5DDJ2

Crystal structure of recombinant foot-and-mouth-disease virus o1m-s2093y empty capsid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
210
structure length
210
Chain Sequence
b'LLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVAQAERFFKTHLFDWVTSDPFGRCHLLELPTDHKGVYGYLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNSEGAPQIKVYANIAPTNVHVAGEFPSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Foot and mouth disease virus, VP1
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type o
molecule tags Virus
total genus 25
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ddj200
2FZ1A 3JB4C 1D4M1 4Q4Y3 1TMF2 1ZBA1 5AC93 5J98B 2HWE3 1QJX2 1BBT2 1AR71 4CDWC 1RUH2 2R042 3VBSC 3JBG2 4SBVA 1FOD1 1D4M2 3VBRA 4AEDB 5C4WB 4WM8B 4Q4Y1 1RUJ3 2QQPA 5AC91 1RVF2 3VBFC 3DPRB 1AYM3 3VBHA 1FOD2 4AEDC 5C4WC 2VQ0A 1QQP3 1AYN3 4IV3B 1MEC2 4WM8C 1AL0G 1AR93 1ZBE3 5AC92 3CJIB 3DPRC 4N43A 2HWE2 1RUJ1 5BNPB 1POV3 4IV3C 3VBOB 1AYM1 1B35A 1BEV2 3NAPB 1X33A 1FPN3 1AYN1 2HWD2 5A32B 1AR91 1ZBE1 3FBMA 1RUJ2 2WFF3 3VBOC 5K0UA 4GMP3 3NAPC 1POV1 4GB31 2BUKA 1QQP2 1AYN2 4RS5A 1AR92 1ZBE2 3VBRB 5FMOL 1VB2A 1VBD1 1VBC3 4N53A 2WFF1 1GFF2 2RM23 4GMP1 4FTEA 1BMV2 2ZTNA 1CD3G 3VBHB 3VBRC 1QJY1 1FPN2 5FMOS 5LK7B 2TBVA 3LOBA 2BBVA 1RUE1 1PO13 2WFF2 1VBC1 5C4WA 4N43B 2MEV2 4YVWA 3VBHC 4Q4X3 2RM21 3VDDA 1C8NA 2XPJA 4FTBA 1B35B 1R1A3 3DPRA 4CDUB 2XBO3 4CDXA 4QPIA 1TME1 4N43C 4IV3A 1SMVA 1VBC2 1PO11 3HAGA 2RM22 1A6CA 2DF7A 5K0UB 1B35C 3CJIA 4CDUC 4Q4X1 4QPGA 5BNPA 1AR73 1R1A1 4RS5B 3NAPA 1NOVA 2XBO1 1VBE3 1E57A 5K0UC 3IDEA 1EAH3 1VBB1 4LLFA 4N53B 1MQTA 5CFDA 4YVSA 5FOJB 3J8F1 1PVC3 4RS5C 1R1A2 4Q4V1 2XBO2 2RS33 1QJU3 2GSYA 5JZGB 4N53C 1VBE1 4RQPA 4WM7A 1EAH1 1ZBA2 2R063 4YVWB 1PGL1 1WCDJ 3VDDB 1AR72 4RR3A 1PVC1 1EV13 1ND3B 2IZWA 2RS31 1QJU1 1VBE2 4CDXB 4QPIB 3S6PA 1RUG3 4YVWC 1EAH2 1NA1A 3VDDC 4Q4Y2 1PGL2 2R073 1HRI3 2R061 1PVC2 1ND3C 5ACA1 4QPGB 4CDXC 1QJU2 4QPIC 1AR83 1EV11 2BPA2 4GB33 4PDWA 4CDUA 3M8LA 4BCUA 1RUG1 1OOPA 3CJIC 2R062 4QPGC 5BNPC 4EJRA 1MQTB 2R071 1VBD3 1NY71 4YVSB 5CFDB 1RUI1 1R093 1PO23 1HRI1 4Y5Z0 1EV12 2BFUL 3VBUA 2RMU3 1AYM2 1AR81 4GH4A 1QJY3 4JGZA 1RUG2 1MQTC 5CFDC 4YVSC 4RQPB 5GKAC 1HQNA 2R072 1NY72 1RUE3 4WM7B 1HRI2 2BFUS 5C9AA 2WZR1 5BNOA 1R091 1PO21 1AR82 4RR3B 4CDQB 4FTSA 4GB32 2RMU1 1RUD3 4RQPC 2X5IA 4WM7C 5DDJ1 4NWVA 5JZGA 4Q4W3 1NA1B 1AUYA 1TME3 1VBD2 2HWC3 1R092 1VRH3 1PO22 2WLPA 2RR13 1AR63 4RR3C 4CDQC 2RMU2 1X36A 1PIV3 2PLV1 1QJY2 2WWSA 1RUD1 1NA1C 1ND3A 4PDWB 3ZFEB 1NCQA 1RUE2 4JGYB 1OOPB 4GMP0 4Q4W1 4Z92B 2HWC1 1VRH1 1FMD3 1RHI3 1VBB3 1AR61 1Z7S1 2RR11 2ZZQA 2FZ2A 1K5MA 1PGW1 1RUD2 1VB4A 4PDWC 3VBUB 1F8VA 3J8F3 3JD73 1PIV1 3ZFEC 4Q4V3 2RS13 1ND2A 4GH4B 1OOPC 4JGZB 4Q4W2 1TME2 1HRV1 2HWC2 1VRH2 1PO12 2RR12 2RS53 2HWB1 3JB8A 5CFCB 3VBUC 5C9AB 2ZAHA 1PGW2 1FMD1 1RHI1 3JBG3 5BNOB 4Q4X2 4GH4C 1VAKA 5C8CA 4JGZC 3JD71 2X5IB 2RS11 3TN93 5CFCC 4FSJA 5C9AC 1R083 5BNOC 1FMD2 1RHI2 1RVF3 1VBB2 1BBT1 2RS51 4CDWB 3JBG1 3J8F2 2X5IC 1IHMA 3VBSB 3JD72 1MEC3 4Q4V2 4CEWA 2RS12 5ACA3 5JZGC 4CDQA 1C8M3 3TN91 1NCQB 2RS52 4CEYA 1R081 5L7OA 1F2NA 1RVF1 1H8TA 3VBFB 1BEV3 1RUI3 1K5MB 1MEC1 1ASJ3 3TN92 4IV1A 1NCQC 2HWD3 1ND2B 2RS32 