5DDGA

The structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with target double strand dna
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
AMKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKLGSKRGAALYKFNGKAYRKDPKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional factor AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator/dna
total genus 48
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ddgA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5ddgA01
2ICJA 2FU4A 3WE3A 4A5MA 2E1CA 3C3WA 5L3DA 2CWEA 3F22A 1I1SA 3KE2A 1U5TC 4P9FA 4HFQA 1J7KA 4HW0A 1T39A 1ZGAA 1G9QA 5IT9K 4L0ZB 2FRHA 2P5VA 2EA2A 4HZFA 3FJYA 4UNOA 4JZSA 2QZ8A 4KUMA 1SFUA 5C7QA 2KJCA 4O6JA 1Q27A 1W7PA 5FGMA 3Q2SA 4CDGA 3DUPA 4U88A 1O3RA 5CJ9A 1KU7A 3FF5A 4PCQA 1TQMA 1SD6A 1IZ1A 2HS5A 4EJVA 2X4HA 4HF2A 1PUEE 3WTSC 3I7VA 3V8LA 1FNNA 5HS9A 1WKMA 1B1BA 1QVJA 1S7AA 2XKPA 5DD8A 5ICCA 4M73A 4MTEA 2GXBA 1KQ9A 2CYYA 1VIQA 2A8QA 2H27A 2ISZA 2WV0A 4YIIA 5L3BA 1G0SA 2EWNA 4LLLA 5ANTA 3GZ6A 3PFIA 2RN7A 2QBYA 1KU3A 1U20A 1Q54A 2PNYA 1ON1A 3O6BB 2H6BA 2P7CB 2EFPA 5FO5A 2JT1A 4OMYA 5D5WB 4KIBA 2F5EA 3SMDA 4XSZF 4XLPF 2PG4A 3LA3A 1O7LA 1FPQA 3P6YA 1IW7F 3LQRA 1HW5A 5F64A 2PEXA 2Q9PA 4R8HA 5HDNA 2HQRA 1SZ3A 1Q1HA 4EM2A 3TOBA 1UHMA 1I1GA 3ELKA 4LFUA 1U2WA 1V8NA 5LEKA 3I64A 3GFIA 1ZHFA 2W4EA 2YVPA 2FSWA 3X0QA 1FC3A 2KDWA 1F1ZA 1HBXG 5H6RA 1FLIA 4N9HA 3F6OA 2HOEA 3OV8A 4BAYA 3E3VA 2FXAA 4M9XA 1MJ9A 2K27A 1HXDA 4EVIA 1UFMA 1XGSA 1GXPA 4G7ZF 3RKYA 3FZVA 4V14A 5BS6A 2IP2A 3W6KB 1XSCA 2O1CA 1PUNA 1MQEA 1O3TA 4I01A 5L3FA 5IT3A 3GXOA 4E70A 5JI6A 4PGHA 3TGNA 5ANUA 5D6FA 4IHSA 2VXZA 2WC2A 4FX4A 3RDIA 4XBFA 5D6EA 1YYVA 1T0FA 3TO9A 2VBZA 4HLXA 3Q5FA 1SMYF 3SXYA 5KK1A 3HTUA 4LLGF 2DUKA 3L09A 3ZMVA 1RZ4A 2YX4A 3CO7C 2NS0A 2Y75A 3BM4A 4PGGA 1JXSA 2R7DA 1DDNA 1DPRA 3Q4IA 1ZLJA 1G4DA 3SHDA 5LBQA 3X0OA 3CLOA 2BBYA 2Z3YA 4WXCA 1O3SA 3GEZA 3ISPA 5CVUA 3N9UA 1B59A 1O7FA 4KYXA 5FSKA 1ZG5A 1B6AA 3F72A 3U1DA 4ZYGA 5L3GA 1T6SA 2HDCA 5F1RA 4HBLA 2GAUA 5FD6A 4WX9A 5JVTA 3I4PA 1FZPB 1U78A 1PPVA 2IT0A 1TW2A 1SAXA 4OIOF 5HLIA 5DEQA 3BJ6A 2ZMEB 4ZG0A 1KYZA 2OQGA 2FMLA 4NHJA 2DK8A 3DFGA 3X0NA 2D1HA 2Q0OA 4A0XA 2FEZA 3QAHA 2AZWA 2HQNA 3DPLC 4I0BA 2RV8A 3WU1B 2DSBA 3MWMA 2R7FA 3ULQB 2GZWA 2QWWA 4A5NA 3P9KA 3I58A 3FMRA 3BDDA 1V8SA 2P5KA 4MQVA 1K26A 1REPC 1ZRDA 3QSJA 2YVMA 3EF5A 2GT4A 2F2EA 2EV0A 1YQAA 2E7XA 2DHOA 1IN7A 4D0PA 1K2EA 3ZR0A 2NRAC 1K79A 3V8JA 3V8KA 1S6LA 4JZVA 2G74A 2YU3A 5GHQA 3U53A 3Q9VA 2IRFG 1ZGJA 3FX3A 3TO7A 3TO6A 3KZZA 5AIQA 1TNSA 3MFKA 2Z33A 4G9YA 1IN5A 5HOOA 2XGXA 2VNQA 2OZ6A 2QYOA 3DV8A 4ILQA 2L01A 1V3FA 4Y13A 1IXSB 1QBJA 4HYEA 2CSOA 1SD5A 1MKMA 5JR3A 1V4RA 1YFHA 1LVAA 4CGZA 2M5WA 2AXLA 2W24A 3PQKA 3P7NA 1V8RA 1P4XA 2XUBA 2HWVA 1XDUA 2NAZA 3QU6A 3ZPLA 1JHFA 4OIPF 2M45A 2GQQA 4KYWA 4KA4A 1DPUA 4LG0B 2ICKA 4ENKA 3F8BA 2OZUA 3KP7A 4O5VA 4YFNF 2OQRA 4KIFA 2DPDA 3DPTA 1ODDA 4ZYHA 1O57A 1KHZA 2VNPA 1R58A 5HDGA 1XCBA 1SMTA 5K5RA 2O61A 4G8XA 3QP5A 5D8LB 3M9AA 3RPQA 4NFWA 3BJOA 2H09A 1BC7C 2R3SA 3KP6A 4OMZA 3BP8A 5DCMB 4F7ZA 4RGUA 1JKNA 3L2CA 4OU0A 2ELHA 3FM3A 3HYQA 1WSUA 1SFEA 1RRQA 4P96A 3F8CA 1LB2A 1XSBA 1RI7A 3O69A 1CF7B 2M87A 3EEUA 4EM0B 5CVVA 2KKOA 2FE3A 5DUKA 3R03A 4YPRA 3E5XA 5GHNA 1BN5A 3X0LA 4EGZA 4BYYA 2LF8A 2MA3A 2JSCA 2NYXA 2DT5A 4G7HF 1FP1D 3LSTA 3JSPA 3CNGA 5CLSA 5BPDA 1TQPA 2FVVA 1GVJA 2Z5UA 4WCGA 1I5ZA 3J80Z 4M74A 2YVNA 5E1XA 4R1HA 4KDPA 2K86A 1ONVA 1H9GA 2WWYA 5LGTA 3AAFA 1YO5C 3K1NA 3I5UA 3ML6A 3O2PE 3KVHA 3RPUA 1I9AA 2W84A 3KP3A 3FWEA 4JQFA 2CG4A 1C0WA 4MGRA 2P6TA 5HS8A 1BI0A 4N9IA 4LD5A 3ZMUA 2A8RA 1YIOA 2M8EA 3D0SA 4TV7A 2ZKZA 1MQWA 2XAQA 5ILVA 2I6KA 3X0SA 4Q5SF 3WTVC 3HRUA 3HIFA 4L5JA 1FX7A 1W4MA 3E57A 5L3EA 1R5HA 3ZP5A 4AVPA 1RIOH 1R23A 5LGUA 1L3LA 4G6DA 3ZMZA 3BPVA 1HSTA 4I0AA 4RS8A 3X0PA 3ABTA 4HDVA 1YS6A 1Y0UA 3T5XA 1BJAA 1ZG3A 1XCVA 5JFRA 1TLHB 2DO7A 3NEUA 4A0ZA 2A8TA 2JPCA 2J8QA 3KCCA 1RUNA 2JPBA 2QQAA 5DDGA 1LDJA 3WODF 1LDDA 3HSEA 2I8TA 1CF7A 4U0VA 2KIMA 1FYKA 2XVCA 1ZARA 4RB0A 4CZZA 5D4SA 2B0VA 3KFWX 3H92A 2CQKA 4HOBA 3BAPA 2OD5A 1V8UA 1KQ8A 5CFJA 4Q4ZF 2CL3A 1PDNC 5CYVA 2V6CA 3RYRA 3K2ZA 4B09A 1NQYA 2FBIA 1GA7A 2ISYA 3N77A 1NHAA 3MGMA 1Z9CA 3RI4A 5CVRA 4RB2C 4UVAA 4L0YB 2IA2A 2Y48A 3GLXA 1ZN2A 2HTJA 3C18A 4LK1F 5A2QK 1MDMA 3MQ0A 4KG4A 2DQRA 2LNBA 4MEYF 3TOAA 5ANVA 3DXJF 2A8SA 2QLZA 1TQIA 2HGCA 2ETHA 5D5UB 1YW7A 3H95A 2KJBA 4HX8A 5TRDA 2A5YB 5HS7A 3CO6C 1Q33A 3K1PA 4HLYA 1XGOA 2L4AA 2YPRA 4MHGA 3WHWA 3LWFA 2K02A 1XSDA 1VHZA 2W25A 3WTYC 5BMZA 2B2KA 4NFXA 3F23A 3DKUA 3BZ6A 4ETSA 3KP2A 3ROUA 4MNUA 1K7AA 3ECOA 4G94A 1Z05A 2FA5A 2K4BA 3F3XA 1YG2A 3J80K 3FSPA 1VCDA 4PZJA 1HKTA 1U3EM 2BYVE 1MJAA 4MPOA 2DK5A 1HQCA 2XKOA 3L85A 2EFQA 1ZLKA 4P9UA 1EH6A 2Q2EA 5ICGA 1F3YA 3FXRA 4KN4X 4ESJA 3GWYA 1NFZA 2YX7A 4GYIA 1LDKB 5J8FA 3P9CA 2QVOA 2V1DA 1QO0D 2VT3A 3K9TA 1W5TA 1KYWA 4KICA 3QRFF 1KA8A 2MC3A 4DNCA 1S29A 4N0BA 3F21A 1G3WA 1YS7A 2MLGA 3WGHA 5E1ZB 1T38A 4BXUA 1VIUA 2VC1A 4IRIA 2STWA 1FWZA 5ERIA 2FMYA 5DUIA 4I98B 1XD7A 5D4RA 5FLXZ 1A04A 4P5OA 3J7AO 