5DDJ2

Crystal structure of recombinant foot-and-mouth-disease virus o1m-s2093y empty capsid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
210
structure length
210
Chain Sequence
b'LLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVAQAERFFKTHLFDWVTSDPFGRCHLLELPTDHKGVYGYLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNSEGAPQIKVYANIAPTNVHVAGEFPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Foot and mouth disease virus, VP1
molecule tags Virus
source organism Foot-and-mouth disease virus - type o
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
total genus 25
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ddj200
1V9U3 1BEV1 1NA1B 1RUC3 1C8M2 5FMOL 4WM7C 5ABJA 3VBOB 1COV1 4CDUB 4IV3C 1ND3B 1RUE1 3ZFFC 4PDWB 1RUF1 1ASJ2 2GH8A 1PO12 3TN93 2XBO3 2HWC3 1AR71 1OOPA 5J96B 1FPN3 1ASJ1 1COV3 1AR92 1AL22 2WFF2 1AYN3 1PVC2 1AR83 2HWB1 1B35B 1VBE3 1RVF1 5JZGA 4N53A 1AYM2 1NCRB 4RS5B 4AEDA 1D4M2 4QPIC 1AYM1 1RUH2 5BNPB 1K5MA 5C9AA 1BBT2 1POV3 1R083 2R043 4RR3A 1BEV2 4Q4W3 1HXS3 4Q4X2 5ACA1 1MQTA 1ZBA2 2RS13 5C9AC 5A33B 3ZXAC 5ACA2 4N43B 1HXS1 1NG0A 5C4WC 1R1A2 1OPOA 5DDJ3 4CDQB 4CDXC 3ZFFB 4YVSB 1ND3C 1RUD2 5A32A 1EV11 2X5IC 2DF7A 2R062 2R073 3VBRC 3VDDC 3ZFEB 4QPGA 5K0UB 1RMU2 1VAKA 4CDQC 1ZBA3 4WM7B 2WLPA 4Y4YA 3DPRB 4QPGC 2WS93 3VBHA 2HWE1 1BBT3 2BPA2 1EAH1 1QJU1 1RUH3 5BNNC 1MEC3 1RHI3 1H8TB 1VBA2 1D4M3 1ND2C 1QQP1 5FOJB 4GH4B 1AYM3 4JGZC 1VBA1 1NCQB 2HWB3 1MQTC 1RVF3 1CJDA 1FPN1 2PLV3 1PVC3 1VBE1 1HRI1 3ZFFA 1DDLA 1TME1 5GKAC 4RR3B 3NAPA 4AEDC 1EV13 4QPIB 5C9AB 1FPN2 1VBD1 4CDQA 2RM22 1PO13 4AEDB 3DPRA 4N43A 4N53B 1OOPC 1RMU1 4QPGB 1X33A 2RMU1 3ZFGB 1CD3G 1QJY2 1K5MC 1RUD3 1ZBE2 1FOD3 4GB31 1AR61 4FTEA 1FMD3 1EAH2 1QJU2 1RUI3 3CJIB 1TMF1 1RUI2 1EAH3 1QJU3 1QQP2 1VB4A 1VBC3 1POV1 1R081 2RS53 4Q4Y3 1FOD2 1RUG2 1NCRA 4Q4V3 2R063 1RUD1 4CDXB 1QJY3 5JZGB 2ZZQA 1FOD1 5K0UC 1RUG1 2MEV3 3TN91 2HWD2 1WCDJ 1HX6A 3M8LA 2XPJA 4IV1A 3VBRA 1SMVA 2HWF1 2WZR1 5DDJ2 5D8AB 2HWD1 2RM23 1RUJ2 4RQPB 1IHMA 3JD73 2HWF2 2WZR2 4N43C 1H8TC 4IV1C 4Z92B 3VBOA 2PLV2 4Q4V1 4RQPC 2HWB2 1NCQC 1VBC1 2RS51 1F8VA 4CDXA 4RS5A 1MEC2 4RQPA 1D4M1 4JGYB 1NCQA 2FZ1A 3CJIA 1PO21 4LLFA 4SBVA 4Q4Y1 4CDWC 3VBRB 2WS92 5D8AC 3IDEA 1RUE2 2WS91 1VBB1 4RHV2 1RMU3 1POV0 3VBHB 3VBSB 1ND2A 2IZWA 4PDWA 4CEWA 2RMU3 3JD72 4WM7A 3DPRC 2HWC1 4EJRA 3VBHC 4CDUA 1PGL1 2WWSA 5LK7B 1X36A 4NWWA 5K0UA 1PIV3 4PDWC 1PO11 1PGL2 4CDWB 4CDUC 2PLV1 5BNOC 4YVSC 3VBOC 1GFF2 4JGZA 3VDDA 3JB8A 1C8M3 1R1A3 4GH4A 1FMD1 1MEC1 3JBG1 5CFDA 1QQP3 3VBFC 1AR63 4GB33 1FMD2 1ZBA1 5ACA3 1HQNA 1C8M1 3JB4C 4QPIA 4FSJA 2R041 3NAPB 1BBT1 2RS12 4RFT0 4RS5C 1VBB2 1NY71 4RHV1 1HXS2 5C4WA 1BEV3 1RUC1 4Q4W2 4JGYC 4Q4X1 2R042 2RS11 3ZFEA 2VQ0A 1RUF2 2ZAHA 1H8TA 4GMP3 1AR72 4FTSA 1PGW1 2BBVA 3JBG3 1A6CA 1EV12 1AL21 1R1A1 1PGW2 1W39A 3VBFB 1AYN2 2WFF3 1RVF2 3CJIC 4YVSA 1F2NA 4IV3A 1NCRC 1AUYA 1RHI1 4WM8A 1BMV2 5JZGC 3J8F2 1AYN1 1B35A 2XBO2 3JBG2 5C8CC 5CFCC 2RM21 1RHI2 1VBA3 5BNOB 1BMV1 1M06G 1R093 3J8F1 1RUF3 2R061 2X5IB 4WM8C 1Z7S2 3LOBA 2RR13 1V9U1 1VBB3 5A33A 2BFUS 1NY72 5A32B 5CFDC 4YVWA 1RUC2 4Q4W1 1V9U2 4GMP0 1AL0G 3VBUC 2BFUL 1QJX3 2X5IA 4GB32 4CDWA 1AR62 4RR3C 5BNOA 2Y26A 1NOVA 2R072 1NA1C 5ABJC 3NAPC 1HRI2 5C4WB 1TME2 4CEYC 1VRH3 4N53C 3VBFA 1HRV3 3VBSA 1VBD2 4CEWB 1RB8G 1VBD3 1AR81 5J98B 5BNPC 1MQTB 1VRH2 5AC91 2XBO1 1PIV2 4BCUA 1VRH1 4YVWB 3FBMA 1E57A 1Z7S1 2RMU2 5AC93 2MEV1 3ZFEC 3VDDB 4RHV3 2FZ2A 2RR11 1RUE3 2RS32 5ABJB 2GSYA 4Q4X3 2QQPA 5CFCB 5BNNB 1TMF2 2RR12 3S6PA 1PO23 1B35C 2HWE2 2RS31 5L7OB 1R082 1Z7S3 4WM8B 4IV3B 1OOPB 1R092 2R071 5L7OC 1PO22 2HWE3 1TMF3 1R091 1RUI1 3J8F3 4YVWC 1ND3A 1QJZA 2RS33 3ZFGC 1VBE2 1AR82 5L7OA 3VBSC 2ZTNA 1AL23 5BNNA 1K5MB 5AC92 1AR93 1COV2 5CFCA 2HWF3 2WZR3 5BNPA 1PIV1 1NA1A 3JD71 5C8CB 1RUJ3 4JGYA 2HWC2 3TN92 1AR73 4CEYA 1ASJ3 4FTBA 1C8NA 5C8CA 2TBVA 1ND2B 2HWD3 5DDJ1 2MEV2 1AR91 1RUJ1 2BUKA 2WFF1 4CEWC 1HRV2 1PVC1 5FMOS 1OHFA 3HAGA 4Y5Z0 3VBUB 3VBUA 1TME3 1QJY1 1HRI3 3ZFGA 1ZBE1 1HRV1 1VB2A 4GH4C 4Q4V2 5CFDB 1RUG3 1QJX1 5D8AA 1VBC2 2RS52 4GMP1 4Q4Y2 4IV1B 1RUH1 4CEYB 1QJX2 4JGZB 4NWVA 1ZBE3
chains in the Genus database with same CATH superfamily
2D97A 4S2DA 5IAXA 1NA1B 4WVVA 5C8WA 3NNMA 4WM7C 4YW1A 4M3CB 1CPNA 3HIFA 4NPMA 2H6BA 5ABJA 4HXCA 2Q8EA 1JH5A 1AX2A 3ZKUA 1UY1A 4CU7A 2KD7A 3PU8A 4XMIA 3LZZA 4O65A 3TNQA 1WW7A 4KU8A 1C1FA 3UK9A 4PBPA 3ZFFC 1RUF1 1UY3A 1PO12 3Q8BA 2AUYA 2F17A 5CKNA 4OHZA 3KV4A 1OOPA 3KF5A 4P9LA 3Q8AA 5FP7A 3VDBA 5FUPA 4MHUA 5EIYB 3MUY1 3WF4A 5K4LA 1AR92 1COV3 2XUMA 4LKDA 5FY4A 2WFF2 4EN7B 5T52A 1AR83 4AVTA 1UCXA 2HWB1 2RJLA 3NJXA 1RVF1 3TWIA 3PU3A 3VZJA 5A3TA 4K6BA 3M1HA 3B69A 2RHPA 1GP6A 1N1VA 5FK8A 2ARBA 5F9TA 5M0TA 3N4MA 4Y1VA 4QKDA 4HANA 5L19A 4O9EA 1KEXA 4R52A 2R30A 4ITCA 1S2EA 4IE4A 3VKFC 2P17A 4ZU4A 3C7OA 3LIGA 5C9AA 3OBZA 3WF3A 1BBT2 1NUKA 1POV3 1JN2P 5K8SA 1UF2C 5FZ6A 2A3XA 2CV6A 4Q4X2 4F83A 1XNDA 5ACA1 5FYIA 5FPUA 2UYBA 4ATEA 1LOEA 4B1LA 2VVDA 1U0AA 4YM3A 4AQ2A 1GP4A 4I3PA 3HBKA 5A7WA 3PJYA 1A8MA 3SCFA 2VZ3A 2ARXA 3E6BA 4AOCA 5C3OA 2WQ4A 2W2IA 