1C8M1 1R082 3ZFGA 1DDLA 2HWE1 2Y26A 3ZFEA 4JGYA 1K5MC 3ZFFB 2WZR3 5ACA2 1BEV1 1ND2C 5C8CB 1V9U3 1C8M2 1ASJ1 1OPOA 2WS93 2HWD1 1RUF3 5D8AB 2HWF3 5DDJ3 3ZFFC 5A33B 5C8CC 1NCRA 1RUI2 5BNNA 1AL23 5CFCA 5ABJB 1QQP1 1ASJ2 5D8AC 4CEWB 1V9U1 2PLV3 2WS91 1RUF1 2HWF1 2MEV3 1HXS3 4CEYB 5L7OB 5ABJC 2WZR2 1COV3 1H8TB 4CEWC 1BMV1 1POV0 1AL21 1Z7S3 1FPN1 1V9U2 4CDWA 2WS92 1RUF2 4IV1B 3VBSA 2HWF2 4CEYC 5L7OC 5DDJ2 3ZFGB 1H8TC 2MEV1 1HRV3 1HXS1 1RB8G 1QJZA 1HX6A 1OHFA 1VBA3 1AL22 1COV1 2HWB3 4IV1C 4NWWA 4Y4YA 1CJDA 3VBFA 3ZFGC 1RMU3 2PLV2 1RUC3 4RHV3 4AEDA 4WM8A 4JGYC 1HXS2 1NG0A 5J96B 4RFT0 1TMF3 1COV2 2GH8A 1VBA1 1NCRB 1Z7S2 1QJX3 1AR62 5BNNB 1BBT3 3ZXAC 1M06G 1RUH3 2R043 3ZFFA 1PIV2 1RMU1 1RUC1 1D4M3 4RHV1 1HRV2 1ZBA3 1NCRC 5D8AA 1VBA2 5BNNC 1W39A 1TMF1 2HWB2 5A33A 1QJX1 3VBOA 1RMU2 1RUC2 1RUH1 1FOD3 2R041 5ABJA 4RHV2 5A32A
chains in the Genus database with same CATH superfamily
2UYAA 4MGTA 4XDPA 2AEYA 1TMF2 1UZVA 2ORZA 1ZBA1 1PM7A 2XDVA 3ZVXA 1UMHA 5IJRA 5LRRA 2W1QA 3WXPA 3ZKYA 5AC93 1OA3A 2ZX0A 2Z4FA 3UGGA 3BUCA 1S0GA 1AR71 4RL7A 5ANQA 1GZCA 2EVXA 2WZEA 2JG8A 3KGZA 4HZFA 3WW4A 2BGPA 3AVSA 3JBG2 3N7JA 4JDOA 1JOBA 4UW6A 4NHKA 2QBXA 1GV9A 3ECQA 1C4RA 4RA0A 4PJYA 1S2BA 3PTRB 1LHOA 1QH7A 3VBRA 1VMJA 1U5ZA 5I91A 4CXYA 2DTWA 1YQ5A 2G1MA 2DVGA 2XGXA 2Y64A 3DXTA 4IEWA 1IQDC 4NOTA 5J09A 3O1SA 3O1UA 1GLHA 4IEYA 1KEXA 3IPVB 5LRSA 1UF2C 4ARXA 1RVF2 4NE9A 3RI8A 1G9BA 2ARAA 4TXWA 2BGCA 3MLJA 2VXJA 3VBHA 3OD4A 4A41A 1DG6A 5G05L 5FZMA 2PFWA 4XDOA 5C4WC 2VQ0A 3DL3A 1QQP3 1MEC2 1OSGA 3U4SA 1W6NA 3LGRA 2KA3A 1AR93 2EF6A 3BYWA 1ZBE3 4LJHA 2V09A 3NKTA 1W6PB 3LFIA 5GLVA 2Z5WA 3LAGA 2CAVA 3IIAA 3L9JT 4M3CF 5AC92 5L36A 5EPAA 2VGDA 1X9TA 2Y6HA 1E5RA 1RUJ1 4XMIA 3E1F1 4LK6A 5FYUA 3WDVA 1QOSA 5C3SA 1RC6A 3EMRA 4K1YA 2FHRA 4XF0A 4LNVA 3S30A 3OUHA 4IV3C 4CYDA 5EIYB 1ZA4A 3S57A 1B35A 5DAVA 3ZXKA 1X33A 3WP6A 2Q5TA 3USUA 4E8DA 2YC4A 5KHHA 5IK8A 5T5JA 5A32B 4W6YA 1DLCA 1MS3A 4FAGA 2W9XA 3ZKUA 2IXIA 3PU8A 3MFCA 3FBYA 1MS8A 2QCSB 4TN7A 4XOGA 3OJBA 4BJ0A 5KHKA 2WFF3 5BYNA 4XJZA 3SKJE 1W8HA 3WX5A 3NAPC 3ALQA 4QWNA 2IUWA 3BOWA 2E6VA 5JMOA 3MW4A 1MS9A 4ASKA 4CUAA 4GB31 4CE8A 1QQP2 1OH4A 1MZ5A 2WINB 2P1BA 2QQJA 2P4EA 4LBOA 3LA7A 2VG9A 3RYRA 1AR92 4XVHA 1HB2A 1ZBE2 3SXWA 1WA4A 4IGQA 3A7QA 2VZ1A 1W2OA 1GU3A 2J1VA 2XWJB 5FMOL 5JI7A 3SLIA 2B46X 2A1XA 2VZQA 1VB2A 3N9NA 1JYVA 1VBC3 4NHXA 5CG8A 1JU4A 1JUHA 2BYVE 2E7AA 4XYXA 3B01A 1GFF2 1N3OA 1RJ7A 3AB0A 4HVOA 4EROA 1KS4A 2DUOA 2W1UA 4GULA 1ZREA 3ABZA 3WG2A 5CU1A 5A3WA 1UPSA 1IG3A 1V00A 3NJYA 1VR3A 1W90A 1ZNPA 2EIDA 1XPWA 2WR9A 1BCXA 3J4UH 5J37A 4K6BA 4EQVA 2VTXJ 3WEZA 3A22A 3E5UA 1ZZ8A 2WFF2 3I2GA 4LXLA 1XU1A 5DAQA 1XSRA 1JZ2A 3P3PA 2WSUA 4S2GA 4YVWA 5CG9A 4Q4X3 2RM21 4EZ4A 5A3UA 2PHDA 2XPJA 4KG8A 1SLIA 4YW2A 3BALA 1Y9MA 4OHVA 2JDZA 3A0NA 3AL5A 1H6XA 3AM2A 2DURA 4LBLA 5LA2A 4LUKA 1EPWA 3CNAA 4N43C 3DYMA 2GNMA 1GSLA 4S2DA 1VBC2 5CB7A 1MS4A 1U12A 4M01A 4AXOA 4GD4A 1PO11 2UU8A 3HAGA 5K9YA 5LA9A 1A6CA 4GWMA 4MGYE 2DF7A 1ZRDA 4PLOA 1PM4A 1Q56A 2HEWF 3OB8A 1OF3A 4KQ7A 5HI0A 3BGAA 2E7TA 4LEJA 2VMEA 5F37A 1AR73 1NQJA 2JB4A 5D1IA 3IMMA 1BHGA 5FZBA 4XUNA 2W2IA 3WQ1A 1WCKA 2Z2SB 4ET7A 3ITQA 4DPNA 5C33A 5FPUA 4Z1VA 4Q0PA 2XBO1 1MS1A 