3WGGA 3DF8A 1J75A 3I59A 3GZ8A 4CYDA 1PUSA 2B06A 2XAHA 1FYLA 1SU2A 5LRSA 3E6CC 3HSFA 3OOPA 2EFOA 1VK6A 1S3JA 2F5DA 1R22A 3GFMA 2M1BA 3H3UA 1B9NA 2VE9A 5ILSA 1UB9A 1R00A 4IXAA 3L00A 3CUQB 4RB3C 2O5FA 3NRVA 1MJBA 2O8XA 2PQVA 3K0LA 3IC7A 5ANSA 5FSMA 1OPCA 1KGSA 1HZTA 1LQ1A 2XV4S 1V8WA 1S7OA 4IF4A 1H0MA 5K5QA 4GGGA 3IRQA 1XMAA 1XDSA 4YPHA 2FBHA 4RAYA 1G6NA 3F6VA 3HOSA 3A6SA 1G3TA 2CW0F 5BONA 1D5VA 3I7UA 5FSLA 4HDUA 2ZNZA 4A6EA 3W6JB 4P55A 5BQTA 4EM1A 5J6XA 4HAMA 3RKWA 2PMHA 2K7LA 4KFCA 1B4AA 4ENNA 3J7Ye 1F5TA 1IUYA 3T0YA 4ZH4F 3QU3A 2JTVA 3F6AA 1PP8F 2O5WA 2PJPA 4WWCA 2DFIA 1SD4A 3GO5A 5ICFA 1USSA 3V4GA 2DPUA 5ICEA 3KZYA 4HQEA 3EQLF 5IW4A 3L7WA 1P2FA 3D5LA 2DAOA 1AOYA 1R5GA 3O3KA 5D8KB 4BHBA 1P6RA 2ADUA 5FFZA 1WRJA 2FNAA 1KTGA 2GIVA 1V8MA 4FX0A 2VBWA 2UXXA 4ASNA 3LAJA 4K6EA 2X0LA 3FXQA 1U8RA 3MCZA 3Q91A 2EV6A 1Z1DA 3CUQA 1ON2A 2EK5A 5CFIA 3P9IA 2QM3A 3E5QA 3JAMZ 3F8MA 3X0MA 1XGMA 2QJOA 1AWCA 2I8UA 1W7PD 2ZNYA 2MH2A 4WXHA 3F13A 2CGPA 1TUMA 3LAPA 1OR7A 4M6XA 2L54A 3T8RA 4KMFA 5K5OA 3JTHA 1TTYA 2OA4A 2O0YA 3ACAA 2FQ3A 4S2WA 3ZN1A 4BHPA 2HZTA 3DQVC 1VTNC 1V8LA 6PAXA 2ZJ2A 2FF4A 1BIBA 2DW4A 3M1EA 3HTSB 3IKTA 2C6YA 5E8GA 2W57A 1IN8A 1F4KA 4CO8A 3ID9A 3RH7A 1D8JA 1GHCA 3VOEA 4NQWA 3R4KA 1BI3A 1XGNA 4FHTA 1LNWA 2GWRA 1RUOA 4GXOA 2VOOA 2Y0MA 4GCVA 2HYGD 2ZFWA 4YOQA 5F6FA 3E6BA 4LB5A 1P4AA 5IT9Z 2RGVA 3J81Z 3OGAA 4IRGA 3I53A 4UXNA 1R36A 4I02A 2A3SA 4KMUX 1FBSA 3KP5A 3MAJA 1K78A 5ED4A 1RNLA 2L3DA 3SHFA 1LEBA 1OW2A 1VRLA 5DYMA 1QZYA 3X0KA 2YR2A 3REOA 2GB5A 4CICA 1QZZA 3IHUA 3VFZA 1IN4A 1WQ2A 4HV6A 2VBYA 3WTWC 1Z6TA 2NNNA 5HLHA 1YW9A 3O61A 1TNTA 1F9NA 1J2XA 3M7GA 4ZZLA 1SD7A 1TW3A 2VE8A 1K6OA 4UV8A 3N97A 3R60A 1IRYA 4WF2A 1PPWA 3HSRA 1PPXA 3EUHA 3GYHX 4LMYA 4L9NA 4G7OF 3WE2A 3GW2A 3S2WA 4LLNA 1BM9A 1V8YA 3BHOA 3FHZA 3K1MA 3N4MA 4Y17A 3MCFA 2L02A 5DPKA 2HKXA 1USTA 5AONA 3RIRA 4WK8F 1BC8C 2PMUA 3JSOA 2HTSA 3EYIA 5ISYA 4IRHA 1ZG1A 2G73A 2LSOA 1L0OC 1YTYA 1TBXA 4KNYA 1Z7UA 3COAC 4S2XA 4KTBA 5GHIA 1JHHA 2V79A 3E6MA 1FP2A 3WGIA 1MDMB 5L3CA 5I8UA 2P6SA 2QKMB 1P92A 4DYWA 5JHUA 3I0TA 1KU2A 1S8NA 5J8CA 1U5TB 5GHOA 4Z2YA 3Q9SA 5AIPA 1PP7U 3JAMK 4ZYEA 3GVAA 1ZREA 4UUVA 5BPIA 4HQMA 2MD5A 1HKQA 3GFLA 2G9WA 4IHTA 3MDIA 2MLKA 4YIFA 4AD9A 2A07F 2D45A 2XRNA 3HOTA 1E2XA 5TJJA 3VB2A 3KETA 2RDPA 4XLNF 4I09A 3T1BA 4N1TA 2DTRA 4LK0F 3F8NA 3EYYA 1EH8A 2J5OA 1BBYA 1DP7P 2G7UA 3LA7A 1JE8A 3E6DA 2D1VA 3Q2TA 3EXQA 3SFZA 3F8FA 1HX3A 3CTAA 5H6QA 4ICKA 2VODA 2MBFA 1ZRFA 3R61A 3O8SA 4OINF 4B8XA 1WI9A 1YW8A 1R1VA 1U6GA 3J81K 1SOIA 2EA4A 4KN7X 4S05A 2IW5A 4ZZDA 4G6QA 2EV5A 3EESA 1LJ9A 5D5XB 1XN7A 1RYAA 2O6GE 3ZN0A 2BE5F 3X0IA 5BOXA 1IXRC 1QGPA 2ESHA 3ZR1A 4JZUA 2GXGA 3GZ5A 4HF0A 1X51A 5E18F 1U5TA 2MH9A 3K69A 4Y15A 4R79A 2J5PA 2B0LA 2IJLA 1EV7A 4JZTA 2Z99A 3FMSA 3I59B 2OBPA 4U7BA 3KP4A 3PQJA 1XSAA 2IA1A 4Q48A 2RC4A 2RRKA 1IF1A 4OIQF 3MEXA 4WXDA 2DSCA 2QENA 3WG9A 3TQNA 2XIGA 5FSIA 4GO1A 4UV9A 2PLYA 3RJPA 1MUTA 4S04A 4A6DA 4RB1A 5FD5A 2QQ9A 5E8IA 1O3QA 1PUQA 3I54A 1KQ0A 2F5CA 2P5LC 1G3SA 1KT9A 3FMQA 2OAZA 1FY7A 2A69F 3GX4X 1V8TA 4AWXB 3R0AA 4JBAA 3L9FA 4YG2F 3JW4A 4ESBA 5EEHA 1I6XA 2VBXA 3AC9A 2AS5F 5DV5A 2FBKA 1DUXC 4ON0A 2XROA 5EEGA 3O6ZA 3IL2A 4Q47A 3G0QA 3DEUA 4AIKA 1FSEA 2IA0A 1H9TA 3CDHA 1X3UA 2EFWA 3SQNA 1V8VA 4GYGA 4EJOA 4BQAA 1R1TA 3HHGA 1MK1A 3BOQA 2ZO4A 1OYWA 3CUOA 4BNCA 1FSHA 1IN6A 1LEAA 5FSOA 2W85A 2EB7A 3B73A 3TKYA 1D8KA 1KU9A 3U2RA 3TDZC 3FCMA 2LDUA 1XSVA 4QWQA 2H6CA 3ZQ7A 4XSXF 3JTGA 4EGYA 3WTUC 2CFXA 3Q1PA 1BOAA 2RKHA 3I71A 3BWGA 2ESNA 2LF7A 3ZMSA 5FFXA 1MZBA 2FKBA 3DKWA 3GFJA 5C8LA 4L9JA 2YSRA 2EJRA 2HEOA 1MR2A 2EFNA 4IPAA 4M9ZA 2VT2A 4A12A 3BPXA 4LGWA 2XSQA 2PN6A 3NQOA 2ZBKA 4UHTA 3V7SA 1B9MA 1OYYA 2A61A 2H94A 2PQ8A 2DU9A 4U0WA 3MZYA 1FOKA 1XSXA 2JRTA 5LLQA 2A6EF 3G73A 1Z91A 1QNTA 5LHHA 5DD4A 1HSJA 2DQLA 1FBUA 2QJTA 1BI2A 4U0YA 4HA8A 2GA2A 1IXCA 3KLNA 4M72A 2TDXA 2LKPA 2V1UA 3HYIA 4NB5A 2WTEA 4MQ9F 2OU2A 1W5SA 5ANWA 1D3YA 1EH7A 4A0YA 4UVCA 2KIFA 4JK1X 1HW2A 5HLGA 3WTTC 4OOIA 3BROA 2BV6A 2VC0A 5H20A 2JVBA 3E97A 2O03A 2ZCWA 5CVJA 3CUQC 1OMIA 3TDUC 1QPMA 3HRSA 4AIJA 2F5FA 3SONA 3HRTA 1FYMA 2P4WA 1STZA 1J5YA 5E17F 4RGSA 3C7JA 3U9GA 3A6TA 2STTA 5K1YA 1R67A 5HZXA 4ENMA 3IKVA 4KG3A 3A6UA 5FB2A 1J9IA 2UZKA 1K78B 1IRGA 5GHPA 3QOPA 2G7HA 2M30A 3GRNA 2L4MA 2HR3A 3X0RA 2IPQX 4BH9A 2PBIA 2HKOA 2ACJA 3IWFA 1FBQA 4LJZF 4EV0A 3ECHA 5LHIA 1WWXA 3FM5A 3GUDA 3R6SA 2BGCA 4A2UA 2IVMA 3VODA 5LPGA 4HX7A 4PDKA 3LQQA 1T2KA 1NQZA 3H3ZA 2GA1A 3MDGA 1E17A 3EDPA 1MD0A 2NNYA 1P4WA 1Z6RA 4DQ2A 3SZPA 2KRFA 4FT8A 4L9VA 4L18B 1SFXA 4QLCU 5GHJA 3HRMA 2PI0A 5FLXK 4UVBA 3VEPA 2JZYA 1R7JA 3QPTA 1VC8A 5E20A 2RNJA 2PFBA 1XB4A 4I7HA 1MGTA 2P8TA 3FXUA 4ENJA 3E5UA 3T8TA 2XAGA 2V9VA 1ZRCA 2YYHA 5FSNA 2QUFA 1ULYA 2ZMEA 1SJYA 1J0RA 3M8FA 3GG6A 5E1WA 3WTXC 1IAWA 1ZYRF 3GF2A 1HKSA 3DP7A 2A8PA 3V7RA 4BHCA 1V8IA 3G3ZA 4C9XA 4OIRF 2FNPA 1HW1A 3X0JA 4S2YA 2DI3A 3P5TA 5A2QZ 3RKXA 3FK9A 2DSDA 2Z9OA 1ZAOA 1JRKA 3EETA 3LFKA 2RQPA 4RGXA 1NFSA 3BJAA 1I27A 2HYFA 3IWZA 3HHHA 4HX4A 1MP2A 1FT9A 1XMKA 2BEOA 3QPHA 2RVCA 