1HXS1 1VMJA 3D0JA 4JDMA 3J7LA 1OSGA 3JXSA 5C4WC 5FZ3A 2BEOA 4IE0A 1UPSA 3VB9A 4GJYA 2ARAA 4X6QB 2XLFA 1SFYA 4OMDA 4Y1ZA 2Q1ZB 4CCLA 3ZN4A 1FXZA 4BIFA 4ZZ5A 2I74A 4NAMA 5CIRA 3ZFFB 4YVSB 3RZKA 4L97A 1PGSA 1WW6A 2YMZA 5F3IA 1BVVA 2V72A 2VMFA 1F4HA 2XVGA 1TQ5A 2OW4A 5FXXA 2X5IC 2DF7A 4LOSA 2WNUC 4XTPA 2IWGB 1XU2A 3OY8B 3POGA 2BZDA 2QBXA 4QX0A 4E8CA 1N1TA 1X82A 4NPLA 4DB5A 1GSLA 5FXWA 3AZVA 3LGRA 3VBRC 1PNFA 4XE9A 1UPIA 2QDNA 4YW7A 3LD8A 2VMIA 2GU9A 3VZLA 4HVOA 4QPYA 1AVBA 1GKBA 3EJKA 3WP5A 1DGLA 3KCYA 4OQ9A 5KHJA 5JXIA 3QLQA 4CCKA 3I8TA 3CZUA 4L2NA 5C3QA 5JSOA 3AZZA 2WC2A 3H3ZA 4CDQC 1G9AA 1GP5A 1RXFA 1W6MB 4NAOA 1ZNPA 4GULA 4F3JA 1VRBA 4ES9A 3PL0A 4K20A 1BBT3 3PVBB 1PM4A 4META 4N9HA 1E5SA 5BNQA 1WW4A 2IXHA 4YGDA 3UJQA 3MICA 5LRSA 1MEC3 4JVAA 4Z2AA 2JG9C 3I7DA 5DUXA 4HK9A 4FPFA 3PUHA 2RJ2A 1W9SA 2Q1FA 4JGZC 3WF1A 3NQHA 1J83A 4CRQA 5EQUA 3KGLA 4I0WB 1HW5A 2VO5A 1IQDC 3DYPA 4QQ2A 2E33A 3U11A 1UYXA 4QXKA 4UYBA 1NE4A 3CF6E 4CXYA 3NAPA 1WLCA 2VD7A 2GP5A 1CZSA 5F8PA 4EE2A 3IIIA 2P6CA 5H9RA 3I3EA 1WW5A 2RM22 1QHDA 3FC0A 2JJ6A 4A45A 4GJZA 4CCJA 5FZ1A 1PO13 3A4UA 2C9AA 3WEZA 3LAGA 1BLZA 3SC7X 2J1TA 5JMCA 4N53B 1NLQA 1OLME 3WW2A 2YYOA 4URAA 4R9CA 5DAWA 4A6SA 2Y64A 1DZTA 3H1YA 2VGDA 4Y3OA 4ZXEA 4K9SA 3ZFGB 4U36A 2RVAA 3POFA 3R6SA 2A1XA 2NMOA 4BQ4A 1W2UA 2DDUA 4KWLA 1QJY2 1D0GA 3KM5A 3HQUA 4K7JA 1ENRA 5DAQA 1ZBE2 1AXKA 3APBA 1FOD3 3UKNA 3GM8A 4GWJA 4NHLA 4DPNA 3UGFA 5J36A 1LHNA 2IXCA 2OXBA 3FBYA 3WNKA 2ORXA 1ZZCA 2C1FA 5I8TA 4Q4Y3 5H9SA 1POV1 1QMJA 3PMSA 2Q8OA 1RC6A 4TSVA 4Q4V3 2ZGOA 2R063 4QGNA 2VE1A 4OHVA 3J9SA 4PQQA 4YG0A 1FOD1 3K77A 4BYYA 4F7ZA 3I2JA 4XBQA 4LBQD 2MEV3 3TN91 1WCKA 3O1VA 2MNGA 1HX6A 2CU5A 4PJYA 4B7EA 4IV1A 1YWKA 4QX5A 1ULDA 3ON7A 4H55A 4QXCA 1QNWA 3GJAA 2W91A 3ETQA 3VL8A 4AI9A 5J7MA 4CXXA 3VHNA 2XLAA 4RQPB 1IHMA 3BPZA 3L2HA 4N43C 3PLQA 3GALA 3HD8B 1W05A 2X09A 2PYTA 4XCBA 1W8UA 3N7KA 2VZPA 3ZYHA 3WQ1A 1MS5A 1FYUA 5JPNB 2ZEXA 4XETA 3O0WA 3WDTA 2JDUA 4HMZA 4JQTA 1QH7A 3NV1A 5FZDA 5LBBA 4D69A 3WDWA 3O1MA 4HETA 1UY0A 5DZEA 5F5QA 3VD5A 2XVLA 4JRLA 1ZRIA 3CBNA 4E27A 1ST8A 2E7AA 1RJ7A 2JENA 2VW1A 1D4M1 5LA1A 2UWBA 5J37A 4JGYB 3OBAA 3RQ0A 4GA9A 1SFNA 2BTVC 1W0NA 2PA7A 2Q30A 1W6QB 3G6JB 3KZ4C 4Y1UA 1G8WA 3VLBB 1EPWA 1UMHA 4HBNA 5HV4A 1BK1A 1NX9A 1QOOA 2I45A 4YZ4A 5EYXA 3BODA 5G04L 3RMXA 3VBRB 4QQLA 5JOWA 4KG8A 3THCA 4CZSA 4A7ZA 4OI2A 1REFA 3ES4A 2BJSA 4XUPA 2YC2A 4MSVA 1OI6A 2WO2A 5IVEA 1VBB1 1POV0 5HPOA 4PLOA 4Y26A 5FZ0A 4A7YA 2A7AA 1ND2A 4B1MA 4ZKTB 3SH5A 2VZUA 2VMEA 4M4PA 5LB6A 5CVRA 4Q5OA 3B01A 4CDUA 4LO5B 4AI0A 4EJRA 2JE8A 2VOWA 2P3KA 1X36A 1YYNA 4A42A 2AACA 1PMHX 4JDNA 2IXJA 2WN3A 4Q0UA 4CCCA 1PGL2 4FBFA 4CDWB 1CAVB 4AI8A 2XL7A 2QE3A 5F6LB 5BV6A 3I54A 3LSDA 1XNKA 5LZ6A 2DFCA 3RDIA 5FJHA 3CL1A 3VDAA 4UT5A 4CP1A 2EALA 2YV8A 4E4ZA 1JYXA 4TTGA 4OI0A 1HB3A 3VZNA 3ZYPA 4BPZA 2VNGA 3VBFC 5A3OA 2X8KA 3W5MA 4GB33 4A44A 3KV9A 1CONA 2VOVA 2FHRA 1S4CA 1C8M1 3BPSA 1WCUA 4XQDA 3M70A 4L8QA 2GDFA 4OUEA 1ACCA 2A75A 2R041 3DL3A 3O0XA 4XIOA 2VOXA 2E6VA 1VBB2 1HXS2 1WKYA 3ILNA 4B7KA 2VTXA 5C4WA 4TXWA 4V2WA 1BEV3 1UN1A 1WZXA 2C6SA 4JGYC 4ZXKA 2FDIA 4LR4A 1HIXA 3PVOA 1CJPA 3BUCA 3T2PA 5EHDA 5E88A 4XABA 4CU6A 1H8TA 4GMP3 1PGW1 3JBG3 5IUQA 4P9XA 5AVAA 3AP7A 2B45X 3J7MA 4D3WA 1WMEA 1AL21 1W39A 3NVCA 4ASMB 3AP5A 5E89A 3EHKA 1AYN2 3BCWA 2DBIA 3CJIC 3ZPOA 2VQUA 4WZFA 5IYYA 3RJRA 1RHI1 4NIGA 1DHKB 4Z8BA 2LALA 2V5YA 2JX9A 3POWA 4YFWA 1LOBA 3O5SA 1XBFA 1GNZA 5L9BA 2XL9A 2YG0A 4C1WA 1BMV1 5I93A 4NHYA 3LDRA 4WM8C 3O1SA 4XQ4A 1QJEA 1SBDA 1Z7S2 3LOBA 2VUAA 2R0FA 1GZTA 2RR13 2ZZJA 3F95A 2JB8A 1V9U1 1T6BX 5BXXA 3T3YA 2K0GA 3U14A 2ZHKA 2PTMA 1W6NB 2BOJA 4G4FA 4FXKB 4KH9A 3VD3A 3LIHA 2KA3A 1LULA 2J1SA 1L7LA 1AXZA 2CHHA 1AL0G 3BALA 2A71A 1IS6A 4GXLA 2ZGRA 1CR7A 3VGIA 5FCCA 3ZSLA 4AG4A 3DEMA 5FOBB 2PHFA 3WG4A 1AR62 4RR3C 2BNNA 1CZVA 1W99A 4P14A 2C24A 3SH3A 3ZYRA 4G9SB 3C2UA 3ETPA 1DYOA 3SXWA 4P9IA 3RMYA 3POJA 2D6PA 1DQ0A 5ABJC 1CAXA 3OBTA 1RIRA 2XJPA 3HN3A 1DG6A 3TOJA 5BPXA 4LPLA 2B39A 1L7RA 1CAWB 2VVFA 3I2OA 2ZKLA 2ADEA 4R4XA 4EN8B 3WG2A 4XDOA 3WNPA 2D44A 4C0HA 2Y60A 1IQAA 3AX4A 1PX3A 4FPYA 4YWAA 3ZXKA 1VP6A 4CXWA 2CNAA 1CQ9A 1XC6A 2UWCA 2W1WA 1S1AA 3GF6A 2AREA 4MGIE 2ZEZA 4GWIA 5HCBA 5I0UA 1PIV2 1R64A 1IG0A 1Y43B 2ZX2A 3ITQA 5K9YA 4XAEA 4LUKA 1VRH1 4BOWA 2D43A 4Y5SA 2P4EA 4AFMA 4DXRA 3TBDA 4Y24A 5F6KA 1FT9A 1Z7S1 1CX1A 1QDOA 1UU4A 2QQUA 1LKNA 2EAKA 2YFZA 3ZMNA 1EPZA 1LGNA 3C3VA 1H6XA 1JW6A 2JDAA 3DECA 5JDBA 4UFIA 4PI2A 5I91A 2GSYA 2XUEA 3FLTA 4Q4X3 4JRAA 4OHXA 1W8TA 5DUVA 2QQPA 2IUWA 5F39A 3KT7A 3ECQA 1TMF2 2RR12 1YXWA 1EYBA 2RS31 5L7OB 1S0GA 1Z7S3 4NROA 1CWPA 4TWTA 1G86A 4LJHA 2JDPA 3MF9A 5GJ6A 3LE0A 1TNRA 4ZS3A 4IV3B 1JZ8A 2CSGA 1NLSA 3OUHA 4O7XA 2D40A 1JI6A 3K4ZA 1G9BA 1XNBA 2HEWF 1JHJA 2XOMA 2WA3A 3CO2A 3CHXA 4NPRA 4BLJA 2L9LA 2JG8C 1ULOA 1ND3A 1WWYA 1F5JA 2WAOA 3E97A 3MI8A 5E16A 5KC5A 2RS33 4FOVA 1IPKA 1PMIA 2OQ7A 1LOFA 1AR82 1SLBA 3AFKA 2WL1A 3POIA 4K3UA 2NQYA 5FKCA 5GZDA 3AYEA 1HQLA 5BNNA 5IVVA 2E51A 4G3YC 1Z78A 3WUDA 1AR93 1COV2 5SV5A 2VW2A 3MFCA 5BNPA 1NZIA 5FZEA 3AKTA 5C8CB 