A;  1YIO A;  2M87 A;  3F6V A;  5D4S A;  3E6B A;  4ENJ A;  1O3Q A;  1H9G A;  2V1X A;  3JSP A;  4WF2 A;  5ILV A;  3V7S A;  2HOE A;  2VBZ A;  5LHI A;  5FFZ A;  5ILS A;  4G8X A;  2PEX A;  1UHM A;  2ZME A;  1XCV A;  1ZAR A;  5F1R A;  1UST A;  3RKY A;  2GWR A;  1HKS A;  1C0W A;  3JTH A;  4GXO A;  2Z3Y A;  1IXC A;  2MD5 A;  5HLI A;  4IRG A;  5ICE A;  4Z2Y A;  3CUQ A;  1OR7 A;  4BHB A;  3VB2 A;  2FBH A;  2DAO A;  5HDN A;  3U9G A;  1ULY A;  3SZP A;  2VE8 A;  3MAJ A;  1DPU A;  2F2E A;  2K02 A;  3HOS A;  2VT3 A;  1U5T C;  3WOD F;  1PDN C;  1XSX A;  3HRM A;  5E1Z B;  2MH2 A;  1MDM B;  5HDK A;  2Z9O A;  5AIP A;  4KDP A;  4UVA A;  3O6B B;  2FEZ A;  3WTS C;  2EFQ A;  3TO7 A;  5IT3 A;  4BH9 A;  1R1T A;  3ZN0 A;  3MZH A;  1MZB A;  4ASN A;  2QYO A;  2YX7 A;  2LF8 A;  4ENN A;  3K0L A;  1WWX A;  2AS5 F;  2PFB A;  1ZN2 A;  4ETS A;  3L09 A;  3TDU C;  2XIG A;  2FXA A;  1S8N A;  4L9T A;  3LA2 A;  3TGN A;  3IRQ A;  2IP2 A;  4EVI A;  2DI3 A;  3IC7 A;  2OBP A;  2EV6 A;  3RJP A;  1K6O A;  2O61 A;  3HHH A;  4OOI A;  5DCM A;  2HYG D;  1DDN A;  3IRR A;  4G7O F;  2XRN A;  1BI1 A;  3E97 A;  3HRT A;  2MLG A;  1Z7U A;  1F9N A;  5LRS A;  3J80 K;  3RPQ A;  4UV8 A;  3RPU A;  4A12 A;  4HOB A;  1ONV A;  1HW1 A;  2XKP A;  5EEH A;  4GYI A;  2A6H F;  5LEJ A;  1XDS A;  1G3T A;  1V3F A;  2L3D A;  4N9H A;  4AD9 A;  3OOP A;  4OIR F;  3L00 A;  1MKM A;  2XKO A;  2DQR A;  1I6X A;  2HR3 A;  4O5V A;  2HQR A;  3E3V A;  3I58 A;  4LMY A;  1AWC A;  5AON A;  1J75 A;  4MEX F;  2YU3 A;  2PI0 A;  2DK8 A;  2K4B A;  3FMS A;  2ISZ A;  3PQJ A;  3QP5 A;  1R1U A;  4CO8 A;  1WSU A;  3ZMZ A;  2M8E A;  1FYK A;  1HBX G;  4AWX B;  3F22 A;  5FB2 A;  3V8K A;  3EQL F;  2HGC A;  2H6B A;  4ESJ A;  1UFM A;  3PFI A;  5E8I A;  3LA3 A;  2X4H A;  4FHT A;  1RUN A;  2RKH A;  2Q2E A;  4R79 A;  4HDV A;  1Z9C A;  2NYX A;  3GYH X;  4LG0 A;  1P4W A;  3QOP A;  4ZYH A;  3F6O A;  3GZ5 A;  2R7D A;  2VC0 A;  3ZMS A;  1U5T A;  2EV5 A;  2CYY A;  2XAS A;  4Y15 A;  1KA8 A;  3FX3 A;  1FX7 A;  1S29 A;  5D5X B;  3MFK A;  1FBQ A;  4HYE A;  4UV9 A;  1E17 A;  5LLQ A;  1TW2 A;  1OYW A;  3RI4 A;  1BI2 A;  4M73 A;  4OU0 A;  2P6T A;  4M9Z A;  3GF2 A;  3LQQ A;  5A2Q K;  3J80 Z;  2P5V A;  4RB0 A;  2W57 A;  2VE9 A;  1BBY A;  1SD4 A;  4WK8 F;  3RYR A;  1R5H A;  4DQ2 A;  1YW7 A;  5E8G A;  4HLY A;  2HFH A;  4Y17 A;  4YFX F;  2KJB A;  2OZU A;  4FX4 A;  2GA2 A;  4EM1 A;  1S3J A;  3I59 B;  1XGN A;  1SFX A;  4GYG A;  4KYW A;  3NEU A;  5LHG A;  1U8R A;  2A07 F;  4HF1 A;  1CGP A;  1O7L A;  3ABT A;  2QUF A;  2DK5 A;  2KJC A;  1R7J A;  5JHU A;  1B4A A;  2QQA A;  5J6X A;  5L3E A;  4WWC A;  3PQK A;  2EJR A;  1YTY A;  1QZZ A;  1ZRF A;  1R23 A;  5TRD A;  3F3X A;  4L18 B;  1QNT A;  2H27 A;  1Q1H A;  4HDU A;  3K1P A;  2CQK A;  1BIA A;  2XV4 S;  2OU2 A;  2Q0O A;  3E6M A;  4BYY A;  2IT0 A;  2V1U A;  3C3W A;  4EJO A;  3HSF A;  5CVR A;  3SHF A;  3M8F A;  3REO A;  4BQA A;  2QM3 A;  4I98 B;  1OPC A;  2PMH A;  3U1D A;  2JPC A;  3K9T A;  2O3F A;  3BP8 A;  5ED4 A;  3SQN A;  1J7K A;  4OIN F;  3EET A;  1I27 A;  4JQF A;  3I0T A;  3I53 A;  2V1D A;  1TBX A;  3ULQ B;  3CUO A;  1JXS A;  3O3K A;  1ZAO A;  3CO7 C;  4K2E A;  2L4A A;  2F5D A;  1EH8 A;  4U7D A;  3T8T A;  2A69 F;  2O03 A;  4HF0 A;  2ZXJ A;  3E6C C;  2MA3 A;  3V8L A;  2GXB A;  2D45 A;  2GAU A;  2W24 A;  2IVM A;  5L3G A;  3F8M A;  4ESF A;  4FX0 A;  2PBI A;  1FY7 A;  1WKM A;  2M5W A;  3MZY A;  3ZP5 A;  3R0A A;  4U7B A;  5FLX K;  2M1B A;  2FRH A;  2BBY A;  1FZP B;  4ENK A;  1PUE E;  4EM2 A;  1EH7 A;  2EV0 A;  4CHU A;  1IN4 A;  2BYV E;  1FOK A;  1XGM A;  2A61 A;  3L9F A;  2KIU A;  1KU7 A;  3FXU A;  4L5I A;  3P9C A;  2FNA A;  4U0Y A;  5DDG A;  2VT2 A;  3I54 A;  1S7O A;  4LD5 A;  3B02 A;  5DV5 A;  3BOQ A;  3RKX A;  1G3S A;  3GFJ A;  5L3F A;  3H3U A;  2CO5 A;  2O0Y A;  2P8T A;  2W25 A;  3TOA A;  1MJA A;  3HIF A;  1QZY A;  2VON A;  4I2O A;  1IN8 A;  2FBK A;  3KP7 A;  2DW4 A;  3JW4 A;  3GWZ A;  1GHC A;  3IKT A;  2H6C A;  1J0R A;  2R3S A;  5FFX A;  4ZZD A;  2Y48 A;  3I4P A;  4PDK A;  2PMU A;  3H92 A;  2GXG A;  4O3M A;  3EUH A;  2CSO A;  2FQ3 A;  4YIF A;  2VN2 A;  3RKW A;  4EJT A;  2MH9 A;  2ZO4 A;  1KQ9 A;  2RDP A;  4ZYE A;  5FLX Z;  4KA4 A;  3HOT A;  1LDD A;  3KLO A;  1OKR A;  1X3U A;  3ML6 A;  2EA2 A;  2YPR A;  4WX9 A;  4LLG F;  2CG4 A;  2VOO A;  1O3S A;  3H3Z A;  3GFM A;  3I64 A;  1BC7 C;  1HKQ A;  2EFN A;  3HUG A;  1FYL A;  1EH6 A;  3GZ6 A;  3KE2 A;  4U88 A;  3FM5 A;  3VOD A;  1HQC A;  3G73 A;  4CXF A;  1DPR A;  2D2W A;  1D3Y A;  6PAX A;  1TW3 A;  4YFN F;  4HF2 A;  1MJ9 A;  2P5L C;  2E7X A;  5FGM A;  2DU9 A;  4G6D A;  5D4R A;  3DKW A;  3LAP A;  4EJV A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  2A5W A;  2TDX A;  5AIQ A;  1GVJ A;  4BJT A;  4IHS A;  1V5E A;  3FBN B;  4S05 A;  4XLA A;  4E4H A;  3TDZ C;  1FEX A;  2K9M A;  1T8I A;  1ZG1 A;  5DUK A;  1MSF C;  4OWR B;  5LGU A;  2EB7 A;  3BR6 A;  3FDY A;  4LOC A;  3ZQF A;  4BUP A;  4YIR X;  1TWH J;  4NB5 A;  3NQO A;  2XAQ A;  1KU2 A;  5EZH A;  2F5C A;  1YYV A;  3HBL A;  4JX6 A;  1KGS A;  2JA2 A;  4CCN A;  2P0W A;  3GFL A;  1H89 C;  3GX4 X;  2H09 A;  4H0E A;  4RB2 C;  4A3J J;  5L3C A;  1UEL B;  2BZT A;  1Z0X A;  5EYR A;  2DFI A;  5CVJ A;  4HV6 A;  1O3R A;  1VND A;  3OYH A;  1WH7 A;  3ZCO A;  4EJU A;  1LB2 A;  2PX9 A;  2CW8 A;  4BAY A;  4EEF G;  2E1M C;  1G3W A;  1D5V A;  4PGG A;  4MQ9 F;  3C18 A;  3H9G A;  3CCM I;  5DTD A;  3CLO A;  4L9N A;  3T0Y A;  1QPM A;  3OYI A;  1ETW A;  4JX5 A;  1HW5 A;  2DN0 A;  1TWG J;  1X1C A;  1OCC H;  3OL3 A;  3KYL A;  5DUI A;  2ZFW A;  1PUF A;  1ON1 A;  4CIC A;  3R0J A;  2KPM A;  4KT6 A;  1S6L A;  4G7H F;  2CS3 A;  2HTJ A;  3S2W A;  4A3B J;  1PP7 U;  1POG A;  2H94 A;  1P4A A;  2V9P A;  4UHT A;  5BPI A;  3HRS A;  3CTA A;  5IYB J;  1LNW