3KLOA 4HV5A 1CGPA 5C7TA 4L9TA 4EJWA 3ABUA 3BY6A 2KDVA 5IW5A 1IRFA 4YFKF 3SZTA 1VHGA 2COMA 3V7CA 1ZH5A 2XAFA 4K2EA 4RGRA 5GHMA 2A6HF 3ERED 2Q8KA 1GXQA 3M8EA 2A68F 3KEQA 4C9WA 4YFXF 2GT2A 2K4JA 3LA2A 4U7DA 5LGNA 1BIAA 3HHJA 4L5IA 1QQIA 2QQBA 3MZHA 1X83A 4EJUA 2FOKA 3GWZA 5HVQC 1RRSA 5HDKA 3FFUA 4HF1A 3A6VA 3CJNA 1X84A 1G3YA 1T98A 4IJXA 4ZYDA 1JGSA 1W7PB 2XASA 2A6TA 2HFHA 4HVYA 2V1XA 4MEXF 2ZXJA 1R1UA 4I2OA 3C1DA 3R0JA 1YLFA 2UXNA 4M6YA 3QP6A 4IJAA 4LG0A 4LB6B 1VC9A 4MTDA 4ESFA 2VN2A 4KIGA 4O3MA 4M9SA 2CO5A 1UHWA 1OKRA 2UWMA 2D2WA 3ZMTA 5LHGA 1OYIA 4RAZA 4IVNA 3RTRA 4EJTA 4N1UA 4S2VA 3B02A 2XHKA 4EMSA 4KT5C 2XAJA 2KIUA 1BI1A 3WTZA 5KVRA 2DLLA 2R5WA 4EQQA 2E7WA 5DCMA 1PVFA 3I9XA 1UCRA 2O3FA 4CHUA 1J59A 3O52A 5LRRA 2VONA 5CVIA 4CXFA 2YVOA 2P7VB 2VOPA 3IRRA 3Q93A 3COUA 3RYPA 3WU0A 5D5VB 4AIHA 3HUGA 3ZMDA 3KEOA 5ILUA 2E1NA 2DBBA 4H0EA 4M71A 5DCFA 5LEJA 4XRFA 2QBYB
chains in the Genus database with same CATH superfamily
2H1KA 2XPUA 2ICJA 3HG9A 5IP7J 2FU4A 4PJMA 3WE3A 3GTQJ 2V4JC 3TEDA 4A3LJ 4XRSA 3S2DJ 2ICWG 4A5MA 4MO7A 1AKHA 3BR0A 3ABMH 1B72B 2E1CA 3BZCA 3C3WA 3SDBA 2MGQA 2CWEA 5L3DA 1GT0C 3F22A 4BJ6C 1OCCH 3KE2A 2QA4I 1I1SA 1U5TC 2M4GA 4P9FA 4HFQA 3LSMA 1J7KA 4HW0A 1T39A 3A01A 1ZGAA 5FJ8J 1G9QA 3RQIA 4XKBA 5IT9K 4L0ZB 2FRHA 2P5VA 2EA2A 2IGMA 3OY9A 4HZFA 3FJYA 1OCTC 4UNOA 4JZSA 2QZ8A 4KUMA 2E34A 1SFUA 1A36A 3ZQFA 5C7QA 3OYDA 2KJCA 4O6JA 3HC7A 1Q27A 3OYFA 1W7PA 5FGMA 3Q2SA 4Y33A 4CDGA 3JR9A 1R9TJ 1KONA 3DUPA 4U88A 2Z2SB 1O3RA 5CJ9A 1KU7A 3I4MJ 5F0CA 3FF5A 4PCQA 4RM3A 1P9QC 1S7EA 1JJ6C 1TQMA 1SD6A 1IZ1A 2HS5A 4EJVA 3CC7I 4HSRA 2X4HA 3HBLA 4HF2A 1PUEE 3WTSC 3I7VA 1IRZA 1ERDA 3CP2A 1MBKA 4ZYAA 3V8LA 2X6OA 4DW6A 3CCRI 1FNNA 2EINH 1RKWA 1ETXA 5HS9A 3AKZA 1WKMA 2QQ8A 1B1BA 4IEJA 1QVJA 1S7AA 2XKPA 5DD8A 2KL4A 2M7AA 5ICCA 2F4IA 3AG1H 4M73A 4MTEA 3GZNB 2W00A 2GXBA 1KQ9A 3Q3SA 2ZXIA 1V54H 2CYYA 2O9LA 4XIDA 1VIQA 2A8QA 2H27A 2ISZA 2WV0A 4YIIA 5L3BA 1G0SA 2EWNA 4LLLA 5ANTA 2B63J 3GZ6A 1YOVB 4CCMA 1TT0A 3PFIA 2RN7A 3L2RA 1UAAA 5J4YA 2QBYA 1QVUA 1KU3A 1Q54A 3IH2A 1U20A 2PNYA 1Z3XA 2ZC2A 4AVZA 1RC9A 1ON1A 1Z3YA 3O6BB 2H6BA 2P7CB 2EFPA 2DA3A 1FEXA 5FO5A 4BKXA 2JT1A 4OMYA 5D5WB 4KIBA 2F5EA 2Z16A 3SMDA 4XSZF 2PG4A 3LA3A 4XLPF 3M3YJ 1O7LA 1FPQA 3P6YA 3BG6A 1IW7F 3LQRA 1HW5A 3OYCA 5F64A 2PEXA 5KCMA 2Q9PA 2LR8A 3J7YJ 3BCBA 3KZIC 4R8HA 5HDNA 2HQRA 4J01A 2K9LA 3OOUA 1SZ3A 1UMQA 1Q1HA 3HKZN 4IHWA 4EM2A 3TOBA 2JA5J 1UHMA 1I1GA 3H5RA 3ELKA 2UUZA 1ZQ3P 3A2KA 4LFUA 3MKWB 3OL4A 1U2WA 1V8NA 5LEKA 3CESA 3I64A 3GFIA 1ZHFA 2HDWA 2W4EA 2YVPA 2FSWA 3CD6I 3X0QA 1FC3A 3FXMA 5K7FA 1HOMA 3G1LA 2R7RA 4QTRA 2KDWA 2Y30A 1F1ZA 2MSYA 4HEA2 5GAGJ 5H6RA 1HBXG 1H8AC 2HQAA 1MMAA 4NBQA 3GBGA 2AHQA 3MMYB 3OYEA 1FLIA 1UJ8A 2F4MB 1FIAA 2VJJA 4N9HA 1BR4A 1VQLI 3F6OA 2HOEA 2DA6A 3OV8A 4BAYA 5GPAA 3E3VA 2IS6A 1X2NA 1VQ8I 4B1RA 3ERMA 2VKEA 3MKZA 2FXAA 3G2BA 2M2EA 3LSIA 4M9XA 1P7JA 1MJ9A 2K27A 1HXDA 3B6AA 1UFMA 1XGSA 4EVIA 3K70C 1GXPA 4G7ZF 3RKYA 1OLTA 3FZVA 3ZQLA 4V14A 5BS6A 3HXLA 3OS2A 2IP2A 3W6KB 1RKTA 1XSCA 2O1CA 1PUNA 3BTLA 2OTJI 1MQEA 3ASOH 1O3TA 4I01A 3GTMJ 2IGOA 5L3FA 1OCOH 5IT3A 3IH3A 1D5YA 1NG6A 3CF2A 5F0FA 3GXOA 4E70A 5JI6A 2V9KA 4NUBA 4PGHA 3TGNA 5ANUA 5D6FA 4IHSA 2NVQJ 2VXZA 2WC2A 4FX4A 3S1QJ 4N4NB 3RDIA 4PJLA 2R7XA 2DA5A 5GTHC 4BACA 4I99C 4XBFA 5D6EA 1YYVA 1T0FA 1X1BA 2LG4A 3RPUD 3TO9A 2M3AA 2I8DA 2VBZA 2X48A 4HLXA 3Q5FA 2AXTC 1IUFA 3LMMA 5IOZA 1IJWC 1SMYF 2LOOA 4BL0B 2P0WA 3SXYA 5KK1A 4M6VA 3HTUA 4LLGF 2DUKA 3K2AA 3L09A 3ZMVA 1RZ4A 2YX4A 3CO7C 1K4TA 2PMZA 2NS0A 2Y75A 3BM4A 3K4MA 2KDZA 4PGGA 4B3AA 1JXSA 2R7DA 4XM3A 4IL6C 1DDNA 1DPRA 3Q4IA 2R93J 1ZLJA 1G4DA 1HA8A 4CCNA 3SHDA 4QPOA 2HDDA 4C2TA 4A3GJ 5LBQA 1N78A 3X0OA 3WHCA 3CLOA 2BBYA 2Z3YA 3CJTB 4WXCA 1O3SA 3GEZA 4CH7A 2LK2A 3ISPA 5CVUA 3N9UA 3OYHA 4A93J 1B59A 1O7FA 4KYXA 5FSKA 3HGYA 1LE8B 3CCEI 3W6VA 3BR5A 1ZG5A 1B6AA 2XGDA 3F72A 3U1DA 1FOXA 4ZYGA 1JT0A 5L3GA 1T6SA 2CUFA 2HDCA 1O4XA 5F1RA 2DA4A 4HBLA 2GAUA 4V2GA 3TP0A 5FD6A 4WX9A 3A03A 5JVTA 3ZRGA 2WAQA 3I4PA 4XRSG 1X4OA 1FZPB 1U78A 1PPVA 4ZC3A 2IT0A 1SANA 5EG0B 4A3CJ 1F36A 1TW2A 4NC8A 1SAXA 5HLIA 4OIOF 2DOFA 5DEQA 1POGA 3BJ6A 2XSDC 2GM4A 2JQ7A 1W5CC 2ZMEB 4ZG0A 3MD2A 3V42A 1KYZA 2OQGA 2FMLA 4NHJA 2ZFUA 2DK8A 5F0HA 2CV2A 1K61A 4UUTA 2E2IJ 3DFGA 2V7FA 4BE1A 2EZKA 3X0NA 2D1HA 3UR3C 2HU9A 2Q0OA 5B3SH 2K85A 1KZHA 4A0XA 1LPQA 4BQOA 2FEZA 3QAHA 2ZXWH 3EUAA 1IV6A 2AZWA 2HQNA 3DPLC 4I0BA 2RV8A 3WU1B 2XC7A 2DT6A 3LOCA 4CCLA 3S2HJ 2DSBA 3MWMA 4UB6C 2R7FA 3ULQB 2GZWA 2L5QA 4PUSA 2QWWA 3BG5A 4A5NA 3G71I 3IH4A 3P9KA 1UHSA 2W82A 4AC0A 4V2FA 2E5NA 3I58A 5GPCA 3FMRA 4HNUA 2L7KA 3HOUJ 3BDDA 1V8SA 2P5KA 4MQVA 1K26A 1VQ4I 1REPC 1ZRDA 4II3A 2VUMJ 2CW7A 3QSJA 3PSIA 2Y0SA 2YVMA 3EF5A 2VI6A 4II2A 2GT4A 3OYJA 2F2EA 2EV0A 1YQAA 2E7XA 4E7SA 2DHOA 1IN7A 4D0PA 1K2EA 4D7NA 3ZR0A 3OIPA 2NRAC 1K79A 3V8JA 3V8KA 2DDBA 1S6LA 3HZJA 2VPLA 3L2QA 4JZVA 4NDLA 2YU3A 4XORA 2G74A 5GHQA 3U53A 2ZMEC 3Q9VA 2IRFG 1ZGJA 1R49A 3FX3A 3TO7A 2VPRA 2E2JJ 3TO6A 3KZZA 5AIQA 1ZGWA 1TNSA 1RPWA 3MFKA 1LFPA 2LKXA 2NOJB 2Z33A 1BL0A 