1VBE3 1OUSA 1E57A 2VQUA 3EHKA 4QXCA 2I2SA 2XOMA 1EAH3 3POIA 4TTGA 1UYPA 4N53B 2ZX3A 1FYUA 3GXUA 3B7MA 1QXPA 3BTZA 5AFEA 4COZA 1H1MA 3J8F1 1YXWA 1UY4A 1ZZCA 2JE8A 2YU1A 4NIHA 3IKWA 4O7XA 2C0ZA 2RS33 3H42B 5JR7B 3W59A 2VH9A 4AVAA 4E2QA 5JZGB 4O61A 4A7ZA 1SFPA 4W8JA 1AX2A 1MPXA 2PA7A 2WNUB 3HQUA 2KR2A 5IHRA 2PHWA 2JKXA 3HJRA 1ZBA2 5GZFA 2GN7A 3V65A 3OBTA 3OOXA 1AR72 1GZ9A 2E32A 4QX5A 3ZYHA 4B4RA 1PVC1 1FXZA 1QIQA 2ZKNA 1Q8QA 4Y22B 4OQ9A 3QOPA 2BVVA 5DUVA 3PUIA 1Q8PA 2VM9A 1VBE2 4MVTA 1WBLA 2D97A 3N4MA 4QPIB 4MHRA 3BPZA 4C0BA 1EAH2 1O5UA 5EYYA 1G6NA 2G9FA 3SEEA 3KT1A 5FPXA 3AZWA 3LWCA 4E27A 1V0AA 1AX0A 3RWNA 3T30A 1XNAA 2R061 1ND3C 1UCXA 4QPGB 5FZOA 4AEKA 3RRDA 4XQWA 1D7PM 3ACFA 2DUPA 1QY4A 1U5IA 4CDXC 2WSVA 1J1TA 3J7HA 1EV11 4DZGA 3O1OA 4GB33 5LA1A 4AL9A 4YZ1A 4LOTA 4A6OA 3M8LA 3AFKA 2ZMNA 3VL8A 3JXSA 4ARYA 1TNRA 2R7EB 4QX3A 2H0VA 2R071 4P9YA 3ACLA 3DECA 2VUAA 2D3RA 4Y5Z0 1L3JA 4E2GA 5FO9B 3LFMA 5KXEA 2ZCWA 2AGSA 4QPYA 3SITA 2ZPXA 3I3MA 4CUGA 3B5LB 5F39A 5IATA 2WA3A 1AR81 2QQKA 2WYFA 1QNWA 3UESA 4JTNA 3ZYGA 1GMMA 2WNVB 2NM1A 1RITA 1UXXX 3DGTA 1WMDA 3FL7A 3K2OA 4NRPA 1HQNA 4YVSC 5T55A 4BQ2A 3P6BA 1IGOA 4JKLA 3WT3A 2DVBA 1QWRA 2VMCA 3ORJA 1WA6X 3LQCA 3LE0A 1WGPA 4P08A 4GB32 3RMYA 4DOUA 1FATA 3HVDA 3WHTA 1JXNA 1SHWB 5FTTC 3URFA 2DBNA 2EXJA 5DDJ1 3FLRA 4UF0A 3T4HB 3JZVA 1F9KA 1NA1B 1CX4A 1EP0A 3KVAA 2XJSA 1VRH3 2DVDA 2WRAA 2XJPA 1AR63 2VVEA 4GZ9A 2RJLA 4RR3C 4AAPA 4PIXA 2C9KA 1ZVFA 2XKOA 3H7YA 3WG3A 5BNQA 4AE2A 2WQZC 5LZ6A 4UW5A 5JXGA 2WWSA 4OHYA 1PVXA 1DQ0A 3ZXEA 1V6KA 1CAXA 4XFBA 4A7YA 1NLSA 4BMBA 4Z92B 1RHI3 1OKOA 1YRZA 5FLJA 1UQXA 1LTEA 5A6QA 5FZIA 1N1YA 4BWOA 3AKRA 4HMZA 1VB4A 2EXHA 4PDWC 5A7WB 5FZGA 2VCBA 3J8F3 1FI2A 3VBUB 5I0DA 3ZFEC 2ZGNA 1QJFA 1PK6A 3LDRA 2WBKA 4GH4B 3ZIXA 1OOPC 3BIWE 3GGLA 1JZ6A 4JGZB 1ENQA 3USSA 2VNRA 1POQA 4QKBA 2WT1A 5M0TA 1W6MA 3SEPA 1VRH2 1PO12 2QZ2A 4FPLA 3ZYBA 2N7GA 1F4HA 1T2XA 1A3KA 4JCKA 3OEBA 5CFCB 3MIEA 1LR5A 1UKRA 1FMD1 5BNOB 2X53S 2XHKA 3O0VA 2JKBA 4CVUA 2VNOA 4WVWA 2RHPA 1NLRA 2A73B 2AREA 4OFGA 4J1XA 4Q1PA 4D94A 3OTFA 2X5IB 4XQDA 5KXDA 4NHMA 5CKMA 5FZ9A 1A78A 3IAPA 4GWNA 4CCDA 4OZXA 5E89A 1PZ8A 1RHI2 1XJAA 3VUOA 2IVIB 2JG9B 4BYYA 4OCTA 2OVUA 5I0UA 4ORFA 3J8F2 4K9SA 1CAVB 1IHMA 5BPXA 1D0GA 3VBSB 5J7MA 4L0PA 3UJQA 5JZGC 1UZWA 4CDQA 2QQOA 4XJAA 4MO3M 3IMNA 3R4SA 3TN91 3I3QA 1O59A 3QCWA 4IDZA 5LBEA 1NCQB 4XCBA 4OI1A 2PHFA 3NKGA 1F2NA 2WABA 4QGLA 4HSJA 1GP5A 1XOYA 4XUPA 2AENA 4YM1A 4PF1A 5I0SA 3O0XA 5IVJA 4R52A 5FPAA 1K5MB 4OUSA 3BPSA 1HQLA 2YU2A 5I8YA 1DFQA 3N9PA 5IK7A 4LBQD 4E4SA 1UOGA 4K8RB 4GJYA 1C8M1 1J1LA 1F4AA 2WNEA 4HL0A 3ZFGA 1NE6A 1DYPA 1OURA 2Q1ZB 5KR7A 3SMHA 3WZ1A 1LHWA 3PTYA 4QGNA 2ZAAA 3KT7A 2FDFA 2TNFA 4CCKA 3KQRA 4AGRA 1BEV1 1ND2C 2W5FA 5IYYA 4JDNA 2Y6JA 3DV8A 3JUUA 1V9U3 2W1SA 3LF7A 4K7JA 3J7NA 4LE3A 5FY7A 2FD8A 1NQDA 2AZ5A 2PHRA 1PGSA 1ULFA 3PVNA 3ZSEA 4D6RA 4TLGA 2YPDA 5DDJ3 1V6OA 3T1LA 1QF3A 3IWZA 3C7EA 4LIUA 5A33B 5C8CC 3AP7A 4URTA 1I6XA 4ISRA 1H4GA 1ODMA 2CAUA 2RV9A 3ZR6A 4F3JA 1S1AA 5CVRA 1KS5A 3L2YA 4NHYA 4BU2A 1S0JA 2RVAA 4AQSA 4CEWB 2F6BA 5A80A 2ZGPA 4YFZA 4D8MA 3C8XA 2IWGB 4Q0UA 2WS91 3KM5A 1SPPA 4M3CA 1UIKA 1OBNA 4EWDA 3OPTA 1CESA 3S7IA 4BIFA 5ABJC 2GNBA 