4FVVA 4XXPA 5K7PA 2WABA 2ZEWA 1NZCA 1LGCA 2ATFA 1H1IA 3EQEA 4IEUA 2CGNA 2V4AA 4LE4A 5HXVA 4FFGA 1CIWA 1DU3D 3NJZA 3K75B 3IZOA 1W8HA 2V73A 5LBFA 1ND2B 2HWD3 1JUIA 1UIKA 2VAUA 3U75A 4CU8A 2OQ6A 1GMMA 2JWPA 4R9DA 1QEXA 1UO9A 4CEWC 3HAGA 2Z4FA 5HCHA 4BZ4A 1XQNA 4Y1YA 3KCCA 4QHOA 1KDKA 3AKRA 4L9BA 4Z82A 1VB2A 4Y5TA 5CFDB 2PHDA 1ZREA 1ULPA 1S0FA 3P3PA 3ZXDA 4IEZA 1Q43A 5D8AA 3HVDA 5FYHA 1UOGA 3FZ3A 3GZEA 3N9OA 2C9KA 1Q56A 2R16A 1SLTA 1QJX2 2VBPA 3H8XA 1FI2A 5GZFA 5JWPA 5T50A 3LCPA 1YQ8A 4CVUA 4YW3A 1NXD1 1SACA 3JCIA 1V9U3 1W03A 3LPFA 1RUC3 4DS0A 4GKXA 4DY3A 1URXA 2D5HA 3WW1A 3BB6A 4R9AA 3ZM8A 2R32A 2XKOA 2B9VA 3NWKA 1GZCA 2VQAA 3OD4A 4CCMA 1H0BA 5KHKA 5KXCA 3B94A 4IV3C 2QVSB 2EXJA 2WJSA 4IGQA 1ND3B 1RUE1 1O4ZA 4QDRA 4V2VA 2YBKA 4AXOA 4PDWB 5CA6A 2QQOA 3POYA 2ZS6B 3T2QA 3GBGA 2XBO3 3IIAA 2Y6FA 2PELA 3I3QA 3WT3A 4MXWA 5J96B 1FPN3 1ASJ1 5EYYA 5D21A 1DZQA 3BIWE 3R05A 3WX5A 1F35A 4BXFA 5FPVA 1S0IA 1Q8SA 2ZGTA 3USSA 2X29A 2D3RA 2ZGQA 1H1AA 4N53A 2UY8A 3PHMA 5FY7A 4AEJA 5FDBA 1AYM2 4COVA 1T2XA 1WD4A 5IK5A 1P8JA 1SFPA 4JV4A 4BMEA 4CE8A 1ZRFA 5FO9B 2LS6A 2O14A 3ZDSA 2QQJA 4PCRA 3ASIA 3ZXEA 2DTWA 1OFSA 2W08A 2R043 4S2HA 1XNTA 5JIAA 4E2GA 4Q4W3 1ZX5A 2JD9A 3BYWA 4GWMA 2JG9A 1MQTA 1ZBA2 3QH7A 3SNMA 5FYUA 1W6NA 1OH3A 4DIQA 4DUVA 4IGPA 1XSQA 4LBLA 3VHOA 4QB1A 5A33B 1JOJA 5A6XA 3ZN6A 2NP0A 3ZXAC 4ISQA 5ACA2 3QCWA 1LGBA 4JQRA 3AK0A 2QFEA 1RINA 1NG0A 3AFGA 5FYSA 3HWJA 4FPHA 2DBNA 3AKSA 1FAYA 3HNMA 4EWEA 3FWEA 3ZX7A 5FZCA 3WNXA 3BTAA 4CDXC 3LQCA 5LK5A 4RYDA 1VR3A 3VUOA 5C5UA 1YEWA 3NV3A 2P3JA 3DN7A 1KGYA 1KS4A 1WMFA 5CU1A 5A7QA 2FCTA 2PHWA 1V70A 4BB3A 1BJQA 1YFXA 2D6MA 1PVXA 3B5LB 2R062 3IPVA 3D5OA 4ET7A 5A1FA 5JAXA 1LTEA 1NLRA 1PHMA 3UYJA 3VZMA 4CCDA 3H7JA 3AL5A 4IEYA 3ZPYA 5DAXA 5IVFA 3ZFEB 2ORZA 5K0UB 5LW9A 4LHLA 5C70A 2W1SA 3K2OA 4FPCA 5IWFA 5JSRA 3LWCA 4XPVA 4A2UA 1JOPA 1VAKA 3BVCA 1OVPA 1GR3A 5DG1A 4WM7B 4AQTA 4HLTA 4M3CF 2WS93 4M3CE 5DMYA 5FYTA 3VBHA 2AH2A 2K2SA 5LEKA 2ADDA 5A7OA 2AR6A 4ORFA 3JQWA 3QACA 3Q8EA 1RUH3 3AMHA 4FPOB 4HKLA 4K1YA 4XC9A 4ARYA 5F1RA 4YZ3A 1H8TB 3AZYA 1D4M3 3EXUA 1ND2C 1SDWA 2I2SA 3MEPA 1OF3A 4UAPA 3VD7A 4TYSA 4KL1A 4QXHA 5A3MA 4QPWA 5CYYA 1W9WA 2DCYA 2WT2A 4XYXA 4D6SA 2A6VA 1K12A 2Y6HA 2HWB3 1MQTC 4H3WA 1KQRA 3OGGA 2PLV3 1PVC3 4FPEA 1HRI1 1N3PA 1UYZA 2DVGA 3EBRA 3FUQA 4Q8LA 1DDLA 4HONA 1TME1 3CDZB 3HOBA 5T5JA 3WP4A 4AEDC 5A6YA 1EV13 4BISA 1WBLA 4LEJA 1VBD1 5C9AB 3I4IA 3NNLA 4OZOA 2EVXA 3OGRA 3ZR5A 2QQLA 1W9YA 4QQPA 3T1MA 4IE5A 2FDJA 1SEFA 2PXJA 2QCSB 3ZYJB 2WKKA 3WNNA 1GV9A 1WCQA 5A3WA 5A7WB 3UGGA 4YARA 1VLNA 2ENRA 1Y4WA 1X33A 4MGZE 4BU2A 2RMU1 1D2QA 3KHBA 2XJVA 5A6ZA 2BW8A 1DBNA 2OKXA 2ZX4A 4EN9B 2P3YA 1OA2A 4HPKA 4UFHA 4BQ1A 5IVCA 2YU1A 1K5MC 1O3RA 4RGAA 4I01A 2B7YA 4GB31 3WNMA 3P5BA 4MX3A 1W6QA 2VXJA 3FHAA 1O59A 1RUI2 1EAH3 1QJU3 3C7GA 4J1WA 1VBC3 1R081 4PIYA 3LA7A 1J59A 2WO7A 4XJ9A 5FAXA 2VZVA 3W5NA 1LOGA 1UY2A 2YXSA 4AGVA 1RGSA 4JAAA 5F5CA 5JR7B 1TNFA 3FE5A 5K0UC 4D7TA 3CEWA 1ZZBA 2VXRA 4IEOA 3J7HA 1JBCA 3HEIA 4WVWA 4W6XA 4YM1A 5FY9A 3WZ1A 2DCZA 3V0AA 5CG8A 1LJ7A 1LHWA 1O4YA 2VNRA 3M3CA 3M8LA 2XH6A 4JKKA 5JXHA 1H9PA 3EYPA 4LO6B 1H2MA 4NIDA 4XIKA 1O7FA 1N1YA 1JOBA 5FY8A 5C9AC 1SMVA 2HWF1 2WZR1 5EP9A 4LBNA 5E8AA 2HWD1 1K3IA 2W52A 5KXEA 1RUJ2 4NIAA 4WZCA 1BCXA 3NNJA 2JXAA 3CMGA 3RFRA 4MOAA 5J09A 1H8TC 2JDKA 3N7JA 1KS5A 2VBDA 2VMCA 4IV1C 4Z92B 5FLIA 2H0BA 1UKRA 2WAAA 4PIZA 4Q4V1 1A3KA 4M3CA 1C5IA 4N7UA 4LUMA 1XNAA 4FPLA 5EXOA 3PTYA 4LORA 1GNHA 2QTWB 3S30A 3TB0A 4ZY9A 1NCQA 5AVPA 5JOXA 4IEPA 4XJAA 1TG7A 3CJIA 1V6JA 2Q8CA 3KGZA 2CTVA 4D6RA 4Y20A 4CDWC 3QH6A 4H7MA 5D8AC 4J25A 3V0BB 1IS4A 2PAKA 4LE3A 2HJIA 2JG8B 1VAVA 3LSEA 1W8ZA 1RUE2 5FO7B 3RI8A 3MDPA 4RHV2 4GQ7A 1RMU3 4KWJA 3V56A 3VBHB 5HI0A 2ZHLA 3AYAA 3E1F1 3IWZA 2D6NA 4MGKE 4O9GA 4PDWA 4C0BA 2RMU3 1DFQA 2B42B 4FOYA 3JD72 1AZDA 4XUQA 4YGBA 3ST7A 2BBAA 1MZ5A 3N3HA 1RUNA 4URTA 2Z79A 3S7EA 5GLVA 3BTXA 4NWWA 5FQ0A 5K0UA 2GAUA 2ZGLA 2E7TA 2IXIA 2GNBA 2VL4A 2W87A 3O1OA 4PT6A 1U5ZA 3SCHA 1YLLA 4LO4B 4CDUC 1OQEA 2RDNA 3I2HA 5BNOC 1ONAA 3RVHA 1FV2A 2WNEA 3NO8A 4YM2A 5FP9A 3VDDA 1VE0A 4MLOA 1AJKA 3JB8A 3MIBA 1Q8QA 3V64A 4JKMA 1X8MA 2HYXA 3SLIA 4QAWA 4XFFA 1W0OA 1N3OA 1R1A3 3N35A 3IAPA 5CFDA 4AAPA 1QQP3 2LTNA 5IHRA 3KV6A 4ONUA 1FMD2 1UNBA 1ZBA1 2QQIA 5E6HA 5FTTC 3V0AB 3UJOA 3KWVA 3MLKA 1G9CA 1GQPA 2AZ5A 2AGSA 2NYYA 3ACGA 4MG2A 1K42A 2IVJA 1TZOA 3JB4C 2JKBA 2RS12 1H1MA 3NAPB 5F7UA 4OMCA 4DINB 2D6LX 2XWBB 1U12A 4QDQA 1NY71 4RFRB 4RHV1 5FZ9A 2J42A 2QZ2A 1IS5A 1LRHA 3J4UH 2OX0A 2RDRA 4P9JA 5LBEA 2IVIB 2WNOA 3VL9A 1CIYA 3OB8A 2WFPA 4AGGA 3WD5A 4QGLA 2VQ0A 1VALA 1RUF2 1UL9A 4MADA 3HQRA 5L9RA 2A6WA 1O5UA 5IK7A 1AR72 2XJTA 2BBVA 4FTSA 2P5BA 4NMIA 3IMMA 1QGLA 2BYVE 4W8JA 1SQ4A 1KDMA 4V1PA 4YM0A 4I2OA 1R1A1 1UXXX 1FNZA 3M3OA 1SLCA 3V65A 1OLMA 1JZ6A 3VBFB 5FUNA 2ZJCA 4YW2A 3SH4A 1RVF2 3ABZA 3JZVA 5I0RA 2OYZA 5CNAA 1W04A 1F2NA 2D6OX 2PHLA 3MF6A 4AYUA 1AUYA 5A80A 1H2LA 5G05L 3J8F2 3S5QA 5JZGC 4CSWA 1MS0A 2JDMA 1UXZA 1UZWA 2ET7A 1G9FA 2E32A 2RM21 3AJZA 4K1ZA 4RGGA 1RHI2 3LEGA 3MIFA 3S7IA 5BNOB 4BK5A 4EQVA 1R093 3PTRB 