4G9YA 1IN5A 1LE8A 3HOWJ 5HOOA 2XGXA 2VNQA 2OZ6A 1AA7A 2QYOA 3DV8A 4ILQA 4PSXA 1FTZA 2L01A 1V3FA 1PJRA 1WJDA 4Y13A 1OISA 1IXSB 5EZHA 1QBJA 3CCSI 4HYEA 2IGKA 3FIWA 2CSOA 1SD5A 1MKMA 2ID3A 3TP3A 5JR3A 1V4RA 5IP6A 5FKMA 1Z77A 1YFHA 2VKVA 5EG0A 1LVAA 4CGZA 4AM3A 2DFFA 3BZKA 2M5WA 2AXLA 2W24A 5F08A 3PQKA 3P7NA 4M3DA 1V8RA 1OCZH 4PJNA 1P4XA 2XUBA 1YITI 2HWVA 1XDUA 2NAZA 2H8RA 3QU6A 2HYJA 3ZPLA 2YUSA 1JHFA 5EF6A 4OIPF 2M45A 1ENHA 2GQQA 1A6IA 4KA4A 5GP9A 4KYWA 3A02A 1DPUA 4LG0B 2UV1A 2ICKA 2XRLA 1MH3A 3WG7H 4ENKA 3F8BA 2OZUA 3KP7A 4O5VA 4YFNF 2OQRA 4KIFA 1HCRA 1WPKA 5C4JJ 2EZIA 3ZQCA 2DPDA 2Y2ZA 3DPTA 1ODDA 4ZYHA 1O57A 4W1UA 2CQQA 1APLC 1KHZA 2VNPA 1R58A 4UB8C 2ELKA 5HDGA 1XCBA 1SMTA 5K5RA 2ME6A 2O61A 4G8XA 3QP5A 5D8LB 2WB1N 4F92B 3M9AA 3CDIA 3RPQA 4NFWA 3BJOA 2H09A 1BC7C 2K40A 2R3SA 4MFDA 1EKEA 3KP6A 4OMZA 4BS9A 3IV5A 3JRGA 5GAHJ 3BP8A 5DCMB 4F7ZA 4F91B 1Y1WJ 3S14J 3BTIA 2BVLA 4RGUA 1S72I 4XN0A 1MBJA 1T08B 3PSFA 1JKNA 3L2CA 4OU0A 1PUFB 1YHQI 5KAFC 2ELHA 3FM3A 3HYQA 2Y69H 1WSUA 1SFEA 2OCEA 3G1OA 2AQEA 1RRQA 1TZLA 4P96A 2A5WA 4N4OB 3WU2C 1JTYA 3F8CA 1LB2A 2LBFA 1XSBA 2RAEA 3E0JB 4B43A 1AHDP 2KRCA 1ACIA 5EZGA 1RI7A 3O69A 2DJIA 3HPHA 1CF7B 1R5ID 2M87A 3EEUA 2WA0A 4CCOA 4EM0B 5CVVA 2KKOA 2FE3A 5DUKA 4U87A 3BC8A 3CMMA 2IS2A 3R03A 4YPRA 2ELJA 3E5XA 5GHNA 1BN5A 1Y0NA 3X0LA 1FOYA 2KQRA 4EGZA 5FLVA 4BYYA 2LF8A 3GTOJ 2HQ5A 2JSCA 2M0MA 2DT5A 2MA3A 2NYXA 3DBLB 3H9GA 2ME0A 5HODA 4G7HF 3RKQA 1FP1D 3LSTA 3JSPA 4XONA 3A01B 3CNGA 1ETQA 5CLSA 5BPDA 3CCUI 1TQPA 2FVVA 1GVJA 2Z5UA 4WCGA 1I5ZA 2E19A 3J80Z 4M74A 2YVNA 5E1XA 4R1HA 4KDPA 3S1NJ 1GUUA 2K86A 1ONVA 2DYRH 3WHBA 1H9GA 2WWYA 2X9DA 4BDYA 5LGTA 3H9JA 1RRJA 3VWBA 2XPWA 5E3MA 2LLKA 3AAFA 4A3EJ 1YO5C 5IPAA 4MLOA 3K1NA 3H0DA 1SFKA 1VF9A 3I5UA 3ML6A 3O2PE 3KVHA 3RPUA 2WY7Q 2RQQA 5E3LA 1I9AA 2DTZA 1JT6A 2VLAA 1MNMC 2W84A 4RLFA 3KP3A 3FWEA 4JQFA 4RA2A 5M5WJ 2CG4A 1C0WA 3K4LA 4MGRA 2P6TA 4XLHA 5HS8A 1BI0A 4N9IA 4LD5A 2HVRA 2BXZA 3ZMUA 3CJRB 2A8RA 3CCVI 3EPZA 2VIXA 2VKDA 1YIOA 2DMTA 2M8EA 3D0SA 2ZKZA 3QPLA 4TV7A 2FX0A 5EYRA 1MQWA 2XAQA 4XN3A 3M4OJ 5ILVA 2I6KA 4XK4A 3X0SA 3FHNA 3WTVC 4Q5SF 2XF6A 1X1AA 3HRUA 3HIFA 4L5JA 1FX7A 1W4MA 3E57A 5L3EA 1R5HA 4A3DJ 3ZP5A 4AVPA 5M5XJ 1M1EB 1RIOH 1R23A 5LGUA 1L3LA 4G6DA 4E6KG 3ZMZA 1EJ9A 3BPVA 3ZQHA 4ZTJA 1PUFA 1HSTA 1TWFJ 4I0AA 4RS8A 2R5YA 4CCJA 3X0PA 4XKCA 3ABTA 4HDVA 1WJCA 1YS6A 1Y0UA 3T5XA 1BJAA 1ZG3A 5TISC 4I6ZA 1XCVA 5JFRA 3DU5A 3H5AA 2CV1A 1TLHB 3S3NA 2DO7A 3VYTB 3NEUA 4A0ZA 2A8TA 4UY8I 2JPCA 2J8QA 3KCCA 3ZQGA 1RUNA 2O8KA 4ABZA 2JPBA 1HDPA 2QQAA 5DDGA 5F1JA 1LDJA 1LDDA 3WODF 3HSEA 3FISA 2I8TA 1CF7A 1MNEA 2NXNB 3QODA 4U0VA 2KIMA 3PIPF 1FYKA 2XVCA 1ZARA 4RB0A 4CZZA 2YS9A 5D4SA 2B0VA 3KFWX 4PFOA 2F5VA 3H92A 1BA5A 2CQKA 4HOBA 2OTLI 3BAPA 2JK3A 4ITVA 2OD5A 5F04A 1B8IA 1V8UA 2K9MA 2ZJQF 1A31A 5DM6F 1KQ8A 2BW3A 5IYBJ 5CFJA 3VDXA 4Q4ZF 3Q0UA 2CL3A 1OFCX 1PDNC 5CYVA 2L7MP 2V6CA 2WADA 5DS9A 3RYRA 3K2ZA 4B09A 1NQYA 1VI0A 2FBIA 3OR2C 5B1BH 3W3CA 2BVMA 1GA7A 2ISYA 4CSWA 4BGDA 5K7HA 4A3IJ 3N77A 1NHAA 3MGMA 3BR3A 3A1YA 1Z9CA 3OR1C 3RI4A 5CVRA 4RLQA 2DMPA 3RSNA 4AIDA 2XSJC 4RB2C 2HI3A 2IXSA 4UVAA 2CUEA 4L0YB 2IA2A 2Y48A 3GLXA 3QOEA 3LSHA 1ZN2A 2HTJA 3C18A 4LK1F 5A2QK 4E7HA 4OAYA 4IKFA 2BHYA 1X3ZB 1MDMA 2DFHA 3MQ0A 2DQRA 4KG4A 3IAS2 1NTCA 2LNBA 4MEYF 1IV8A 1MBHA 3TOAA 3DXJF 5ANVA 2A8SA 5B66C 2QLZA 1TQIA 2P81A 2HGCA 2ETHA 5J47A 3CZ6A 1YW7A 2I10A 3ZGKA 5IP9J 5D5UB 5IOYA 2KJBA 3H95A 1R4MB 3HM5A 3LL7A 4HX8A 3F9KA 5C3EJ 3AG4H 3FDYA 4Y7NJ 5EJCA 1G8XA 1YX5A 5TRDA 2R7TA 4D9JA 2A5YB 5GTIC 5HS7A 3QPSA 2YU9J 3CO6C 1Q33A 3IAM2 3K1PA 4E7JA 2R5ZB 4FTHA 4HLYA 1XGOA 2L4AA 2YPRA 4OAZA 4MHGA 3WHWA 3KIOA 3LWFA 2K02A 1XSDA 1VQ5I 3PO3J 3S17J 4IHXA 1VHZA 1NK3P 2W25A 3BT9A 3WTYC 5BMZA 5CPRB 3K4BA 4FASD 2B2KA 1SVLA 2EPFA 4NFXA 1LFBA 3F23A 5IYDJ 3RZDJ 3DKUA 1Z21A 2X1EA 3BZ6A 4ETSA 3KP2A 1YIJI 4E7LA 4ZDPA 3ROUA 4ZJZA 4MNUA 1K7AA 2BY3A 3ECOA 2XGCA 3DBHB 4G94A 1Z05A 2FA5A 4BJ5C 2K4BA 1RESA 2NOGA 3F3XA 3CCJI 2R7SA 1YG2A 2CQNA 3J80K 3FSPA 1SVMA 3OSFA 1VCDA 4PZJA 1HKTA 1U3EM 2BYVE 5BNGA 1H88C 1MH4A 1MJAA 4MPOA 2DK5A 4DOZA 1HQCA 2XKOA 2Y9YA 2MC4A 3L85A 2V1NA 2EFQA 1ZLKA 5FRNA 4P9UA 1EH6A 1QA6A 1V5EA 2Q2EA 5ICGA 1F3YA 2ZB9A 3FXRA 4KN4X 4ESJA 3GWYA 3PNYA 1NFZA 2YX7A 2K9SA 3ZCOA 5J4VA 4GYIA 2L0KA 1LDKB 5J8FA 2MW8A 3P9CA 3DLAA 2QVOA 2M0CA 4C3JJ 2V1DA 1QO0D 2I5UA 3OS1A 2VT3A 2XB5A 2WAEA 3K9TA 4JX4A 1W5TA 1KYWA 1WJEA 3O8GA 4KICA 3QRFF 1KA8A 2MC3A 4IX7A 3HOZJ 4DNCA 1S29A 4N0BA 3F21A 1G3WA 2L2OA 1YS7A 2MLGA 1ETKA 3WGHA 2AO9A 1QPIA 3CCYA 1BW5A 2E2HJ 1E0EA 5E1ZB 2F4OB 1T38A 3Q0WA 2ZSHB 4BXUA 3LSKA 1VIUA 1K83J 3CDLA 2VC1A 4IRIA 2STWA 1ZR2A 1FWZA 5ERIA 3CCMI 2FMYA 4BE2A 5DUIA 2LFBA 4I98B 1XD7A 5D4RA 1T0FC 5FLXZ 3JRAA 1A04A 5EDNA 4P5OA 3LSGA 3J7AO 4JP0A 3S8PA 3WGGA 3DF8A 4KJZA 1J75A 2X1CA 3I59A 1Y56A 5EGOA 3GZ8A 1IG7A 4CYDA 2L9NA 1PUSA 2B06A 2XAHA 2R5ZA 4AYBN 3BTCA 3H36A 1FYLA 1SU2A 5LRSA 2ZJRF 3QQAA 1WJFA 3E6CC 3HSFA 4IQJA 3OOPA 3DBRB 1S5LC 2EFOA 4S0HB 1LVKA 1VK6A 2WB1A 4JOMA 2HNHA 1S3JA 2F5DA 1R22A 3GFMA 2M1BA 3H3UA 1W36D 