5DD8A

The crystal structure of hucr mutant (hucr-e48q) from deinococcus radiodurans
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLQRLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histidine switch controlling pH-dependent protein folding and DNA binding in a transcription factor at the core of synthetic network devices.
pubmed doi rcsb
molecule keywords Transcriptional regulator, MarR family
molecule tags Transcription regulator
source organism Deinococcus radiodurans
total genus 53
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd8A00
1EH8A 4BHCA 2IA2A 2A5YB 4A6EA 1ZG5A 1E17A 1KQ0A 2FBHA 3R6SA 2P7CB 2NAZA 4CO8A 1D5VA 4XSXF 4LB5A 2EFNA 2V9VA 4R1HA 2ZO4A 2VBZA 1H9TA 3HTUA 1VTNC 3WTZA 3I59B 4QWQA 1Z9CA 2VC0A 1HW1A 2JPBA 5BPDA 3TO7A 3KP6A 1UHWA 3E6BA 1HKTA 4R8HA 5FLXZ 1BBYA 2OA4A 3QP5A 5HDKA 4N9HA 1D8JA 2FEZA 5D5XB 3ZP5A 3CUQC 2ACJA 2RV8A 3ZMUA 3CUQB 5ED4A 3E5UA 4RGRA 4IRHA 3WTUC 5A2QZ 1MKMA 3M9AA 3U1DA 5LHGA 2MA3A 5ERIA 1I6XA 3CJNA 3B73A 3QU6A 4EJOA 4UVCA 4IPAA 2HR3A 3EETA 4DQ2A 1R00A 1UCRA 1S7AA 5DV5A 4BH9A 1BIBA 5BQTA 5L3GA 3E3VA 1YFHA 2A68F 4MQVA 2CWEA 3HHGA 1KU7A 5BOXA 3QAHA 4P9FA 2AXLA 1LB2A 4HLXA 2ZFWA 5H6QA 4BNCA 5EEGA 4L0YB 5HVQC 1J7KA 3L2CA 4WWCA 3MAJA 2P7VB 3M1EA 5D5VB 1XGNA 3SZPA 3C1DA 3PQJA 3P9CA 4CICA 3ULQB 2QUFA 4KIGA 2XIGA 3KFWX 2PN6A 2BEOA 2VC1A 4LFUA 1XGMA 1QPMA 2RKHA 1R23A 3DKWA 1GHCA 4HV5A 2PJPA 3NEUA 2DFIA 1FP2A 4M71A 1G3TA 4Q4ZF 1ZYRF 2QQBA 3RKWA 1U3EM 3IKVA 1QNTA 2K4JA 2NNNA 3T1BA 4ZYEA 3RTRA 3GZ5A 5L3FA 1JXSA 4OIRF 3F21A 3ZN1A 4JBAA 4MTEA 2W84A 4IVNA 1BC7C 2A6EF 5DD4A 5D8LB 4ESJA 3CO6C 3TO9A 4IHTA 1QQIA 3KETA 1H0MA 2FNPA 4KICA 4A0XA 2IA0A 4IRIA 2CSOA 4Q5SF 3R0AA 4ENJA 1IRFA 1ZLJA 3KCCA 4CDGA 1Z6RA 3VODA 3GX4X 4N0BA 2M1BA 3T8RA 4UVBA 4A5NA 2OD5A 1OYIA 3BJAA 1OKRA 4F7ZA 2L4MA 5J8FA 2YSRA 4A12A 4RB3C 3HOSA 1QZZA 2KRFA 3TDZC 1XGOA 4ESBA 1IN7A 1YQAA 3L9FA 3V8JA 4PCQA 3QOPA 1U5TA 2EV5A 4GCVA 5L3EA 2GA2A 4XRFA 5HDGA 1REPC 3R60A 2FU4A 2V79A 2HS5A 2L01A 4YIFA 3R0JA 3HSFA 2BE5F 3MEXA 5LGNA 1IN4A 1T0FA 2XGXA 2ESNA 1XN7A 1KU3A 1BJAA 2DW4A 3EYYA 1R5HA 1FP1D 2YX4A 2IA1A 4YG2F 1IF1A 3HUGA 4M9SA 4OIQF 2Y0MA 3BDDA 1FZPB 1FYLA 4IHSA 3PQKA 1USTA 2B0LA 1BIAA 2J5OA 3IKTA 1FPQA 1BC8C 2EA2A 4L5IA 4PDKA 5JI6A 4EM1A 1YW9A 2A07F 2ESHA 2HWVA 1KYWA 4LG0B 1G3YA 1YG2A 1HKSA 3V4GA 3MZYA 3L00A 1MDMA 2CO5A 2XRNA 4XSZF 3KP2A 3JAMZ 2AS5F 4P9UA 2Q8KA 2PLYA 1FSEA 2ZKZA 5J8CA 2KJCA 5JHUA 3J80K 1GXPA 4S04A 5FO5A 4OIOF 1X3UA 1WI9A 1NHAA 1LEAA 2WTEA 1ZRDA 2X0LA 3GYHX 1HQCA 1YLFA 1Z1DA 3GFMA 4O3MA 3RJPA 2NS0A 4P55A 4XBFA 1T98A 2JT1A 2GZWA 1ZRCA 3F72A 2XKOA 5H6RA 1U6GA 2XKPA 2CG4A 4AD9A 4HDVA 1K79A 3P9IA 3QPHA 1IN8A 4M74A 2H09A 4HQEA 1CF7A 3F3XA 2YR2A 4ENKA 4HBLA 1P92A 2PMHA 4R79A 1UFMA 2FNAA 1OYWA 3T5XA 2Y75A 3BZ6A 5LLQA 2DK5A 3K1PA 2LNBA 2A61A 2HQNA 4I0BA 4RGSA 1W4MA 2EWNA 4NQWA 4ON0A 5CYVA 2STTA 4KUMA 2HOEA 3WE3A 2VODA 3U9GA 4CXFA 2M30A 3F6VA 3BOQA 2IT0A 2K02A 1U8RA 3LSTA 1BOAA 3L7WA 5HLGA 2QQ9A 4AIHA 1BI2A 3IL2A 1AOYA 4HF2A 1FBSA 3COAC 5L3BA 1K7AA 1Y0UA 5JFRA 2P5VA 3I58A 3GLXA 2QBYA 3VOEA 1W7PD 3ABTA 1HW5A 1TW2A 4HF0A 5A2QK 4EVIA 3J81Z 2XAQA 2DLLA 3K1NA 5D5UB 2DAOA 1I1GA 4ZYGA 2PI0A 3U2RA 3TOBA 4NB5A 1Z7UA 4EJUA 4RAYA 2ZCWA 5E20A 3HHHA 1G3SA 1K78B 3ZMVA 4GXOA 4BHBA 2HDCA 4L5JA 2QZ8A 2HTJA 3MQ0A 2K86A 1IUYA 4L9JA 2FF4A 3FMSA 4NHJA 2L3DA 5D8KB 1SMTA 4Z2YA 3GZ6A 5HLHA 1FBQA 4ASNA 5HS7A 5BPIA 1LVAA 1IXSB 4WX9A 3RDIA 2ZXJA 3I59A 1W5SA 2EFWA 3HSRA 4A0YA 4RS8A 1H9GA 1YS7A 2MBFA 5DEQA 2V1DA 4O6JA 1R36A 1TW3A 2HZTA 1A04A 1XSVA 4YFXF 3BP8A 4I02A 1J9IA 4L18B 3W6KB 1J2XA 2QQAA 2P4WA 4AVPA 3I54A 4ZZDA 1LEBA 3CUQA 5F6FA 2FBKA 4I7HA 1ON1A 2DBBA 1ZN2A 4EGYA 1CGPA 3M8EA 4B8XA 2C6YA 2EFOA 4KT5C 1BN5A 1R22A 5EEHA 1USSA 1FC3A 2XAJA 2OQGA 3Q5FA 2HEOA 3KLNA 1V4RA 4ZYHA 1ZARA 2P6SA 1XB4A 4HX7A 3WTTC 1R1VA 3IC7A 2ZNZA 3I5UA 2ETHA 1HSJA 2FSWA 1I1SA 2UXNA 5CVJA 3RKYA 2P5LC 4IXAA 4RB0A 4WCGA 4UXNA 1SMYF 1MJ9A 3KEQA 4YFKF 2YU3A 3LA2A 3FZVA 2PEXA 4H0EA 2O61A 4ENMA 4OU0A 5FFZA 4HA8A 4A2UA 2PBIA 2EV0A 2GAUA 3GEZA 4YIIA 3RPUA 4L9TA 1ODDA 5CJ9A 3EUHA 3FX3A 2XAHA 1W5TA 1ZGJA 1IZ1A 1R5GA 5LGUA 1FSHA 2MH9A 3F6OA 1T6SA 5DCFA 1G4DA 1JHFA 2QENA 2DPUA 3BY6A 1BM9A 2EB7A 2IPQX 4KNYA 3GFLA 5DYMA 4U88A 2L54A 3FHZA 4GGGA 2O03A 3V7RA 5E18F 2YPRA 1WQ2A 2OZ6A 3VFZA 3LQQA 1B9MA 3SFZA 4U0VA 5J6XA 2KIUA 3D0SA 4PGGA 3S2WA 3ZMDA 3FMQA 4M73A 3HRMA 1ONVA 2G7UA 3WTVC 5ILVA 5DCMB 4GYGA 1OR7A 2VN2A 3C7JA 1T38A 2P6TA 1FY7A 3K2ZA 3WGGA 1YYVA 4HDUA 2L02A 3SXYA 2IJLA 2W85A 4LLNA 2JPCA 4LK1F 2DT5A 1IAWA 1FWZA 3JAMK 2F5CA 1FOKA 1D8KA 2QYOA 2DQLA 3ROUA 3Q9SA 5BMZA 1TLHB 2J5PA 2FA5A 2LSOA 4K2EA 3FMRA 5E17F 3JSPA 1XSDA 2GQQA 4IF4A 1I5ZA 2F5DA 3LFKA 4UNOA 4GO1A 1HBXG 1HXDA 4ZZLA 1XGSA 2DK8A 2PG4A 1KQ8A 3DQVC 3T0YA 2HFHA 1MJAA 2EK5A 2LKPA 3HYIA 5TJJA 2NYXA 4Y17A 3DPLC 5KVRA 2E1NA 1XD7A 3G73A 2G9WA 3H92A 4LG0A 1FNNA 4MEXF 1J5YA 2PQ8A 4LK0F 2BGCA 4HOBA 4KIFA 4S05A 2EFPA 2FQ3A 1LDDA 3PFIA 1O3QA 1XSXA 1QGPA 3ZN0A 1J75A 2ADUA 2HYGD 4XLPF 1W7PB 2Y48A 3SQNA 3KP3A 1U2WA 3W6JB 2KKOA 3GW2A 2QM3A 4CZZA 1Z05A 2ZJ2A 4CGZA 1R1TA 2E7XA 4LJZF 3I4PA 2A69F 2XHKA 1B9NA 4YFNF 1LNWA 4IRGA 1KU2A 3GFJA 2MD5A 2FMLA 1ZHFA 3KP7A 4U0WA 4CYDA 5TRDA 2VOPA 3LAPA 1PP7U 1QZYA 1O7FA 3LQRA 2L4AA 4MNUA 3RIRA 4HF1A 2WC2A 1B59A 2EFQA 3FM3A 3JTGA 1B1BA 3LA3A 5AIPA 1TQMA 1G3WA 1JE8A 4XLNF 3N97A 3HTSB 3DV8A 3BJ6A 5F1RA 3ZQ7A 4BYYA 2K27A 1Z91A 4G6DA 4LLGF 1K6OA 5CVVA 4FX4A 3F8CA 3WTWC 3LWFA 4CHUA 3E6CC 2FXAA 1YW7A 1T39A 2V6CA 1EH7A 2VT3A 1P6RA 3GF2A 5DDGA 1S3JA 2ZMEB 4LMYA 4EJVA 5IT9Z 3OOPA 4AWXB 4U7BA 1WKMA 3RI4A 1R1UA 3WU1B 5D6FA 3QPTA 2HQRA 3KP5A 2VT2A 1MJBA 2GWRA 2GXGA 3WGHA 4G6QA 2RC4A 1WSUA 1DDNA 3FWEA 1R58A 5AONA 2MH2A 1O57A 4EMSA 2K7LA 3F8FA 4RGUA 1V3FA 2XAGA 2WV0A 1B6AA 5K5RA 5CLSA 5DUIA 2GA1A 4OIPF 3NQOA 4M9XA 2D1HA 2IVMA 4HLYA 3IRRA 2O6GE 1YTYA 1K78A 1XCBA 1YS6A 2G7HA 3ZMZA 1QBJA 1P2FA 1ULYA 2O3FA 4KN7X 5D4RA 1RNLA 3HRUA 4BAYA 3ABUA 3K69A 5FLXK 5HOOA 3DEUA 3GXOA 1LDKB 2Z33A 1FX7A 4UVAA 4GYIA 2CQKA 3GUDA 3F22A 1OYYA 1JHHA 1FYMA 4RGXA 4MTDA 2LF8A 3TKYA 2XASA 1EV7A 3WTXC 3RYRA 3KLOA 1PDNC 3ZMTA 2M8EA 3CUOA 5ILUA 1IRGA 2RGVA 1F9NA 1J0RA 1OPCA 2A6HF 2ISYA 3E6MA 5DUKA 5ICEA 4A0ZA 1HKQA 2Z5UA 4ESFA 3MWMA 2KJBA 1GVJA 3REOA 2D45A 3NRVA 1SFUA 2K4BA 3K1MA 2IP2A 2X4HA 3ECOA 5E1ZB 3MFKA 4EGZA 1XDSA 1RUNA 4ENNA 2Z99A 5F64A 3N4MA 3O6BB 2RNJA 2A3SA 3HIFA 4U7DA 1DP7P 1R7JA 4EM0B 2P8TA 4UV9A 5K5OA 5D6EA 5H20A 3DF8A 2MLKA 2W25A 3CLOA 4PZJA 1B4AA 1RIOH 2XV4S 2EA4A 3ELKA 3KP4A 4PGHA 4ZYDA 3EDPA 5FD5A 2UXXA 4EJTA 4RAZA 2DI3A 1O3SA 2CW0F 3F8BA 1KQ9A 3M8FA 4WF2A 3C18A 1TNSA 4HYEA 5AIQA 5LHIA 2E7WA 4Q47A 4OMYA 4KDPA 4G8XA 1Z6TA 4KFCA 3I71A 5LHHA 1PUEE 4ETSA 2VBWA 2Q2EA 4WXDA 3WTSC 3JSOA 5FFXA 3OV8A 1AWCA 1LDJA 2GXBA 2UWMA 3DFGA 1ZLKA 4OMZA 3BWGA 4MEYF 1ZGAA 3SHFA 5HS8A 2M45A 5DCMA 1STZA 2NNYA 4G7OF 1D3YA 1LJ9A 1SFXA 2P5KA 3CTAA 4E70A 1L3LA 1F4KA 2Q0OA 3E97A 2O8XA 4EJWA 4G7HF 5FD6A 5JR3A 1WWXA 5LEKA 2STWA 3JW4A 2F2EA 2CYYA 4HW0A 3SZTA 5HS9A 2HGCA 2PFBA 4M6YA 1TTYA 1IN5A 3RPQA 1DPUA 3T8TA 2XUBA 5FGMA 5JVTA 4FHTA 1SD4A 1SD6A 1DUXC 3RKXA 5E1WA 5LGTA 2QWWA 5KK1A 3E5QA 4BXUA 1E2XA 4B09A 2F5EA 4M9ZA 5D5WB 5ICGA 3FF5A 3DPTA 2DQRA 2JRTA 1OMIA 2MC3A 4LB6B 4A6DA 2ISZA 4KYWA 2DTRA 3ZPLA 1KU9A 2R7DA 3DXJF 3VEPA 4O5VA 2FE3A 1KGSA 2ZNYA 2FBIA 4MHGA 3F8MA 2WWYA 2V1XA 4M6XA 2LDUA 5E1XA 1FBUA 1BI3A 1S6LA 2ELHA 1PP8F 1S7OA 2W24A 5ICCA 2VONA 1XCVA 4L9NA 4JK1X 3WGIA 1G6NA 4KMUX 2OBPA 3G3ZA 3HRSA 4HQMA 4A5MA 4I98B 1P4AA 1RZ4A 3HSEA 4HX8A 4MGRA 3R61A 2QLZA 4P96A 4D0PA 2OZUA 3QP6A 3H3UA 2FOKA 3M7GA 2R7FA 3IRQA 1IW7F 3KEOA 1W7PA 2RN7A 2ZBKA 3B02A 5IT9K 1ZG1A 4I01A 1FYKA 1SFEA 3O2PE 4I09A 2CFXA 2RVCA 3J7AO 1P4XA 3HOTA 4L0ZB 1J59A 3V8LA 4Q48A 1L0OC 4KA4A 3L09A 2KIFA 5E8IA 2Z9OA 4LLLA 4LD5A 4Y13A 2DO7A 5LRSA 3WG9A 3P7NA 2NRAC 4KMFA 2VE8A 2XROA 2QVOA 1MZBA 3GWZA 5CVRA 5LBQA 2FRHA 2EV6A 4G94A 5HDNA 4UUVA 1FLIA 5ILSA 4AIKA 2UZKA 5L3DA 1S8NA 4WXHA 5DD8A 2HTSA 4HAMA 1UB9A 1S29A 4M72A 4G9YA 4U0YA 3TQNA 4BQAA 1HW2A 1LQ1A 1U5TC 4UV8A 2ZMEA 3TGNA 1ZAOA 4Y15A 1U5TB 5LEJA 1JGSA 3J81K 2RDPA 2YX7A 1RUOA 2JTVA 4HX4A 1SD7A 2BBYA 3BJOA 3TOAA 1C0WA 3LAJA 2HYFA 3WU0A 4EQQA 1GXQA 4KIBA 4OINF 3KZYA 3WE2A 2BYVE 4IJAA 1O7LA 1UHMA 2XVCA 3ML6A 3EYIA 3ZMSA 1YIOA 5L3CA 1T2KA 4ZH4F 1ZRFA 4RB2C 3I53A 2E1CA 3LA7A 3HRTA 5E8GA 5IT3A 1ZG3A 3BPVA 3WTYC 3ERED 4AIJA 2D1VA 3K0LA 3F23A 5BS6A 3MZHA 2COMA 2Z3YA 4OOIA 3WODF 3FXRA 1BI1A 4HV6A 2BV6A 1QO0D 4WK8F 5K5QA 4FT8A 2JSCA 2VOOA 3I64A 4HZFA 3GVAA 4N9IA 3E6DA 1KA8A 3EQLF 3ISPA 1YW8A 1MDMB 2M5WA 2F5FA 3P9KA 1XDUA 4KN4X 4JQFA 4UHTA 3Q9VA 3AAFA 3V7CA 3IWZA 2TDXA 3IWFA 2H27A 3FXQA 2W57A 3KE2A 4QLCU 2VBYA 3JTHA 4I2OA 2OQRA 4L9VA 3VB2A 3DP7A 4P5OA 4EM2A 2HKOA 4TV7A 1XMAA 2H94A 3H3ZA 3FXUA 4WXCA 3I0TA 1TNTA 1I27A 1TQPA 3GO5A 2GIVA 1WRJA 3FM5A 2LF7A 1CF7B 1F1ZA 4DNCA 2R3SA 2KIMA 3QU3A 5D4SA 5FB2A 1TQIA 1KYZA 1MGTA 1IXRC 3TDUC 2D2WA 1ON2A 1HSTA 1TBXA 2OAZA 3CDHA 2IRFG 3CO7C 3QRFF 1F5TA 2IW5A 3C3WA 4MQ9F 2XAFA 3K9TA 5HLIA 4I0AA 1SD5A 2VBXA 3D5LA 2V1UA 6PAXA 1YO5C 2VXZA 2FMYA 3MCZA 5CVUA 1EH6A 3IHUA 4FX0A 4BHPA 1XMKA 1SAXA 5LRRA 2JZYA 1O3RA 2HKXA 5K1YA 3BPXA 2CGPA 3R4KA 3J80Z 3E5XA 1P4WA 1ZH5A 2VE9A 4EV0A 2DU9A 2M87A 3F8NA 1IXCA 2DPDA 1RI7A 3O3KA 5CVIA 1O3TA 2RQPA 2OU2A 2MLGA 2H6BA 4RB1A 2QBYB 1Q1HA 1MD0A 3V7SA 5ICFA 4LGWA 3V8KA 1ZREA 1FT9A 2EJRA 1DPRA 3RYPA 4G7ZF 2O0YA 3KZZA 2H6CA 3TO6A 1BI0A 2PMUA 3ECHA 3GFIA 3BROA 1IN6A 1U78A
chains in the Genus database with same CATH superfamily
2FQ4A 4AM3A 4B3XA 1EH8A 2E60A 4BHCA 4A93J 2IA2A 2A5YB 1V54H 4EEFG 1UHSA 1BW5A 2XF5A 5J1YA 4XRMA 3G1OA 4A6EA 1ZG5A 1E17A 2BVLA 5B1AH 2JA2A 1KQ0A 2F6CA 2FBHA 4XK4A 3R6SA 2EZIA 2HXOA 2ZXWH 3KX2A 2CS3A 2P7CB 3HXLA 2NAZA 4CO8A 4HSRA 4B48A 3C2HA 4XSXF 1D5VA 2LY9A 2DOEA 4LB5A 2EFNA 1YJ9I 2KZVA 5E3NA 1BW6A 1MH4A 2V9VA 1M1EB 2ZO4A 2VBZA 4R1HA 1H9TA 3SFIA 4BQOA 3HTUA 1VTNC 3WTZA 2L7MP 3I59B 5M5WJ 1TC3C 4QWQA 1Z9CA 3Q0UA 1RR8C 2DA2A 3ZQIA 2VC0A 1TWFJ 3LSMA 1HW1A 2JPBA 4LIVA 5BPDA 5FLVA 2CRGA 3TO7A 3KP6A 1UHWA 3MKLA 3E6BA 1HKTA 4R8HA 1MMNA 4BKXA 1BBYA 2OA4A 5FLXZ 3J7YJ 1WZ2A 2WAQA 2HNHA 1ZR4A 3QP5A 4FQGA 5HDKA 3A2KA 4N9HA 1YHQI 1D8JA 2AO9A 2FEZA 5D5XB 3ZP5A 3CUQC 2JRMA 2FX0A 3PFYA 2DDAA 2R7QA 3CCYA 2DA4A 2ACJA 3NARA 2RV8A 3ZMUA 3CUQB 5ED4A 3E5UA 4RGRA 4IRHA 4RDUA 3WTUC 5KAIC 5A2QZ 1MKMA 3M9AA 1MW7A 3U1DA 3H3VK 3OYJA 4A3JJ 1TWCJ 1PUFB 5LHGA 1X4OA 2MA3A 1JKPC 5ERIA 1I6XA 2RQQA 3CJNA 3B73A 3QU6A 3J7AY 4EJOA 2JK3A 4UVCA 3UR3C 2L0KA 4IPAA 2HR3A 2P81A 2XSDC 3EETA 4DQ2A 3HEFA 1R00A 1UCRA 1OCCH 1S7AA 5DV5A 4BH9A 1IDZA 3BTCA 1BIBA 2LKSA 2L9SA 2A05A 3RCOA 5BQTA 1XC5A 5L3GA 3E3VA 4M3BA 2VQGA 1YFHA 2A68F 3VSKA 4MQVA 2CWEA 2IEKA 3OIPA 3HHGA 1IUFA 1KU7A 5BOXA 3QAHA 4P9FA 2KZGA 2E34A 2AXLA 1LB2A 4HLXA 2XPVA 4IHXA 2ZFWA 5H6QA 2W4SA 4DOZA 4BNCA 5EEGA 4BEHA 1TP4A 4L0YB 5HVQC 1ZK8A 1J7KA 3L2CA 4WWCA 4HRIA 3MAJA 2P7VB 3M1EA 5D5VB 1X1PA 1XGNA 4I6ZA 3SZPA 4A3FJ 3C1DA 3PQJA 3P9CA 4CICA 1KONA 3ULQB 2QUFA 4KIGA 1TWHJ 2XIGA 3EUHC 3KFWX 2PN6A 1MBJA 2BEOA 3OOUA 2VC1A 4LFUA 4BJTA 5H2FC 2X1DA 1XGMA 1QPMA 1XTAA 2RKHA 1VQNI 1R23A 2MFZA 3DKWA 1GHCA 4BE2A 3HBLA 5M5YJ 4HV5A 2PJPA 4JX5A 3NEUA 2DFIA 1I50J 1FP2A 4M71A 1G3TA 4RBOA 4Q4ZF 2W1OA 3BC8A 1ZYRF 2XB0X 1Y1WJ 2QQBA 2KRCA 4HNVA 3RKWA 1U3EM 3WG7H 3IKVA 4XR6A 1HC8A 1QNTA 4XKCA 4F91B 1Z77A 2Y9ZA 2K4JA 2E2IJ 2NNNA 3T1BA 1U0JA 4IO9F 4ZYEA 3K10A 3RTRA 2JUCA 1FOYA 3GZ5A 3JRBA 5L3FA 1JXSA 4OIRF 3F21A 1WJCA 2X6XA 2ECBA 3ZN1A 4JBAA 3LSRA 2HOSA 3RZDJ 1NH3A 4ITVA 4MTEA 5GPCA 2W84A 1X1BA 3A01A 3HOWJ 1FOXA 3H0DA 4IVNA 1BC7C 2HPMA 3PSFA 1OR7C 3OIQA 3LSGA 2A6EF 