5DD8A

The crystal structure of hucr mutant (hucr-e48q) from deinococcus radiodurans
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
156
Chain Sequence
DTAALLERIRSDWARLNHGPSAGPMLTLLLLQRLHAALGREIERTYAASGLNAAGWDLLLTLYRSAPPEGLRPTELSALAAISGPSTSNRIVRLLEKGLIERREASIRLTPQGRALVTHLLPAHLATTQRVLAPLSAQEQRTLEELAGRMLAGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title Histidine switch controlling pH-dependent protein folding and DNA binding in a transcription factor at the core of synthetic network devices.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transcription regulator
total genus 53
structure length 156
sequence length 172
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12802 MarR_2 MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dd8A00
2DPUA 4OINF 2DW4A 4BQAA 2DAOA 4IHTA 3KCCA 3ZMTA 1YTYA 4GXOA 4P5OA 3E6DA 1XSDA 1BBYA 2MA3A 4WX9A 3U2RA 2H27A 1U5TB 1FLIA 4KIFA 2A6EF 3IRQA 2LKPA 4G9YA 1IN8A 4P96A 1UCRA 3BP8A 1TLHB 2NS0A 5AIPA 3QU3A 3H3ZA 4KA4A 1T98A 3T8RA 5A2QK 1SAXA 4XSXF 5JFRA 3K9TA 2FBHA 3FX3A 4L9VA 3R0AA 3GF2A 3KP5A 2VONA 4M6YA 1I27A 4GYIA 5E1ZB 1TQPA 5D6FA 3PFIA 1F1ZA 1RZ4A 2EV0A 2QZ8A 2Y48A 2M87A 4RGXA 2XAQA 2F5EA 4IRGA 2GWRA 4XSZF 3DFGA 3MCZA 2X4HA 1B4AA 4FHTA 5AIQA 5DD8A 4BH9A 3MZHA 1HKTA 1XSVA 2ISZA 3KZZA 4RGSA 4ETSA 1CGPA 1JE8A 2IRFG 4ZH4F 5LHIA 3J7AO 1RNLA 3PQJA 4P9FA 3VB2A 4KFCA 4WXCA 1ZRFA 3JSPA 3JTGA 2FOKA 5ED4A 2M5WA 1R58A 2VT3A 1SD5A 2XAHA 1KQ9A 3FXQA 4HV6A 1S6LA 5HDKA 4EMSA 1Z9CA 3TKYA 4Q4ZF 3GEZA 3P7NA 4A12A 1HW1A 2CFXA 1XCVA 5DCFA 4MQVA 5ICFA 1W4MA 4OMZA 3L2CA 4GCVA 3T1BA 1U2WA 3KE2A 4G7ZF 4M9SA 1EH6A 2MD5A 3L09A 3H92A 2CO5A 1YG2A 3ZMUA 2X0LA 5FLXK 1FBSA 4RAZA 1PP8F 1L3LA 5E18F 3BJ6A 1BC8C 4A6DA 3P9CA 3QOPA 1BIAA 1MZBA 2FA5A 4XLPF 2RKHA 2Z9OA 1SFXA 2O03A 2A6HF 1XN7A 3CO7C 2VN2A 1W5TA 1RUOA 2HWVA 2ZO4A 3EYYA 2L3DA 5LRRA 1DUXC 1IXRC 5HLIA 3W6JB 1IUYA 2NNNA 1I5ZA 1I1GA 1GHCA 2FNAA 1NHAA 2JT1A 2HYFA 2O0YA 4AVPA 4CHUA 5DYMA 2HYGD 1BM9A 3W6KB 1DDNA 4ESFA 1FBQA 2D1VA 4O5VA 1USSA 3E6CC 2CQKA 4MEXF 3KLNA 1XDSA 1QPMA 3ELKA 1FBUA 5KK1A 3HHGA 1J0RA 4RB0A 3REOA 4MTDA 1KGSA 4Q47A 2FU4A 1QZYA 1YIOA 3GFMA 4BYYA 2RV8A 3SXYA 3COAC 3C3WA 1D8JA 2JPCA 5E20A 2K4JA 2QUFA 3DF8A 1BJAA 2K4BA 4H0EA 1UHMA 1U5TC 4YIFA 5DD4A 3K2ZA 4IF4A 1IXCA 1HXDA 2FNPA 3O6BB 4KUMA 4UVCA 5JVTA 1MKMA 3WGGA 5E1WA 4NHJA 2FE3A 1WI9A 1LDKB 3KP4A 3OOPA 1XGNA 3JW4A 3KZYA 3CO6C 1AOYA 5J6XA 1TQMA 2HEOA 2QQAA 2G9WA 3QPTA 2GAUA 2Q0OA 3Q5FA 3L9FA 3E5QA 1JHHA 5D4SA 3V8KA 3WTVC 2IA0A 3MZYA 4Q48A 1F5TA 4UV8A 5LEKA 3FXUA 1E2XA 5KVRA 5BPIA 3DP7A 5CYVA 4M72A 4G6QA 4ZYEA 4A6EA 4R79A 1B1BA 1FZPB 1FYMA 3GUDA 3IHUA 3ZMZA 3NQOA 1DP7P 4LFUA 3T0YA 1H9TA 2VBWA 3F8NA 2H6BA 2FBKA 3F72A 4HDVA 4HBLA 1ON1A 5K5OA 4HYEA 1QBJA 4XRFA 4UVBA 1QO0D 1ZAOA 3KEQA 5TJJA 1X3UA 3MWMA 2IA1A 5L3CA 2Q8KA 4OIOF 1SD4A 2L01A 3FMQA 1HKSA 3GO5A 3TDUC 3DQVC 2L4AA 4ZZLA 4CZZA 4I7HA 5ICCA 4HF1A 3E3VA 1LNWA 3IL2A 4M6XA 3HRTA 2MLGA 1Z1DA 4MEYF 1LJ9A 2ZMEB 2COMA 2GIVA 2P7CB 2OQGA 5E1XA 5DUIA 1P4AA 1EH7A 2Z99A 5ILSA 2A3SA 1O7LA 2W84A 3M8EA 1D8KA 4YFNF 3I0TA 4WWCA 5F1RA 2BE5F 4LD5A 2D1HA 1O3TA 2L02A 1J9IA 2EFWA 4HX8A 2UWMA 3WE2A 4JK1X 2O8XA 3DV8A 1IRGA 1G3TA 2EFPA 4L9NA 1R1TA 3B73A 5L3EA 4RB1A 3HRUA 1ZREA 3ECOA 4AIHA 3EYIA 3BZ6A 4DNCA 1F4KA 3TOBA 2VBXA 2A61A 4ZYGA 2EV5A 3PQKA 4CGZA 3HYIA 3KFWX 3F23A 1OR7A 4ESJA 2RVCA 4ENJA 3ABTA 1P92A 3DPLC 5HS8A 2GZWA 2QENA 3N97A 1S7AA 2BYVE 3VFZA 5LHHA 4PGGA 3F8FA 2XRNA 1G3YA 4RGRA 1HSTA 1YW8A 2IP2A 1IXSB 3GX4X 1JHFA 2XVCA 2VOPA 1ZLJA 3F21A 1MJAA 2DI3A 3ZN1A 4NQWA 1ZG1A 3CJNA 2ZJ2A 4HOBA 2V1DA 2HR3A 3V4GA 4IXAA 3ECHA 3RDIA 3CLOA 3RIRA 1WRJA 2PI0A 1MDMB 2L54A 3P9IA 1OYWA 3HOSA 2XV4S 1J7KA 1OKRA 3E5UA 1JXSA 4AIKA 5E17F 4MTEA 3RJPA 3R61A 1O3RA 4IPAA 1FSEA 2DU9A 2EB7A 2BBYA 3J81Z 3WE3A 2HOEA 3K1NA 2Q2EA 1CF7A 2QBYB 2EJRA 3SHFA 5FD6A 1USTA 2F5DA 3HSFA 5HDGA 1H0MA 2K27A 1S3JA 2Z3YA 2YU3A 3BPXA 3WTUC 4U88A 2K7LA 5HLHA 2HTJA 2M1BA 2WTEA 2ZCWA 3BDDA 2VC0A 3J80Z 1BN5A 3MFKA 2QWWA 5IT9Z 3R4KA 2EFOA 3E6BA 5ICEA 1ZRDA 2MH9A 3O3KA 3ERED 3JAMZ 3AAFA 2LNBA 3LQQA 3TO7A 4WK8F 4HA8A 1B9MA 1BI0A 3KETA 3FM5A 5E8IA 2M8EA 2BGCA 3CUQB 1FYLA 4OIPF 1Z05A 4M9ZA 1PDNC 3HRMA 2V79A 1IZ1A 5J8FA 4D0PA 1SD6A 4LB6B 4UUVA 4AD9A 1IAWA 4L5IA 3FWEA 3QP5A 1BIBA 2FBIA 1O3SA 4MNUA 5DUKA 1UB9A 2O6GE 2ETHA 5LGNA 1XGMA 5ICGA 3EUHA 2CSOA 5DCMB 2H09A 2ELHA 3GVAA 5TRDA 4M74A 1U3EM 3GXOA 2L4MA 2YX4A 3KP6A 3GFIA 2DPDA 1W7PB 2XAGA 1ZGAA 4MGRA 3NRVA 2O61A 1WWXA 1FWZA 3HSRA 4CYDA 4FX4A 2HKXA 2E7WA 3WTSC 3QU6A 4PCQA 2PLYA 2KRFA 4LGWA 4OU0A 2PFBA 2DO7A 5FFZA 1SFEA 4YG2F 1TNTA 3BROA 4M73A 4LLGF 4R8HA 3Q9SA 4FX0A 5F64A 5CVUA 4GO1A 3EQLF 2R7DA 1SMTA 4ESBA 2QM3A 4KN4X 3R6SA 1T2KA 1KU2A 2MC3A 4ZYDA 2LDUA 3IKTA 3HHHA 3ZPLA 5HS9A 4HW0A 2E7XA 3JTHA 4HX7A 4CO8A 5D5VB 1P4XA 5J8CA 2ZMEA 3MEXA 2HQNA 3WU1B 2P5KA 1ZG3A 1FX7A 3IWFA 1XGSA 5K1YA 2OQRA 4BXUA 4LG0B 1A04A 4HQEA 1ZYRF 3DEUA 4HDUA 1XSXA 1ONVA 3KEOA 1R1VA 1WSUA 3FMRA 3M8FA 1YS6A 2QYOA 4B8XA 2YR2A 4YIIA 4KMFA 3T8TA 4EVIA 4YFKF 4ZYHA 1WKMA 5BPDA 4UHTA 4EGYA 4OIRF 4Q5SF 5H6RA 2XGXA 5LBQA 1TW3A 3CUOA 1Z7UA 2DQLA 1IF1A 3DXJF 3F22A 2D45A 3SZPA 4QWQA 3ML6A 1FC3A 2KKOA 4HV5A 1W5SA 3QRFF 3BJOA 1RI7A 3WTTC 2H6CA 2LF8A 1LQ1A 1H9GA 3T5XA 5HS7A 4KIBA 4BHPA 1J2XA 1T6SA 1L0OC 1O57A 3ISPA 3GW2A 1KYZA 4ASNA 2ZNYA 3TDZC 1XMKA 5CJ9A 3G3ZA 2DK5A 3IWZA 4A5MA 3LA3A 1TW2A 1BC7C 3WU0A 3CUQC 3F6OA 3N4MA 2D2WA 3C18A 4EM1A 3P9KA 2MH2A 3FMSA 5ILUA 1O7FA 4MHGA 1U8RA 2TDXA 3QP6A 1GXPA 1TBXA 2VE8A 2EA2A 3M1EA 2A68F 2W24A 3E5XA 4JBAA 4PDKA 1QZZA 5DEQA 2P6SA 3F6VA 1SFUA 3V8LA 2W57A 2G7UA 1MDMA 4OMYA 4RS8A 3I64A 2YPRA 4MQ9F 1J5YA 3IKVA 4BNCA 3RPUA 5JI6A 2XIGA 2UXXA 1TNSA 2MLKA 2KJCA 3BWGA 4A0XA 4WF2A 3RTRA 2Z33A 1ZG5A 3TQNA 1U5TA 3U9GA 2VODA 1ZGJA 4EM0B 2QBYA 2R7FA 1KQ0A 2V6CA 3FXRA 4M71A 1WQ2A 2CYYA 4LB5A 1I6XA 2QVOA 4XBFA 4QLCU 1RUNA 5LGUA 2JZYA 4CICA 4RB2C 2EA4A 2A07F 3S2WA 4I01A 3WGHA 3R0JA 4I0BA 4EJWA 5L3DA 3F3XA 3U1DA 2FEZA 3C1DA 5FO5A 2JRTA 2W85A 2ZNZA 2PN6A 3J80K 2XROA 2EFQA 5IT9K 4UNOA 2VT2A 1FY7A 4A0ZA 2PMUA 1K7AA 3CUQA 2HGCA 2E1NA 2PBIA 4A2UA 3JAMK 1OMIA 1XGOA 4AWXB 1HW2A 3GYHX 1T38A 1QGPA 4O6JA 1ZLKA 5K5QA 1B59A 4ENKA 4LMYA 2UZKA 4WCGA 2HZTA 5DV5A 2ACJA 4IRHA 1BOAA 4M9XA 3TO9A 5LGTA 1STZA 5LEJA 2G7HA 6PAXA 3GFJA 1E17A 1UHWA 4EQQA 5BOXA 3I71A 5DCMA 4A5NA 1ZHFA 3MQ0A 1K6OA 2DQRA 1JGSA 2KIFA 4UVAA 4BHBA 1TQIA 2HQRA 4RB3C 2NAZA 4HQMA 2CWEA 2AS5F 1K78B 1ZN2A 3K1MA 1LDJA 3O2PE 1FNNA 4HF0A 3GWZA 2PEXA 1Y0UA 2BEOA 2FMYA 1YLFA 3HTUA 3FZVA 3ZQ7A 1XCBA 3K69A 2EK5A 4PZJA 2PJPA 3TGNA 2DTRA 2A5YB 2FMLA 3WTXC 1K79A 3V7CA 4Y17A 2XAFA 2FXAA 4EV0A 1W7PD 4K2EA 1ZH5A 4ON0A 1Z91A 3RKXA 1ZRCA 4WXHA 1Q1HA 4EJUA 1YO5C 5FD5A 3M9AA 1QNTA 1OYYA 2GA1A 2NYXA 2H94A 2VXZA 4G8XA 2XAJA 4I2OA 5CVJA 3F8BA 5HLGA 2OZ6A 5E8GA 2LF7A 2DFIA 1R23A 2CG4A 2IVMA 3HUGA 4IHSA 5L3GA 3ABUA 2DBBA 4EJVA 2DK8A 5ERIA 2CW0F 3D0SA 3ZP5A 4XLNF 4LG0A 3V7RA 4HZFA 3KLOA 4L9TA 1PUEE 1KA8A 1R36A 4R1HA 1MGTA 1P4WA 2STTA 2ZFWA 3BJAA 3WGIA 2FQ3A 3SQNA 1SD7A 3IC7A 5JHUA 2P8TA 2IA2A 3QPHA 3LAJA 1I1SA 5D5WB 3FHZA 4KIGA 1B9NA 3I53A 4BAYA 2P4WA 3K0LA 4ZZDA 2R3SA 3LA2A 2F2EA 1KQ8A 3I59B 4N9IA 3HOTA 2XUBA 1D5VA 5ILVA 3G73A 3F8CA 2EV6A 2HS5A 1B6AA 3BOQA 1IN6A 5IT3A 3QAHA 2ESHA 4EJTA 2V1XA 3IRRA 2Y75A 3WODF 2E1CA 4AIJA 4ENMA 4L0ZB 1G3WA 3LAPA 2OD5A 4KICA 2IJLA 3R60A 3HRSA 4Y15A 2GQQA 1DPUA 5K5RA 2RC4A 2IPQX 4KNYA 3FF5A 5EEHA 2OU2A 2WWYA 5CVRA 1KU9A 2QQ9A 2V1UA 2W25A 4HAMA 4P55A 1MD0A 4Z2YA 5H20A 5LRSA 3LFKA 1R22A 3GZ6A 1KYWA 2XKPA 3ZMVA 3OV8A 5AONA 1ON2A 3BPVA 3WTYC 1FP1D 1V3FA 2B0LA 5FB2A 1KU7A 4OOIA 3RPQA 3NEUA 2IW5A 1YS7A 3ROUA 1DPRA 1XDUA 1Z6RA 1ODDA 4KMUX 1LVAA 5L3FA 4UXNA 3TOAA 2WC2A 4KT5C 4N9HA 1D3YA 3I54A 2Z5UA 2XASA 2EFNA 1TTYA 1XMAA 3K1PA 5CVVA 5BMZA 1BI1A 2HTSA 2PQ8A 1FYKA 2VE9A 1GXQA 1P2FA 2QQBA 5A2QZ 4I98B 1CF7B 1P6RA 5EEGA 5D8LB 2YX7A 4IRIA 1BI2A 2FF4A 2OA4A 3KP3A 1HSJA 2P5VA 1G4DA 4LJZF 3GZ5A 4G6DA 2CGPA 4F7ZA 5DDGA 1HBXG 3L00A 3ZMDA 2F5CA 4BHCA 5HDNA 1YQAA 2ZXJA 1EH8A 2A69F 2P6TA 2KIMA 5D5XB 4TV7A 3VEPA 2HKOA 1J75A 1MJ9A 3LWFA 2ZKZA 1T39A 4S04A 2OBPA 2KJBA 2P7VB 3I58A 4HLYA 4L5JA 3V8JA 5D5UB 1S7OA 3H3UA 1YW9A 3LSTA 4L0YB 5BS6A 2OAZA 2RN7A 3DPTA 3C7JA 3WG9A 3SFZA 3ULQB 5CLSA 1KU3A 1IRFA 5LLQA 2K02A 3B02A 4ENNA 4P9UA 3RYRA 1LEBA 4GYGA 1QQIA 1IN5A 2K86A 3D5LA 4U0VA 4NB5A 4IJAA 4WXDA 1PP7U 4CXFA 4U7DA 2P5LC 1FSHA 4YFXF 4U0WA 1K78A 5LHGA 2HFHA 3E97A 2FRHA 1BI3A 2YSRA 1OYIA 2XHKA 1YW7A 3WTWC 3LQRA 2RQPA 1O3QA 4HLXA 4I02A 3RYPA 1FT9A 5FLXZ 5D6EA 3E6MA 4UV9A 4JQFA 5CVIA 4I0AA 4S05A 2VBZA 5HOOA 2C6YA 1G6NA 3ZN0A 4U0YA 5D4RA 2BV6A 2VC1A 1LB2A 1U78A 4G7OF 2ESNA 3TO6A 3CDHA 2F5FA 1S29A 4FT8A 1S8NA 4IVNA 1GVJA 1YYVA 2HDCA 1J59A 3CTAA 4HX4A 5D8KB 1G3SA 2STWA 1ULYA 2GXGA 2ADUA 2AXLA 1V4RA 1SMYF 1R5GA 5FFXA 2RGVA 1AWCA 3SZTA 3I5UA 4EGZA 3WTZA 2NNYA 5H6QA 2M45A 1YFHA 3HTSB 2DLLA 4DQ2A 1R5HA 3J81K 4CDGA 4OIQF 1R7JA 1EV7A 5F6FA 4LK1F 5HVQC 2QLZA 2OZUA 2XKOA 2LSOA 3HSEA 4RGUA 1ZARA 2RNJA 4G7HF 3I4PA 2GA2A 2KIUA 1MJBA 3HIFA 3RKYA 2VBYA 4LLNA 1OPCA 3KP2A 2FSWA 2WV0A 3EDPA 4Y13A 1XD7A 3GLXA 3GFLA 1FOKA 1HW5A 3I59A 2UXNA 3BY6A 4PGHA 4U7BA 1IN7A 2V9VA 3VOEA 3MAJA 4B09A 2IT0A 2JTVA 4RAYA 1IW7F 2Y0MA 1RIOH 4KYWA 4KDPA 4I09A 4O3MA 4GGGA 4G94A 2MBFA 4LLLA 1IN4A 4LK0F 3V7SA 1REPC 5L3BA 4L9JA 1XB4A 3VODA 1VTNC 2VOOA 2GXBA 1UFMA 5BQTA 1HKQA 1W7PA 5JR3A 2O3FA 3KP7A 4HF2A 4EJOA 3EETA 1T0FA 3L7WA 1Z6TA 1C0WA 1HQCA 2JPBA 3F8MA 1LDDA 1FP2A 3Q9VA 4A0YA 1F9NA 2M30A 3RI4A 4E70A 3M7GA 2PMHA 1R00A 2NRAC 1LEAA 4L18B 2J5OA 2J5PA 2PG4A 2ZBKA 3FM3A 2EWNA 4EM2A 1R1UA 3ZMSA 4N0BA 2DT5A 2RDPA 3JSOA 1U6GA 2JSCA 3DKWA 4KN7X 5FGMA 1FPQA 3LA7A 2ISYA 3RKWA
chains in the Genus database with same CATH superfamily
5J40A 2DPUA 2DA3A 2RREA 3E1SA 2R7ZJ 1IV6A 4OINF 2DW4A 4UB8C 4BQAA 4BY1J 2DAOA 4IHTA 3EUHC 3KCCA 3ZMTA 3HGGA 3FISA 1YTYA 4GXOA 3M07A 4P5OA 3E6DA 1XSDA 3A4CA 2EIMH 2IEKA 1UZCA 1BBYA 2M0CA 4BBRJ 2EZKA 3JRGA 3FXOA 2MA3A 4WX9A 3U2RA 3OYKA 2H27A 1X3ZB 2X6XA 1U5TB 1FLIA 4C2MJ 5B3SH 3CC4I 4KIFA 2A6EF 3IRQA 3BTCA 2LKPA 1DU0A 4G9YA 3CD6I 1IN8A 4C9YA 4P96A 1AKHA 1UCRA 3BP8A 1TLHB 2NS0A 5AIPA 5HNHA 2K3PA 3QU3A 3H3ZA 4F92B 4KA4A 1PUFB 4BJTA 4Z6YA 1D5YA 3CF5F 2JSPA 2CW8A 1BW5A 3TMOA 1T98A 4J00A 2OF7A 3CC7I 3T8RA 2JMWA 1FJLA 5KAFC 2XF6A 5A2QK 5E3MA 1SAXA 2IXSA 2O5RA 4XSXF 5JFRA 1VQOI 3K9TA 4V2GA 2EBIA 2XF7A 4QPQA 2FBHA 3FX3A 2ZJRF 4L9VA 3R0AA 1D1AA 2DMNA 3GF2A 4XLCA 1LVKA 3GBGA 5M5XJ 4Y52J 3KP5A 3QODA 2KPMA 2R7UA 4XRSG 1RR8C 3AG3H 4D5FA 1GV5A 2DMPA 2VONA 4M6YA 1JJ6C 1I27A 4P1WA 4GYIA 5F04A 5E1ZB 2H8WA 1TQPA 5D6FA 3PFIA 1F1ZA 3ASNH 1RZ4A 1GVDA 2EV0A 2QZ8A 1RESA 2Y48A 5TGTA 5FKNA 2M87A 4RGXA 2DA1A 2I8DA 2Z1DA 5GPCA 2XAQA 2F5EA 3S3OA 3VSLA 4IRGA 3A02A 3GTQJ 3ZR8X 2GWRA 3BCBA 4XSZF 3DFGA 3MCZA 2X4HA 1B4AA 1YI2I 3Q0VA 4FHTA 2K9MA 5AIQA 1WJ5A 1IO2A 2GIZA 5DD8A 4BH9A 3FKJA 4E7IA 3MZHA 5E3LA 1NH3A 1HKTA 5K7HA 1XSVA 2ISZA 1SAUA 2K85A 1HA8A 3KZZA 2PJRA 4RGSA 1K4TA 2XPUA 4ETSA 4JYKA 4NBQA 1CGPA 4PJ0C 4JP0A 3Q3SA 1JE8A 2NVQJ 2IRFG 4ZH4F 3F0CA 4XMYA 4A93J 1MBKA 2VUMJ 2L0KA 5LHIA 4KISA 3J7AO 1RNLA 3DBRB 3PQJA 3MKLA 4P9FA 3VB2A 5IP9J 4B44A 2DODA 4KFCA 4WXCA 4ABZA 1ZRFA 2IS1A 3JSPA 3JTGA 2FOKA 5ED4A 2V1NA 2M5WA 2KFDA 1R58A 2M3AA 2E2IJ 4NNJA 2VT3A 1SD5A 2XAHA 1KQ9A 1YJ9I 2L9RA 1RPWA 3FXQA 4HV6A 1S6LA 2V6EA 5HDKA 1W1WE 2M9HA 2COBA 4EMSA 1Z9CA 1E3HA 2GOMA 3TKYA 4Q4ZF 3GEZA 3P7NA 2LFBA 3ZQQA 4A12A 5JVGF 1HW1A 4MFDA 4UUSA 2CFXA 2QGUA 1XCVA 1MBFA 5DCFA 2OCEA 1PJRA 4MQVA 5ICFA 3KYCB 1W4MA 4B43A 2BOLA 3MKZA 4OMZA 3L2CA 2CUEA 4GCVA 3T1BA 1U2WA 3KE2A 2KRCA 4G7ZF 4M9SA 4NQWB 3HJEA 1EH6A 4G12A 2MD5A 3L09A 2CRGA 2CS3A 