4BY7J 1B9NA 2VE9A 5ILSA 2KRHA 4XKWA 1UB9A 3CLQA 1R00A 4IXAA 3AL0B 1WCMJ 3L00A 3CUQB 4RB3C 2O5FA 3NRVA 1MJBA 2O8XA 2PQVA 3K0LA 2DA2A 3IC7A 5ANSA 4FQGA 5E79C 5FSMA 1Y1VJ 3D5RC 1OPCA 1KGSA 1HZTA 1LQ1A 3GTKJ 2XV4S 1V8WA 1AU7A 1S7OA 3I9V2 4IF4A 1H0MA 4PJ0C 4F55A 5K5QA 2VQGA 4GGGA 3IRQA 1XMAA 3DTIA 5C4XJ 1XDSA 3OYAA 4DBQA 4YPHA 2FBHA 4RAYA 1G6NA 1JUPA 3F6VA 3HOSA 3A6SA 1WGXA 1G3TA 2CW0F 2K3PA 2HXOA 5BONA 2W4SA 1D5VA 3J7ZI 3I7UA 5FSLA 1IDZA 4HDUA 2ZNZA 4A6EA 3W6JB 4P55A 1WJBA 4EM1A 5BQTA 5J6XA 4HAMA 2JA7J 3RKWA 5B5EC 2PMHA 2K7LA 3VYUB 2EILH 2IGNA 4JYKA 4KFCA 1B4AA 4ENNA 3DKXA 3J7Ye 1F5TA 1R4NB 3T0YA 1IUYA 4ZH4F 3QU3A 5FKNA 2JTVA 3F6AA 1PP8F 3JCUC 2O5WA 1YRNA 2PJPA 4WWCA 2DFIA 2JVHA 1SD4A 5J1RA 3GO5A 5ICFA 2WV1A 1USSA 3MVPA 2X85A 3OYBA 3V4GA 2DPUA 5ICEA 4NQWB 1XS9A 1UELB 3AG3H 3KZYA 4IHVA 3FBIB 4HQEA 1Q1VA 3EQLF 5IW4A 3L7WA 2PJRB 3AL0C 1P2FA 1SFOJ 3C2BA 2EIJH 3D5LA 2DAOA 4CYCA 4LIUA 1JKRC 1AOYA 4Z6YA 1R5GA 3O3KA 2CFOA 5D8KB 4BHBA 3GTGJ 2LC2A 5CQEA 1P6RA 2ADUA 5FFZA 1WRJA 5JVGF 2FNAA 3OIOA 2R7ZJ 1KTGA 1JGGA 4C2UA 1E3PA 1RETA 2Q1ZB 2GIVA 5IYCJ 1V8MA 2XB0X 4FX0A 2VBWA 2UXXA 2EIKH 4ASNA 3LAJA 4K6EA 2X0LA 2HPIA 1SVOA 2MD0A 3FXQA 4H4KC 3NWTA 3OL3A 1U8RA 2R7UA 1X19A 3MCZA 5CKTA 1W0UA 1W1WE 3E7LA 3Q91A 3W2WA 4L5EA 3L2VA 2EV6A 1Z1DA 3CUQA 1ON2A 2XAUA 2HOTA 2EK5A 3NAUA 4E7IA 3P9IA 5CFIA 2R0QC 3BQYA 2QM3A 3E5QA 3SEQA 3JAMZ 3F8MA 5FRMA 1X3WB 3X0MA 1XGMA 2LBFB 2QJOA 1AWCA 2I8UA 1W7PD 2ZNYA 2NVTJ 2MH2A 4WXHA 3F13A 2X6YA 2CGPA 1TUMA 3K7AJ 3HL2A 3LAPA 4FISA 1LKXA 1OR7A 3PNTA 2JJ7A 4M6XA 4PFPA 4A3JJ 2L54A 3F0CA 3T8RA 3NWSA 4XL9A 4KMFA 5K5OA 3JTHA 1TTYA 2OA4A 3H0GJ 2O0YA 3DPUA 3DTKA 3MN2A 1WZ2A 4BEHA 4ANJA 2FQ3A 3ACAA 5JHFA 4JX6A 4B3XA 4S2WA 3ZN1A 1A35A 3TBIA 4BHPA 2HZTA 3QWLA 3DQVC 2Y9ZA 3K4KA 4B48A 1VTNC 3DTEA 2AQFA 4G12A 1V8LA 1BOBA 3SZGA 6PAXA 3Q0VA 2ZJ2A 3DKYA 2FF4A 2R7VA 1BIBA 2DW4A 3M1EA 2A05A 1Y8QB 3HTSB 3IKTA 2C6YA 5E8GA 2W57A 1IN8A 1F4KA 4CO8A 4J00A 3ID9A 3S15J 3RH7A 1V5GA 3D1NI 4GDFA 1D8JA 1GHCA 2DMUA 2JUCA 3VOEA 4NQWA 3R4KA 1BI3A 1XGNA 3JRCA 5M3FJ 2X1DA 4FHTA 1LNWA 3SJMA 2PJRA 1X2MA 2GWRA 4BBRJ 1RUOA 2VB6A 4IQ4A 3KEYA 4GXOA 2VOOA 2Y0MA 4GCVA 3CJQB 2HYGD 2V26A 3S1RJ 1WFXA 2ZFWA 2L9RA 4YOQA 5F6FA 3E6BA 4LB5A 1P4AA 5IT9Z 3S3MA 1N25A 2KMUA 2RGVA 3J81Z 3OGAA 4IRGA 3I53A 1YI2I 2DYSH 1WVRA 2KZVA 1R36A 4I02A 4UXNA 5IY5H 4B44A 2A3SA 2VJIA 1UG0A 2DA7A 1VQPI 4KMUX 1FBSA 3HOVJ 2HXIA 3KP5A 3MAJA 2VQHA 4FE7A 3K10A 4YEJA 2BY0A 2DJNA 2DOEA 4XRMA 1K78A 1A6QA 5ED4A 1N77A 1D0ZA 1RNLA 2L3DA 4DIQA 3SHFA 3BCAA 1LEBA 2DXIA 5DYMA 1OW2A 1VRLA 4C3HJ 1QZYA 2LTPA 2R5YB 3TW7A 3MZ8A 3X0KA 2MYSA 4BJTA 2YR2A 3REOA 2GB5A 4CICA 2NS8A 3A0BC 1QZZA 2EBIA 3IHUA 3VFZA 1IN4A 1WQ2A 1TL8A 1JKQC 4HV6A 3LNQA 2VBYA 3WTWC 1Z6TA 3HEFA 1K6YA 2NNNA 3BTJA 4M3BA 1YW9A 4XLCA 5HLHA 1OCPA 1TNTA 4XR6A 3RCOA 1F9NA 1OCRH 1G59A 3O61A 1J2XA 3M7GA 4ZZLA 1SD7A 1TW3A 2VE8A 3BR1A 1K6OA 2K9QA 1MMGA 4AU7A 3CCLI 4J19A 1VQ7I 2DOAA 4BXFA 4UV8A 1GV2A 3N97A 3R60A 1XTAA 1IRYA 4WF2A 1PPWA 3HSRA 4I76A 1PPXA 3EUHA 3GYHX 2MFZA 2HOAA 3PL8A 1B8IB 1I3AA 4L9NA 4LMYA 3HPGA 4G7OF 2BW3B 3WE2A 3BG7A 3GW2A 3S2WA 3TMOA 4LLNA 3ZR8X 5CQGA 1BM9A 5HNFA 2BY1A 3DEEA 1V8YA 3BHOA 3FHZA 2BOLA 3K1MA 4E7ZA 3N4MA 4Y17A 4BUPA 3MCFA 2L02A 5DPKA 1U0JA 4NC6A 3S1MJ 4C2MJ 4DZPA 2HKXA 2B7EA 2JMWA 3K6GA 1USTA 1JKPC 5AONA 2E1MB 3RIRA 4WK8F 1MMDA 1BC8C 1DP3A 2PMUA 3ABLH 3JSOA 3JRFA 1TWHJ 2HTSA 3DWLE 3EYIA 4IRHA 1ZG1A 1T8IA 2G73A 5ISYA 2LSOA 1L0OC 2OV7A 1TBXA 1YTYA 4KNYA 1Z7UA 1ETYA 3COAC 1A5JA 4S2XA 4KTBA 5GHIA 1JHHA 2K3FA 2V79A 3E6MA 4A3MJ 1FP2A 4D7MA 3WGIA 1MDMB 1ZTRA 1Y39A 5L3CA 1U8BA 2NVXJ 5I8UA 3ZQIA 1QHGA 2P6SA 2QKMB 4DYCA 2CS3A 1P92A 3K70D 3S32A 4DYWA 3SDGA 3FK6A 3HOXJ 5JHUA 3I0TA 1KU2A 2RREA 2CMPA 3H9QA 4LIVA 1S8NA 5J8CA 2MABA 1UG2A 1U5TB 5GHOA 1TC3C 5E3OA 4Z2YA 2XF7A 4RDUA 3Q9SA 5AIPA 1PP7U 2DT7B 3JAMK 3GVAA 4ZYEA 5LD2C 4A3KJ 4A3FJ 4AYBA 4D1QA 1ZREA 3RQ4A 4UUVA 4C9YA 5BPIA 1ETOA 4HQMA 2MD5A 2F6CA 2CH0A 1OQYA 1HKQA 1ETWA 3GFLA 4XOTA 2LVSA 2G9WA 4CA0A 2FJ1A 1TWGJ 2LY9A 2EZLA 2DN0A 4IHTA 3DU6A 3MDIA 2MLKA 2FD5A 2EH3A 4YIFA 3EUKL 4AD9A 4HNTA 2D45A 2A07F 2XRNA 4Y52J 1DGRM 3HOTA 1D1CA 1E2XA 5TJJA 2KT0A 1R71A 3VB2A 3KETA 2JA6J 2RDPA 4XLNF 4C30A 4I09A 3T1BA 4N1TA 2DTRA 4LK0F 1YJNI 3F8NA 2LY1A 1BW6A 1GVDA 1BR2A 2KLOA 3EYYA 3SEZA 1EH8A 2J5OA 2E35A 1BBYA 1DP7P 4BQNA 2G7UA 3K4JA 3LA7A 3A0HC 3QYBA 4M3FA 1JE8A 2CV0A 1HC8A 2R7QA 3E6DA 3QYEA 2Q2EB 2XDVA 2BHZA 1EA3A 2D1VA 3DCFA 3IUOA 4LG3A 1G2HA 3FKJA 3F8FA 3SFZA 3EXQA 3Q2TA 2OJED 1HX3A 3M8JA 3CTAA 1JUMA 2TRTA 5H6QA 4ICKA 2VODA 4XLFA 2MBFA 3ESWB 1ZRFA 3R61A 2R92J 4J7GA 3O8SA 1WJAA 4OWRB 4OINF 4B8XA 3CC2I 4A69C 1WI9A 1ETVA 1YW8A 1R1VA 1U6GA 3HB9A 2VXDA 3DEWA 3J81K 1SOIA 2EA4A 3M1CA 4KN7X 4S05A 2JA2A 3I56I 1VFCA 2IW5A 1YE9A 5FKOA 4ZZDA 1TWCJ 4RAGA 1ZK8A 4G6QA 3S93A 3CF5F 2EV5A 3EESA 1LJ9A 5HLTA 2E60A 5D5XB 3QYFA 1XN7A 1RYAA 2O6GE 3LFUA 2JN6A 3ZN0A 3FBNB 2BE5F 2NVUB 3X0IA 5BOXA 1IXRC 1QGPA 2ESHA 3ZR1A 4JZUA 2GXGA 3X2QH 4NNJA 3GZ5A 4HF0A 3BR6A 1X51A 1HDDC 5E18F 1U5TA 2MH9A 3K69A 4Y15A 2LRDA 4R79A 2BZTA 2J5PA 