4IEPA 5T50A 2ZEXA 4LKFA 4AI8A 4N9HA 4UW3A 2CL2A 3OY8A 5F3IA 4YM2A 3ZSJA 2Y33A 4FP2A 2GN3A 1V9U2 3B3QE 1LOAA 3PUQA 4CDWA 3W9AA 2BDRA 2BOIA 5BUVA 5KHIA 2D5HA 4BPZA 1N1TA 4ZZ8A 3NNJA 4RYDA 2JG8C 2W68A 4JRLA 1S0BA 5DDJ2 2O8QA 1H8TC 3KHBA 5FREA 2MEV1 3VZNA 1H1IA 3NNMA 2AC1A 1B09A 1O8SA 1G9AA 1HX6A 1VBA3 3FLPA 2OZJA 1JOJA 1LHNA 3CO2A 2D3PA 5FXVA 1SG3A 5I0TA 4QU1A 1HQWA 3VD7A 2E51A 4R9CA 1QH6A 3LSEA 3VBFA 1ULEA 4DXSA 3BTXA 2VZOA 3I3DA 1LGNA 3UKNA 3O1PA 3EO6A 1RMU3 1SACA 1CZSA 4Y1VA 3HOBA 3WW2A 4DB5A 4RHV3 4AFMA 3AVRA 2B7YA 4MGSA 3M70A 4RD7A 1QOTA 1MVQA 3IPVA 4H3WA 2R1BA 5HXVA 1LRHA 1SQ4A 4I01A 4CZSA 2E63A 2HLEA 3AKTA 4D0QA 4YSFA 1NT0A 1Y43B 3ZXAC 1C1FA 4JHTA 4XF4A 4R9AA 2R043 2VW2A 4LBNA 4MGQA 2Y6LA 1DQ2A 3T2OA 2ILMA 3A0KA 5LBFA 5A1AA 2ZXQA 1SLCA 1TNFA 1D4M3 2G19A 4BQYA 2B39A 1ZX5A 4AEMA 1W6PA 3KF5A 4M3CE 5APAA 2ZX1A 1NCRC 3OBZA 1VBA2 4XJWA 1K12A 1W39A 3M3IA 5BNNC 5I93A 3NRUA 4PLMA 1V6JA 3NV4A 5F5QA 1LOFC 5A1LA 1TMF1 1IS4A 5CBLA 2ERFA 1DP0A 3OUIA 4N9IA 2VOTA 5FZ1A 5DN2A 3LEGA 3AYAA 1RMU2 4J6GA 4O9GA 5LEJA 2XJUA 2YFZA 3MEPA 5A1FA 1UY3A 4RHV2 1W3XA 5J48A 1W0OA 2A71A 2VOKA 1I9RA 4BHPA 4A3XA 5A32A 5JOYA 2ET7A 1DLLA 4DIQA 4YARA 1Q8SA 4JHZA 2Y8KA 3T2TA 4DRRA 2FDKA 4UFIA 3ZM8A 5FUPA 2CDOA 2GALA 3NW4A 4CRQA 2OT7A 5HCHA 2QDNA 2G9ZA 2R042 3WW1A 2Q8DA 3VBSC 4GALA 4SBVA 1AXZA 1OXCA 1TZOA 2AACA 2CWMA 1X9PA 3WQBA 2O1QA 2BJSA 4Q8KA 1D4M2 1JS9A 3CIHA 3PVEA 5C4WB 3PIGA 2ZBJA 3KCXA 1RTVA 4UYBA 3WF0A 1O91A 2O0OA 3D0JA 4AOCA 5F1RA 3GBGA 1GP6A 1HB1A 2A3YA 3FFZA 4EN9B 5DAWA 5AC91 4B4QA 4HFSA 3M2MA 4F7ZA 1AYM3 1XRUA 3GNEA 3E6DA 4XIKA 5FQ0B 1XE8A 4AFCA 4AEDC 1IPJA 1NKGA 1XYPA 4DEQA 1AYN3 1IZ3A 4IV3B 4WM8C 5FZCA 4YFWA 1HN1A 2YY1A 1AL0G 3N36A 2QDRA 4R4ZA 5FRAA 1YEWA 3EBRA 4BZ4A 1C5HA 5K4LA 3CJIB 2ZS6B 3ZXLA 3O1RA 1SLAA 4JV4A 1JYIA 2HH9A 3MO4A 4XAAA 1POV3 1NXD1 1UX7A 1OPMA 1O3SA 1REFA 2D6OX 1E5SA 1BEV2 2XL7A 3NAPB 3VKLA 4LUMA 2XLFA 5FYYA 5LEKA 5B4XA 4OI4A 5A70A 1DHKB 1W8TA 3ZN5A 1OQ1A 3D82A 4XZUG 4YPJA 5JOXA 1AR91 4B29A 1ZBE1 1XNKA 2IC1A 3FBMA 3NJXA 3KWVA 3NV3A 3PNAA 3TEXA 1TVGA 2MNGA 5FP8A 1CX1A 3C7OA 2Y34A 4KBBA 3OBRA 5GLUA 4Y20B 3SH4A 1UW8A 3LD8A 1UWWA 2BRTA 1VJ2A 5F6KA 5LB6A 3TNPB 2ZKLA 1AYN2 2CWSA 1HJGA 2GAUA 4QKFA 3MDPA 2VVDA 4G9SB 1WW6A 5EJZB 3RI9A 2XL9A 3D8CA 1CIYA 3E6BA 3ACHA 4Y4RA 1L7LA 4FCAA 2VZUA 4FFIA 3X29B 1JZ4A 2ZA9A 2R32A 5EJ3A 2J1TA 3N3HA 4DS0A 4E4ZA 4N53A 3ZMNA 3VDBA 1BYHA 3OYWB 2WFF1 2AR6A 3MGUA 3WD5A 3HIFA 2A5ZA 3C2UA 2AEZA 3I2DA 2ZTNA 3LEKA 3WNPA 1DBNA 2XWBB 4IEUA 3P1IA 2GP3A 3MIGA 1KFXL 5IFTA 4P14A 4HBNA 3LOBA 1AX1A 3MF9A 4UI9L 4NAOA 2D6MA 4CCJA 1OFNA 2WNUA 4RGGA 4AAXA 2ZHKA 5SV8A 3I3BA 1VBC1 4AK3A 4N43B 2MEV2 2VJXA 1V6LA 2FDGA 4IE0A 1YC61 5BXXA 4LT5A 4NR1A 2NQYA 4URAA 2ZMLA 1C8NA 2HJIA 2J1SA 4GAZA 4W65A 1S55A 3PJYA 3K51A 4LIVA 4Y22A 4FTBA 1UOJA 3DPRA 5DAPA 2K2SA 1KJLA 3O12A 3OF1A 1XSQA 3AMNA 3VHNA 1ULGA 4QPIA 2LS6A 5B2GB 5GZDA 1I3HA 5KHJA 1XE0A 1ZZ9A 2PHUA 3DKWA 1QXRA 3WNXA 2VNGA 1YFXA 4BMEA 5IT6A 1D4VB 3ZYPA 1XB9A 2B9UA 4QD2A 4ASMB 2D93A 1GANA 4IUGA 4Q4X1 4QPGA 5FYHA 3HWJA 1S0EA 3LB9A 5BNPA 4QT6A 4JDMA 1J84A 1VRBA 2GP5A 1K42A 2RJKA 3N9OA 3S5AA 1WLCA 1HB4A 2WQ8A 1US3A 4EZHA 3WF4A 2CNAA 1QDOA 5FYIA 5C7GA 4NPRA 4HG6B 5K0UC 1ZRIA 