1TZLA 5DD4A 1WFXA 3Q3SA 5D8LB 4XRSA 4ESJA 3CO6C 2NVTJ 3TO9A 4IHTA 1QQIA 3MKYB 3KETA 1H0MA 1FTTA 2COBA 2FNPA 4KICA 4A0XA 2IA0A 2AQEA 4IRIA 3WU2C 2CSOA 3K4CA 3K70D 4Q5SF 3LSJA 3R0AA 5IOYA 2ICWG 4ENJA 1IRFA 1ZLJA 2GOMA 1IRZA 3KCCA 4BL0B 1UELB 4CDGA 3GTJJ 2KT0A 1Z6RA 3VODA 3GX4X 4N0BA 2M1BA 3T8RA 3UNGC 4UVBA 4A5NA 2OD5A 2R93J 1OYIA 1SVMA 2NOGA 4E7SA 3BJAA 2XC7A 1DP3A 1OKRA 4F7ZA 2XPUA 1BOBA 3A1YA 2L4MA 5J8FA 2W7NA 1ZTRA 2MABA 2E36A 3CJQB 2YSRA 1WI3A 4U87A 4A12A 4RB3C 3HOSA 1QZZA 3VDXA 1HDDC 3S1QJ 1FIAA 2KRFA 4A3EJ 5HLTA 2XRLA 5CPRB 3TDZC 1XGOA 4ESBA 4FE4A 1IN7A 1ZR2A 1YQAA 3L9FA 2HDWA 4JX4A 3V8JA 3NWSA 4PCQA 3AG3H 3QOPA 1U5TA 3HG9A 1TT5B 3CCQI 3BCBA 2EV5A 4GCVA 4PUSA 1BR4A 5J4VA 2HVSA 3HGGA 5L3EA 3CD6I 2GA2A 4XRFA 5HDGA 1REPC 3R60A 1UMQA 2FU4A 1VQ4I 2V79A 4J19A 2HS5A 2L01A 2FD5A 4XKBA 3JRFA 2VKEA 4YIFA 2VKDA 3R0JA 1E3HA 3HSFA 2BE5F 4E7JA 5FLMJ 2R5YA 5E3LA 1U9OA 3MEXA 5LGNA 1IN4A 1T0FA 2XGCA 3K6GA 1F43A 5B66C 1Z67A 4C2MJ 4FTHA 2XGXA 3ZGKA 2ESNA 4F55A 1XN7A 5IY5H 3U21A 1KU3A 1BJAA 1UZCA 2DW4A 2OUMA 1HOMA 3EYYA 1R5HA 1FP1D 2YX4A 2O9LA 2IA1A 3PO3J 3GTOJ 2TCTA 4RLFA 3PNYA 2DYRH 2KDOA 4DYQA 4YG2F 1IF1A 3HUGA 4LIUA 4HNUA 4M9SA 3KYCB 3CP8A 4OIQF 2Y0MA 3I55I 3BDDA 1FZPB 1FYLA 4IHSA 3PQKA 2HQ5A 4BBSJ 1USTA 2B0LA 1BIAA 2J5OA 3IKTA 3EUAA 1FPQA 2WAEA 5E3OA 3RQIA 1BC8C 2EA2A 2E2HJ 2JN6A 4L5IA 2VL8A 4A3MJ 4PDKA 5JI6A 4EM1A 1YW9A 2A07F 4E4HA 3JRGA 2KQRA 3PSIA 2ESHA 1YJNI 2HWVA 1KYWA 3VYTB 3HKZA 5J3LA 1R5ID 3CCSI 4LG0B 2FOWA 1G3YA 1YG2A 2VIXA 1HKSA 4M3GA 4Z6YA 2QKMB 3V4GA 3MZYA 4ZYAA 1S72I 2LR8A 2PMZN 2NVYJ 2RAEA 2LLKA 3ABLH 1FJLA 1W0UA 2GLOA 3L00A 3PJRA 4D1QA 1MDMA 1FMWA 2CO5A 2XRNA 4XSZF 3VYRB 3KP2A 4F93B 5IP6A 3JAMZ 2AS5F 1TT0A 2XPWA 5FKOA 3ZQGA 4HPQA 2BY0A 4P9UA 3H9QA 2Q8KA 4YRVA 2PLYA 1LE8B 1FSEA 2ZKZA 3W6VA 5J8CA 2KJCA 3GTPJ 1QPIA 5JHUA 3J80K 1XMXA 1GXPA 3KEYA 4S04A 1VI0A 3DBHB 1MMSA 2DMPA 5FO5A 4OIOF 1X3UA 1WI9A 1NHAA 1LEAA 3G4SI 2EPFA 2IGMA 2WTEA 1ZRDA 2X0LA 1HQCA 3GYHX 1YLFA 3CMYA 5M3MJ 1Z1DA 3GFMA 4IHWA 4O3MA 5FKLA 3RJPA 1R4NB 2NS0A 4P55A 4XBFA 1T98A 2Q1ZB 3BR1A 2HYJA 4PSXA 2JT1A 3G1MA 2H8RA 2ZMEC 4C3JJ 2GZWA 1ZRCA 3M07A 3F72A 4B4CA 1ETQA 4FETA 1B8IA 2XKOA 4C3IJ 2KFDA 1JUMA 3HZJA 5H6RA 4PFPA 4MIMA 4CYCA 1U6GA 2OCCH 2XKPA 2CG4A 2WAQN 3BTIA 2ME6A 4AD9A 4HDVA 1K79A 3P9IA 2JA6J 1ITYA 2IS2A 3QPHA 1Y56A 1IN8A 2EILH 4M74A 2V9PA 4N4NB 2DYSH 2H09A 4HQEA 2WB1A 3F3XA 1CF7A 2YR2A 4ENKA 4HBLA 3GTGJ 1P92A 2LRDA 3F0CA 1H89C 2CW8A 2PMHA 4R79A 3H5RA 3KYLA 1EJ9A 2QSFX 3BG5A 4FASD 2RNGA 4IQJA 4AYBA 1UFMA 2FNAA 5HODA 4YIRX 2B63J 4BE1A 2BW3A 1K83J 5EGOB 1OYWA 3GTMJ 3T5XA 3OYDA 1ZELA 2Y75A 1JT0A 3BZ6A 3QYEA 5LLQA 3JRDA 3LSHA 2DK5A 3K1PA 2LNBA 2ELJA 2A61A 2HQNA 4CCKA 2R5ZB 4I0BA 2ZJQF 4D5CA 4RGSA 4AU7A 4D7MA 3JR9A 1W4MA 2EWNA 4XKWA 4NQWA 4ON0A 3L2WA 5CYVA 3SDBA 1OFCX 3PUBA 4KUMA 2HOEA 3FKIJ 3AKZA 2STTA 3WE3A 2VODA 3U9GA 1N77A 3ONQA 4CXFA 3JRAA 4CYCB 1WGXA 2LYCA 2M30A 3F6VA 3BOQA 2IT0A 1I6HJ 2JA7J 1WH5A 2K02A 3WHBA 1U8RA 3LSTA 4Y33A 1BOAA 1VQ9I 1EF4A 3L7WA 4X0GA 2BY3A 5HLGA 2QQ9A 4AIHA 1BI2A 4LITA 2M0CA 3IL2A 1AOYA 4HF2A 4DJAA 4XORA 3RQ4A 3H0GJ 1FBSA 3COAC 5L3BA 1I39A 5LD2C 1K7AA 1Y0UA 1JI8A 3M8JA 5JFRA 3S3NA 1TL8A 2LOOA 1WJBA 2P5VA 2B9SA 3I58A 4CCNA 1X1DA 1OQYA 3GLXA 2R7RA 1WJDA 2QBYA 5KNLA 1HA8A 1OCRH 2DT6A 5GAHJ 3VOEA 4IL6C 1W7PD 3ABTA 1HW5A 3TL4X 1TW2A 4HF0A 5A2QK 1FEXA 3HC7A 4EVIA 3J81Z 2DJNA 3BLYA 1JGGA 2XAQA 2DLLA 4H4KC 3K1NA 5D5UB 2DAOA 1I1GA 3ZQQA 4ZYGA 2PI0A 3U2RA 3ZOBA 1R49A 2MSYA 3TOBA 4NB5A 1MNMC 2R7VA 1Z7UA 2F4MB 4EJUA 4RAYA 2ZCWA 3KIOA 5E20A 3HHHA 1G3SA 1K78B 3ZMVA 4GXOA 4BHBA 2HDCA 4D9JA 4L5JA 3HL2A 3W2VA 2QZ8A 2HTJA 2WY8Q 5CQEA 3MQ0A 1UG0A 2K86A 1IUYA 4L9JA 4BY7J 1G8XA 1BA5A 5K7ZA 4IOCF 2DXIA 5JHFA 1FOWA 2X6YA 2FF4A 3BG6A 3FMSA 4NHJA 1X3WB 1JT6A 3FK7A 3DCFA 4XLHA 2L3DA 3GMEA 5D8KB 1SMTA 2NXNB 4Z2YA 2E5ZA 3GZ6A 4JOMA 5HLHA 1MBKA 2LKXA 3DLAA 2PJRA 2L7ZA 1YI2I 4RLQA 4ZDLA 1FBQA 2EIMH 4ASNA 1SAUA 5HS7A 1VQ6I 5BPIA 1LVAA 1IXSB 4B47A 2H1LA 4WX9A 4DZPA 5K7HA 2DA5A 3RDIA 2ZXJA 3I59A 4BXFA 3CCLI 1AKHA 1W5SA 3H5NA 2EFWA 3HSRA 4A0YA 4RS8A 1H9GA 1YS7A 2MBFA 5DEQA 2V1DA 2OTLI 4O6JA 3MMYB 4KITB 2ZJRF 1R36A 2VJJA 1TW3A 4IQ4A 2HZTA 4NBQA 1B72B 1A04A 1SFKA 3HM5A 1XSVA 1ZQ3P 2VKHA 1JTYA 4YFXF 3BP8A 4I02A 1D0ZA 3S1RJ 1J9IA 2HI3A 4L18B 3W6KB 1J2XA 1JKOC 3OYKA 2CUJA 3K70C 2QQAA 2P4WA 4AVPA 2DFHA 3I54A 3MZ8A 4ZZDA 1LEBA 1V5EA 3CUQA 9ANTA 1JKRC 2K3PA 2XF7A 5F6FA 2FBKA 3C2BA 4I7HA 4F92B 5IP7J 1ON1A 2DBBA 1ZN2A 4EGYA 3IH4A 3M8EA 1CGPA 4B8XA 2C6YA 1RRJA 2EFOA 2XDVA 3CCEI 2HDDA 4KT5C 1BN5A 1R22A 2L9NA 5EEHA 1PUFA 3TMOA 4II2A 3OYNA 2PJRB 1SVOA 1USSA 1VZ0A 1FC3A 4C2TA 2XAJA 1MMDA 3CC4I 4ZC3A 5E3MA 2OQGA 3Q5FA 1FMVA 4BDZA 2HEOA 3KLNA 1V4RA 4ZYHA 1AKHB 2BY1A 1ZARA 2EBIA 3EPZA 2P6SA 3HDDA 3QODA 1XB4A 4HX7A 4J01A 4BQQA 2CUZA 3ASOH 1R1VA 3WTTC 3H5AA 1GV2A 3RZOJ 3KZIC 3B6CA 3IC7A 3GCMA 2HPIA 3ZQHA 2ZNZA 3I5UA 2ETHA 1HSJA 2FSWA 4ZTFA 1I1SA 2N8GA 2QQ8A 2UXNA 5CVJA 2BOLA 3RKYA 2P5LC 4IXAA 3HPHA 2YS9A 4RB0A 3ZQLA 4WCGA 4UXNA 1SMYF 4A3GJ 1MJ9A 3KEQA 4YFKF 2IGKA 2ID6A 2YU3A 1T95A 3LA2A 3FZVA 4E7HA 2LG4A 2PEXA 3OYLA 4H0EA 2O61A 4ENMA 4OU0A 3ZCOA 5FFZA 4RAGA 3M3YJ 4HA8A 4PJLA 4A2UA 2PBIA 3QOEA 2EV0A 2GAUA 3GEZA 4YIIA 2IBDA 3RPUA 4L9TA 2XB5A 1ODDA 5CJ9A 3EUHA 2CU7A 3QPSA 3FX3A 2XAHA 1Y0NA 2V9KA 4V2GA 1H8AC 1W5TA 1ZGJA 4XICA 4DYCA 1IZ1A 1R5GA 4GDFA 3OR2C 5LGUA 1FSHA 2MH9A 3F6OA 3TP3A 1T6SA 1NG6A 2W82A 5DCFA 1WCMJ 1JHFA 2ZFUA 3OSGA 1G4DA 2QENA 2DPUA 1LFPA 3K4LA 2DTZA 3BY6A 1BM9A 2EB7A 2IPQX 2VPRA 3M1CA 3GFLA 4KNYA 1ETKA 5DYMA 4U88A 2L54A 2DCEA 3FHZA 5KHDA 2P0WA 3CJRB 4GGGA 2O03A 3FDYA 2LH9A 3V7RA 2MC4A 2Q2EB 1S9HA 5E18F 2YPRA 1WQ2A 3DTKA 2OZ6A 3JREA 3VFZA 2IGNA 3HGYA 4XLEA 5K7FA 3LQQA 1B9MA 1WJAA 3L2VA 3SFZA 1X19A 4U0VA 4XLAA 5J6XA 2KIUA 5C4JJ 3D0SA 4PGGA 2EQRA 3O8GA 3AFHA 3S2WA 3ZMDA 3FMQA 4M73A 3HRMA 1ONVA 2G7UA 3WTVC 5ILVA 5DCMB 1V55H 4GYGA 1OR7A 2VN2A 3C7JA 1Y39A 4MLOA 5J1RA 1T38A 1I3AA 1QU3A 2P6TA 1FY7A 4XOPA 2E35A 3BR0A 3FXLA 4GRIA 4CCOA 4PJJA 1A5JA 3MD2A 3K2ZA 4UB8C 2A6TA 3BZKA 3W3CA 2UUZA 5M5XJ 3AL0C 2Y69H 3WGGA 1YYVA 4FCYA 2DFFA 4F3QA 4HDUA 3CF2A 1SFOJ 2HOAA 2QSGX 5EYRA 2WB1N 2BY2A 3CMAI 3GTKJ 3AL0B 1V5FA 2L02A 3SXYA 2X51A 2IJLA 3OYIA 1JTXA 2W85A 3QPLA 4HNTA 2BHYA 4LLNA 5TISC 2JPCA 1ETOA 4LK1F 2DT5A 2DOFA 3CESA 4XIDA 1IAWA 1FWZA 2JWTA 3JAMK 1D1AA 1JJ8C 4PJNA 2F5CA 1FOKA 1D8KA 2AQFA 2QYOA 1I3QJ 2DQLA 1FIPA 3PIOF 1G2HA 3ROUA 3CCVI 3Q9SA 5EG0B 5BMZA 3FBNB 3FIWA 3SEQA 2QEXI 1TLHB 2BXZA 2J5PA 2FA5A 2ZSHB 3OY9A 2LSOA 3UKGA 1MBFA 2NVXJ 3BR3A 2PX9A 3FMRA 1GLNA 4K2EA 5E17F 3JSPA 1U8BA 3S3MA 3JRHA 2ZC2A 4M3EA 3PIPF 1XSDA 2GQQA 4IF4A 2DT7B 4X1EA 1I5ZA 2F5DA 3LFKA 2I10A 5HNHA 4IKFA 4UNOA 4GO1A 1HBXG 1ZGWA 1HXDA 2QGUA 2L9RA 4ZZLA 3QYBA 1XGSA 3B6AA 2DK8A 3G71I 2PG4A 3TP0A 1KQ8A 3DQVC 2MYSA 3T0YA 2HFHA 2Y0SA 2M4GA 3ESWB 3OYCA 1MJAA 2EK5A 2LKPA 3FKJA 1P7JA 3HYIA 2WBMA 5TJJA 2NYXA 4Y17A 5TGTA 3DPLC 2LBFA 1YRNB 5KVRA 2E1NA 2OF7A 1XD7A 2IS1A 2DA6A 3G73A 2G9WA 2QCOA 3H92A 4ABZA 5GAEJ 1E0EA 4LG0A 3CF5F 1UG2A 3CLQA 1FNNA 1NTCA 2VXDA 3IAS2 4MEXF 1J5YA 2PQ8A 4LK0F 2BGCA 2X1CA 4HOBA 4KIFA 4D5FA 4S05A 3CMMA 3VYUB 1PVEA 2EFPA 2FQ3A 1LDDA 3PFIA 2EZKA 3H9JA 1O3QA 2MD0A 3DLLF 1XSXA 1QGPA 3ZN0A 1J75A 2ADUA 4X6AJ 2HYGD 1W36D 1LE8A 4XLPF 1W7PB 2Y48A 2H1KA 3SQNA 2YUSA 2K9MA 3KP3A 1JUSA 2GM4A 2UV1A 1U2WA 2VKVA 3HJEA 3W6JB 2KKOA 2X6OA 2QM3A 3GW2A 1SEUA 2EIJH 4GFBA 1MNEA 4CZZA 1Z05A 4CSWA 2MGQA 2ZJ2A 4ZTJA 3LSKA 2CFOA 2I8DA 4CGZA 1R1TA 2E7XA 4LJZF 1XG1A 5GADJ 3I4PA 2A69F 2XHKA 5HNFA 1R4MB 4BQNA 1B9NA 4YFNF 2JVHA 2LBFB 1LNWA 4IRGA 1KU2A 3GFJA 4CCJA 2MD5A 2F48A 2FMLA 1ZHFA 1T33A 1XX5A 3KP7A 1POGA 2EH3A 4U0WA 4CYDA 4BU2A 3RKQA 5TRDA 2VOPA 1A6IA 2DOAA 3ASNH 3BZCA 1VQLI 4J00A 2F5VA 4KJZA 3LAPA 1PP7U 1QZYA 1O7FA 2V4JC 4Y4RA 1ENHA 1Y1VJ 4BS9A 3L2RA 3GBGA 3LQRA 2L4AA 1MMGA 1X3ZB 4RMNA 3S15J 4MNUA 2CW7A 3RIRA 3S2DJ 4HF1A 2LVSA 2WC2A 1B59A 2EFQA 2A5WA 3FM3A 4XN3A 5CQGA 3JTGA 3MKWB 1B1BA 4V2FA 1DQUA 3LA3A 1T0FC 2M8GX 4JYKA 5AIPA 1TQMA 1G3WA 1JE8A 3GTLJ 2NS7A 4XLNF 3SDGA 2VLAA 1PJRA 3N97A 3HTSB 1QRYA 1IRXA 2G0EA 3BJ6A 3DV8A 3ZQ7A 5F1RA 5EGOA 2Z16A 4G6TB 5KCMA 4BYYA 2K27A 2KPMA 1AHDP 1Z91A 4G6DA 4LLGF 2ZB9A 3HB9A 1K6OA 5CVVA 4IHYA 4FX4A 1TWGJ 3F8CA 2CQQA 3WTWC 3O8HA 2R5ZA 3LWFA 4CHUA 3E6CC 4OWRB 2FXAA 1YW7A 1T39A 2HVQA 2V6CA 1WH7A 1AU7A 1EH7A 2XAUA 2VT3A 1P6RA 3GF2A 2MW8A 5DDGA 2R7SA 2LTPA 1S3JA 2ZMEB 4I99C 4LMYA 2HOTA 4EJVA 5IT9Z 3OOPA 4AWXB 3A0BC 4U7BA 3CCRI 4MO7A 1WKMA 2KMUA 3RI4A 1R1UA 1O4XA 1WVRA 3WU1B 5D6FA 3QPTA 2HQRA 3KP5A 2R7WA 3CZ6A 4BXXJ 2M4KA 2XGEA 2VJ5A 2VT2A 2R92J 3PL8A 3Q0VA 5FJ8J 4BDYA 1N78A 2WY7Q 1MJBA 2GWRA 3SZGA 2GXGA 5E79C 4G6QA 3WGHA 2BVMA 1GV5A 4RM2A 2RC4A 1WSUA 1DDNA 3CQZJ 3FWEA 1R58A 1Z3YA 5AONA 1NG7A 2MH2A 2E71A 5C4XJ 2DJIA 5J40A 3LNQA 2ZXIA 1O57A 4EMSA 5GAGJ 2K7LA 1IG7A 3F8FA 4RGUA 1V3FA 2XAGA 2WV0A 2O8KA 1K61A 3DEEA 1B6AA 2KDZA 5K5RA 4XN0A 5CLSA 5DUIA 1LPQA 2GA1A 3DTIA 3G2BA 3AG1H 4CZCA 3J7ZI 4OIPF 4AIDA 2ZXHA 4B43A 3CC7I 4UY8I 3D1NI 1X1AA 3NQOA 3CCJI 3P5JA 4M9XA 1RPWA 2D1HA 2L5QA 1Z0XA 3S1MJ 5C44J 2K9SA 3TW7A 2IVMA 3FK6A 2M34A 4HLYA 3IRRA 2O6GE 1YTYA 3OYAA 1K78A 2JMWA 2DDBA 1XCBA 1YS6A 1D1CA 1ETVA 4DBQA 2G7HA 1APLC 4HEA2 3ZMZA 1QBJA 1P2FA 4UUSB 2VQCA 1ULYA 2CUEA 2EIKH 2O3FA 4KN7X 1RNLA 5D4RA 2HU9A 5FRNA 3HRUA 3WHCA 5EZHA 4BAYA 3ABUA 2X85A 3K69A 5FLXK 5HOOA 3DEUA 3CP2A 3GXOA 3LSIA 4JP0A 3PUFA 1LDKB 2Z33A 3S93A 1FX7A 4UVAA 4GYIA 2CQKA 3GUDA 3F22A 1OYYA 1JHHA 2OV7A 3PM1A 3QWLA 1FYMA 5F0HA 4RGXA 4MTDA 1T8IA 4NC8A 3S16J 2LF8A 4MFEA 3TKYA 2XASA 2Y2ZA 3U1KA 1EV7A 4E7ZA 3WTXC 3RYRA 3KLOA 5LFAA 3ZMTA 1PDNC 2M8EA 3CUOA 3SJMA 5ILUA 1N25A 3K4BA 1B72A 2HQAA 2FJ1A 4CCMA 1VQOI 1IRGA 2GBYA 4LOCA 2RGVA 1F9NA 1J0RA 1OPCA 1SVLA 2A6HF 1F36A 2K85A 4QPQA 2ISYA 1BR1A 3E6MA 1GT0C 2F4IA 5DUKA 5ICEA 1W0TA 2KISA 4A0ZA 4N4OB 4IHVA 1HKQA 2Z5UA 4ESFA 3MWMA 5DM6F 4RA2A 2KJBA 1GVJA 3CC2I 3REOA 2D45A 3NRVA 1SFUA 2OPTA 3NAUA 2K4BA 3K1MA 4A3LJ 2IP2A 2X4HA 3ECOA 5E1ZB 5IOZA 4C2UA 3MFKA 4EGZA 4PK4A 2R7ZJ 5J47A 1XDSA 2LY2A 1KZHA 4M3DA 1OCPA 3ZXSA 5EF6A 2IXSA 4M6VA 4QIWN 3S32A 1RUNA 4ENNA 5EEAA 1XPXA 2GXAA 1WJEA 2Z99A 5F64A 3N4MA 4XLFA 4JX6A 3O6BB 2RNJA 4DIQA 3OMYA 2A3SA 3HIFA 2W48A 1P7IA 4U7DA 1DP7P 5JLWA 1R7JA 1A31A 2CV1A 3IH2A 4EM0B 2P8TA 4UV9A 5K5OA 5D6EA 5H20A 3DF8A 2MLKA 3DU5A 2W25A 3OL3A 2IS6A 3CLOA 4LG3A 1WJ5A 4UUTA 4PZJA 3NWTA 2O7OA 2DA7A 1B4AA 3OWTA 4XKVA 2XV4S 1RIOH 2EA4A 1D5YA 1Y6IA 1FTZA 3ELKA 1MSFC 3DU6A 2OJED 4BJ5C 3KP4A 4PGHA 4ZYDA 1MMAA 3EDPA 5FD5A 2UXXA 1QZEA 4A3BJ 2PMZA 4EJTA 4RAZA 3JRCA 1IDYA 2DI3A 5EDNA 1O3SA 2CW0F 2JA8J 5B1BH 2E1MC 5GTIC 2XSJC 3F8BA 1ETXA 1KQ9A 3ZQFA 3M8FA 3SYTA 4WF2A 2E1MB 2R7UA 1TWAJ 3C18A 2AHQA 1TNSA 2JSPA 1X2NA 4HYEA 5AIQA 5LHIA 2E7WA 4Q47A 1MBHA 3S14J 4OMYA 2ECCA 2KLOA 4KDPA 2OCEA 4G12A 1RESA 4BE0A 2Y31A 1JKQC 3ZR8X 2DA1A 1VQ5I 1IV6A 4G8XA 1Z6TA 4KFCA 4L5EA 3PNTA 5FRMA 2KP6A 3ERMA 3I71A 3S3OA 3S17J 5LHHA 3BQZA 1PUEE 4ETSA 3G1LA 4A69C 2VBWA 2M2EA 2Q2EA 4WXDA 5B3SH 3WTSC 3JSOA 1NK2P 1V5GA 5FFXA 3FISA 3OV8A 1AWCA 1LDJA 2GXBA 1SC7A 2CQ7A 2LMDA 3S8PA 4BGDA 2UWMA 1BL0A 5J1UA 4S0HB 2ZSIB 3DFGA 1ZLKA 4OMZA 2Y30A 3BWGA 2CH0A 3HOYJ 4MEYF 1ZGAA 3L2UA 3S1NJ 3SHFA 5HS8A 2M45A 4ZJZA 5DCMA 1STZA 2O5RA 5KAFC 1W36C 3ZRGA 2NNYA 4IEJA 4G7OF 1D3YA 1LJ9A 3HKZN 1SFXA 1YE9A 2P5KA 3CTAA 4E70A 1R9TJ 1L3LA 1F4KA 2Q0OA 3E97A 2O8XA 3A0HC 5IPAA 4EJWA 4G7HF 5FD6A 1WPKA 5JR3A 2DMTA 1WWXA 1IGNA 5LEKA 2STWA 1RR7A 3JW4A 2TRTA 4DGWB 1N75A 2F2EA 2CYYA 3LL7A 4IOAF 4HW0A 3SZTA 5HS9A 3E7LA 3OL4A 2HGCA 2PFBA 4M6YA 1TTYA 1IN5A 3IUOA 3RPQA 2CQXA 2Z2SB 1DPUA 4XNFA 3T8TA 2XUBA 1Z21A 3OYEA 5FGMA 1D0YA 