A;  3CC4 I;  2CQN A;  1IUY A;  4RA2 A;  2V1N A;  2BW3 A;  2XAU A;  5EDN A;  1G59 A;  5LEK A;  3EYI A;  2V4J C;  5EEA A;  4UVB A;  4HEA 2;  3WU2 C;  1DU0 A;  5H6R A;  4HZF A;  3IWF A;  4DNC A;  4C3H J;  4BHC A;  2LF7 A;  4G94 A;  2E7W A;  4UY8 I;  2VKV A;  3DP7 A;  2R5Z A;  2LK2 A;  2RGV A;  1XSD A;  1EF4 A;  3BQZ A;  2K85 A;  3PSI A;  4P5O A;  4OIP F;  1D0Y A;  4CYC B;  1E2X A;  3H5N A;  3GVA A;  1KQ0 A;  1YLF A;  1TT0 A;  2BOL A;  3C1D A;  4FE7 A;  1LEA A;  3AG1 H;  3HOY J;  3L2C A;  4XLE A;  4RAZ A;  3E5Q A;  1I50 J;  2XGE A;  1T6S A;  3IH4 A;  2ESN A;  2DA7 A;  3BJO A;  2ETH A;  3D0S A;  1DP7 P;  5FD5 A;  1IN6 A;  2JVH A;  1FJL A;  2EFO A;  3JAM Z;  4EM0 B;  1LFU P;  3LQR A;  3BR0 A;  2NS0 A;  3MCZ A;  2P7C B;  3GXO A;  1XC5 A;  2STW A;  5F0F A;  3KP4 A;  1TWA J;  2R92 J;  1NK2 P;  4LK0 F;  4E7K A;  3MEX A;  5FRO A;  2ECB A;  5C3E J;  1BW6 A;  3IH2 A;  4HA8 A;  3WTT C;  1GUU A;  3ZMT A;  4KJZ A;  3RSN A;  1BN5 A;  5EGO A;  3GTO J;  2KP6 A;  4CZZ A;  3KIO A;  4B3X A;  2HYF A;  5JFR A;  1ZHF A;  3PNY A;  1IF1 A;  2IGM A;  4O6J A;  1JJ6 C;  2R7W A;  4F7Z A;  2HOT A;  2VB6 A;  1FTT A;  4IPA A;  4NQW A;  2DTR A;  3FXR A;  4HX7 A;  3GFI A;  2CRG A;  2YX4 A;  1LQ1 A;  1SD5 A;  3H5A A;  5CQG A;  3F0C A;  2F5V A;  2DA3 A;  4A3F J;  1WI3 A;  3P7N A;  2EK5 A;  2R5Y B;  3BR1 A;  5HS8 A;  2L02 A;  4M6Y A;  1FLI A;  5F0H A;  2JSC A;  3LSR A;  5F27 A;  1YFH A;  1AOY A;  1I6H J;  4MGR A;  5FKN A;  5HOD A;  5GAD J;  1Z6T A;  1VQ7 I;  4MTE A;  3KFW X;  4CZC A;  4FAS D;  2JUG A;  4RB1 A;  3HKZ A;  2Y75 A;  1JKP C;  4I76 A;  4GDF A;  3QYF A;  4P96 A;  4B1R A;  3I9V 2;  2NOG A;  5M5X J;  3GLX A;  2LG4 A;  2VC1 A;  2VQC A;  1R5I D;  2XRO A;  2XUB A;  2R7Z J;  2NAZ A;  1WQ2 A;  3Q9S A;  1Y56 A;  5LGT A;  1O7F A;  3OWT A;  1S72 I;  3KET A;  2WAD A;  3LSJ A;  4ZTF A;  4MNU A;  2KMU A;  3R60 A;  4BNC A;  2LBF A;  2STT A;  2CGP A;  2GZW A;  3KEQ A;  4U0V A;  1Z77 A;  4M71 A;  5HOO A;  3RCO A;  3OV8 A;  1V5G A;  1TQP A;  2QBY B;  4IQ4 A;  2XAG A;  2M45 A;  5D5V B;  4E6K G;  2MD0 A;  3ZPL A;  2WY8 Q;  4A5N A;  3I59 A;  2VQH A;  1K79 A;  3HOU J;  4BXX J;  3EYY A;  3N97 A;  2M30 A;  2V9V A;  3DV8 A;  5E3O A;  4MLO A;  4ENM A;  2HVS A;  1G6N A;  1FBS A;  4FT8 A;  4G6Q A;  5ICC A;  2FNP A;  1P7I A;  4UUS A;  5HNF A;  1SAX A;  1XMX A;  2HKO A;  2FUG 2;  1R58 A;  3ZMV A;  1JTX A;  1YX3 A;  1FIA A;  2G7H A;  2QVO A;  5C4J J;  4PSX A;  5F0C A;  1GLN A;  3LSI A;  5B66 C;  4DGW B;  2BVL A;  1ZRE A;  3Q0U A;  3SYT A;  1ORK A;  3WTU C;  2DA6 A;  2RVC A;  1W7P A;  3BLY A;  5FD6 A;  5KAF C;  2XRL A;  2EFP A;  1ZG5 A;  1XCB A;  3C7J A;  1WH5 A;  3AKZ A;  3K1N A;  1DU6 A;  4WXH A;  5JLX A;  1IRZ A;  2VJI A;  4N4O B;  1T56 A;  2CUF A;  4EGY A;  4ZYD A;  1FMW A;  3QQA A;  4A6D A;  3QP6 A;  2QSG X;  1B8I B;  4IHT A;  1W4M A;  3OYE A;  3MN2 A;  5J8C A;  2DMN A;  2DCE A;  3BDD A;  2IA2 A;  4M74 A;  3HPG A;  3U21 A;  3DTK A;  1R1V A;  4XL9 A;  2VOD A;  3FMQ A;  4DYC A;  2IS1 A;  4GRI A;  2BVM A;  3DF8 A;  2AO9 A;  2KRC A;  2JA7 J;  2GBY A;  3Q5F A;  1QZE A;  1IXR C;  3QPH A;  5IOZ A;  3L2U A;  1TWF J;  4HX8 A;  2VKE A;  1TQM A;  2IRF G;  4FET A;  2E36 A;  3LSK A;  1YQA A;  2Z16 A;  4L5E A;  2KL4 A;  4UNO A;  2L7F P;  1ZQ3 P;  4G9Y A;  2Q8K A;  5LHH A;  2V6E A;  3BJA A;  1X3W B;  4I0A A;  4EAT A;  2ELJ A;  1KU9 A;  5DS9 A;  1OLT A;  2BGC A;  2CUJ A;  1N78 A;  1J5Y A;  2LP0 A;  1YS6 A;  5KCM A;  1YS7 A;  2DFF A;  2BY2 A;  4N0B A;  3ZQL A;  2E2H J;  2XAJ A;  3K6G A;  1JGS A;  1MNE A;  5K7Z A;  1LJ9 A;  3HSR A;  5BMZ A;  5BOX A;  3ZOB A;  5JI6 A;  4MTD A;  5BQT A;  2OQR A;  3BR3 A;  3PO2 J;  2G7U A;  5HS9 A;  2D1V A;  2J5O A;  1FOW A;  2JZY A;  1P6R A;  2X1D A;  4LLL A;  1U5T B;  3HOX J;  2JA6 J;  1U6G A;  3KX2 A;  3NWS A;  4AID A;  2KT0 A;  3H1C A;  3OYC A;  3HJE A;  4IHV A;  3CC2 I;  2K86 A;  2VJ5 A;  1HSJ A;  2YUS A;  1EA3 A;  4LFU A;  5BNG A;  2XPW A;  1IRF A;  3KP2 A;  3TP0 A;  4B44 A;  1X1P A;  2LNB A;  5GAH J;  3G6E I;  1J2X A;  4LGW A;  2DOE A;  5KHD A;  3X2Q H;  5E20 A;  2RQP A;  3HC7 A;  3B6C A;  3BCB A;  3GTP J;  5J8F A;  4ANJ A;  2JUC A;  2EFW A;  2VPL A;  3HTU A;  5GAG J;  2OPT A;  1KON A;  1XMA A;  1MJB A;  1G2H A;  2KHM A;  3CP8 A;  1Z67 A;  1GV2 A;  5CJ9 A;  5EEG A;  3JRG A;  1TL8 A;  1UB9 A;  3FXQ A;  5D8L B;  1SAU A;  3LSG A;  1IV6 A;  5E3L A;  2QEN A;  1XS9 A;  4LLN A;  1FSE A;  2DJI A;  3V42 A;  2UWM A;  4XID A;  2MLK A;  3K4M A;  2W48 A;  3JSO A;  2O6G E;  4M3G A;  4JOM A;  5EG0 B;  1T33 A;  2IBD A;  2MW8 A;  3HZJ A;  1OFC X;  2VBX A;  3ECH A;  3M3Y J;  1T2K A;  3QPL A;  3R6S A;  3RZD J;  1GXP A;  1OCT C;  1PVE A;  4YEL A;  1X2M A;  1WJA A;  3ROU A;  2IPQ X;  3H5R A;  3I5U A;  3WTZ A;  3M7G A;  2QF7 A;  3K69 A;  4ZC3 A;  1PJR A;  4A2U A;  1I1S A;  2CFO A;  5F6F A;  1MGT A;  3JRF A;  4CDG A;  3VPR A;  3K4J A;  2F5E A;  3FXK A;  5CYV A;  3IHU A;  1VQL I;  3ASN H;  3PUF A;  5DEQ A;  2NVU B;  1I3A A;  2VOP A;  1ZGJ A;  4FE4 A;  4BS9 A;  4YRV A;  4D5C A;  2XGD A;  4L9J A;  3F23 A;  2K3F A;  2UV1 A;  2XPU A;  4XKC A;  1P4X A;  2L9S A;  3I55 I;  1ETK A;  3VWB A;  1JE8 A;  1BR1 A;  1J59 A;  2XC7 A;  2K4J A;  4C2M J;  2E1C A;  1A5J A;  5E1W A;  2J5P A;  1ITY A;  3HL2 A;  1SMT A;  3MD2 A;  1IZ1 A;  2JT1 A;  1GVD A;  2NVQ J;  3WTW C;  2FMY A;  4AIH A;  2WAE A;  1CF7 B;  2CFX A;  4A0Y A;  2DT7 B;  5ILU A;  2YR2 A;  2XVC A;  3OYF A;  5FLM J;  4PGH A;  3K70 D;  3SZG A;  1HA8 A;  1B1B A;  1FWZ A;  5GPC A;  2LKP A;  2LKX A;  4ZH4 F;  3HRU A;  5E79 C;  2EA4 A;  2IJL A;  1XSV A;  2XAF A;  2HI3 A;  1R6R A;  1N25 A;  3OS1 A;  2G9W A;  2FQ4 A;  1TQI A;  1XPX A;  2CU7 A;  1XX5 A;  3WE3 A;  2L7M P;  2K3P A;  5J1R A;  3DTI A;  1QVU A;  3I71 A;  4II3 A;  3KCC A;  3E6D A;  3HTS B;  3E7L