3H92A 1JUSA 2CO5A 4A3DJ 1T33A 3HPHA 1YG2A 3ZMUA 2X0LA 2ICWG 4PK4A 5FLXK 2E2JJ 1FBSA 2HZDA 4RAZA 2RNGA 4KITB 1PP8F 4G6TB 1OCCH 1L3LA 5E18F 3BJ6A 1BC8C 2K9NA 4ZTJA 1D0XA 5F27A 2BHYA 4A6DA 1VQ6I 3P9CA 3QOPA 1BIAA 1MZBA 2FA5A 4XLPF 2RKHA 2Z9OA 2ECBA 2Y2ZA 5E79C 4UB6C 3J7ZI 1SFXA 4A3GJ 2K3FA 4AYBN 3H5NA 2XB0X 4JOMA 2O03A 2A6HF 2P0WA 2CUFA 1XN7A 4CCKA 3CO7C 4HRIA 2VN2A 1W5TA 1RUOA 2HWVA 3A0HC 5CKTA 5EGOB 2ZO4A 2R0QC 3K4JA 4IHYA 3EYYA 2L3DA 5LRRA 1XG1A 1DUXC 1IXRC 5HLIA 3W6JB 1IUYA 5EF6A 2LP0A 2MABA 2NNNA 4Y3OA 1I5ZA 1I1GA 2Q2EB 1GHCA 2FNAA 4RAGA 1NHAA 3H3VK 2JT1A 2HYFA 2O0YA 1GDTA 4AVPA 4CHUA 5DYMA 2EIJH 1T56A 1EA3A 2HYGD 1BM9A 2X1EA 1MBEA 1MNMC 5B1AH 3W6KB 2R5YA 1DDNA 4ESFA 3CCJI 4U87A 3GTLJ 1FBQA 2D1VA 2KLOA 3SEQA 2HU9A 3OYNA 2DA2A 4O5VA 3C2BA 1USSA 3E6CC 3HXLA 4F91B 3CLQA 2CQKA 4MEXF 3KLNA 1XDSA 1QPMA 3ELKA 3W3CA 3RKQA 3BG5A 2A05A 1FBUA 5KK1A 3OYEA 1ZGWA 3HHGA 1J0RA 4RB0A 3REOA 4MTDA 2W00A 2ID6A 3IAS2 1KGSA 4Q47A 2FU4A 1QZYA 1YIOA 4CCNA 1ETVA 3OY9A 3GFMA 3K4CA 4BYYA 1KZHA 2RV8A 3SXYA 1IRZA 3FDYA 3COAC 3C3WA 1D8JA 2JPCA 3PSFA 5E20A 2K4JA 3NAUA 3EUKL 2QUFA 4RM3A 2QEXI 1VQMI 4QIWN 3I9V2 3DF8A 1QHGA 4KT6A 3UR3C 1D1BA 1BJAA 2K4BA 4XLHA 5J3LA 1OCPA 4H0EA 1UHMA 1U5TC 3G71I 4YIFA 1RRJA 5DD4A 5E3OA 3BLYA 3K2ZA 5K7FA 3FXKA 2LTPA 1I39A 4IF4A 2DFHA 1IXCA 3GTJJ 2WAFA 1HXDA 2FNPA 1QRYA 1BW6A 2VIXA 4NC7A 4CCMA 2VQHA 3O6BB 3W2WA 3K70C 4BDZA 2XSDC 4KUMA 3S14J 3CDLA 4UVCA 5JVTA 1MKMA 2OV7A 3WGGA 1BJZA 5E1WA 1VQPI 1E3PA 5FKMA 4NHJA 1MNEA 2FE3A 3GCMA 1GV2A 1WI9A 1LDKB 3KP4A 3OOPA 1MW7A 3AG4H 1XGNA 3JW4A 3KZYA 5GAHJ 3CO6C 1AOYA 4BE0A 3OYMA 1Y1WJ 5J6XA 2LREA 1W0TA 1CQTA 1TQMA 1FOYA 2QQAA 2HEOA 2G9WA 3QPTA 3I56I 1LE8B 2GAUA 2Q0OA 2ZSHB 3Q5FA 4PFOA 5J4YA 2JN6A 5EYRA 2ID3A 2XPVA 3E5QA 3L9FA 3DTEA 1JHHA 1JUMA 4XK4A 3V8KA 5D4SA 3S15J 2L9SA 3WTVC 2IA0A 2DT6A 1S9HA 3JRAA 3MZYA 4Q48A 1F5TA 4UV8A 5LEKA 4D1QA 4RDUA 3FXUA 1E2XA 2EQRA 5KVRA 5BPIA 3DP7A 4A3FJ 3MN2A 3QYEA 5CYVA 4M72A 2JA6J 3BR2A 2Y31A 3AFHA 4G6QA 4H4KC 1KONA 1YOVB 4A6EA 3ZOBA 4ZYEA 4R79A 3A2KA 4AIDA 2LMDA 2YU9J 1U0JA 1B1BA 1FZPB 3HOWJ 1FYMA 3GUDA 3IHUA 2IGOA 3ZMZA 3NQOA 4XKWA 3QPLA 1DP7P 3M3YJ 4LFUA 3OYCA 3T0YA 1I6HJ 2XF5A 4HSRA 2DA7A 1H9TA 2BY1A 4GFBA 2VBWA 3F8NA 2H6BA 4Y4RA 3BTIA 2B7EA 2FBKA 1ACIA 1B72A 3HOYJ 4PJLA 2N8GA 3F72A 4HDVA 4HBLA 1ON1A 5K5OA 3QPSA 5KNLA 4HYEA 1QBJA 4XRFA 1ZR4A 4GDFA 1OR7C 2FD5A 4UVBA 5IY5H 1QO0D 4DZJA 1MSFC 1ZAOA 3KEQA 5TJJA 2LBFB 3ZRGA 4DOZA 1X3UA 3DCFA 2DJNA 3MWMA 4D7MA 3CCLI 2JVHA 5H2FC 2EZLA 3ASOH 4QSHA 2IA1A 5L3CA 2Q8KA 5DTDA 1QU3A 4OIOF 1SD4A 2L01A 3FMQA 2BY0A 3DKXA 5M5WJ 1HKSA 3GO5A 3TDUC 3DQVC 2L4AA 4ZZLA 1WVRA 4CZZA 4I7HA 5ICCA 4HF1A 4BXXJ 3E3VA 1LNWA 3IL2A 4M6XA 3GLLA 1D1CA 5F1JA 3HRTA 2Y30A 3TEDA 4CUGA 2MLGA 1Z1DA 4MEYF 1JUPA 1LJ9A 2ZMEB 5DM6F 1PUFA 4ZDOA 2COMA 2GIVA 4RBOA 4BE1A 4EEFG 2P7CB 4CCJA 2VQCA 5JLWA 2OQGA 3VYSB 2PMZN 5E1XA 5DUIA 2BZTA 2L9VA 1P4AA 1EH7A 2Z99A 5ILSA 2A3SA 2RQQA 3I4MJ 2A5WA 3RPUD 1X1PA 3JREA 1A5JA 1O7LA 2W84A 2EILH 3M8EA 4ZC3A 3C2GA 1D8KA 2KIQA 5EJCA 3GTPJ 4FTHA 4YFNF 3I0TA 4WWCA 1VZ0A 5F1RA 3FXLA 3PM1A 2BE5F 4W1UA 3OYLA 4LD5A 2DOAA 4ZDLA 2DMUA 1JGGA 3PO3J 1I50J 1E0EA 2D1HA 1O3TA 3K70D 4C3JJ 2L02A 1J9IA 1R4NB 2E36A 1OCTC 2EFWA 1BR1A 4YELA 4HX8A 1GT0C 5JHFA 2UWMA 3WE2A 4JK1X 2LOOA 2O8XA 3DV8A 1WFXA 3PUBA 1IRGA 1OCOH 2IS4A 1G3TA 2EFPA 2VQGA 1MBGA 4L9NA 1R1TA 3RSNA 4AYBA 4DJAA 3B73A 2VXDA 5L3EA 1OISA 4RB1A 3HRUA 3H5AA 1ZREA 3ECOA 2K9SA 1DGRM 1PYVA 3OIQA 2GXAA 1G8XA 4AIHA 2MD0A 5EG0B 3EYIA 4CZCA 3PL8A 1VQ7I 2WY7Q 3BZ6A 4DNCA 3ABKH 1F4KA 3TOBA 2VBXA 2A61A 3O8HA 4ZYGA 2EV5A 3PQKA 2GM4A 4CGZA 3HYIA 2M7AA 3ZQFA 2Z16A 3HEFA 3KFWX 3A0BC 2JA2A 3F23A 1OR7A 3ESWB 4ESJA 2RVCA 1RKWA 4LIVA 4B47A 4ENJA 4J19A 3ABTA 1P92A 3DPLC 5HS8A 2GZWA 2QENA 3FXMA 3GTKJ 3OYIA 3N97A 1M1EB 5GTHC 2CV1A 1S7AA 2BYVE 3VFZA 5DS9A 5GAGJ 5LHHA 5JLXA 2VI6A 3F8FA 2DTZA 4PGGA 2XRNA 2V9KA 3CCQI 1G3YA 2UUZA 4RGRA 3JRIA 2QSHX 1HSTA 1YW8A 2IP2A 3DBLB 2CQNA 1IXSB 3WG7H 2RAEA 3W2AA 3U21A 3GX4X 1JHFA 2XVCA 2VOPA 1FIAA 2EH3A 1BR2A 3LNQA 1OJLA 2F6CA 1ZLJA 3G4SI 4XOTA 3F21A 2LKSA 1P7IA 2BW3B 1X1DA 2EZIA 2GLOA 1MJAA 2DI3A 3EUAA 2ME6A 3ZN1A 4NQWA 1HCRA 3I55I 1ZG1A 2ELJA 2M2EA 3CJNA 2ZJ2A 4HOBA 2ZJQF 2V1DA 2FQ4A 2HR3A 3V4GA 4IXAA 1HLVA 3ECHA 2OJED 1WGXA 4C3HJ 3HOVJ 4XONA 5CPRB 3RDIA 1EKEA 4X0GA 3RZOJ 1UG2A 3CLOA 3RIRA 3ZQCA 2WAQN 1WRJA 2PI0A 1X4PA 3PFYA 2H1KA 1MDMB 2L54A 3P9IA 1OYWA 3HOSA 2VLAA 1RC9A 2W4SA 2DDAA 1R49A 2XV4S 2JA5J 2YUSA 1J7KA 1OKRA 3E5UA 1JXSA 4AIKA 5E17F 4MTEA 3RJPA 1VQNI 3OYHA 3R61A 3K4LA 5EGOA 1O3RA 4DYQA 3NWSA 1FSEA 4IPAA 3CCRI 2V4JC 2DU9A 1YHQI 2EB7A 5FLMJ 2BBYA 5HODA 3J81Z 4IZZA 1JI8A 3WE3A 2HOEA 3K1NA 2Q2EA 1CF7A 2QBYB 2EJRA 1SANA 3OS1A 3SHFA 2B9SA 5FD6A 1USTA 2F5DA 3HSFA 5HDGA 1H0MA 2K27A 1S3JA 1V5GA 2HXIA 2JVGA 2Z3YA 4ITVA 2LKXA 2DXIA 4PFPA 4M6VA 3TP0A 5DM7F 2YU3A 3BPXA 4D7NA 3WTUC 4U88A 1SFOJ 3DWLE 1A31A 2K7LA 5HLHA 4DZPA 2HTJA 1HC8A 2M1BA 3ZCOA 1TWFJ 2HQ5A 2MGQA 3CCVI 4E4HA 3H5RA 2WTEA 1ETOA 2ZCWA 3BDDA 5LFAA 4BDYA 2VC0A 3J80Z 1BN5A 3MFKA 2QWWA 5IT9Z 3R4KA 2EFOA 3E6BA 5FLVA 4W97A 5ICEA 2E1OA 1ZRDA 2E5ZA 3TW6A 2MH9A 1JKRC 3O3KA 1Z21A 2XGDA 3ERED 3JAMZ 3AAFA 2LNBA 5CQGA 3LQQA 2X51A 3ZXSA 1MMSA 3TO7A 4WK8F 1VFCA 1Y56A 3DEWA 3QQAA 4HA8A 4XR6A 3BQYA 2AHQA 4M3EA 1B9MA 1BI0A 4F55A 3KETA 3FM5A 2PX9A 5E8IA 2M8EA 2BGCA 3CUQB 1IG7A 1FYLA 1ETYA 3GTMJ 4OIPF 2BVMA 2ZMEC 2H1LA 1N25A 1Z05A 4M9ZA 1PDNC 1Z77A 3HRMA 1N78A 1GLNA 2V79A 4FETA 3OL3A 1IZ1A 5J8FA 3MD2A 3BG7A 4D0PA 2MFZA 2V7FA 1SD6A 1R9TJ 3S3NA 4CYCB 4LB6B 3KZIC 4UUVA 4AD9A 5J1RA 1IAWA 4L5IA 1V55H 1EF4A 3FWEA 3QP5A 1BIBA 4AC0A 2FBIA 1R6RA 1O3SA 1ERDA 4MNUA 2ZB9A 5DUKA 2K40A 2FX0A 1UB9A 3QOEA 2O6GE 5FROA 3H0GJ 3PIOF 4IOCF 2ETHA 4IEJA 5LGNA 4EATA 2YS9A 2ZC2A 1XGMA 5ICGA 1LE8A 1IGNA 5GAEJ 3EUHA 3S2DJ 2CSOA 5DCMB 2H09A 1A36A 2PMZA 1K61A 2ELHA 3GVAA 2HVRA 5TRDA 4M74A 3AL0B 1U3EM 3GXOA 2L4MA 2YX4A 3KP6A 3GFIA 4BACA 2DPDA 1W7PB 2XAGA 4BL0B 3HPGA 2KZVA 2E19A 3A1YA 1ZGAA 3CJRB 3NRVA 4MGRA 4A3KJ 2O61A 1WWXA 2VASA 3CCYA 1FWZA 3HSRA 3W2VA 2XSJC 4CYDA 1QVTA 4FX4A 2HKXA 2E7WA 3KX2A 3WTSC 3QU6A 4PCQA 3CMAI 2PLYA 4BQQA 2KRFA 2ELKA 4LGWA 4RLQA 4IO9F 4I76A 4OU0A 3ONQA 2DFEA 2AQFA 2PFBA 2HDDA 3G2BA 2DO7A 3HBLA 2Y9YA 1TT0A 3CCUI 2KHMA 5FFZA 1SFEA 2VB6A 4YG2F 1TNTA 3BROA 4XIDA 4M73A 1WJDA 1DP3A 1WJAA 4LLGF 4R8HA 3Q9SA 3CQZJ 4FX0A 2LBFA 3ABMH 5F64A 5KCMA 4LITA 2ME0A 5CVUA 1X2NA 4GO1A 3EQLF 4YEJA 2QSFX 4XLFA 2R7DA 1SMTA 4ESBA 5F08A 5F0CA 2QM3A 4IQJA 2JUCA 4LOCA 4KN4X 1DU6A 3R6SA 3L2UA 1T2KA 1KU2A 2MC3A 3OSGA 4ZYDA 2LDUA 2F5VA 3IKTA 1NTCA 4L5EA 3HHHA 3ZPLA 4ZYAA 5HS9A 3S3MA 4HW0A 3FHNA 3B6CA 4RAFA 2E7XA 3JTHA 4HX7A 3HUGB 4CO8A 5D5VB 1P4XA 3U1KA 5J8CA 2F4IA 3ZGKA 3OOUA 2DYRH 5IP6A 3K7AJ 1YE9A 2ZMEA 3MEXA 3DLAA 2HQNA 2GBYA 3DBHB 4JX6A 5F0FA 3WU1B 2P5KA 2WB1N 1ZG3A 1FX7A 2IBDA 1FOXA 3IWFA 2WAEA 3S16J 4N4OB 3A01B 1XGSA 1A35A 5K1YA 1V5FA 2IGKA 1V5EA 1LKXA 2OQRA 4BXUA 5TISC 3OYAA 1BOBA 4LG0B 1WH5A 3ABLH 1A04A 5J47A 5FRMA 1JT0A 2LYCA 4M3GA 4HQEA 2I5UA 1YX3A 3PSIA 4AU7A 2KL4A 1D0ZA 3DEUA 1ZYRF 4HDUA 1XSXA 1W5CC 1ONVA 1UELB 4M3DA 2E5NA 3KEOA 1R1VA 2L7MP 1JKPC 1WSUA 3FMRA 3M8FA 1YS6A 3J7AY 2CQ7A 3BR0A 2O8KA 3CC2I 4RA2A 3DU5A 2QYOA 4FISA 3KIOA 4B8XA 1WI3A 2YR2A 3OR2C 5HLTA 4YIIA 4KMFA 1TWGJ 3T8TA 4EVIA 4YFKF 4ZYHA 1WKMA 9ANTA 5BPDA 2WBMA 4DW6A 1ETWA 2LR8A 4UHTA 2CUZA 4EGYA 4OIRF 4BY7J 4ZTFA 1W36D 4Q5SF 3ZQLA 1I3AA 5H6RA 4ZDPA 2WAQA 2XGXA 2DA6A 2LG4A 4HG2A 5FKKA 3VDXA 5LBQA 1TW3A 3UNGC 1E3OC 2ECCA 1ZK8A 3CUOA 2ZSIB 1Z7UA 2DQLA 1IF1A 3DXJF 3WU2C 2JUGA 2X6WA 2XB5A 4HNVA 3F22A 1LPQA 2ZJPF 3SZPA 2D45A 1YIJI 2E71A 4QWQA 1D0YA 2V9PA 3ML6A 3HOZJ 2F48A 5C44J 2OUMA 5EG0A 2QKLB 3H35A 5J4VA 2VJIA 1FC3A 3PNYA 2KKOA 3JCUC 1X3WB 2Y69H 1W5SA 4HV5A 3M4OJ 1X1CA 3H1CA 2IS6A 3QRFF 4MO7A 2NS7A 3BJOA 1RI7A 2CV2A 3BZKA 3WTTC 1VNDA 2XDVA 1NK3P 2H6CA 4E7JA 2LF8A 3JRHA 2K9QA 1IDZA 2DN0A 2E1MB 5EZHA 1FTZA 3X2QH 1LQ1A 1H9GA 3T5XA 4XN0A 5HS7A 4KIBA 4BHPA 4FE4A 2IAIA 1J2XA 4C2TA 1A6IA 1T6SA 1L0OC 1O57A 3ISPA 3L2WA 2F4OB 3GW2A 1KYZA 4ASNA 2ZNYA 3CDIA 3TDZC 3E7LA 1XMKA 2EZHA 4QPOA 3BQZA 3G3ZA 5CJ9A 2DK5A 3IWZA 4A5MA 4BEHB 1XTAA 3LA3A 3MZ8A 2QSGX 2R7XA 1TW2A 2Z2SB 1BC7C 3WU0A 2HPMA 3CUQC 3HGYA 3F6OA 2BW3A 3FBNB 3N4MA 2D2WA 3C18A 4EM1A 1VQ5I 3P9KA 4NC8A 3BZCA 3JRFA 1HF0A 3RZDJ 5B66C 2MH2A 3FMSA 3F9KA 5ILUA 4E7SA 1WZ2A 1O7FA 4MHGA 1U8RA 2TDXA 4BKXA 2R7QA 3OL4A 2O9LA 3QP6A 1GXPA 1TBXA 2VE8A 3B6AA 5GTIC 2EA2A 3M1EA 4BS9A 2A68F 2W24A 3E5XA 2I10A 4JBAA 4PDKA 4UUSB 2Y9ZA 1H89C 1TL8A 1LFBA 1QZZA 1MMGA 2P6SA 5DEQA 1T08B 5EZGA 2AO9A 1F36A 3F6VA 1U9NA 3C2HA 2X9DA 2E34A 3P5JA 1SFUA 4B4CA 1SEUA 2KRHA 3V8LA 2W57A 1MH3A 2G7UA 1MDMA 4OMYA 4RS8A 2W1OA 3I64A 1K4SA 3LMMA 2YPRA 4BUPA 3LSKA 2R5ZB 2HVQA 4MQ9F 1J5YA 3IKVA 4BNCA 3RPUA 2HOSA 5JI6A 2XIGA 2UXXA 1Y0NA 1TNSA 2MLKA 2KJCA 3BWGA 3K4BA 4A0XA 3AL0C 4WF2A 2L7FP 4J01A 3RTRA 1K83J 3CF2A 2Z33A 1MH4A 3BT9A 1OFCX 1LFPA 1N75A 1ZG5A 3TQNA 3G1LA 1Z3YA 1U5TA 3U9GA 2HOTA 1YRNB 2VODA 1ZGJA 4EM0B 2QBYA 2XPWA 1MSEC 3LL7A 4BQOA 2R7FA 4II2A 4C3IJ 2VQLA 5GADJ 3S8PA 3CJQB 1KQ0A 2LY9A 2V6CA 5IOZA 3DTIA 3FXRA 4M71A 4A69C 1WQ2A 3SDBA 2CYYA 4LB5A 1I6XA 2QVOA 1JJ8C 2X1DA 4XBFA 4QLCU 1RUNA 5LGUA 3G6EI 2JZYA 1ZKGA 4CICA 3L2VA 4RB2C 1ORKA 1IC8A 2EA4A 1TZLA 2A07F 4DBRA 2CU7A 3HL2A 2EINH 3S2WA 4I01A 1X1BA 4A3BJ 2QKMB 4A3CJ 3CESA 3WGHA 2W82A 3R0JA 1FMVA 4I0BA 4EJWA 5FKOA 5IYBJ 5L3DA 1DGWY 2MW8A 3VYUB 3F3XA 3U1DA 3CMMA 4BJ5C 3W6VA 2FEZA 3C1DA 5FO5A 2JRTA 3K2AA 2W85A 4F3QA 2MG4A 2ZNZA 2BY2A 4IQ4A 2PN6A 1VQ4I 4C2UA 3J80K 2XROA 2EFQA 2WA0A 2M4KA 5IT9K 2CV0A 4A3IJ 2E60A 4UNOA 2ZFUA 3GTOJ 2VT2A 1FY7A 4A0ZA 2PMUA 2VPRA 1WH7A 1K7AA 3CUQA 2HGCA 2E1NA 2PBIA 4A2UA 2HPIA 1S7EA 4A3MJ 3K4MA 4B3AA 3JAMK 4XKCA 4RMNA 1OMIA 1X19A 1ZQ3P 1XGOA 4AWXB 2IGMA 1HW2A 3GYHX 2E2HJ 1T38A 1QGPA 1MBHA 3BR3A 2OC6A 3CCMI 4O6JA 4E7KA 2M7BA 1ZLKA 5K5QA 1B59A 5KHDA 5J1UA 2FUG2 4CYCA 4ENKA 4LMYA 1F43A 3J7YJ 3D5SC 2UZKA 1Y6IA 4IX7A 4WCGA 4BQNA 2HZTA 2OCCH 1TWHJ 5DV5A 2ACJA 4IRHA 2ZXWH 1BOAA 3MVPA 4M9XA 3TO9A 1STZA 2G7HA 2HYJA 5LGTA 3GFJA 5LEJA 2W7NA 1E17A 1UHWA 4EQQA 5BOXA 3HM5A 1RKTA 4XN3A 3E0JB 2AXTC 2WB1A 3I71A 5DCMA 2JRMA 4A5NA 1ZHFA 3MQ0A 1K6OA 2DQRA 3IH2A 1JGSA 1MIJA 3OYFA 2A6TA 2VPLA 5IOYA 2KIFA 4UVAA 4BHBA 1TQIA 2HQRA 2NVXJ 2WADA 3PNVA 3VSKA 4RB3C 2NAZA 2X1CA 3LSJA 4HQMA 2UV1A 2CWEA 2GOXB 4XQFA 4B3XA 2AS5F 1K78B 1ZN2A 3K1MA 1LDJA 1XMXA 3O2PE 1FNNA 4HF0A 3GWZA 2XGEA 2PEXA 1Y0UA 2BEOA 2FMYA 1YLFA 3HTUA 4DGWB 3DKYA 3IP4B 1ETXA 3FZVA 3ZQ7A 1WJEA 1XCBA 3K69A 2KDOA 2EK5A 2HOAA 4OAYA 4PJMA 4XKBA 1ITYA 4PZJA 2PJPA 2HNHA 2DTRA 2LVSA 3TGNA 2A5YB 2LC2A 2FMLA 3WTXC 4HSTA 3V7CA 1K79A 4Y17A 2JA8J 2XAFA 4I6ZA 1OCZH 5FKLA 2FXAA 4EV0A 3BC8A 1W7PD 1ZELA 2KDZA 1WHUA 3ERMA 3TBIA 4K2EA 4BGDA 1UG0A 2E1MC 3K6GA 1ZH5A 3L2QA 2NXNB 2M34A 1TT5B 4ON0A 1Z91A 4IHWA 5E3NA 3RKXA 1IV8A 1ZRCA 2L9NA 1WPKA 4WXHA 4JX4A 1NK2P 2LRDA 1Q1HA 3TP3A 4EJUA 1YO5C 5FD5A 3ZQHA 4XLAA 2KMUA 4DYCA 3M9AA 1QNTA 1OYYA 1NG7A 2GA1A 2R7SA 2NYXA 2H94A 4RLFA 2VXZA 1WJFA 4G8XA 2DCEA 1HDDC 4AVZA 2XAJA 4I2OA 5CVJA 3LFUA 3F8BA 3LSGA 5HLGA 2OZ6A 5E8GA 2LF7A 1MMAA 2DFIA 1SC7A 1R23A 1UHSA 2CG4A 2IVMA 3HUGA 4IHSA 1AA7A 3DPUA 4E7LA 5L3GA 1PVEA 2DBBA 3ABUA 4EJVA 4OAZA 1G2HA 5F0HA 1B8IB 3MKYB 3I3LA 2DK8A 2BY3A 5ERIA 4FE7A 1RR7A 4JX5A 1UAAA 1IUFA 3A01A 3DU6A 3OYJA 3AKZA 2CW0F 1HOMA 1YJWI 3D0SA 1R71A 3ZP5A 1SFKA 1VF9A 4XLNF 1TWCJ 4LG0A 4XKVA 3V7RA 4IOAF 3H9JA 5LD2C 4HZFA 1W0UA 3JRBA 3DLLF 2BVLA 3KLOA 4L9TA 1PUEE 1KA8A 1R36A 4R1HA 1MGTA 1P4WA 2STTA 2ZFWA 4FQGA 3BJAA 3WGIA 2FQ3A 1Z0XA 1BL0A 3SQNA 1SD7A 3IC7A 5JHUA 3HC7A 2P8TA 2P81A 2IA2A 2QQ8A 3OS0A 3QPHA 3LAJA 3G1OA 4Y33A 