1QVUA 5JVTA 1QVTA 4FHTA 1SD4A 1SD6A 5EJCA 3OYFA 3DKXA 2Y9YA 1DUXC 1MSEC 4BY1J 3RKXA 4XRSG 4KISA 5E1WA 5LGTA 3PNVA 2QWWA 2GOXB 5KK1A 3E5QA 4BXUA 5IYBJ 3CMEI 1D0XA 4II3A 5EG0A 3H9GA 1E2XA 2X6WA 1RC9A 2KHMA 4Y3OA 4B09A 2F5EA 4DBRA 4M9ZA 4OAZA 5GTHC 5D5WB 3BTJA 5ICGA 3FF5A 3DPTA 1VQ8I 2DQRA 2JRTA 3JCUC 3I4NJ 1OMIA 2B7EA 4ZDOA 4XMYA 2QF7A 3W2WA 2MC3A 4LB6B 3IV5A 4A6DA 2ISZA 1OCZH 5JLXA 4KYWA 2DTRA 3ZPLA 1KU9A 2BHZA 2R7DA 5IP9J 3L1PA 3Q0WA 5EZGA 4BBRJ 3DXJF 3VEPA 4O5VA 2FE3A 1KGSA 2ZNYA 3H35A 4AVZA 2FBIA 4MHGA 3MKZA 3F8MA 2WWYA 3FBIB 2V1XA 4M6XA 1R71A 2IAIA 2LDUA 5E1XA 3SEZA 1FBUA 2HZDA 3D5SC 1WHUA 1BI3A 3K4JA 1E3PA 1ETWA 1S6LA 2ELHA 1PP8F 1S7OA 2W24A 5ICCA 3IH3A 4AYBN 2VONA 1BR2A 1XCVA 1HCRA 4L9NA 1EKEA 4JK1X 3OYGA 3WGIA 1A35A 1G6NA 3RSNA 4Y52J 1K4TA 2M7BA 1YRNA 2WADA 3CJTB 3FXJA 3C2GA 1YIJI 4KMUX 5BNGA 2AXTC 3OYBA 2OBPA 3G3ZA 3HRSA 4HQMA 4C30A 5B5EC 4A5MA 3KPHA 4I98B 3DTEA 1P4AA 1RZ4A 3HSEA 1IJWC 1A6QA 4HX8A 3FXOA 4MGRA 4CUGA 3HOZJ 2JJ7A 3R61A 2QLZA 4KT6A 4BEHB 4P96A 4D0PA 1OCTC 2OZUA 2L7FP 2XF6A 4MFDA 4E7KA 3QP6A 2KL4A 3H3UA 1H88C 2FOKA 2NVUB 4B1RA 3M7GA 1AA7A 2R7FA 3IRQA 2V26A 1IW7F 3KEOA 3ABKH 2W00A 1W7PA 2RN7A 2ZBKA 2HXIA 2KIQA 1JUPA 3B02A 3BT9A 1ZG1A 5IT9K 5F08A 1BJZA 4I01A 3IAM2 1YJWI 3I9V2 3QYFA 1FYKA 1SFEA 3LOCA 1JJ6C 3BTLA 3O2PE 3MN2A 4I09A 1QHHD 2CFXA 1EA3A 2RVCA 2K9LA 1YX5A 3J7AO 1P4XA 1Y8RB 3HOTA 2V6EA 2E2JJ 4L0ZB 1J59A 3OYMA 3V8LA 2CMPA 4CH7A 4Q48A 1L0OC 4KA4A 5JVGF 3L09A 4B44A 2KIFA 5E8IA 3G6EI 2Z9OA 3FHNA 5J4YA 4LLLA 5C3EJ 2RREA 2HVRA 2VASA 3OSFA 4LD5A 4Y13A 2DO7A 1LUJB 1J09A 5LRSA 1MIJA 3WG9A 4NC6A 4BACA 3PO2J 3CCUI 3OS2A 4XQFA 1S7EA 1NK3P 3P7NA 3A01B 1WJFA 4I76A 2NRAC 4XM3A 3W2AA 4KMFA 4Y7NJ 2VE8A 1S5LC 3BG7A 2QVOA 2XROA 1MZBA 3GWZA 5CVRA 1YX3A 5LBQA 2FRHA 2EV6A 2JQ7A 1ZKGA 4G94A 3ABMH 4ZDPA 5HDNA 4UUVA 1GUUA 2LD5A 2EZLA 5ILSA 4P1WA 1FLIA 2IGOA 4PJMA 2LP0A 3A03A 4AIKA 2CQNA 2UZKA 5L3DA 1S8NA 4WXHA 2K9QA 4BJ6C 3L2QA 2WV1A 5DD8A 1ERDA 1Z3XA 4W1UA 2HTSA 4HAMA 2YU9J 1UB9A 1S29A 4M72A 5F27A 4G9YA 2ELKA 4U0YA 1DGWY 3TQNA 3TEDA 2NOJB 3HOXJ 4BQAA 2R7TA 3N05A 1HW2A 1LQ1A 1U5TC 1Y8QB 4AC0A 3S2HJ 4UV8A 3K4KA 2CV2A 2ZMEA 2F4OB 1ZAOA 3TGNA 3CCMI 1GDTA 3I3LA 1PYVA 4Y15A 1P9QC 2VJ4A 1U5TB 4XL9A 5LEJA 1JGSA 3EUKL 2RDPA 4FE7A 3J81K 2YX7A 1RUOA 2JTVA 4NC7A 4HX4A 4V19K 1DU6A 1MBGA 4A3CJ 1SD7A 5FKNA 2BBYA 3BJOA 3TOAA 1C0WA 3LAJA 2EINH 1VF9A 2HYFA 3WU0A 4EQQA 3I56I 1GXQA 1RETA 4KIBA 2M7AA 3KZYA 4OINF 3WE2A 3OS0A 2QSHX 2L2OA 2BYVE 4IJAA 1O7LA 2R5YB 3TBIA 3DPUA 1UHMA 2R4GA 2XVCA 3K2AA 4CCLA 2CUFA 2LC2A 3BR5A 3ML6A 3EYIA 1W1WE 2H8WA 4ANJA 3HOUJ 3DWLE 3RPUD 3ZMSA 1YIOA 2LK2A 5L3CA 4NUBA 5M3FJ 4ZH4F 1T2KA 1ZRFA 4RB2C 1RKWA 3I53A 2VPLA 2E1CA 1SANA 3LA7A 3HRTA 2VJIA 3K7AJ 1DGRM 3HUGB 4DZJA 2DMNA 5E8GA 5DS9A 5IT3A 3AG4H 1HF0A 3GTQJ 2DN0A 5F0CA 4M3FA 4E7LA 1ZG3A 3BPVA 1MH3A 3WTYC 1HLVA 1ETYA 3OIOA 3ERED 4AIJA 2D1VA 3K0LA 3F23A 3CDIA 5BS6A 2L9VA 4A3IJ 3MZHA 1Z7LA 2VI6A 2COMA 3K4NA 1RKTA 2Z3YA 4OOIA 2M9HA 4UUSA 3M4OJ 2VQLA 3WODF 3FXRA 1BI1A 3A02A 4HV6A 2BV6A 5F04A 3K4MA 2I5UA 1QO0D 4WK8F 5K5QA 4FT8A 2M0MA 3VPRA 2JSCA 2VOOA 3MVPA 1W5CC 1OCOH 3E1SA 5FROA 1LKXA 3I64A 4HZFA 4PFOA 4FISA 4QSHA 1VQPI 3GVAA 4N9IA 2DA3A 5DTDA 2MG4A 3E6DA 4XOTA 1KA8A 3EQLF 3LMMA 1QHGA 3DBLB 3ISPA 1QA6A 3GLLA 1VNDA 4IX7A 1ACIA 1YW8A 4C3HJ 1T56A 2D5VA 2WA0A 1MDMB 2M5WA 2F5FA 3P9KA 1IC8A 2WAFA 3VYSB 1XDUA 4RAFA 2DMQA 4KN4X 4JQFA 4UHTA 1YITI 2X9DA 3OYHA 1K6YA 3A4CA 3KYDB 3Q9VA 3V7CA 3AAFA 2QA4I 3IWZA 1LFUP 2TDXA 3IWFA 2H27A 4NDLA 3FXQA 3VSLA 2W57A 3KE2A 4QLCU 2VBYA 1T08B 2V7FA 5GPAA 3JTHA 1U9NA 2E1OA 2OQRA 4L9VA 4I2OA 4A3DJ 5FKKA 3BG9A 2E19A 3IP4B 3VB2A 3AG2H 3DP7A 4P5OA 3FXKA 4EM2A 2OC6A 2HKOA 2ZJPF 4TV7A 1XMAA 2H94A 3H3ZA 3FXUA 2LY1A 4WXCA 3HOVJ 1VFCA 3I0TA 2R7XA 1VQKI 3VWBA 1TNTA 1I27A 1B8IB 1Q1VA 2GIZA 1TQPA 2VB6A 4YELA 3GO5A 2R0QC 2ID3A 2GIVA 2M3AA 1WRJA 5F0FA 4UB6C 2DMUA 3FM5A 4IZZA 2LF7A 4YEJA 4E7IA 5FKMA 2K5CA 1G59A 1CF7B 1LFBA 1HDPA 4OAYA 1X4PA 3BR2A 2OTJI 3H1CA 1F1ZA 3QQAA 2K40A 4E6KG 2CJJA 4DNCA 2Z1DA 2R3SA 4XONA 5IYDJ 4CA0A 3FXMA 2KIMA 4C9YA 2E5NA 3ZQCA 1X2MA 3QU3A 2EZHA 2QKLB 5DM7F 5D4SA 5FB2A 3LFUA 1CQTA 3V42A 1TQIA 1KYZA 1OLTA 1MGTA 1IXRC 2CV0A 3TDUC 2D2WA 1ON2A 1HSTA 1TBXA 3DKYA 2LFBA 2OAZA 3CDHA 3I4MJ 2BW3B 2IRFG 3CO7C 3OS1A 3QRFF 4DW6A 1F5TA 2IW5A 1LVKA 2L7KA 3C3WA 4MQ9F 2XAFA 3DBRB 4QTRA 3K9TA 2VUMJ 2R7OA 2V1NA 5HLIA 1ORKA 4HG2A 2JA5J 3LSPA 3OR1C 4I0AA 1SD5A 2VBXA 4BUPA 3D5LA 1MBEA 2V1UA 2BZTA 3DEWA 6PAXA 1DU0A 2X48A 1YO5C 2K9NA 1YOVB 4NQWB 2VXZA 2XGDA 4XLCA 1UAAA 2FMYA 2VQHA 2NS8A 3MCZA 1EH6A 3IHUA 4FX0A 4HSTA 1XMKA 5CVUA 4BHPA 5IYCJ 1SAXA 5LRRA 2JZYA 5CKTA 4F52A 2FUG2 1O3RA 2HKXA 4RM3A 5K1YA 3BPXA 2CGPA 3R4KA 1X1CA 3TW6A 3J80Z 4PSWA 3E5XA 1K4SA 1XS9A 3F9KA 1P4WA 1ZH5A 2VE9A 2KRHA 4NNJA 4W97A 3HPGA 4EV0A 4EATA 2DU9A 2X1EA 2M87A 3F8NA 1IV8A 5F1JA 1OJLA 4B3AA 4AUXA 3BG3A 1IXCA 2DPDA 2K3FA 1RI7A 3BR6A 3O3KA 5CVIA 2DFEA 2JUGA 1O3TA 3E0JB 1GVDA 2RQPA 2OU2A 2MLGA 1IO2A 2H6BA 2IS4A 1X58A 4RB1A 4PJ0C 1VQ7I 2QBYB 1Q1HA 1R6RA 1MD0A 1VQMI 5GP9A 3V7SA 5ICFA 3X2QH 4LGWA 1OISA 1MNDA 2NVQJ 3D5RC 3BCAA 3GZNB 3V8KA 3JRIA 2Y0SN 3BQYA 4D7NA 1ZREA 2LREA 1FT9A 2EJRA 3H36A 1D1BA 1DPRA 3RYPA 2BXYA 2O0YA 3KZZA 4G7ZF 1A36A 2H6CA 4DYRA 3TO6A 1BI0A 3CDLA 4QPOA 4A3KJ 2DODA 2ME0A 2PMUA 2JVGA 1UJ8A 3ECHA 3GFIA 1E3OC 3BROA 1IN6A 1U78A
chains in the Genus database with same CATH topology
1EH8A 4BHCA 2IA2A 2A5YB 4A6EA 1ZG5A 1E17A 1KQ0A 2FBHA 3R6SA 2P7CB 2NAZA 4CO8A 1D5VA 4XSXF 4LB5A 2EFNA 2V9VA 4R1HA 2ZO4A 2VBZA 1H9TA 3HTUA 1VTNC 3WTZA 3I59B 4QWQA 1Z9CA 2VC0A 1HW1A 2JPBA 5BPDA 3TO7A 3KP6A 1UHWA 3E6BA 1HKTA 4R8HA 5FLXZ 1BBYA 2OA4A 3QP5A 5HDKA 4N9HA 1D8JA 2FEZA 5D5XB 3ZP5A 3CUQC 2ACJA 2RV8A 3ZMUA 3CUQB 5ED4A 3E5UA 4RGRA 4IRHA 3WTUC 5A2QZ 1MKMA 3M9AA 3U1DA 5LHGA 2MA3A 5ERIA 1I6XA 3CJNA 3B73A 3QU6A 4EJOA 4UVCA 4IPAA 2HR3A 3EETA 4DQ2A 1R00A 1UCRA 1S7AA 5DV5A 4BH9A 1BIBA 5BQTA 5L3GA 3E3VA 1YFHA 2A68F 4MQVA 2CWEA 3HHGA 1KU7A 5BOXA 3QAHA 4P9FA 2AXLA 1LB2A 4HLXA 2ZFWA 5H6QA 4BNCA 5EEGA 4L0YB 5HVQC 1J7KA 3L2CA 4WWCA 3MAJA 2P7VB 3M1EA 5D5VB 1XGNA 3SZPA 3C1DA 3PQJA 3P9CA 4CICA 3ULQB 2QUFA 4KIGA 2XIGA 3KFWX 2PN6A 2BEOA 2VC1A 4LFUA 1XGMA 1QPMA 2RKHA 1R23A 3DKWA 1GHCA 4HV5A 2PJPA 3NEUA 2DFIA 1FP2A 4M71A 1G3TA 4Q4ZF 1ZYRF 2QQBA 3RKWA 1U3EM 3IKVA 1QNTA 2K4JA 2NNNA 3T1BA 4ZYEA 3RTRA 3GZ5A 5L3FA 1JXSA 4OIRF 3F21A 3ZN1A 4JBAA 4MTEA 2W84A 4IVNA 1BC7C 2A6EF 5DD4A 5D8LB 4ESJA 3CO6C 3TO9A 4IHTA 1QQIA 3KETA 1H0MA 2FNPA 4KICA 4A0XA 2IA0A 4IRIA 2CSOA 4Q5SF 3R0AA 4ENJA 1IRFA 1ZLJA 3KCCA 4CDGA 1Z6RA 3VODA 3GX4X 4N0BA 2M1BA 3T8RA 4UVBA 4A5NA 2OD5A 1OYIA 3BJAA 1OKRA 4F7ZA 2L4MA 5J8FA 2YSRA 4A12A 4RB3C 3HOSA 1QZZA 2KRFA 3TDZC 1XGOA 4ESBA 1IN7A 1YQAA 3L9FA 3V8JA 4PCQA 3QOPA 1U5TA 2EV5A 4GCVA 5L3EA 2GA2A 4XRFA 5HDGA 1REPC 3R60A 2FU4A 2V79A 2HS5A 2L01A 4YIFA 3R0JA 3HSFA 2BE5F 3MEXA 5LGNA 1IN4A 1T0FA 2XGXA 2ESNA 1XN7A 1KU3A 1BJAA 2DW4A 3EYYA 1R5HA 1FP1D 2YX4A 2IA1A 4YG2F 1IF1A 3HUGA 4M9SA 4OIQF 2Y0MA 3BDDA 1FZPB 1FYLA 4IHSA 3PQKA 1USTA 2B0LA 1BIAA 2J5OA 3IKTA 1FPQA 1BC8C 2EA2A 4L5IA 4PDKA 5JI6A 4EM1A 1YW9A 2A07F 2ESHA 2HWVA 1KYWA 4LG0B 1G3YA 1YG2A 1HKSA 3V4GA 3MZYA 3L00A 1MDMA 2CO5A 2XRNA 4XSZF 3KP2A 3JAMZ 2AS5F 4P9UA 2Q8KA 2PLYA 1FSEA 2ZKZA 5J8CA 2KJCA 5JHUA 3J80K 1GXPA 4S04A 5FO5A 4OIOF 1X3UA 1WI9A 1NHAA 1LEAA 2WTEA 1ZRDA 2X0LA 3GYHX 1HQCA 1YLFA 1Z1DA 3GFMA 4O3MA 3RJPA 2NS0A 4P55A 4XBFA 1T98A 2JT1A 2GZWA 1ZRCA 3F72A 2XKOA 5H6RA 1U6GA 2XKPA 2CG4A 4AD9A 4HDVA 1K79A 3P9IA 3QPHA 1IN8A 4M74A 2H09A 4HQEA 1CF7A 3F3XA 2YR2A 4ENKA 4HBLA 1P92A 2PMHA 4R79A 1UFMA 2FNAA 1OYWA 3T5XA 2Y75A 3BZ6A 5LLQA 2DK5A 3K1PA 2LNBA 2A61A 2HQNA 4I0BA 4RGSA 1W4MA 2EWNA 4NQWA 4ON0A 5CYVA 2STTA 4KUMA 2HOEA 3WE3A 2VODA 3U9GA 4CXFA 2M30A 3F6VA 3BOQA 2IT0A 2K02A 1U8RA 3LSTA 1BOAA 3L7WA 5HLGA 2QQ9A 4AIHA 1BI2A 3IL2A 1AOYA 4HF2A 1FBSA 3COAC 5L3BA 1K7AA 1Y0UA 5JFRA 2P5VA 3I58A 3GLXA 2QBYA 3VOEA 1W7PD 3ABTA 1HW5A 1TW2A 4HF0A 5A2QK 4EVIA 3J81Z 2XAQA 2DLLA 3K1NA 5D5UB 2DAOA 1I1GA 4ZYGA 2PI0A 3U2RA 3TOBA 4NB5A 1Z7UA 4EJUA 4RAYA 2ZCWA 5E20A 3HHHA 1G3SA 1K78B 3ZMVA 4GXOA 4BHBA 2HDCA 4L5JA 2QZ8A 2HTJA 3MQ0A 2K86A 1IUYA 4L9JA 2FF4A 3FMSA 4NHJA 2L3DA 5D8KB 1SMTA 4Z2YA 3GZ6A 5HLHA 1FBQA 4ASNA 5HS7A 5BPIA 1LVAA 1IXSB 4WX9A 3RDIA 2ZXJA 3I59A 1W5SA 2EFWA 3HSRA 4A0YA 4RS8A 1H9GA 1YS7A 2MBFA 5DEQA 2V1DA 4O6JA 1R36A 1TW3A 2HZTA 1A04A 1XSVA 4YFXF 3BP8A 4I02A 1J9IA 4L18B 3W6KB 1J2XA 2QQAA 2P4WA 4AVPA 3I54A 4ZZDA 1LEBA 3CUQA 5F6FA 2FBKA 4I7HA 1ON1A 2DBBA 1ZN2A 4EGYA 1CGPA 3M8EA 4B8XA 2C6YA 2EFOA 4KT5C 1BN5A 1R22A 5EEHA 1USSA 1FC3A 2XAJA 2OQGA 3Q5FA 2HEOA 3KLNA 1V4RA 4ZYHA 1ZARA 2P6SA 1XB4A 4HX7A 3WTTC 1R1VA 3IC7A 2ZNZA 3I5UA 2ETHA 1HSJA 2FSWA 1I1SA 2UXNA 5CVJA 3RKYA 2P5LC 4IXAA 4RB0A 4WCGA 4UXNA 1SMYF 1MJ9A 3KEQA 4YFKF 2YU3A 3LA2A 3FZVA 2PEXA 4H0EA 2O61A 4ENMA 4OU0A 5FFZA 4HA8A 4A2UA 2PBIA 2EV0A 2GAUA 3GEZA 4YIIA 3RPUA 4L9TA 1ODDA 5CJ9A 3EUHA 3FX3A 2XAHA 1W5TA 1ZGJA 1IZ1A 1R5GA 5LGUA 1FSHA 2MH9A 3F6OA 1T6SA 5DCFA 1G4DA 1JHFA 2QENA 2DPUA 3BY6A 1BM9A 2EB7A 2IPQX 4KNYA 3GFLA 5DYMA 4U88A 2L54A 3FHZA 4GGGA 2O03A 3V7RA 5E18F 2YPRA 1WQ2A 2OZ6A 3VFZA 3LQQA 1B9MA 3SFZA 4U0VA 5J6XA 2KIUA 3D0SA 4PGGA 3S2WA 3ZMDA 3FMQA 4M73A 3HRMA 1ONVA 2G7UA 3WTVC 5ILVA 5DCMB 4GYGA 1OR7A 2VN2A 3C7JA 1T38A 2P6TA 1FY7A 3K2ZA 3WGGA 1YYVA 4HDUA 2L02A 3SXYA 2IJLA 2W85A 4LLNA 2JPCA 4LK1F 2DT5A 1IAWA 1FWZA 3JAMK 2F5CA 1FOKA 1D8KA 2QYOA 2DQLA 3ROUA 3Q9SA 5BMZA 1TLHB 2J5PA 2FA5A 2LSOA 4K2EA 3FMRA 5E17F 3JSPA 1XSDA 2GQQA 4IF4A 1I5ZA 2F5DA 3LFKA 4UNOA 4GO1A 1HBXG 1HXDA 4ZZLA 1XGSA 2DK8A 2PG4A 1KQ8A 3DQVC 3T0YA 2HFHA 1MJAA 2EK5A 2LKPA 3HYIA 5TJJA 2NYXA 4Y17A 3DPLC 5KVRA 2E1NA 1XD7A 3G73A 2G9WA 3H92A 4LG0A 1FNNA 4MEXF 1J5YA 2PQ8A 4LK0F 2BGCA 4HOBA 4KIFA 4S05A 2EFPA 2FQ3A 1LDDA 3PFIA 1O3QA 1XSXA 1QGPA 3ZN0A 1J75A 2ADUA 2HYGD 4XLPF 1W7PB 2Y48A 3SQNA 3KP3A 1U2WA 3W6JB 2KKOA 3GW2A 2QM3A 4CZZA 1Z05A 2ZJ2A 4CGZA 1R1TA 2E7XA 4LJZF 3I4PA 2A69F 2XHKA 1B9NA 4YFNF 1LNWA 4IRGA 1KU2A 3GFJA 2MD5A 2FMLA 1ZHFA 3KP7A 4U0WA 4CYDA 5TRDA 2VOPA 3LAPA 1PP7U 1QZYA 1O7FA 3LQRA 2L4AA 4MNUA 3RIRA 4HF1A 2WC2A 1B59A 2EFQA 3FM3A 3JTGA 1B1BA 3LA3A 5AIPA 1TQMA 1G3WA 1JE8A 4XLNF 3N97A 3HTSB 3DV8A 3BJ6A 5F1RA 3ZQ7A 4BYYA 2K27A 1Z91A 4G6DA 4LLGF 1K6OA 5CVVA 4FX4A 3F8CA 3WTWC 3LWFA 4CHUA 3E6CC 2FXAA 1YW7A 1T39A 2V6CA 1EH7A 2VT3A 1P6RA 3GF2A 5DDGA 1S3JA 2ZMEB 4LMYA 4EJVA 5IT9Z 3OOPA 4AWXB 4U7BA 1WKMA 3RI4A 1R1UA 3WU1B 5D6FA 3QPTA 2HQRA 3KP5A 2VT2A 1MJBA 2GWRA 2GXGA 3WGHA 4G6QA 2RC4A 1WSUA 1DDNA 3FWEA 1R58A 5AONA 2MH2A 1O57A 4EMSA 2K7LA 3F8FA 4RGUA 1V3FA 2XAGA 2WV0A 1B6AA 5K5RA 5CLSA 5DUIA 2GA1A 4OIPF 3NQOA 4M9XA 2D1HA 2IVMA 4HLYA 3IRRA 2O6GE 1YTYA 1K78A 1XCBA 1YS6A 2G7HA 3ZMZA 1QBJA 1P2FA 1ULYA 2O3FA 4KN7X 5D4RA 1RNLA 3HRUA 4BAYA 3ABUA 3K69A 5FLXK 5HOOA 3DEUA 3GXOA 1LDKB 2Z33A 1FX7A 4UVAA 4GYIA 2CQKA 3GUDA 3F22A 1OYYA 1JHHA 1FYMA 4RGXA 4MTDA 2LF8A 3TKYA 2XASA 1EV7A 3WTXC 3RYRA 3KLOA 1PDNC 3ZMTA 2M8EA 3CUOA 5ILUA 1IRGA 2RGVA 1F9NA 1J0RA 1OPCA 2A6HF 2ISYA 3E6MA 5DUKA 5ICEA 4A0ZA 1HKQA 2Z5UA 4ESFA 3MWMA 2KJBA 1GVJA 3REOA 2D45A 3NRVA 1SFUA 2K4BA 3K1MA 2IP2A 2X4HA 3ECOA 5E1ZB 3MFKA 4EGZA 1XDSA 1RUNA 4ENNA 2Z99A 5F64A 3N4MA 3O6BB 2RNJA 2A3SA 3HIFA 4U7DA 1DP7P 1R7JA 4EM0B 2P8TA 4UV9A 5K5OA 5D6EA 5H20A 3DF8A 2MLKA 2W25A 3CLOA 4PZJA 1B4AA 1RIOH 2XV4S 2EA4A 3ELKA 3KP4A 4PGHA 4ZYDA 3EDPA 5FD5A 2UXXA 4EJTA 4RAZA 2DI3A 1O3SA 2CW0F 3F8BA 1KQ9A 3M8FA 4WF2A 3C18A 1TNSA 4HYEA 5AIQA 5LHIA 2E7WA 4Q47A 4OMYA 4KDPA 4G8XA 1Z6TA 4KFCA 3I71A 5LHHA 1PUEE 4ETSA 2VBWA 2Q2EA 4WXDA 3WTSC 3JSOA 5FFXA 3OV8A 1AWCA 1LDJA 2GXBA 2UWMA 3DFGA 1ZLKA 