A;  2B0L A;  2GIV A;  3MQ0 A;  3A4C A;  1SFE A;  3NAR A;  1RES A;  1BA5 A;  3EUA A;  1BJA A;  1SVM A;  1Z3X A;  2ELK A;  4M6X A;  3JRE A;  1R36 A;  4XN3 A;  5IP7 J;  3JTG A;  4A3E J;  2JTV A;  1ODD A;  2R7V A;  3K10 A;  3KEO A;  2QSF X;  1BM9 A;  3SZT A;  1IRX A;  1D8K A;  2MC3 A;  2FU4 A;  2P6S A;  3O8G A;  3F21 A;  1QO0 D;  1QVT A;  5FKO A;  4Q47 A;  1H88 C;  3QOD A;  4WXC A;  2O7O A;  2RNJ A;  1BI3 A;  3ASO H;  3I3L A;  4EJW A;  5LGN A;  1U9N A;  4I0B A;  2L01 A;  3A2K A;  2X0L A;  3KP5 A;  1ZR2 A;  1K78 A;  3VFZ A;  2KIF A;  1OIS A;  3DFG A;  2R7O A;  5B5E C;  3FMR A;  3TBI A;  2VBW A;  1X1B A;  5KVR A;  1KYW A;  4CGZ A;  3K4C A;  1WJB A;  2X6O A;  3CLQ A;  1A31 A;  1WJF A;  3OYL A;  1UCR A;  4ON0 A;  4I01 A;  3ECO A;  1LEB A;  2E2I J;  2VL8 A;  2AXL A;  3VYU B;  1KZH A;  2QA4 I;  1AHD P;  3IAM 2;  4G7Z F;  4XOP A;  5HLG A;  2CV0 A;  1ZRD A;  1IW7 F;  4B43 A;  3RKQ A;  4KMF A;  1YRN B;  2XF7 A;  2GLO A;  1QHH D;  3IP4 B;  1FIP A;  2BHY A;  3GBG A;  2MBF A;  4DBQ A;  2L54 A;  1Z3Y A;  4AIJ A;  2UXX A;  1F4K A;  4R1H A;  1MBK A;  4ZZL A;  1R9T J;  4E7I A;  1XD7 A;  3OYG A;  1REP C;  3A02 A;  1TWC J;  4RB3 C;  1Y8Q B;  3GO5 A;  2BY0 A;  2NS7 A;  4CCM A;  5J40 A;  4L9V A;  3J7A O;  1T0F C;  4RAY A;  2GA1 A;  4YG2 F;  2KRH A;  3JRA A;  2LLK A;  2OQG A;  3T5X A;  4YEJ A;  3OYD A;  1F1Z A;  2L4M A;  1JHF A;  2LTP A;  4PJM A;  5L3D A;  5F04 A;  2KIQ A;  2ADU A;  2DBB A;  3VDX A;  1HOM A;  3BJ6 A;  2DO7 A;  3GCM A;  4XRF A;  4QIW N;  2CWE A;  3CO6 C;  1TP4 A;  1UG2 A;  3JR9 A;  3DXJ F;  4RGX A;  4UVC A;  4IRH A;  2PQ8 A;  3IKV A;  3PJR A;  4W97 A;  2XB5 A;  4FTH A;  1LE8 A;  3M1C A;  3ISP A;  3PM1 A;  4CCJ A;  2KQR A;  4Q4Z F;  4IEJ A;  4HBL A;  3S16 J;  1I1G A;  3T8R A;  4QTR A;  1QU3 A;  1DUX C;  1QQI A;  2DMU A;  3CCV I;  4ZTJ A;  1R49 A;  1DGR M;  1TTY A;  5HDG A;  3BTL A;  2H8R A;  2JQ7 A;  2FF4 A;  1K4S A;  1YIJ I;  2JWT A;  2F4I A;  2FML A;  2HWV A;  1B9M A;  1BW5 A;  3M8J A;  1DQU A;  4V19 K;  4MQV A;  3RZO J;  3VYT B;  2W4S A;  3W2V A;  4BKX A;  4XM3 A;  4F3Q A;  4ZYG A;  4L0Y B;  5D5U B;  1FNN A;  5E17 F;  1P7J A;  4S04 A;  2X9D A;  3F72 A;  1HXD A;  2ELH A;  3MKL A;  1MDM A;  3HYI A;  2QLZ A;  4RGU A;  4XQF A;  3QRF F;  3QOE A;  1J9I A;  3U1K A;  1Z6R A;  2DOA A;  3PIO F;  3AFH A;  3HPH A;  2ZXH A;  3RTR A;  3BY6 A;  3JAM K;  1TLH B;  2A3S A;  2HS5 A;  5K7F A;  1SFU A;  1UMQ A;  4F92 B;  2L9V A;  2QCO A;  1X3Z B;  4UUT A;  3GTQ J;  4Y13 A;  1D8J A;  4ESB A;  3G1O A;  4A3I J;  5H6Q A;  1N75 A;  1LVK A;  3IV5 A;  1X1A A;  1VQ5 I;  3PNV A;  2LRE A;  2Q1Z B;  2E1N A;  2COM A;  2JMW A;  4PJN A;  4B09 A;  1ENH A;  2HPI A;  1LVA A;  5HS7 A;  4A6E A;  3LSP A;  4I02 A;  2OD5 A;  2ZNY A;  3ZQ7 A;  2KDO A;  3EPZ A;  1W5C C;  5B1A H;  1YO5 C;  3CJR B;  1IRG A;  2M2E A;  1JHH A;  1QGP A;  4HAM A;  2L2O A;  2W82 A;  4CYC A;  1XDU A;  3A01 A;  3SEQ A;  1Y0N A;  4L0Z B;  1BIB A;  1TZL A;  2HTS A;  3Q0W A;  2K27 A;  2LVS A;  1LDJ A;  2A68 F;  3BR2 A;  3D1N I;  1Y0U A;  1CQT A;  1MMG A;  3DPT A;  4XN0 A;  2ZB9 A;  4A3C J;  1LFP A;  4AU7 A;  1Z05 A;  3LWF A;  3DQV C;  1BI0 A;  4LIT A;  1S7A A;  3HUG B;  2KZG A;  2K9N A;  3BG7 A;  2NNN A;  2EZH A;  2Z99 A;  2X48 A;  1RZ4 A;  2DOF A;  2A6E F;  4I09 A;  2BXZ A;  2XGC A;  3I56 I;  2NNY A;  2HPM A;  1WGX A;  2IXS A;  5HVQ C;  2WBM A;  4IJA A;  4XLN F;  4OIO F;  1ETX A;  4BY7 J;  1P2F A;  1FTZ A;  4DIQ A;  2ZJ2 A;  4HRI A;  1R00 A;  3HOW J;  3H36 A;  1MMD A;  3BZ6 A;  5DM7 F;  4BDY A;  1IAW A;  2QGU A;  4CA0 A;  4AVP A;  2EBI A;  1G4D A;  4A5M A;  2ZME B;  5D5W B;  4XLC A;  2DPU A;  4OAY A;  3J81 K;  2M7A A;  4XLF A;  4IOC F;  4KFC A;  5JVT A;  2X1C A;  4QLC U;  1IGN A;  4XK4 A;  2VBY A;  3KZY A;  2HZT A;  3M1E A;  2UXN A;  1T38 A;  3S1N J;  2ISY A;  5IT9 K;  5EJC A;  2FBI A;  1F5T A;  3FHZ A;  1OYI A;  2VQL A;  1W7P D;  2R7Q A;  2DDA A;  2LKS A;  2R5Y A;  2MAB A;  4RDU A;  3WG9 A;  3CUQ B;  4HV5 A;  1DP3 A;  3GW2 A;  2LY1 A;  2EZI A;  3H35 A;  2FOW A;  1T0F A;  4BQN A;  1OCP A;  1YG2 A;  1HKT A;  1IN5 A;  1S7E A;  3LSM A;  2JVG A;  3CES A;  4XSX F;  3WU0 A;  2KKO A;  2JA8 J;  4HQE A;  2K5C A;  1V5F A;  5LRR A;  2L5Q A;  2XAH A;  3F9K A;  3P9I A;  4E7S A;  3WTX C;  5D8K B;  4DZP A;  2Z2S B;  2OA4 A;  1WHU A;  4D1Q A;  1BR2 A;  3G1M A;  2HZD A;  1FP2 A;  1STZ A;  3B6A A;  1L0O C;  3FM3 A;  5FRN A;  1BC8 C;  2VQG A;  1YW8 A;  3CCY A;  4GGG A;  4LG3 A;  5JHF A;  3OY9 A;  1JT0 A;  1IN7 A;  5CVI A;  2HVR A;  2CUE A;  2FX0 A;  1XB4 A;  1ZKG A;  4W1U A;  4A0X A;  5HLT A;  3O8H A;  3AL0 B;  4E7H A;  1R5G A;  1Z21 A;  4LK1 F;  5FO5 A;  3DPL C;  1APL C;  3MZ8 A;  3OYK A;  1MND A;  1WJE A;  1ZYR F;  2OUM A;  1PUF B;  1I3Q J;  2PN6 A;  3QWL A;  2WV0 A;  3ERM A;  1Y39 A;  2QWW A;  2QBY A;  3HGG A;  4A3D J;  4YFK F;  1W5T A;  1GDT A;  4P9F A;  1ON2 A;  4KUM A;  1T39 A;  1ZG3 A;  3BRO A;  1UHW A;  3HHG A;  1OMI A;  2KFD A;  3BCA A;  4I7H A;  3ESW B;  3D5L A;  2KRF A;  3GLL A;  4U0W A;  2BW3 B;  1I5Z A;  1MH4 A;  4MIM A;  3RIR A;  3KLN A;  1MMS A;  3CC7 I;  3JRC A;  4XNF A;  2P7V B;  4CCK A;  3VEP A;  1VQ6 I;  3HEF A;  5TJJ A;  5J47 A;  3K1M A;  2X6Y A;  3NRV A;  5M5Y J;  3COA C;  1KU3 A;  3V4G A;  2DXI A;  3GUD A;  3CF5 F;  2TCT A;  2R5Z B;  3AG3 H;  2LDU A;  1ZRC A;  2EWN A;  2K7L A;  4IKF A;  1FMV A;  4E70 A;  3KP3 A;  2WWY A;  2HEO A;  3R4K A;  2DMQ A;  1WPK A;  3LFK A;  3MMY B;  5B1B H;  4IVN A;  1VQP I;  2EIL H;  1OCZ H;  2LR8 A;  3IWZ A;  4GO1 A;  4ITV A;  4YII A;  5J4V A;  2JPB A;  3K7A J;  3LMM A;  1RUO A;  5CVU A;  2L7Z A;  1HW2 A;  1FP1 D;  3WU1 B;  2Y2Z A;  3LST A;  3SJM A;  4UXN A;  4NHJ A;  4AIK A;  1UHS A;  2CW0 F;  1ZGA A;  1X19 A;  2RNG A;  3M8E A;  3WGG A;  5BPD A;  4BE1 A;  3FWE A;  4JP0 A;  3S93 