1F15A 1RTVA 2VUCA 4K8FA 4XILA 1XE7A 4AI1A 1LEMA 3K48A 3K4DA 1SLAA 4RN5A 1REEA 1T6GC 5GLZA 1JODA 2Y6JA 3AXEA 3H7YA 3KVBA 2QQNA 3VKOA 1W9TA 2P1BA 4LOTA 3OY8A 4XAAA 3IKWA 4Z07A 1UWWA 2BFUS 5LEJA 1NY72 3ILFA 2FCUA 5CFDC 2VZRA 1F31A 2ETEA 3BI3A 3NSTA 2ZAAA 3SHRA 3ZXLA 4A3ZA 3QD6A 4CDWA 1ZRCA 4YPJA 3KD4A 2Y26A 4AHZA 4EZHA 4XBLA 3ZSEA 4BMBA 4YG3A 4Q0VA 5FK7A 1N47A 4YW6A 3RYKA 4I0AA 1YNAA 3WDXA 1HKDA 2E63A 3MUZ1 4JTOA 1HRI2 4QD2A 1UW8A 2DTYA 1TME2 2ZMLA 1CESA 2XDVA 3PNAA 3USUA 4B4QA 1YO8A 2GMMA 1H8VA 3AXDA 4BDVB 1HRV3 5A6QA 1VBD2 4H2AA 3ZXGA 2GC2A 5JXGA 1PK6B 4IE6A 1OF4A 4FQ4A 5H9PA 3IDBB 3LF7A 4TLFA 1QOSA 1YI9A 3WQ7A 2VNVA 3PUSA 1EUTA 2J1UA 3C8XA 4BCUA 3NMBA 5FZFA 4ZPIA 5D2AA 4LA2A 1E5RA 1SG3A 1WMDA 4KG0A 1RYYA 3WG1A 2Y38A 3MW4A 2SBAA 5CZKA 2Z2SB 5FYCA 4DXZA 5H9QA 5FMCA 3ZFEC 2IXLA 3VDDB 4B29A 4D6QA 1AJOA 2RG4A 4EWAA 1HV1A 3ZR6A 5ABJB 2VZOA 4FP3A 2WZPP 3PMEA 2NN8A 4BE3A 1G9DA 5BNNB 2ZCWA 3MV01 1YCIA 4HN0A 4C8DA 1GWLA 1ZVFA 1PO23 1KJRA 5FQ0B 4XW3A 1R082 1WGPA 4DEVA 1SLLA 3B02A 4CP9A 2CYFA 4Z1VA 2ZBJA 4BQ3A 3MFAA 4TLGA 3ZIXA 5A3NA 2GH2A 1OOPB 4XF4A 4QWNA 2Z69A 1IPSA 3AP9A 3IB3A 4BQWA 4LHNA 5CBLA 3PIJA 1IS3A 1PO22 2A70A 4P9WA 5C3PA 1OFNA 1W3XA 1WD3A 1R091 3WP3A 5FLHA 3OBRA 4QX2A 1X50A 1C4RA 4HN1A 5FJKA 3ZFGC 1VBE2 3M4FA 1IZ3A 1QKQA 2D3SA 5DAPA 5GZEA 1AL23 2VG9A 4YGCA 5FZBA 5CFCA 2HWF3 2V4VA 2WZR3 4YLZA 1PIV1 1NA1A 5LA2A 4KMQA 4BXSV 1Q5OA 2EA7A 3ME2A 2JIJA 4XF0A 4UF0B 5LATA 2HWC2 3RSJA 1Y7BA 2QQKA 3MIEA 4BJ0A 4Z2WA 3B3QE 3RRDA 2FCVA 3CNAA 2OA2A 3OPTA 3P1IA 4UXAA 5FPLA 1ASJ3 4QX1A 4CCNA 1C8NA 4UF0A 3VHRA 4HZFA 1OD3A 4NUBA 4IGOA 1BYHA 2BERA 1YRZA 3PURA 5DDJ1 4EYUA 4IUGA 3O1UA 2YGLA 2YB7A 5JOYA 2VMGA 2VUJA 2LM3A 1HRV2 2JEMA 1PVC1 4Y5Z0 2JG8A 3BKZA 5IVJA 1TME3 2J1RA 1QJY1 4SLIA 1O6UA 5L9VA 1HRI3 1XYPA 2ZHMA 3BTZA 1RUG3 3GDBA 3WUCA 5FFOC 1W6PB 1FV3A 2RS52 2C26A 3CLPA 3DXUA 4GD4A 4GMP1 3HN1A 4NHMA 4QX7A 5ANQA 1CAWA 1O91A 1H30A 4AVSA 2ZGSA 3ACHA 1OKOA 2NMNA 3AKPA 1RUD2 4XACA 5FY1A 3N9LA 3ACLA 3ZKYA 4AQSA 2WRAA 1VIWB 5FMOL 5FZ7A 4B8EA 3GJBA 3VHPA 3WDYA 5A3LA 3AMPA 3BN6A 3VBOB 4C1XA 1DQ6A 1F5FA 1HN1A 1RXGA 2YROA 3OYWA 3P3NA 5C6CA 2WNUB 1COV1 4CDUB 1UZ0A 1JYWA 3E5UA 2Q4SA 4XMAA 4RGKA 4CYDA 4NIHA 2OS2A 4LBQA 3ES1A 5DG2A 2ZHNA 2FD8A 4GIQA 5GZCA 3CKHA 3O1RA 3VDCA 3FLRA 4H14A 2GH8A 3POSA 2P3IA 2VM9A 2V09A 3TN93 3IM0A 2R1BA 3N9MA 3H3UA 3AVSA 2QJVA 2CGOA 3MW3A 5A7PA 2OVUA 4YSFA 2DVBA 3EB7A 4P00B 3URFA 1S0EA 2DU1A 3P6BA 5DABA 4Y4RA 5KXBA 4FFFA 3AZXA 1MZEA 1B35B 3BIEA 1GOGA 4DEQA 1CAUA 2LRPA 3OCPA 5JZGA 1UX6A 2LROA 1NAEA 3O12A 4XURA 2FMYA 1NCRB 4MO3M 2O8OA 4QX3A 1C1LA 1DGRN 3R4SA 1DLCA 4NRMA 4AEDA 3WR0A 3OGJA 5JMOA 5BNPB 4COYA 5T5OA 1K5MA 2DWRA 4PQ9A 5LY1A 1K45A 2WN2A 4JKLA 1YJKA 4HPKB 4QB6A 4R8HA 1KFUL 4PHZA 1YFYA 4AL9A 4IETA 5C3RA 4XUNA 4AK3A 2EIEA 3N7MA 4EV0A 2WA4A 4DRVA 2RS13 1FNYA 3T0AA 4B3NA 1GNYA 3AZWA 4CU9A 3I2DA 5GLUA 1JUHA 3T2TA 1GZWB 5FLJA 5JIUA 4XFCA 1W2NA 2WLQA 3GBFA 4XF1A 2XB6C 2DCTA 2DFBA 2EXIA 2BP6A 2ID4A 4LMFA 4N43B 1WLWA 1LHOA 4IERA 1NKGA 2XGXA 4IQPA 4XHXA 3B93A 2W9XA 2UY9A 1R1A2 3LPGA 3INAA 1KXGA 4QDSA 1PMJX 4MXVA 5ERLA 4XVHA 4KNCA 1GANA 3D4KA 4IDZA 5GLTA 3EO6A 1Y9QA 4JTNA 1OA4A 3HMYA 2VZSA 2GNTA 2KM2A 3L9JT 4GALA 4P9YA 3T30A 5LCWL 2WDBA 4RD7A 1ZA4A 4HL0A 2IFRA 1CX4A 1EV11 5APAA 4YZ1A 2N7GA 5A32A 1U5XA 3U78A 1WA6X 3PUIA 3S0MA 2XQXA 3KT4A 3LA3A 2Y6LA 5DQ0A 1A78A 3WP6A 1O8PA 1DQ4A 1HLCA 2R073 2YBPA 2R1DA 4J1XA 5HCFA 1ZM1A 1MVQA 1JYNA 4XFIA 3PDQA 1I5ZA 3KV5A 4QPGA 5F3CA 2J22A 1A34A 4XEZA 5FO8B 2PQQA 4AVAA 1RMU2 3MBWA 2R0HA 4S2GA 1HQWA 5T3NA 1OPMA 4FQZA 5EZWA 1KJLA 1Y9GA 2WO1A 4N7IA 5FZGA 1MS4A 5JXJA 4NO4A 4D8MA 3ZDVA 1YHFA 5LY2A 3M7AA 4GZ9A 4DRRA 5KR7A 3U10A 3H8UA 5SV8A 1SZBA 4XZUG 4Q8KA 2BQPA 4XFBA 1J1TA 2HWE1 2CDOA 2EXHA 4UI9L 2BPA2 1EAH1 1QJU1 4Q0SA 5I0TA 3KLSA 2A6XA 3N7LA 3IMNA 4FOWA 1VBA2 2Y6KA 3OGVA 1QQP1 4OI4A 1EY2A 4L92A 2O1QA 4AFAA 1EUUA 4GH4B 1BXHA 1CGPA 1NE6A 1UOBA 1V6OA 4GKYA 4CUGA 3AP6A 3H8RA 4LHKA 4L99A 3O7OA 4BQXA 2JG9B 4KWKA 4PI0A 1FPN1 1YI7A 2E53A 1JMUB 3GBWA 3AMMA 3C7HA 4RR3B 2H6CA 4QPIB 2ZGPA 3KMHA 4MGQA 3HNYM 5FZIA 3RNSA 3ZYBA 4CDQA 5I0DA 4NN0A 2ZGKA 1IKQA 1HB2A 2ZGMA 2GALA 2GN7A 3M3QA 1TEIA 2W68A 1W6MA 2C4XA 1I3HA 3D6EA 4FCAA 2JE9A 1N3QA 2ILMA 4DFSA 4P5HA 3ZSKA 2J1EA 2YPJA 4NIIA 3AB0A 4CCOA 1OOPC 5A3PA 4I30A 4BHPA 4YYOA 1IOAA 2XWJB 4QPGB 5A1LA 1KFXL 4QX8A 1JZ3A 1ODNA 4QU2A 2YPDA 3U1XA 4XFGA 1RUD3 5LA9A 4DNYA 1OQDA 2VTXJ 5FV3A 3WQBA 1C5HA 4LT5A 1AR61 1X8EA 3OJBA 3HBZA 4I09A 1EAH2 1QJU2 1RUI3 2J1VA 4XTMA 1STMA 5J3UA 3UV9A 3CJIB 1YIFA 4CPBD 1DGRA 1WA4A 2RS53 3OF1A 1BK0A 1ZZ6A 4KQ7A 4MGYE 1RUG2 2WSUA 4QM8A 4ZU5A 4BK4A 3FHIB 4F8AA 2DVFA 4CDXB 3DYOA 1KITA 4A3XA 2ZZQA 1UX7A 1LHUA 3RZZA 2XKPA 1DYKA 1UMZA 3CQOA 3A22A 5EJ1B 4DQAA 1QNYA 1HDKA 2B9UA 4PLMA 2VOTA 3I2KA 3MIHA 3RPQA 4ASKA 5FPAA 1CN1A 2ES3A 3ACFA 2RE9A 1WCDJ 4MXWB 2PHRA 1ALYA 3AVRA 2BDRA 4UFJA 3OPWA 3BTYA 3MV11 4R9BA 2VU9A 5DDJ2 5C5TA 1W8FA 5D8AB 3CIHA 4AR2A 1ZZ9A 1J3PA 4LIVA 1D4VB 4OHWA 3WCSA 3RG0A 1M4WA 2HWF2 2WZR2 4LO7A 1MACA 2RV9A 3MGUA 2E31A 2YY1A 5FWJA 3I3DA 1XE8A 3T1LA 3VZOA 4CA9A 