4OMZA 3BWGA 4MEYF 1ZGAA 3SHFA 5HS8A 2M45A 5DCMA 1STZA 2NNYA 4G7OF 1D3YA 1LJ9A 1SFXA 2P5KA 3CTAA 4E70A 1L3LA 1F4KA 2Q0OA 3E97A 2O8XA 4EJWA 4G7HF 5FD6A 5JR3A 1WWXA 5LEKA 2STWA 3JW4A 2F2EA 2CYYA 4HW0A 3SZTA 5HS9A 2HGCA 2PFBA 4M6YA 1TTYA 1IN5A 3RPQA 1DPUA 3T8TA 2XUBA 5FGMA 5JVTA 4FHTA 1SD4A 1SD6A 1DUXC 3RKXA 5E1WA 5LGTA 2QWWA 5KK1A 3E5QA 4BXUA 1E2XA 4B09A 2F5EA 4M9ZA 5D5WB 5ICGA 3FF5A 3DPTA 2DQRA 2JRTA 1OMIA 2MC3A 4LB6B 4A6DA 2ISZA 4KYWA 2DTRA 3ZPLA 1KU9A 2R7DA 3DXJF 3VEPA 4O5VA 2FE3A 1KGSA 2ZNYA 2FBIA 4MHGA 3F8MA 2WWYA 2V1XA 4M6XA 2LDUA 5E1XA 1FBUA 1BI3A 1S6LA 2ELHA 1PP8F 1S7OA 2W24A 5ICCA 2VONA 1XCVA 4L9NA 4JK1X 3WGIA 1G6NA 4KMUX 2OBPA 3G3ZA 3HRSA 4HQMA 4A5MA 4I98B 1P4AA 1RZ4A 3HSEA 4HX8A 4MGRA 3R61A 2QLZA 4P96A 4D0PA 2OZUA 3QP6A 3H3UA 2FOKA 3M7GA 2R7FA 3IRQA 1IW7F 3KEOA 1W7PA 2RN7A 2ZBKA 3B02A 5IT9K 1ZG1A 4I01A 1FYKA 1SFEA 3O2PE 4I09A 2CFXA 2RVCA 3J7AO 1P4XA 3HOTA 4L0ZB 1J59A 3V8LA 4Q48A 1L0OC 4KA4A 3L09A 2KIFA 5E8IA 2Z9OA 4LLLA 4LD5A 4Y13A 2DO7A 5LRSA 3WG9A 3P7NA 2NRAC 4KMFA 2VE8A 2XROA 2QVOA 1MZBA 3GWZA 5CVRA 5LBQA 2FRHA 2EV6A 4G94A 5HDNA 4UUVA 1FLIA 5ILSA 4AIKA 2UZKA 5L3DA 1S8NA 4WXHA 5DD8A 2HTSA 4HAMA 1UB9A 1S29A 4M72A 4G9YA 4U0YA 3TQNA 4BQAA 1HW2A 1LQ1A 1U5TC 4UV8A 2ZMEA 3TGNA 1ZAOA 4Y15A 1U5TB 5LEJA 1JGSA 3J81K 2RDPA 2YX7A 1RUOA 2JTVA 4HX4A 1SD7A 2BBYA 3BJOA 3TOAA 1C0WA 3LAJA 2HYFA 3WU0A 4EQQA 1GXQA 4KIBA 4OINF 3KZYA 3WE2A 2BYVE 4IJAA 1O7LA 1UHMA 2XVCA 3ML6A 3EYIA 3ZMSA 1YIOA 5L3CA 1T2KA 4ZH4F 1ZRFA 4RB2C 3I53A 2E1CA 3LA7A 3HRTA 5E8GA 5IT3A 1ZG3A 3BPVA 3WTYC 3ERED 4AIJA 2D1VA 3K0LA 3F23A 5BS6A 3MZHA 2COMA 2Z3YA 4OOIA 3WODF 3FXRA 1BI1A 4HV6A 2BV6A 1QO0D 4WK8F 5K5QA 4FT8A 2JSCA 2VOOA 3I64A 4HZFA 3GVAA 4N9IA 3E6DA 1KA8A 3EQLF 3ISPA 1YW8A 1MDMB 2M5WA 2F5FA 3P9KA 1XDUA 4KN4X 4JQFA 4UHTA 3Q9VA 3AAFA 3V7CA 3IWZA 2TDXA 3IWFA 2H27A 3FXQA 2W57A 3KE2A 4QLCU 2VBYA 3JTHA 4I2OA 2OQRA 4L9VA 3VB2A 3DP7A 4P5OA 4EM2A 2HKOA 4TV7A 1XMAA 2H94A 3H3ZA 3FXUA 4WXCA 3I0TA 1TNTA 1I27A 1TQPA 3GO5A 2GIVA 1WRJA 3FM5A 2LF7A 1CF7B 1F1ZA 4DNCA 2R3SA 2KIMA 3QU3A 5D4SA 5FB2A 1TQIA 1KYZA 1MGTA 1IXRC 3TDUC 2D2WA 1ON2A 1HSTA 1TBXA 2OAZA 3CDHA 2IRFG 3CO7C 3QRFF 1F5TA 2IW5A 3C3WA 4MQ9F 2XAFA 3K9TA 5HLIA 4I0AA 1SD5A 2VBXA 3D5LA 2V1UA 6PAXA 1YO5C 2VXZA 2FMYA 3MCZA 5CVUA 1EH6A 3IHUA 4FX0A 4BHPA 1XMKA 1SAXA 5LRRA 2JZYA 1O3RA 2HKXA 5K1YA 3BPXA 2CGPA 3R4KA 3J80Z 3E5XA 1P4WA 1ZH5A 2VE9A 4EV0A 2DU9A 2M87A 3F8NA 1IXCA 2DPDA 1RI7A 3O3KA 5CVIA 1O3TA 2RQPA 2OU2A 2MLGA 2H6BA 4RB1A 2QBYB 1Q1HA 1MD0A 3V7SA 5ICFA 4LGWA 3V8KA 1ZREA 1FT9A 2EJRA 1DPRA 3RYPA 4G7ZF 2O0YA 3KZZA 2H6CA 3TO6A 1BI0A 2PMUA 3ECHA 3GFIA 3BROA 1IN6A 1U78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EH8 A;  4BHC A;  2IA2 A;  2A5Y B;  4A6E A;  1ZG5 A;  1E17 A;  1KQ0 A;  2FBH A;  3R6S A;  2P7C B;  2NAZ A;  4CO8 A;  1D5V A;  4XSX F;  4LB5 A;  2EFN A;  2V9V A;  4R1H A;  2ZO4 A;  2VBZ A;  1H9T A;  3HTU A;  1VTN C;  3WTZ A;  3I59 B;  4QWQ A;  1Z9C A;  2VC0 A;  1HW1 A;  2JPB A;  5BPD A;  3TO7 A;  3KP6 A;  1UHW A;  3E6B A;  1HKT A;  4R8H A;  5FLX Z;  1BBY A;  2OA4 A;  3QP5 A;  5HDK A;  4N9H A;  1D8J A;  2FEZ A;  5D5X B;  3ZP5 A;  3CUQ C;  2ACJ A;  2RV8 A;  3ZMU A;  3CUQ B;  5ED4 A;  3E5U A;  4RGR A;  4IRH A;  3WTU C;  5A2Q Z;  1MKM A;  3M9A A;  3U1D A;  5LHG A;  2MA3 A;  5ERI A;  1I6X A;  3CJN A;  3B73 A;  3QU6 A;  4EJO A;  4UVC A;  4IPA A;  2HR3 A;  3EET A;  4DQ2 A;  1R00 A;  1UCR A;  1S7A A;  5DV5 A;  4BH9 A;  1BIB A;  5BQT A;  5L3G A;  3E3V A;  1YFH A;  2A68 F;  4MQV A;  2CWE A;  3HHG A;  1KU7 A;  5BOX A;  3QAH A;  4P9F A;  2AXL A;  1LB2 A;  4HLX A;  2ZFW A;  5H6Q A;  4BNC A;  5EEG A;  4L0Y B;  5HVQ C;  1J7K A;  3L2C A;  4WWC A;  3MAJ A;  2P7V B;  3M1E A;  5D5V B;  1XGN A;  3SZP A;  3C1D A;  3PQJ A;  3P9C A;  4CIC A;  3ULQ B;  2QUF A;  4KIG A;  2XIG A;  3KFW X;  2PN6 A;  2BEO A;  2VC1 A;  4LFU A;  1XGM A;  1QPM A;  2RKH A;  1R23 A;  3DKW A;  1GHC A;  4HV5 A;  2PJP A;  3NEU A;  2DFI A;  1FP2 A;  4M71 A;  1G3T A;  4Q4Z F;  1ZYR F;  2QQB A;  3RKW A;  1U3E M;  3IKV A;  1QNT A;  2K4J A;  2NNN A;  3T1B A;  4ZYE A;  3RTR A;  3GZ5 A;  5L3F A;  1JXS A;  4OIR F;  3F21 A;  3ZN1 A;  4JBA A;  4MTE A;  2W84 A;  4IVN A;  1BC7 C;  2A6E F;  5DD4 A;  5D8L B;  4ESJ A;  3CO6 C;  3TO9 A;  4IHT A;  1QQI A;  3KET A;  1H0M A;  2FNP A;  4KIC A;  4A0X A;  2IA0 A;  4IRI A;  2CSO A;  4Q5S F;  3R0A A;  4ENJ A;  1IRF A;  1ZLJ A;  3KCC A;  4CDG A;  1Z6R A;  3VOD A;  3GX4 X;  4N0B A;  2M1B A;  3T8R A;  4UVB A;  4A5N A;  2OD5 A;  1OYI A;  3BJA A;  1OKR A;  4F7Z A;  2L4M A;  5J8F A;  2YSR A;  4A12 A;  4RB3 C;  3HOS A;  1QZZ A;  2KRF A;  3TDZ C;  1XGO A;  4ESB A;  1IN7 A;  1YQA A;  3L9F A;  3V8J A;  4PCQ A;  3QOP A;  1U5T A;  2EV5 A;  4GCV A;  5L3E A;  2GA2 A;  4XRF A;  5HDG A;  1REP C;  3R60 A;  2FU4 A;  2V79 A;  2HS5 A;  2L01 A;  4YIF A;  3R0J A;  3HSF A;  2BE5 F;  3MEX A;  5LGN A;  1IN4 A;  1T0F A;  2XGX A;  2ESN A;  1XN7 A;  1KU3 A;  1BJA A;  2DW4 A;  3EYY A;  1R5H A;  1FP1 D;  2YX4 A;  2IA1 A;  4YG2 F;  1IF1 A;  3HUG A;  4M9S A;  4OIQ F;  2Y0M A;  3BDD A;  1FZP B;  1FYL A;  4IHS A;  3PQK A;  1UST A;  2B0L A;  1BIA A;  2J5O A;  3IKT A;  1FPQ A;  1BC8 C;  2EA2 A;  4L5I A;  4PDK A;  5JI6 A;  4EM1 A;  1YW9 A;  2A07 F;  2ESH A;  2HWV A;  1KYW A;  4LG0 B;  1G3Y A;  1YG2 A;  1HKS A;  3V4G A;  3MZY A;  3L00 A;  1MDM A;  2CO5 A;  2XRN A;  4XSZ F;  3KP2 A;  3JAM Z;  2AS5 F;  4P9U A;  2Q8K A;  2PLY A;  1FSE A;  2ZKZ A;  5J8C A;  2KJC A;  5JHU A;  3J80 K;  1GXP A;  4S04 A;  5FO5 A;  4OIO F;  1X3U A;  1WI9 A;  1NHA A;  1LEA A;  2WTE A;  1ZRD A;  2X0L A;  3GYH X;  1HQC A;  1YLF A;  1Z1D A;  3GFM A;  4O3M A;  3RJP A;  2NS0 A;  4P55 A;  4XBF A;  1T98 A;  2JT1 A;  2GZW A;  1ZRC A;  3F72 A;  2XKO A;  5H6R A;  1U6G A;  2XKP A;  2CG4 A;  4AD9 A;  4HDV A;  1K79 A;  3P9I A;  3QPH A;  1IN8 A;  4M74 A;  2H09 A;  4HQE A;  1CF7 A;  3F3X A;  2YR2 A;  4ENK A;  4HBL A;  1P92 A;  2PMH A;  4R79 A;  1UFM A;  2FNA A;  1OYW A;  3T5X A;  2Y75 A;  3BZ6 A;  5LLQ A;  2DK5 A;  3K1P A;  2LNB A;  2A61 A;  2HQN A;  4I0B A;  4RGS A;  1W4M A;  2EWN A;  4NQW A;  4ON0 A;  5CYV A;  2STT A;  4KUM A;  2HOE A;  3WE3 A;  2VOD A;  3U9G A;  4CXF A;  2M30 A;  3F6V A;  3BOQ A;  2IT0 A;  2K02 A;  1U8R A;  3LST A;  1BOA A;  3L7W A;  5HLG A;  2QQ9 A;  4AIH A;  1BI2 A;  3IL2 A;  1AOY A;  4HF2 A;  1FBS A;  3COA C;  5L3B A;  1K7A A;  1Y0U A;  5JFR A;  2P5V A;  3I58 A;  3GLX A;  2QBY A;  3VOE A;  1W7P D;  3ABT A;  1HW5 A;  1TW2 A;  4HF0 A;  5A2Q K;  4EVI A;  3J81 Z;  2XAQ A;  2DLL A;  3K1N A;  5D5U B;  2DAO A;  1I1G A;  4ZYG A;  2PI0 A;  3U2R A;  3TOB A;  4NB5 A;  1Z7U A;  4EJU A;  4RAY A;  2ZCW A;  5E20 A;  3HHH A;  1G3S A;  1K78 B;  3ZMV A;  4GXO A;  4BHB A;  2HDC A;  4L5J A;  2QZ8 A;  2HTJ A;  3MQ0 A;  2K86 A;  1IUY A;  4L9J A;  2FF4 A;  3FMS A;  4NHJ A;  2L3D A;  5D8K B;  1SMT A;  4Z2Y A;  3GZ6 A;  5HLH A;  1FBQ A;  4ASN A;  5HS7 A;  5BPI A;  1LVA A;  1IXS B;  4WX9 A;  3RDI A;  2ZXJ A;  3I59 A;  1W5S A;  2EFW A;  3HSR A;  4A0Y A;  4RS8 A;  1H9G A;  1YS7 A;  2MBF A;  5DEQ A;  2V1D A;  4O6J A;  1R36 A;  1TW3 A;  2HZT A;  1A04 A;  1XSV A;  4YFX F;  3BP8 A;  4I02 A;  1J9I A;  4L18 B;  3W6K B;  1J2X A;  2QQA A;  2P4W A;  4AVP A;  3I54 A;  4ZZD A;  1LEB A;  3CUQ A;  5F6F A;  2FBK A;  4I7H A;  1ON1 A;  2DBB A;  1ZN2 A;  4EGY A;  1CGP A;  3M8E A;  4B8X A;  2C6Y A;  2EFO A;  4KT5 C;  1BN5 A;  1R22 A;  5EEH A;  1USS A;  1FC3 A;  2XAJ A;  2OQG A;  3Q5F A;  2HEO A;  3KLN A;  1V4R A;  4ZYH A;  1ZAR A;  2P6S A;  1XB4 A;  4HX7 A;  3WTT C;  1R1V A;  3IC7 A;  2ZNZ A;  3I5U A;  2ETH A;  1HSJ A;  2FSW A;  1I1S A;  2UXN A;  5CVJ A;  3RKY A;  2P5L C;  4IXA A;  4RB0 A;  4WCG A;  4UXN A;  1SMY F;  1MJ9 A;  3KEQ A;  4YFK F;  2YU3 A;  3LA2 A;  3FZV A;  2PEX A;  4H0E A;  2O61 A;  4ENM A;  4OU0 A;  5FFZ A;  4HA8 A;  4A2U A;  2PBI A;  2EV0 A;  2GAU A;  3GEZ A;  4YII A;  3RPU A;  4L9T A;  1ODD A;  5CJ9 A;  3EUH A;  3FX3 A;  2XAH A;  1W5T A;  1ZGJ A;  1IZ1 A;  1R5G A;  5LGU A;  1FSH A;  2MH9 A;  3F6O A;  1T6S A;  5DCF A;  1G4D A;  1JHF A;  2QEN A;  2DPU A;  3BY6 A;  1BM9 A;  2EB7 A;  2IPQ X;  4KNY A;  3GFL A;  5DYM A;  4U88 A;  2L54 A;  3FHZ A;  4GGG A;  2O03 A;  3V7R A;  5E18 F;  2YPR A;  1WQ2 A;  2OZ6 A;  3VFZ A;  3LQQ A;  1B9M A;  3SFZ A;  4U0V A;  5J6X A;  2KIU A;  3D0S A;  4PGG A;  3S2W A;  3ZMD A;  3FMQ A;  4M73 A;  3HRM A;  1ONV A;  2G7U A;  3WTV C;  5ILV A;  5DCM B;  4GYG A;  1OR7 A;  2VN2 A;  3C7J A;  1T38 A;  2P6T A;  1FY7 A;  3K2Z A;  3WGG A;  1YYV A;  4HDU A;  2L02 A;  3SXY A;  2IJL A;  2W85 A;  4LLN A;  2JPC A;  4LK1 F;  2DT5 A;  1IAW A;  1FWZ A;  3JAM K;  2F5C A;  1FOK A;  1D8K A;  2QYO A;  2DQL A;  3ROU A;  3Q9S A;  5BMZ A;  1TLH B;  2J5P A;  2FA5 A;  2LSO A;  4K2E A;  3FMR A;  5E17 F;  3JSP A;  1XSD A;  2GQQ A;  4IF4 A;  1I5Z A;  2F5D A;  3LFK A;  4UNO A;  4GO1 A;  1HBX G;  1HXD A;  4ZZL A;  1XGS A;  2DK8 A;  2PG4 A;  1KQ8 A;  3DQV C;  3T0Y A;  2HFH A;  1MJA A;  2EK5 A;  2LKP A;  3HYI A;  5TJJ A;  2NYX A;  4Y17 A;  3DPL C;  5KVR A;  2E1N A;  1XD7 A;  3G73 A;  2G9W A;  3H92 A;  4LG0 A;  1FNN A;  4MEX F;  1J5Y A;  2PQ8 A;  4LK0 F;  2BGC A;  4HOB A;  4KIF A;  4S05 A;  2EFP A;  2FQ3 A;  1LDD A;  3PFI A;  1O3Q A;  1XSX A;  1QGP A;  3ZN0 A;  1J75 A;  2ADU A;  2HYG D;  4XLP F;  1W7P B;  2Y48 A;  3SQN A;  3KP3 A;  1U2W A;  3W6J B;  2KKO A;  3GW2 A;  2QM3 A;  4CZZ A;  1Z05 A;  2ZJ2 A;  4CGZ A;  1R1T A;  2E7X A;  4LJZ F;  3I4P A;  2A69 F;  2XHK A;  1B9N A;  4YFN F;  1LNW A;  4IRG A;  1KU2 A;  3GFJ A;  2MD5 A;  2FML A;  1ZHF A;  3KP7 A;  4U0W A;  4CYD A;  5TRD A;  2VOP A;  3LAP A;  1PP7 U;  1QZY A;  1O7F A;  3LQR A;  2L4A A;  4MNU A;  3RIR A;  4HF1 A;  2WC2 A;  1B59 A;  2EFQ A;  3FM3 A;  3JTG A;  1B1B A;  3LA3 A;  5AIP A;  1TQM A;  1G3W A;  1JE8 A;  4XLN F;  3N97 A;  3HTS B;  3DV8 A;  3BJ6 A;  5F1R A;  3ZQ7 A;  4BYY A;  2K27 A;  1Z91 A;  4G6D A;  4LLG F;  1K6O A;  5CVV A;  4FX4 A;  3F8C A;  3WTW C;  3LWF A;  4CHU A;  3E6C C;  2FXA A;  1YW7 A;  1T39 A;  2V6C A;  1EH7 A;  2VT3 A;  1P6R A;  3GF2 A;  5DDG A;  1S3J A;  2ZME B;  4LMY A;  4EJV A;  5IT9 Z;  3OOP A;  4AWX B;  4U7B A;  1WKM A;  3RI4 A;  1R1U A;  3WU1 B;  5D6F A;  3QPT A;  2HQR A;  3KP5 A;  2VT2 A;  1MJB A;  2GWR A;  2GXG A;  3WGH A;  4G6Q A;  2RC4 A;  1WSU A;  1DDN A;  3FWE A;  1R58 A;  5AON A;  2MH2 A;  1O57 A;  4EMS A;  2K7L A;  3F8F A;  4RGU A;  1V3F A;  2XAG A;  2WV0 A;  1B6A A;  5K5R A;  5CLS A;  5DUI A;  2GA1 A;  4OIP F;  3NQO A;  4M9X A;  2D1H A;  2IVM A;  4HLY A;  3IRR A;  2O6G E;  1YTY A;  1K78 A;  1XCB A;  1YS6 A;  2G7H A;  3ZMZ A;  1QBJ A;  1P2F A;  1ULY A;  2O3F A;  4KN7 X;  5D4R A;  1RNL A;  3HRU A;  4BAY A;  3ABU A;  3K69 A;  5FLX K;  5HOO A;  3DEU A;  3GXO A;  1LDK B;  2Z33 A;  1FX7 A;  4UVA A;  4GYI A;  2CQK A;  3GUD A;  3F22 A;  1OYY A;  1JHH A;  1FYM A;  4RGX A;  4MTD A;  2LF8 A;  3TKY A;  2XAS A;  1EV7 A;  3WTX C;  3RYR A;  3KLO A;  1PDN C;  3ZMT A;  2M8E A;  3CUO A;  5ILU A;  1IRG A;  2RGV A;  1F9N A;  1J0R A;  1OPC A;  2A6H F;  2ISY A;  3E6M A;  5DUK A;  5ICE A;  4A0Z A;  1HKQ A;  2Z5U A;  4ESF A;  3MWM A;  2KJB A;  1GVJ A;  3REO A;  2D45 A;  3NRV A;  1SFU A;  2K4B A;  3K1M A;  2IP2 A;  2X4H A;  3ECO A;  5E1Z B;  3MFK A;  4EGZ A;  1XDS A;  1RUN A;  4ENN A;  2Z99 A;  5F64 A;  3N4M A;  3O6B B;  2RNJ A;  2A3S A;  3HIF A;  4U7D A;  1DP7 P;  1R7J A;  4EM0 B;  2P8T A;  4UV9 A;  5K5O A;  5D6E A;  5H20 A;  3DF8 A;  2MLK A;  2W25 A;  3CLO A;  4PZJ A;  1B4A A;  1RIO H;  2XV4 S;  2EA4 A;  3ELK A;  3KP4 A;  4PGH