1I1SA 2IS2A 1FOWA 4Y7NJ 5D5WB 3FHZA 2L2OA 4KIGA 4YRVA 1B9NA 5FRNA 2DJIA 2CJJA 5FJ8J 3SEZA 2VJJA 3I53A 1U8BA 4BAYA 2F4MB 1ETQA 3IH3A 2P4WA 1XC5A 4A3EJ 1TC3C 3K0LA 1VI0A 4ZZDA 2R3SA 2DOEA 3LA2A 2F2EA 2LY2A 1KQ8A 3I59B 1BA5A 4N9IA 3HOTA 2XUBA 2OTJI 1D5VA 1N77A 5ILVA 3G73A 3F8CA 2EV6A 2FOWA 2HS5A 1B6AA 1VQKI 3BOQA 1W36C 1OQYA 1IN6A 5IT3A 2M8GX 3QAHA 2ESHA 4EJTA 2V1XA 5GP9A 2XC7A 3IRRA 1P9QC 2Y75A 3WODF 2E1CA 4AIJA 2DOFA 4ENMA 3VYRB 3Q0WA 3PJRA 4L0ZB 1G3WA 3LAPA 1IDYA 2W48A 2OD5A 3QWLA 4KICA 4XLEA 1IJWC 1X4OA 2IJLA 2R7WA 3HB9A 3SJMA 3R60A 3HRSA 4Y15A 1LFUP 2GQQA 4XNFA 1DPUA 5K5RA 2RC4A 2IPQX 3RQ4A 4KNYA 2DMTA 4A3JJ 4X6AJ 3BTLA 3FF5A 2OU2A 5EEHA 2WWYA 3OWTA 2ZXHA 3S17J 1X1AA 5CVRA 1KU9A 2BXYA 2QQ9A 2V1UA 3WHCA 2G0EA 1MMDA 4BEHA 2W25A 5B5EC 4B48A 1X58A 2EIKH 2CFOA 4HAMA 4P55A 1MD0A 4Z2YA 5M3FJ 3ZQGA 5H20A 5LRSA 3LFKA 4E7ZA 1R22A 2Y0SN 3GZ6A 2HI3A 5BNGA 1KYWA 1I3QJ 4PUSA 2E35A 4V19K 2O7OA 2XKPA 3ZMVA 3OV8A 3K10A 3KYDB 5AONA 3HKZN 2VJ5A 1IRXA 1ON2A 3BPVA 3WTYC 1FP1D 3G1MA 1T95A 1Y8QB 3L2RA 1QA6A 2B63J 1V3FA 2B0LA 5FB2A 1Y1VJ 3BG6A 1XX5A 1KU7A 4OOIA 3RPQA 3JRCA 4E6KG 3H0DA 3NEUA 2IW5A 4D9JA 3OYBA 2R5ZA 3O8GA 4BJ6C 1YS7A 3ROUA 1DPRA 3LOCA 2MSYA 1XDUA 1Z6RA 5CQEA 1ODDA 4PSWA 2QA4I 4F93B 4KMUX 1LVAA 2BXZA 1OCRH 5L3FA 1JTXA 4UXNA 3TOAA 1JKQC 2WC2A 4KT5C 4N9HA 1D3YA 3I54A 2Z5UA 1YRNA 2XASA 3K4KA 1U9OA 3GTGJ 1SVOA 4PJJA 1K6YA 2EFNA 2WY8Q 3IAM2 1GUUA 1TTYA 1XMAA 3K1PA 5CVVA 5BMZA 1BI1A 2HTSA 2PQ8A 1FYKA 5M5YJ 1WJCA 2H8RA 2VE9A 3TW7A 1TP4A 1UJ8A 3NWTA 3PIPF 1Z3XA 4ZJZA 4XORA 1GXQA 4AM3A 1ZR2A 1QPIA 1P2FA 3FK7A 2QQBA 1MNDA 4I98B 5A2QZ 3L1PA 1P6RA 1CF7B 1AKHB 3M1CA 4DIQA 5EEGA 4HNUA 5D8LB 2YX7A 4IRIA 1FTTA 1BI2A 2FF4A 3EPZA 2MYSA 1XPXA 2OA4A 1Y39A 2JWTA 3CP2A 1ETKA 2L5QA 3KP3A 1HSJA 2IGNA 2P5VA 1G4DA 4LJZF 3PNTA 3GZ5A 4G6DA 2TCTA 4RM2A 2CGPA 4F7ZA 2XAUA 5DDGA 1Y8RB 1HBXG 3L00A 3ZMDA 4F52A 4M3BA 2F5CA 4BHCA 1R5ID 3BR6A 5HDNA 4FCYA 1YQAA 2ZXJA 1G59A 3KEYA 1EH8A 3LSMA 2KZGA 2A69F 2P6TA 3HZJA 2KIMA 3BR1A 4TV7A 4X1EA 5D5XB 2CMPA 3VEPA 2HKOA 3VYTB 3OMYA 1QHHD 1ENHA 3GMEA 1J75A 1MJ9A 2CH0A 2X85A 3LSPA 3LWFA 1J09A 2ZKZA 3M8JA 4OWRB 1T39A 4S04A 3IUOA 2OBPA 2KJBA 2P7VB 4CA0A 3H9GA 3KYLA 3I58A 1S5LC 3ZQIA 2BHZA 1APLC 4HLYA 2VKDA 4D5CA 3VWBA 4XRMA 4L5JA 4YIRX 3V8JA 2LD5A 2DMQA 5D5UB 2VL8A 3LSHA 1S7OA 3H3UA 4UY8I 1YW9A 3LSTA 4L0YB 2PJRB 3OIOA 2R93J 5BS6A 2R7VA 2OAZA 2RN7A 2R7RA 3DPTA 1H88C 1JTYA 2KT0A 3C7JA 3WG9A 2K5CA 3CCSI 1XS9A 4IHVA 4CSWA 3FIWA 3SFZA 5CLSA 3ULQB 1KU3A 1IRFA 3RQIA 4ANJA 5LLQA 1Z67A 2K02A 3B02A 4ENNA 4P9UA 3RYRA 1LEBA 6PAXA 3FKIJ 1WJBA 4GYGA 3OYGA 3MKWB 1QQIA 2FJ1A 1IN5A 1Z7LA 4BU2A 2K86A 3D5LA 4U0VA 4NB5A 3LSRA 4IJAA 4WXDA 1PP7U 4QTRA 2NVTJ 1QZEA 2R92J 3FK6A 4CXFA 4MFEA 3HOUJ 4U7DA 2P5LC 1FSHA 2X48A 4YFXF 4U0WA 3S93A 3I4NJ 1K78A 5LHGA 1NG6A 2HFHA 2WV1A 3E97A 2FRHA 2YSRA 1BI3A 1LUJB 1OYIA 2TRTA 5IYDJ 3S1QJ 2XHKA 1X2MA 1YW7A 3WTWC 3LQRA 2VKVA 2HQAA 1YX5A 2AQEA 2RQPA 4XM3A 1O3QA 4HLXA 4I02A 3RYPA 1FT9A 3CZ6A 1AU7A 5FLXZ 5D6EA 3RCOA 3E6MA 4UV9A 4JQFA 1VQ9I 4LIUA 2CUJA 5C4XJ 2XRLA 5CVIA 4I0AA 2X6YA 4S05A 2LLKA 1YJNI 2D5VA 2VBZA 5HOOA 2C6YA 1G6NA 3ZN0A 2NVUB 4U0YA 5D4RA 2M4GA 2BV6A 1V54H 2VC1A 3SFIA 1LB2A 1H8AC 2R7OA 3SYTA 1U78A 4HPQA 4G7OF 2DFFA 1MBJA 2ESNA 3TO6A 3DTKA 3CDHA 2HXOA 2F5FA 1S29A 4GRIA 4FT8A 1S8NA 2LH9A 4IVNA 3VPRA 1GVJA 4NC6A 2HDWA 1YYVA 2HDCA 1J59A 2VKEA 2OPTA 2QCOA 1YITI 5EDNA 5HNFA 3CTAA 1SVLA 4HX4A 2NVYJ 2OTLI 5D8KB 2JJ7A 1G3SA 2STWA 1ULYA 3TL4X 4CH7A 4II3A 2GXGA 2VJ4A 2ADUA 2AXLA 4DBQA 1V4RA 1SMYF 5J1YA 1T0FC 1R5GA 5FFXA 2RGVA 1AWCA 3SZTA 3I5UA 4EGZA 2V26A 3S1MJ 3WTZA 2NNYA 5H6QA 2M45A 1YFHA 1FMWA 1B8IA 3HTSB 1O4XA 2CQQA 2JQ7A 2XGCA 2DLLA 4DQ2A 3Q0UA 1R5HA 3CJTB 3J81K 4CDGA 3BTJA 2DA5A 4OIQF 1R7JA 2LY1A 1EV7A 5F6FA 4LK1F 3DEEA 5HVQC 4C30A 3FXJA 2QLZA 2OZUA 1UMQA 2XKOA 1DQUA 3BCAA 3OSFA 2LSOA 4LG3A 2VKHA 3OS2A 3HSEA 3WHBA 4RGUA 1JT6A 1ZARA 2RNJA 5B1BH 4G7HF 2R5YB 3I4PA 3D5RC 3LSIA 1WCMJ 2GA2A 2KIUA 3H9QA 4XOPA 3BG3A 2DT7B 2Y0SA 1MJBA 4V2FA 2DYSH 3FBIB 1QVUA 3HIFA 2X6OA 2DDBA 3RKYA 3S1RJ 2Q1ZB 2VBYA 4XL9A 1AHDP 5IP7J 3SDGA 3HKZA 2R4GA 3CMEI 2LK2A 4KJZA 1HDPA 3HG9A 4NDLA 1RETA 4LLNA 1OPCA 3KP2A 2FSWA 1BR4A 2WV0A 3UKGA 3GZNB 3EDPA 1VQLI 3S2HJ 4Y13A 1XD7A 5EEAA 3GLXA 5C4JJ 3V42A 3GFLA 3OYDA 1FOKA 4MIMA 1HW5A 3I59A 3JR9A 2UXNA 1EJ9A 1FIPA 3BY6A 4PGHA 4U7BA 4PJNA 3K4NA 1IN7A 2V9VA 3N05A 4DYRA 3IV5A 3VOEA 3MAJA 3OR1C 4HEA2 4IL6C 4B09A 4XICA 3IH4A 1VQ8I 2IT0A 2JTVA 4RAYA 1IW7F 1MMNA 2Y0MA 2JK3A 2KP6A 2CW7A 3AG2H 1FEXA 4M3FA 2L7ZA 1RIOH 4XRSA 4IKFA 4KYWA 2K9LA 4KDPA 4I09A 4O3MA 2KQRA 4GGGA 5IYCJ 1JKOC 3AG1H 4G94A 2MBFA 4LLLA 3MMYB 4N4NB 1IN4A 4B1RA 4LK0F 3V7SA 1REPC 5L3BA 4L9JA 2CQXA 3PO2J 1XB4A 3VODA 3S32A 1VTNC 2NOJB 2VOOA 2GXBA 1UFMA 4NUBA 3SZGA 5BQTA 3BG9A 1ZTRA 1HKQA 2JA7J 3CMYA 2M0MA 1W7PA 5JR3A 2O3FA 3KP7A 1A6QA 2NOGA 4BE2A 3HOXJ 4HF2A 4EJOA 1Q1VA 1T0FA 3EETA 3L7WA 4E7HA 1Z6TA 1C0WA 2L7KA 1HQCA 2JPBA 2MC4A 3JRDA 1P7JA 3F8MA 1S72I 1LDDA 1FP2A 2HVSA 4FASD 3Q9VA 4CCLA 4A0YA 1F9NA 2DA4A 2M30A 3RI4A 4E70A 3HDDA 2NS8A 3M7GA 2PMHA 5C3EJ 1R00A 4HNTA 2NRAC 1LEAA 3OIPA 4S0HB 4L18B 4A3LJ 3A03A 2J5OA 2KISA 4UUTA 2J5PA 2PG4A 1R4MB 3S1NJ 4I99C 3CP8A 2ZBKA 3NARA 3FM3A 5KAIC 1OLTA 2EWNA 5K7ZA 4EM2A 1R1UA 2R7TA 4CCOA 3H36A 4IHXA 3QYBA 1TWAJ 4MLOA 4AUXA 3QYFA 3ZMSA 4N0BA 2QF7A 2DT5A 5M3MJ 2EPFA 2RDPA 3JSOA 1U6GA 2JSCA 3DKWA 1SVMA 3CCEI 4KN7X 1B72B 4PSXA 3BR5A 1T8IA 5FGMA 2ZXIA 1FPQA 3PUFA 3LA7A 5GPAA 3KPHA 5IPAA 4BBSJ 2ISYA 3D1NI 4BXFA 3RKWA 1POGA
chains in the Genus database with same CATH topology
2DPUA 4OINF 2DW4A 4BQAA 2DAOA 4IHTA 3KCCA 3ZMTA 1YTYA 4GXOA 4P5OA 3E6DA 1XSDA 1BBYA 2MA3A 4WX9A 3U2RA 2H27A 1U5TB 1FLIA 4KIFA 2A6EF 3IRQA 2LKPA 4G9YA 1IN8A 4P96A 1UCRA 3BP8A 1TLHB 2NS0A 5AIPA 3QU3A 3H3ZA 4KA4A 1T98A 3T8RA 5A2QK 1SAXA 4XSXF 5JFRA 3K9TA 2FBHA 3FX3A 4L9VA 3R0AA 3GF2A 3KP5A 2VONA 4M6YA 1I27A 4GYIA 5E1ZB 1TQPA 5D6FA 3PFIA 1F1ZA 1RZ4A 2EV0A 2QZ8A 2Y48A 2M87A 4RGXA 2XAQA 2F5EA 4IRGA 2GWRA 4XSZF 3DFGA 3MCZA 2X4HA 1B4AA 4FHTA 5AIQA 5DD8A 4BH9A 3MZHA 1HKTA 1XSVA 2ISZA 3KZZA 4RGSA 4ETSA 1CGPA 1JE8A 2IRFG 4ZH4F 5LHIA 3J7AO 1RNLA 3PQJA 4P9FA 3VB2A 4KFCA 4WXCA 1ZRFA 3JSPA 3JTGA 2FOKA 5ED4A 2M5WA 1R58A 2VT3A 1SD5A 2XAHA 1KQ9A 3FXQA 4HV6A 1S6LA 5HDKA 4EMSA 1Z9CA 3TKYA 4Q4ZF 3GEZA 3P7NA 4A12A 1HW1A 2CFXA 1XCVA 5DCFA 4MQVA 5ICFA 1W4MA 4OMZA 3L2CA 4GCVA 3T1BA 1U2WA 3KE2A 4G7ZF 4M9SA 1EH6A 2MD5A 3L09A 3H92A 2CO5A 1YG2A 3ZMUA 2X0LA 5FLXK 1FBSA 4RAZA 1PP8F 1L3LA 5E18F 3BJ6A 1BC8C 4A6DA 3P9CA 3QOPA 1BIAA 1MZBA 2FA5A 4XLPF 2RKHA 2Z9OA 1SFXA 2O03A 2A6HF 1XN7A 3CO7C 2VN2A 1W5TA 1RUOA 2HWVA 2ZO4A 3EYYA 2L3DA 5LRRA 1DUXC 1IXRC 5HLIA 3W6JB 1IUYA 2NNNA 1I5ZA 1I1GA 1GHCA 2FNAA 1NHAA 2JT1A 2HYFA 2O0YA 4AVPA 4CHUA 5DYMA 2HYGD 1BM9A 3W6KB 1DDNA 4ESFA 1FBQA 2D1VA 4O5VA 1USSA 3E6CC 2CQKA 4MEXF 3KLNA 1XDSA 1QPMA 3ELKA 1FBUA 5KK1A 3HHGA 1J0RA 4RB0A 3REOA 4MTDA 1KGSA 4Q47A 2FU4A 1QZYA 1YIOA 3GFMA 4BYYA 2RV8A 3SXYA 3COAC 3C3WA 1D8JA 2JPCA 5E20A 2K4JA 2QUFA 3DF8A 1BJAA 2K4BA 4H0EA 1UHMA 1U5TC 4YIFA 5DD4A 3K2ZA 4IF4A 1IXCA 1HXDA 2FNPA 3O6BB 4KUMA 4UVCA 5JVTA 1MKMA 3WGGA 5E1WA 4NHJA 2FE3A 1WI9A 1LDKB 3KP4A 3OOPA 1XGNA 3JW4A 3KZYA 3CO6C 1AOYA 5J6XA 1TQMA 2HEOA 2QQAA 2G9WA 3QPTA 2GAUA 2Q0OA 3Q5FA 3L9FA 3E5QA 1JHHA 5D4SA 3V8KA 3WTVC 2IA0A 3MZYA 4Q48A 1F5TA 4UV8A 5LEKA 3FXUA 1E2XA 5KVRA 5BPIA 3DP7A 5CYVA 4M72A 4G6QA 4ZYEA 4A6EA 4R79A 1B1BA 1FZPB 1FYMA 3GUDA 3IHUA 3ZMZA 3NQOA 1DP7P 4LFUA 3T0YA 1H9TA 2VBWA 3F8NA 2H6BA 2FBKA 3F72A 4HDVA 4HBLA 1ON1A 5K5OA 4HYEA 1QBJA 4XRFA 4UVBA 1QO0D 1ZAOA 3KEQA 5TJJA 1X3UA 3MWMA 2IA1A 5L3CA 2Q8KA 4OIOF 1SD4A 2L01A 3FMQA 1HKSA 3GO5A 3TDUC 3DQVC 2L4AA 4ZZLA 4CZZA 4I7HA 5ICCA 4HF1A 3E3VA 1LNWA 3IL2A 4M6XA 3HRTA 2MLGA 1Z1DA 4MEYF 1LJ9A 2ZMEB 2COMA 2GIVA 2P7CB 2OQGA 5E1XA 5DUIA 1P4AA 1EH7A 2Z99A 5ILSA 2A3SA 1O7LA 2W84A 3M8EA 1D8KA 4YFNF 3I0TA 4WWCA 5F1RA 2BE5F 4LD5A 2D1HA 1O3TA 2L02A 1J9IA 2EFWA 4HX8A 2UWMA 3WE2A 4JK1X 2O8XA 3DV8A 1IRGA 1G3TA 2EFPA 4L9NA 1R1TA 3B73A 5L3EA 4RB1A 3HRUA 1ZREA 3ECOA 4AIHA 3EYIA 3BZ6A 4DNCA 1F4KA 3TOBA 2VBXA 2A61A 4ZYGA 2EV5A 3PQKA 4CGZA 3HYIA 3KFWX 3F23A 1OR7A 4ESJA 2RVCA 4ENJA 3ABTA 1P92A 3DPLC 5HS8A 2GZWA 2QENA 3N97A 1S7AA 2BYVE 3VFZA 5LHHA 4PGGA 3F8FA 2XRNA 1G3YA 4RGRA 1HSTA 1YW8A 2IP2A 1IXSB 3GX4X 1JHFA 2XVCA 2VOPA 1ZLJA 3F21A 1MJAA 2DI3A 3ZN1A 4NQWA 1ZG1A 3CJNA 2ZJ2A 4HOBA 2V1DA 2HR3A 3V4GA 4IXAA 3ECHA 3RDIA 3CLOA 3RIRA 1WRJA 2PI0A 1MDMB 2L54A 3P9IA 1OYWA 3HOSA 2XV4S 1J7KA 1OKRA 3E5UA 1JXSA 4AIKA 5E17F 4MTEA 3RJPA 3R61A 1O3RA 4IPAA 1FSEA 2DU9A 2EB7A 2BBYA 3J81Z 3WE3A 2HOEA 3K1NA 2Q2EA 1CF7A 2QBYB 2EJRA 3SHFA 5FD6A 1USTA 2F5DA 3HSFA 5HDGA 1H0MA 2K27A 1S3JA 2Z3YA 2YU3A 3BPXA 3WTUC 4U88A 2K7LA 5HLHA 2HTJA 2M1BA 2WTEA 2ZCWA 3BDDA 2VC0A 3J80Z 1BN5A 3MFKA 2QWWA 5IT9Z 3R4KA 2EFOA 3E6BA 5ICEA 1ZRDA 2MH9A 3O3KA 3ERED 3JAMZ 3AAFA 2LNBA 3LQQA 3TO7A 4WK8F 4HA8A 1B9MA 1BI0A 3KETA 3FM5A 5E8IA 2M8EA 2BGCA 3CUQB 1FYLA 4OIPF 1Z05A 4M9ZA 1PDNC 3HRMA 2V79A 1IZ1A 5J8FA 4D0PA 1SD6A 4LB6B 4UUVA 4AD9A 1IAWA 4L5IA 3FWEA 3QP5A 1BIBA 2FBIA 1O3SA 4MNUA 5DUKA 1UB9A 2O6GE 2ETHA 5LGNA 1XGMA 5ICGA 3EUHA 2CSOA 5DCMB 2H09A 2ELHA 3GVAA 5TRDA 4M74A 1U3EM 3GXOA 2L4MA 2YX4A 3KP6A 3GFIA 2DPDA 1W7PB 2XAGA 1ZGAA 4MGRA 3NRVA 2O61A 1WWXA 1FWZA 3HSRA 4CYDA 4FX4A 2HKXA 2E7WA 3WTSC 3QU6A 4PCQA 2PLYA 2KRFA 4LGWA 4OU0A 2PFBA 2DO7A 5FFZA 1SFEA 4YG2F 1TNTA 3BROA 4M73A 4LLGF 4R8HA 3Q9SA 4FX0A 5F64A 5CVUA 4GO1A 3EQLF 2R7DA 1SMTA 4ESBA 2QM3A 4KN4X 3R6SA 1T2KA 1KU2A 2MC3A 4ZYDA 2LDUA 3IKTA 3HHHA 3ZPLA 5HS9A 4HW0A 2E7XA 3JTHA 4HX7A 4CO8A 5D5VB 1P4XA 5J8CA 2ZMEA 3MEXA 2HQNA 3WU1B 2P5KA 1ZG3A 1FX7A 3IWFA 1XGSA 5K1YA 2OQRA 4BXUA 4LG0B 1A04A 4HQEA 1ZYRF 3DEUA 4HDUA 1XSXA 1ONVA 3KEOA 1R1VA 1WSUA 3FMRA 3M8FA 1YS6A 2QYOA 4B8XA 2YR2A 4YIIA 4KMFA 3T8TA 4EVIA 4YFKF 4ZYHA 1WKMA 5BPDA 4UHTA 4EGYA 4OIRF 4Q5SF 5H6RA 2XGXA 5LBQA 1TW3A 3CUOA 1Z7UA 2DQLA 1IF1A 3DXJF 3F22A 2D45A 3SZPA 4QWQA 3ML6A 1FC3A 2KKOA 4HV5A 1W5SA 3QRFF 3BJOA 1RI7A 3WTTC 2H6CA 2LF8A 1LQ1A 1H9GA 3T5XA 5HS7A 4KIBA 4BHPA 1J2XA 1T6SA 1L0OC 1O57A 3ISPA 3GW2A 1KYZA 4ASNA 2ZNYA 3TDZC 1XMKA 5CJ9A 3G3ZA 2DK5A 3IWZA 4A5MA 3LA3A 1TW2A 1BC7C 3WU0A 3CUQC 3F6OA 3N4MA 2D2WA 3C18A 4EM1A 3P9KA 2MH2A 3FMSA 5ILUA 1O7FA 4MHGA 1U8RA 2TDXA 3QP6A 1GXPA 1TBXA 2VE8A 2EA2A 3M1EA 2A68F 2W24A 3E5XA 4JBAA 4PDKA 1QZZA 5DEQA 2P6SA 3F6VA 1SFUA 3V8LA 2W57A 2G7UA 1MDMA 4OMYA 4RS8A 3I64A 2YPRA 4MQ9F 1J5YA 3IKVA 4BNCA 3RPUA 5JI6A 2XIGA 2UXXA 1TNSA 2MLKA 2KJCA 3BWGA 4A0XA 4WF2A 3RTRA 2Z33A 1ZG5A 3TQNA 1U5TA 3U9GA 2VODA 1ZGJA 4EM0B 2QBYA 2R7FA 1KQ0A 2V6CA 3FXRA 4M71A 1WQ2A 2CYYA 4LB5A 1I6XA 2QVOA 4XBFA 4QLCU 1RUNA 5LGUA 2JZYA 4CICA 4RB2C 2EA4A 2A07F 3S2WA 4I01A 3WGHA 3R0JA 4I0BA 4EJWA 5L3DA 3F3XA 3U1DA 2FEZA 3C1DA 5FO5A 2JRTA 2W85A 2ZNZA 2PN6A 3J80K 2XROA 2EFQA 5IT9K 4UNOA 2VT2A 1FY7A 4A0ZA 2PMUA 1K7AA 3CUQA 2HGCA 2E1NA 2PBIA 4A2UA 3JAMK 1OMIA 1XGOA 4AWXB 1HW2A 3GYHX 1T38A 1QGPA 4O6JA 1ZLKA 5K5QA 1B59A 4ENKA 4LMYA 2UZKA 4WCGA 2HZTA 5DV5A 2ACJA 4IRHA 1BOAA 4M9XA 3TO9A 5LGTA 1STZA 5LEJA 2G7HA 6PAXA 3GFJA 1E17A 1UHWA 4EQQA 5BOXA 3I71A 5DCMA 4A5NA 1ZHFA 3MQ0A 1K6OA 2DQRA 1JGSA 2KIFA 4UVAA 4BHBA 1TQIA 2HQRA 4RB3C 2NAZA 4HQMA 2CWEA 2AS5F 1K78B 1ZN2A 3K1MA 1LDJA 3O2PE 1FNNA 4HF0A 3GWZA 2PEXA 1Y0UA 2BEOA 2FMYA 1YLFA 3HTUA 3FZVA 3ZQ7A 1XCBA 3K69A 2EK5A 4PZJA 2PJPA 3TGNA 2DTRA 2A5YB 2FMLA 3WTXC 1K79A 3V7CA 4Y17A 2XAFA 2FXAA 4EV0A 1W7PD 4K2EA 1ZH5A 4ON0A 1Z91A 3RKXA 1ZRCA 4WXHA 1Q1HA 4EJUA 1YO5C 5FD5A 3M9AA 1QNTA 1OYYA 2GA1A 2NYXA 2H94A 2VXZA 4G8XA 2XAJA 4I2OA 5CVJA 3F8BA 5HLGA 2OZ6A 5E8GA 2LF7A 2DFIA 1R23A 2CG4A 2IVMA 3HUGA 4IHSA 5L3GA 3ABUA 2DBBA 