1J1LA 1PZ9A 2PLV2 4B4PA 3GCWA 4PIXA 5IT6A 4RQPC 3GZTB 2HWB2 1U5YA 3MIDA 5JPMB 3LA2A 1GOHA 2RS51 3GHMA 2PAEA 3FFZA 2W46A 1O3SA 3NKGA 5IFTA 1ULCA 1PM7A 2MHFA 1D0HA 4FXGB 4XFHA 3RWKX 1UU6A 4IXLA 3NV4A 4AI3A 1VMFA 2FZ1A 3J7NA 1VJ2A 1E5HA 3WNLA 4LULA 4MHRA 1SPPA 1X9TA 2WNVB 3QBQA 4XF3A 2A3WA 2WS92 4M0HA 2W0XA 2YU2A 2ZX1A 2W5FA 3IN9A 3IDEA 3KHCA 2OUHA 3ENRA 3SCGA 3I59B 2ZX0A 3THTA 2ZGNA 4ATFA 5IJRA 3OTFA 2IZWA 5GM0A 1REDA 3U37A 2YFUA 1V6IA 3MIGA 3USUB 2D98A 2EIGA 5FMBA 1XPWA 2QZ3A 4ZZ8A 3NRUA 4COZA 1PGL1 4B4RA 3HNBM 4DZGA 4XZPA 3G7DA 5T55A 4PDWC 2EIBA 3LDKA 1B09A 1OLQA 3H3LA 4OVEA 3F2ZA 4TN7A 3BGAA 4HSLA 3JUUA 3OEAA 2JDZA 4XFAA 1NXMA 1BQPA 1GFF2 1W9FA 4I02A 4JGZA 4Q29A 5EPAA 4AVVA 4AWDA 4DXTA 1MVEA 4XJWA 5BUVA 3VKNA 2UURA 1C8M3 3W9AA 2DVDA 1XJAA 2ZPXA 2HBTA 3HQXA 4UWDA 2FDKA 3R0RA 2GC3A 3KQRA 1QWRA 2P6HA 1Y3TA 3VN4A 1W6OA 1DQ5A 2ZEYA 4ZS2A 5DZGA 1US3A 2JDNA 5J48A 1QH6A 1BZWA 4UW4A 2XJSA 5FMDA 5ACA3 1HQNA 4XBNA 2D6KA 4HG6B 3OEBA 4FSJA 1J58A 2VW0A 2CAVA 1BBT1 4FPGA 1K5JA 4RFT0 1O5LA 3TEYA 4RS5C 4DY5A 1UZYA 3ATGA 2WQZC 3ROUA 5DUUA 4BLIA 1J3RA 1RUC1 4LBMA 4Q4W2 3PJQA 5FYMA 2R042 4XUTA 4WBBA 1S2KA 1WLDA 1LR5A 3WG3A 3ZFEA 4E4HA 5KBFA 4ASLA 1SCSA 2AYHA 5CB7A 3NNFA 2HLEA 5FPBA 4UFKA 2ZAHA 3TEWA 1BHGA 3HJRA 5BY5A 1DP0A 1TE1B 1ZYBA 4UOJA 4AEKA 2AEYA 3POBA 3ZVXA 4AHYA 4DUWA 2EIDA 1GOFA 4Q2FA 1JXNA 3MZHA 5DAVA 1A6CA 5B4XA 2PAMA 4W65A 2A6ZA 1PGW2 1QJFA 2QKDA 3RZJA 5FXVA 4DO0A 2XHNA 2YHJA 4OCTA 2J7MA 1PZ8A 1XXNA 1V6KA 3H0OA 5EV7A 3TEXA 2WWUA 4BQ2A 1S0CA 4M00A 2K9ZA 1NCRC 2VZQA 2LW8A 5FPXA 1W2AX 1AYN1 1B35A 2XBO2 1RUOA 1LU1A 3KS7A 1HV0A 1YQ5A 5CFCC 1IGOA 1VBA3 4LBKA 1M06G 5JCTA 1LNSA 1RUF3 1UYPA 4CP0A 4HVQA 1JZ7A 1JYVA 1DGWA 2HH9A 2Y0IA 3NL1A 4NVPA 5CAZA 2PHTA 2YDEA 3B9IA 5FYBA 3O1TA 1GQHA 4WVZA 1MZ6A 1YFWA 1LOCA 1I9RA 1VMHA 1ZZ7A 3DYMA 3H50A 3UNPA 3T0DA 5IVBA 2AC1A 1LODA 5A33A 3T0BA 3NJVA 3N9NA 5CEHA 3UL2A 1GUIA 3HPNA 3O1PA 1JU4A 4HOOA 2QNKA 1UIJA 4XUOA 4YVWA 1RUC2 4Q4W1 3M3IA 1V9U2 1YQ6A 4GMP0 2G9GA 4HKOA 1OD5A 2XMLA 4AE2A 5L36A 4JZRA 1QJX3 3WOGA 1F9KA 3PUQA 5F2SA 3RZMA 3IT8A 4OHYA 1YC61 1V6NA 2BWCA 1NOVA 4MH0E 2R072 1NA1C 5FRAA 2HKXA 3IDCB 5C4WB 1POQA 4E8DA 2WT0A 2WQ8A 3ZIWA 1VRH3 1XU1A 1DLLA 2CL2A 2NZ9A 3WLUA 4K40A 2WO3A 1OXCA 2XJRA 5DXDA 1W6PA 1G7YA 2YC0A 3MO4A 4N53C 4Y22A 3VBSA 4CEWB 1WCSA 2DUQA 5J98B 4ES8A 1MQTB 1VRH2 2IXKA 5AC91 2A3YA 3N9QA 2GZWA 2W3JA 3FL7A 4FAGA 2YUEA 4K21A 4QKNA 5A3UA 2ARCA 2B5HA 4LXLA 5LWBA 4KBZA 4FI9A 4LK7A 3VD9A 2A73B 4LKSA 4MZUA 4HVRA 2FMDA 1QXRA 4I3GA 5EWSA 4E2QA 1I6XA 1E57A 5FZAA 2HEVF 2RMU2 2YC4A 1QDCA 4OI1A 2DURA 3I2GA 2W94A 4FFHA 4RHV3 1IPJA 4LQRA 1RUE3 2RS32 5T5LA 2X05A 5HBAA 5CFCB 3VD4A 2BWAA 4PBOA 4CP2A 2RDSA 3MPPG 5FZKA 4P5YA 3S6PA 1B35C 1ODMA 1CPMA 1HN0A 1V0AA 2SLIA 3SISA 2Q5TA 5AFBA 4WM8B 5IW0A 4TZDA 2QUOA 5FZ8A 2W39A 2IFWA 4QMAA 4NHKA 2QQMA 4COUA 2R071 4WVMB 1GZWA 5L7OC 3FMGA 1BKZA 1TMF3 3JQXA 1V6LA 3AMNA 3AP4A 4YVWC 3UETA 3WF2A 1LESA 2PHUA 3GXUA 2HBUA 1QJZA 3LEIA 5DPNA 3ZYIB 4A41A 4BIOA 1OH4A 1UD1A 2EICA 2PFWA 4NJ4A 3SQOA 1GWKA 4QQHA 4QT6A 3VBSC 1UKGA 4FPJA 1K5MB 1S55A 3OUJA 4OUMA 5IK4A 4IEVA 4LKEA 3UKTA 4KI5M 1W28A 2UU8A 4FPKA 1SLIA 1RUJ3 4XJ8A 5LA0A 2G4IA 4JGYA 4QU1A 2A5ZA 2GC1A 4NR1A 5FY5A 2F4LA 3TN92 1SDDB 1ZRRA 3DKQA 3I2FA 4CEYA 3WCRA 3SEEA 4INDA 3NJYA 1RJ8A 5C8CA 2TBVA 1OQ1A 1OVSA 4MGTA 1AR91 1PNGA 3FFQA 1UZZA 2ZX3A 4I0BA 2FDGA 1GQGA 3ILRA 4Q0PA 3VBUB 2Q1MA 4X6RB 5FP8A 3VBUA 5JI9A 1I5PA 1MS8A 1PK6A 2X53S 3NV2A 4NE9A 1ZBE1 4AI2A 1UZVA 4YG6A 3KB5A 4IESA 4JDOA 2WZEA 2Q8DA 1QJX1 3B7MA 4AVBA 5JUVA 1J3QA 2VBBA 1VBC2 3KVAA 4AQ6A 5FZMA 5LASA 5F37A 3B9CA 3K4AA 4AHXA 1V6MA 2CWSA 1H2NA 2CGPA 4IV1B 2FBEA 1RUH1 4UW5A 2GMEA 2VCBA 1JU3A 4CEYB 2G19A 4NWVA 2RDQA 4PF5A 1XB9A 3PVNA 3IBMA 4PLNA 1QOTA 4UW6A 1BEV1 1QIQA 1C8M2 2G9FA 2VUDA 2WYSA 4OLLA 4DUXA 4AFDA 3ORJA 2XQRA 1R1ZA 2Z5WA 3PUAA 5F32A 1NQDA 1TVGA 1X7NA 2OZ6A 1DGWX 3DV8A 3D82A 2HYKA 1HJFA 5FZOB 1HJGA 4YW5A 4BH9A 3RZLA 4LIUA 4PF1A 1PZ7A 4YW4A 1JYIA 2GMPA 1ASJ2 2LUWA 1AHSA 3W59A 4OZXA 1W3VA 1H4HA 2QQWA 2XVKA 3WV6A 5CISA 1O4TA 1LENA 2JD4A 2HWC3 1AR71 1SBFA 2Y6GA 1OKQA 3E6DA 4YZ2A 4MGSA 1F4AA 2D5FA 3ZSJA 5IATA 5T5PA 2BVBA 1GICA 1JS9A 1AL22 1AYN3 2XHKA 4M0NA 1PVC2 3WNOA 2P34A 1VBE3 2NLRA 3RWNA 1W8OA 2G9ZA 4JHTA 5JVVA 2YGMA 1XRUA 2WZ8A 4IEQA 3UT0A 4NOTA 4RS5B 3EMRA 3WDUA 4LO8A 4BQYA 4E4SA 1D4M2 1O8SA 2WINB 2BNMA 3RJ2X 3W20A 2ZABA 2BGPA 4QPIC 3THPA 1AYM1 1S0BA 1FATA 1RUH2 3VKLA 2GNDA 3MHZA 3MLJA 2JECA 4UFMA 1R083 4RR3A 1OUXA 1BEV2 2VMHA 3I97A 3I3MA 3U0ZA 2C5DA 1HXS3 3RZHA 4W4ZA 3WXPA 3MLLA 1I1EA 4K8RB 3QOPA 2ZOEB 1OURA 2K46A 3E5QA 4FFIA 3TEZA 3WF0A 3N36A 1LU2A 2WWJA 2Y8KA 1JZ4A 3WHTA 4Q0QA 3E5XA 3GZUC 2DYCA 5FYZA 1RL3A 4LK6A 5KWRA 1OPOA 2I07B 5DDJ3 2FDFA 1ENXA 1VAMA 3DF0A 5F5IA 4CDQB 4XDPA 4EROA 1YIPA 2B46X 3K46A 3H8OA 1UY4A 3WINE 1OA3A 1SBEA 1UOJA 2VC9A 3LB9A 2H0VA 4GWNA 3ZOIA 4E9KA 3L2YA 4Y33A 4XOGA 4EN0A 3ZN6B 5KHGA 3E6CC 1ND3C 4FO9A 3SEPA 5FUIA 3HT2A 3C7FA 5C7GA 2WSVA 4EN6B 2VCAA 1H4GA 4UBGA 1MS3A 2DUOA 4N90A 3A23A 3KT1A 3S57A 2VCCA 1LB2A 3ZYFA 3U4XA 2VH9A 5BYNA 4NHXA 4MYEA 3TYJA 4HT1T 