2B0LA 4LITA 2IJLA 1EV7A 1I39A 4JZTA 2Z99A 3FMSA 2HVQA 2X6WA 3I59B 4YELA 5EGOB 2OBPA 2CQ7A 1MIJA 4XOPA 4U7BA 2NS7A 3KP4A 1VZ0A 3PQJA 1XSAA 2IA1A 2Z1DA 3KPHA 4Q48A 2RC4A 4DZJA 1JKOC 3IP4B 2RRKA 1FIPA 1WH5A 2HVSA 3FKIJ 1IF1A 4OIQF 4D5FA 3MEXA 4RMNA 4WXDA 2DSCA 2QENA 3WG9A 1CQTA 1V5FA 3FXJA 3TQNA 2XIGA 4FETA 3L1PA 3OMYA 3RZOJ 1WH7A 3SYTA 2KISA 4BU2A 1HLVA 1FOWA 2NVYJ 5FSIA 4GO1A 4UV9A 1D0YA 2PLYA 4GRIA 1IRXA 3RJPA 2L7ZA 1MUTA 2DFEA 1NK2P 3GTJJ 4HPQA 4S04A 4A6DA 3BG9A 2CU7A 4RB1A 5J3LA 5FD5A 2QQ9A 5E8IA 1O3QA 1MMSA 9ANTA 3I54A 1KQ0A 2F5CA 1PUQA 2L7FP 2P5LC 3HGGA 1G3SA 4CCKA 2RNGA 5KNLA 3I55I 1KT9A 2COBA 3FMQA 4XKVA 3FXKA 2OAZA 2JRMA 2LP0A 1FY7A 1E3OC 2A69F 5E3NA 3GX4X 2KZGA 1WHUA 1Y8RB 2ECCA 1V8TA 4QPQA 1TWAJ 3BLYA 1I3QJ 1Z7LA 4AWXB 1DU6A 1SC7A 4B47A 1GV5A 2E71A 3R0AA 4JBAA 3L9FA 4YG2F 3JW4A 4ESBA 5EEHA 1I6XA 2VBXA 2QF7A 1B72A 3AC9A 2AS5F 1FTTA 5GAEJ 1QZEA 5DV5A 1D1AA 2FBKA 1DUXC 4ON0A 2XROA 5EEGA 3O6ZA 3IL2A 1OJLA 4Q47A 3G0QA 3DEUA 2FUG2 1MMNA 1FSEA 2IA0A 4AIKA 1H9TA 2GBYA 4RBOA 3PNVA 3CDHA 4EATA 1X3UA 3S3OA 2EFWA 3SQNA 1T95A 2VQLA 4GYGA 4D5CA 1HF0A 1V8VA 1T33A 4EJOA 4BQAA 1D1BA 1E3HA 4P1WA 3OYLA 1R1TA 2GXAA 4MFEA 3HHGA 1MK1A 3BOQA 2ZXHA 2JA8J 2ZO4A 4ZDOA 2GOXB 3U1KA 1YRNB 3KX2A 1OYWA 3CUOA 5J1YA 4BNCA 4HRIA 1FSHA 5J1UA 2D5VA 1IN6A 1LEAA 2LMDA 5FSOA 2W85A 1MBGA 3CC4I 2EB7A 5KAIC 3B73A 3ONQA 3TKYA 1D8KA 1KU9A 2OUMA 3U2RA 3TDZC 3FCMA 2LDUA 1XSVA 4QWQA 2H6CA 3ZQ7A 2WAFA 4XSXF 3JTGA 3NARA 4EGYA 3WTUC 4AUXA 2CFXA 2KPMA 3KYLA 3U21A 2CW8A 3Q1PA 1ZKGA 4CYCB 1BOAA 2GIZA 4XLAA 3PJRA 1GDTA 2RKHA 3FXLA 1JI8A 3I71A 1I50J 1SAUA 1NG7A 3BWGA 2ESNA 1R6RA 2LF7A 3ZMSA 2BY2A 5FFXA 1MZBA 2FKBA 2G0EA 4F93B 2JUGA 2DODA 3DKWA 4DYQA 1PYVA 3GFJA 5C8LA 4L9JA 2YSRA 2EJRA 3DLLF 2HEOA 1T56A 1MR2A 3GTLJ 2EFNA 4IPAA 4M9ZA 3HJEA 5F27A 2VT2A 4A12A 4MIMA 1X58A 3BPXA 4LGWA 1Z67A 1ZELA 3FXOA 2XSQA 4KISA 2PN6A 2QCOA 3NQOA 2ZBKA 4UHTA 1D0XA 3V7SA 4UUSB 2O7OA 1JTXA 1B9MA 1OYYA 2O5RA 2A61A 1X1PA 3OSGA 1QU3A 2H94A 3D5SC 2PQ8A 4X1EA 2LY2A 3G6EI 4QSHA 4ZDLA 2DU9A 3SFIA 2E5ZA 4IO9F 1K4SA 4U0WA 3MZYA 4DBRA 3K4CA 2KHMA 1XSXA 2JRTA 3JRBA 1FOKA 3B6CA 2IAIA 4W97A 5LLQA 2A6EF 3E1SA 3G73A 3CP8A 3PIOF 1Z91A 4G6TB 4RAFA 3HDDA 2X6XA 3AFHA 4DGWB 3L2WA 2QKLB 2N8GA 1QNTA 5LHHA 5DD4A 1HSJA 2DQLA 1FBUA 2CQXA 4BEHB 2M4KA 1BI2A 3JRIA 4U0YA 2QJTA 4HA8A 2GA2A 1IXCA 1XMXA 1X1CA 3ABKH 3KLNA 3ZXSA 3BQZA 2TDXA 4M72A 3H35A 5FROA 1N75A 4B4CA 2LKPA 4FE4A 2V1UA 3HYIA 4NB5A 2ID6A 2WTEA 2KFDA 3GCMA 1IC8A 4MQ9F 2OU2A 1W5SA 3I3LA 1ITYA 5ANWA 3KYDB 1D3YA 3PM1A 1EH7A 4A0YA 2WBMA 3OYGA 4UVCA 2KIFA 2CUJA 5DTDA 1MSFC 2CRGA 4JK1X 1HW2A 5HLGA 2ECBA 3WTTC 4OOIA 3BROA 2BV6A 3LSRA 2VC0A 4RM2A 5H20A 2JVBA 3E97A 1YX3A 2O03A 5B1AH 2ZCWA 1FMVA 5CVJA 5M5YJ 3CUQC 2B9SA 1OMIA 3TDUC 3K4NA 1QPMA 3HRSA 3PUFA 2LD5A 4AIJA 2F5FA 3SONA 2BXYA 3N05A 1JUSA 3HRTA 3L2UA 4XQFA 1FYMA 2P4WA 1STZA 1J5YA 5E17F 3PFYA 4RGSA 3C7JA 3U9GA 4CUGA 4BQQA 3ZQQA 3A6TA 4NC7A 3OYMA 1GLNA 2STTA 5K1YA 1DGWY 1VQMI 1R67A 5HZXA 3G4SI 4IOCF 4ENMA 1PVEA 3IKVA 4KG3A 3A6UA 5FB2A 1OR7C 5TGTA 1J9IA 2OF7A 2UZKA 1MBFA 1K78B 1IRGA 5GHPA 3QOPA 3OWTA 5EEAA 3GMEA 2G7HA 2OCCH 2DMQA 3JRDA 1XPXA 2M30A 3GRNA 2L4MA 4BE0A 2HR3A 3X0RA 2IPQX 4BH9A 2JVGA 5DM7F 2PBIA 2KDOA 2HKOA 2ACJA 3IWFA 1FBQA 4LJZF 4PJJA 4EV0A 4UUSA 2FQ4A 3ECHA 2IBDA 3CQZJ 1WI3A 3UNGC 5LHIA 3H1CA 1WWXA 2V9PA 3I4NJ 1QHHD 3G1MA 3S16J 2LH9A 3FM5A 3FK7A 1LFUP 1FMWA 2LREA 2M7BA 3GUDA 3R6SA 1VQNI 1W0TA 2BGCA 4A2UA 2IVMA 3VODA 5LPGA 4HX7A 4PDKA 3LQQA 3MKYB 1T2KA 1NQZA 3H3ZA 1S9HA 2GA1A 2QSGX 3MDGA 1E17A 2VJ4A 3EDPA 2EZHA 2GOMA 1MD0A 2NNYA 2QEXI 1P4WA 4BY1J 1Z6RA 5GADJ 3TL4X 4DQ2A 2IEKA 3SZPA 2OPTA 2KRFA 3TW6A 3H5NA 4FT8A 2VASA 4L9VA 4L18B 1SFXA 4CZCA 5H2FC 2R4GA 4XNFA 4QLCU 4PSWA 1P7IA 4FCYA 5GHJA 3HRMA 2PI0A 5FLXK 4E4HA 4ZTFA 4UVBA 3P5JA 3VEPA 2JZYA 1IDYA 4HSTA 4BBSJ 2DA1A 1R7JA 3QPTA 2QSHX 5E20A 1VC8A 2RNJA 4YRVA 2PFBA 1XB4A 4I7HA 1MGTA 2P8TA 3FXUA 1X4PA 1WJ5A 3J7AY 3CCQI 2LKSA 4ENJA 2IS4A 3E5UA 4M3GA 3T8TA 2XAGA 2V9VA 1ZRCA 2YYHA 3ASNH 2R7WA 2QUFA 5FSNA 1ULYA 2ZMEA 1SJYA 1J0RA 1ZR4A 3M8FA 3GG6A 5E1WA 3WTXC 1VNDA 1IAWA 4XLEA 5FLMJ 1ZYRF 2FOWA 3LSPA 3UKGA 3GF2A 1HKSA 1MNDA 3DP7A 3VYRB 2A8PA 1IO2A 3V7RA 4BHCA 1FJLA 3BG3A 3HOYJ 5LFAA 2X51A 4HG2A 3OIQA 3OYKA 3A4CA 1V8IA 2K5CA 3G3ZA 4C9XA 4OIRF 1JJ8C 1Z0XA 3BR2A 1U9OA 2FNPA 3CMAI 4GFBA 1BR1A 2OC6A 1HW1A 1TP4A 3EUHC 3X0JA 4X6AJ 4S2YA 3VSLA 2DI3A 2XPVA 2MG4A 2W7NA 3P5TA 4Y3OA 5A2QZ 3RKXA 4F52A 4IHYA 3FK9A 2CJJA 2DSDA 2V6EA 2Z9OA 3H3VK 1ZAOA 1JRKA 1BJZA 1DQUA 3EETA 3LFKA 2EQRA 3MKLA 2RQPA 4RGXA 1SEUA 1NFSA 1RR7A 3W2VA 3BJAA 2XGEA 1I27A 4QIWN 2DCEA 1W36C 1VQKI 1UZCA 2DDAA 2HYFA 5FKKA 3IWZA 3HHHA 2M34A 1U9NA 1TT5B 2LYCA 4HX4A 4Y4RA 1DU0A 1MP2A 1FT9A 1XMKA 2BEOA 3QPHA 3HUGB 2DMNA 2EIMH 1ORKA 2RVCA 3KLOA 4HV5A 4DJAA 1CGPA 4KT6A 5C7TA 4L9TA 1RR8C 3W2AA 1EF4A 4EJWA 1QRYA 1QVTA 3ABUA 3BY6A 5C44J 2KDVA 1J09A 5IW5A 2PMZN 2M8GX 2PX9A 1IRFA 4YFKF 3SZTA 4YIRX 1VHGA 2COMA 2XF5A 3V7CA 1ZH5A 2XAFA 4K2EA 2Y31A 4RGRA 5GHMA 2VJ5A 2K9NA 4JX5A 2VL8A 2A6HF 3ERED 4XMYA 2Q8KA 1GXQA 1AKHB 