4EJVA 2DK8A 5ERIA 2CW0F 3D0SA 3ZP5A 4XLNF 4LG0A 3V7RA 4HZFA 3KLOA 4L9TA 1PUEE 1KA8A 1R36A 4R1HA 1MGTA 1P4WA 2STTA 2ZFWA 3BJAA 3WGIA 2FQ3A 3SQNA 1SD7A 3IC7A 5JHUA 2P8TA 2IA2A 3QPHA 3LAJA 1I1SA 5D5WB 3FHZA 4KIGA 1B9NA 3I53A 4BAYA 2P4WA 3K0LA 4ZZDA 2R3SA 3LA2A 2F2EA 1KQ8A 3I59B 4N9IA 3HOTA 2XUBA 1D5VA 5ILVA 3G73A 3F8CA 2EV6A 2HS5A 1B6AA 3BOQA 1IN6A 5IT3A 3QAHA 2ESHA 4EJTA 2V1XA 3IRRA 2Y75A 3WODF 2E1CA 4AIJA 4ENMA 4L0ZB 1G3WA 3LAPA 2OD5A 4KICA 2IJLA 3R60A 3HRSA 4Y15A 2GQQA 1DPUA 5K5RA 2RC4A 2IPQX 4KNYA 3FF5A 5EEHA 2OU2A 2WWYA 5CVRA 1KU9A 2QQ9A 2V1UA 2W25A 4HAMA 4P55A 1MD0A 4Z2YA 5H20A 5LRSA 3LFKA 1R22A 3GZ6A 1KYWA 2XKPA 3ZMVA 3OV8A 5AONA 1ON2A 3BPVA 3WTYC 1FP1D 1V3FA 2B0LA 5FB2A 1KU7A 4OOIA 3RPQA 3NEUA 2IW5A 1YS7A 3ROUA 1DPRA 1XDUA 1Z6RA 1ODDA 4KMUX 1LVAA 5L3FA 4UXNA 3TOAA 2WC2A 4KT5C 4N9HA 1D3YA 3I54A 2Z5UA 2XASA 2EFNA 1TTYA 1XMAA 3K1PA 5CVVA 5BMZA 1BI1A 2HTSA 2PQ8A 1FYKA 2VE9A 1GXQA 1P2FA 2QQBA 5A2QZ 4I98B 1CF7B 1P6RA 5EEGA 5D8LB 2YX7A 4IRIA 1BI2A 2FF4A 2OA4A 3KP3A 1HSJA 2P5VA 1G4DA 4LJZF 3GZ5A 4G6DA 2CGPA 4F7ZA 5DDGA 1HBXG 3L00A 3ZMDA 2F5CA 4BHCA 5HDNA 1YQAA 2ZXJA 1EH8A 2A69F 2P6TA 2KIMA 5D5XB 4TV7A 3VEPA 2HKOA 1J75A 1MJ9A 3LWFA 2ZKZA 1T39A 4S04A 2OBPA 2KJBA 2P7VB 3I58A 4HLYA 4L5JA 3V8JA 5D5UB 1S7OA 3H3UA 1YW9A 3LSTA 4L0YB 5BS6A 2OAZA 2RN7A 3DPTA 3C7JA 3WG9A 3SFZA 3ULQB 5CLSA 1KU3A 1IRFA 5LLQA 2K02A 3B02A 4ENNA 4P9UA 3RYRA 1LEBA 4GYGA 1QQIA 1IN5A 2K86A 3D5LA 4U0VA 4NB5A 4IJAA 4WXDA 1PP7U 4CXFA 4U7DA 2P5LC 1FSHA 4YFXF 4U0WA 1K78A 5LHGA 2HFHA 3E97A 2FRHA 1BI3A 2YSRA 1OYIA 2XHKA 1YW7A 3WTWC 3LQRA 2RQPA 1O3QA 4HLXA 4I02A 3RYPA 1FT9A 5FLXZ 5D6EA 3E6MA 4UV9A 4JQFA 5CVIA 4I0AA 4S05A 2VBZA 5HOOA 2C6YA 1G6NA 3ZN0A 4U0YA 5D4RA 2BV6A 2VC1A 1LB2A 1U78A 4G7OF 2ESNA 3TO6A 3CDHA 2F5FA 1S29A 4FT8A 1S8NA 4IVNA 1GVJA 1YYVA 2HDCA 1J59A 3CTAA 4HX4A 5D8KB 1G3SA 2STWA 1ULYA 2GXGA 2ADUA 2AXLA 1V4RA 1SMYF 1R5GA 5FFXA 2RGVA 1AWCA 3SZTA 3I5UA 4EGZA 3WTZA 2NNYA 5H6QA 2M45A 1YFHA 3HTSB 2DLLA 4DQ2A 1R5HA 3J81K 4CDGA 4OIQF 1R7JA 1EV7A 5F6FA 4LK1F 5HVQC 2QLZA 2OZUA 2XKOA 2LSOA 3HSEA 4RGUA 1ZARA 2RNJA 4G7HF 3I4PA 2GA2A 2KIUA 1MJBA 3HIFA 3RKYA 2VBYA 4LLNA 1OPCA 3KP2A 2FSWA 2WV0A 3EDPA 4Y13A 1XD7A 3GLXA 3GFLA 1FOKA 1HW5A 3I59A 2UXNA 3BY6A 4PGHA 4U7BA 1IN7A 2V9VA 3VOEA 3MAJA 4B09A 2IT0A 2JTVA 4RAYA 1IW7F 2Y0MA 1RIOH 4KYWA 4KDPA 4I09A 4O3MA 4GGGA 4G94A 2MBFA 4LLLA 1IN4A 4LK0F 3V7SA 1REPC 5L3BA 4L9JA 1XB4A 3VODA 1VTNC 2VOOA 2GXBA 1UFMA 5BQTA 1HKQA 1W7PA 5JR3A 2O3FA 3KP7A 4HF2A 4EJOA 3EETA 1T0FA 3L7WA 1Z6TA 1C0WA 1HQCA 2JPBA 3F8MA 1LDDA 1FP2A 3Q9VA 4A0YA 1F9NA 2M30A 3RI4A 4E70A 3M7GA 2PMHA 1R00A 2NRAC 1LEAA 4L18B 2J5OA 2J5PA 2PG4A 2ZBKA 3FM3A 2EWNA 4EM2A 1R1UA 3ZMSA 4N0BA 2DT5A 2RDPA 3JSOA 1U6GA 2JSCA 3DKWA 4KN7X 5FGMA 1FPQA 3LA7A 2ISYA 3RKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DPU A;  4OIN F;  2DW4 A;  4BQA A;  2DAO A;  4IHT A;  3KCC A;  3ZMT A;  1YTY A;  4GXO A;  4P5O A;  3E6D A;  1XSD A;  1BBY A;  2MA3 A;  4WX9 A;  3U2R A;  2H27 A;  1U5T B;  1FLI A;  4KIF A;  2A6E F;  3IRQ A;  2LKP A;  4G9Y A;  1IN8 A;  4P96 A;  1UCR A;  3BP8 A;  1TLH B;  2NS0 A;  5AIP A;  3QU3 A;  3H3Z A;  4KA4 A;  1T98 A;  3T8R A;  5A2Q K;  1SAX A;  4XSX F;  5JFR A;  3K9T A;  2FBH A;  3FX3 A;  4L9V A;  3R0A A;  3GF2 A;  3KP5 A;  2VON A;  4M6Y A;  1I27 A;  4GYI A;  5E1Z B;  1TQP A;  5D6F A;  3PFI A;  1F1Z A;  1RZ4 A;  2EV0 A;  2QZ8 A;  2Y48 A;  2M87 A;  4RGX A;  2XAQ A;  2F5E A;  4IRG A;  2GWR A;  4XSZ F;  3DFG A;  3MCZ A;  2X4H A;  1B4A A;  4FHT A;  5AIQ A;  5DD8 A;  4BH9 A;  3MZH A;  1HKT A;  1XSV A;  2ISZ A;  3KZZ A;  4RGS A;  4ETS A;  1CGP A;  1JE8 A;  2IRF G;  4ZH4 F;  5LHI A;  3J7A O;  1RNL A;  3PQJ A;  4P9F A;  3VB2 A;  4KFC A;  4WXC A;  1ZRF A;  3JSP A;  3JTG A;  2FOK A;  5ED4 A;  2M5W A;  1R58 A;  2VT3 A;  1SD5 A;  2XAH A;  1KQ9 A;  3FXQ A;  4HV6 A;  1S6L A;  5HDK A;  4EMS A;  1Z9C A;  3TKY A;  4Q4Z F;  3GEZ A;  3P7N A;  4A12 A;  1HW1 A;  2CFX A;  1XCV A;  5DCF A;  4MQV A;  5ICF A;  1W4M A;  4OMZ A;  3L2C A;  4GCV A;  3T1B A;  1U2W A;  3KE2 A;  4G7Z F;  4M9S A;  1EH6 A;  2MD5 A;  3L09 A;  3H92 A;  2CO5 A;  1YG2 A;  3ZMU A;  2X0L A;  5FLX K;  1FBS A;  4RAZ A;  1PP8 F;  1L3L A;  5E18 F;  3BJ6 A;  1BC8 C;  4A6D A;  3P9C A;  3QOP A;  1BIA A;  1MZB A;  2FA5 A;  4XLP F;  2RKH A;  2Z9O A;  1SFX A;  2O03 A;  2A6H F;  1XN7 A;  3CO7 C;  2VN2 A;  1W5T A;  1RUO A;  2HWV A;  2ZO4 A;  3EYY A;  2L3D A;  5LRR A;  1DUX C;  1IXR C;  5HLI A;  3W6J B;  1IUY A;  2NNN A;  1I5Z A;  1I1G A;  1GHC A;  2FNA A;  1NHA A;  2JT1 A;  2HYF A;  2O0Y A;  4AVP A;  4CHU A;  5DYM A;  2HYG D;  1BM9 A;  3W6K B;  1DDN A;  4ESF A;  1FBQ A;  2D1V A;  4O5V A;  1USS A;  3E6C C;  2CQK A;  4MEX F;  3KLN A;  1XDS A;  1QPM A;  3ELK A;  1FBU A;  5KK1 A;  3HHG A;  1J0R A;  4RB0 A;  3REO A;  4MTD A;  1KGS A;  4Q47 A;  2FU4 A;  1QZY A;  1YIO A;  3GFM A;  4BYY A;  2RV8 A;  3SXY A;  3COA C;  3C3W A;  1D8J A;  2JPC A;  5E20 A;  2K4J A;  2QUF A;  3DF8 A;  1BJA A;  2K4B A;  4H0E A;  1UHM A;  1U5T C;  4YIF A;  5DD4 A;  3K2Z A;  4IF4 A;  1IXC A;  1HXD A;  2FNP A;  3O6B B;  4KUM A;  4UVC A;  5JVT A;  1MKM A;  3WGG A;  5E1W A;  4NHJ A;  2FE3 A;  1WI9 A;  1LDK B;  3KP4 A;  3OOP A;  1XGN A;  3JW4 A;  3KZY A;  3CO6 C;  1AOY A;  5J6X A;  1TQM A;  2HEO A;  2QQA A;  2G9W A;  3QPT A;  2GAU A;  2Q0O A;  3Q5F A;  3L9F A;  3E5Q A;  1JHH A;  5D4S A;  3V8K A;  3WTV C;  2IA0 A;  3MZY A;  4Q48 A;  1F5T A;  4UV8 A;  5LEK A;  3FXU A;  1E2X A;  5KVR A;  5BPI A;  3DP7 A;  5CYV A;  4M72 A;  4G6Q A;  4ZYE A;  4A6E A;  4R79 A;  1B1B A;  1FZP B;  1FYM A;  3GUD A;  3IHU A;  3ZMZ A;  3NQO A;  1DP7 P;  4LFU A;  3T0Y A;  1H9T A;  2VBW A;  3F8N A;  2H6B A;  2FBK A;  3F72 A;  4HDV A;  4HBL A;  1ON1 A;  5K5O A;  4HYE A;  1QBJ A;  4XRF A;  4UVB A;  1QO0 D;  1ZAO A;  3KEQ A;  5TJJ A;  1X3U A;  3MWM A;  2IA1 A;  5L3C A;  2Q8K A;  4OIO F;  1SD4 A;  2L01 A;  3FMQ A;  1HKS A;  3GO5 A;  3TDU C;  3DQV C;  2L4A A;  4ZZL A;  4CZZ A;  4I7H A;  5ICC A;  4HF1 A;  3E3V A;  1LNW A;  3IL2 A;  4M6X A;  3HRT A;  2MLG A;  1Z1D A;  4MEY F;  1LJ9 A;  2ZME B;  2COM A;  2GIV A;  2P7C B;  2OQG A;  5E1X A;  5DUI A;  1P4A A;  1EH7 A;  2Z99 A;  5ILS A;  2A3S A;  1O7L A;  2W84 A;  3M8E A;  1D8K A;  4YFN F;  3I0T A;  4WWC A;  5F1R A;  2BE5 F;  4LD5 A;  2D1H A;  1O3T A;  2L02 A;  1J9I A;  2EFW A;  4HX8 A;  2UWM A;  3WE2 A;  4JK1 X;  2O8X A;  3DV8 A;  1IRG A;  1G3T A;  2EFP A;  4L9N A;  1R1T A;  3B73 A;  5L3E A;  4RB1 A;  3HRU A;  1ZRE A;  3ECO A;  4AIH A;  3EYI A;  3BZ6 A;  4DNC A;  1F4K A;  3TOB A;  2VBX A;  2A61 A;  4ZYG A;  2EV5 A;  3PQK A;  4CGZ A;  3HYI A;  3KFW X;  3F23 A;  1OR7 A;  4ESJ A;  2RVC A;  4ENJ A;  3ABT A;  1P92 A;  3DPL C;  5HS8 A;  2GZW A;  2QEN A;  3N97 A;  1S7A A;  2BYV E;  3VFZ A;  5LHH A;  4PGG A;  3F8F A;  2XRN A;  1G3Y A;  4RGR A;  1HST A;  1YW8 A;  2IP2 A;  1IXS B;  3GX4 X;  1JHF A;  2XVC A;  2VOP A;  1ZLJ A;  3F21 A;  1MJA A;  2DI3 A;  3ZN1 A;  4NQW A;  1ZG1 A;  3CJN A;  2ZJ2 A;  4HOB A;  2V1D A;  2HR3 A;  3V4G A;  4IXA A;  3ECH A;  3RDI A;  3CLO A;  3RIR A;  1WRJ A;  2PI0 A;  1MDM B;  2L54 A;  3P9I A;  1OYW A;  3HOS A;  2XV4 S;  1J7K A;  1OKR A;  3E5U A;  1JXS A;  4AIK A;  5E17 F;  4MTE A;  3RJP A;  3R61 A;  1O3R A;  4IPA A;  1FSE A;  2DU9 A;  2EB7 A;  2BBY A;  3J81 Z;  3WE3 A;  2HOE A;  3K1N A;  2Q2E A;  1CF7 A;  2QBY B;  2EJR A;  3SHF A;  5FD6 A;  1UST A;  2F5D A;  3HSF A;  5HDG A;  1H0M A;  2K27 A;  1S3J A;  2Z3Y A;  2YU3 A;  3BPX A;  3WTU C;  4U88 A;  2K7L A;  5HLH A;  2HTJ A;  2M1B A;  2WTE A;  2ZCW A;  3BDD A;  2VC0 A;  3J80 Z;  1BN5 A;  3MFK A;  2QWW A;  5IT9 Z;  3R4K A;  2EFO A;  3E6B A;  5ICE A;  1ZRD A;  2MH9 A;  3O3K A;  3ERE D;  3JAM Z;  3AAF A;  2LNB A;  3LQQ A;  3TO7 A;  4WK8 F;  4HA8 A;  1B9M A;  1BI0 A;  3KET A;  3FM5 A;  5E8I A;  2M8E A;  2BGC A;  3CUQ B;  1FYL A;  4OIP F;  1Z05 A;  4M9Z A;  1PDN C;  3HRM A;  2V79 A;  1IZ1 A;  5J8F A;  4D0P A;  1SD6 A;  4LB6 B;  4UUV A;  4AD9 A;  1IAW A;  4L5I A;  3FWE A;  3QP5 A;  1BIB A;  2FBI A;  1O3S A;  4MNU A;  5DUK A;  1UB9 A;  2O6G E;  2ETH A;  5LGN A;  1XGM A;  5ICG A;  3EUH A;  2CSO A;  5DCM B;  2H09 A;  2ELH A;  3GVA A;  5TRD A;  4M74 A;  1U3E M;  3GXO A;  2L4M A;  2YX4 A;  3KP6 A;  3GFI A;  2DPD A;  1W7P B;  2XAG A;  1ZGA A;  4MGR A;  3NRV A;  2O61 A;  1WWX A;  1FWZ A;  3HSR A;  4CYD A;  4FX4 A;  2HKX A;  2E7W A;  3WTS C;  3QU6 A;  4PCQ A;  2PLY A;  2KRF A;  4LGW A;  4OU0 A;  2PFB A;  2DO7 A;  5FFZ A;  1SFE A;  4YG2 F;  1TNT A;  3BRO A;  4M73 A;  4LLG F;  4R8H A;  3Q9S A;  4FX0 A;  5F64 A;  5CVU A;  4GO1 A;  3EQL F;  2R7D A;  1SMT A;  4ESB A;  2QM3 A;  4KN4 X;  3R6S A;  1T2K A;  1KU2 A;  2MC3 A;  4ZYD A;  2LDU A;  3IKT A;  3HHH A;  3ZPL A;  5HS9 A;  4HW0 A;  2E7X A;  3JTH A;  4HX7 A;  4CO8 A;  5D5V B;  1P4X A;  5J8C A;  2ZME A;  3MEX A;  2HQN A;  3WU1 B;  2P5K A;  1ZG3 A;  1FX7 A;  3IWF A;  1XGS A;  5K1Y A;  2OQR A;  4BXU A;  4LG0 B;  1A04 A;  4HQE A;  1ZYR F;  3DEU A;  4HDU A;  1XSX A;  1ONV A;  3KEO A;  1R1V A;  1WSU A;  3FMR A;  3M8F A;  1YS6 A;  2QYO A;  4B8X A;  2YR2 A;  4YII A;  4KMF A;  3T8T A;  4EVI A;  4YFK F;  4ZYH A;  1WKM A;  5BPD A;  4UHT A;  4EGY A;  4OIR F;  4Q5S F;  5H6R A;  2XGX A;  5LBQ A;  1TW3 A;  3CUO A;  1Z7U A;  2DQL A;  1IF1 A;  3DXJ F;  3F22 A;  2D45 A;  3SZP A;  4QWQ A;  3ML6 A;  1FC3 A;  2KKO A;  4HV5 A;  1W5S A;  3QRF F;  3BJO A;  1RI7 A;  3WTT C;  2H6C A;  2LF8 A;  1LQ1 A;  1H9G A;  3T5X A;  5HS7 A;  4KIB A;  4BHP A;  1J2X A;  1T6S A;  1L0O C;  1O57 A;  3ISP A;  3GW2 A;  1KYZ A;  4ASN A;  2ZNY A;  3TDZ C;  1XMK A;  5CJ9 A;  3G3Z A;  2DK5 A;  3IWZ A;  4A5M A;  3LA3 A;  1TW2 A;  1BC7 C;  3WU0 A;  3CUQ C;  3F6O A;  3N4M A;  2D2W A;  3C18 A;  4EM1 A;  3P9K A;  2MH2 A;  3FMS A;  5ILU A;  1O7F A;  4MHG A;  1U8R A;  2TDX A;  3QP6 A;  1GXP A;  1TBX A;  2VE8 A;  2EA2 A;  3M1E A;  2A68 F;  2W24 A;  3E5X A;  4JBA A;  4PDK A;  1QZZ A;  5DEQ A;  2P6S A;  3F6V A;  1SFU A;  3V8L A;  2W57 A;  2G7U A;  1MDM A;  4OMY A;  4RS8 A;  3I64 A;  2YPR A;  4MQ9 F;  1J5Y A;  3IKV A;  4BNC A;  3RPU A;  5JI6 A;  2XIG A;  2UXX A;  1TNS A;  2MLK A;  2KJC A;  3BWG A;  4A0X A;  4WF2 A;  3RTR A;  2Z33 A;  1ZG5 A;  3TQN A;  1U5T A;  3U9G A;  2VOD A;  1ZGJ A;  4EM0 B;  2QBY A;  2R7F A;  1KQ0 A;  2V6C A;  3FXR A;  4M71 A;  1WQ2 A;  2CYY A;  4LB5 A;  1I6X A;  2QVO A;  4XBF A;  4QLC U;  1RUN A;  5LGU A;  2JZY A;  4CIC A;  4RB2 C;  2EA4 A;  2A07 F;  3S2W A;  4I01 A;  3WGH A;  3R0J A;  4I0B A;  4EJW A;  5L3D A;  3F3X A;  3U1D A;  2FEZ A;  3C1D A;  5FO5 A;  2JRT A;  2W85 A;  2ZNZ A;  2PN6 A;  3J80 K;  2XRO A;  2EFQ A;  5IT9 K;  4UNO A;  2VT2 A;  1FY7 A;  4A0Z A;  2PMU A;  1K7A A;  3CUQ A;  2HGC A;  2E1N A;  2PBI A;  4A2U A;  3JAM K;  1OMI A;  1XGO A;  4AWX B;  1HW2 A;  3GYH X;  1T38 A;  1QGP A;  4O6J A;  1ZLK A;  5K5Q A;  1B59 A;  4ENK A;  4LMY A;  2UZK A;  4WCG A;  2HZT A;  5DV5 A;  2ACJ A;  4IRH A;  1BOA A;  4M9X A;  3TO9 A;  5LGT A;  1STZ A;  5LEJ A;  2G7H A;  6PAX A;  3GFJ A;  1E17 A;  1UHW A;  4EQQ A;  5BOX A;  3I71 A;  5DCM A;  4A5N A;  1ZHF A;  3MQ0 A;  1K6O A;  2DQR A;  1JGS A;  2KIF A;  4UVA A;  4BHB A;  1TQI A;  2HQR A;  4RB3 C;  2NAZ A;  4HQM A;  2CWE A;  2AS5 F;  1K78 B;  1ZN2 A;  3K1M A;  1LDJ A;  3O2P E;  1FNN A;  4HF0 A;  3GWZ A;  2PEX A;  1Y0U A;  2BEO A;  2FMY A;  1YLF A;  3HTU A;  3FZV A;  3ZQ7 A;  1XCB A;  3K69 A;  2EK5 A;  4PZJ A;  2PJP A;  3TGN A;  2DTR A;  2A5Y B;  2FML A;  3WTX C;  1K79 A;  3V7C A;  4Y17 A;  2XAF A;  2FXA A;  4EV0 A;  1W7P D;  4K2E A;  1ZH5 A;  4ON0 A;  1Z91 A;  