A;  5KK1 A;  4P9U A;  1B8I A;  5K5Q A;  2A6T A;  3ZMD A;  4C3I J;  4HQM A;  1VTN C;  1XTA A;  2D1H A;  2IGO A;  5LD2 C;  1B72 A;  2X1E A;  1SVO A;  3JRD A;  3O2P E;  5DCM B;  3J81 Z;  3S1R J;  2RN7 A;  2LY2 A;  5K7H A;  3M07 A;  1XGO A;  4A0Z A;  5IOY A;  5IT9 Z;  1ETY A;  1WI9 A;  1LFB A;  2PG4 A;  2P5K A;  3MKY B;  2FOK A;  1NHA A;  2HYJ A;  4XKW A;  1HDD C;  1VQ8 I;  4OMZ A;  5GTI C;  3U2R A;  1AA7 A;  2G0E A;  1BR4 A;  4L5J A;  2IA0 A;  1IO2 A;  4M72 A;  2ZJP F;  1I39 A;  2N8G A;  4XON A;  1HC8 A;  2XHK A;  1YIT I;  1R4M B;  1XGS A;  2HQA A;  3PL8 A;  2QQ8 A;  4NQW B;  3TKY A;  3ONQ A;  3ELK A;  1RET A;  3EDP A;  1GXQ A;  2OAZ A;  1A04 A;  5JLW A;  3BPX A;  3QU3 A;  1JUP A;  1WJD A;  3CME I;  4A3K J;  3BG9 A;  1K61 A;  2NRA C;  2XB0 X;  4KN4 X;  4EMS A;  3WGH A;  2ESH A;  2QQ9 A;  1FBU A;  1MMN A;  2VPR A;  4X0G A;  4BJ6 C;  2IA1 A;  3DTE A;  2EQR A;  2V6C A;  2FJ1 A;  3C2G A;  3CD6 I;  1TNT A;  3CJQ B;  3ERE D;  1UJ8 A;  4N4N B;  3TO6 A;  4RAF A;  5L3B A;  2F5F A;  1S9H A;  1JJ8 C;  1X4P A;  1KQ8 A;  1WCM J;  4XOR A;  2ID3 A;  3KZI C;  5TIS C;  4C2U A;  5ICF A;  4BHP A;  3TW6 A;  1AKH B;  2L9R A;  3L2V A;  4J01 A;  2WTE A;  3HOV J;  3E5U A;  2NVX J;  3CCJ I;  2RV8 A;  1WJC A;  4BQQ A;  2R93 J;  1WRJ A;  2VJJ A;  5JR3 A;  1QBJ A;  5K5O A;  1SD6 A;  3WE2 A;  3BQY A;  1GV5 A;  3QYE A;  3QU6 A;  2Q2E B;  2ZSI B;  2LBF B;  4A93 J;  4X1E A;  4PK4 A;  2FE3 A;  3ZR8 X;  1D5Y A;  5F64 A;  1D0X A;  4JK1 X;  3DKX A;  2Z5U A;  5EG0 A;  3V8J A;  4LG0 B;  4BQO A;  2DYS H;  2E19 A;  2R4G A;  3CDH A;  1USS A;  4MO7 A;  1XN7 A;  1Y1W J;  1L3L A;  4RLF A;  3FXO A;  1XG1 A;  4I99 C;  4DOZ A;  5IPA A;  1SAN A;  3I4M J;  3FF5 A;  2LSO A;  3E5X A;  1UZC A;  4PJL A;  4CYD A;  1HST A;  4UUV A;  4KIB A;  4XKB A;  4LB5 A;  1W36 C;  2HDW A;  2RRE A;  1U78 A;  4QWQ A;  1FC3 A;  2K9Q A;  1JKR C;  3Q0V A;  3TQN A;  4FQG A;  4M3B A;  2EH3 A;  3LAJ A;  1G8X A;  1RIO H;  3V7R A;  5J1U A;  3EUK L;  3K2Z A;  5LBQ A;  2AXT C;  2HQN A;  3TOB A;  1W7P B;  3FKJ A;  1E0E A;  1RKW A;  2XSJ C;  3CZ6 A;  3F8N A;  4A3G J;  4LB6 B;  4R8H A;  1S5L C;  3L7W A;  4M9X A;  3LA7 A;  5EZG A;  1IDY A;  4LJZ F;  4RAG A;  3KPH A;  4EQQ A;  4IF4 A;  4BAC A;  4MHG A;  5IP6 A;  3ZQC A;  2EIJ H;  3I4N J;  1SD7 A;  1RI7 A;  3WHB A;  1GT0 C;  4EV0 A;  1CF7 A;  2DT5 A;  4HX4 A;  3M9A A;  1U2W A;  1NK3 P;  3BTC A;  2VAS A;  4BEH B;  3W6K B;  2VXD A;  1B6A A;  3K2A A;  4HNT A;  3OYA A;  1HDP A;  2Z33 A;  1JT6 A;  2WC2 A;  1D1C A;  1O3T A;  3S3M A;  2M0M A;  2E34 A;  2JK3 A;  2HNH A;  2Y0M A;  3MKZ A;  1ZLK A;  3BPV A;  4PZJ A;  3R61 A;  1RNL A;  2C6Y A;  1A36 A;  4IHW A;  2WA0 A;  2YSR A;  5ERI A;  1RR8 C;  4KIF A;  2COB A;  4CSW A;  1NTC A;  3FHN A;  3OMY A;  3W3C A;  1RKT A;  2JRT A;  1RRJ A;  1IJW C;  1G3Y A;  4XLP F;  1FSH A;  2R7X A;  3VSK A;  2DLL A;  2QKM B;  2PJP A;  3AG4 H;  2KIM A;  1YX5 A;  3P9K A;  2ZNZ A;  4Q48 A;  2D5V A;  2IW5 A;  4D0P A;  2BEO A;  4XLH A;  2ZSH B;  3FK6 A;  4LIU A;  3IAS 2;  1Q1V A;  4JBA A;  3OIO A;  2XGX A;  2A5Y B;  3TO9 A;  4ZJZ A;  5M3M J;  4RGS A;  2GXA A;  4KMU X;  5A2Q Z;  1IXS B;  3UR3 C;  2TRT A;  2WV1 A;  4AM3 A;  2X51 A;  3K70 C;  2LRD A;  1O57 A;  2ZBK A;  1VQO I;  2EIK H;  5F1J A;  2ME0 A;  3C2H A;  1JTY A;  3H9J A;  1FPQ A;  1U0J A;  2BV6 A;  3NAU A;  4RGR A;  3F8C A;  2FSW A;  2E5N A;  2R7S A;  3MKW B;  1NG6 A;  4IXA A;  4XRS A;  3WGI A;  3KP6 A;  2W00 A;  4PFO A;  3DU5 A;  2VXZ A;  5GTH C;  3CCS I;  3CCU I;  5CVV A;  4ZDP A;  5BS6 A;  4IRI A;  1B59 A;  4GCV A;  5KAI C;  4HNV A;  4B8X A;  3G4S I;  4P55 A;  3QAH A;  2CV2 A;  1F36 A;  2Y0S N;  4IHX A;  3CCL I;  1YJ9 I;  3W6J B;  4XRS G;  2ZME C;  3F8F A;  3SXY A;  1K7A A;  3CMY A;  2P4W A;  3OOU A;  3T1B A;  1YRN A;  1BOA A;  2W1O A;  1A6I A;  2ZCW A;  3JRB A;  3CDL A;  3CJN A;  3V7C A;  4KNY A;  4MEY F;  3BG6 A;  3RYP A;  4A3M J;  5DD4 A;  4WXD A;  4C3J J;  3LL7 A;  4TV7 A;  3WTY C;  4NC7 A;  5E1X A;  1RC9 A;  1YW9 A;  1KYZ A;  3GTM J;  1TNS A;  1VF9 A;  2Y69 H;  3B73 A;  3BWG A;  2VI6 A;  3N4M A;  3CUQ C;  4CCL A;  1OR7 C;  3RQI A;  2JRM A;  1R4N B;  4FCY A;  2JN6 A;  3DEE A;  1EV7 A;  5CLS A;  1WFX A;  3CCQ I;  3WTV C;  2MC4 A;  1R71 A;  3ZQG A;  1T98 A;  4EGZ A;  4Y33 A;  3VOE A;  5H20 A;  2GQQ A;  2O8X A;  4BXF A;  3CDI A;  1B9N A;  3C2B A;  4AC0 A;  5IP9 J;  2W7N A;  1ZH5 A;  2VJ4 A;  3G3Z A;  2DPD A;  4KIG A;  2HKX A;  4PCQ A;  3GTL J;  3CF2 A;  2PJR A;  3KEY A;  1DGW Y;  1PP8 F;  1W5S A;  3ZN1 A;  2QZ8 A;  2ACJ A;  3AAF A;  2VKD A;  3GEZ A;  5GPA A;  3AL0 C;  2YU9 J;  1SVL A;  2M9H A;  2V79 A;  2JA5 J;  2OF7 A;  2OCE A;  1SMY F;  5K1Y A;  5H2F C;  3OS0 A;  4OIQ F;  4CH7 A;  2O5R A;  3SFZ A;  5IYC J;  3A0B C;  4HLX A;  5DYM A;  1XMK A;  4XSZ F;  2DQL A;  3NWT A;  4JX4 A;  4B3A A;  1VQK I;  1ZLJ A;  3S17 J;  2RC4 A;  3MWM A;  4OMY A;  2WAQ N;  1R22 A;  3D5R C;  2PLY A;  1ETO A;  3Q9V A;  4GFB A;  2ZKZ A;  2KIS A;  2P81 A;  2R7F A;  3VSL A;  1Y1V J;  2RQQ A;  2OZ6 A;  1SFK A;  1P92 A;  3GTJ J;  1Z91 A;  2FA5 A;  3QYB A;  3K4N A;  3OIQ A;  2W84 A;  1FYM A;  4RS8 A;  3G2B A;  4DYQ A;  1V4R A;  2BXY A;  3FZV A;  4IX7 A;  4HNU A;  5DCF A;  2W85 A;  3PFY A;  1OYY A;  3RDI A;  3DBH B;  3SEZ A;  1LDK B;  1H0M A;  4AVZ A;  4XBF A;  3DBR B;  3IL2 A;  4N9I A;  3W6V A;  2BY3 A;  4KT5 C;  5DD8 A;  2CQQ A;  3BTJ A;  1OCR H;  1V55 H;  3ZMU A;  1K78 B;  3MVP A;  1MD0 A;  3F8B A;  5ICG A;  4M9S A;  3PSF A;  3OR1 C;  3OYN A;  2HDC A;  1QHG A;  2UZK A;  3OSF A;  5GAE J;  3DEW A;  3D5S C;  1U3E M;  3PO3 J;  5D6F A;  5HLH A;  4WCG A;  4I6Z A;  3HSE A;  3G71 I;  3KZZ A;  4BXU A;  3ABU A;  1Z1D A;  4KN7 X;  5E18 F;  1H9T A;  5D6E A;  9ANT A;  3FXM A;  2DA1 A;  1BOB A;  4Q5S F;  3WG7 H;  3OS2 A;  1MBH A;  