3M8EA 2A68F 3KEQA 4HNVA 4C9WA 4YFXF 5HNHA 3GLLA 2R7OA 2GT2A 3OYIA 1YJWI 2K4JA 5J40A 3JREA 3LA2A 4U7DA 2F48A 3C2HA 1BIAA 5FKLA 2W1OA 5LGNA 3C2GA 3HHJA 2E36A 3HKZA 2VKHA 4L5IA 1QQIA 2QQBA 3MZHA 1X83A 4EJUA 2FOKA 2ZJPF 2VQCA 3GWZA 1X1DA 2WAQN 4J7HA 1YJ9I 5HVQC 1RRSA 5HDKA 4C3IJ 4XICA 3FFUA 4HF1A 3A6VA 3CJNA 1X84A 3ZOBA 4BXXJ 1G3YA 1T98A 4DYRA 1VQ6I 4ZYDA 4IJXA 4X0GA 2L9SA 4LOCA 5M3MJ 1JGSA 1W7PB 2XASA 1I6HJ 2A6TA 2HFHA 2KP6A 2CUZA 1H89C 4V19K 4HVYA 2V1XA 4MEXF 2ZXJA 1R1UA 1XC5A 5K7ZA 4I2OA 3C1DA 2CZRA 3KYCB 1VQ9I 3R0JA 1YLFA 2UXNA 3M07A 4M6YA 3VPRA 3PO2J 3QP6A 4IJAA 1IGNA 4LG0A 4LB6B 1VC9A 2W48A 4MTDA 2IS1A 4ESFA 2VN2A 4KIGA 5JLXA 4O3MA 4M9SA 2CO5A 1UHWA 1OKRA 2UWMA 1Y6IA 2D2WA 2H1LA 3O8HA 2M9HA 3ZMTA 2TCTA 2HZDA 1OYIA 1XX5A 3AG2H 4RAZA 5LHGA 3VSKA 3OYNA 3CMEI 5KHDA 4IVNA 3RTRA 4EJTA 4N1UA 4S2VA 3LSJA 3B02A 4IOAF 2QGUA 2XHKA 4EMSA 2JWTA 4KT5C 2HOSA 2XAJA 2KIUA 1BI1A 3WTZA 5KVRA 1XG1A 1MBEA 2DLLA 3VYSB 2ZSIB 2H8WA 2HPMA 3OS0A 4KITB 4BDZA 2R5WA 4A3BJ 5JLWA 4EQQA 2E7WA 5DCMA 1PVFA 3I9XA 1UCRA 2O3FA 4CHUA 1VQOI 1NH3A 1J59A 3O52A 5LRRA 4PK4A 2VONA 5CVIA 4CXFA 2YVOA 2QSFX 1LUJB 2P7VB 2E1MC 3GTPJ 4F3QA 2VOPA 3IRRA 3Q93A 2Y0SN 3COUA 2WY8Q 3RYPA 4M3EA 3WU0A 4AIHA 5D5VB 3CMYA 2KIQA 4IZZA 3HUGA 3ZMDA 3KEOA 4E7KA 1F43A 2E1OA 5ILUA 1MW7A 3JRHA 2JSPA 2E1NA 2DBBA 3PUBA 4M71A 2L9VA 4H0EA 1MSEC 4EEFG 2GLOA 1V55H 5DCFA 5LEJA 4XRFA 2QBYB
chains in the Genus database with same CATH topology
2ICJA 2FU4A 3WE3A 4A5MA 2E1CA 3C3WA 5L3DA 2CWEA 3F22A 1I1SA 3KE2A 1U5TC 4P9FA 4HFQA 1J7KA 4HW0A 1T39A 1ZGAA 1G9QA 5IT9K 4L0ZB 2FRHA 2P5VA 2EA2A 4HZFA 3FJYA 4UNOA 4JZSA 2QZ8A 4KUMA 1SFUA 5C7QA 2KJCA 4O6JA 1Q27A 1W7PA 5FGMA 3Q2SA 4CDGA 3DUPA 4U88A 1O3RA 5CJ9A 1KU7A 3FF5A 4PCQA 1TQMA 1SD6A 1IZ1A 2HS5A 4EJVA 2X4HA 4HF2A 1PUEE 3WTSC 3I7VA 3V8LA 1FNNA 5HS9A 1WKMA 1B1BA 1QVJA 1S7AA 2XKPA 5DD8A 5ICCA 4M73A 4MTEA 2GXBA 1KQ9A 2CYYA 1VIQA 2A8QA 2H27A 2ISZA 2WV0A 4YIIA 5L3BA 1G0SA 2EWNA 4LLLA 5ANTA 3GZ6A 3PFIA 2RN7A 2QBYA 1KU3A 1U20A 1Q54A 2PNYA 1ON1A 3O6BB 2H6BA 2P7CB 2EFPA 5FO5A 2JT1A 4OMYA 5D5WB 4KIBA 2F5EA 3SMDA 4XSZF 4XLPF 2PG4A 3LA3A 1O7LA 1FPQA 3P6YA 1IW7F 3LQRA 1HW5A 5F64A 2PEXA 2Q9PA 4R8HA 5HDNA 2HQRA 1SZ3A 1Q1HA 4EM2A 3TOBA 1UHMA 1I1GA 3ELKA 4LFUA 1U2WA 1V8NA 5LEKA 3I64A 3GFIA 1ZHFA 2W4EA 2YVPA 2FSWA 3X0QA 1FC3A 2KDWA 1F1ZA 1HBXG 5H6RA 1FLIA 4N9HA 3F6OA 2HOEA 3OV8A 4BAYA 3E3VA 2FXAA 4M9XA 1MJ9A 2K27A 1HXDA 4EVIA 1UFMA 1XGSA 1GXPA 4G7ZF 3RKYA 3FZVA 4V14A 5BS6A 2IP2A 3W6KB 1XSCA 2O1CA 1PUNA 1MQEA 1O3TA 4I01A 5L3FA 5IT3A 3GXOA 4E70A 5JI6A 4PGHA 3TGNA 5ANUA 5D6FA 4IHSA 2VXZA 2WC2A 4FX4A 3RDIA 4XBFA 5D6EA 1YYVA 1T0FA 3TO9A 2VBZA 4HLXA 3Q5FA 1SMYF 3SXYA 5KK1A 3HTUA 4LLGF 2DUKA 3L09A 3ZMVA 1RZ4A 2YX4A 3CO7C 2NS0A 2Y75A 3BM4A 4PGGA 1JXSA 2R7DA 1DDNA 1DPRA 3Q4IA 1ZLJA 1G4DA 3SHDA 5LBQA 3X0OA 3CLOA 2BBYA 2Z3YA 4WXCA 1O3SA 3GEZA 3ISPA 5CVUA 3N9UA 1B59A 1O7FA 4KYXA 5FSKA 1ZG5A 1B6AA 3F72A 3U1DA 4ZYGA 5L3GA 1T6SA 2HDCA 5F1RA 4HBLA 2GAUA 5FD6A 4WX9A 5JVTA 3I4PA 1FZPB 1U78A 1PPVA 2IT0A 1TW2A 1SAXA 4OIOF 5HLIA 5DEQA 3BJ6A 2ZMEB 4ZG0A 1KYZA 2OQGA 2FMLA 4NHJA 2DK8A 3DFGA 3X0NA 2D1HA 2Q0OA 4A0XA 2FEZA 3QAHA 2AZWA 2HQNA 3DPLC 4I0BA 2RV8A 3WU1B 2DSBA 3MWMA 2R7FA 3ULQB 2GZWA 2QWWA 4A5NA 3P9KA 3I58A 3FMRA 3BDDA 1V8SA 2P5KA 4MQVA 1K26A 1REPC 1ZRDA 3QSJA 2YVMA 3EF5A 2GT4A 2F2EA 2EV0A 1YQAA 2E7XA 2DHOA 1IN7A 4D0PA 1K2EA 3ZR0A 2NRAC 1K79A 3V8JA 3V8KA 1S6LA 4JZVA 2G74A 2YU3A 5GHQA 3U53A 3Q9VA 2IRFG 1ZGJA 3FX3A 3TO7A 3TO6A 3KZZA 5AIQA 1TNSA 3MFKA 2Z33A 4G9YA 1IN5A 5HOOA 2XGXA 2VNQA 2OZ6A 2QYOA 3DV8A 4ILQA 2L01A 1V3FA 4Y13A 1IXSB 1QBJA 4HYEA 2CSOA 1SD5A 1MKMA 5JR3A 1V4RA 1YFHA 1LVAA 4CGZA 2M5WA 2AXLA 2W24A 3PQKA 3P7NA 1V8RA 1P4XA 2XUBA 2HWVA 1XDUA 2NAZA 3QU6A 3ZPLA 1JHFA 4OIPF 2M45A 2GQQA 4KYWA 4KA4A 1DPUA 4LG0B 2ICKA 4ENKA 3F8BA 2OZUA 3KP7A 4O5VA 4YFNF 2OQRA 4KIFA 2DPDA 3DPTA 1ODDA 4ZYHA 1O57A 1KHZA 2VNPA 1R58A 5HDGA 1XCBA 1SMTA 5K5RA 2O61A 4G8XA 3QP5A 5D8LB 3M9AA 3RPQA 4NFWA 3BJOA 2H09A 1BC7C 2R3SA 3KP6A 4OMZA 3BP8A 5DCMB 4F7ZA 4RGUA 1JKNA 3L2CA 4OU0A 2ELHA 3FM3A 3HYQA 1WSUA 1SFEA 1RRQA 4P96A 3F8CA 1LB2A 1XSBA 1RI7A 3O69A 1CF7B 2M87A 3EEUA 4EM0B 5CVVA 2KKOA 2FE3A 5DUKA 3R03A 4YPRA 3E5XA 5GHNA 1BN5A 3X0LA 4EGZA 4BYYA 2LF8A 2MA3A 2JSCA 2NYXA 2DT5A 4G7HF 1FP1D 3LSTA 3JSPA 3CNGA 5CLSA 5BPDA 1TQPA 2FVVA 1GVJA 2Z5UA 4WCGA 1I5ZA 3J80Z 4M74A 2YVNA 5E1XA 4R1HA 4KDPA 2K86A 1ONVA 1H9GA 2WWYA 5LGTA 3AAFA 1YO5C 3K1NA 3I5UA 3ML6A 3O2PE 3KVHA 3RPUA 1I9AA 2W84A 3KP3A 3FWEA 4JQFA 2CG4A 1C0WA 4MGRA 2P6TA 5HS8A 1BI0A 4N9IA 4LD5A 3ZMUA 2A8RA 1YIOA 2M8EA 3D0SA 4TV7A 2ZKZA 1MQWA 2XAQA 5ILVA 2I6KA 3X0SA 4Q5SF 3WTVC 3HRUA 3HIFA 4L5JA 1FX7A 1W4MA 3E57A 5L3EA 1R5HA 3ZP5A 4AVPA 1RIOH 1R23A 5LGUA 1L3LA 4G6DA 3ZMZA 3BPVA 1HSTA 4I0AA 4RS8A 3X0PA 3ABTA 4HDVA 1YS6A 1Y0UA 3T5XA 1BJAA 1ZG3A 1XCVA 5JFRA 1TLHB 2DO7A 3NEUA 4A0ZA 2A8TA 2JPCA 2J8QA 3KCCA 1RUNA 2JPBA 2QQAA 5DDGA 1LDJA 3WODF 1LDDA 3HSEA 2I8TA 1CF7A 4U0VA 2KIMA 1FYKA 2XVCA 1ZARA 4RB0A 4CZZA 5D4SA 2B0VA 3KFWX 3H92A 2CQKA 4HOBA 3BAPA 2OD5A 1V8UA 1KQ8A 5CFJA 4Q4ZF 2CL3A 