A;  4ZYD A;  3EDP A;  5FD5 A;  2UXX A;  4EJT A;  4RAZ A;  2DI3 A;  1O3S A;  2CW0 F;  3F8B A;  1KQ9 A;  3M8F A;  4WF2 A;  3C18 A;  1TNS A;  4HYE A;  5AIQ A;  5LHI A;  2E7W A;  4Q47 A;  4OMY A;  4KDP A;  4G8X A;  1Z6T A;  4KFC A;  3I71 A;  5LHH A;  1PUE E;  4ETS A;  2VBW A;  2Q2E A;  4WXD A;  3WTS C;  3JSO A;  5FFX A;  3OV8 A;  1AWC A;  1LDJ A;  2GXB A;  2UWM A;  3DFG A;  1ZLK A;  4OMZ A;  3BWG A;  4MEY F;  1ZGA A;  3SHF A;  5HS8 A;  2M45 A;  5DCM A;  1STZ A;  2NNY A;  4G7O F;  1D3Y A;  1LJ9 A;  1SFX A;  2P5K A;  3CTA A;  4E70 A;  1L3L A;  1F4K A;  2Q0O A;  3E97 A;  2O8X A;  4EJW A;  4G7H F;  5FD6 A;  5JR3 A;  1WWX A;  5LEK A;  2STW A;  3JW4 A;  2F2E A;  2CYY A;  4HW0 A;  3SZT A;  5HS9 A;  2HGC A;  2PFB A;  4M6Y A;  1TTY A;  1IN5 A;  3RPQ A;  1DPU A;  3T8T A;  2XUB A;  5FGM A;  5JVT A;  4FHT A;  1SD4 A;  1SD6 A;  1DUX C;  3RKX A;  5E1W A;  5LGT A;  2QWW A;  5KK1 A;  3E5Q A;  4BXU A;  1E2X A;  4B09 A;  2F5E A;  4M9Z A;  5D5W B;  5ICG A;  3FF5 A;  3DPT A;  2DQR A;  2JRT A;  1OMI A;  2MC3 A;  4LB6 B;  4A6D A;  2ISZ A;  4KYW A;  2DTR A;  3ZPL A;  1KU9 A;  2R7D A;  3DXJ F;  3VEP A;  4O5V A;  2FE3 A;  1KGS A;  2ZNY A;  2FBI A;  4MHG A;  3F8M A;  2WWY A;  2V1X A;  4M6X A;  2LDU A;  5E1X A;  1FBU A;  1BI3 A;  1S6L A;  2ELH A;  1PP8 F;  1S7O A;  2W24 A;  5ICC A;  2VON A;  1XCV A;  4L9N A;  4JK1 X;  3WGI A;  1G6N A;  4KMU X;  2OBP A;  3G3Z A;  3HRS A;  4HQM A;  4A5M A;  4I98 B;  1P4A A;  1RZ4 A;  3HSE A;  4HX8 A;  4MGR A;  3R61 A;  2QLZ A;  4P96 A;  4D0P A;  2OZU A;  3QP6 A;  3H3U A;  2FOK A;  3M7G A;  2R7F A;  3IRQ A;  1IW7 F;  3KEO A;  1W7P A;  2RN7 A;  2ZBK A;  3B02 A;  5IT9 K;  1ZG1 A;  4I01 A;  1FYK A;  1SFE A;  3O2P E;  4I09 A;  2CFX A;  2RVC A;  3J7A O;  1P4X A;  3HOT A;  4L0Z B;  1J59 A;  3V8L A;  4Q48 A;  1L0O C;  4KA4 A;  3L09 A;  2KIF A;  5E8I A;  2Z9O A;  4LLL A;  4LD5 A;  4Y13 A;  2DO7 A;  5LRS A;  3WG9 A;  3P7N A;  2NRA C;  4KMF A;  2VE8 A;  2XRO A;  2QVO A;  1MZB A;  3GWZ A;  5CVR A;  5LBQ A;  2FRH A;  2EV6 A;  4G94 A;  5HDN A;  4UUV A;  1FLI A;  5ILS A;  4AIK A;  2UZK A;  5L3D A;  1S8N A;  4WXH A;  5DD8 A;  2HTS A;  4HAM A;  1UB9 A;  1S29 A;  4M72 A;  4G9Y A;  4U0Y A;  3TQN A;  4BQA A;  1HW2 A;  1LQ1 A;  1U5T C;  4UV8 A;  2ZME A;  3TGN A;  1ZAO A;  4Y15 A;  1U5T B;  5LEJ A;  1JGS A;  3J81 K;  2RDP A;  2YX7 A;  1RUO A;  2JTV A;  4HX4 A;  1SD7 A;  2BBY A;  3BJO A;  3TOA A;  1C0W A;  3LAJ A;  2HYF A;  3WU0 A;  4EQQ A;  1GXQ A;  4KIB A;  4OIN F;  3KZY A;  3WE2 A;  2BYV E;  4IJA A;  1O7L A;  1UHM A;  2XVC A;  3ML6 A;  3EYI A;  3ZMS A;  1YIO A;  5L3C A;  1T2K A;  4ZH4 F;  1ZRF A;  4RB2 C;  3I53 A;  2E1C A;  3LA7 A;  3HRT A;  5E8G A;  5IT3 A;  1ZG3 A;  3BPV A;  3WTY C;  3ERE D;  4AIJ A;  2D1V A;  3K0L A;  3F23 A;  5BS6 A;  3MZH A;  2COM A;  2Z3Y A;  4OOI A;  3WOD F;  3FXR A;  1BI1 A;  4HV6 A;  2BV6 A;  1QO0 D;  4WK8 F;  5K5Q A;  4FT8 A;  2JSC A;  2VOO A;  3I64 A;  4HZF A;  3GVA A;  4N9I A;  3E6D A;  1KA8 A;  3EQL F;  3ISP A;  1YW8 A;  1MDM B;  2M5W A;  2F5F A;  3P9K A;  1XDU A;  4KN4 X;  4JQF A;  4UHT A;  3Q9V A;  3AAF A;  3V7C A;  3IWZ A;  2TDX A;  3IWF A;  2H27 A;  3FXQ A;  2W57 A;  3KE2 A;  4QLC U;  2VBY A;  3JTH A;  4I2O A;  2OQR A;  4L9V A;  3VB2 A;  3DP7 A;  4P5O A;  4EM2 A;  2HKO A;  4TV7 A;  1XMA A;  2H94 A;  3H3Z A;  3FXU A;  4WXC A;  3I0T A;  1TNT A;  1I27 A;  1TQP A;  3GO5 A;  2GIV A;  1WRJ A;  3FM5 A;  2LF7 A;  1CF7 B;  1F1Z A;  4DNC A;  2R3S A;  2KIM A;  3QU3 A;  5D4S A;  5FB2 A;  1TQI A;  1KYZ A;  1MGT A;  1IXR C;  3TDU C;  2D2W A;  1ON2 A;  1HST A;  1TBX A;  2OAZ A;  3CDH A;  2IRF G;  3CO7 C;  3QRF F;  1F5T A;  2IW5 A;  3C3W A;  4MQ9 F;  2XAF A;  3K9T A;  5HLI A;  4I0A A;  1SD5 A;  2VBX A;  3D5L A;  2V1U A;  6PAX A;  1YO5 C;  2VXZ A;  2FMY A;  3MCZ A;  5CVU A;  1EH6 A;  3IHU A;  4FX0 A;  4BHP A;  1XMK A;  1SAX A;  5LRR A;  2JZY A;  1O3R A;  2HKX A;  5K1Y A;  3BPX A;  2CGP A;  3R4K A;  3J80 Z;  3E5X A;  1P4W A;  1ZH5 A;  2VE9 A;  4EV0 A;  2DU9 A;  2M87 A;  3F8N A;  1IXC A;  2DPD A;  1RI7 A;  3O3K A;  5CVI A;  1O3T A;  2RQP A;  2OU2 A;  2MLG A;  2H6B A;  4RB1 A;  2QBY B;  1Q1H A;  1MD0 A;  3V7S A;  5ICF A;  4LGW A;  3V8K A;  1ZRE A;  1FT9 A;  2EJR A;  1DPR A;  3RYP A;  4G7Z F;  2O0Y A;  3KZZ A;  2H6C A;  3TO6 A;  1BI0 A;  2PMU A;  3ECH A;  3GFI A;  3BRO A;  1IN6 A;  1U78 A; 
#chains in the Genus database with same CATH topology
 2FQ4 A;  4AM3 A;  4B3X A;  1EH8 A;  2E60 A;  4BHC A;  4A93 J;  2IA2 A;  2A5Y B;  1V54 H;  4EEF G;  1UHS A;  1BW5 A;  2XF5 A;  5J1Y A;  4XRM A;  3G1O A;  4A6E A;  1ZG5 A;  1E17 A;  2BVL A;  5B1A H;  2JA2 A;  1KQ0 A;  2F6C A;  2FBH A;  4XK4 A;  3R6S A;  2EZI A;  2HXO A;  2ZXW H;  3KX2 A;  2CS3 A;  2P7C B;  3HXL A;  2NAZ A;  4CO8 A;  4HSR A;  4B48 A;  3C2H A;  4XSX F;  1D5V A;  2LY9 A;  2DOE A;  4LB5 A;  2EFN A;  1YJ9 I;  2KZV A;  5E3N A;  1BW6 A;  1MH4 A;  2V9V A;  1M1E B;  2ZO4 A;  2VBZ A;  4R1H A;  1H9T A;  3SFI A;  4BQO A;  3HTU A;  1VTN C;  3WTZ A;  2L7M P;  3I59 B;  5M5W J;  1TC3 C;  4QWQ A;  1Z9C A;  3Q0U A;  1RR8 C;  2DA2 A;  3ZQI A;  2VC0 A;  1TWF J;  3LSM A;  1HW1 A;  2JPB A;  4LIV A;  5BPD A;  5FLV A;  2CRG A;  3TO7 A;  3KP6 A;  1UHW A;  3MKL A;  3E6B A;  1HKT A;  4R8H A;  1MMN A;  4BKX A;  1BBY A;  2OA4 A;  5FLX Z;  3J7Y J;  1WZ2 A;  2WAQ A;  2HNH A;  1ZR4 A;  3QP5 A;  4FQG A;  5HDK A;  3A2K A;  4N9H A;  1YHQ I;  1D8J A;  2AO9 A;  2FEZ A;  5D5X B;  3ZP5 A;  3CUQ C;  2JRM A;  2FX0 A;  3PFY A;  2DDA A;  2R7Q A;  3CCY A;  2DA4 A;  2ACJ A;  3NAR A;  2RV8 A;  3ZMU A;  3CUQ B;  5ED4 A;  3E5U A;  4RGR A;  4IRH A;  4RDU A;  3WTU C;  5KAI C;  5A2Q Z;  1MKM A;  3M9A A;  1MW7 A;  3U1D A;  3H3V K;  3OYJ A;  4A3J J;  1TWC J;  1PUF B;  5LHG A;  1X4O A;  2MA3 A;  1JKP C;  5ERI A;  1I6X A;  2RQQ A;  3CJN A;  3B73 A;  3QU6 A;  3J7A Y;  4EJO A;  2JK3 A;  4UVC A;  3UR3 C;  2L0K A;  4IPA A;  2HR3 A;  2P81 A;  2XSD C;  3EET A;  4DQ2 A;  3HEF A;  1R00 A;  1UCR A;  1OCC H;  1S7A A;  5DV5 A;  4BH9 A;  1IDZ A;  3BTC A;  1BIB A;  2LKS A;  2L9S A;  2A05 A;  3RCO A;  5BQT A;  1XC5 A;  5L3G A;  3E3V A;  4M3B A;  2VQG A;  1YFH A;  2A68 F;  3VSK A;  4MQV A;  2CWE A;  2IEK A;  3OIP A;  3HHG A;  1IUF A;  1KU7 A;  5BOX A;  3QAH A;  4P9F A;  2KZG A;  2E34 A;  2AXL A;  1LB2 A;  4HLX A;  2XPV A;  4IHX A;  2ZFW A;  5H6Q A;  2W4S A;  4DOZ A;  4BNC A;  5EEG A;  4BEH A;  1TP4 A;  4L0Y B;  5HVQ C;  1ZK8 A;  1J7K A;  3L2C A;  4WWC A;  4HRI A;  3MAJ A;  2P7V B;  3M1E A;  5D5V B;  1X1P A;  1XGN A;  4I6Z A;  3SZP A;  4A3F J;  3C1D A;  3PQJ A;  3P9C A;  4CIC A;  1KON A;  3ULQ B;  2QUF A;  4KIG A;  1TWH J;  2XIG A;  3EUH C;  3KFW X;  2PN6 A;  1MBJ A;  2BEO A;  3OOU A;  2VC1 A;  4LFU A;  4BJT A;  5H2F C;  2X1D A;  1XGM A;  1QPM A;  1XTA A;  2RKH A;  1VQN I;  1R23 A;  2MFZ A;  3DKW A;  1GHC A;  4BE2 A;  3HBL A;  5M5Y J;  4HV5 A;  2PJP A;  4JX5 A;  3NEU A;  2DFI A;  1I50 J;  1FP2 A;  4M71 A;  1G3T A;  4RBO A;  4Q4Z F;  2W1O A;  3BC8 A;  1ZYR F;  2XB0 X;  1Y1W J;  2QQB A;  2KRC A;  4HNV A;  3RKW A;  1U3E M;  3WG7 H;  3IKV A;  4XR6 A;  1HC8 A;  1QNT A;  4XKC A;  4F91 B;  1Z77 A;  2Y9Z A;  2K4J A;  2E2I J;  2NNN A;  3T1B A;  1U0J A;  4IO9 F;  4ZYE A;  3K10 A;  3RTR A;  2JUC A;  1FOY A;  3GZ5 A;  3JRB A;  5L3F A;  1JXS A;  4OIR F;  3F21 A;  1WJC A;  2X6X A;  2ECB A;  3ZN1 A;  4JBA A;  3LSR A;  2HOS A;  3RZD J;  1NH3 A;  4ITV A;  4MTE A;  5GPC A;  2W84 A;  1X1B A;  3A01 A;  3HOW J;  1FOX A;  3H0D A;  4IVN A;  1BC7 C;  2HPM A;  3PSF A;  1OR7 C;  3OIQ A;  3LSG A;  2A6E F;  1TZL A;  5DD4 A;  1WFX A;  3Q3S A;  5D8L B;  4XRS A;  4ESJ A;  3CO6 C;  2NVT J;  3TO9 A;  4IHT A;  1QQI A;  3MKY B;  3KET A;  1H0M A;  1FTT A;  2COB A;  2FNP A;  4KIC A;  4A0X A;  2IA0 A;  2AQE A;  4IRI A;  3WU2 C;  2CSO A;  3K4C A;  3K70 D;  4Q5S F;  3LSJ A;  3R0A A;  5IOY A;  2ICW G;  4ENJ A;  1IRF A;  1ZLJ A;  2GOM A;  1IRZ A;  3KCC A;  4BL0 B;  1UEL B;  4CDG A;  3GTJ J;  2KT0 A;  1Z6R A;  3VOD A;  3GX4 X;  4N0B A;  2M1B A;  3T8R A;  3UNG C;  4UVB A;  4A5N A;  2OD5 A;  2R93 J;  1OYI A;  1SVM A;  2NOG A;  4E7S A;  3BJA A;  2XC7 A;  1DP3 A;  1OKR A;  4F7Z A;  2XPU A;  1BOB A;  3A1Y A;  2L4M A;  5J8F A;  2W7N A;  1ZTR A;  2MAB A;  2E36 A;  3CJQ B;  2YSR A;  1WI3 A;  4U87 A;  4A12 A;  4RB3 C;  3HOS A;  1QZZ A;  3VDX A;  1HDD C;  3S1Q J;  1FIA A;  2KRF A;  4A3E J;  5HLT A;  2XRL A;  5CPR B;  3TDZ C;  1XGO A;  4ESB A;  4FE4 A;  1IN7 A;  1ZR2 A;  1YQA A;  3L9F A;  2HDW A;  4JX4 A;  3V8J A;  3NWS A;  4PCQ A;  3AG3 H;  3QOP A;  1U5T A;  3HG9 A;  1TT5 B;  3CCQ I;  3BCB A;  2EV5 A;  4GCV A;  4PUS A;  1BR4 A;  5J4V A;  2HVS A;  3HGG A;  5L3E A;  3CD6 I;  2GA2 A;  4XRF A;  5HDG A;  1REP C;  3R60 A;  1UMQ A;  2FU4 A;  1VQ4 I;  2V79 A;  4J19 A;  2HS5 A;  2L01 A;  2FD5 A;  4XKB A;  3JRF A;  2VKE A;  4YIF A;  2VKD A;  3R0J A;  1E3H A;  3HSF A;  2BE5 F;  4E7J A;  5FLM J;  2R5Y A;  5E3L A;  1U9O A;  3MEX A;  5LGN A;  1IN4 A;  1T0F A;  2XGC A;  3K6G A;  1F43 A;  5B66 C;  1Z67 A;  4C2M J;  4FTH A;  2XGX A;  3ZGK A;  2ESN A;  4F55 A;  1XN7 A;  5IY5 H;  3U21 A;  1KU3 A;  1BJA A;  1UZC A;  2DW4 A;  2OUM A;  1HOM A;  3EYY A;  1R5H A;  1FP1 D;  2YX4 A;  2O9L A;  2IA1 A;  3PO3 J;  3GTO J;  2TCT A;  4RLF A;  3PNY A;  2DYR H;  2KDO A;  4DYQ A;  4YG2 F;  1IF1 A;  3HUG A;  4LIU A;  4HNU A;  4M9S A;  3KYC B;  3CP8 A;  4OIQ F;  2Y0M A;  3I55 I;  3BDD A;  1FZP B;  1FYL A;  4IHS A;  3PQK A;  2HQ5 A;  4BBS J;  1UST A;  2B0L A;  1BIA A;  2J5O A;  3IKT A;  3EUA A;  1FPQ A;  2WAE A;  5E3O A;  3RQI A;  1BC8 C;  2EA2 A;  2E2H J;  2JN6 A;  4L5I A;  2VL8 A;  4A3M J;  4PDK A;  5JI6 A;  4EM1 A;  1YW9 A;  2A07 F;  4E4H A;  3JRG A;  2KQR A;  3PSI A;  2ESH A;  1YJN I;  2HWV A;  1KYW A;  3VYT B;  3HKZ A;  5J3L A;  1R5I D;  3CCS I;  4LG0 B;  2FOW A;  1G3Y A;  1YG2 A;  2VIX A;  1HKS A;  4M3G A;  4Z6Y A;  2QKM B;  3V4G A;  3MZY A;  4ZYA A;  1S72 I;  2LR8 A;  2PMZ N;  2NVY J;  2RAE A;  2LLK A;  3ABL H;  1FJL A;  1W0U A;  2GLO A;  3L00 A;  3PJR A;  4D1Q A;  1MDM A;  1FMW A;  2CO5 A;  2XRN A;  4XSZ F;  3VYR B;  3KP2 A;  4F93 B;  5IP6 A;  3JAM Z;  2AS5 F;  1TT0 A;  2XPW A;  5FKO A;  3ZQG A;  4HPQ A;  2BY0 A;  4P9U A;  3H9Q A;  2Q8K A;  4YRV A;  2PLY A;  1LE8 B;  1FSE A;  2ZKZ A;  3W6V A;  5J8C A;  2KJC A;  3GTP J;  1QPI A;  5JHU A;  3J80 K;  1XMX A;  1GXP A;  3KEY A;  4S04 A;  1VI0 A;  3DBH B;  1MMS A;  2DMP A;  5FO5 A;  4OIO F;  1X3U A;  1WI9 A;  1NHA A;  1LEA A;  3G4S I;  2EPF A;  2IGM A;  2WTE A;  1ZRD A;  2X0L A;  1HQC A;  3GYH X;  1YLF A;  3CMY A;  5M3M J;  1Z1D A;  3GFM A;  4IHW A;  4O3M A;  5FKL A;  3RJP A;  1R4N B;  2NS0 A;  4P55 A;  4XBF A;  1T98 A;  2Q1Z B;  3BR1 A;  2HYJ A;  4PSX A;  2JT1 A;  3G1M A;  2H8R A;  2ZME C;  4C3J J;  2GZW A;  1ZRC A;  3M07 A;  3F72 A;  4B4C A;  1ETQ A;  4FET A;  1B8I A;  2XKO A;  4C3I J;  2KFD A;  1JUM A;  3HZJ A;  5H6R A;  4PFP A;  4MIM A;  4CYC A;  1U6G A;  2OCC H;  2XKP A;  2CG4 A;  2WAQ N;  3BTI A;  2ME6 A;  4AD9 A;  4HDV A;  1K79 A;  3P9I A;  2JA6 J;  1ITY A;  2IS2 A;  3QPH A;  1Y56 A;  1IN8 A;  2EIL H;  4M74 A;  2V9P A;  4N4N B;  2DYS H;  2H09 A;  4HQE A;  2WB1 A;  3F3X A;  1CF7 A;  2YR2 A;  4ENK A;  4HBL A;  3GTG J;  1P92 A;  2LRD A;  3F0C A;  1H89 C;  2CW8 A;  2PMH A;  4R79 A;  3H5R A;  3KYL A;  1EJ9 A;  2QSF X;  3BG5 A;  4FAS D;  2RNG A;  4IQJ A;  4AYB A;  1UFM A;  2FNA A;  5HOD A;  4YIR X;  2B63 J;  4BE1 A;  2BW3 A;  1K83 J;  5EGO B;  1OYW A;  3GTM J;  3T5X A;  3OYD A;  1ZEL A;  2Y75 A;  1JT0 A;  3BZ6 A;  3QYE A;  5LLQ A;  3JRD A;  3LSH