4JAAA 1UKGA 1VBB1 1O8PA 4MXVA 2WO2A 3PJQA 4B1LA 5FY1A 4Y5SA 2GC3A 4AVVA 3HNMA 4KWUA 2BNNA 2ZZJA 4K21A 1YQCA 4RS5C 1I5ZA 1JMUB 4Q4V1 4DINB 5HV0A 4OYUA 1RYYA 3U14A 1G7YA 1XNBA 2CTVA 5IVBA 3I2FA 3ZOIA 4Q8LA 2WNVA 1V6MA 1UMZA 3AKPA 4QHOA 5LCWL 1JYTA 1VBE1 1OKQA 2NYYA 4QX0A 5FBZA 3N9MA 4LO6B 2NN8A 3T2QA 3PIJA 1EAH1 3ROUA 1L7RA 2BBAA 2BW8A 4OUEA 2ZX2A 2WJSA 2H0BA 4HANA 4NIGA 2VU9A 4BB3A 3TYJA 1A8DA 1NE4A 5F6LB 5JSPA 1VMHA 4YM3A 1ND3B 4XAEA 3V0BA 2IZWA 2RS31 4GKYA 5A3NA 2WLQA 4YG6A 3SH5A 1Q3EA 4CDXB 4HSLA 3GM8A 1RUG3 1JODA 1HJFA 1NA1A 1H2MA 1HIXA 3VDDC 4YW3A 2PHTA 3VLBB 1PGL2 4PIZA 4FO9A 2DUQA 5EWSA 2D5FA 1HRI3 2Q1FA 3WLUA 1WMFA 5FZ8A 3S7EA 4AVCA 3T0BA 4XHXA 3LOIA 2ZACA 4W50A 2VMDA 5IAVA 2B9VA 1WBFA 4AZZA 4KNCA 5L19A 1SLTA 2YBKA 2C1FA 1ULCA 4FOWA 2YFUA 2OUHA 2W92A 3ZYRA 1OC1A 4CDUA 1F15A 5H9RA 5EZWA 3UL2A 2ZGLA 1OD5A 5F3EA 4BXSV 2DCZA 3CJIC 1F35A 3N35A 2WFPA 4ZU5A 1OMIA 4EJRA 1PK6C 1S0CA 2JB8A 4YVSB 5CFDB 3ZPYA 4ZZ5A 4WV8A 4LKEA 3UJOA 5FMDA 1MR5A 5FZ6A 5A7WA 3VBUA 2FDHA 1X50A 2YHJA 1HV0A 3I8TA 4LHNA 5GM0A 3WDXA 1W28A 2JEMA 4GH4A 1OA4A 1WUVA 5BY5A 4JGZA 1RUG2 1UZ0A 3VL9A 1MQTC 1UMIA 3ZN6B 1LNSA 5GKAC 5AVPA 4A42A 2V4AA 1WMXA 3SISA 1MS0A 1DGRN 1HRI2 3TBDA 1N1SA 2GMPA 5CIRA 2WZR1 4FXGB 3ZXFA 5BNOA 3HQRA 3RMXA 5JI9A 1JZ8A 1FAYA 4COUA 4P00B 4RR3B 5FZFA 4EV0A 1D0HA 2F4LA 1RUD3 2JDHA 2CGPA 5FLHA 4RQPC 2X5IA 1YFUA 5C3PA 5I8SA 4WM7C 3V64A 4PT6A 1JHJA 2A3WA 3PUAA 4XEZA 4FI9A 5EV7A 1REEA 4H2AA 4Q4W3 4ZS2A 1Y9QA 3AP4A 3R4DB 2JG9A 3PU3A 4GQ7A 2CY6A 2RR13 4CDQC 5E1RA 3GBWA 1OD3A 3KV4A 5EHDA 2QNKA 3MYXA 3ZDSA 5FO8B 1CAVA 2XR4A 1BVVA 4MUVA 3OEAA 5TSWA 2Y0IA 5JXIA 4QXKA 1YCIA 5A7OA 4BOWA 5LA0A 1ZZ7A 2EA7A 4PDWB 1MZEA 4Q0QA 4LORA 3ZFEB 4XUOA 1NCQA 4PF5A 1Y3TA 4Q26A 1OOPB 1LHUA 2VR4A 3VDAA 1UNBA 1Z78A 2GNDA 5DG1A 1VRH1 1MZ6A 1Z7S1 1NAEA 1VBB3 1AR61 2DVFA 2VZ3A 2YXSA 4KU8A 4WZFA 3GYDA 3FWEA 1K5MA 1RUD2 2QQIA 4F83A 3N7LA 3BI3A 4Q4V3 4CCEA 3JQXA 4HXCA 1MS5A 1YNAA 5HCAA 2XG3A 4CU8A 4Q0SA 1DGRA 3MIBA 4Q4W2 4M00A 1T6GC 1HRV1 3I54A 4XFHA 1VPHA 4AW7A 3SNMA 1W6QA 2RR12 4L2NA 4LO7A 3GDBA 2HWB1 3JB8A 3LPFA 1PX3A 3A4UA 1CR7A 2OQ6A 2ZAHA 3ZR5A 2CV6A 1RHI1 3FFQA 2XLGA 4Q4X2 1VAKA 2E31A 3TAYA 1TG7A 4OHXA 2OS2A 3WINE 3DEMA 3N7MA 4HK9A 5FZAA 4NROA 2I45A 3KSCA 5EFUA 2KXLA 2PYTA 4IESA 2XUMA 2D6PA 5C9AC 1R083 2NMNA 4RGKA 3TEYA 1V70A 3ZX7A 1VBB2 1ZZ6A 2G4IA 4YW6A 1BBT1 3OGSA 2VAUA 4QQLA 2WC2A 5C6CA 2DU1A 2Z79A 4OULA 4OHZA 3ZSLA 3H1YA 4Q4V2 4CEWA 4AHWA 4BA6A 1DZQA 2ZGRA 4W6XA 2DFBA 2GU9A 2D7FA 3HD8B 5FFOC 2G9GA 2BP6A 3VD5A 2VPVA 2EIBA 3Q8FA 3UT0A 3U4XA 2NLRA 1EPZA 1W9SA 2B5HA 4O65A 2B45X 3HN1A 2ATFA 4K40A 1CN1A 1W2AX 3MI8A 3THCA 3W58A 1LOBA 3AP9A 1OQEA 2ADEA 2LM3A 1ASJ3 1GZTA 1FNYA 3GJAA 2HWD3 2W95A 1LEDA 1ND2B 4N8MA 5FXWA 2RS32 3B93A 5EQUA 3U37A 4AF9A 1R082 1L7QA 1BXHA 1FT9A 1CZTA 2XVLA 2HWE1 4V2VA 4UBGA 1GQPA 1KGYA 3WG1A 4JGYA 4CXWA 1JTZX 1W2UA 3THPA 5JXJA 2WZR3 1H30A 4LPLA 1UD1A 2F17A 3LIHA 3QBQA 4BLIA 4CA9A 5C8CB 1QNYA 2JECA 1OPOA 1JHNA 3NJVA 3POYA 1CJPA 5LBCA 1RUF3 4BXFA 1BKZA 2HWF3 1GYKA 2OIIA 4QDSA 3O1TA 4NJ4A 5GJ6A 3EB7A 2A3XA 1LB2A 1IOAA 1PHMA 2VOVA 4MX3A 4XMAA 4H55A 2W46A 1CWPA 4QHBA 4TSVA 3OGVA 2VECA 1AL23 3WOGA 3ZN4A 5ABJB 1ASJ2 2PHXA 3MV11 5LATA 