1PDNC 5CYVA 2V6CA 3RYRA 3K2ZA 4B09A 1NQYA 2FBIA 1GA7A 2ISYA 3N77A 1NHAA 3MGMA 1Z9CA 3RI4A 5CVRA 4RB2C 4UVAA 4L0YB 2IA2A 2Y48A 3GLXA 1ZN2A 2HTJA 3C18A 4LK1F 5A2QK 1MDMA 3MQ0A 4KG4A 2DQRA 2LNBA 4MEYF 3TOAA 5ANVA 3DXJF 2A8SA 2QLZA 1TQIA 2HGCA 2ETHA 5D5UB 1YW7A 3H95A 2KJBA 4HX8A 5TRDA 2A5YB 5HS7A 3CO6C 1Q33A 3K1PA 4HLYA 1XGOA 2L4AA 2YPRA 4MHGA 3WHWA 3LWFA 2K02A 1XSDA 1VHZA 2W25A 3WTYC 5BMZA 2B2KA 4NFXA 3F23A 3DKUA 3BZ6A 4ETSA 3KP2A 3ROUA 4MNUA 1K7AA 3ECOA 4G94A 1Z05A 2FA5A 2K4BA 3F3XA 1YG2A 3J80K 3FSPA 1VCDA 4PZJA 1HKTA 1U3EM 2BYVE 1MJAA 4MPOA 2DK5A 1HQCA 2XKOA 3L85A 2EFQA 1ZLKA 4P9UA 1EH6A 2Q2EA 5ICGA 1F3YA 3FXRA 4KN4X 4ESJA 3GWYA 1NFZA 2YX7A 4GYIA 1LDKB 5J8FA 3P9CA 2QVOA 2V1DA 1QO0D 2VT3A 3K9TA 1W5TA 1KYWA 4KICA 3QRFF 1KA8A 2MC3A 4DNCA 1S29A 4N0BA 3F21A 1G3WA 1YS7A 2MLGA 3WGHA 5E1ZB 1T38A 4BXUA 1VIUA 2VC1A 4IRIA 2STWA 1FWZA 5ERIA 2FMYA 5DUIA 4I98B 1XD7A 5D4RA 5FLXZ 1A04A 4P5OA 3J7AO 3WGGA 3DF8A 1J75A 3I59A 3GZ8A 4CYDA 1PUSA 2B06A 2XAHA 1FYLA 1SU2A 5LRSA 3E6CC 3HSFA 3OOPA 2EFOA 1VK6A 1S3JA 2F5DA 1R22A 3GFMA 2M1BA 3H3UA 1B9NA 2VE9A 5ILSA 1UB9A 1R00A 4IXAA 3L00A 3CUQB 4RB3C 2O5FA 3NRVA 1MJBA 2O8XA 2PQVA 3K0LA 3IC7A 5ANSA 5FSMA 1OPCA 1KGSA 1HZTA 1LQ1A 2XV4S 1V8WA 1S7OA 4IF4A 1H0MA 5K5QA 4GGGA 3IRQA 1XMAA 1XDSA 4YPHA 2FBHA 4RAYA 1G6NA 3F6VA 3HOSA 3A6SA 1G3TA 2CW0F 5BONA 1D5VA 3I7UA 5FSLA 4HDUA 2ZNZA 4A6EA 3W6JB 4P55A 5BQTA 4EM1A 5J6XA 4HAMA 3RKWA 2PMHA 2K7LA 4KFCA 1B4AA 4ENNA 3J7Ye 1F5TA 1IUYA 3T0YA 4ZH4F 3QU3A 2JTVA 3F6AA 1PP8F 2O5WA 2PJPA 4WWCA 2DFIA 1SD4A 3GO5A 5ICFA 1USSA 3V4GA 2DPUA 5ICEA 3KZYA 4HQEA 3EQLF 5IW4A 3L7WA 1P2FA 3D5LA 2DAOA 1AOYA 1R5GA 3O3KA 5D8KB 4BHBA 1P6RA 2ADUA 5FFZA 1WRJA 2FNAA 1KTGA 2GIVA 1V8MA 4FX0A 2VBWA 2UXXA 4ASNA 3LAJA 4K6EA 2X0LA 3FXQA 1U8RA 3MCZA 3Q91A 2EV6A 1Z1DA 3CUQA 1ON2A 2EK5A 5CFIA 3P9IA 2QM3A 3E5QA 3JAMZ 3F8MA 3X0MA 1XGMA 2QJOA 1AWCA 2I8UA 1W7PD 2ZNYA 2MH2A 4WXHA 3F13A 2CGPA 1TUMA 3LAPA 1OR7A 4M6XA 2L54A 3T8RA 4KMFA 5K5OA 3JTHA 1TTYA 2OA4A 2O0YA 3ACAA 2FQ3A 4S2WA 3ZN1A 4BHPA 2HZTA 3DQVC 1VTNC 1V8LA 6PAXA 2ZJ2A 2FF4A 1BIBA 2DW4A 3M1EA 3HTSB 3IKTA 2C6YA 5E8GA 2W57A 1IN8A 1F4KA 4CO8A 3ID9A 3RH7A 1D8JA 1GHCA 3VOEA 4NQWA 3R4KA 1BI3A 1XGNA 4FHTA 1LNWA 2GWRA 1RUOA 4GXOA 2VOOA 2Y0MA 4GCVA 2HYGD 2ZFWA 4YOQA 5F6FA 3E6BA 4LB5A 1P4AA 5IT9Z 2RGVA 3J81Z 3OGAA 4IRGA 3I53A 4UXNA 1R36A 4I02A 2A3SA 4KMUX 1FBSA 3KP5A 3MAJA 1K78A 5ED4A 1RNLA 2L3DA 3SHFA 1LEBA 1OW2A 1VRLA 5DYMA 1QZYA 3X0KA 2YR2A 3REOA 2GB5A 4CICA 1QZZA 3IHUA 3VFZA 1IN4A 1WQ2A 4HV6A 2VBYA 3WTWC 1Z6TA 2NNNA 5HLHA 1YW9A 3O61A 1TNTA 1F9NA 1J2XA 3M7GA 4ZZLA 1SD7A 1TW3A 2VE8A 1K6OA 4UV8A 3N97A 3R60A 1IRYA 4WF2A 1PPWA 3HSRA 1PPXA 3EUHA 3GYHX 4LMYA 4L9NA 4G7OF 3WE2A 3GW2A 3S2WA 4LLNA 1BM9A 1V8YA 3BHOA 3FHZA 3K1MA 3N4MA 4Y17A 3MCFA 2L02A 5DPKA 2HKXA 1USTA 5AONA 3RIRA 4WK8F 1BC8C 2PMUA 3JSOA 2HTSA 3EYIA 5ISYA 4IRHA 1ZG1A 2G73A 2LSOA 1L0OC 1YTYA 1TBXA 4KNYA 1Z7UA 3COAC 4S2XA 4KTBA 5GHIA 1JHHA 2V79A 3E6MA 1FP2A 3WGIA 1MDMB 5L3CA 5I8UA 2P6SA 2QKMB 1P92A 4DYWA 5JHUA 3I0TA 1KU2A 1S8NA 5J8CA 1U5TB 5GHOA 4Z2YA 3Q9SA 5AIPA 1PP7U 3JAMK 4ZYEA 3GVAA 1ZREA 4UUVA 5BPIA 4HQMA 2MD5A 1HKQA 3GFLA 2G9WA 4IHTA 3MDIA 2MLKA 4YIFA 4AD9A 2A07F 2D45A 2XRNA 3HOTA 1E2XA 5TJJA 3VB2A 3KETA 2RDPA 4XLNF 4I09A 3T1BA 4N1TA 2DTRA 4LK0F 3F8NA 3EYYA 1EH8A 2J5OA 1BBYA 1DP7P 2G7UA 3LA7A 1JE8A 3E6DA 2D1VA 3Q2TA 3EXQA 3SFZA 3F8FA 1HX3A 3CTAA 5H6QA 4ICKA 2VODA 2MBFA 1ZRFA 3R61A 4J7GA 3O8SA 4OINF 4B8XA 1WI9A 1YW8A 1R1VA 1U6GA 3J81K 1SOIA 2EA4A 4KN7X 4S05A 2IW5A 4ZZDA 4G6QA 2EV5A 3EESA 1LJ9A 5D5XB 1XN7A 1RYAA 2O6GE 3ZN0A 2BE5F 3X0IA 5BOXA 1IXRC 1QGPA 2ESHA 3ZR1A 4JZUA 2GXGA 3GZ5A 4HF0A 1X51A 5E18F 1U5TA 2MH9A 3K69A 4Y15A 4R79A 2J5PA 2B0LA 2IJLA 1EV7A 4JZTA 2Z99A 3FMSA 3I59B 2OBPA 4U7BA 3KP4A 3PQJA 1XSAA 2IA1A 4Q48A 2RC4A 2RRKA 1IF1A 4OIQF 3MEXA 4WXDA 2DSCA 2QENA 3WG9A 3TQNA 2XIGA 5FSIA 4GO1A 4UV9A 2PLYA 3RJPA 1MUTA 4S04A 4A6DA 4RB1A 5FD5A 2QQ9A 5E8IA 1O3QA 1PUQA 3I54A 1KQ0A 2F5CA 2P5LC 1G3SA 1KT9A 3FMQA 2OAZA 1FY7A 2A69F 3GX4X 1V8TA 4AWXB 3R0AA 4JBAA 3L9FA 4YG2F 3JW4A 4ESBA 5EEHA 1I6XA 2VBXA 3AC9A 2AS5F 5DV5A 2FBKA 1DUXC 4ON0A 2XROA 5EEGA 3O6ZA 3IL2A 4Q47A 3G0QA 3DEUA 4AIKA 1FSEA 2IA0A 1H9TA 3CDHA 1X3UA 2EFWA 3SQNA 1V8VA 4GYGA 4EJOA 4BQAA 1R1TA 3HHGA 1MK1A 3BOQA 2ZO4A 1OYWA 3CUOA 4BNCA 1FSHA 1IN6A 1LEAA 5FSOA 2W85A 2EB7A 3B73A 3TKYA 1D8KA 1KU9A 3U2RA 3TDZC 3FCMA 2LDUA 1XSVA 4QWQA 2H6CA 3ZQ7A 4XSXF 3JTGA 4EGYA 3WTUC 2CFXA 3Q1PA 1BOAA 2RKHA 3I71A 3BWGA 2ESNA 2LF7A 3ZMSA 5FFXA 1MZBA 2FKBA 3DKWA 3GFJA 5C8LA 4L9JA 2YSRA 2EJRA 2HEOA 1MR2A 2EFNA 4IPAA 4M9ZA 2VT2A 4A12A 3BPXA 4LGWA 2XSQA 2PN6A 3NQOA 2ZBKA 4UHTA 3V7SA 1B9MA 1OYYA 2A61A 2H94A 2PQ8A 2DU9A 4U0WA 3MZYA 1FOKA 1XSXA 2JRTA 5LLQA 2A6EF 3G73A 1Z91A 1QNTA 5LHHA 5DD4A 1HSJA 2DQLA 1FBUA 2QJTA 1BI2A 4U0YA 4HA8A 2GA2A 1IXCA 3KLNA 4M72A 2TDXA 2LKPA 2V1UA 3HYIA 4NB5A 2WTEA 4MQ9F 2OU2A 1W5SA 5ANWA 1D3YA 1EH7A 4A0YA 4UVCA 2KIFA 4JK1X 1HW2A 5HLGA 3WTTC 4OOIA 3BROA 2BV6A 2VC0A 5H20A 2JVBA 3E97A 2O03A 2ZCWA 5CVJA 3CUQC 1OMIA 3TDUC 1QPMA 3HRSA 4AIJA 2F5FA 3SONA