A;  2DK5 A;  3K1P A;  2LNB A;  2ELJ A;  2A61 A;  2HQN A;  4CCK A;  2R5Z B;  4I0B A;  2ZJQ F;  4D5C A;  4RGS A;  4AU7 A;  4D7M A;  3JR9 A;  1W4M A;  2EWN A;  4XKW A;  4NQW A;  4ON0 A;  3L2W A;  5CYV A;  3SDB A;  1OFC X;  3PUB A;  4KUM A;  2HOE A;  3FKI J;  3AKZ A;  2STT A;  3WE3 A;  2VOD A;  3U9G A;  1N77 A;  3ONQ A;  4CXF A;  3JRA A;  4CYC B;  1WGX A;  2LYC A;  2M30 A;  3F6V A;  3BOQ A;  2IT0 A;  1I6H J;  2JA7 J;  1WH5 A;  2K02 A;  3WHB A;  1U8R A;  3LST A;  4Y33 A;  1BOA A;  1VQ9 I;  1EF4 A;  3L7W A;  4X0G A;  2BY3 A;  5HLG A;  2QQ9 A;  4AIH A;  1BI2 A;  4LIT A;  2M0C A;  3IL2 A;  1AOY A;  4HF2 A;  4DJA A;  4XOR A;  3RQ4 A;  3H0G J;  1FBS A;  3COA C;  5L3B A;  1I39 A;  5LD2 C;  1K7A A;  1Y0U A;  1JI8 A;  3M8J A;  5JFR A;  3S3N A;  1TL8 A;  2LOO A;  1WJB A;  2P5V A;  2B9S A;  3I58 A;  4CCN A;  1X1D A;  1OQY A;  3GLX A;  2R7R A;  1WJD A;  2QBY A;  5KNL A;  1HA8 A;  1OCR H;  2DT6 A;  5GAH J;  3VOE A;  4IL6 C;  1W7P D;  3ABT A;  1HW5 A;  3TL4 X;  1TW2 A;  4HF0 A;  5A2Q K;  1FEX A;  3HC7 A;  4EVI A;  3J81 Z;  2DJN A;  3BLY A;  1JGG A;  2XAQ A;  2DLL A;  4H4K C;  3K1N A;  5D5U B;  2DAO A;  1I1G A;  3ZQQ A;  4ZYG A;  2PI0 A;  3U2R A;  3ZOB A;  1R49 A;  2MSY A;  3TOB A;  4NB5 A;  1MNM C;  2R7V A;  1Z7U A;  2F4M B;  4EJU A;  4RAY A;  2ZCW A;  3KIO A;  5E20 A;  3HHH A;  1G3S A;  1K78 B;  3ZMV A;  4GXO A;  4BHB A;  2HDC A;  4D9J A;  4L5J A;  3HL2 A;  3W2V A;  2QZ8 A;  2HTJ A;  2WY8 Q;  5CQE A;  3MQ0 A;  1UG0 A;  2K86 A;  1IUY A;  4L9J A;  4BY7 J;  1G8X A;  1BA5 A;  5K7Z A;  4IOC F;  2DXI A;  5JHF A;  1FOW A;  2X6Y A;  2FF4 A;  3BG6 A;  3FMS A;  4NHJ A;  1X3W B;  1JT6 A;  3FK7 A;  3DCF A;  4XLH A;  2L3D A;  3GME A;  5D8K B;  1SMT A;  2NXN B;  4Z2Y A;  2E5Z A;  3GZ6 A;  4JOM A;  5HLH A;  1MBK A;  2LKX A;  3DLA A;  2PJR A;  2L7Z A;  1YI2 I;  4RLQ A;  4ZDL A;  1FBQ A;  2EIM H;  4ASN A;  1SAU A;  5HS7 A;  1VQ6 I;  5BPI A;  1LVA A;  1IXS B;  4B47 A;  2H1L A;  4WX9 A;  4DZP A;  5K7H A;  2DA5 A;  3RDI A;  2ZXJ A;  3I59 A;  4BXF A;  3CCL I;  1AKH A;  1W5S A;  3H5N A;  2EFW A;  3HSR A;  4A0Y A;  4RS8 A;  1H9G A;  1YS7 A;  2MBF A;  5DEQ A;  2V1D A;  2OTL I;  4O6J A;  3MMY B;  4KIT B;  2ZJR F;  1R36 A;  2VJJ A;  1TW3 A;  4IQ4 A;  2HZT A;  4NBQ A;  1B72 B;  1A04 A;  1SFK A;  3HM5 A;  1XSV A;  1ZQ3 P;  2VKH A;  1JTY A;  4YFX F;  3BP8 A;  4I02 A;  1D0Z A;  3S1R J;  1J9I A;  2HI3 A;  4L18 B;  3W6K B;  1J2X A;  1JKO C;  3OYK A;  2CUJ A;  3K70 C;  2QQA A;  2P4W A;  4AVP A;  2DFH A;  3I54 A;  3MZ8 A;  4ZZD A;  1LEB A;  1V5E A;  3CUQ A;  9ANT A;  1JKR C;  2K3P A;  2XF7 A;  5F6F A;  2FBK A;  3C2B A;  4I7H A;  4F92 B;  5IP7 J;  1ON1 A;  2DBB A;  1ZN2 A;  4EGY A;  3IH4 A;  3M8E A;  1CGP A;  4B8X A;  2C6Y A;  1RRJ A;  2EFO A;  2XDV A;  3CCE I;  2HDD A;  4KT5 C;  1BN5 A;  1R22 A;  2L9N A;  5EEH A;  1PUF A;  3TMO A;  4II2 A;  3OYN A;  2PJR B;  1SVO A;  1USS A;  1VZ0 A;  1FC3 A;  4C2T A;  2XAJ A;  1MMD A;  3CC4 I;  4ZC3 A;  5E3M A;  2OQG A;  3Q5F A;  1FMV A;  4BDZ A;  2HEO A;  3KLN A;  1V4R A;  4ZYH A;  1AKH B;  2BY1 A;  1ZAR A;  2EBI A;  3EPZ A;  2P6S A;  3HDD A;  3QOD A;  1XB4 A;  4HX7 A;  4J01 A;  4BQQ A;  2CUZ A;  3ASO H;  1R1V A;  3WTT C;  3H5A A;  1GV2 A;  3RZO J;  3KZI C;  3B6C A;  3IC7 A;  3GCM A;  2HPI A;  3ZQH A;  2ZNZ A;  3I5U A;  2ETH A;  1HSJ A;  2FSW A;  4ZTF A;  1I1S A;  2N8G A;  2QQ8 A;  2UXN A;  5CVJ A;  2BOL A;  3RKY A;  2P5L C;  4IXA A;  3HPH A;  2YS9 A;  4RB0 A;  3ZQL A;  4WCG A;  4UXN A;  1SMY F;  4A3G J;  1MJ9 A;  3KEQ A;  4YFK F;  2IGK A;  2ID6 A;  2YU3 A;  1T95 A;  3LA2 A;  3FZV A;  4E7H A;  2LG4 A;  2PEX A;  3OYL A;  4H0E A;  2O61 A;  4ENM A;  4OU0 A;  3ZCO A;  5FFZ A;  4RAG A;  3M3Y J;  4HA8 A;  4PJL A;  4A2U A;  2PBI A;  3QOE A;  2EV0 A;  2GAU A;  3GEZ A;  4YII A;  2IBD A;  3RPU A;  4L9T A;  2XB5 A;  1ODD A;  5CJ9 A;  3EUH A;  2CU7 A;  3QPS A;  3FX3 A;  2XAH A;  1Y0N A;  2V9K A;  4V2G A;  1H8A C;  1W5T A;  1ZGJ A;  4XIC A;  4DYC A;  1IZ1 A;  1R5G A;  4GDF A;  3OR2 C;  5LGU A;  1FSH A;  2MH9 A;  3F6O A;  3TP3 A;  1T6S A;  1NG6 A;  2W82 A;  5DCF A;  1WCM J;  1JHF A;  2ZFU A;  3OSG A;  1G4D A;  2QEN A;  2DPU A;  1LFP A;  3K4L A;  2DTZ A;  3BY6 A;  1BM9 A;  2EB7 A;  2IPQ X;  2VPR A;  3M1C A;  3GFL A;  4KNY A;  1ETK A;  5DYM A;  4U88 A;  2L54 A;  2DCE A;  3FHZ A;  5KHD A;  2P0W A;  3CJR B;  4GGG A;  2O03 A;  3FDY A;  2LH9 A;  3V7R A;  2MC4 A;  2Q2E B;  1S9H A;  5E18 F;  2YPR A;  1WQ2 A;  3DTK A;  2OZ6 A;  3JRE A;  3VFZ A;  2IGN A;  3HGY A;  4XLE A;  5K7F A;  3LQQ A;  1B9M A;  1WJA A;  3L2V A;  3SFZ A;  1X19 A;  4U0V A;  4XLA A;  5J6X A;  2KIU A;  5C4J J;  3D0S A;  4PGG A;  2EQR A;  3O8G A;  3AFH A;  3S2W A;  3ZMD A;  3FMQ A;  4M73 A;  3HRM A;  1ONV A;  2G7U A;  3WTV C;  5ILV A;  5DCM B;  1V55 H;  4GYG A;  1OR7 A;  2VN2 A;  3C7J A;  1Y39 A;  4MLO A;  5J1R A;  1T38 A;  1I3A A;  1QU3 A;  2P6T A;  1FY7 A;  4XOP A;  2E35 A;  3BR0 A;  3FXL A;  4GRI A;  4CCO A;  4PJJ A;  1A5J A;  3MD2 A;  3K2Z A;  4UB8 C;  2A6T A;  3BZK A;  3W3C A;  2UUZ A;  5M5X J;  3AL0 C;  2Y69 H;  3WGG A;  1YYV A;  4FCY A;  2DFF A;  4F3Q A;  4HDU A;  3CF2 A;  1SFO J;  2HOA A;  2QSG X;  5EYR A;  2WB1 N;  2BY2 A;  3CMA I;  3GTK J;  3AL0 B;  1V5F A;  2L02 A;  3SXY A;  2X51 A;  2IJL A;  3OYI A;  1JTX A;  2W85 A;  3QPL A;  4HNT A;  2BHY A;  4LLN A;  5TIS C;  2JPC A;  1ETO A;  4LK1 F;  2DT5 A;  2DOF A;  3CES A;  4XID A;  1IAW A;  1FWZ A;  2JWT A;  3JAM K;  1D1A A;  1JJ8 C;  4PJN A;  2F5C A;  1FOK A;  1D8K A;  2AQF A;  2QYO A;  1I3Q J;  2DQL A;  1FIP A;  3PIO F;  1G2H A;  3ROU A;  3CCV I;  3Q9S A;  5EG0 B;  5BMZ A;  3FBN B;  3FIW A;  3SEQ A;  2QEX I;  1TLH B;  2BXZ A;  2J5P A;  2FA5 A;  2ZSH B;  3OY9 A;  2LSO A;  3UKG A;  1MBF A;  2NVX J;  3BR3 A;  2PX9 A;  3FMR A;  1GLN A;  4K2E A;  5E17 F;  3JSP A;  1U8B A;  3S3M A;  3JRH A;  2ZC2 A;  4M3E A;  3PIP F;  1XSD A;  2GQQ A;  4IF4 A;  2DT7 B;  4X1E A;  1I5Z A;  2F5D A;  3LFK A;  2I10 A;  5HNH A;  4IKF A;  4UNO A;  4GO1 A;  1HBX G;  1ZGW A;  1HXD A;  2QGU A;  2L9R A;  4ZZL A;  3QYB A;  1XGS A;  3B6A A;  2DK8 A;  3G71 I;  2PG4 A;  3TP0 A;  1KQ8 A;  3DQV C;  2MYS A;  3T0Y A;  2HFH A;  2Y0S A;  2M4G A;  3ESW B;  3OYC A;  1MJA A;  2EK5 A;  2LKP A;  3FKJ A;  1P7J A;  3HYI A;  2WBM A;  5TJJ A;  2NYX A;  4Y17 A;  5TGT A;  3DPL C;  2LBF A;  1YRN B;  5KVR A;  2E1N A;  2OF7 A;  1XD7 A;  2IS1 A;  2DA6 A;  3G73 A;  2G9W A;  2QCO A;  3H92 A;  4ABZ A;  5GAE J;  1E0E A;  4LG0 A;  3CF5 F;  1UG2 A;  3CLQ A;  1FNN A;  1NTC A;  2VXD A;  3IAS 2;  4MEX F;  1J5Y A;  2PQ8 A;  4LK0 F;  2BGC A;  2X1C A;  4HOB A;  4KIF A;  4D5F A;  4S05 A;  3CMM A;  3VYU B;  1PVE A;  2EFP A;  2FQ3 A;  1LDD A;  3PFI A;  2EZK A;  3H9J A;  1O3Q A;  2MD0 A;  3DLL F;  1XSX A;  1QGP A;  3ZN0 A;  1J75 A;  2ADU A;  4X6A J;  2HYG D;  1W36 D;  1LE8 A;  4XLP F;  1W7P B;  2Y48 A;  2H1K A;  3SQN A;  2YUS A;  2K9M A;  3KP3 A;  1JUS A;  2GM4 A;  2UV1 A;  1U2W A;  2VKV A;  3HJE A;  3W6J B;  2KKO A;  2X6O A;  2QM3 A;  3GW2 A;  1SEU A;  2EIJ H;  4GFB A;  1MNE A;  4CZZ A;  1Z05 A;  4CSW A;  2MGQ A;  2ZJ2 A;  4ZTJ A;  3LSK A;  2CFO A;  2I8D A;  4CGZ A;  1R1T A;  2E7X A;  4LJZ F;  1XG1 A;  5GAD J;  3I4P A;  2A69 F;  2XHK A;  5HNF A;  1R4M B;  4BQN A;  1B9N A;  4YFN F;  2JVH A;  2LBF B;  1LNW A;  4IRG A;  1KU2 A;  3GFJ A;  4CCJ A;  2MD5 A;  2F48 A;  2FML A;  1ZHF A;  1T33 A;  1XX5 A;  3KP7 A;  1POG A;  2EH3 A;  4U0W A;  4CYD A;  4BU2 A;  3RKQ A;  5TRD A;  2VOP A;  1A6I A;  2DOA A;  3ASN H;  3BZC A;  1VQL I;  4J00 A;  2F5V A;  4KJZ A;  3LAP A;  1PP7 U;  1QZY A;  1O7F A;  2V4J C;  4Y4R A;  1ENH A;  1Y1V J;  4BS9 A;  3L2R A;  3GBG A;  3LQR A;  2L4A A;  1MMG A;  1X3Z B;  4RMN A;  3S15 J;  4MNU A;  2CW7 A;  3RIR A;  3S2D J;  4HF1 A;  2LVS A;  2WC2 A;  1B59 A;  2EFQ A;  2A5W A;  3FM3 A;  4XN3 A;  5CQG A;  3JTG A;  3MKW B;  1B1B A;  4V2F A;  1DQU A;  3LA3 A;  1T0F C;  2M8G X;  4JYK A;  5AIP A;  1TQM A;  1G3W A;  1JE8 A;  3GTL J;  2NS7 A;  4XLN F;  3SDG A;  2VLA A;  1PJR A;  3N97 A;  3HTS B;  1QRY A;  1IRX A;  2G0E A;  3BJ6 A;  3DV8 A;  3ZQ7 A;  5F1R A;  5EGO A;  2Z16 A;  4G6T B;  5KCM A;  4BYY A;  2K27 A;  2KPM A;  1AHD P;  1Z91 A;  4G6D A;  4LLG F;  2ZB9 A;  3HB9 A;  1K6O A;  5CVV A;  4IHY A;  4FX4 A;  1TWG J;  3F8C A;  2CQQ A;  3WTW C;  3O8H A;  2R5Z A;  3LWF A;  4CHU A;  3E6C C;  4OWR B;  2FXA A;  1YW7 A;  1T39 A;  2HVQ A;  2V6C A;  1WH7 A;  1AU7 A;  1EH7 A;  2XAU A;  2VT3 A;  1P6R A;  3GF2 A;  2MW8 A;  5DDG A;  2R7S A;  2LTP A;  1S3J A;  2ZME B;  4I99 C;  4LMY A;  2HOT A;  4EJV A;  5IT9 Z;  3OOP A;  4AWX B;  3A0B C;  4U7B A;  3CCR I;  4MO7 A;  1WKM A;  2KMU A;  3RI4 A;  1R1U A;  1O4X A;  1WVR A;  3WU1 B;  5D6F A;  3QPT A;  2HQR A;  3KP5 A;  2R7W A;  3CZ6 A;  4BXX J;  2M4K A;  2XGE A;  2VJ5 A;  2VT2 A;  2R92 J;  3PL8 A;  3Q0V A;  5FJ8 J;  4BDY A;  1N78 A;  2WY7 Q;  1MJB A;  2GWR A;  3SZG A;  2GXG A;  5E79 C;  4G6Q A;  3WGH A;  2BVM A;  1GV5 A;  4RM2 A;  2RC4 A;  1WSU A;  1DDN A;  3CQZ J;  3FWE A;  1R58 A;  1Z3Y A;  5AON A;  1NG7 A;  2MH2 A;  2E71 A;  5C4X J;  2DJI A;  5J40 A;  3LNQ A;  2ZXI A;  1O57 A;  4EMS A;  5GAG J;  2K7L A;  1IG7 A;  3F8F A;  4RGU A;  1V3F A;  2XAG A;  2WV0 A;  2O8K A;  1K61 A;  3DEE A;  1B6A A;  2KDZ A;  5K5R A;  4XN0 A;  5CLS A;  5DUI A;  1LPQ A;  2GA1 A;  3DTI A;  3G2B A;  3AG1 H;  4CZC A;  3J7Z I;  4OIP F;  4AID A;  2ZXH A;  4B43 A;  3CC7 I;  4UY8 I;  3D1N I;  1X1A A;  3NQO A;  3CCJ I;  3P5J A;  4M9X A;  1RPW A;  2D1H A;  2L5Q A;  1Z0X A;  3S1M J;  5C44 J;  2K9S A;  3TW7 A;  2IVM A;  3FK6 A;  2M34 A;  4HLY A;  3IRR A;  2O6G E;  1YTY A;  3OYA A;  1K78 A;  2JMW A;  2DDB A;  1XCB A;  1YS6 A;  1D1C A;  1ETV A;  4DBQ A;  2G7H A;  1APL C;  4HEA 2;  3ZMZ A;  1QBJ A;  1P2F A;  4UUS B;  2VQC A;  1ULY A;  2CUE A;  2EIK H;  2O3F A;  4KN7 X;  1RNL A;  5D4R A;  2HU9 A;  5FRN A;  3HRU A;  3WHC A;  5EZH A;  4BAY A;  3ABU A;  2X85 A;  3K69 A;  5FLX K;  5HOO A;  3DEU A;  3CP2 A;  3GXO A;  3LSI A;  4JP0 A;  3PUF A;  1LDK B;  2Z33 A;  3S93 A;  1FX7 A;  4UVA A;  4GYI A;  2CQK A;  3GUD A;  3F22 A;  1OYY A;  1JHH A;  2OV7 A;  3PM1 A;  3QWL A;  1FYM A;  5F0H A;  4RGX A;  4MTD A;  1T8I A;  4NC8 A;  3S16 J;  2LF8 A;  4MFE A;  3TKY A;  2XAS A;  2Y2Z A;  3U1K A;  1EV7 A;  4E7Z A;  3WTX C;  3RYR A;  3KLO A;  5LFA A;  3ZMT A;  1PDN C;  2M8E A;  3CUO A;  3SJM A;  5ILU A;  1N25 A;  3K4B A;  1B72 A;  2HQA A;  2FJ1 A;  4CCM A;  1VQO I;  1IRG A;  2GBY A;  4LOC A;  2RGV A;  1F9N A;  1J0R A;  1OPC A;  1SVL A;  2A6H F;  1F36 A;  2K85 A;  4QPQ A;  2ISY A;  1BR1 A;  3E6M A;  1GT0 C;  2F4I A;  5DUK A;  5ICE A;  1W0T A;  2KIS A;  4A0Z A;  4N4O B;  4IHV A;  1HKQ A;  2Z5U A;  4ESF A;  3MWM A;  5DM6 F;  4RA2 A;  2KJB A;  1GVJ A;  3CC2 I;  3REO A;  2D45 A;  3NRV A;  1SFU A;  2OPT A;  3NAU A;  2K4B A;  3K1M A;  4A3L J;  2IP2 A;  2X4H A;  3ECO A;  5E1Z B;  5IOZ A;  4C2U A;  3MFK A;  4EGZ A;  4PK4 A;  2R7Z J;  5J47 A;  1XDS A;  2LY2 A;  1KZH A;  4M3D A;  1OCP A;  3ZXS A;  5EF6 A;  2IXS A;  4M6V A;  4QIW N;  3S32 A;  1RUN A;  4ENN A;  5EEA A;  1XPX A;  2GXA A;  1WJE A;  2Z99 A;  5F64 A;  3N4M A;  4XLF A;  4JX6 A;  3O6B B;  2RNJ A;  4DIQ A;  3OMY A;  2A3S A;  3HIF A;  2W48 A;  1P7I A;  4U7D A;  1DP7 P;  5JLW A;  1R7J A;  1A31 A;  2CV1 A;  3IH2 A;  4EM0 B;  2P8T A;  4UV9 A;  5K5O A;  5D6E A;  5H20 A;  3DF8 A;  2MLK A;  3DU5 A;  2W25 A;  3OL3 A;  2IS6 A;  3CLO A;  4LG3 A;  1WJ5 A;  4UUT A;  4PZJ A;  3NWT A;  2O7O A;  2DA7 A;  1B4A A;  3OWT A;  4XKV A;  2XV4 S;  1RIO H;  2EA4 A;  1D5Y A;  1Y6I