1W06A 2D44A 4YWAA 1GWLA 2GC0A 5F5CA 1V9U1 5FYCA 2BERA 2WUHA 4JKMA 3RDIA 1SLLA 4CP9A 1ACCA 2QE3A 3KV6A 2J42A 2Y0OA 4X8PA 5FPLA 2DBIA 2NMOA 1HXS3 4CCMA 5KC6A 4OQ8A 5F7UA 1U0AA 2RDRA 1HW5A 2JG8B 4AGVA 1RL3A 2VUDA 4CPBA 3POWA 4G4FA 2WZR2 4HK8A 1H8TB 4LBQB 2ET1A 5CAZA 1BMV1 4XF9A 2WT0A 3RZZA 3G6JB 1Z7S3 3NWKA 2TUNA 2JIGA 1FPN1 5T3NA 1ULDA 2W39A 1GOHA 2EXIA 1WD3A 1RUF2 2XXZA 4WVVA 3W5MA 2HWF2 4BE3A 4CEYC 5L7OC 2QTWB 4NPLA 4FOQA 4KH9A 4YNIA 1LENA 5IVCA 4FOYA 1HRV3 1UY1A 3AMMA 1QJZA 5AVAA 4XF3A 4UFJA 5JIAA 1AL22 4PHZA 5DUUA 2HWB3 3MICA 4IV1C 3PVOA 4PI2A 4V2WA 2X05A 3U10A 4MXWB 4M0NA 4I0AA 2OX0A 1RUC3 2C4XA 4FPOB 5F2WA 5IW0A 2KM2A 3HT1A 4XTPA 4OMCA 4FPCA 1JH5A 2JIJA 5FZLA 5F5AA 5CYYA 1HXS2 2ARBA 5KC5A 1W0NA 1R1ZA 4B7EA 3U1XA 5JPMB 1SDDB 2BNMA 2CSGA 2R6QA 1FX5A 2ZGMA 1HV1A 5FMCA 3RZKA 1VBA1 4COYA 1NCRB 1O4ZA 1Z7S2 2AH2A 4QAWA 4CXXA 4D6SA 1BBT3 5BNNB 1AR62 1JZ5A 2ZEYA 5FQ0A 2CGOA 1RUH3 4FFFA 3RJ2X 3R0RA 3VDCA 3ZFFA 3IDCB 4CCOA 1RMU1 2P3KA 3MZHA 1MZFA 2WA4A 3CKHA 4KGGA 4RHV1 4XTMA 4MLOA 5HCBA 1HRV2 1KQRA 1ALYA 1V6NA 3MW2A 3Q8AA 5D8AA 2J22A 1LAJA 5IK4A 5GLZA 2HWB2 2W08A 5FY8A 4ITCA 5FYSA 1F5JA 4D7YA 5JOWA 3POEA 1ODNA 2YYOA 1P8JA 2VVFA 4FP3A 1RUC2 3HNBM 1FNZA 4W6WA 2R041 1FOD3 4DXRA 3DN7A 2WIIB 1R64A 4QB6A 4YZ3A 5FO7B 2DCKA 3FN9A 4XXPA 2FZ1A 5L73A 1D4M1 2GH2A 2VULA 4Q4Y3 3JU9A 5ERLA 3RYKA 4EN7B 5DXDA 5IVVA 4FPGA 4R9BA 5DUWA 5J98B 5LBBA 2HWE3 2CDPA 4AYUA 1BBT2 4Y20A 2D98A 1W2TA 3K3OA 5FYBA 5FWEA 1RUH2 3MIFA 5FP7A 5JWPA 5FWJA 3JQWA 1N47A 2DCYA 2VD7A 3NV2A 5DAXA 2VXRA 4QXBA 4BQ1A 1KDKA 3GJBA 4EWEA 4S2FA 1W03A 2JX9A 4MHUA 3THTA 4AEDB 4WM8B 5JSOA 2I74A 5FJKA 1G9CA 4AWDA 2VUCA 3OYWA 5EYXA 1GQGA 2EIGA 5GZEA 2VC9A 2ES3A 2ZGQA 3BTAA 3PURA 4OLLA 4XDQA 1DZRA 3V0AB 4LMFA 5IVFA 1FOD2 4L9BA 2E9QA 1US2A 5DG2A 3BCWA 1OT5A 1OLMA 4KMQA 2ZGKA 4FFHA 1GZWB 1YI9A 3MPPG 2XJQA 3K4AA 2AUYA 3S0MA 1H8VA 3MUZ1 1STMA 1HLCA 3RNSA 3DPRC 3B02A 4N43A 1U5XA 2HWE2 3AP6A 5FBJA 4Y1YA 4MGKE 3EJKA 4A2UA 2A6ZA 2R16A 3AMQA 5FY0A 4UWDA 4PBOA 4NIIA 1CPMA 5SV5A 1AYM1 2DYCA 3C7FA 4IERA 3ILNA 5FP3A 4QXHA 2X29A 1FPN3 1AYN1 3H3UA 1Q8OA 1RINA 3CU7A 4W4ZA 1W8OA 4GKXA 4ZHNA 4XBNA 2PXJA 2AYHA 3GCWA 3PMEA 4NAMA 1DQ1A 4B1MA 4DXTA 2VCCA 5DQ0A 4H7LA 4IEQA 3VBOC 1C28A 3U0ZA 4GMP3 1POV1 2TEPA 3MF6A 4XCAA 1W9WA 3T2PA 1XYNA 2BUKA 3M3CA 1J3QA 4R9DA 1Q5OA 2D40A 3RJRA 3O7OA 1GKBA 5FZDA 4I09A 2FQPA 4QQOA 4X6RB 1WKYA 1IS6A 2PELA 4E4HA 2BGOA 1UZYA 4QQPA 3C7GA 3Q9OA 1VBD1 2VO5A 4QX1A 2WN3A 4TWTA 4ZXKA 4XFIA 4YYOA 5FP4A 1BMV2 2BU9A 1X8EA 2BQPA 4ZXEA 3LSDA 3VBRC 5LASA 1QJY1 4PQQA 4UXAA 1FPN2 2VL4A 5FLIA 3WNMA 2FMDA 4P02B 1OLME 4HVRA 4IE6A 5LK7B 4XETA 2BZDA 2TBVA 2BBVA 2ZOEB 5CKQA 4MGZE 3VN4A 1Q8VA 3D5OA 3FUOA 4WZCA 3VHRA 4AG4A 4FFGA 3RZHA 3QH7A 3VBHC 1X7NA 2DFCA 4B3NA 2XJRA 3ZXDA 3HBKA 1LEMA 4HVQA 1QHDA 4BLJA 4NRMA 4DQAA 2QVSB 3H9AA 1R1A3 2DCJA 1AZDA 1JZ3A 1NX9A 2Y6KA 2ZABA 3MLKA 1S0IA 4DXZA 3DKQA 4CDXA 1ST8A 3KCYA 1LU1A 1TME1 3NL1A 1SMVA 2ZHMA 1IS5A 1UN1A 5JDBA 3BODA 3BU0A 2UWAA 3ZXGA 5K0UB 1B35C 2W52A 2P34A 2OQ7A 3FLTA 5A7SA 4CDUC 1RGSA 5BV6A 1I5PA 1DGLA 3IBMA 4F8AA 4DUVA 4XW3A 4BM8A 1W05A 3KVBA 2CGNA 3GF6A 4AQTA 4Q29A 3SQOA 5KWRA 1KXGA 4RS5B 5F3GA 2D43A 5B4NA 3KQ4B 4FPYA 3EXUA 2P17A 3ZMOA 3RQ0A 