1FT9 A;  4HW0 A;  5K5R A;  2QQB A;  3DEU A;  4KIC A;  2GOX B;  4IQJ A;  4NBQ A;  3QPT A;  5FRM A;  1YIO A;  2M87 A;  2WAF A;  3F6V A;  4DBR A;  4P1W A;  2XPV A;  3SDG A;  2OV7 A;  5D4S A;  3E6B A;  4ENJ A;  1O3Q A;  3A03 A;  2ZXW H;  3S14 J;  5GP9 A;  1H9G A;  2V1X A;  3JSP A;  4WF2 A;  5FJ8 J;  5ILV A;  3V7S A;  2HOE A;  1IDZ A;  2JSP A;  2VBZ A;  3JRI A;  2H1L A;  1BJZ A;  2V7F A;  3GZN B;  5LHI A;  5FFZ A;  5ILS A;  2DTZ A;  1QPI A;  4G8X A;  1E3P A;  2PEX A;  1UHM A;  2CH0 A;  1XCV A;  2ZME A;  1ZAR A;  3VYR B;  1MMA A;  1MH3 A;  2M7B A;  5F1R A;  1UST A;  3RKY A;  3HOZ J;  4F52 A;  2HVQ A;  1IV8 A;  2GWR A;  1HKS A;  1ETV A;  4CUG A;  1H8A C;  1ERD A;  2CV1 A;  3GME A;  4MFD A;  5E3M A;  1C0W A;  3JTH A;  4KIS A;  4GXO A;  2JJ7 A;  2Y0S A;  4NNJ A;  2Z3Y A;  1HCR A;  1IXC A;  4B47 A;  3WHC A;  2M4G A;  2MD5 A;  3HDD A;  5HLI A;  2MFZ A;  4IRG A;  1T95 A;  3J7Y J;  2X6X A;  1NH3 A;  1LE8 B;  4F91 B;  3BC8 A;  3ZQH A;  5ICE A;  4Z2Y A;  3CUQ A;  2MYS A;  4M3F A;  1OR7 A;  4AYB N;  3LAP A;  4PJ0 C;  4BHB A;  3VB2 A;  3OYJ A;  2FBH A;  2DAO A;  3E0J B;  1MW7 A;  5C4X J;  5HDN A;  3U9G A;  1ULY A;  3SZP A;  2VE8 A;  3MAJ A;  1DPU A;  4A69 C;  2F2E A;  2K02 A;  3HOS A;  3GTK J;  4NUB A;  2OCC H;  2OC6 A;  2VT3 A;  1U5T C;  2R0Q C;  3ABM H;  2B63 J;  4UB8 C;  3WOD F;  4ABZ A;  1PDN C;  1MBF A;  1XSX A;  3HRM A;  5E1Z B;  2MH2 A;  4G6T B;  1MDM B;  5HDK A;  4XIC A;  3L2R A;  2Z9O A;  1VQM I;  1Z7L A;  5AIP A;  4KDP A;  2EIN H;  1IUF A;  2F48 A;  3LFU A;  4UVA A;  1E3H A;  3O6B B;  2V26 A;  2FEZ A;  3DLA A;  3WTS C;  2EFQ A;  1X4O A;  3TO7 A;  4HST A;  5IT3 A;  1YI2 I;  2E5Z A;  1QA6 A;  5DM6 F;  4BH9 A;  3DLL F;  2LFB A;  1IC8 A;  4V2G A;  1JI8 A;  1ACI A;  1R1T A;  2MGQ A;  1VFC A;  3ZN0 A;  3PUB A;  3MZH A;  2CMP A;  1MZB A;  3BT9 A;  2CQX A;  3JCU C;  4ASN A;  4BJ5 C;  2QYO A;  2IS4 A;  2YX7 A;  2DA5 A;  1M1E B;  2LF8 A;  1WVR A;  5B3S H;  4ENN A;  2VLA A;  3K0L A;  1WWX A;  2AS5 F;  4M3D A;  2PFB A;  2WAQ A;  1YOV B;  2K9L A;  1ZN2 A;  4ETS A;  3L09 A;  1AU7 A;  2R7R A;  3A01 B;  1MSE C;  3TDU C;  1MNM C;  2CUZ A;  3LOC A;  2XIG A;  2FXA A;  1S8N A;  3AG2 H;  4L9T A;  1VZ0 A;  3LA2 A;  1MBJ A;  3TGN A;  3DWL E;  4CCO A;  2E35 A;  3IRQ A;  2IP2 A;  4EVI A;  2VIX A;  2DI3 A;  3IC7 A;  4KIT B;  2DFE A;  2OBP A;  2EV6 A;  3BTI A;  4H4K C;  2GIZ A;  3RJP A;  1K6O A;  1Y6I A;  1W0T A;  2O61 A;  3HHH A;  4OOI A;  5DCM A;  5EF6 A;  2HYG D;  1X58 A;  1DDN A;  3IRR A;  4G7O F;  2XRN A;  1BI1 A;  3FXL A;  3E97 A;  4IOA F;  3HRT A;  2MLG A;  1Z7U A;  1K83 J;  2CW7 A;  1YE9 A;  1F9N A;  5LRS A;  3J80 K;  2ZFU A;  3RPQ A;  4LIV A;  4UV8 A;  3RPU A;  2B7E A;  1UG0 A;  4DYR A;  4HOB A;  4A12 A;  4A3L J;  1NG7 A;  1ONV A;  3OR2 C;  4Y4R A;  1HW1 A;  2XKP A;  5EEH A;  4GYI A;  2DT6 A;  2A6H F;  2NOJ B;  3TP3 A;  5LEJ A;  2LOO A;  2OJE D;  1EJ9 A;  1XDS A;  3PIP F;  1G3T A;  1V3F A;  2L3D A;  4N9H A;  4AD9 A;  3BG5 A;  3OOP A;  4OIR F;  2L9N A;  1ZTR A;  3L00 A;  1MKM A;  2XKO A;  4X6A J;  2DQR A;  1I6X A;  2HR3 A;  4NC6 A;  2F4M B;  4O5V A;  5J1Y A;  4U87 A;  2HQR A;  3S8P A;  3E3V A;  1OCO H;  3S2D J;  3I58 A;  4LMY A;  1AWC A;  5C44 J;  5AON A;  1WZ2 A;  5FKL A;  1D0Z A;  1J75 A;  4MEX F;  2YU3 A;  5JVG F;  2PI0 A;  2DK8 A;  3K4B A;  3BZC A;  2L7K A;  2DFH A;  2DMT A;  2K4B A;  2MSY A;  3FMS A;  4QPQ A;  2RAE A;  2ISZ A;  2BHZ A;  3PQJ A;  3QP5 A;  1R1U A;  4CO8 A;  1WSU A;  3ZMZ A;  1W1W E;  5HNH A;  1MIJ A;  2EIM H;  2M8E A;  4JYK A;  1FYK A;  1HBX G;  2OTJ I;  4AWX B;  2HOA A;  3F22 A;  1Y8R B;  5FB2 A;  1AKH A;  3V8K A;  3EQL F;  1HLV A;  2HGC A;  2H6B A;  2GOM A;  4ESJ A;  4EJV A;  1UFM A;  3S32 A;  3PFI A;  1ZGW A;  5E8I A;  2ZJR F;  2O8K A;  3LA3 A;  2NVT J;  2X4H A;  3E1S A;  4FHT A;  1RUN A;  5EGO B;  2RKH A;  2Q2E A;  4RLQ A;  1FOY A;  3HXL A;  4MFE A;  4R79 A;  4HDV A;  1Z9C A;  1LKX A;  3HGY A;  2NYX A;  3GYH X;  3CMA I;  4LG0 A;  3ZXS A;  2DA2 A;  1N77 A;  1P4W A;  3QOP A;  4ZYH A;  2HQ5 A;  3DKY A;  3H0G J;  1OQY A;  4BGD A;  3FXJ A;  3F6O A;  4XKV A;  3GZ5 A;  4HG2 A;  1U8B A;  2LMD A;  3ZQI A;  2R7D A;  4Z6Y A;  2VC0 A;  2OTL I;  1VQ9 I;  2NVY J;  3ZMS A;  4AYB A;  1U5T A;  2XF5 A;  2EV5 A;  2CYY A;  1J09 A;  3KYD B;  2XAS A;  2LY9 A;  4BE2 A;  4Y15 A;  1KA8 A;  2EZL A;  3FX3 A;  4BBS J;  1FX7 A;  4ZDO A;  1S29 A;  5D5X B;  2E2J J;  1U9O A;  3MFK A;  5M3F J;  5IY5 H;  4D9J A;  4J19 A;  1FBQ A;  4RMN A;  1F43 A;  4HYE A;  1LUJ B;  4UV9 A;  1E17 A;  5LLQ A;  1TW2 A;  2PMZ N;  4DZJ A;  1OYW A;  3RI4 A;  1BI2 A;  3OYB A;  3FIS A;  2LC2 A;  4M73 A;  1ZEL A;  4OU0 A;  1VQ4 I;  2IS6 A;  5IYD J;  2P6T A;  4M9Z A;  3GF2 A;  1SEU A;  3LQQ A;  5A2Q K;  3ZGK A;  3J80 Z;  2P5V A;  4RB0 A;  2W57 A;  2VE9 A;  1BBY A;  1SD4 A;  2IEK A;  4WK8 F;  2IGK A;  3RYR A;  1B72 B;  1JUS A;  1R5H A;  3ABK H;  4DQ2 A;  1YW7 A;  5E8G A;  4BEH A;  4HLY A;  2HFH A;  4Y17 A;  5LFA A;  4YFX F;  3TW7 A;  2KJB A;  2OZU A;  4FX4 A;  2GA2 A;  4EM1 A;  1JUM A;  5CKT A;  1S3J A;  4B48 A;  3I59 B;  4BU2 A;  1XGN A;  1SFX A;  3FK7 A;  2K9S A;  1JGG A;  4ZYA A;  4E7J A;  2M34 A;  4GYG A;  4C30 A;  4KYW A;  2DJN A;  3NEU A;  5E3N A;  4UUS B;  3S2H J;  2E1M B;  5LHG A;  1U8R A;  3S3N A;  2CQ7 A;  2MG4 A;  2A07 F;  4OAZ A;  4HF1 A;  1CGP A;  1O7L A;  2Y30 A;  3ABT A;  2QUF A;  2DK5 A;  2KJC A;  4DJA A;  3A0H C;  4B4C A;  1R7J A;  5JHU A;  1B4A A;  2QQA A;  2XF6 A;  2HXI A;  2M4K A;  5J6X A;  5L3E A;  4WWC A;  3CP2 A;  3PQK A;  3OYM A;  2EJR A;  1YTY A;  1QZZ A;  1QRY A;  1ZRF A;  2FD5 A;  5KNL A;  1R23 A;  2AHQ A;  2QKL B;  3CQZ J;  2EZK A;  3F3X A;  5TRD A;  4L18 B;  2E1O A;  2AQF A;  3K4L A;  3FBI B;  1QNT A;  2H27 A;  1Q1H A;  4HDU A;  3K1P A;  2CQK A;  3DBL B;  1BIA A;  