A;  1FTZ A;  3ELK A;  1MSF C;  3DU6 A;  2OJE D;  4BJ5 C;  3KP4 A;  4PGH A;  4ZYD A;  1MMA A;  3EDP A;  5FD5 A;  2UXX A;  1QZE A;  4A3B J;  2PMZ A;  4EJT A;  4RAZ A;  3JRC A;  1IDY A;  2DI3 A;  5EDN A;  1O3S A;  2CW0 F;  2JA8 J;  5B1B H;  2E1M C;  5GTI C;  2XSJ C;  3F8B A;  1ETX A;  1KQ9 A;  3ZQF A;  3M8F A;  3SYT A;  4WF2 A;  2E1M B;  2R7U A;  1TWA J;  3C18 A;  2AHQ A;  1TNS A;  2JSP A;  1X2N A;  4HYE A;  5AIQ A;  5LHI A;  2E7W A;  4Q47 A;  1MBH A;  3S14 J;  4OMY A;  2ECC A;  2KLO A;  4KDP A;  2OCE A;  4G12 A;  1RES A;  4BE0 A;  2Y31 A;  1JKQ C;  3ZR8 X;  2DA1 A;  1VQ5 I;  1IV6 A;  4G8X A;  1Z6T A;  4KFC A;  4L5E A;  3PNT A;  5FRM A;  2KP6 A;  3ERM A;  3I71 A;  3S3O A;  3S17 J;  5LHH A;  3BQZ A;  1PUE E;  4ETS A;  3G1L A;  4A69 C;  2VBW A;  2M2E A;  2Q2E A;  4WXD A;  5B3S H;  3WTS C;  3JSO A;  1NK2 P;  1V5G A;  5FFX A;  3FIS A;  3OV8 A;  1AWC A;  1LDJ A;  2GXB A;  1SC7 A;  2CQ7 A;  2LMD A;  3S8P A;  4BGD A;  2UWM A;  1BL0 A;  5J1U A;  4S0H B;  2ZSI B;  3DFG A;  1ZLK A;  4OMZ A;  2Y30 A;  3BWG A;  2CH0 A;  3HOY J;  4MEY F;  1ZGA A;  3L2U A;  3S1N J;  3SHF A;  5HS8 A;  2M45 A;  4ZJZ A;  5DCM A;  1STZ A;  2O5R A;  5KAF C;  1W36 C;  3ZRG A;  2NNY A;  4IEJ A;  4G7O F;  1D3Y A;  1LJ9 A;  3HKZ N;  1SFX A;  1YE9 A;  2P5K A;  3CTA A;  4E70 A;  1R9T J;  1L3L A;  1F4K A;  2Q0O A;  3E97 A;  2O8X A;  3A0H C;  5IPA A;  4EJW A;  4G7H F;  5FD6 A;  1WPK A;  5JR3 A;  2DMT A;  1WWX A;  1IGN A;  5LEK A;  2STW A;  1RR7 A;  3JW4 A;  2TRT A;  4DGW B;  1N75 A;  2F2E A;  2CYY A;  3LL7 A;  4IOA F;  4HW0 A;  3SZT A;  5HS9 A;  3E7L A;  3OL4 A;  2HGC A;  2PFB A;  4M6Y A;  1TTY A;  1IN5 A;  3IUO A;  3RPQ A;  2CQX A;  2Z2S B;  1DPU A;  4XNF A;  3T8T A;  2XUB A;  1Z21 A;  3OYE A;  5FGM A;  1D0Y A;  1QVU A;  5JVT A;  1QVT A;  4FHT A;  1SD4 A;  1SD6 A;  5EJC A;  3OYF A;  3DKX A;  2Y9Y A;  1DUX C;  1MSE C;  4BY1 J;  3RKX A;  4XRS G;  4KIS A;  5E1W A;  5LGT A;  3PNV A;  2QWW A;  2GOX B;  5KK1 A;  3E5Q A;  4BXU A;  5IYB J;  3CME I;  1D0X A;  4II3 A;  5EG0 A;  3H9G A;  1E2X A;  2X6W A;  1RC9 A;  2KHM A;  4Y3O A;  4B09 A;  2F5E A;  4DBR A;  4M9Z A;  4OAZ A;  5GTH C;  5D5W B;  3BTJ A;  5ICG A;  3FF5 A;  3DPT A;  1VQ8 I;  2DQR A;  2JRT A;  3JCU C;  3I4N J;  1OMI A;  2B7E A;  4ZDO A;  4XMY A;  2QF7 A;  3W2W A;  2MC3 A;  4LB6 B;  3IV5 A;  4A6D A;  2ISZ A;  1OCZ H;  5JLX A;  4KYW A;  2DTR A;  3ZPL A;  1KU9 A;  2BHZ A;  2R7D A;  5IP9 J;  3L1P A;  3Q0W A;  5EZG A;  4BBR J;  3DXJ F;  3VEP A;  4O5V A;  2FE3 A;  1KGS A;  2ZNY A;  3H35 A;  4AVZ A;  2FBI A;  4MHG A;  3MKZ A;  3F8M A;  2WWY A;  3FBI B;  2V1X A;  4M6X A;  1R71 A;  2IAI A;  2LDU A;  5E1X A;  3SEZ A;  1FBU A;  2HZD A;  3D5S C;  1WHU A;  1BI3 A;  3K4J A;  1E3P A;  1ETW A;  1S6L A;  2ELH A;  1PP8 F;  1S7O A;  2W24 A;  5ICC A;  3IH3 A;  4AYB N;  2VON A;  1BR2 A;  1XCV A;  1HCR A;  4L9N A;  1EKE A;  4JK1 X;  3OYG A;  3WGI A;  1A35 A;  1G6N A;  3RSN A;  4Y52 J;  1K4T A;  2M7B A;  1YRN A;  2WAD A;  3CJT B;  3FXJ A;  3C2G A;  1YIJ I;  4KMU X;  5BNG A;  2AXT C;  3OYB A;  2OBP A;  3G3Z A;  3HRS A;  4HQM A;  4C30 A;  5B5E C;  4A5M A;  3KPH A;  4I98 B;  3DTE A;  1P4A A;  1RZ4 A;  3HSE A;  1IJW C;  1A6Q A;  4HX8 A;  3FXO A;  4MGR A;  4CUG A;  3HOZ J;  2JJ7 A;  3R61 A;  2QLZ A;  4KT6 A;  4BEH B;  4P96 A;  4D0P A;  1OCT C;  2OZU A;  2L7F P;  2XF6 A;  4MFD A;  4E7K A;  3QP6 A;  2KL4 A;  3H3U A;  1H88 C;  2FOK A;  2NVU B;  4B1R A;  3M7G A;  1AA7 A;  2R7F A;  3IRQ A;  2V26 A;  1IW7 F;  3KEO A;  3ABK H;  2W00 A;  1W7P A;  2RN7 A;  2ZBK A;  2HXI A;  2KIQ A;  1JUP A;  3B02 A;  3BT9 A;  1ZG1 A;  5IT9 K;  5F08 A;  1BJZ A;  4I01 A;  3IAM 2;  1YJW I;  3I9V 2;  3QYF A;  1FYK A;  1SFE A;  3LOC A;  1JJ6 C;  3BTL A;  3O2P E;  3MN2 A;  4I09 A;  1QHH D;  2CFX A;  1EA3 A;  2RVC A;  2K9L A;  1YX5 A;  3J7A O;  1P4X A;  1Y8R B;  3HOT A;  2V6E A;  2E2J J;  4L0Z B;  1J59 A;  3OYM A;  3V8L A;  2CMP A;  4CH7 A;  4Q48 A;  1L0O C;  4KA4 A;  5JVG F;  3L09 A;  4B44 A;  2KIF A;  5E8I A;  3G6E I;  2Z9O A;  3FHN A;  5J4Y A;  4LLL A;  5C3E J;  2RRE A;  2HVR A;  2VAS A;  3OSF A;  4LD5 A;  4Y13 A;  2DO7 A;  1LUJ B;  1J09 A;  5LRS A;  1MIJ A;  3WG9 A;  4NC6 A;  4BAC A;  3PO2 J;  3CCU I;  3OS2 A;  4XQF A;  1S7E A;  1NK3 P;  3P7N A;  3A01 B;  1WJF A;  4I76 A;  2NRA C;  4XM3 A;  3W2A A;  4KMF A;  4Y7N J;  2VE8 A;  1S5L C;  3BG7 A;  2QVO A;  2XRO A;  1MZB A;  3GWZ A;  5CVR A;  1YX3 A;  5LBQ A;  2FRH A;  2EV6 A;  2JQ7 A;  1ZKG A;  4G94 A;  3ABM H;  4ZDP A;  5HDN A;  4UUV A;  1GUU A;  2LD5 A;  2EZL A;  5ILS A;  4P1W A;  1FLI A;  2IGO A;  4PJM A;  2LP0 A;  3A03 A;  4AIK A;  2CQN A;  2UZK A;  5L3D A;  1S8N A;  4WXH A;  2K9Q A;  4BJ6 C;  3L2Q A;  2WV1 A;  5DD8 A;  1ERD A;  1Z3X A;  4W1U A;  2HTS A;  4HAM A;  2YU9 J;  1UB9 A;  1S29 A;  4M72 A;  5F27 A;  4G9Y A;  2ELK A;  4U0Y A;  1DGW Y;  3TQN A;  3TED A;  2NOJ B;  3HOX J;  4BQA A;  2R7T A;  3N05 A;  1HW2 A;  1LQ1 A;  1U5T C;  1Y8Q B;  4AC0 A;  3S2H J;  4UV8 A;  3K4K A;  2CV2 A;  2ZME A;  2F4O B;  1ZAO A;  3TGN A;  3CCM I;  1GDT A;  3I3L A;  1PYV A;  4Y15 A;  1P9Q C;  2VJ4 A;  1U5T B;  4XL9 A;  5LEJ A;  1JGS A;  3EUK L;  2RDP A;  4FE7 A;  3J81 K;  2YX7 A;  1RUO A;  2JTV A;  4NC7 A;  4HX4 A;  4V19 K;  1DU6 A;  1MBG A;  4A3C J;  1SD7 A;  5FKN A;  2BBY A;  3BJO A;  3TOA A;  1C0W A;  3LAJ A;  2EIN H;  1VF9 A;  2HYF A;  3WU0 A;  4EQQ A;  3I56 I;  1GXQ A;  1RET A;  4KIB A;  2M7A A;  3KZY A;  4OIN F;  3WE2 A;  3OS0 A;  2QSH X;  2L2O A;  2BYV E;  4IJA A;  1O7L A;  2R5Y B;  3TBI A;  3DPU A;  1UHM A;  2R4G A;  2XVC A;  3K2A A;  4CCL A;  2CUF A;  2LC2 A;  3BR5 A;  3ML6 A;  3EYI A;  1W1W E;  2H8W A;  4ANJ A;  3HOU J;  3DWL E;  3RPU D;  3ZMS A;  1YIO A;  2LK2 A;  5L3C A;  4NUB A;  5M3F J;  4ZH4 F;  1T2K A;  1ZRF A;  4RB2 C;  1RKW A;  3I53 A;  2VPL A;  2E1C A;  1SAN A;  3LA7 A;  3HRT A;  2VJI A;  3K7A J;  1DGR M;  3HUG B;  4DZJ A;  2DMN A;  5E8G A;  5DS9 A;  5IT3 A;  3AG4 H;  1HF0 A;  3GTQ J;  2DN0 A;  5F0C A;  4M3F A;  4E7L A;  1ZG3 A;  3BPV A;  1MH3 A;  3WTY C;  1HLV A;  1ETY A;  3OIO A;  3ERE D;  4AIJ A;  2D1V A;  3K0L A;  3F23 A;  3CDI A;  5BS6 A;  2L9V A;  4A3I J;  3MZH A;  1Z7L A;  2VI6 A;  2COM A;  3K4N A;  1RKT A;  2Z3Y A;  4OOI A;  2M9H A;  4UUS A;  3M4O J;  2VQL A;  3WOD F;  3FXR A;  1BI1 A;  3A02 A;  4HV6 A;  2BV6 A;  5F04 A;  3K4M A;  2I5U A;  1QO0 D;  4WK8 F;  5K5Q A;  4FT8 A;  2M0M A;  3VPR A;  2JSC A;  2VOO A;  3MVP A;  1W5C C;  1OCO H;  3E1S A;  5FRO A;  1LKX A;  3I64 A;  4HZF A;  4PFO A;  4FIS A;  4QSH A;  1VQP I;  3GVA A;  4N9I A;  2DA3 A;  5DTD A;  2MG4 A;  3E6D A;  4XOT A;  1KA8 A;  3EQL F;  3LMM A;  1QHG A;  3DBL B;  3ISP A;  1QA6 A;  3GLL A;  1VND A;  4IX7 A;  1ACI A;  1YW8 A;  4C3H J;  1T56 A;  2D5V A;  2WA0 A;  1MDM B;  2M5W A;  2F5F A;  3P9K A;  1IC8 A;  2WAF A;  3VYS B;  1XDU A;  4RAF A;  2DMQ A;  4KN4 X;  4JQF A;  4UHT A;  1YIT I;  2X9D A;  3OYH A;  1K6Y A;  3A4C A;  3KYD B;  3Q9V A;  3V7C A;  3AAF A;  2QA4 I;  3IWZ A;  1LFU P;  2TDX A;  3IWF A;  2H27 A;  4NDL A;  3FXQ A;  3VSL A;  2W57 A;  3KE2 A;  4QLC U;  2VBY A;  1T08 B;  2V7F A;  5GPA A;  3JTH A;  1U9N A;  2E1O A;  2OQR A;  4L9V A;  4I2O A;  4A3D J;  5FKK A;  3BG9 A;  2E19 A;  3IP4 B;  3VB2 A;  3AG2 H;  3DP7 A;  4P5O A;  3FXK A;  4EM2 A;  2OC6 A;  2HKO A;  2ZJP F;  4TV7 A;  1XMA A;  2H94 A;  3H3Z A;  3FXU A;  2LY1 A;  4WXC A;  3HOV J;  1VFC A;  3I0T A;  2R7X A;  1VQK I;  3VWB A;  1TNT A;  1I27 A;  1B8I B;  1Q1V A;  2GIZ A;  1TQP A;  2VB6 A;  4YEL A;  3GO5 A;  2R0Q C;  2ID3 A;  2GIV A;  2M3A A;  1WRJ A;  5F0F A;  4UB6 C;  2DMU A;  3FM5 A;  4IZZ A;  2LF7 A;  4YEJ A;  4E7I A;  5FKM A;  2K5C A;  1G59 A;  1CF7 B;  1LFB A;  1HDP A;  4OAY A;  1X4P A;  3BR2 A;  2OTJ I;  3H1C A;  1F1Z A;  3QQA A;  2K40 A;  4E6K G;  2CJJ A;  4DNC A;  2Z1D A;  2R3S A;  4XON A;  5IYD J;  4CA0 A;  3FXM A;  2KIM A;  4C9Y A;  2E5N A;  3ZQC A;  1X2M A;  3QU3 A;  2EZH A;  2QKL B;  5DM7 F;  5D4S A;  5FB2 A;  3LFU A;  1CQT A;  3V42 A;  1TQI A;  1KYZ A;  1OLT A;  1MGT A;  1IXR C;  2CV0 A;  3TDU C;  2D2W A;  1ON2 A;  1HST A;  1TBX A;  3DKY A;  2LFB A;  2OAZ A;  3CDH A;  3I4M J;  2BW3 B;  2IRF G;  3CO7 C;  3OS1 A;  3QRF F;  4DW6 A;  1F5T A;  2IW5 A;  1LVK A;  2L7K A;  3C3W A;  4MQ9 F;  2XAF A;  3DBR B;  4QTR A;  3K9T A;  2VUM J;  2R7O A;  2V1N A;  5HLI A;  1ORK A;  4HG2 A;  2JA5 J;  3LSP A;  3OR1 C;  4I0A A;  1SD5 A;  2VBX A;  4BUP A;  3D5L A;  1MBE A;  2V1U A;  2BZT A;  3DEW A;  6PAX A;  1DU0 A;  2X48 A;  1YO5 C;  2K9N A;  1YOV B;  4NQW B;  2VXZ A;  2XGD A;  4XLC A;  1UAA A;  2FMY A;  2VQH A;  2NS8 A;  3MCZ A;  1EH6 A;  3IHU A;  4FX0 A;  4HST A;  1XMK A;  5CVU A;  4BHP A;  5IYC J;  1SAX A;  5LRR A;  2JZY A;  5CKT A;  4F52 A;  2FUG 2;  1O3R A;  2HKX A;  4RM3 A;  5K1Y A;  3BPX A;  2CGP A;  3R4K A;  1X1C A;  3TW6 A;  3J80 Z;  4PSW A;  3E5X A;  1K4S A;  1XS9 A;  3F9K A;  1P4W A;  1ZH5 A;  2VE9 A;  2KRH A;  4NNJ A;  4W97 A;  3HPG A;  4EV0 A;  4EAT A;  2DU9 A;  2X1E A;  2M87 A;  3F8N A;  1IV8 A;  5F1J A;  1OJL A;  4B3A A;  4AUX A;  3BG3 A;  1IXC A;  2DPD A;  2K3F A;  1RI7 A;  3BR6 A;  3O3K A;  5CVI A;  2DFE A;  2JUG A;  1O3T A;  3E0J B;  1GVD A;  2RQP A;  2OU2 A;  2MLG A;  1IO2 A;  2H6B A;  2IS4 A;  1X58 A;  4RB1 A;  4PJ0 C;  1VQ7 I;  2QBY B;  1Q1H A;  1R6R A;  1MD0 A;  1VQM I;  5GP9 A;  3V7S A;  5ICF A;  3X2Q H;  4LGW A;  1OIS A;  1MND A;  2NVQ J;  3D5R C;  3BCA A;  3GZN B;  3V8K A;  3JRI A;  2Y0S N;  3BQY A;  4D7N A;  1ZRE A;  2LRE A;  1FT9 A;  2EJR A;  3H36 A;  1D1B A;  1DPR A;  3RYP A;  2BXY A;  2O0Y A;  3KZZ A;  4G7Z F;  1A36 A;  2H6C A;  4DYR A;  3TO6 A;  1BI0 A;  3CDL A;  4QPO A;  4A3K J;  2DOD A;  2ME0 A;  2PMU A;  2JVG A;  1UJ8 A;  3ECH A;  3GFI A;  1E3O C;  3BRO A;  1IN6 A;  1U78 A; 
#chains in the Genus database with same CATH homology