3RKX A;  1ZRC A;  4WXH A;  1Q1H A;  4EJU A;  1YO5 C;  5FD5 A;  3M9A A;  1QNT A;  1OYY A;  2GA1 A;  2NYX A;  2H94 A;  2VXZ A;  4G8X A;  2XAJ A;  4I2O A;  5CVJ A;  3F8B A;  5HLG A;  2OZ6 A;  5E8G A;  2LF7 A;  2DFI A;  1R23 A;  2CG4 A;  2IVM A;  3HUG A;  4IHS A;  5L3G A;  3ABU A;  2DBB A;  4EJV A;  2DK8 A;  5ERI A;  2CW0 F;  3D0S A;  3ZP5 A;  4XLN F;  4LG0 A;  3V7R A;  4HZF A;  3KLO A;  4L9T A;  1PUE E;  1KA8 A;  1R36 A;  4R1H A;  1MGT A;  1P4W A;  2STT A;  2ZFW A;  3BJA A;  3WGI A;  2FQ3 A;  3SQN A;  1SD7 A;  3IC7 A;  5JHU A;  2P8T A;  2IA2 A;  3QPH A;  3LAJ A;  1I1S A;  5D5W B;  3FHZ A;  4KIG A;  1B9N A;  3I53 A;  4BAY A;  2P4W A;  3K0L A;  4ZZD A;  2R3S A;  3LA2 A;  2F2E A;  1KQ8 A;  3I59 B;  4N9I A;  3HOT A;  2XUB A;  1D5V A;  5ILV A;  3G73 A;  3F8C A;  2EV6 A;  2HS5 A;  1B6A A;  3BOQ A;  1IN6 A;  5IT3 A;  3QAH A;  2ESH A;  4EJT A;  2V1X A;  3IRR A;  2Y75 A;  3WOD F;  2E1C A;  4AIJ A;  4ENM A;  4L0Z B;  1G3W A;  3LAP A;  2OD5 A;  4KIC A;  2IJL A;  3R60 A;  3HRS A;  4Y15 A;  2GQQ A;  1DPU A;  5K5R A;  2RC4 A;  2IPQ X;  4KNY A;  3FF5 A;  5EEH A;  2OU2 A;  2WWY A;  5CVR A;  1KU9 A;  2QQ9 A;  2V1U A;  2W25 A;  4HAM A;  4P55 A;  1MD0 A;  4Z2Y A;  5H20 A;  5LRS A;  3LFK A;  1R22 A;  3GZ6 A;  1KYW A;  2XKP A;  3ZMV A;  3OV8 A;  5AON A;  1ON2 A;  3BPV A;  3WTY C;  1FP1 D;  1V3F A;  2B0L A;  5FB2 A;  1KU7 A;  4OOI A;  3RPQ A;  3NEU A;  2IW5 A;  1YS7 A;  3ROU A;  1DPR A;  1XDU A;  1Z6R A;  1ODD A;  4KMU X;  1LVA A;  5L3F A;  4UXN A;  3TOA A;  2WC2 A;  4KT5 C;  4N9H A;  1D3Y A;  3I54 A;  2Z5U A;  2XAS A;  2EFN A;  1TTY A;  1XMA A;  3K1P A;  5CVV A;  5BMZ A;  1BI1 A;  2HTS A;  2PQ8 A;  1FYK A;  2VE9 A;  1GXQ A;  1P2F A;  2QQB A;  5A2Q Z;  4I98 B;  1CF7 B;  1P6R A;  5EEG A;  5D8L B;  2YX7 A;  4IRI A;  1BI2 A;  2FF4 A;  2OA4 A;  3KP3 A;  1HSJ A;  2P5V A;  1G4D A;  4LJZ F;  3GZ5 A;  4G6D A;  2CGP A;  4F7Z A;  5DDG A;  1HBX G;  3L00 A;  3ZMD A;  2F5C A;  4BHC A;  5HDN A;  1YQA A;  2ZXJ A;  1EH8 A;  2A69 F;  2P6T A;  2KIM A;  5D5X B;  4TV7 A;  3VEP A;  2HKO A;  1J75 A;  1MJ9 A;  3LWF A;  2ZKZ A;  1T39 A;  4S04 A;  2OBP A;  2KJB A;  2P7V B;  3I58 A;  4HLY A;  4L5J A;  3V8J A;  5D5U B;  1S7O A;  3H3U A;  1YW9 A;  3LST A;  4L0Y B;  5BS6 A;  2OAZ A;  2RN7 A;  3DPT A;  3C7J A;  3WG9 A;  3SFZ A;  3ULQ B;  5CLS A;  1KU3 A;  1IRF A;  5LLQ A;  2K02 A;  3B02 A;  4ENN A;  4P9U A;  3RYR A;  1LEB A;  4GYG A;  1QQI A;  1IN5 A;  2K86 A;  3D5L A;  4U0V A;  4NB5 A;  4IJA A;  4WXD A;  1PP7 U;  4CXF A;  4U7D A;  2P5L C;  1FSH A;  4YFX F;  4U0W A;  1K78 A;  5LHG A;  2HFH A;  3E97 A;  2FRH A;  1BI3 A;  2YSR A;  1OYI A;  2XHK A;  1YW7 A;  3WTW C;  3LQR A;  2RQP A;  1O3Q A;  4HLX A;  4I02 A;  3RYP A;  1FT9 A;  5FLX Z;  5D6E A;  3E6M A;  4UV9 A;  4JQF A;  5CVI A;  4I0A A;  4S05 A;  2VBZ A;  5HOO A;  2C6Y A;  1G6N A;  3ZN0 A;  4U0Y A;  5D4R A;  2BV6 A;  2VC1 A;  1LB2 A;  1U78 A;  4G7O F;  2ESN A;  3TO6 A;  3CDH A;  2F5F A;  1S29 A;  4FT8 A;  1S8N A;  4IVN A;  1GVJ A;  1YYV A;  2HDC A;  1J59 A;  3CTA A;  4HX4 A;  5D8K B;  1G3S A;  2STW A;  1ULY A;  2GXG A;  2ADU A;  2AXL A;  1V4R A;  1SMY F;  1R5G A;  5FFX A;  2RGV A;  1AWC A;  3SZT A;  3I5U A;  4EGZ A;  3WTZ A;  2NNY A;  5H6Q A;  2M45 A;  1YFH A;  3HTS B;  2DLL A;  4DQ2 A;  1R5H A;  3J81 K;  4CDG A;  4OIQ F;  1R7J A;  1EV7 A;  5F6F A;  4LK1 F;  5HVQ C;  2QLZ A;  2OZU A;  2XKO A;  2LSO A;  3HSE A;  4RGU A;  1ZAR A;  2RNJ A;  4G7H F;  3I4P A;  2GA2 A;  2KIU A;  1MJB A;  3HIF A;  3RKY A;  2VBY A;  4LLN A;  1OPC A;  3KP2 A;  2FSW A;  2WV0 A;  3EDP A;  4Y13 A;  1XD7 A;  3GLX A;  3GFL A;  1FOK A;  1HW5 A;  3I59 A;  2UXN A;  3BY6 A;  4PGH A;  4U7B A;  1IN7 A;  2V9V A;  3VOE A;  3MAJ A;  4B09 A;  2IT0 A;  2JTV A;  4RAY A;  1IW7 F;  2Y0M A;  1RIO H;  4KYW A;  4KDP A;  4I09 A;  4O3M A;  4GGG A;  4G94 A;  2MBF A;  4LLL A;  1IN4 A;  4LK0 F;  3V7S A;  1REP C;  5L3B A;  4L9J A;  1XB4 A;  3VOD A;  1VTN C;  2VOO A;  2GXB A;  1UFM A;  5BQT A;  1HKQ A;  1W7P A;  5JR3 A;  2O3F A;  3KP7 A;  4HF2 A;  4EJO A;  3EET A;  1T0F A;  3L7W A;  1Z6T A;  1C0W A;  1HQC A;  2JPB A;  3F8M A;  1LDD A;  1FP2 A;  3Q9V A;  4A0Y A;  1F9N A;  2M30 A;  3RI4 A;  4E70 A;  3M7G A;  2PMH A;  1R00 A;  2NRA C;  1LEA A;  4L18 B;  2J5O A;  2J5P A;  2PG4 A;  2ZBK A;  3FM3 A;  2EWN A;  4EM2 A;  1R1U A;  3ZMS A;  4N0B A;  2DT5 A;  2RDP A;  3JSO A;  1U6G A;  2JSC A;  3DKW A;  4KN7 X;  5FGM A;  1FPQ A;  3LA7 A;  2ISY A;  3RKW A; 
#chains in the Genus database with same CATH topology
 5J40 A;  2DPU A;  2DA3 A;  2RRE A;  3E1S A;  2R7Z J;  1IV6 A;  4OIN F;  2DW4 A;  4UB8 C;  4BQA A;  4BY1 J;  2DAO A;  4IHT A;  3EUH C;  3KCC A;  3ZMT A;  3HGG A;  3FIS A;  1YTY A;  4GXO A;  3M07 A;  4P5O A;  3E6D A;  1XSD A;  3A4C A;  2EIM H;  2IEK A;  1UZC A;  1BBY A;  2M0C A;  4BBR J;  2EZK A;  3JRG A;  3FXO A;  2MA3 A;  4WX9 A;  3U2R A;  3OYK A;  2H27 A;  1X3Z B;  2X6X A;  1U5T B;  1FLI A;  4C2M J;  5B3S H;  3CC4 I;  4KIF A;  2A6E F;  3IRQ A;  3BTC A;  2LKP A;  1DU0 A;  4G9Y A;  3CD6 I;  1IN8 A;  4C9Y A;  4P96 A;  1AKH A;  1UCR A;  3BP8 A;  1TLH B;  2NS0 A;  5AIP A;  5HNH A;  2K3P A;  3QU3 A;  3H3Z A;  4F92 B;  4KA4 A;  1PUF B;  4BJT A;  4Z6Y A;  1D5Y A;  3CF5 F;  2JSP A;  2CW8 A;  1BW5 A;  3TMO A;  1T98 A;  4J00 A;  2OF7 A;  3CC7 I;  3T8R A;  2JMW A;  1FJL A;  5KAF C;  2XF6 A;  5A2Q K;  5E3M A;  1SAX A;  2IXS A;  2O5R A;  4XSX F;  5JFR A;  1VQO I;  3K9T A;  4V2G A;  2EBI A;  2XF7 A;  4QPQ A;  2FBH A;  3FX3 A;  2ZJR F;  4L9V A;  3R0A A;  1D1A A;  2DMN A;  3GF2 A;  4XLC A;  1LVK A;  3GBG A;  5M5X J;  4Y52 J;  3KP5 A;  3QOD A;  2KPM A;  2R7U A;  4XRS G;  1RR8 C;  3AG3 H;  4D5F A;  1GV5 A;  2DMP A;  2VON A;  4M6Y A;  1JJ6 C;  1I27 A;  4P1W A;  4GYI A;  5F04 A;  5E1Z B;  2H8W A;  1TQP A;  5D6F A;  3PFI A;  1F1Z A;  3ASN H;  1RZ4 A;  1GVD A;  2EV0 A;  2QZ8 A;  1RES A;  2Y48 A;  5TGT A;  5FKN A;  2M87 A;  4RGX A;  2DA1 A;  2I8D A;  2Z1D A;  5GPC A;  2XAQ A;  2F5E A;  3S3O A;  3VSL A;  4IRG A;  3A02 A;  3GTQ J;  3ZR8 X;  2GWR A;  3BCB A;  4XSZ F;  3DFG A;  3MCZ A;  2X4H A;  1B4A A;  1YI2 I;  3Q0V A;  4FHT A;  2K9M A;  5AIQ A;  1WJ5 A;  1IO2 A;  2GIZ A;  5DD8 A;  4BH9 A;  3FKJ A;  4E7I A;  3MZH A;  5E3L A;  1NH3 A;  1HKT A;  5K7H A;  1XSV A;  2ISZ A;  1SAU A;  2K85 A;  1HA8 A;  3KZZ A;  2PJR A;  4RGS A;  1K4T A;  2XPU A;  4ETS A;  4JYK A;  4NBQ A;  1CGP A;  4PJ0 C;  4JP0 A;  3Q3S A;  1JE8 A;  2NVQ J;  2IRF G;  4ZH4 F;  3F0C A;  4XMY A;  4A93 J;  1MBK A;  2VUM J;  2L0K A;  5LHI A;  4KIS A;  3J7A O;  1RNL A;  3DBR B;  3PQJ A;  3MKL A;  4P9F A;  3VB2 A;  5IP9 J;  4B44 A;  2DOD A;  4KFC A;  4WXC A;  4ABZ A;  1ZRF A;  2IS1 A;  3JSP A;  3JTG A;  2FOK A;  5ED4 A;  2V1N A;  2M5W A;  2KFD A;  1R58 A;  2M3A A;  2E2I J;  4NNJ A;  2VT3 A;  1SD5 A;  2XAH A;  1KQ9 A;  1YJ9 I;  2L9R A;  1RPW A;  3FXQ A;  4HV6 A;  1S6L A;  2V6E A;  5HDK A;  1W1W E;  2M9H A;  2COB A;  4EMS A;  1Z9C A;  1E3H A;  2GOM A;  3TKY A;  4Q4Z F;  3GEZ A;  3P7N A;  2LFB A;  3ZQQ A;  4A12 A;  5JVG F;  1HW1 A;  4MFD A;  4UUS A;  2CFX A;  2QGU A;  1XCV A;  1MBF A;  5DCF A;  2OCE A;  1PJR A;  4MQV A;  5ICF A;  3KYC B;  1W4M A;  4B43 A;  2BOL A;  3MKZ A;  4OMZ A;  3L2C A;  2CUE A;  4GCV A;  3T1B A;  1U2W A;  3KE2 A;  2KRC A;  4G7Z F;  4M9S A;  4NQW B;  3HJE A;  1EH6 A;  4G12 A;  2MD5 A;  3L09 A;  2CRG A;  2CS3 A;  3H92 A;  1JUS A;  2CO5 A;  4A3D J;  1T33 A;  3HPH A;  1YG2 A;  3ZMU A;  2X0L A;  2ICW G;  4PK4 A;  5FLX K;  2E2J J;  1FBS A;  2HZD A;  4RAZ A;  2RNG A;  4KIT B;  1PP8 F;  4G6T B;  1OCC H;  1L3L A;  5E18 F;  3BJ6 A;  1BC8 C;  2K9N A;  4ZTJ A;  1D0X A;  5F27 A;  2BHY A;  4A6D A;  1VQ6 I;  3P9C A;  3QOP A;  1BIA A;  1MZB A;  2FA5 A;  4XLP F;  2RKH A;  2Z9O A;  2ECB A;  2Y2Z A;  5E79 C;  4UB6 C;  3J7Z I;  1SFX A;  4A3G J;  2K3F A;  4AYB N;  3H5N A;  2XB0 X;  4JOM A;  2O03 A;  2A6H F;  2P0W A;  2CUF A;  1XN7 A;  4CCK A;  3CO7 C;  4HRI A;  2VN2 A;  1W5T A;  1RUO A;  2HWV A;  3A0H C;  5CKT A;  5EGO B;  2ZO4 A;  2R0Q C;  3K4J A;  4IHY A;  3EYY A;  2L3D A;  5LRR A;  1XG1 A;  1DUX C;  1IXR C;  5HLI A;  3W6J B;  1IUY A;  5EF6 A;  2LP0 A;  2MAB A;  2NNN A;  4Y3O A;  1I5Z A;  1I1G A;  2Q2E B;  1GHC A;  2FNA A;  4RAG A;  1NHA A;  3H3V K;  2JT1 A;  2HYF A;  2O0Y A;  1GDT A;  4AVP A;  4CHU A;  5DYM A;  2EIJ H;  1T56 A;  1EA3 A;  2HYG D;  1BM9 A;  2X1E A;  1MBE A;  1MNM C;  5B1A H;  3W6K B;  2R5Y A;  1DDN A;  4ESF A;  3CCJ I;  4U87 A;  3GTL J;  1FBQ A;  2D1V A;  2KLO A;  3SEQ A;  2HU9 A;  3OYN A;  2DA2 A;  4O5V A;  3C2B A;  1USS A;  3E6C C;  3HXL A;  4F91 B;  3CLQ A;  2CQK A;  4MEX F;  3KLN A;  1XDS A;  1QPM A;  3ELK A;  3W3C A;  3RKQ A;  3BG5 A;  2A05 A;  1FBU A;  5KK1 A;  3OYE A;  1ZGW A;  3HHG A;  1J0R A;  4RB0 A;  3REO A;  4MTD A;  2W00 A;  2ID6 A;  3IAS 2;  1KGS A;  4Q47 A;  2FU4 A;  1QZY A;  1YIO A;  4CCN A;  1ETV A;  3OY9 A;  3GFM A;  3K4C A;  4BYY A;  1KZH A;  2RV8 A;  3SXY A;  1IRZ A;  3FDY A;  3COA C;  3C3W A;  1D8J A;  2JPC A;  3PSF A;  5E20 A;  2K4J A;  3NAU A;  3EUK L;  2QUF A;  4RM3 A;  2QEX I;  1VQM I;  4QIW N;  3I9V 2;  3DF8 A;  1QHG A;  4KT6 A;  3UR3 C;  1D1B A;  1BJA A;  2K4B A;  4XLH A;  5J3L A;  1OCP A;  4H0E A;  1UHM A;  1U5T C;  3G71 I;  4YIF A;  1RRJ A;  5DD4 A;  5E3O A;  3BLY A;  3K2Z A;  5K7F A;  3FXK A;  2LTP A;  1I39 A;  4IF4 A;  2DFH A;  1IXC A;  3GTJ J;  2WAF A;  1HXD A;  2FNP A;  1QRY A;  1BW6 A;  2VIX A;  4NC7 A;  4CCM A;  2VQH A;  3O6B B;  3W2W A;  3K70 C;  4BDZ A;  2XSD C;  4KUM A;  3S14 J;  3CDL A;  4UVC A;  5JVT A;  1MKM A;  2OV7 A;  3WGG A;  1BJZ A;  5E1W A;  1VQP I;  1E3P A;  5FKM A;  4NHJ A;  1MNE A;  2FE3 A;  3GCM A;  1GV2 A;  1WI9 A;  1LDK B;  3KP4 A;  3OOP A;  1MW7 A;  3AG4 H;  1XGN A;  3JW4 A;  3KZY A;  5GAH J;  3CO6 C;  1AOY A;  4BE0 A;  3OYM A;  1Y1W J;  5J6X A;  2LRE A;  1W0T A;  1CQT A;  1TQM A;  1FOY A;  2QQA A;  2HEO A;  2G9W A;  3QPT A;  3I56 I;  1LE8 B;  2GAU A;  2Q0O A;  2ZSH B;  3Q5F A;  4PFO A;  5J4Y A;  2JN6 A;  5EYR A;  2ID3 A;  2XPV A;  3E5Q A;  3L9F A;  3DTE A;  1JHH A;  1JUM A;  4XK4 A;  3V8K A;  5D4S A;  3S15 J;  2L9S A;  3WTV C;  2IA0 A;  2DT6 A;  1S9H A;  3JRA A;  3MZY A;  4Q48 A;  1F5T A;  4UV8 A;  5LEK A;  4D1Q A;  4RDU A;  3FXU A;  1E2X A;  2EQR A;  5KVR A;  5BPI A;  3DP7 A;  4A3F J;  3MN2 A;  3QYE A;  5CYV A;  4M72 A;  2JA6 J;  3BR2 A;  2Y31 A;  3AFH A;  4G6Q A;  4H4K C;  1KON A;  1YOV B;  4A6E A;  3ZOB A;  4ZYE A;  4R79 A;  3A2K A;  4AID A;  2LMD A;  2YU9 J;  1U0J A;  1B1B A;  1FZP B;  3HOW J;  1FYM A;  3GUD A;  3IHU A;  2IGO A;  3ZMZ A;  3NQO A;  4XKW A;  3QPL A;  1DP7 P;  3M3Y J;  4LFU A;  3OYC A;  3T0Y A;  1I6H J;  2XF5 A;  4HSR A;  2DA7 A;  1H9T A;  2BY1 A;  4GFB A;  2VBW A;  3F8N A;  2H6B A;  4Y4R A;  3BTI A;  2B7E A;  2FBK A;  1ACI A;  1B72 A;  3HOY J;  4PJL A;  2N8G A;  3F72 A;  4HDV A;  4HBL A;  1ON1 A;  5K5O A;  3QPS A;  5KNL A;  4HYE A;  1QBJ A;  4XRF A;  1ZR4 A;  4GDF A;  1OR7 C;  2FD5 A;  4UVB A;  5IY5 H;  1QO0 D;  4DZJ A;  1MSF C;  1ZAO A;  3KEQ A;  5TJJ A;  2LBF B;  3ZRG A;  4DOZ A;  1X3U A;  3DCF A;  2DJN A;  3MWM A;  4D7M A;  3CCL I;  2JVH A;  5H2F C;  2EZL A;  3ASO H;  4QSH A;  2IA1 A;  5L3C A;  2Q8K A;  5DTD A;  1QU3 A;  4OIO F;  1SD4 A;  2L01 A;  3FMQ A;  2BY0 A;  3DKX A;  5M5W J;  1HKS A;  3GO5 A;  3TDU C;  3DQV C;  2L4A A;  4ZZL A;  1WVR A;  4CZZ A;  4I7H A;  5ICC A;  4HF1 A;  4BXX J;  3E3V A;  1LNW A;  3IL2 A;  4M6X A;  3GLL A;  1D1C A;  5F1J A;  3HRT A;  2Y30 A;  3TED A;  4CUG A;  2MLG A;  1Z1D A;  4MEY F;  1JUP A;  1LJ9 A;  2ZME B;  5DM6 F;  1PUF A;  