2XV4 S;  3H9Q A;  1W36 D;  1YJW I;  3H3V K;  2ID6 A;  2OU2 A;  2Q0O A;  3S15 J;  3E6M A;  4BYY A;  4HSR A;  5FKM A;  2E60 A;  1JKO C;  2IT0 A;  2ZXI A;  3H0D A;  2V1U A;  4G12 A;  3C3W A;  3EUH C;  4EJO A;  2WB1 N;  3FIW A;  1JKQ C;  3HM5 A;  3HSF A;  5CVR A;  2BY1 A;  3SHF A;  3M8F A;  3REO A;  4BQA A;  2QM3 A;  4I98 B;  3IH3 A;  4M6V A;  1OPC A;  2PMH A;  4E7L A;  3U1D A;  3OL4 A;  3ZRG A;  2DYR H;  1A6Q A;  2JPC A;  1TT5 B;  5F08 A;  3CCE I;  3GTG J;  3K9T A;  4Y52 J;  2IAI A;  3SFI A;  2O3F A;  1X2N A;  1SC7 A;  4PFP A;  3JRH A;  2M0C A;  3BP8 A;  5ED4 A;  3SQN A;  1W0U A;  1J7K A;  3UKG A;  1WJ5 A;  4OIN F;  5M5W J;  3EET A;  1IG7 A;  1I27 A;  4JQF A;  4XRM A;  3I0T A;  3LSH A;  5FKK A;  1YHQ I;  3I53 A;  3CJT B;  2V1D A;  3Q3S A;  1TBX A;  3ULQ B;  3CUO A;  1JXS A;  1T08 B;  1ZAO A;  2HXO A;  3O3K A;  3CO7 C;  1BL0 A;  2IGN A;  4K2E A;  4PUS A;  1UAA A;  4C2T A;  4F55 A;  2L4A A;  2F5D A;  4RM3 A;  2KDZ A;  4NC8 A;  1EH8 A;  4U7D A;  3T8T A;  2A69 F;  2HDD A;  1OJL A;  2O03 A;  4AUX A;  2F6C A;  3S1M J;  4HF0 A;  1X1D A;  2ZXJ A;  1PYV A;  3E6C C;  2MA3 A;  3V8L A;  2GXB A;  2D45 A;  2E71 A;  2HOS A;  1ETQ A;  2GAU A;  2O9L A;  1E3O C;  2W24 A;  4C9Y A;  2IVM A;  5L3G A;  2Y31 A;  3L2W A;  3F8M A;  4ESF A;  4XMY A;  4D5F A;  1A35 A;  4FX0 A;  2PBI A;  1FY7 A;  1WKM A;  2GM4 A;  1K4T A;  2M5W A;  3S3O A;  3DU6 A;  3MZY A;  4II2 A;  3ZP5 A;  1FOX A;  2R7T A;  3R0A A;  4U7B A;  2X85 A;  5FLX K;  2M1B A;  2FRH A;  2BBY A;  1FZP B;  2QEX I;  4ENK A;  1PUE E;  4EM2 A;  1EH7 A;  4FIS A;  4RM2 A;  4Y3O A;  2DDB A;  2H1K A;  2EV0 A;  2KLO A;  2HU9 A;  3ABL H;  5J4Y A;  4CHU A;  1IN4 A;  5J3L A;  3IUO A;  3W2W A;  3J7Z I;  2BYV E;  1FOK A;  1VQN I;  2PMZ A;  1XGM A;  2A61 A;  2LH9 A;  3FKI J;  3CCR I;  3L9F A;  2KIU A;  1KU7 A;  4S0H B;  3M4O J;  2DA4 A;  1MBE A;  3FXU A;  2VUM J;  4L5I A;  5TGT A;  3BR5 A;  3P9C A;  2FNA A;  4U0Y A;  1EKE A;  2V9K A;  1ZR4 A;  2M3A A;  5DDG A;  3N05 A;  2VT2 A;  2DOD A;  4ZDL A;  3I54 A;  1S7O A;  3P5J A;  4LD5 A;  3B02 A;  5DV5 A;  4QSH A;  3TMO A;  3BOQ A;  3RKX A;  3TL4 X;  1G3S A;  3GFJ A;  5L3F A;  3H3U A;  2LYC A;  1ZK8 A;  3KYC B;  3QPS A;  3HG9 A;  2Z1D A;  4XR6 A;  2CO5 A;  2O0Y A;  2P8T A;  2W25 A;  2M8G X;  4IHY A;  3TOA A;  3OSG A;  3S1Q J;  1MJA A;  4BDZ A;  2K40 A;  2QSH X;  3BG3 A;  3HIF A;  1QZY A;  4BE0 A;  3OIP A;  2I5U A;  2VON A;  4I2O A;  1IN8 A;  2FBK A;  2XDV A;  3KP7 A;  2DW4 A;  4IZZ A;  3JW4 A;  1TC3 C;  3L2Q A;  3GWZ A;  1GHC A;  3TED A;  4HPQ A;  4RBO A;  3IKT A;  2H6C A;  4IL6 C;  1J0R A;  1MBG A;  2CJJ A;  2R3S A;  4D7M A;  2ICW G;  2IS2 A;  3CMM A;  2B9S A;  5CQE A;  5FFX A;  4ZZD A;  2Y48 A;  2NS8 A;  3DPU A;  2I10 A;  2ZC2 A;  3I4P A;  3ZQQ A;  2DMP A;  3SDB A;  4PDK A;  2PMU A;  2X6W A;  2Y9Y A;  3H92 A;  4PJJ A;  2GXG A;  3DCF A;  4O3M A;  2YS9 A;  2UUZ A;  3EUH A;  4IO9 F;  2CSO A;  1YJN I;  2FQ3 A;  2ZJQ F;  2LD5 A;  4YIF A;  2VN2 A;  1V54 H;  2I8D A;  3PNT A;  3RKW A;  3BZK A;  1O4X A;  4EJT A;  2MH9 A;  1D1B A;  2ZO4 A;  4E7Z A;  4F93 B;  3K4K A;  1KQ9 A;  2WB1 A;  2RDP A;  3UNG C;  4ZYE A;  2L0K A;  4XOT A;  4BY1 J;  5FLX Z;  2KZV A;  4KA4 A;  3HOT A;  4DW6 A;  4BL0 B;  1LDD A;  3W2A A;  3KLO A;  1SFO J;  1LPQ A;  1OKR A;  1RPW A;  1X3U A;  3ML6 A;  3L1P A;  2EA2 A;  2PJR B;  2NXN B;  2H8W A;  4NDL A;  2YPR A;  4WX9 A;  2EPF A;  3A1Y A;  3HB9 A;  3J7A Y;  2WY7 Q;  4LLG F;  1P9Q C;  2CG4 A;  2VOO A;  1O3S A;  3H3Z A;  3VYS B;  3GFM A;  3I64 A;  1BC7 C;  5FLV A;  1HKQ A;  4PSW A;  2EFN A;  4M3E A;  3HUG A;  1FYL A;  2A05 A;  1EH6 A;  2R7U A;  2ECC A;  3GZ6 A;  4Y7N J;  2ME6 A;  4J00 A;  2VKH A;  3KE2 A;  4D7N A;  4U88 A;  3FM5 A;  4UB6 C;  4V2F A;  3VOD A;  1HQC A;  4BBR J;  3G73 A;  3G1L A;  4CXF A;  3LNQ A;  1DPR A;  2D2W A;  1HF0 A;  1D3Y A;  2AQE A;  1TW3 A;  4YFN F;  6PAX A;  3HKZ N;  4HF2 A;  2Y9Z A;  2XSD C;  4QPO A;  1MJ9 A;  3RPU D;  5CPR B;  2P5L C;  2E7X A;  3RQ4 A;  1RR7 A;  5FGM A;  2F4O B;  1K6Y A;  2DU9 A;  4G6D A;  5D4R A;  3DKW A;  1D1A A;  2BE5 F; 
#chains in the Genus database with same CATH homology
 2TDX A;  5AIQ A;  1GVJ A;  4IHS A;  4S05 A;  3TDZ C;  1ZG1 A;  5DUK A;  5LGU A;  2EB7 A;  4NB5 A;  3NQO A;  2XAQ A;  1KU2 A;  2F5C A;  1YYV A;  1KGS A;  3GFL A;  3GX4 X;  2H09 A;  4H0E A;  4RB2 C;  5L3C A;  2DFI A;  5CVJ A;  4HV6 A;  1O3R A;  4EJU A;  1LB2 A;  4BAY A;  1G3W A;  1D5V A;  4PGG A;  4MQ9 F;  3C18 A;  3CLO A;  4L9N A;  3T0Y A;  1QPM A;  1HW5 A;  5DUI A;  2ZFW A;  1ON1 A;  4CIC A;  3R0J A;  1S6L A;  4G7H F;  2HTJ A;  3S2W A;  1PP7 U;  2H94 A;  1P4A A;  4UHT A;  5BPI A;  3HRS A;  3CTA A;  1LNW A;  1IUY A;  5LEK A;  3EYI A;  4UVB A;  5H6R A;  4HZF A;  3IWF A;  4DNC A;  4BHC A;  2LF7 A;  4G94 A;  2E7W A;  3DP7 A;  2RGV A;  1XSD A;  4P5O A;  4OIP F;  1E2X A;  3GVA A;  1KQ0 A;  1YLF A;  3C1D A;  1LEA A;  3L2C A;  4RAZ A;  3E5Q A;  1T6S A;  2ESN A;  3BJO A;  2ETH A;  3D0S A;  1DP7 P;  5FD5 A;  1IN6 A;  2EFO A;  3JAM Z;  4EM0 B;  3LQR A;  2NS0 A;  3MCZ A;  2P7C B;  3GXO A;  2STW A;  3KP4 A;  4LK0 F;  3MEX A;  4HA8 A;  3WTT C;  3ZMT A;  1BN5 A;  4CZZ A;  5JFR A;  2HYF A;  1ZHF A;  1IF1 A;  4O6J A;  4F7Z A;  4IPA A;  4NQW A;  2DTR A;  3FXR A;  4HX7 A;  3GFI A;  2YX4 A;  1LQ1 A;  1SD5 A;  3P7N A;  2EK5 A;  5HS8 A;  2L02 A;  4M6Y A;  1FLI A;  2JSC A;  1YFH A;  1AOY A;  4MGR A;  1Z6T A;  4MTE A;  3KFW X;  4RB1 A;  2Y75 A;  4P96 A;  3GLX A;  2VC1 A;  2XRO A;  2XUB A;  2NAZ A;  1WQ2 A;  3Q9S A;  5LGT A;  1O7F A;  3KET A;  4MNU A;  3R60 A;  4BNC A;  2STT A;  2CGP A;  2GZW A;  3KEQ A;  4U0V A;  4M71 A;  5HOO A;  3OV8 A;  1TQP A;  2QBY B;  2XAG A;  2M45 A;  5D5V B;  3ZPL A;  4A5N A;  3I59 A;  1K79 A;  3EYY A;  3N97 A;  2M30 A;  2V9V A;  3DV8 A;  4ENM A;  