 1EH8 A;  4BHC A;  2IA2 A;  2A5Y B;  4A6E A;  1ZG5 A;  1E17 A;  1KQ0 A;  2FBH A;  3R6S A;  2P7C B;  2NAZ A;  4CO8 A;  1D5V A;  4XSX F;  4LB5 A;  2EFN A;  2V9V A;  4R1H A;  2ZO4 A;  2VBZ A;  1H9T A;  3HTU A;  1VTN C;  3WTZ A;  3I59 B;  4QWQ A;  1Z9C A;  2VC0 A;  1HW1 A;  2JPB A;  5BPD A;  3TO7 A;  3KP6 A;  1UHW A;  3E6B A;  1HKT A;  4R8H A;  5FLX Z;  1BBY A;  2OA4 A;  3QP5 A;  5HDK A;  4N9H A;  1D8J A;  2FEZ A;  5D5X B;  3ZP5 A;  3CUQ C;  2ACJ A;  2RV8 A;  3ZMU A;  3CUQ B;  5ED4 A;  3E5U A;  4RGR A;  4IRH A;  3WTU C;  5A2Q Z;  1MKM A;  3M9A A;  3U1D A;  5LHG A;  2MA3 A;  5ERI A;  1I6X A;  3CJN A;  3B73 A;  3QU6 A;  4EJO A;  4UVC A;  4IPA A;  2HR3 A;  3EET A;  4DQ2 A;  1R00 A;  1UCR A;  1S7A A;  5DV5 A;  4BH9 A;  1BIB A;  5BQT A;  5L3G A;  3E3V A;  1YFH A;  2A68 F;  4MQV A;  2CWE A;  3HHG A;  1KU7 A;  5BOX A;  3QAH A;  4P9F A;  2AXL A;  1LB2 A;  4HLX A;  2ZFW A;  5H6Q A;  4BNC A;  5EEG A;  4L0Y B;  5HVQ C;  1J7K A;  3L2C A;  4WWC A;  3MAJ A;  2P7V B;  3M1E A;  5D5V B;  1XGN A;  3SZP A;  3C1D A;  3PQJ A;  3P9C A;  4CIC A;  3ULQ B;  2QUF A;  4KIG A;  2XIG A;  3KFW X;  2PN6 A;  2BEO A;  2VC1 A;  4LFU A;  1XGM A;  1QPM A;  2RKH A;  1R23 A;  3DKW A;  1GHC A;  4HV5 A;  2PJP A;  3NEU A;  2DFI A;  1FP2 A;  4M71 A;  1G3T A;  4Q4Z F;  1ZYR F;  2QQB A;  3RKW A;  1U3E M;  3IKV A;  1QNT A;  2K4J A;  2NNN A;  3T1B A;  4ZYE A;  3RTR A;  3GZ5 A;  5L3F A;  1JXS A;  4OIR F;  3F21 A;  3ZN1 A;  4JBA A;  4MTE A;  2W84 A;  4IVN A;  1BC7 C;  2A6E F;  5DD4 A;  5D8L B;  4ESJ A;  3CO6 C;  3TO9 A;  4IHT A;  1QQI A;  3KET A;  1H0M A;  2FNP A;  4KIC A;  4A0X A;  2IA0 A;  4IRI A;  2CSO A;  4Q5S F;  3R0A A;  4ENJ A;  1IRF A;  1ZLJ A;  3KCC A;  4CDG A;  1Z6R A;  3VOD A;  3GX4 X;  4N0B A;  2M1B A;  3T8R A;  4UVB A;  4A5N A;  2OD5 A;  1OYI A;  3BJA A;  1OKR A;  4F7Z A;  2L4M A;  5J8F A;  2YSR A;  4A12 A;  4RB3 C;  3HOS A;  1QZZ A;  2KRF A;  3TDZ C;  1XGO A;  4ESB A;  1IN7 A;  1YQA A;  3L9F A;  3V8J A;  4PCQ A;  3QOP A;  1U5T A;  2EV5 A;  4GCV A;  5L3E A;  2GA2 A;  4XRF A;  5HDG A;  1REP C;  3R60 A;  2FU4 A;  2V79 A;  2HS5 A;  2L01 A;  4YIF A;  3R0J A;  3HSF A;  2BE5 F;  3MEX A;  5LGN A;  1IN4 A;  1T0F A;  2XGX A;  2ESN A;  1XN7 A;  1KU3 A;  1BJA A;  2DW4 A;  3EYY A;  1R5H A;  1FP1 D;  2YX4 A;  2IA1 A;  4YG2 F;  1IF1 A;  3HUG A;  4M9S A;  4OIQ F;  2Y0M A;  3BDD A;  1FZP B;  1FYL A;  4IHS A;  3PQK A;  1UST A;  2B0L A;  1BIA A;  2J5O A;  3IKT A;  1FPQ A;  1BC8 C;  2EA2 A;  4L5I A;  4PDK A;  5JI6 A;  4EM1 A;  1YW9 A;  2A07 F;  2ESH A;  2HWV A;  1KYW A;  4LG0 B;  1G3Y A;  1YG2 A;  1HKS A;  3V4G A;  3MZY A;  3L00 A;  1MDM A;  2CO5 A;  2XRN A;  4XSZ F;  3KP2 A;  3JAM Z;  2AS5 F;  4P9U A;  2Q8K A;  2PLY A;  1FSE A;  2ZKZ A;  5J8C A;  2KJC A;  5JHU A;  3J80 K;  1GXP A;  4S04 A;  5FO5 A;  4OIO F;  1X3U A;  1WI9 A;  1NHA A;  1LEA A;  2WTE A;  1ZRD A;  2X0L A;  3GYH X;  1HQC A;  1YLF A;  1Z1D A;  3GFM A;  4O3M A;  3RJP A;  2NS0 A;  4P55 A;  4XBF A;  1T98 A;  2JT1 A;  2GZW A;  1ZRC A;  3F72 A;  2XKO A;  5H6R A;  1U6G A;  2XKP A;  2CG4 A;  4AD9 A;  4HDV A;  1K79 A;  3P9I A;  3QPH A;  1IN8 A;  4M74 A;  2H09 A;  4HQE A;  1CF7 A;  3F3X A;  2YR2 A;  4ENK A;  4HBL A;  1P92 A;  2PMH A;  4R79 A;  1UFM A;  2FNA A;  1OYW A;  3T5X A;  2Y75 A;  3BZ6 A;  5LLQ A;  2DK5 A;  3K1P A;  2LNB A;  2A61 A;  2HQN A;  4I0B A;  4RGS A;  1W4M A;  2EWN A;  4NQW A;  4ON0 A;  5CYV A;  2STT A;  4KUM A;  2HOE A;  3WE3 A;  2VOD A;  3U9G A;  4CXF A;  2M30 A;  3F6V A;  3BOQ A;  2IT0 A;  2K02 A;  1U8R A;  3LST A;  1BOA A;  3L7W A;  5HLG A;  2QQ9 A;  4AIH A;  1BI2 A;  3IL2 A;  1AOY A;  4HF2 A;  1FBS A;  3COA C;  5L3B A;  1K7A A;  1Y0U A;  5JFR A;  2P5V A;  3I58 A;  3GLX A;  2QBY A;  3VOE A;  1W7P D;  3ABT A;  1HW5 A;  1TW2 A;  4HF0 A;  5A2Q K;  4EVI A;  3J81 Z;  2XAQ A;  2DLL A;  3K1N A;  5D5U B;  2DAO A;  1I1G A;  4ZYG A;  2PI0 A;  3U2R A;  3TOB A;  4NB5 A;  1Z7U A;  4EJU A;  4RAY A;  2ZCW A;  5E20 A;  3HHH A;  1G3S A;  1K78 B;  3ZMV A;  4GXO A;  4BHB A;  2HDC A;  4L5J A;  2QZ8 A;  2HTJ A;  3MQ0 A;  2K86 A;  1IUY A;  4L9J A;  2FF4 A;  3FMS A;  4NHJ A;  2L3D A;  5D8K B;  1SMT A;  4Z2Y A;  3GZ6 A;  5HLH A;  1FBQ A;  4ASN A;  5HS7 A;  5BPI A;  1LVA A;  1IXS B;  4WX9 A;  3RDI A;  2ZXJ A;  3I59 A;  1W5S A;  2EFW A;  3HSR A;  4A0Y A;  4RS8 A;  1H9G A;  1YS7 A;  2MBF A;  5DEQ A;  2V1D A;  4O6J A;  1R36 A;  1TW3 A;  2HZT A;  1A04 A;  1XSV A;  4YFX F;  3BP8 A;  4I02 A;  1J9I A;  4L18 B;  3W6K B;  1J2X A;  2QQA A;  2P4W A;  4AVP A;  3I54 A;  4ZZD A;  1LEB A;  3CUQ A;  5F6F A;  2FBK A;  4I7H A;  1ON1 A;  2DBB A;  1ZN2 A;  4EGY A;  1CGP A;  3M8E A;  4B8X A;  2C6Y A;  2EFO A;  4KT5 C;  1BN5 A;  1R22 A;  5EEH A;  1USS A;  1FC3 A;  2XAJ A;  2OQG A;  3Q5F A;  2HEO A;  3KLN A;  1V4R A;  4ZYH A;  1ZAR A;  2P6S A;  1XB4 A;  4HX7 A;  3WTT C;  1R1V A;  3IC7 A;  2ZNZ A;  3I5U A;  2ETH A;  1HSJ A;  2FSW A;  1I1S A;  2UXN A;  5CVJ A;  3RKY A;  2P5L C;  4IXA A;  4RB0 A;  4WCG A;  4UXN A;  1SMY F;  1MJ9 A;  3KEQ A;  4YFK F;  2YU3 A;  3LA2 A;  3FZV A;  2PEX A;  4H0E A;  2O61 A;  4ENM A;  4OU0 A;  5FFZ A;  4HA8 A;  4A2U A;  2PBI A;  2EV0 A;  2GAU A;  3GEZ A;  4YII A;  3RPU A;  4L9T A;  1ODD A;  5CJ9 A;  3EUH A;  3FX3 A;  2XAH A;  1W5T A;  1ZGJ A;  1IZ1 A;  1R5G A;  5LGU A;  1FSH A;  2MH9 A;  3F6O A;  1T6S A;  5DCF A;  1G4D A;  1JHF A;  2QEN A;  2DPU A;  3BY6 A;  1BM9 A;  2EB7 A;  2IPQ X;  4KNY A;  3GFL A;  5DYM A;  4U88 A;  2L54 A;  3FHZ A;  4GGG A;  2O03 A;  3V7R A;  5E18 F;  2YPR A;  1WQ2 A;  2OZ6 A;  3VFZ A;  3LQQ A;  1B9M A;  3SFZ A;  4U0V A;  5J6X A;  2KIU A;  3D0S A;  4PGG A;  3S2W A;  3ZMD A;  3FMQ A;  4M73 A;  3HRM A;  1ONV A;  2G7U A;  3WTV C;  5ILV A;  5DCM B;  4GYG A;  1OR7 A;  2VN2 A;  3C7J A;  1T38 A;  2P6T A;  1FY7 A;  3K2Z A;  3WGG A;  1YYV A;  4HDU A;  2L02 A;  3SXY A;  2IJL A;  2W85 A;  4LLN A;  2JPC A;  4LK1 F;  2DT5 A;  1IAW A;  1FWZ A;  3JAM K;  2F5C A;  1FOK A;  1D8K A;  2QYO A;  2DQL A;  3ROU A;  3Q9S A;  5BMZ A;  1TLH B;  2J5P A;  2FA5 A;  2LSO A;  4K2E A;  3FMR A;  5E17 F;  3JSP A;  1XSD A;  2GQQ A;  4IF4 A;  1I5Z A;  2F5D A;  3LFK A;  4UNO A;  4GO1 A;  1HBX G;  1HXD A;  4ZZL A;  1XGS A;  2DK8 A;  2PG4 A;  1KQ8 A;  3DQV C;  3T0Y A;  2HFH A;  1MJA A;  2EK5 A;  2LKP A;  3HYI A;  5TJJ A;  2NYX A;  4Y17 A;  3DPL C;  5KVR A;  2E1N A;  1XD7 A;  3G73 A;  2G9W A;  3H92 A;  4LG0 A;  1FNN A;  4MEX F;  1J5Y A;  2PQ8 A;  4LK0 F;  2BGC A;  4HOB A;  4KIF A;  4S05 A;  2EFP A;  2FQ3 A;  1LDD A;  3PFI A;  1O3Q A;  1XSX A;  1QGP A;  3ZN0 A;  1J75 A;  2ADU A;  2HYG D;  4XLP F;  1W7P B;  2Y48 A;  3SQN A;  3KP3 A;  1U2W A;  3W6J B;  2KKO A;  3GW2 A;  2QM3 A;  4CZZ A;  1Z05 A;  2ZJ2 A;  4CGZ A;  1R1T A;  2E7X A;  4LJZ F;  3I4P A;  2A69 F;  2XHK A;  1B9N A;  4YFN F;  1LNW A;  4IRG A;  1KU2 A;  3GFJ A;  2MD5 A;  2FML A;  1ZHF A;  3KP7 A;  4U0W A;  4CYD A;  5TRD A;  2VOP A;  3LAP A;  1PP7 U;  1QZY A;  1O7F A;  3LQR A;  2L4A A;  4MNU A;  3RIR A;  4HF1 A;  2WC2 A;  1B59 A;  2EFQ A;  3FM3 A;  3JTG A;  1B1B A;  3LA3 A;  5AIP A;  1TQM A;  1G3W A;  1JE8 A;  4XLN F;  3N97 A;  3HTS B;  3DV8 A;  3BJ6 A;  5F1R A;  3ZQ7 A;  4BYY A;  2K27 A;  1Z91 A;  4G6D A;  4LLG F;  1K6O A;  5CVV A;  4FX4 A;  3F8C A;  3WTW C;  3LWF A;  4CHU A;  3E6C C;  2FXA A;  1YW7 A;  1T39 A;  2V6C A;  1EH7 A;  2VT3 A;  1P6R A;  3GF2 A;  5DDG A;  1S3J A;  2ZME B;  4LMY A;  4EJV A;  5IT9 Z;  3OOP A;  4AWX B;  4U7B A;  1WKM A;  3RI4 A;  1R1U A;  3WU1 B;  5D6F A;  3QPT A;  2HQR A;  3KP5 A;  2VT2 A;  1MJB A;  2GWR A;  2GXG A;  3WGH A;  4G6Q A;  2RC4 A;  1WSU A;  1DDN A;  3FWE A;  1R58 A;  5AON A;  2MH2 A;  1O57 A;  4EMS A;  2K7L A;  3F8F A;  4RGU A;  1V3F A;  2XAG A;  2WV0 A;  1B6A A;  5K5R A;  5CLS A;  5DUI A;  2GA1 A;  4OIP F;  3NQO A;  4M9X A;  2D1H A;  2IVM A;  4HLY A;  3IRR A;  2O6G E;  1YTY A;  1K78 A;  1XCB A;  1YS6 A;  2G7H A;  3ZMZ A;  1QBJ A;  1P2F A;  1ULY A;  2O3F A;  4KN7 X;  5D4R A;  1RNL A;  3HRU A;  4BAY A;  3ABU A;  3K69 A;  5FLX K;  5HOO A;  3DEU A;  3GXO A;  1LDK B;  2Z33 A;  1FX7 A;  4UVA A;  4GYI A;  2CQK A;  3GUD A;  3F22 A;  1OYY A;  1JHH A;  1FYM A;  4RGX A;  4MTD A;  2LF8 A;  3TKY A;  2XAS A;  1EV7 A;  3WTX C;  3RYR A;  3KLO A;  1PDN C;  3ZMT A;  2M8E A;  3CUO A;  5ILU A;  1IRG A;  2RGV A;  1F9N A;  1J0R A;  1OPC A;  2A6H F;  2ISY A;  3E6M A;  5DUK A;  5ICE A;  4A0Z A;  1HKQ A;  2Z5U A;  4ESF A;  3MWM A;  2KJB A;  1GVJ A;  3REO A;  2D45 A;  3NRV A;  1SFU A;  2K4B A;  3K1M A;  2IP2 A;  2X4H A;  3ECO A;  5E1Z B;  3MFK A;  4EGZ A;  1XDS A;  1RUN A;  4ENN A;  2Z99 A;  5F64 A;  3N4M A;  3O6B B;  2RNJ A;  2A3S A;  3HIF A;  4U7D A;  1DP7 P;  1R7J A;  4EM0 B;  2P8T A;  4UV9 A;  5K5O A;  5D6E A;  5H20 A;  3DF8 A;  2MLK A;  2W25 A;  3CLO A;  4PZJ A;  1B4A A;  1RIO H;  2XV4 S;  2EA4 A;  3ELK A;  3KP4 A;  4PGH A;  4ZYD A;  3EDP A;  5FD5 A;  2UXX A;  4EJT A;  4RAZ A;  2DI3 A;  1O3S A;  2CW0 F;  3F8B A;  1KQ9 A;  3M8F A;  4WF2 A;  3C18 A;  1TNS A;  4HYE A;  5AIQ A;  5LHI A;  2E7W A;  4Q47 A;  4OMY A;  4KDP A;  4G8X A;  1Z6T A;  4KFC A;  3I71 A;  5LHH A;  1PUE E;  4ETS A;  2VBW A;  2Q2E A;  4WXD A;  3WTS C;  3JSO A;  5FFX A;  3OV8 A;  1AWC A;  1LDJ A;  2GXB A;  2UWM A;  3DFG A;  1ZLK A;  4OMZ A;  3BWG A;  4MEY F;  1ZGA A;  3SHF A;  5HS8 A;  2M45 A;  5DCM A;  1STZ A;  2NNY A;  4G7O F;  1D3Y A;  1LJ9 A;  1SFX A;  2P5K A;  3CTA A;  4E70 A;  1L3L A;  1F4K A;  2Q0O A;  3E97 A;  2O8X A;  4EJW A;  4G7H F;  5FD6 A;  5JR3 A;  1WWX A;  5LEK A;  2STW A;  3JW4 A;  2F2E A;  2CYY A;  4HW0 A;  3SZT A;  5HS9 A;  2HGC A;  2PFB A;  4M6Y A;  1TTY A;  1IN5 A;  3RPQ A;  1DPU A;  3T8T A;  2XUB A;  5FGM A;  5JVT A;  4FHT A;  1SD4 A;  1SD6 A;  1DUX C;  3RKX A;  5E1W A;  5LGT A;  2QWW A;  5KK1 A;  3E5Q A;  4BXU A;  1E2X A;  4B09 A;  2F5E A;  4M9Z A;  5D5W B;  5ICG A;  3FF5 A;  3DPT A;  2DQR A;  2JRT A;  1OMI A;  2MC3 A;  4LB6 B;  4A6D A;  2ISZ A;  4KYW A;  2DTR A;  3ZPL A;  1KU9 A;  2R7D A;  3DXJ F;  3VEP A;  4O5V A;  2FE3 A;  1KGS A;  2ZNY A;  2FBI A;  4MHG A;  3F8M A;  2WWY A;  2V1X A;  4M6X A;  2LDU A;  5E1X A;  1FBU A;  1BI3 A;  1S6L A;  2ELH A;  1PP8 F;  1S7O A;  2W24 A;  5ICC A;  2VON A;  1XCV A;  4L9N A;  4JK1 X;  3WGI A;  1G6N A;  4KMU X;  2OBP A;  3G3Z A;  3HRS A;  4HQM A;  4A5M A;  4I98 B;  1P4A A;  1RZ4 A;  3HSE A;  4HX8 A;  4MGR A;  3R61 A;  2QLZ A;  4P96 A;  4D0P A;  2OZU A;  3QP6 A;  3H3U A;  2FOK A;  3M7G A;  2R7F A;  3IRQ A;  1IW7 F;  3KEO A;  1W7P A;  2RN7 A;  2ZBK A;  3B02 A;  5IT9 K;  1ZG1 A;  4I01 A;  1FYK A;  1SFE A;  3O2P E;  4I09 A;  2CFX A;  2RVC A;  3J7A O;  1P4X A;  3HOT A;  4L0Z B;  1J59 A;  3V8L A;  4Q48 A;  1L0O C;  4KA4 A;  3L09 A;  2KIF A;  5E8I A;  2Z9O A;  4LLL A;  4LD5 A;  4Y13 A;  2DO7 A;  5LRS A;  3WG9 A;  3P7N A;  2NRA C;  4KMF A;  2VE8 A;  2XRO A;  2QVO A;  1MZB A;  3GWZ A;  5CVR A;  5LBQ A;  2FRH A;  2EV6 A;  4G94 A;  5HDN A;  4UUV A;  1FLI A;  5ILS A;  4AIK A;  2UZK A;  5L3D A;  1S8N A;  4WXH A;  5DD8 A;  2HTS A;  4HAM A;  1UB9 A;  1S29 A;  4M72 A;  4G9Y A;  4U0Y A;  3TQN A;  4BQA A;  1HW2 A;  1LQ1 A;  1U5T C;  4UV8 A;  2ZME A;  3TGN A;  1ZAO A;  4Y15 A;  1U5T B;  5LEJ A;  1JGS A;  3J81 K;  2RDP A;  2YX7 A;  1RUO A;  2JTV A;  4HX4 A;  1SD7 A;  2BBY A;  3BJO A;  3TOA A;  1C0W A;  3LAJ A;  2HYF A;  3WU0 A;  4EQQ A;  1GXQ A;  4KIB A;  4OIN F;  3KZY A;  3WE2 A;  2BYV E;  4IJA A;  1O7L A;  1UHM A;  2XVC A;  3ML6 A;  3EYI A;  3ZMS A;  1YIO A;  5L3C A;  1T2K A;  4ZH4 F;  1ZRF A;  4RB2 C;  3I53 A;  2E1C A;  3LA7 A;  3HRT A;  5E8G A;  5IT3 A;  1ZG3 A;  3BPV A;  3WTY C;  3ERE D;  4AIJ A;  2D1V A;  3K0L A;  3F23 A;  5BS6 A;  3MZH A;  2COM A;  2Z3Y A;  4OOI A;  3WOD F;  3FXR A;  1BI1 A;  4HV6 A;  2BV6 A;  1QO0 D;  4WK8 F;  5K5Q A;  4FT8 A;  2JSC A;  2VOO A;  3I64 A;  4HZF A;  3GVA A;  4N9I A;  3E6D A;  1KA8 A;  3EQL F;  3ISP A;  1YW8 A;  1MDM B;  2M5W A;  2F5F A;  3P9K A;  1XDU A;  4KN4 X;  4JQF A;  4UHT A;  3Q9V A;  3AAF A;  3V7C A;  3IWZ A;  2TDX A;  3IWF A;  2H27 A;  3FXQ A;  2W57 A;  3KE2 A;  4QLC U;  2VBY A;  3JTH A;  4I2O A;  2OQR A;  4L9V A;  3VB2 A;  3DP7 A;  4P5O A;  4EM2 A;  2HKO A;  4TV7 A;  1XMA A;  2H94 A;  3H3Z A;  3FXU A;  4WXC A;  3I0T A;  1TNT A;  1I27 A;  1TQP A;  3GO5 A;  2GIV A;  1WRJ A;  3FM5 A;  2LF7 A;  1CF7 B;  1F1Z A;  4DNC A;  2R3S A;  2KIM A;  3QU3 A;  5D4S A;  5FB2 A;  1TQI A;  1KYZ A;  1MGT A;  1IXR C;  3TDU C;  2D2W A;  1ON2 A;  1HST A;  1TBX A;  2OAZ A;  3CDH A;  2IRF G;  3CO7 C;  3QRF F;  1F5T A;  2IW5 A;  3C3W A;  4MQ9 F;  2XAF A;  3K9T A;  5HLI A;  4I0A A;  1SD5 A;  2VBX A;  3D5L A;  2V1U A;  6PAX A;  1YO5 C;  2VXZ A;  2FMY A;  3MCZ A;  5CVU A;  1EH6 A;  3IHU A;  4FX0 A;  4BHP A;  1XMK A;  1SAX A;  5LRR A;  2JZY A;  1O3R A;  2HKX A;  5K1Y A;  3BPX A;  2CGP A;  3R4K A;  3J80 Z;  3E5X A;  1P4W A;  1ZH5 A;  2VE9 A;  4EV0 A;  2DU9 A;  2M87 A;  3F8N A;  1IXC A;  2DPD A;  1RI7 A;  3O3K A;  5CVI A;  1O3T A;  2RQP A;  2OU2 A;  2MLG A;  2H6B A;  4RB1 A;  2QBY B;  1Q1H A;  1MD0 A;  3V7S A;  5ICF A;  4LGW A;  3V8K A;  1ZRE A;  1FT9 A;  2EJR A;  1DPR A;  3RYP A;  4G7Z F;  2O0Y A;  3KZZ A;  2H6C A;  3TO6 A;  1BI0 A;  2PMU A;  3ECH A;  3GFI A;  3BRO A;  1IN6 A;  1U78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...