4ZDO A;  2COM A;  2GIV A;  4RBO A;  4BE1 A;  4EEF G;  2P7C B;  4CCJ A;  2VQC A;  5JLW A;  2OQG A;  3VYS B;  2PMZ N;  5E1X A;  5DUI A;  2BZT A;  2L9V A;  1P4A A;  1EH7 A;  2Z99 A;  5ILS A;  2A3S A;  2RQQ A;  3I4M J;  2A5W A;  3RPU D;  1X1P A;  3JRE A;  1A5J A;  1O7L A;  2W84 A;  2EIL H;  3M8E A;  4ZC3 A;  3C2G A;  1D8K A;  2KIQ A;  5EJC A;  3GTP J;  4FTH A;  4YFN F;  3I0T A;  4WWC A;  1VZ0 A;  5F1R A;  3FXL A;  3PM1 A;  2BE5 F;  4W1U A;  3OYL A;  4LD5 A;  2DOA A;  4ZDL A;  2DMU A;  1JGG A;  3PO3 J;  1I50 J;  1E0E A;  2D1H A;  1O3T A;  3K70 D;  4C3J J;  2L02 A;  1J9I A;  1R4N B;  2E36 A;  1OCT C;  2EFW A;  1BR1 A;  4YEL A;  4HX8 A;  1GT0 C;  5JHF A;  2UWM A;  3WE2 A;  4JK1 X;  2LOO A;  2O8X A;  3DV8 A;  1WFX A;  3PUB A;  1IRG A;  1OCO H;  2IS4 A;  1G3T A;  2EFP A;  2VQG A;  1MBG A;  4L9N A;  1R1T A;  3RSN A;  4AYB A;  4DJA A;  3B73 A;  2VXD A;  5L3E A;  1OIS A;  4RB1 A;  3HRU A;  3H5A A;  1ZRE A;  3ECO A;  2K9S A;  1DGR M;  1PYV A;  3OIQ A;  2GXA A;  1G8X A;  4AIH A;  2MD0 A;  5EG0 B;  3EYI A;  4CZC A;  3PL8 A;  1VQ7 I;  2WY7 Q;  3BZ6 A;  4DNC A;  3ABK H;  1F4K A;  3TOB A;  2VBX A;  2A61 A;  3O8H A;  4ZYG A;  2EV5 A;  3PQK A;  2GM4 A;  4CGZ A;  3HYI A;  2M7A A;  3ZQF A;  2Z16 A;  3HEF A;  3KFW X;  3A0B C;  2JA2 A;  3F23 A;  1OR7 A;  3ESW B;  4ESJ A;  2RVC A;  1RKW A;  4LIV A;  4B47 A;  4ENJ A;  4J19 A;  3ABT A;  1P92 A;  3DPL C;  5HS8 A;  2GZW A;  2QEN A;  3FXM A;  3GTK J;  3OYI A;  3N97 A;  1M1E B;  5GTH C;  2CV1 A;  1S7A A;  2BYV E;  3VFZ A;  5DS9 A;  5GAG J;  5LHH A;  5JLX A;  2VI6 A;  3F8F A;  2DTZ A;  4PGG A;  2XRN A;  2V9K A;  3CCQ I;  1G3Y A;  2UUZ A;  4RGR A;  3JRI A;  2QSH X;  1HST A;  1YW8 A;  2IP2 A;  3DBL B;  2CQN A;  1IXS B;  3WG7 H;  2RAE A;  3W2A A;  3U21 A;  3GX4 X;  1JHF A;  2XVC A;  2VOP A;  1FIA A;  2EH3 A;  1BR2 A;  3LNQ A;  1OJL A;  2F6C A;  1ZLJ A;  3G4S I;  4XOT A;  3F21 A;  2LKS A;  1P7I A;  2BW3 B;  1X1D A;  2EZI A;  2GLO A;  1MJA A;  2DI3 A;  3EUA A;  2ME6 A;  3ZN1 A;  4NQW A;  1HCR A;  3I55 I;  1ZG1 A;  2ELJ A;  2M2E A;  3CJN A;  2ZJ2 A;  4HOB A;  2ZJQ F;  2V1D A;  2FQ4 A;  2HR3 A;  3V4G A;  4IXA A;  1HLV A;  3ECH A;  2OJE D;  1WGX A;  4C3H J;  3HOV J;  4XON A;  5CPR B;  3RDI A;  1EKE A;  4X0G A;  3RZO J;  1UG2 A;  3CLO A;  3RIR A;  3ZQC A;  2WAQ N;  1WRJ A;  2PI0 A;  1X4P A;  3PFY A;  2H1K A;  1MDM B;  2L54 A;  3P9I A;  1OYW A;  3HOS A;  2VLA A;  1RC9 A;  2W4S A;  2DDA A;  1R49 A;  2XV4 S;  2JA5 J;  2YUS A;  1J7K A;  1OKR A;  3E5U A;  1JXS A;  4AIK A;  5E17 F;  4MTE A;  3RJP A;  1VQN I;  3OYH A;  3R61 A;  3K4L A;  5EGO A;  1O3R A;  4DYQ A;  3NWS A;  1FSE A;  4IPA A;  3CCR I;  2V4J C;  2DU9 A;  1YHQ I;  2EB7 A;  5FLM J;  2BBY A;  5HOD A;  3J81 Z;  4IZZ A;  1JI8 A;  3WE3 A;  2HOE A;  3K1N A;  2Q2E A;  1CF7 A;  2QBY B;  2EJR A;  1SAN A;  3OS1 A;  3SHF A;  2B9S A;  5FD6 A;  1UST A;  2F5D A;  3HSF A;  5HDG A;  1H0M A;  2K27 A;  1S3J A;  1V5G A;  2HXI A;  2JVG A;  2Z3Y A;  4ITV A;  2LKX A;  2DXI A;  4PFP A;  4M6V A;  3TP0 A;  5DM7 F;  2YU3 A;  3BPX A;  4D7N A;  3WTU C;  4U88 A;  1SFO J;  3DWL E;  1A31 A;  2K7L A;  5HLH A;  4DZP A;  2HTJ A;  1HC8 A;  2M1B A;  3ZCO A;  1TWF J;  2HQ5 A;  2MGQ A;  3CCV I;  4E4H A;  3H5R A;  2WTE A;  1ETO A;  2ZCW A;  3BDD A;  5LFA A;  4BDY A;  2VC0 A;  3J80 Z;  1BN5 A;  3MFK A;  2QWW A;  5IT9 Z;  3R4K A;  2EFO A;  3E6B A;  5FLV A;  4W97 A;  5ICE A;  2E1O A;  1ZRD A;  2E5Z A;  3TW6 A;  2MH9 A;  1JKR C;  3O3K A;  1Z21 A;  2XGD A;  3ERE D;  3JAM Z;  3AAF A;  2LNB A;  5CQG A;  3LQQ A;  2X51 A;  3ZXS A;  1MMS A;  3TO7 A;  4WK8 F;  1VFC A;  1Y56 A;  3DEW A;  3QQA A;  4HA8 A;  4XR6 A;  3BQY A;  2AHQ A;  4M3E A;  1B9M A;  1BI0 A;  4F55 A;  3KET A;  3FM5 A;  2PX9 A;  5E8I A;  2M8E A;  2BGC A;  3CUQ B;  1IG7 A;  1FYL A;  1ETY A;  3GTM J;  4OIP F;  2BVM A;  2ZME C;  2H1L A;  1N25 A;  1Z05 A;  4M9Z A;  1PDN C;  1Z77 A;  3HRM A;  1N78 A;  1GLN A;  2V79 A;  4FET A;  3OL3 A;  1IZ1 A;  5J8F A;  3MD2 A;  3BG7 A;  4D0P A;  2MFZ A;  2V7F A;  1SD6 A;  1R9T J;  3S3N A;  4CYC B;  4LB6 B;  3KZI C;  4UUV A;  4AD9 A;  5J1R A;  1IAW A;  4L5I A;  1V55 H;  1EF4 A;  3FWE A;  3QP5 A;  1BIB A;  4AC0 A;  2FBI A;  1R6R A;  1O3S A;  1ERD A;  4MNU A;  2ZB9 A;  5DUK A;  2K40 A;  2FX0 A;  1UB9 A;  3QOE A;  2O6G E;  5FRO A;  3H0G J;  3PIO F;  4IOC F;  2ETH A;  4IEJ A;  5LGN A;  4EAT A;  2YS9 A;  2ZC2 A;  1XGM A;  5ICG A;  1LE8 A;  1IGN A;  5GAE J;  3EUH A;  3S2D J;  2CSO A;  5DCM B;  2H09 A;  1A36 A;  2PMZ A;  1K61 A;  2ELH A;  3GVA A;  2HVR A;  5TRD A;  4M74 A;  3AL0 B;  1U3E M;  3GXO A;  2L4M A;  2YX4 A;  3KP6 A;  3GFI A;  4BAC A;  2DPD A;  1W7P B;  2XAG A;  4BL0 B;  3HPG A;  2KZV A;  2E19 A;  3A1Y A;  1ZGA A;  3CJR B;  3NRV A;  4MGR A;  4A3K J;  2O61 A;  1WWX A;  2VAS A;  3CCY A;  1FWZ A;  3HSR A;  3W2V A;  2XSJ C;  4CYD A;  1QVT A;  4FX4 A;  2HKX A;  2E7W A;  3KX2 A;  3WTS C;  3QU6 A;  4PCQ A;  3CMA I;  2PLY A;  4BQQ A;  2KRF A;  2ELK A;  4LGW A;  4RLQ A;  4IO9 F;  4I76 A;  4OU0 A;  3ONQ A;  2DFE A;  2AQF A;  2PFB A;  2HDD A;  3G2B A;  2DO7 A;  3HBL A;  2Y9Y A;  1TT0 A;  3CCU I;  2KHM A;  5FFZ A;  1SFE A;  2VB6 A;  4YG2 F;  1TNT A;  3BRO A;  4XID A;  4M73 A;  1WJD A;  1DP3 A;  1WJA A;  4LLG F;  4R8H A;  3Q9S A;  3CQZ J;  4FX0 A;  2LBF A;  3ABM H;  5F64 A;  5KCM A;  4LIT A;  2ME0 A;  5CVU A;  1X2N A;  4GO1 A;  3EQL F;  4YEJ A;  2QSF X;  4XLF A;  2R7D A;  1SMT A;  4ESB A;  5F08 A;  5F0C A;  2QM3 A;  4IQJ A;  2JUC A;  4LOC A;  4KN4 X;  1DU6 A;  3R6S A;  3L2U A;  1T2K A;  1KU2 A;  2MC3 A;  3OSG A;  4ZYD A;  2LDU A;  2F5V A;  3IKT A;  1NTC A;  4L5E A;  3HHH A;  3ZPL A;  4ZYA A;  5HS9 A;  3S3M A;  4HW0 A;  3FHN A;  3B6C A;  4RAF A;  2E7X A;  3JTH A;  4HX7 A;  3HUG B;  4CO8 A;  5D5V B;  1P4X A;  3U1K A;  5J8C A;  2F4I A;  3ZGK A;  3OOU A;  2DYR H;  5IP6 A;  3K7A J;  1YE9 A;  2ZME A;  3MEX A;  3DLA A;  2HQN A;  2GBY A;  3DBH B;  4JX6 A;  5F0F A;  3WU1 B;  2P5K A;  2WB1 N;  1ZG3 A;  1FX7 A;  2IBD A;  1FOX A;  3IWF A;  2WAE A;  3S16 J;  4N4O B;  3A01 B;  1XGS A;  1A35 A;  5K1Y A;  1V5F A;  2IGK A;  1V5E A;  1LKX A;  2OQR A;  4BXU A;  5TIS C;  3OYA A;  1BOB A;  4LG0 B;  1WH5 A;  3ABL H;  1A04 A;  5J47 A;  5FRM A;  1JT0 A;  2LYC A;  4M3G A;  4HQE A;  2I5U A;  1YX3 A;  3PSI A;  4AU7 A;  2KL4 A;  1D0Z A;  3DEU A;  1ZYR F;  4HDU A;  1XSX A;  1W5C C;  1ONV A;  1UEL B;  4M3D A;  2E5N A;  3KEO A;  1R1V A;  2L7M P;  1JKP C;  1WSU A;  3FMR A;  3M8F A;  1YS6 A;  3J7A Y;  2CQ7 A;  3BR0 A;  2O8K A;  3CC2 I;  4RA2 A;  3DU5 A;  2QYO A;  4FIS A;  3KIO A;  4B8X A;  1WI3 A;  2YR2 A;  3OR2 C;  5HLT A;  4YII A;  4KMF A;  1TWG J;  3T8T A;  4EVI A;  4YFK F;  4ZYH A;  1WKM A;  9ANT A;  5BPD A;  2WBM A;  4DW6 A;  1ETW A;  2LR8 A;  4UHT A;  2CUZ A;  4EGY A;  4OIR F;  4BY7 J;  4ZTF A;  1W36 D;  4Q5S F;  3ZQL A;  1I3A A;  5H6R A;  4ZDP A;  2WAQ A;  2XGX A;  2DA6 A;  2LG4 A;  4HG2 A;  5FKK A;  3VDX A;  5LBQ A;  1TW3 A;  3UNG C;  1E3O C;  2ECC A;  1ZK8 A;  3CUO A;  2ZSI B;  1Z7U A;  2DQL A;  1IF1 A;  3DXJ F;  3WU2 C;  2JUG A;  2X6W A;  2XB5 A;  4HNV A;  3F22 A;  1LPQ A;  2ZJP F;  3SZP A;  2D45 A;  1YIJ I;  2E71 A;  4QWQ A;  1D0Y A;  2V9P A;  3ML6 A;  3HOZ J;  2F48 A;  5C44 J;  2OUM A;  5EG0 A;  2QKL B;  3H35 A;  5J4V A;  2VJI A;  1FC3 A;  3PNY A;  2KKO A;  3JCU C;  1X3W B;  2Y69 H;  1W5S A;  4HV5 A;  3M4O J;  1X1C A;  3H1C A;  2IS6 A;  3QRF F;  4MO7 A;  2NS7 A;  3BJO A;  1RI7 A;  2CV2 A;  3BZK A;  3WTT C;  1VND A;  2XDV A;  1NK3 P;  2H6C A;  4E7J A;  2LF8 A;  3JRH A;  2K9Q A;  1IDZ A;  2DN0 A;  2E1M B;  5EZH A;  1FTZ A;  3X2Q H;  1LQ1 A;  1H9G A;  3T5X A;  4XN0 A;  5HS7 A;  4KIB A;  4BHP A;  4FE4 A;  2IAI A;  1J2X A;  4C2T A;  1A6I A;  1T6S A;  1L0O C;  1O57 A;  3ISP A;  3L2W A;  2F4O B;  3GW2 A;  1KYZ A;  4ASN A;  2ZNY A;  3CDI A;  3TDZ C;  3E7L A;  1XMK A;  2EZH A;  4QPO A;  3BQZ A;  3G3Z A;  5CJ9 A;  2DK5 A;  3IWZ A;  4A5M A;  4BEH B;  1XTA A;  3LA3 A;  3MZ8 A;  2QSG X;  2R7X A;  1TW2 A;  2Z2S B;  1BC7 C;  3WU0 A;  2HPM A;  3CUQ C;  3HGY A;  3F6O A;  2BW3 A;  3FBN B;  3N4M A;  2D2W A;  3C18 A;  4EM1 A;  1VQ5 I;  3P9K A;  4NC8 A;  3BZC A;  3JRF A;  1HF0 A;  3RZD J;  5B66 C;  2MH2 A;  3FMS A;  3F9K A;  5ILU A;  4E7S A;  1WZ2 A;  1O7F A;  4MHG A;  1U8R A;  2TDX A;  4BKX A;  2R7Q A;  3OL4 A;  2O9L A;  3QP6 A;  1GXP A;  1TBX A;  2VE8 A;  3B6A A;  5GTI C;  2EA2 A;  3M1E A;  4BS9 A;  2A68 F;  2W24 A;  3E5X A;  2I10 A;  4JBA A;  4PDK A;  4UUS B;  2Y9Z A;  1H89 C;  1TL8 A;  1LFB A;  1QZZ A;  1MMG A;  2P6S A;  5DEQ A;  1T08 B;  5EZG A;  2AO9 A;  1F36 A;  3F6V A;  1U9N A;  3C2H A;  2X9D A;  2E34 A;  3P5J A;  1SFU A;  4B4C A;  1SEU A;  2KRH A;  3V8L A;  2W57 A;  1MH3 A;  2G7U A;  1MDM A;  4OMY A;  4RS8 A;  2W1O A;  3I64 A;  1K4S A;  3LMM A;  2YPR A;  4BUP A;  3LSK A;  2R5Z B;  2HVQ A;  4MQ9 F;  1J5Y A;  3IKV A;  4BNC A;  3RPU A;  2HOS A;  5JI6 A;  2XIG A;  2UXX A;  1Y0N A;  1TNS A;  2MLK A;  2KJC A;  3BWG A;  3K4B A;  4A0X A;  3AL0 C;  4WF2 A;  2L7F P;  4J01 A;  3RTR A;  1K83 J;  3CF2 A;  2Z33 A;  1MH4 A;  3BT9 A;  1OFC X;  1LFP A;  1N75 A;  1ZG5 A;  3TQN A;  3G1L A;  1Z3Y A;  1U5T A;  3U9G A;  2HOT A;  1YRN B;  2VOD A;  1ZGJ A;  4EM0 B;  2QBY A;  2XPW A;  1MSE C;  3LL7 A;  4BQO A;  2R7F A;  4II2 A;  4C3I J;  2VQL A;  5GAD J;  3S8P A;  3CJQ B;  1KQ0 A;  2LY9 A;  2V6C A;  5IOZ A;  3DTI A;  3FXR A;  4M71 A;  4A69 C;  1WQ2 A;  3SDB A;  2CYY A;  4LB5 A;  1I6X A;  2QVO A;  1JJ8 C;  2X1D A;  4XBF A;  4QLC U;  1RUN A;  5LGU A;  3G6E I;  2JZY A;  1ZKG A;  4CIC A;  3L2V A;  4RB2 C;  1ORK A;  1IC8 A;  2EA4 A;  1TZL A;  2A07 F;  4DBR A;  2CU7 A;  3HL2 A;  2EIN H;  3S2W A;  4I01 A;  1X1B A;  4A3B J;  2QKM B;  4A3C J;  3CES A;  3WGH A;  2W82 A;  3R0J A;  1FMV A;  4I0B A;  4EJW A;  5FKO A;  5IYB J;  5L3D A;  1DGW Y;  2MW8 A;  3VYU B;  3F3X A;  3U1D A;  3CMM A;  4BJ5 C;  3W6V A;  2FEZ A;  3C1D A;  5FO5 A;  2JRT A;  3K2A A;  2W85 A;  4F3Q A;  2MG4 A;  2ZNZ A;  2BY2 A;  4IQ4 A;  2PN6 A;  1VQ4 I;  4C2U A;  3J80 K;  2XRO A;  2EFQ A;  2WA0 A;  2M4K A;  5IT9 K;  2CV0 A;  4A3I J;  2E60 A;  4UNO A;  2ZFU A;  3GTO J;  2VT2 A;  1FY7 A;  4A0Z A;  2PMU A;  2VPR A;  1WH7 A;  1K7A A;  3CUQ A;  2HGC A;  2E1N A;  2PBI A;  4A2U A;  2HPI A;  1S7E A;  4A3M J;  3K4M A;  4B3A A;  3JAM K;  4XKC A;  4RMN A;  1OMI A;  1X19 A;  1ZQ3 P;  1XGO A;  4AWX B;  2IGM A;  1HW2 A;  3GYH X;  2E2H J;  1T38 A;  1QGP A;  1MBH A;  3BR3 A;  2OC6 A;  3CCM I;  4O6J A;  4E7K A;  2M7B A;  1ZLK A;  5K5Q A;  1B59 A;  5KHD A;  5J1U A;  2FUG 2;  4CYC A;  4ENK A;  4LMY A;  1F43 A;  3J7Y J;  3D5S C;  2UZK A;  1Y6I A;  4IX7 A;  4WCG A;  4BQN A;  2HZT A;  2OCC H;  1TWH J;  5DV5 A;  2ACJ A;  4IRH A;  2ZXW H;  1BOA A;  3MVP A;  4M9X A;  3TO9 A;  1STZ A;  2G7H A;  2HYJ A;  5LGT A;  3GFJ A;  5LEJ A;  2W7N A;  1E17 A;  1UHW A;  4EQQ A;  5BOX A;  3HM5 A;  1RKT A;  4XN3 A;  3E0J B;  2AXT C;  2WB1 A;  3I71 A;  5DCM A;  2JRM A;  4A5N A;  1ZHF A;  3MQ0 A;  1K6O A;  2DQR A;  3IH2 A;  1JGS A;  1MIJ A;  3OYF A;  2A6T A;  2VPL A;  5IOY A;  2KIF A;  4UVA A;  4BHB A;  1TQI A;  2HQR A;  2NVX J;  2WAD A;  3PNV A;  3VSK A;  4RB3 C;  2NAZ A;  2X1C A;  3LSJ A;  4HQM A;  2UV1 A;  2CWE A;  2GOX B;  4XQF A;  4B3X A;  2AS5 F;  1K78 B;  1ZN2 A;  3K1M A;  1LDJ A;  1XMX A;  3O2P E;  1FNN A;  4HF0 A;  3GWZ A;  2XGE A;  2PEX A;  1Y0U A;  2BEO A;  2FMY A;  1YLF A;  3HTU A;  4DGW B;  3DKY A;  3IP4 B;  1ETX A;  3FZV A;  3ZQ7 A;  1WJE A;  1XCB A;  3K69 A;  2KDO A;  2EK5 A;  2HOA A;  4OAY A;  4PJM A;  4XKB A;  1ITY A;  4PZJ A;  2PJP A;  2HNH A;  