4RSUA 2V5DA 1Z0HA 1PNGA 4LLFA 1BLZA 2F4PA 3GZTB 4YVSA 5CFDA 2R0FA 3BOPA 4Y24A 2WZPP 4S2HA 3AFGA 5FOJB 5F9TA 2W1WA 3T09A 2VZRA 3K48A 3DUIA 1R1A2 3KCCA 2C9AA 3NO8A 3RWKX 4XF1A 3E5QA 3I59B 2BWAA 1QJU3 2QQUA 2GSYA 3UETA 5JIUA 2HYXA 2VTXA 2NPIA 3NNLA 3R4UA 1FV3A 4KWLA 2I07B 3WDWA 4WVMB 3LCPA 1OVPA 5CZKA 5IAXA 3H8RA 1XXNA 2X09A 2YGLA 4C0HA 4AVTA 2A6XA 4PQ9A 2ORXA 2O8OA 1PGL1 3VDDB 1JYNA 4GJZA 4RR3A 1YQ2A 1GNYA 5T5LA 1YQ6A 4BDVB 3KT4A 3LA2A 2ADDA 1IS3A 4HLTA 5C5TA 4XZPA 1W6OB 3BB6A 4XBQA 1CAXB 3VZMA 3D4KA 1V6IA 3D0SA 5JMCA 4AQ2A 2LTNA 4YVWC 1IPSA 1KDMA 5DABA 4JTOA 1YIPA 3N9LA 4UFMA 5FPBA 2WKKA 2OXBA 5H9PA 1GOGA 5F32A 5ACA1 3ETPA 5IWFA 3N7KA 1PK6B 1O3TA 1QJU2 5CFDC 3O5SA 5FXZA 4QB2A 4K1ZA 2BPA2 4QDRA 1QU0A 4AI9A 3K4ZA 3LEMA 4PDWA 2D3SA 3B00A 2P3JA 3KS7A 3UGHA 4BCUA 1O5LA 4QQHA 1RUG1 4ZU4A 1OOPA 4ISQA 3HMYA 2A70A 1YLLA 4BQ4A 1MQTB 1VBD3 1RUI1 1R093 4YM0A 1PO23 1WW7A 1HRI1 2YMZA 3AZZA 4JZRA 1I1EA 1O3RA 2RMU3 2YPJA 1AYM2 3FHQA 3H3LA 2WT2A 4K8FA 5FKBA 2W47A 4LULA 1QJY3 4KGQA 2A6YA 1VMFA 3ST7A 4IETA 4CTEA 2R1DA 5JOZA 2WAOA 5FYTA 4RQPB 5FCCA 1NY72 1LECA 1GP4A 4HN0A 4NMIA 4WM7B 5DZEA 2BFUS 5FYMA 2JJ6A 3KZ4C 1WLDA 4Q5OA 3ENRA 3OPWA 3HBZA 2QQMA 5FY4A 3WG4A 1ENRA 4CDQB 4FTSA 5C3OA 2XONA 1IQAA 2QQLA 1YHFA 1UY0A 2K0GA 5FYVA 4ZPIA 4NWVA 5FP9A 4BQ5A 5JZGA 4AR2A 1BVP1 1XYOA 2CU5A 4QB1A 1TME3 1AUYA 1K45A 2C26A 1VBD2 4XILA 1CAWB 2HWC3 3N9QA 1R092 1KFUL 5EP9A 1PO22 4QX8A 4CP0A 1PMJX 4UAPA 2OZ6A 4N90A 5KXBA 3KLSA 2RMU2 3I2KA 3M7AA 4FOVA 4QKDA 1OH3A 2E53A 2GMEA 1FV2A 1LOCA 1PIV3 1QJY2 1Y9GA 2PLV1 1RUD1 3H1WA 4AI2A 1J59A 4OI2A 2ZHNA 1S2EA 3VHPA 1W9TA 3I2HA 5T52A 2DDUA 4Q4W1 1CIWA 3KV5A 1JW6A 3F2ZA 4NN0A 4EYUA 4QQ2A 1MVEA 4L99A 1QMJA 2IXLA 2RR11 4IE5A 4XJ9A 4Y33A 4AI3A 3OSDA 2ZZQA 3DF0A 4ASLA 2YB7A 3O1VA 3RZLA 4E2SA 1F8VA 1UU4A 1GNHA 3JD73 2ARXA 3W21A 2RS13 1ND2A 3CDZB 5H9SA 4LTAA 2IFWA 2ZGSA 2WAAA 1O7FA 4SLIA 3CJXA 4K20A 1TME2 2E7QA 4QU2A 4U36A 4Q1RA 2HWC2 1HDKA 5C5UA 4DY3A 2VZPA 4IE4A 1W8FA 2RS53 4LA3A 2EAAA 1N1VA 2JDPA 3AYDA 2ZGOA 5C9AB 4KBZA 1PGW2 4AHZA 3JBG3 4LK7A 2IXHA 3ILFA 4CCCA 3H8OA 5FK8A 5C8CA 4LA2A 3VZKA 4XFFA 4H7MA 2VCAA 3IM0A 3K46A 1ONAA 1H2NA 4IEOA 4XFGA 2VMFA 2WYSA 1ZRCA 4ATEA 4JRAA 3PHMA 4CU6A 4FSJA 3SCHA 4PCRA 1YWKA 1G8WA 3JCIA 1RVF3 3RVHA 2WN2A 5C71A 4CCNA 2XUEA 3GHMA 3IZOA 4CDWB 1J58A 3I2JA 4XPVA 3JD72 3HEIA 3VD9A 1MEC3 2ETEA 2RS12 1VP6A 2Y38A 4YGCA 5FZ4A 5ACA3 3TB0A 4AQ6A 1LESA 2BVBA 4P9LA 3RPQA 1AHSA 4A4AA 4KWJA 4LBMA 1F5FA 3R6SA 3TEWA 4OZOA 4QKNA 2B8MA 2J1EA 2RS52 3CMGA 1R081 2JE7A 4LBKA 4QX2A 5A3PA 2WL1A 4HT1T 1O4TA 4QPWA 5D2AA 1H8TA 4LBQA 3VBFB 4QGMA 4AVSA 5JAXA 4D7SA 4UW4A 4XUTA 2P37A 2R30A 4MOAA 1RUI3 4YZ4A 4I2OA 2Q4SA 4NUBA 2RE9A 1LJ7A 2VZSA 3MV01 3PUSA 3H50A 1RIRA 2Q30A 2FDIA 1UU6A 2H6BA 5A7QA 1XNCA 1DDLA 3VV1A 3ZSMA 1WLTA 1O6UA 2VOWA 2Y26A 4J1WA 3AYEA 1ZRFA 2J1RA 3K75B 4JQTA 2V5YA 1NLQA 5LWBA 4JX0A 5ACA2 4MZUA 4MXWA 2IFRA 4DMIA 4Y1UA 1JU3A 1ASJ1 2HWD1 1UX6A 1WWYA 4EN8B 3BIEA 1N3PA 1PNFA 2ZJCA 1DQ4A 1NXMA 2PAMA 3RFRA 2YGMA 3ZFFC 3H8XA 1WCUA 4Q27A 4IE7A 5C3RA 2WDBA 1LKNA 1NCRA 1PZ7A 4LKDA 4WVZA 3CZJA 1RUI2 3E5XA 1J83A 4G3YC 4L97A 5FJHA 4D6QA 1D2SA 5BNNA 4RN5A 5CFCA 1LOFA 1T6BX 5D8AC 2A6VA 2HYKA 4QX7A 1S0DA 4UFLA 