4MVTA 3VDDC 4AVCA 2FDHA 1W2TA 3WY6A 2VZTA 1U5IA 1IG3A 5FZ4A 2ERFA 2D93A 2PQSA 2VR4A 4YZ5A 5HV0A 2B8MA 5L73A 3THDA 1ZBA3 4XJUA 2WLPA 4Y4YA 3T4VA 2Q0AA 3DPRB 1MS9A 4QPGC 5FR3A 1ZRDA 5TSWA 2GC0A 2XXZA 5IAVA 1ZZ8A 1DZRA 2XONA 2BU9A 3VV1A 1J84A 1MS1A 5BNNC 4OULA 1RHI3 1V00A 4AZZA 1JHNA 5AFEA 5FOJB 4WV8A 2O0OA 1IKPA 2Y0OA 3DUIA 1JYTA 5FZLA 1AYM3 3BOPA 3POEA 2JIGA 1VBA1 4P9GA 2VNOA 4XHBA 1NCQB 3CU7A 2GNMA 4YRDA 4HSJA 4IL7A 1RVF3 5FBJA 1CJDA 5A7SA 2BGCA 1AXYA 1VBE1 1JYCA 3I3BA 3ZFFA 5ANNA 3OG2A 5GKAC 2D7FA 3T08A 4Q27A 1OC1A 2DV9A 1CAVA 2GP3A 1S0JA 1UYYA 2XJQA 3D8CA 4IE7A 4OFGA 4D7YA 1FPN2 1YQ2A 4KGQA 5FP3A 1WBFA 4M01A 5DUWA 2JDYA 2V5DA 4LBJA 2TNFA 4AEDB 1WLTA 3DPRA 5KHHA 1MPXA 4BM8A 4GAZA 1W6OB 5FYVA 4N43A 3ZYGA 1OLRA 1C28A 2YZ4A 3CZJA 2BRTA 5GZGA 4QKFA 1RMU1 2F4PA 4W6YA 4LKFA 3I59A 4KU7A 1ZA7A 3ZO0B 1US2A 4A7KA 1SHWB 1W8NA 1CD3G 1UU5A 5A70A 1FX5A 3RGBA 4OQ8A 2C0ZA 3WQ0A 1EP0A 3IPVB 2VCMA 1GWMA 2PN5A 4FTEA 1FMD3 5JOZA 5DN2A 4D7SA 5ISLA 3AM2A 5FREA 4ZHNA 2EF6A 1TMF1 3J26N 1VB4A 2VULA 1QQP2 1QF3A 3AJYA 3AKQA 3GCXA 4HFSA 1FOD2 3WW4A 1NCRA 1XSRA 3OYWB 1RUD1 1QJY3 4QKBA 1LEDA 5JZGB 5A1AA 2WUHA 4J6GA 2WT1A 1RUG1 2OUJA 1JZ5A 3ELNA 4YNIA 1O3QA 3OSDA 3OOXA 1C57A 4ZU7A 4NRQA 4OUSA 1APNA 2HWD2 3UKVA 4X8NA 2XPJA 3SITA 3VBRA 1W90A 3R4UA 2UYAA 4QQOA 3RI9A 1SCRA 3ALQA 4AFBA 3PVEA 1UOFA 2ZMNA 4KGGA 2RM23 4BQ5A 4FAHA 3RZGA 1LAJA 2Y33A 4WVMA 2WNVC 4S2FA 1HB1A 2JICA 4U2AA 3LEMA 4CCEA 1UMIA 3JD73 4P02B 4UFLA 2WNUA 1KD7A 3AYCA 3W58A 1NYWA 4QHBA 3VBOA 1XNCA 5CKMA 1PX4A 3ZMOA 3SKVA 2Z42A 4MV2A 1NCQC 5JSPA 2BVVA 1VBC1 1F8VA 3CJXA 3WW3A 3ZSMA 2IC1A 2JB4A 1QY4A 3KSCA 4CDXA 2OZJA 3WVJA 4BA6A 4RS5A 4LBOA 4DXSA 4LLOA 2ET1A 3A0KA 1BVP1 1MEC2 4RQPA 3BOWA 3I2IA 4AGRA 3WHUA 1PO21 3H1MA 4LLFA 2CY6A 4SBVA 1AF9A 4Q4Y1 5B4NA 4XXAA 1ENQA 4Y1XA 3O14A 1QXPA 3V0BA 3GYDA 1DYPA 3H9AA 2WS91 1ULFA 1QXJA 4QM9A 4Y20B 3S5AA 1YJLA 2PHXA 1DCSA 3K3OA 4Y22B 3VBSB 4CEWA 5I8SA 4MUVA 1W0PA 4WM7A 3DPRC 4JHZA 2ZXQA 3FUOA 1W8WA 3OGSA 2HWC1 5GLWA 5FXZA 3M2MA 1L3JA 4Q26A 3VBHC 2D3PA 2WWSA 3KF3A 5LK7B 4IW3A 2QDRA 3DKWA 2KR2A 1PIV3 1WUVA 4KBBA 3B00A 3C7EA 3IDAA 1PO11 2DVAA 2DUPA 4AHWA 3FLPA 1LHVA 4E4DX 1X9PA 5FBZA 2G1MA 2O8QA 2PLV1 2ZACA 1A8DA 3HT1A 3K3NA 4YVSC 1QU0A 3VBOC 5CG9A 3Q9OA 4R4ZA 2UWAA 4AF9A 1JZ2A 2DCKA 2XJUA 1VPHA 1UQXA 3NNGA 4JCKA 4LA3A 1G6NA 1Q3EA 2BOIA 4GH4A 1FMD1 1MEC1 3JBG1 4CTEA 3OPZA 3BU7A 4HKWA 4CUCA 5FP4A 3DGTA 5FWEA 1CVNA 1AR63 4CUBA 3RYPA 3VZKA 5HXMA 2OPWA 2WYFA 5FYYA 3UESA 1AX0A 1NT0A 4XCAA 2NM1A 3T2OA 2OIIA 4QPIA 2VVEA 4DMIA 2JDHA 3RYRA 1E5IA 2VECA 3LKJA 2J1AA 2VMDA 4N8MA 1KRIA 1Q8PA 2XLGA 3W21A 4Q4X1 2RS11 1LCLA 4W6WA 4YGEA 5FY0A 3KCXA 3LFIA 4BWOA 3GHNA 4M4RA 2W1QA 2PMWB 2YBSA 3ZXJA 4D94A 1S0DA 3T4HB 4FP2A 1JTZX 5KHIA 4UW3A 1H6YA 2CWMA 4RSUA 1RITA 1EV12 1HB4A 3Q8CA 2W95A 3M3EA 2OPKA 5C33A 4DOUA 3TRSB 1H2KA 2BV4A 2WFF3 3H42B 4FOQA 4YVSA 2E7QA 3T09A 4IV3A 2VZ1A 2JE7A 1BMV2 4WM8A 5CKQA 2CAUA 3ZN5A 5IFPA 3X29B 2AEZA 1GLHA 5C8CC 3JBG2 4C91A 1DQ1A 1ULEA 3KQ4B 2BGOA 2A6YA 3J8F1 3JU9A 3NKTA 2R061 2X5IB 3LFMA 3VKMA 5IVYA 1XE0A 2GN3A 4OYUA 2ZGUA 3Q8FA 2NPIA 4JC1A 5E1RA 5FPZA 2FQPA 4AFCA 3OUIA 5JR2A 2OT7A 1AX1A 1VBB3 4L11A 3ZLIA 3LOIA 5A32B 3LDBA 1CZTA 1ULGA 2CDPA 1ENSA 5DZFA 5LBCA 1XYNA 3ACIA 3A7QA 3DCQA 5I0SA 1DF0A 2W47A 2R49A 4FT8A 3VBUC 2BFUL 1D2SA 1Y9MA 4H7LA 2VPVA 2X5IA 4GB32 1YUDA 3A21A 5J1XA 2ZA9A 4QB2A 1MZFA 5F2WA 4XDQA 5BNOA 4ZONA 5FZHA 1LOAA 5T54A 3FHQA 3O0VA 1NQJA 2XG3A 4AEMA 3A0NA 4HK8A 4YFZA 3D0SA 1O3TA 5F3GA 1MR5A 1Z0HA 3NAPC 2TEPA 3SMHA 4CEYC 2R7EB 3IAQA 4AW7A 3AL6A 1LOFC 1DIWA 1CAXB 2BNOA 3VBFA 5I8YA 1RB8G 3AYDA 4X8PA 1VBD3 5B2GB 1AR81 3RS6A 5BNPC 2AENA 2EAAA 4CUAA 1D7PM 1OUSA 1GZ9A 2VY0A 3OD0A 2XBO1 1S2BA 3GGLA 4Q1RA 1H9WA 2ZMKA 4N9IA 1Q8OA 4ARXA 1SPPB 2WNVA 1PK6C 4YVWB 3MPBA 3FBMA 4EWDA 3K51A 1OBNA 4LBQB 4L0PA 5EJ3A 5AC93 3GNEA 3MYXA 5HCAA 2MEV1 5JI7A 2F6BA 2FZ2A 2VQTA 2RR11 4XF9A 4D0QA 5IK8A 1CAUB 1W06A 1N1SA 1YFUA 3FJSA 2TUNA 2Y34A 3FN9A 3HR9A 3MW2A 4AAXA 1L7QA 2WR9A 4QHZA 3PIGA 4LNVA 3AC0A 4RA0A 5D1IA 2HWE2 2P2KA 2R6QA 4IEWA 4COWA 2E9QA 2P37A 1R092 2WIIB 4RL7A 2HEYF 2VJXA 2WBKA 2HWE3 4NRPA 4LTAA 4IEXA 5C71A 4LHSA 3J8F3 1RUI1 2RJKA 2DCJA 3SKJE 4W50A 1DQ2A 3LEKA 2ZKNA 5FKBA 4LITA 4QXBA 4A6OA 3I49A 4P08A 5LRRA 2EXKA 5JLVA 3FX3A 5L7OA 2X10A 1OMIA 1YQCA 2ZTNA 3N9PA 3AMQA 4O61A 5EFUA 3U4SA 4Q1PA 5CADA 3GZAA 5AC92 5F3EA 2B4KA 1OT5A 3U07A 3JD71 4ISRA 1UAIA 3D3AA 1AR73 2VOKA 3TNPB 2JKXA 3H1WA 4JX0A 4XQWA 5EJZB 5KC6A 4FTBA 5KXDA 2XR4A 1GBGA 1XYOA 2MPFA 3UGHA 2VTFA 2MEV2 2W92A 2QQVA 4A4AA 1RUJ1 2W1UA 1W2OA 2BUKA 2WFF1 3NW4A 4UBHA 3R4DB 3WDVA 4EZ4A 5FMOS 1OHFA 1XOYA 5FIXA 2E26A 4E2SA 3DXTA 5GALA 1LECA 4KWUA 3TAYA 2DU0A 3WSOA 2KXLA 3ZFGA 1HRV1 4GH4C 4Q4V2 1Q8VA 3BU0A 1GU3A 5F5AA 4QGMA 1GYKA 1WMXA 4Q4Y2 5FZOA 5C3SA 4XJZA 4C90A 4JGZB 3ZXFA 5A7NA 4CP9B 4CPBA 1C3HA 1ZBE3
chains in the Genus database with same CATH topology