2DTR A;  2LVS A;  3TGN A;  2A5Y B;  2LC2 A;  2FML A;  3WTX C;  4HST A;  3V7C A;  1K79 A;  4Y17 A;  2JA8 J;  2XAF A;  4I6Z A;  1OCZ H;  5FKL A;  2FXA A;  4EV0 A;  3BC8 A;  1W7P D;  1ZEL A;  2KDZ A;  1WHU A;  3ERM A;  3TBI A;  4K2E A;  4BGD A;  1UG0 A;  2E1M C;  3K6G A;  1ZH5 A;  3L2Q A;  2NXN B;  2M34 A;  1TT5 B;  4ON0 A;  1Z91 A;  4IHW A;  5E3N A;  3RKX A;  1IV8 A;  1ZRC A;  2L9N A;  1WPK A;  4WXH A;  4JX4 A;  1NK2 P;  2LRD A;  1Q1H A;  3TP3 A;  4EJU A;  1YO5 C;  5FD5 A;  3ZQH A;  4XLA A;  2KMU A;  4DYC A;  3M9A A;  1QNT A;  1OYY A;  1NG7 A;  2GA1 A;  2R7S A;  2NYX A;  2H94 A;  4RLF A;  2VXZ A;  1WJF A;  4G8X A;  2DCE A;  1HDD C;  4AVZ A;  2XAJ A;  4I2O A;  5CVJ A;  3LFU A;  3F8B A;  3LSG A;  5HLG A;  2OZ6 A;  5E8G A;  2LF7 A;  1MMA A;  2DFI A;  1SC7 A;  1R23 A;  1UHS A;  2CG4 A;  2IVM A;  3HUG A;  4IHS A;  1AA7 A;  3DPU A;  4E7L A;  5L3G A;  1PVE A;  2DBB A;  3ABU A;  4EJV A;  4OAZ A;  1G2H A;  5F0H A;  1B8I B;  3MKY B;  3I3L A;  2DK8 A;  2BY3 A;  5ERI A;  4FE7 A;  1RR7 A;  4JX5 A;  1UAA A;  1IUF A;  3A01 A;  3DU6 A;  3OYJ A;  3AKZ A;  2CW0 F;  1HOM A;  1YJW I;  3D0S A;  1R71 A;  3ZP5 A;  1SFK A;  1VF9 A;  4XLN F;  1TWC J;  4LG0 A;  4XKV A;  3V7R A;  4IOA F;  3H9J A;  5LD2 C;  4HZF A;  1W0U A;  3JRB A;  3DLL F;  2BVL A;  3KLO A;  4L9T A;  1PUE E;  1KA8 A;  1R36 A;  4R1H A;  1MGT A;  1P4W A;  2STT A;  2ZFW A;  4FQG A;  3BJA A;  3WGI A;  2FQ3 A;  1Z0X A;  1BL0 A;  3SQN A;  1SD7 A;  3IC7 A;  5JHU A;  3HC7 A;  2P8T A;  2P81 A;  2IA2 A;  2QQ8 A;  3OS0 A;  3QPH A;  3LAJ A;  3G1O A;  4Y33 A;  1I1S A;  2IS2 A;  1FOW A;  4Y7N J;  5D5W B;  3FHZ A;  2L2O A;  4KIG A;  4YRV A;  1B9N A;  5FRN A;  2DJI A;  2CJJ A;  5FJ8 J;  3SEZ A;  2VJJ A;  3I53 A;  1U8B A;  4BAY A;  2F4M B;  1ETQ A;  3IH3 A;  2P4W A;  1XC5 A;  4A3E J;  1TC3 C;  3K0L A;  1VI0 A;  4ZZD A;  2R3S A;  2DOE A;  3LA2 A;  2F2E A;  2LY2 A;  1KQ8 A;  3I59 B;  1BA5 A;  4N9I A;  3HOT A;  2XUB A;  2OTJ I;  1D5V A;  1N77 A;  5ILV A;  3G73 A;  3F8C A;  2EV6 A;  2FOW A;  2HS5 A;  1B6A A;  1VQK I;  3BOQ A;  1W36 C;  1OQY A;  1IN6 A;  5IT3 A;  2M8G X;  3QAH A;  2ESH A;  4EJT A;  2V1X A;  5GP9 A;  2XC7 A;  3IRR A;  1P9Q C;  2Y75 A;  3WOD F;  2E1C A;  4AIJ A;  2DOF A;  4ENM A;  3VYR B;  3Q0W A;  3PJR A;  4L0Z B;  1G3W A;  3LAP A;  1IDY A;  2W48 A;  2OD5 A;  3QWL A;  4KIC A;  4XLE A;  1IJW C;  1X4O A;  2IJL A;  2R7W A;  3HB9 A;  3SJM A;  3R60 A;  3HRS A;  4Y15 A;  1LFU P;  2GQQ A;  4XNF A;  1DPU A;  5K5R A;  2RC4 A;  2IPQ X;  3RQ4 A;  4KNY A;  2DMT A;  4A3J J;  4X6A J;  3BTL A;  3FF5 A;  2OU2 A;  5EEH A;  2WWY A;  3OWT A;  2ZXH A;  3S17 J;  1X1A A;  5CVR A;  1KU9 A;  2BXY A;  2QQ9 A;  2V1U A;  3WHC A;  2G0E A;  1MMD A;  4BEH A;  2W25 A;  5B5E C;  4B48 A;  1X58 A;  2EIK H;  2CFO A;  4HAM A;  4P55 A;  1MD0 A;  4Z2Y A;  5M3F J;  3ZQG A;  5H20 A;  5LRS A;  3LFK A;  4E7Z A;  1R22 A;  2Y0S N;  3GZ6 A;  2HI3 A;  5BNG A;  1KYW A;  1I3Q J;  4PUS A;  2E35 A;  4V19 K;  2O7O A;  2XKP A;  3ZMV A;  3OV8 A;  3K10 A;  3KYD B;  5AON A;  3HKZ N;  2VJ5 A;  1IRX A;  1ON2 A;  3BPV A;  3WTY C;  1FP1 D;  3G1M A;  1T95 A;  1Y8Q B;  3L2R A;  1QA6 A;  2B63 J;  1V3F A;  2B0L A;  5FB2 A;  1Y1V J;  3BG6 A;  1XX5 A;  1KU7 A;  4OOI A;  3RPQ A;  3JRC A;  4E6K G;  3H0D A;  3NEU A;  2IW5 A;  4D9J A;  3OYB A;  2R5Z A;  3O8G A;  4BJ6 C;  1YS7 A;  3ROU A;  1DPR A;  3LOC A;  2MSY A;  1XDU A;  1Z6R A;  5CQE A;  1ODD A;  4PSW A;  2QA4 I;  4F93 B;  4KMU X;  1LVA A;  2BXZ A;  1OCR H;  5L3F A;  1JTX A;  4UXN A;  3TOA A;  1JKQ C;  2WC2 A;  4KT5 C;  4N9H A;  1D3Y A;  3I54 A;  2Z5U A;  1YRN A;  2XAS A;  3K4K A;  1U9O A;  3GTG J;  1SVO A;  4PJJ A;  1K6Y A;  2EFN A;  2WY8 Q;  3IAM 2;  1GUU A;  1TTY A;  1XMA A;  3K1P A;  5CVV A;  5BMZ A;  1BI1 A;  2HTS A;  2PQ8 A;  1FYK A;  5M5Y J;  1WJC A;  2H8R A;  2VE9 A;  3TW7 A;  1TP4 A;  1UJ8 A;  3NWT A;  3PIP F;  1Z3X A;  4ZJZ A;  4XOR A;  1GXQ A;  4AM3 A;  1ZR2 A;  1QPI A;  1P2F A;  3FK7 A;  2QQB A;  1MND A;  4I98 B;  5A2Q Z;  3L1P A;  1P6R A;  1CF7 B;  1AKH B;  3M1C A;  4DIQ A;  5EEG A;  4HNU A;  5D8L B;  2YX7 A;  4IRI A;  1FTT A;  1BI2 A;  2FF4 A;  3EPZ A;  2MYS A;  1XPX A;  2OA4 A;  1Y39 A;  2JWT A;  3CP2 A;  1ETK A;  2L5Q A;  3KP3 A;  1HSJ A;  2IGN A;  2P5V A;  1G4D A;  4LJZ F;  3PNT A;  3GZ5 A;  4G6D A;  2TCT A;  4RM2 A;  2CGP A;  4F7Z A;  2XAU A;  5DDG A;  1Y8R B;  1HBX G;  3L00 A;  3ZMD A;  4F52 A;  4M3B A;  2F5C A;  4BHC A;  1R5I D;  3BR6 A;  5HDN A;  4FCY A;  1YQA A;  2ZXJ A;  1G59 A;  3KEY A;  1EH8 A;  3LSM A;  2KZG A;  2A69 F;  2P6T A;  3HZJ A;  2KIM A;  3BR1 A;  4TV7 A;  4X1E A;  5D5X B;  2CMP A;  3VEP A;  2HKO A;  3VYT B;  3OMY A;  1QHH D;  1ENH A;  3GME A;  1J75 A;  1MJ9 A;  2CH0 A;  2X85 A;  3LSP A;  3LWF A;  1J09 A;  2ZKZ A;  3M8J A;  4OWR B;  1T39 A;  4S04 A;  3IUO A;  2OBP A;  2KJB A;  2P7V B;  4CA0 A;  3H9G A;  3KYL A;  3I58 A;  1S5L C;  3ZQI A;  2BHZ A;  1APL C;  4HLY A;  2VKD A;  4D5C A;  3VWB A;  4XRM A;  4L5J A;  4YIR X;  3V8J A;  2LD5 A;  2DMQ A;  5D5U B;  2VL8 A;  3LSH A;  1S7O A;  3H3U A;  4UY8 I;  1YW9 A;  3LST A;  4L0Y B;  2PJR B;  3OIO A;  2R93 J;  5BS6 A;  2R7V A;  2OAZ A;  2RN7 A;  2R7R A;  3DPT A;  1H88 C;  1JTY A;  2KT0 A;  3C7J A;  3WG9 A;  2K5C A;  3CCS I;  1XS9 A;  4IHV A;  4CSW A;  3FIW A;  3SFZ A;  5CLS A;  3ULQ B;  1KU3 A;  1IRF A;  3RQI A;  4ANJ A;  5LLQ A;  1Z67 A;  2K02 A;  3B02 A;  4ENN A;  4P9U A;  3RYR A;  1LEB A;  6PAX A;  3FKI J;  1WJB A;  4GYG A;  3OYG A;  3MKW B;  1QQI A;  2FJ1 A;  1IN5 A;  1Z7L A;  4BU2 A;  2K86 A;  3D5L A;  4U0V A;  4NB5 A;  3LSR A;  4IJA A;  4WXD A;  1PP7 U;  4QTR A;  2NVT J;  1QZE A;  2R92 J;  3FK6 A;  4CXF A;  4MFE A;  3HOU J;  4U7D A;  2P5L C;  1FSH A;  2X48 A;  4YFX F;  4U0W A;  3S93 A;  3I4N J;  1K78 A;  5LHG A;  1NG6 A;  2HFH A;  2WV1 A;  3E97 A;  2FRH A;  2YSR A;  1BI3 A;  1LUJ B;  1OYI A;  2TRT A;  5IYD J;  3S1Q J;  2XHK A;  1X2M A;  1YW7 A;  3WTW C;  3LQR A;  2VKV A;  2HQA A;  1YX5 A;  2AQE A;  2RQP A;  4XM3 A;  1O3Q A;  4HLX A;  4I02 A;  3RYP A;  1FT9 A;  3CZ6 A;  1AU7 A;  5FLX Z;  5D6E A;  3RCO A;  3E6M A;  4UV9 A;  4JQF A;  1VQ9 I;  4LIU A;  2CUJ A;  5C4X J;  2XRL A;  5CVI A;  4I0A A;  2X6Y A;  4S05 A;  2LLK A;  1YJN I;  2D5V A;  2VBZ A;  5HOO A;  2C6Y A;  1G6N A;  3ZN0 A;  2NVU B;  4U0Y A;  5D4R A;  2M4G A;  2BV6 A;  1V54 H;  2VC1 A;  3SFI A;  1LB2 A;  1H8A C;  2R7O A;  3SYT A;  1U78 A;  4HPQ A;  4G7O F;  2DFF A;  1MBJ A;  2ESN A;  3TO6 A;  3DTK A;  3CDH A;  2HXO A;  2F5F A;  1S29 A;  4GRI A;  4FT8 A;  1S8N A;  2LH9 A;  4IVN A;  3VPR A;  1GVJ A;  4NC6 A;  2HDW A;  1YYV A;  2HDC A;  1J59 A;  2VKE A;  2OPT A;  2QCO A;  1YIT I;  5EDN A;  5HNF A;  3CTA A;  1SVL A;  4HX4 A;  2NVY J;  2OTL I;  5D8K B;  2JJ7 A;  1G3S A;  2STW A;  1ULY A;  3TL4 X;  4CH7 A;  4II3 A;  2GXG A;  2VJ4 A;  2ADU A;  2AXL A;  4DBQ A;  1V4R A;  1SMY F;  5J1Y A;  1T0F C;  1R5G A;  5FFX A;  2RGV A;  1AWC A;  3SZT A;  3I5U A;  4EGZ A;  2V26 A;  3S1M J;  3WTZ A;  2NNY A;  5H6Q A;  2M45 A;  1YFH A;  1FMW A;  1B8I A;  3HTS B;  1O4X A;  2CQQ A;  2JQ7 A;  2XGC A;  2DLL A;  4DQ2 A;  3Q0U A;  1R5H A;  3CJT B;  3J81 K;  4CDG A;  3BTJ A;  2DA5 A;  4OIQ F;  1R7J A;  2LY1 A;  1EV7 A;  5F6F A;  4LK1 F;  3DEE A;  5HVQ C;  4C30 A;  3FXJ A;  2QLZ A;  2OZU A;  1UMQ A;  2XKO A;  1DQU A;  3BCA A;  3OSF A;  2LSO A;  4LG3 A;  2VKH A;  3OS2 A;  3HSE A;  3WHB A;  4RGU A;  1JT6 A;  1ZAR A;  2RNJ A;  5B1B H;  4G7H F;  2R5Y B;  3I4P A;  3D5R C;  3LSI A;  1WCM J;  2GA2 A;  2KIU A;  3H9Q A;  4XOP A;  3BG3 A;  2DT7 B;  2Y0S A;  1MJB A;  4V2F A;  2DYS H;  3FBI B;  1QVU A;  3HIF A;  2X6O A;  2DDB A;  3RKY A;  3S1R J;  2Q1Z B;  2VBY A;  4XL9 A;  1AHD P;  5IP7 J;  3SDG A;  3HKZ A;  2R4G A;  3CME I;  2LK2 A;  4KJZ A;  1HDP A;  3HG9 A;  4NDL A;  1RET A;  4LLN A;  1OPC A;  3KP2 A;  2FSW A;  1BR4 A;  2WV0 A;  3UKG A;  3GZN B;  3EDP A;  1VQL I;  3S2H J;  4Y13 A;  1XD7 A;  5EEA A;  3GLX A;  5C4J J;  3V42 A;  3GFL A;  3OYD A;  1FOK A;  4MIM A;  1HW5 A;  3I59 A;  3JR9 A;  2UXN A;  1EJ9 A;  1FIP A;  3BY6 A;  4PGH A;  4U7B A;  4PJN A;  3K4N A;  1IN7 A;  2V9V A;  3N05 A;  4DYR A;  3IV5 A;  3VOE A;  3MAJ A;  3OR1 C;  4HEA 2;  4IL6 C;  4B09 A;  4XIC A;  3IH4 A;  1VQ8 I;  2IT0 A;  2JTV A;  4RAY A;  1IW7 F;  1MMN A;  2Y0M A;  2JK3 A;  2KP6 A;  2CW7 A;  3AG2 H;  1FEX A;  4M3F A;  2L7Z A;  1RIO H;  4XRS A;  4IKF A;  4KYW A;  2K9L A;  4KDP A;  4I09 A;  4O3M A;  2KQR A;  4GGG A;  5IYC J;  1JKO C;  3AG1 H;  4G94 A;  2MBF A;  4LLL A;  3MMY B;  4N4N B;  1IN4 A;  4B1R A;  4LK0 F;  3V7S A;  1REP C;  5L3B A;  4L9J A;  2CQX A;  3PO2 J;  1XB4 A;  3VOD A;  3S32 A;  1VTN C;  2NOJ B;  2VOO A;  2GXB A;  1UFM A;  4NUB A;  3SZG A;  5BQT A;  3BG9 A;  1ZTR A;  1HKQ A;  2JA7 J;  3CMY A;  2M0M A;  1W7P A;  5JR3 A;  2O3F A;  3KP7 A;  1A6Q A;  2NOG A;  4BE2 A;  3HOX J;  4HF2 A;  4EJO A;  1Q1V A;  1T0F A;  3EET A;  3L7W A;  4E7H A;  1Z6T A;  1C0W A;  2L7K A;  1HQC A;  2JPB A;  2MC4 A;  3JRD A;  1P7J A;  3F8M A;  1S72 I;  1LDD A;  1FP2 A;  2HVS A;  4FAS D;  3Q9V A;  4CCL A;  4A0Y A;  1F9N A;  2DA4 A;  2M30 A;  3RI4 A;  4E70 A;  3HDD A;  2NS8 A;  3M7G A;  2PMH A;  5C3E J;  1R00 A;  4HNT A;  2NRA C;  1LEA A;  3OIP A;  4S0H B;  4L18 B;  4A3L J;  3A03 A;  2J5O A;  2KIS A;  4UUT A;  2J5P A;  2PG4 A;  1R4M B;  3S1N J;  4I99 C;  3CP8 A;  2ZBK A;  3NAR A;  3FM3 A;  5KAI C;  1OLT A;  2EWN A;  5K7Z A;  4EM2 A;  1R1U A;  2R7T A;  4CCO A;  3H36 A;  4IHX A;  3QYB A;  1TWA J;  4MLO A;  4AUX A;  3QYF A;  3ZMS A;  4N0B A;  2QF7 A;  2DT5 A;  5M3M J;  2EPF A;  2RDP A;  3JSO A;  1U6G A;  2JSC A;  3DKW A;  1SVM A;  3CCE I;  4KN7 X;  1B72 B;  4PSX A;  3BR5 A;  1T8I A;  5FGM A;  2ZXI A;  1FPQ A;  3PUF A;  3LA7 A;  5GPA A;  3KPH A;  5IPA A;  4BBS J;  2ISY A;  3D1N I;  4BXF A;  3RKW A;  1POG A; 
#chains in the Genus database with same CATH homology