1G6N A;  1FBS A;  4FT8 A;  4G6Q A;  5ICC A;  2FNP A;  1SAX A;  2HKO A;  1R58 A;  3ZMV A;  2G7H A;  2QVO A;  1ZRE A;  3WTU C;  2RVC A;  1W7P A;  5FD6 A;  2EFP A;  1ZG5 A;  1XCB A;  3C7J A;  3K1N A;  4WXH A;  4EGY A;  4ZYD A;  4A6D A;  4IHT A;  3QP6 A;  1W4M A;  5J8C A;  3BDD A;  2IA2 A;  4M74 A;  1R1V A;  2VOD A;  3FMQ A;  3DF8 A;  3Q5F A;  1IXR C;  3QPH A;  4HX8 A;  1TQM A;  2IRF G;  1YQA A;  4UNO A;  4G9Y A;  2Q8K A;  5LHH A;  3BJA A;  4I0A A;  1KU9 A;  2BGC A;  1J5Y A;  1YS6 A;  1YS7 A;  4N0B A;  2XAJ A;  1JGS A;  1LJ9 A;  3HSR A;  5BMZ A;  5BOX A;  5JI6 A;  4MTD A;  5BQT A;  2OQR A;  2G7U A;  5HS9 A;  2D1V A;  2J5O A;  2JZY A;  1P6R A;  4LLL A;  1U5T B;  1U6G A;  2K86 A;  4LFU A;  1HSJ A;  1IRF A;  3KP2 A;  2LNB A;  1J2X A;  4LGW A;  5E20 A;  2RQP A;  5J8F A;  2EFW A;  3HTU A;  1XMA A;  1MJB A;  2BE5 F;  5CJ9 A;  5EEG A;  1UB9 A;  3FXQ A;  5D8L B;  2QEN A;  4LLN A;  1FSE A;  2UWM A;  2MLK A;  3JSO A;  2O6G E;  2VBX A;  3ECH A;  1T2K A;  3R6S A;  1GXP A;  3ROU A;  2IPQ X;  3I5U A;  3WTZ A;  3M7G A;  3K69 A;  4A2U A;  1I1S A;  5F6F A;  1MGT A;  4CDG A;  2F5E A;  5CYV A;  3IHU A;  5DEQ A;  2VOP A;  1ZGJ A;  4L9J A;  3F23 A;  1P4X A;  1JE8 A;  1J59 A;  2K4J A;  2E1C A;  5E1W A;  2J5P A;  1SMT A;  1IZ1 A;  2JT1 A;  3WTW C;  2FMY A;  4AIH A;  1CF7 B;  2CFX A;  4A0Y A;  5ILU A;  2YR2 A;  2XVC A;  4PGH A;  1B1B A;  1FWZ A;  2LKP A;  4ZH4 F;  3HRU A;  2EA4 A;  2IJL A;  1XSV A;  2XAF A;  2G9W A;  1TQI A;  3WE3 A;  3I71 A;  3KCC A;  3E6D A;  3HTS B;  2B0L A;  2GIV A;  3MQ0 A;  1SFE A;  1BJA A;  4M6X A;  1R36 A;  3JTG A;  2JTV A;  1ODD A;  3KEO A;  1BM9 A;  3SZT A;  1D8K A;  2MC3 A;  2FU4 A;  2P6S A;  3F21 A;  1QO0 D;  4Q47 A;  4WXC A;  2RNJ A;  1BI3 A;  4EJW A;  5LGN A;  4I0B A;  2L01 A;  2X0L A;  3KP5 A;  1K78 A;  3VFZ A;  2KIF A;  3DFG A;  3FMR A;  2VBW A;  5KVR A;  1KYW A;  4CGZ A;  1UCR A;  4ON0 A;  4I01 A;  3ECO A;  1LEB A;  2AXL A;  4G7Z F;  5HLG A;  1ZRD A;  1IW7 F;  4KMF A;  2MBF A;  2L54 A;  4AIJ A;  2UXX A;  1F4K A;  4R1H A;  4ZZL A;  1XD7 A;  1REP C;  4RB3 C;  3GO5 A;  4L9V A;  3J7A O;  4RAY A;  2GA1 A;  4YG2 F;  2OQG A;  3T5X A;  1F1Z A;  2L4M A;  1JHF A;  5L3D A;  2ADU A;  2DBB A;  3BJ6 A;  2DO7 A;  4XRF A;  2CWE A;  3CO6 C;  3DXJ F;  4RGX A;  4UVC A;  4IRH A;  2PQ8 A;  3IKV A;  3ISP A;  4Q4Z F;  4HBL A;  1I1G A;  3T8R A;  1DUX C;  1QQI A;  1TTY A;  5HDG A;  2FF4 A;  2FML A;  2HWV A;  1B9M A;  4MQV A;  4L0Y B;  4ZYG A;  5D5U B;  1FNN A;  5E17 F;  4S04 A;  3F72 A;  1HXD A;  2ELH A;  1MDM A;  3HYI A;  2QLZ A;  4RGU A;  3QRF F;  1J9I A;  1Z6R A;  3RTR A;  3BY6 A;  3JAM K;  1TLH B;  2A3S A;  2HS5 A;  1SFU A;  4Y13 A;  1D8J A;  4ESB A;  5H6Q A;  2E1N A;  2COM A;  4B09 A;  1LVA A;  5HS7 A;  4A6E A;  4I02 A;  2OD5 A;  2ZNY A;  3ZQ7 A;  1YO5 C;  1IRG A;  1JHH A;  1QGP A;  4HAM A;  1XDU A;  4L0Z B;  1BIB A;  2HTS A;  2K27 A;  1LDJ A;  2A68 F;  1Y0U A;  3DPT A;  1Z05 A;  3LWF A;  3DQV C;  1BI0 A;  1S7A A;  2NNN A;  2Z99 A;  1RZ4 A;  2A6E F;  4I09 A;  2NNY A;  5HVQ C;  4IJA A;  4XLN F;  4OIO F;  1P2F A;  2ZJ2 A;  1R00 A;  3BZ6 A;  1IAW A;  4AVP A;  1G4D A;  4A5M A;  2ZME B;  5D5W B;  2DPU A;  3J81 K;  4KFC A;  5JVT A;  4QLC U;  2VBY A;  3KZY A;  2HZT A;  3M1E A;  2UXN A;  1T38 A;  2ISY A;  5IT9 K;  2FBI A;  1F5T A;  3FHZ A;  1OYI A;  1W7P D;  3WG9 A;  3CUQ B;  4HV5 A;  3GW2 A;  1T0F A;  1YG2 A;  1HKT A;  1IN5 A;  4XSX F;  3WU0 A;  2KKO A;  4HQE A;  5LRR A;  2XAH A;  3P9I A;  3WTX C;  5D8K B;  2OA4 A;  1FP2 A;  1STZ A;  1L0O C;  3FM3 A;  1BC8 C;  1YW8 A;  4GGG A;  1IN7 A;  5CVI A;  4A0X A;  1XB4 A;  1R5G A;  4LK1 F;  5FO5 A;  3DPL C;  1ZYR F;  2PN6 A;  2WV0 A;  2QWW A;  2QBY A;  4YFK F;  1W5T A;  4P9F A;  1ON2 A;  4KUM A;  1T39 A;  1ZG3 A;  3BRO A;  1UHW A;  3HHG A;  1OMI A;  4I7H A;  3D5L A;  2KRF A;  4U0W A;  3RIR A;  1I5Z A;  3KLN A;  2P7V B;  3VEP A;  5TJJ A;  3K1M A;  3NRV A;  3COA C;  1KU3 A;  3V4G A;  3GUD A;  2LDU A;  1ZRC A;  2EWN A;  2K7L A;  4E70 A;  2WWY A;  3KP3 A;  2HEO A;  3R4K A;  3LFK A;  4IVN A;  3IWZ A;  4GO1 A;  4YII A;  2JPB A;  1RUO A;  5CVU A;  1HW2 A;  1FP1 D;  3WU1 B;  3LST A;  4UXN A;  4NHJ A;  4AIK A;  2CW0 F;  1ZGA A;  3M8E A;  3WGG A;  5BPD A;  3FWE A;  4P9U A;  5KK1 A;  5K5Q A;  1VTN C;  3ZMD A;  4HQM A;  2D1H A;  3O2P E;  5DCM B;  3J81 Z;  2RN7 A;  1XGO A;  4A0Z A;  5IT9 Z;  1WI9 A;  2PG4 A;  2P5K A;  2FOK A;  1NHA A;  4OMZ A;  3U2R A;  4L5J A;  2IA0 A;  4M72 A;  2XHK A;  1XGS A;  3TKY A;  3ELK A;  3EDP A;  1GXQ A;  2OAZ A;  1A04 A;  3BPX A;  3QU3 A;  2NRA C;  4EMS A;  4KN4 X;  3WGH A;  2ESH A;  2QQ9 A;  1FBU A;  2IA1 A;  2V6C A;  1TNT A;  3ERE D;  3TO6 A;  5L3B A;  2F5F A;  1KQ8 A;  5ICF A;  4BHP A;  2WTE A;  3E5U A;  2RV8 A;  1WRJ A;  5JR3 A;  1QBJ A;  5K5O A;  1SD6 A;  3WE2 A;  3QU6 A;  2FE3 A;  5F64 A;  4JK1 X;  4LG0 B;  2Z5U A;  3V8J A;  3CDH A;  1USS A;  1XN7 A;  1L3L A;  3FF5 A;  2LSO A;  3E5X A;  4CYD A;  1HST A;  4UUV A;  4KIB A;  4LB5 A;  1U78 A;  4QWQ A;  1FC3 A;  3TQN A;  3LAJ A;  1RIO H;  3V7R A;  3K2Z A;  5LBQ A;  2HQN A;  3TOB A;  1W7P B;  3F8N A;  4LB6 B;  4R8H A;  3L7W A;  4M9X A;  3LA7 A;  4LJZ F;  4EQQ A;  4IF4 A;  4MHG A;  1SD7 A;  1RI7 A;  1CF7 A;  4EV0 A;  2DT5 A;  4HX4 A;  3M9A A;  1U2W A;  3W6K B;  1B6A A;  2Z33 A;  2WC2 A;  1O3T A;  2Y0M A;  1ZLK A;  3BPV A;  4PZJ A;  3R61 A;  1RNL A;  2C6Y A;  2YSR A;  5ERI A;  4KIF A;  2JRT A;  1G3Y A;  4XLP F;  1FSH A;  2DLL A;  2PJP A;  2KIM A;  3P9K A;  2ZNZ A;  4Q48 A;  2IW5 A;  4D0P A;  2BEO A;  4JBA A;  3TO9 A;  2XGX A;  2A5Y B;  4RGS A;  4KMU X;  5A2Q Z;  1IXS B;  1O57 A;  2ZBK A;  1FPQ A;  2BV6 A;  4RGR A;  3F8C A;  2FSW A;  4IXA A;  3WGI A;  3KP6 A;  2VXZ A;  5CVV A;  5BS6 A;  4IRI A;  1B59 A;  4GCV A;  4B8X A;  4P55 A;  3QAH A;  3W6J