2D97A 4S2DA 1NA1B 4WVVA 5C8WA 4WM7C 4YW1A 4M3CB 1CPNA 3HIFA 2H6BA 5ABJA 1JH5A 1AX2A 4XMIA 3LZZA 3TNQA 1WW7A 4KU8A 1C1FA 3UK9A 4PBPA 3ZFFC 1RUF1 1PO12 2AUYA 1OOPA 4P9LA 1AR92 1COV3 2XUMA 2WFF2 4EN7B 5T52A 1AR83 4AVTA 1UCXA 2HWB1 2RJLA 1RVF1 3TWIA 3VZJA 4K6BA 3M1HA 3B69A 2RHPA 3N4MA 1N1VA 2ARBA 5F9TA 4Y1VA 4HANA 5L19A 4O9EA 4R52A 2R30A 4ITCA 3VKFC 2P17A 4ZU4A 5C9AA 1BBT2 1POV3 1JN2P 5K8SA 1UF2C 2A3XA 2CV6A 4Q4X2 4F83A 1XNDA 5ACA1 2UYBA 4ATEA 1LOEA 2VVDA 1U0AA 4YM3A 4AQ2A 4I3PA 3PJYA 1A8MA 3SCFA 2ARXA 3E6BA 2WQ4A 1HXS1 3D0JA 4JDMA 1OSGA 5C4WC 2BEOA 1UPSA 4X6QB 2XLFA 1SFYA 4Y1ZA 2Q1ZB 3ZN4A 1FXZA 4BIFA 2I74A 5CIRA 3ZFFB 4YVSB 4L97A 1PGSA 1WW6A 2YMZA 1BVVA 2XVGA 1TQ5A 2OW4A 2X5IC 2DF7A 4XTPA 2WNUC 2IWGB 1XU2A 3OY8B 1N1TA 1X82A 4DB5A 1GSLA 3AZVA 3LGRA 3VBRC 1PNFA 4XE9A 1UPIA 2QDNA 2VMIA 2GU9A 3VZLA 4HVOA 4QPYA 1AVBA 1GKBA 3EJKA 3WP5A 1DGLA 3KCYA 5KHJA 3QLQA 3I8TA 4L2NA 5JSOA 3AZZA 2WC2A 3H3ZA 4CDQC 1G9AA 1W6MB 1ZNPA 4GULA 4F3JA 4ES9A 4K20A 1BBT3 3PVBB 4META 4N9HA 5BNQA 1WW4A 2IXHA 4YGDA 3UJQA 3MICA 5LRSA 1MEC3 4JVAA 2JG9C 3I7DA 5DUXA 4HK9A 4FPFA 4JGZC 4CRQA 3KGLA 4I0WB 1HW5A 4QQ2A 3U11A 4QXKA 1NE4A 3CF6E 3NAPA 1WLCA 5H9RA 1WW5A 2RM22 1QHDA 3FC0A 2JJ6A 1PO13 3A4UA 2C9AA 3LAGA 5JMCA 4N53B 3WW2A 2YYOA 4R9CA 1DZTA 3H1YA 2VGDA 4K9SA 3ZFGB 4U36A 3R6SA 2NMOA 1W2UA 4KWLA 1QJY2 1D0GA 3KM5A 4K7JA 1ENRA 1ZBE2 1AXKA 3APBA 1FOD3 3UKNA 4NHLA 4DPNA 5J36A 1LHNA 2IXCA 3FBYA 1ZZCA 2C1FA 5I8TA 4Q4Y3 5H9SA 1POV1 1QMJA 3PMSA 2Q8OA 1RC6A 4TSVA 4Q4V3 2ZGOA 2R063 4QGNA 4OHVA 3J9SA 4YG0A 1FOD1 4BYYA 4F7ZA 4XBQA 4LBQD 2MEV3 3TN91 1WCKA 2MNGA 1HX6A 4PJYA 4B7EA 4IV1A 1YWKA 4QX5A 1ULDA 4H55A 1QNWA 3ETQA 3VL8A 5J7MA 3VHNA 2XLAA 4RQPB 1IHMA 3BPZA 3L2HA 4N43C 3PLQA 3GALA 3HD8B 2PYTA 3N7KA 3WQ1A 1MS5A 1FYUA 5JPNB 4XETA 3O0WA 3WDTA 4HMZA 4D69A 1QH7A 3NV1A 3WDWA 4HETA 5DZEA 5F5QA 2XVLA 4JRLA 4E27A 2E7AA 1RJ7A 2JENA 2VW1A 1D4M1 2UWBA 5J37A 4JGYB 3RQ0A 4GA9A 1SFNA 2BTVC 2PA7A 3G6JB 2Q30A 1W6QB 3KZ4C 4Y1UA 1G8WA 3VLBB 1EPWA 4HBNA 1J59A 1BK1A 2I45A 1QOOA 4YZ4A 5EYXA 3RMXA 3BODA 3VBRB 5JOWA 4QQLA 4KG8A 4CZSA 4A7ZA 4OI2A 1REFA 3ES4A 4MSVA 1OI6A 1VBB1 1POV0 4PLOA 4Y26A 4A7YA 2A7AA 1ND2A 4ZKTB 3SH5A 5CVRA 4EJRA 3B01A 4CDUA 4LO5B 4AI0A 2VOWA 2P3KA 1X36A 1YYNA 4JDNA 2IXJA 4Q0UA 1PGL2 4FBFA 4CDWB 1CAVB 4AI8A 2XL7A 2QE3A 5F6LB 5BV6A 3I54A 3LSDA 1XNKA 2DFCA 3RDIA 3CL1A 4CP1A 2EALA 2YV8A 4E4ZA 4OI0A 3VZNA 3ZYPA 4BPZA 2VNGA 3VBFC 2X8KA 4GB33 1CONA 2VOVA 2FHRA 1C8M1 4XQDA 3M70A 4L8QA 2GDFA 2A75A 3DL3A 2R041 3O0XA 4XIOA 2VOXA 2E6VA 1VBB2 1HXS2 4B7KA 3ILNA 5C4WA 1BEV3 1UN1A 4ZXKA 4JGYC 4LR4A 1HIXA 3PVOA 1CJPA 5E88A 1H8TA 4GMP3 1PGW1 3JBG3 5IUQA 4P9XA 5AVAA 3AP7A 2B45X 1WMEA 1AL21 1W39A 3NVCA 4ASMB 3AP5A 5E89A 3EHKA 1AYN2 3BCWA 3CJIC 4WZFA 3RJRA 1RHI1 1DHKB 4Z8BA 2LALA 2V5YA 2JX9A 3POWA 4YFWA 1LOBA 3O5SA 1GNZA 2XL9A 4C1WA 1BMV1 5I93A 4WM8C 4XQ4A 1SBDA 1Z7S2 3LOBA 2VUAA 2R0FA 2RR13 2ZZJA 1V9U1 5BXXA 2K0GA 2ZHKA 2PTMA 1W6NB 4G4FA 4KH9A 4FXKB 2KA3A 1LULA 1AXZA 1AL0G 3BALA 2A71A 1IS6A 4GXLA 2ZGRA 1CR7A 3VGIA 5FCCA 3ZSLA 4AG4A 5FOBB 2PHFA 3WG4A 1AR62 4RR3C 2BNNA 4P14A 3SH3A 3ZYRA 4G9SB 3C2UA 3SXWA 4P9IA 3RMYA 2D6PA 1DQ0A 5ABJC 1CAXA 3OBTA 1RIRA 2XJPA 1DG6A 3TOJA 5BPXA 2B39A 1CAWB 2VVFA 2ZKLA 4R4XA 4EN8B 3WG2A 2D44A 4C0HA 1IQAA 3AX4A 4FPYA 3ZXKA 1VP6A 2CNAA 2UWCA 1CQ9A 5HCBA 4MGIE 1S1AA 3GF6A 2AREA 4D3WA 5I0UA 5K9YA 1PIV2 1Y43B 2ZX2A 4LUKA 1VRH1 4BOWA 2D43A 4AFMA 3TBDA 4Y24A 5F6KA 1FT9A 1Z7S1 1QDOA 1UU4A 1LKNA 2EAKA 3ZMNA 1EPZA 1LGNA 3C3VA 1JW6A 5JDBA 2GSYA 3FLTA 4Q4X3 5DUVA 4JRAA 4OHXA 2QQPA 3KT7A 3ECQA 1TMF2 2RR12 1EYBA 1YXWA 2RS31 5L7OB 1S0GA 1Z7S3 4TWTA 1G86A 3MF9A 5GJ6A 1TNRA 4IV3B 1NLSA 2D40A 1G9BA 1XNBA 2HEWF 3CO2A 2WA3A 4NPRA 4BLJA 2JG8C 1ND3A 3E97A 1F5JA 3MI8A 5E16A 5KC5A 2RS33 4FOVA 1IPKA 1PMIA 1LOFA 1AR82 1SLBA 3AFKA 2WL1A 4K3UA 5GZDA 2NQYA 3AYEA 1HQLA 5BNNA 2E51A 4G3YC 1Z78A 3WUDA 1AR93 1COV2 5SV5A 2VW2A 3MFCA 5BNPA 3AKTA 5C8CB 4FVVA 4XXPA 5K7PA 1NZCA 1LGCA 2ATFA 1H1IA 3EQEA 4IEUA 2CGNA 4LE4A 5HXVA 1CIWA 1DU3D 3NJZA 2V73A 1ND2B 1UIKA 1JUIA 2HWD3 4R9DA 4CEWC 3HAGA 4BZ4A 1XQNA 4Y1YA 3KCCA 3AKRA 1KDKA 4L9BA 4Z82A 1VB2A 5CFDB 2PHDA 1ZREA 1S0FA 3P3PA 3ZXDA 4IEZA 1Q43A 5D8AA 3FZ3A 1Q56A 2R16A 1SLTA 1QJX2 1FI2A 5GZFA 5JWPA 5T50A 3LCPA 4YW3A 1NXD1 1SACA 3JCIA 1V9U3 4DY3A 4DS0A 1RUC3 4GKXA 1URXA 2D5HA 3WW1A 3BB6A 4R9AA 2R32A 2XKOA 3NWKA 1GZCA 2VQAA 3OD4A 5KHKA 1H0BA 5KXCA 3B94A 4IV3C 2QVSB 2EXJA 2WJSA 1ND3B 1RUE1 1O4ZA 4AXOA 4PDWB 5CA6A 3POYA 2ZS6B 3GBGA 2XBO3 3IIAA 2PELA 3WT3A 4MXWA 5J96B 1FPN3 1ASJ1 5EYYA 1DZQA 3BIWE 3R05A 3WX5A 1S0IA 1Q8SA 2ZGTA 3USSA 2X29A 2D3RA 2ZGQA 1H1AA 4N53A 2UY8A 3PHMA 4AEJA 5FDBA 1AYM2 4COVA 1WD4A 5IK5A 4JV4A 4BMEA 1ZRFA 5FO9B 3ZDSA 4PCRA 3ASIA 3ZXEA 2DTWA 1OFSA 2W08A 2R043 4S2HA 5JIAA 4E2GA 4Q4W3 1ZX5A 4GWMA 2JG9A 1MQTA 1ZBA2 3QH7A 3SNMA 1W6NA 5C9AC 5A33B 4LBLA 3VHOA 1JOJA 3ZN6A 2NP0A 3ZXAC 4ISQA 5ACA2 3QCWA 1LGBA 4JQRA 3AK0A 2QFEA 1RINA 1NG0A 3AFGA 3HWJA 4FPHA 3AKSA 1FAYA 4EWEA 3FWEA 3ZX7A 3WNXA 3BTAA 4CDXC 5LK5A 1VR3A 3VUOA 3NV3A 2P3JA 3DN7A 1KS4A 1WMFA 5CU1A 2PHWA 1V70A 1BJQA 1YFXA 2D6MA 1PVXA 3B5LB 2R062 3IPVA 3D5OA 5JAXA 1LTEA 1NLRA 1PHMA 3VZMA 3H7JA 4IEYA 3ZPYA 3ZFEB 5K0UB 4LHLA 4FPCA 5JSRA 3LWCA 4XPVA 4A2UA 1VAKA 1GR3A 5DG1A 4WM7B 4AQTA 4HLTA 4M3CF 2WS93 