 2DPU A;  4OIN F;  2DW4 A;  4BQA A;  2DAO A;  4IHT A;  3KCC A;  3ZMT A;  1YTY A;  4GXO A;  4P5O A;  3E6D A;  1XSD A;  1BBY A;  2MA3 A;  4WX9 A;  3U2R A;  2H27 A;  1U5T B;  1FLI A;  4KIF A;  2A6E F;  3IRQ A;  2LKP A;  4G9Y A;  1IN8 A;  4P96 A;  1UCR A;  3BP8 A;  1TLH B;  2NS0 A;  5AIP A;  3QU3 A;  3H3Z A;  4KA4 A;  1T98 A;  3T8R A;  5A2Q K;  1SAX A;  4XSX F;  5JFR A;  3K9T A;  2FBH A;  3FX3 A;  4L9V A;  3R0A A;  3GF2 A;  3KP5 A;  2VON A;  4M6Y A;  1I27 A;  4GYI A;  5E1Z B;  1TQP A;  5D6F A;  3PFI A;  1F1Z A;  1RZ4 A;  2EV0 A;  2QZ8 A;  2Y48 A;  2M87 A;  4RGX A;  2XAQ A;  2F5E A;  4IRG A;  2GWR A;  4XSZ F;  3DFG A;  3MCZ A;  2X4H A;  1B4A A;  4FHT A;  5AIQ A;  5DD8 A;  4BH9 A;  3MZH A;  1HKT A;  1XSV A;  2ISZ A;  3KZZ A;  4RGS A;  4ETS A;  1CGP A;  1JE8 A;  2IRF G;  4ZH4 F;  5LHI A;  3J7A O;  1RNL A;  3PQJ A;  4P9F A;  3VB2 A;  4KFC A;  4WXC A;  1ZRF A;  3JSP A;  3JTG A;  2FOK A;  5ED4 A;  2M5W A;  1R58 A;  2VT3 A;  1SD5 A;  2XAH A;  1KQ9 A;  3FXQ A;  4HV6 A;  1S6L A;  5HDK A;  4EMS A;  1Z9C A;  3TKY A;  4Q4Z F;  3GEZ A;  3P7N A;  4A12 A;  1HW1 A;  2CFX A;  1XCV A;  5DCF A;  4MQV A;  5ICF A;  1W4M A;  4OMZ A;  3L2C A;  4GCV A;  3T1B A;  1U2W A;  3KE2 A;  4G7Z F;  4M9S A;  1EH6 A;  2MD5 A;  3L09 A;  3H92 A;  2CO5 A;  1YG2 A;  3ZMU A;  2X0L A;  5FLX K;  1FBS A;  4RAZ A;  1PP8 F;  1L3L A;  5E18 F;  3BJ6 A;  1BC8 C;  4A6D A;  3P9C A;  3QOP A;  1BIA A;  1MZB A;  2FA5 A;  4XLP F;  2RKH A;  2Z9O A;  1SFX A;  2O03 A;  2A6H F;  1XN7 A;  3CO7 C;  2VN2 A;  1W5T A;  1RUO A;  2HWV A;  2ZO4 A;  3EYY A;  2L3D A;  5LRR A;  1DUX C;  1IXR C;  5HLI A;  3W6J B;  1IUY A;  2NNN A;  1I5Z A;  1I1G A;  1GHC A;  2FNA A;  1NHA A;  2JT1 A;  2HYF A;  2O0Y A;  4AVP A;  4CHU A;  5DYM A;  2HYG D;  1BM9 A;  3W6K B;  1DDN A;  4ESF A;  1FBQ A;  2D1V A;  4O5V A;  1USS A;  3E6C C;  2CQK A;  4MEX F;  3KLN A;  1XDS A;  1QPM A;  3ELK A;  1FBU A;  5KK1 A;  3HHG A;  1J0R A;  4RB0 A;  3REO A;  4MTD A;  1KGS A;  4Q47 A;  2FU4 A;  1QZY A;  1YIO A;  3GFM A;  4BYY A;  2RV8 A;  3SXY A;  3COA C;  3C3W A;  1D8J A;  2JPC A;  5E20 A;  2K4J A;  2QUF A;  3DF8 A;  1BJA A;  2K4B A;  4H0E A;  1UHM A;  1U5T C;  4YIF A;  5DD4 A;  3K2Z A;  4IF4 A;  1IXC A;  1HXD A;  2FNP A;  3O6B B;  4KUM A;  4UVC A;  5JVT A;  1MKM A;  3WGG A;  5E1W A;  4NHJ A;  2FE3 A;  1WI9 A;  1LDK B;  3KP4 A;  3OOP A;  1XGN A;  3JW4 A;  3KZY A;  3CO6 C;  1AOY A;  5J6X A;  1TQM A;  2HEO A;  2QQA A;  2G9W A;  3QPT A;  2GAU A;  2Q0O A;  3Q5F A;  3L9F A;  3E5Q A;  1JHH A;  5D4S A;  3V8K A;  3WTV C;  2IA0 A;  3MZY A;  4Q48 A;  1F5T A;  4UV8 A;  5LEK A;  3FXU A;  1E2X A;  5KVR A;  5BPI A;  3DP7 A;  5CYV A;  4M72 A;  4G6Q A;  4ZYE A;  4A6E A;  4R79 A;  1B1B A;  1FZP B;  1FYM A;  3GUD A;  3IHU A;  3ZMZ A;  3NQO A;  1DP7 P;  4LFU A;  3T0Y A;  1H9T A;  2VBW A;  3F8N A;  2H6B A;  2FBK A;  3F72 A;  4HDV A;  4HBL A;  1ON1 A;  5K5O A;  4HYE A;  1QBJ A;  4XRF A;  4UVB A;  1QO0 D;  1ZAO A;  3KEQ A;  5TJJ A;  1X3U A;  3MWM A;  2IA1 A;  5L3C A;  2Q8K A;  4OIO F;  1SD4 A;  2L01 A;  3FMQ A;  1HKS A;  3GO5 A;  3TDU C;  3DQV C;  2L4A A;  4ZZL A;  4CZZ A;  4I7H A;  5ICC A;  4HF1 A;  3E3V A;  1LNW A;  3IL2 A;  4M6X A;  3HRT A;  2MLG A;  1Z1D A;  4MEY F;  1LJ9 A;  2ZME B;  2COM A;  2GIV A;  2P7C B;  2OQG A;  5E1X A;  5DUI A;  1P4A A;  1EH7 A;  2Z99 A;  5ILS A;  2A3S A;  1O7L A;  2W84 A;  3M8E A;  1D8K A;  4YFN F;  3I0T A;  4WWC A;  5F1R A;  2BE5 F;  4LD5 A;  2D1H A;  1O3T A;  2L02 A;  1J9I A;  2EFW A;  4HX8 A;  2UWM A;  3WE2 A;  4JK1 X;  2O8X A;  3DV8 A;  1IRG A;  1G3T A;  2EFP A;  4L9N A;  1R1T A;  3B73 A;  5L3E A;  4RB1 A;  3HRU A;  1ZRE A;  3ECO A;  4AIH A;  3EYI A;  3BZ6 A;  4DNC A;  1F4K A;  3TOB A;  2VBX A;  2A61 A;  4ZYG A;  2EV5 A;  3PQK A;  4CGZ A;  3HYI A;  3KFW X;  3F23 A;  1OR7 A;  4ESJ A;  2RVC A;  4ENJ A;  3ABT A;  1P92 A;  3DPL C;  5HS8 A;  2GZW A;  2QEN A;  3N97 A;  1S7A A;  2BYV E;  3VFZ A;  5LHH A;  4PGG A;  3F8F A;  2XRN A;  1G3Y A;  4RGR A;  1HST A;  1YW8 A;  2IP2 A;  1IXS B;  3GX4 X;  1JHF A;  2XVC A;  2VOP A;  1ZLJ A;  3F21 A;  1MJA A;  2DI3 A;  3ZN1 A;  4NQW A;  1ZG1 A;  3CJN A;  2ZJ2 A;  4HOB A;  2V1D A;  2HR3 A;  3V4G A;  4IXA A;  3ECH A;  3RDI A;  3CLO A;  3RIR A;  1WRJ A;  2PI0 A;  1MDM B;  2L54 A;  3P9I A;  1OYW A;  3HOS A;  2XV4 S;  1J7K A;  1OKR A;  3E5U A;  1JXS A;  4AIK A;  5E17 F;  4MTE A;  3RJP A;  3R61 A;  1O3R A;  4IPA A;  1FSE A;  2DU9 A;  2EB7 A;  2BBY A;  3J81 Z;  3WE3 A;  2HOE A;  3K1N A;  2Q2E A;  1CF7 A;  2QBY B;  2EJR A;  3SHF A;  5FD6 A;  1UST A;  2F5D A;  3HSF A;  5HDG A;  1H0M A;  2K27 A;  1S3J A;  2Z3Y A;  2YU3 A;  3BPX A;  3WTU C;  4U88 A;  2K7L A;  5HLH A;  2HTJ A;  2M1B A;  2WTE A;  2ZCW A;  3BDD A;  2VC0 A;  3J80 Z;  1BN5 A;  3MFK A;  2QWW A;  5IT9 Z;  3R4K A;  2EFO A;  3E6B A;  5ICE A;  1ZRD A;  2MH9 A;  3O3K A;  3ERE D;  3JAM Z;  3AAF A;  2LNB A;  3LQQ A;  3TO7 A;  4WK8 F;  4HA8 A;  1B9M A;  1BI0 A;  3KET A;  3FM5 A;  5E8I A;  2M8E A;  2BGC A;  3CUQ B;  1FYL A;  4OIP F;  1Z05 A;  4M9Z A;  1PDN C;  3HRM A;  2V79 A;  1IZ1 A;  5J8F A;  4D0P A;  1SD6 A;  4LB6 B;  4UUV A;  4AD9 A;  1IAW A;  4L5I A;  3FWE A;  3QP5 A;  1BIB A;  2FBI A;  1O3S A;  4MNU A;  5DUK A;  1UB9 A;  2O6G E;  2ETH A;  5LGN A;  1XGM A;  5ICG A;  3EUH A;  2CSO A;  5DCM B;  2H09 A;  2ELH A;  3GVA A;  5TRD A;  4M74 A;  1U3E M;  3GXO A;  2L4M A;  2YX4 A;  3KP6 A;  3GFI A;  2DPD A;  1W7P B;  2XAG A;  1ZGA A;  4MGR A;  3NRV A;  2O61 A;  1WWX A;  1FWZ A;  3HSR A;  4CYD A;  4FX4 A;  2HKX A;  2E7W A;  3WTS C;  3QU6 A;  4PCQ A;  2PLY A;  2KRF A;  4LGW A;  4OU0 A;  2PFB A;  2DO7 A;  5FFZ A;  1SFE A;  4YG2 F;  1TNT A;  3BRO A;  4M73 A;  4LLG F;  4R8H A;  3Q9S A;  4FX0 A;  5F64 A;  5CVU A;  4GO1 A;  3EQL F;  2R7D A;  1SMT A;  4ESB A;  2QM3 A;  4KN4 X;  3R6S A;  1T2K A;  1KU2 A;  2MC3 A;  4ZYD A;  2LDU A;  3IKT A;  3HHH A;  3ZPL A;  5HS9 A;  4HW0 A;  2E7X A;  3JTH A;  4HX7 A;  4CO8 A;  5D5V B;  1P4X A;  5J8C A;  2ZME A;  3MEX A;  2HQN A;  3WU1 B;  2P5K A;  1ZG3 A;  1FX7 A;  3IWF A;  1XGS A;  5K1Y A;  2OQR A;  4BXU A;  4LG0 B;  1A04 A;  4HQE A;  1ZYR F;  3DEU A;  4HDU A;  1XSX A;  1ONV A;  3KEO A;  1R1V A;  1WSU A;  3FMR A;  3M8F A;  1YS6 A;  2QYO A;  4B8X A;  2YR2 A;  4YII A;  4KMF A;  3T8T A;  4EVI A;  4YFK F;  4ZYH A;  1WKM A;  5BPD A;  4UHT A;  4EGY A;  4OIR F;  4Q5S F;  5H6R A;  2XGX A;  5LBQ A;  1TW3 A;  3CUO A;  1Z7U A;  2DQL A;  1IF1 A;  3DXJ F;  3F22 A;  2D45 A;  3SZP A;  4QWQ A;  3ML6 A;  1FC3 A;  2KKO A;  4HV5 A;  1W5S A;  3QRF F;  3BJO A;  1RI7 A;  3WTT C;  2H6C A;  2LF8 A;  1LQ1 A;  1H9G A;  3T5X A;  5HS7 A;  4KIB A;  4BHP A;  1J2X A;  1T6S A;  1L0O C;  1O57 A;  3ISP A;  3GW2 A;  1KYZ A;  4ASN A;  2ZNY A;  3TDZ C;  1XMK A;  5CJ9 A;  3G3Z A;  2DK5 A;  3IWZ A;  4A5M A;  3LA3 A;  1TW2 A;  1BC7 C;  3WU0 A;  3CUQ C;  3F6O A;  3N4M A;  2D2W A;  3C18 A;  4EM1 A;  3P9K A;  2MH2 A;  3FMS A;  5ILU A;  1O7F A;  4MHG A;  1U8R A;  2TDX A;  3QP6 A;  1GXP A;  1TBX A;  2VE8 A;  2EA2 A;  3M1E A;  2A68 F;  2W24 A;  3E5X A;  4JBA A;  4PDK A;  1QZZ A;  5DEQ A;  2P6S A;  3F6V A;  1SFU A;  3V8L A;  2W57 A;  2G7U A;  1MDM A;  4OMY A;  4RS8 A;  3I64 A;  2YPR A;  4MQ9 F;  1J5Y A;  3IKV A;  4BNC A;  3RPU A;  5JI6 A;  2XIG A;  2UXX A;  1TNS A;  2MLK A;  2KJC A;  3BWG A;  4A0X A;  4WF2 A;  3RTR A;  2Z33 A;  1ZG5 A;  3TQN A;  1U5T A;  3U9G A;  2VOD A;  1ZGJ A;  4EM0 B;  2QBY A;  2R7F A;  1KQ0 A;  2V6C A;  3FXR A;  4M71 A;  1WQ2 A;  2CYY A;  4LB5 A;  1I6X A;  2QVO A;  4XBF A;  4QLC U;  1RUN A;  5LGU A;  2JZY A;  4CIC A;  4RB2 C;  2EA4 A;  2A07 F;  3S2W A;  4I01 A;  3WGH A;  3R0J A;  4I0B A;  4EJW A;  5L3D A;  3F3X A;  3U1D A;  2FEZ A;  3C1D A;  5FO5 A;  2JRT A;  2W85 A;  2ZNZ A;  2PN6 A;  3J80 K;  2XRO A;  2EFQ A;  5IT9 K;  4UNO A;  2VT2 A;  1FY7 A;  4A0Z A;  2PMU A;  1K7A A;  3CUQ A;  2HGC A;  2E1N A;  2PBI A;  4A2U A;  3JAM K;  1OMI A;  1XGO A;  4AWX B;  1HW2 A;  3GYH X;  1T38 A;  1QGP A;  4O6J A;  1ZLK A;  5K5Q A;  1B59 A;  4ENK A;  4LMY A;  2UZK A;  4WCG A;  2HZT A;  5DV5 A;  2ACJ A;  4IRH A;  1BOA A;  4M9X A;  3TO9 A;  5LGT A;  1STZ A;  5LEJ A;  2G7H A;  6PAX A;  3GFJ A;  1E17 A;  1UHW A;  4EQQ A;  5BOX A;  3I71 A;  5DCM A;  4A5N A;  1ZHF A;  3MQ0 A;  1K6O A;  2DQR A;  1JGS A;  2KIF A;  4UVA A;  4BHB A;  1TQI A;  2HQR A;  4RB3 C;  2NAZ A;  4HQM A;  2CWE A;  2AS5 F;  1K78 B;  1ZN2 A;  3K1M A;  1LDJ A;  3O2P E;  1FNN A;  4HF0 A;  3GWZ A;  2PEX A;  1Y0U A;  2BEO A;  2FMY A;  1YLF A;  3HTU A;  3FZV A;  3ZQ7 A;  1XCB A;  3K69 A;  2EK5 A;  4PZJ A;  2PJP A;  3TGN A;  2DTR A;  2A5Y B;  2FML A;  3WTX C;  1K79 A;  3V7C A;  4Y17 A;  2XAF A;  2FXA A;  4EV0 A;  1W7P D;  4K2E A;  1ZH5 A;  4ON0 A;  1Z91 A;  3RKX A;  1ZRC A;  4WXH A;  1Q1H A;  4EJU A;  1YO5 C;  5FD5 A;  3M9A A;  1QNT A;  1OYY A;  2GA1 A;  2NYX A;  2H94 A;  2VXZ A;  4G8X A;  2XAJ A;  4I2O A;  5CVJ A;  3F8B A;  5HLG A;  2OZ6 A;  5E8G A;  2LF7 A;  2DFI A;  1R23 A;  2CG4 A;  2IVM A;  3HUG A;  4IHS A;  5L3G A;  3ABU A;  2DBB A;  4EJV A;  2DK8 A;  5ERI A;  2CW0 F;  3D0S A;  3ZP5 A;  4XLN F;  4LG0 A;  3V7R A;  4HZF A;  3KLO A;  4L9T A;  1PUE E;  1KA8 A;  1R36 A;  4R1H A;  1MGT A;  1P4W A;  2STT A;  2ZFW A;  3BJA A;  3WGI A;  2FQ3 A;  3SQN A;  1SD7 A;  3IC7 A;  5JHU A;  2P8T A;  2IA2 A;  3QPH A;  3LAJ A;  1I1S A;  5D5W B;  3FHZ A;  4KIG A;  1B9N A;  3I53 A;  4BAY A;  2P4W A;  3K0L A;  4ZZD A;  2R3S A;  3LA2 A;  2F2E A;  1KQ8 A;  3I59 B;  4N9I A;  3HOT A;  2XUB A;  1D5V A;  5ILV A;  3G73 A;  3F8C A;  2EV6 A;  2HS5 A;  1B6A A;  3BOQ A;  1IN6 A;  5IT3 A;  3QAH A;  2ESH A;  4EJT A;  2V1X A;  3IRR A;  2Y75 A;  3WOD F;  2E1C A;  4AIJ A;  4ENM A;  4L0Z B;  1G3W A;  3LAP A;  2OD5 A;  4KIC A;  2IJL A;  3R60 A;  3HRS A;  4Y15 A;  2GQQ A;  1DPU A;  5K5R A;  2RC4 A;  2IPQ X;  4KNY A;  3FF5 A;  5EEH A;  2OU2 A;  2WWY A;  5CVR A;  1KU9 A;  2QQ9 A;  2V1U A;  2W25 A;  4HAM A;  4P55 A;  1MD0 A;  4Z2Y A;  5H20 A;  5LRS A;  3LFK A;  1R22 A;  3GZ6 A;  1KYW A;  2XKP A;  3ZMV A;  3OV8 A;  5AON A;  1ON2 A;  3BPV A;  3WTY C;  1FP1 D;  1V3F A;  2B0L A;  5FB2 A;  1KU7 A;  4OOI A;  3RPQ A;  3NEU A;  2IW5 A;  1YS7 A;  3ROU A;  1DPR A;  1XDU A;  1Z6R A;  1ODD A;  4KMU X;  1LVA A;  5L3F A;  4UXN A;  3TOA A;  2WC2 A;  4KT5 C;  4N9H A;  1D3Y A;  3I54 A;  2Z5U A;  2XAS A;  2EFN A;  1TTY A;  1XMA A;  3K1P A;  5CVV A;  5BMZ A;  1BI1 A;  2HTS A;  2PQ8 A;  1FYK A;  2VE9 A;  1GXQ A;  1P2F A;  2QQB A;  5A2Q Z;  4I98 B;  1CF7 B;  1P6R A;  5EEG A;  5D8L B;  2YX7 A;  4IRI A;  1BI2 A;  2FF4 A;  2OA4 A;  3KP3 A;  1HSJ A;  2P5V A;  1G4D A;  4LJZ F;  3GZ5 A;  4G6D A;  2CGP A;  4F7Z A;  5DDG A;  1HBX G;  3L00 A;  3ZMD A;  2F5C A;  4BHC A;  5HDN A;  1YQA A;  2ZXJ A;  1EH8 A;  2A69 F;  2P6T A;  2KIM A;  5D5X B;  4TV7 A;  3VEP A;  2HKO A;  1J75 A;  1MJ9 A;  3LWF A;  2ZKZ A;  1T39 A;  4S04 A;  2OBP A;  2KJB A;  2P7V B;  3I58 A;  4HLY A;  4L5J A;  3V8J A;  5D5U B;  1S7O A;  3H3U A;  1YW9 A;  3LST A;  4L0Y B;  5BS6 A;  2OAZ A;  2RN7 A;  3DPT A;  3C7J A;  3WG9 A;  3SFZ A;  3ULQ B;  5CLS A;  1KU3 A;  1IRF A;  5LLQ A;  2K02 A;  3B02 A;  4ENN A;  4P9U A;  3RYR A;  1LEB A;  4GYG A;  1QQI A;  1IN5 A;  2K86 A;  3D5L A;  4U0V A;  4NB5 A;  4IJA A;  4WXD A;  1PP7 U;  4CXF A;  4U7D A;  2P5L C;  1FSH A;  4YFX F;  4U0W A;  1K78 A;  5LHG A;  2HFH A;  3E97 A;  2FRH A;  1BI3 A;  2YSR A;  1OYI A;  2XHK A;  1YW7 A;  3WTW C;  3LQR A;  2RQP A;  1O3Q A;  4HLX A;  4I02 A;  3RYP A;  1FT9 A;  5FLX Z;  5D6E A;  3E6M A;  4UV9 A;  4JQF A;  5CVI A;  4I0A A;  4S05 A;  2VBZ A;  5HOO A;  2C6Y A;  1G6N A;  3ZN0 A;  4U0Y A;  5D4R A;  2BV6 A;  2VC1 A;  1LB2 A;  1U78 A;  4G7O F;  2ESN A;  3TO6 A;  3CDH A;  2F5F A;  1S29 A;  4FT8 A;  1S8N A;  4IVN A;  1GVJ A;  1YYV A;  2HDC A;  1J59 A;  3CTA A;  4HX4 A;  5D8K B;  1G3S A;  2STW A;  1ULY A;  2GXG A;  2ADU A;  2AXL A;  1V4R A;  1SMY F;  1R5G A;  5FFX A;  2RGV A;  1AWC A;  3SZT A;  3I5U A;  4EGZ A;  3WTZ A;  2NNY A;  5H6Q A;  2M45 A;  1YFH A;  3HTS B;  2DLL A;  4DQ2 A;  1R5H A;  3J81 K;  4CDG A;  4OIQ F;  1R7J A;  1EV7 A;  5F6F A;  4LK1 F;  5HVQ C;  2QLZ A;  2OZU A;  2XKO A;  2LSO A;  3HSE A;  4RGU A;  1ZAR A;  2RNJ A;  4G7H F;  3I4P A;  2GA2 A;  2KIU A;  1MJB A;  3HIF A;  3RKY A;  2VBY A;  4LLN A;  1OPC A;  3KP2 A;  2FSW A;  2WV0 A;  3EDP A;  4Y13 A;  1XD7 A;  3GLX A;  3GFL A;  1FOK A;  1HW5 A;  3I59 A;  2UXN A;  3BY6 A;  4PGH A;  4U7B A;  1IN7 A;  2V9V A;  3VOE A;  3MAJ A;  4B09 A;  2IT0 A;  2JTV A;  4RAY A;  1IW7 F;  2Y0M A;  1RIO H;  4KYW A;  4KDP A;  4I09 A;  4O3M A;  4GGG A;  4G94 A;  2MBF A;  4LLL A;  1IN4 A;  4LK0 F;  3V7S A;  1REP C;  5L3B A;  4L9J A;  1XB4 A;  3VOD A;  1VTN C;  2VOO A;  2GXB A;  1UFM A;  5BQT A;  1HKQ A;  1W7P A;  5JR3 A;  2O3F A;  3KP7 A;  4HF2 A;  4EJO A;  3EET A;  1T0F A;  3L7W A;  1Z6T A;  1C0W A;  1HQC A;  2JPB A;  3F8M A;  1LDD A;  1FP2 A;  3Q9V A;  4A0Y A;  1F9N A;  2M30 A;  3RI4 A;  4E70 A;  3M7G A;  2PMH A;  1R00 A;  2NRA C;  1LEA A;  4L18 B;  2J5O A;  2J5P A;  2PG4 A;  2ZBK A;  3FM3 A;  2EWN A;  4EM2 A;  1R1U A;  3ZMS A;  4N0B A;  2DT5 A;  2RDP A;  3JSO A;  1U6G A;  2JSC A;  3DKW A;  4KN7 X;  5FGM A;  1FPQ A;  3LA7 A;  2ISY A;  3RKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...