B;  3F8F A;  3SXY A;  1K7A A;  2P4W A;  3T1B A;  1BOA A;  2ZCW A;  3CJN A;  3V7C A;  4KNY A;  4MEY F;  3RYP A;  5DD4 A;  4WXD A;  4TV7 A;  3WTY C;  5E1X A;  1YW9 A;  1KYZ A;  1TNS A;  3B73 A;  3BWG A;  3N4M A;  3CUQ C;  1EV7 A;  5CLS A;  3WTV C;  1T98 A;  4EGZ A;  3VOE A;  5H20 A;  2GQQ A;  2O8X A;  1B9N A;  1ZH5 A;  3G3Z A;  2DPD A;  4KIG A;  2HKX A;  4PCQ A;  1PP8 F;  1W5S A;  3ZN1 A;  2QZ8 A;  2ACJ A;  3AAF A;  3GEZ A;  2V79 A;  1SMY F;  5K1Y A;  4OIQ F;  3SFZ A;  4HLX A;  5DYM A;  1XMK A;  4XSZ F;  2DQL A;  1ZLJ A;  2RC4 A;  3MWM A;  4OMY A;  1R22 A;  2PLY A;  3Q9V A;  2ZKZ A;  2R7F A;  2OZ6 A;  1P92 A;  1Z91 A;  2FA5 A;  2W84 A;  1FYM A;  4RS8 A;  1V4R A;  3FZV A;  5DCF A;  2W85 A;  1OYY A;  3RDI A;  1LDK B;  1H0M A;  4XBF A;  3IL2 A;  4N9I A;  4KT5 C;  5DD8 A;  3ZMU A;  1K78 B;  1MD0 A;  3F8B A;  5ICG A;  4M9S A;  2HDC A;  2UZK A;  1U3E M;  5D6F A;  5HLH A;  4WCG A;  3HSE A;  3KZZ A;  4BXU A;  3ABU A;  1Z1D A;  4KN7 X;  5E18 F;  1H9T A;  5D6E A;  4Q5S F;  1FT9 A;  4HW0 A;  5K5R A;  2QQB A;  3DEU A;  4KIC A;  3QPT A;  1YIO A;  2M87 A;  3F6V A;  5D4S A;  3E6B A;  4ENJ A;  1O3Q A;  1H9G A;  2V1X A;  3JSP A;  4WF2 A;  5ILV A;  3V7S A;  2HOE A;  2VBZ A;  5LHI A;  5FFZ A;  5ILS A;  4G8X A;  2PEX A;  1UHM A;  2ZME A;  1XCV A;  1ZAR A;  5F1R A;  1UST A;  3RKY A;  2GWR A;  1HKS A;  1C0W A;  3JTH A;  4GXO A;  2Z3Y A;  1IXC A;  2MD5 A;  5HLI A;  4IRG A;  5ICE A;  4Z2Y A;  3CUQ A;  1OR7 A;  4BHB A;  3VB2 A;  2FBH A;  2DAO A;  5HDN A;  3U9G A;  1ULY A;  3SZP A;  2VE8 A;  3MAJ A;  1DPU A;  2F2E A;  2K02 A;  3HOS A;  2VT3 A;  1U5T C;  3WOD F;  1PDN C;  1XSX A;  3HRM A;  5E1Z B;  2MH2 A;  1MDM B;  5HDK A;  2Z9O A;  5AIP A;  4KDP A;  4UVA A;  3O6B B;  2FEZ A;  3WTS C;  2EFQ A;  3TO7 A;  5IT3 A;  4BH9 A;  1R1T A;  3ZN0 A;  3MZH A;  1MZB A;  4ASN A;  2QYO A;  2YX7 A;  2LF8 A;  4ENN A;  3K0L A;  1WWX A;  2AS5 F;  2PFB A;  1ZN2 A;  4ETS A;  3L09 A;  3TDU C;  2XIG A;  2FXA A;  1S8N A;  4L9T A;  3LA2 A;  3TGN A;  3IRQ A;  2IP2 A;  4EVI A;  2DI3 A;  3IC7 A;  2OBP A;  2EV6 A;  3RJP A;  1K6O A;  2O61 A;  3HHH A;  4OOI A;  5DCM A;  2HYG D;  1DDN A;  3IRR A;  4G7O F;  2XRN A;  1BI1 A;  3E97 A;  3HRT A;  2MLG A;  1Z7U A;  1F9N A;  5LRS A;  3J80 K;  3RPQ A;  4UV8 A;  3RPU A;  4A12 A;  4HOB A;  1ONV A;  1HW1 A;  2XKP A;  5EEH A;  4GYI A;  2A6H F;  5LEJ A;  1XDS A;  1G3T A;  1V3F A;  2L3D A;  4N9H A;  4AD9 A;  3OOP A;  4OIR F;  3L00 A;  1MKM A;  2XKO A;  2DQR A;  1I6X A;  2HR3 A;  4O5V A;  2HQR A;  3E3V A;  3I58 A;  4LMY A;  1AWC A;  5AON A;  1J75 A;  4MEX F;  2YU3 A;  2PI0 A;  2DK8 A;  2K4B A;  3FMS A;  2ISZ A;  3PQJ A;  3QP5 A;  1R1U A;  4CO8 A;  1WSU A;  3ZMZ A;  2M8E A;  1FYK A;  1HBX G;  4AWX B;  3F22 A;  5FB2 A;  3V8K A;  3EQL F;  2HGC A;  2H6B A;  4ESJ A;  1UFM A;  3PFI A;  5E8I A;  3LA3 A;  2X4H A;  4FHT A;  1RUN A;  2RKH A;  2Q2E A;  4R79 A;  4HDV A;  1Z9C A;  2NYX A;  3GYH X;  4LG0 A;  1P4W A;  3QOP A;  4ZYH A;  3F6O A;  3GZ5 A;  2R7D A;  2VC0 A;  3ZMS A;  1U5T A;  2EV5 A;  2CYY A;  2XAS A;  4Y15 A;  1KA8 A;  3FX3 A;  1FX7 A;  1S29 A;  5D5X B;  3MFK A;  1FBQ A;  4HYE A;  4UV9 A;  1E17 A;  5LLQ A;  1TW2 A;  1OYW A;  3RI4 A;  1BI2 A;  4M73 A;  4OU0 A;  2P6T A;  4M9Z A;  3GF2 A;  3LQQ A;  5A2Q K;  3J80 Z;  2P5V A;  4RB0 A;  2W57 A;  2VE9 A;  1BBY A;  1SD4 A;  4WK8 F;  3RYR A;  1R5H A;  4DQ2 A;  1YW7 A;  5E8G A;  4HLY A;  2HFH A;  4Y17 A;  4YFX F;  2KJB A;  2OZU A;  4FX4 A;  2GA2 A;  4EM1 A;  1S3J A;  3I59 B;  1XGN A;  1SFX A;  4GYG A;  4KYW A;  3NEU A;  5LHG A;  1U8R A;  2A07 F;  4HF1 A;  1CGP A;  1O7L A;  3ABT A;  2QUF A;  2DK5 A;  2KJC A;  1R7J A;  5JHU A;  1B4A A;  2QQA A;  5J6X A;  5L3E A;  4WWC A;  3PQK A;  2EJR A;  1YTY A;  1QZZ A;  1ZRF A;  1R23 A;  5TRD A;  3F3X A;  4L18 B;  1QNT A;  2H27 A;  1Q1H A;  4HDU A;  3K1P A;  2CQK A;  1BIA A;  2XV4 S;  2OU2 A;  2Q0O A;  3E6M A;  4BYY A;  2IT0 A;  2V1U A;  3C3W A;  4EJO A;  3HSF A;  5CVR A;  3SHF A;  3M8F A;  3REO A;  4BQA A;  2QM3 A;  4I98 B;  1OPC A;  2PMH A;  3U1D A;  2JPC A;  3K9T A;  2O3F A;  3BP8 A;  5ED4 A;  3SQN A;  1J7K A;  4OIN F;  3EET A;  1I27 A;  4JQF A;  3I0T A;  3I53 A;  2V1D A;  1TBX A;  3ULQ B;  3CUO A;  1JXS A;  3O3K A;  1ZAO A;  3CO7 C;  4K2E A;  2L4A A;  2F5D A;  1EH8 A;  4U7D A;  3T8T A;  2A69 F;  2O03 A;  4HF0 A;  2ZXJ A;  3E6C C;  2MA3 A;  3V8L A;  2GXB A;  2D45 A;  2GAU A;  2W24 A;  2IVM A;  5L3G A;  3F8M A;  4ESF A;  4FX0 A;  2PBI A;  1FY7 A;  1WKM A;  2M5W A;  3MZY A;  3ZP5 A;  3R0A A;  4U7B A;  5FLX K;  2M1B A;  2FRH A;  2BBY A;  1FZP B;  4ENK A;  1PUE E;  4EM2 A;  1EH7 A;  2EV0 A;  4CHU A;  1IN4 A;  2BYV E;  1FOK A;  1XGM A;  2A61 A;  3L9F A;  2KIU A;  1KU7 A;  3FXU A;  4L5I A;  3P9C A;  2FNA A;  4U0Y A;  5DDG A;  2VT2 A;  3I54 A;  1S7O A;  4LD5 A;  3B02 A;  5DV5 A;  3BOQ A;  3RKX A;  1G3S A;  3GFJ A;  5L3F A;  3H3U A;  2CO5 A;  2O0Y A;  2P8T A;  2W25 A;  3TOA A;  1MJA A;  3HIF A;  1QZY A;  2VON A;  4I2O A;  1IN8 A;  2FBK A;  3KP7 A;  2DW4 A;  3JW4 A;  3GWZ A;  1GHC A;  3IKT A;  2H6C A;  1J0R A;  2R3S A;  5FFX A;  4ZZD A;  2Y48 A;  3I4P A;  4PDK A;  2PMU A;  3H92 A;  2GXG A;  4O3M A;  3EUH A;  2CSO A;  2FQ3 A;  4YIF A;  2VN2 A;  3RKW A;  4EJT A;  2MH9 A;  2ZO4 A;  1KQ9 A;  2RDP A;  4ZYE A;  5FLX Z;  4KA4 A;  3HOT A;  1LDD A;  3KLO A;  1OKR A;  1X3U A;  3ML6 A;  2EA2 A;  2YPR A;  4WX9 A;  4LLG F;  2CG4 A;  2VOO A;  1O3S A;  3H3Z A;  3GFM A;  3I64 A;  1BC7 C;  1HKQ A;  2EFN A;  3HUG A;  1FYL A;  1EH6 A;  3GZ6 A;  3KE2 A;  4U88 A;  3FM5 A;  3VOD A;  1HQC A;  3G73 A;  4CXF A;  1DPR A;  2D2W A;  1D3Y A;  6PAX A;  1TW3 A;  4YFN F;  4HF2 A;  1MJ9 A;  2P5L C;  2E7X A;  5FGM A;  2DU9 A;  4G6D A;  5D4R A;  3DKW A;  3LAP A;  4EJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...