4M3CE 3VBHA 2AH2A 2K2SA 5LEKA 2AR6A 4ORFA 3JQWA 3QACA 1RUH3 3AMHA 4FPOB 4HKLA 4K1YA 5F1RA 4YZ3A 1H8TB 3AZYA 1D4M3 3EXUA 1ND2C 1SDWA 2I2SA 3MEPA 4OHYA 4TYSA 4KL1A 5A3MA 2DCYA 2WT2A 4XYXA 2A6VA 2HWB3 1MQTC 4H3WA 1KQRA 3OGGA 2PLV3 1PVC3 4FPEA 1HRI1 1N3PA 3FUQA 2DVGA 3EBRA 4Q8LA 1DDLA 1TME1 5T5JA 3WP4A 4AEDC 1EV13 1WBLA 4LEJA 1VBD1 5C9AB 3I4IA 2EVXA 4QQPA 3T1MA 1SEFA 3ZYJB 2QCSB 2WKKA 1GV9A 4YARA 1VLNA 2ENRA 1X33A 4MGZE 2RMU1 1D2QA 2XJVA 2BW8A 1DBNA 4EN9B 2ZX4A 1OA2A 4HPKA 4BQ1A 1K5MC 1O3RA 4RGAA 4I01A 2B7YA 4GB31 4MX3A 1W6QA 1RUI2 1EAH3 1QJU3 4J1WA 1VBC3 1R081 4PIYA 3LA7A 4XJ9A 5FAXA 1LOGA 2YXSA 4AGVA 1RGSA 4JAAA 5JR7B 1TNFA 3FE5A 5K0UC 4D7TA 3CEWA 1ZZBA 2VXRA 4IEOA 4YM1A 1JBCA 4WVWA 4W6XA 3WZ1A 2DCZA 3V0AA 5CG8A 1LJ7A 1LHWA 1O4YA 2VNRA 3M3CA 3M8LA 2XH6A 1H9PA 4LO6B 1H2MA 4XIKA 1O7FA 1N1YA 1SMVA 2HWF1 2WZR1 4LBNA 5E8AA 2HWD1 2W52A 5KXEA 1RUJ2 4WZCA 1BCXA 2JXAA 5J09A 1H8TC 3N7JA 4IV1C 1KS5A 4Z92B 5FLIA 2H0BA 1UKRA 4PIZA 4Q4V1 1A3KA 4M3CA 1C5IA 4N7UA 4LUMA 4FPLA 5EXOA 3PTYA 1GNHA 3S30A 3TB0A 1NCQA 5AVPA 5JOXA 4IEPA 4XJAA 3CJIA 1V6JA 3KGZA 2CTVA 4Y20A 4CDWC 3QH6A 4H7MA 5D8AC 3V0BB 1IS4A 2PAKA 4LE3A 2HJIA 2JG8B 1VAVA 3LSEA 1RUE2 5FO7B 3RI8A 3MDPA 4RHV2 4GQ7A 1RMU3 4KWJA 3V56A 3VBHB 5HI0A 2ZHLA 3AYAA 3IWZA 2D6NA 4MGKE 4O9GA 4PDWA 4C0BA 2RMU3 1DFQA 2B42B 4FOYA 3JD72 1AZDA 4YGBA 3ST7A 1MZ5A 3N3HA 1RUNA 4URTA 2Z79A 3S7EA 5GLVA 4NWWA 5FQ0A 5K0UA 2GAUA 2ZGLA 2E7TA 2IXIA 2GNBA 1U5ZA 3SCHA 1YLLA 4LO4B 4CDUC 1OQEA 5BNOC 1ONAA 1FV2A 2WNEA 3NO8A 4YM2A 3VDDA 4MLOA 1AJKA 3JB8A 3MIBA 1Q8QA 3V64A 1X8MA 3SLIA 4XFFA 1W0OA 1N3OA 1R1A3 3N35A 5CFDA 1QQP3 2LTNA 4ONUA 1FMD2 1ZBA1 5FTTC 3V0AB 3UJOA 3MLKA 1G9CA 2AZ5A 2AGSA 2NYYA 3JB4C 2JKBA 2RS12 1H1MA 3NAPB 4DINB 2D6LX 2XWBB 1U12A 4RHV1 1NY71 2QZ2A 1IS5A 1LRHA 3J4UH 4P9JA 3VL9A 2WFPA 4AGGA 3WD5A 4QGLA 2VQ0A 1VALA 1RUF2 1UL9A 2A6WA 1O5UA 5IK7A 1AR72 2XJTA 2BBVA 4FTSA 1QGLA 2BYVE 1SQ4A 1KDMA 4V1PA 4YM0A 4I2OA 1R1A1 3M3OA 1FNZA 1SLCA 3V65A 3VBFB 2ZJCA 4YW2A 3SH4A 1RVF2 3JZVA 5I0RA 2OYZA 5CNAA 2D6OX 1F2NA 2PHLA 3MF6A 4AYUA 1AUYA 1H2LA 5JZGC 3J8F2 1MS0A 2ET7A 1G9FA 2RM21 3AJZA 4K1ZA 4RGGA 3S7IA 1RHI2 3VKNA 3MIFA 5BNOB 1R093 1RTVA 4K8FA 4XILA 1XE7A 4AI1A 1LEMA 3K48A 1SLAA 1REEA 1T6GC 5GLZA 3AXEA 3H7YA 3VKOA 3OY8A 5LEJA 3IKWA 4Z07A 2BFUS 1NY72 3ILFA 5CFDC 1F31A 2ETEA 3NSTA 2ZAAA 3SHRA 3ZXLA 3QD6A 4CDWA 1ZRCA 3KD4A 2Y26A 4AHZA 4XBLA 3ZSEA 4BMBA 4YG3A 4Q0VA 1N47A 3RYKA 4I0AA 1YNAA 3WDXA 1HKDA 2E63A 4JTOA 1HRI2 4QD2A 1UW8A 2DTYA 1TME2 2ZMLA 1CESA 3PNAA 3USUA 4B4QA 1YO8A 3AXDA 1H8VA 2GMMA 1HRV3 1VBD2 3ZXGA 2GC2A 1PK6B 4FQ4A 5H9PA 3IDBB 4TLFA 3WQ7A 1QOSA 1YI9A 4BCUA 4AEKA 4LA2A 1WMDA 4KG0A 3WG1A 2Y38A 3MW4A 2SBAA 2Z2SB 4DXZA 5H9QA 3ZFEC 2IXLA 3VDDB 4B29A 1AJOA 4EWAA 1HV1A 5ABJB 4FP3A 2WZPP 3PMEA 2NN8A 4BE3A 1G9DA 5BNNB 2ZCWA 1YCIA 4HN0A 1PO23 1ZVFA 1KJRA 5FQ0B 4XW3A 1R082 1WGPA 4Z1VA 1SLLA 3B02A 2CYFA 2ZBJA 3MFAA 3ZIXA 2GH2A 1OOPB 4XF4A 2Z69A 3AP9A 4LHNA 5CBLA 1IS3A 1PO22 2A70A 4P9WA 1OFNA 1WD3A 1R091 3WP3A 5FLHA 3OBRA 1X50A 1C4RA 4HN1A 3ZFGC 1VBE2 3M4FA 1IZ3A 1QKQA 2D3SA 5GZEA 1AL23 2VG9A 4YGCA 5CFCA 2HWF3 2WZR3 4YLZA 1PIV1 1NA1A 1Q5OA 2EA7A 3ME2A 4XF0A 2HWC2 3RSJA 1Y7BA 3MIEA 4Z2WA 3B3QE 3RRDA 3CNAA 2OA2A 4UXAA 1ASJ3 1C8NA 3VHRA 4HZFA 1BYHA 5DDJ1 1YRZA 2YGLA 5JOYA 2VMGA 2VUJA 2LM3A 1HRV2 2JEMA 1PVC1 4Y5Z0 2JG8A 1TME3 1QJY1 4SLIA 1HRI3 1XYPA 2ZHMA 1RUG3 3WUCA 5FFOC 1W6PB 1FV3A 2RS52 3CLPA 4GMP1 4NHMA 3HN1A 1CAWA 1O91A 1H30A 4AVSA 2ZGSA 3AKPA 2NMNA 1RUD2 4AQSA 3ACLA 1VIWB 5FMOL 4B8EA 3VHPA 3WDYA 5A3LA 3AMPA 3VBOB 4C1XA 1DQ6A 1F5FA 2YROA 3OYWA 3P3NA 5C6CA 2WNUB 1COV1 4CDUB 3E5UA 2Q4SA 4XMAA 4CYDA 4LBQA 3ES1A 5DG2A 2ZHNA 4GIQA 5GZCA 3FLRA 4H14A 2GH8A 3POSA 2P3IA 2V09A 3TN93 3IM0A 2R1BA 3H3UA 2QJVA 2CGOA 3MW3A 2OVUA 4YSFA 2DVBA 3URFA 1S0EA 2DU1A 5KXBA 3AZXA 1MZEA 1B35B 1CAUA 3OCPA 5JZGA 1UX6A 3O12A 2FMYA 1NCRB 2O8OA 1C1LA 1DGRN 3R4SA 4AEDA 3WR0A 3OGJA 5BNPB 4COYA 5T5OA 1K5MA 2DWRA 4PQ9A 1YJKA 4HPKB 4R8HA 1KFUL 1YFYA 4IETA 4AK3A 3N7MA 4EV0A 2WA4A 4DRVA 2RS13 1FNYA 4B3NA 3AZWA 3I2DA 5GLUA 1JUHA 3T2TA 1GZWB 5FLJA 5JIUA 4XFCA 2WLQA 3GBFA 4XF1A 2XB6C 2DCTA 2DFBA 2EXIA 4N43B 1WLWA 1LHOA 4IERA 2XGXA 4IQPA 4XHXA 3B93A 2UY9A 1R1A2 3INAA 1KXGA 4MXVA 4KNCA 1GANA 3D4KA 5GLTA 3EO6A 1Y9QA 4JTNA 1OA4A 3HMYA 4GALA 2GNTA 2KM2A 3L9JT 4P9YA 4RD7A 1ZA4A 4HL0A 2IFRA 1CX4A 1EV11 4YZ1A 5A32A 2N7GA 1U5XA 3S0MA 3KT4A 3LA3A 1A78A 3WP6A 4J1XA 1DQ4A 1HLCA 2R073 2R1DA 5HCFA 1ZM1A 1MVQA 4XFIA 1I5ZA 4QPGA 4XEZA 5FO8B 2PQQA 4AVAA 1RMU2 4S2GA 2R0HA 1HQWA 5T3NA 1OPMA 4FQZA 5EZWA 1KJLA 4N7IA 1MS4A 4NO4A 1YHFA 3M7AA 4DRRA 3U10A 3H8UA 5SV8A 4Q8KA 2BQPA 4XFBA 1J1TA 2HWE1 2EXHA 2BPA2 1EAH1 1QJU1 4Q0SA 5I0TA 3KLSA 2A6XA 3N7LA 3IMNA 4FOWA 1VBA2 1QQP1 4OI4A 1EY2A 4L92A 2O1QA 4AFAA 4GH4B 1BXHA 1CGPA 1NE6A 1V6OA 4GKYA 3AP6A 4LHKA 4L99A 3O7OA 2JG9B 4KWKA 1FPN1 1YI7A 2E53A 3GBWA 3AMMA 4RR3B 2H6CA 4QPIB 2ZGPA 3KMHA 3RNSA 4CDQA 4NN0A 2ZGKA 1IKQA 2ZGMA 2GALA 2GN7A 3M3QA 1TEIA 2W68A 1W6MA 1I3HA 3D6EA 4FCAA 2JE9A 1N3QA 2ILMA 4DFSA 4P5HA 3ZSKA 2YPJA 3AB0A 1OOPC 4I30A 4BHPA 4YYOA 1IOAA 2XWJB <