4M4PA 5T54A 2D6LX 4UBHA 1W2NA 2WNOA 1J3PA 2PLV3 4QDQA 2JDMA 2JDYA 1RUF1 1ENXA 1VIWB 3RGBA 5EJ1B 2HWF1 4GA9A 2V73A 2VUJA 3FMGA 4IGOA 4A6SA 2HKXA 1YO8A 4COVA 1JZ7A 4Y5TA 4CEYB 5L7OB 3IB3A 2IXJA 2W0XA 2KD7A 3ELNA 3MIHA 3BU7A 1C3HA 1H1AA 1WW4A 4Z82A 1COV3 3AC0A 1RXGA 2FCTA 3LEIA 3UGFA 3RSJA 3WCRA 3WP3A 2XJTA 1AL21 3Q8EA 1BJQA 2LRPA 5A3TA 2QFEA 4IV1B 3VBSA 5F3CA 4YZ2A 5LK5A 3O14A 2DVAA 4EN6B 4HPKB 1IKQA 1SZBA 4QMAA 4LLOA 3UKVA 2LUWA 4BQXA 1EUUA 1HXS1 1RB8G 4YLZA 4M4RA 1EY2A 3M3QA 3AXDA 4B4PA 4K3UA 4XURA 1AF9A 5A3MA 4NWWA 2WO1A 4Y4YA 3WSOA 5KHGA 2QQWA 5F5IA 2BOJA 3E97A 3AP5A 5K7PA 3ZFGC 1UIJA 2PLV2 3THDA 5FPZA 2JE9A 1CZVA 1UYXA 2EXKA 3AKQA 2P2KA 1U5YA 4FPJA 4AEDA 4WM8A 1YUDA 3BVCA 2CHHA 5A3LA 2WWJA 1QKQA 4MH0E 4EWAA 2R0HA 2H6CA 3DXUA 1YFWA 3GCXA 4RFT0 1G86A 3WF2A 2GMMA 1COV2 2WWUA 2JD9A 3I3EA 2GH8A 1LHVA 3V56A 1QJX3 3AXEA 3V0AA 2FDJA 4GIQA 2YC0A 3G7DA 5FPVA 4ONUA 1M06G 3M4FA 4HKWA 2UYBA 2LALA 3HR9A 4XUQA 5CISA 3IIIA 4Y1XA 1GZWA 2SBAA 4PIYA 1RUC1 2UY8A 5A6XA 2Y60A 5GZGA 2W94A 4XJ8A 3WUCA 2J7MA 1UOBA 2OUJA 3IDBB 4IXLA 3RG0A 1ZBA3 4DRVA 3T4VA 3VGIA 4DUWA 4D3WA 3FHAA 1G9FA 1GICA 1DIWA 2HEYF 2YV8A 3EYPA 1GOFA 4FBFA 4CP1A 1JYWA 2V72A 3WW3A 2VY0A 1JI6A 5A33A 3J9SA 1WD4A 3FUQA 4BH9A 1RUH1 3OGJA 3POJA 1SDWA 3ATGA 4GWIA 4HONA 4BIOA 5FY5A 3JB4C 3PDQA 1LGCA 4DUXA 1C1LA 1YQ8A 3FX3A 2VBBA 4KU7A 1H2KA 4DY5A 4E8CA 1J3RA 1DZTA 1GWKA 4FPFA 4AVBA 1QJX2 1BK1A 2BWCA 4CDWC 3UNPA 3E6CC 1W9FA 1GR3A 2YBSA 1FOD1 1YYNA 3UKTA 5A7PA 4ZY9A 2XJVA 4R8HA 3SC7X 1C5IA 4FQ4A 4Q4Y1 2WO7A 4NPMA 3WCSA 1RUJ3 1W8NA 2QQPA 4FAHA 4X8NA 5DPNA 1SFNA 3VBFC 4LHSA 3WNOA 3DPRB 1ZA7A 2DU0A 3C3VA 3ETQA 3H7JA 5GZCA 3PL0A 3WF1A 3J7MA 3PMSA 1UPIA 3MW3A 2K46A 5JPNB 1RUOA 2OPWA 3U07A 3VKNA 3ACGA 3I4IA 1CAUB 5IFPA 3NV1A 1BQPA 1O4YA 4INDA 2EICA 4XACA 5FIXA 5FZKA 3VHOA 3HT2A 2JICA 2YDEA 2VOXA 2ZX4A 3AJZA 3LIGA 3ES1A 5BNPB 1UL9A 2C5DA 1TE1B 3AJYA 1SCSA 4UFHA 3CZUA 3A23A 4M0HA 4Q2FA 3RYPA 3VBOB 5CEHA 3CQOA 3ZXJA 2XMLA 4H14A 4CCLA 5GLWA 4CP2A 4MV2A 3VB9A 3VD3A 4XFAA 2HWD2 5EXOA 2ZMKA 1AJOA 1GQHA 1RUJ2 1UOFA 2VQTA 4ZS3A 3WVJA 3B94A 4FVVA 2Q0AA 5K0UA 1X8MA 1LGBA 2IVJA 4I0WB 4U2AA 1ENSA 3U78A 3AL6A 3DYPA 1W04A 4RS5A 5CA6A 2HBUA 5D21A 4HETA 1HN0A 1JUIA 3VBRB 4HKOA 4YZ5A 5JCTA 2QQNA 2WZ8A 3FHIB 2NP0A 1SLBA 2PHLA 4UT5A 3W20A 3ZIWA 5DMYA 2RM23 4IEXA 4LBJA 4YRDA 2P5BA 3NSTA 5DUXA 3T08A 3WNLA 4GMP1 4NIAA 4E4DX 4FTEA 2X10A 3LDKA 1CD3G 3V0BB 5J3UA 3VBHB 4AFBA 3ASIA 1PMIA 3I59A 5FMOS 1SBFA 5HBAA 4LR4A 4BQ3A 1XQNA 1W6NB 5C3QA 4L92A 3MUY1 5CNAA 2K9ZA 4N7IA 4B8EA 1RUE1 4WVMA 1PO13 1OFSA 2OW4A 2DWRA 2A6WA 1AXKA 1OVSA 4P9GA 4YG3A 4KWKA 4BK4A 5C4WA 1YI7A 1CVNA 5ANNA 5E16A 2MPFA 4LKSA 2DV9A 4JQRA 3VDDA 2JWPA 3MLLA 5KXCA 1W99A 3GZAA 2JD4A 1B35B 4CDUB 3K4DA 3UV9A 1W6OA 3EQEA 4XC9A 3USUB 1CGPA 2XBO3 1G9DA 3WUDA 1LULA 2IXCA 2VQAA 4IV3A 2QQVA 1XNTA 1WMEA 4NHLA 3WDUA 5FDBA 2BEOA 2RM22 2VNVA 3J7LA 4I02A 2BV4A 4J25A 3CJIA 3CEWA 1APNA 4QHZA 1W8UA 1HKDA 3LZZA 2VMHA 3AZVA 2X8KA 3VZLA 2OA2A 4FPHA 3QD6A 1R1A1 1BK0A 1W0PA 3VKOA 3O0WA 4YG0A 3J26N 4MSVA 2UWCA 4CU7A 1F31A 3NAPA 1NOVA 4L8QA 3VZJA 3ZO0B 3ZLIA 4P9WA 4CUCA 3FJSA 4AI0A 3U75A 2Q8EA 3ZYFA 2XB6C 1YJKA 3IDEA 3LPGA 4NIDA 1NZCA 2XQRA 3NJZA 1QGLA 1MQTA 4C91A 1REDA 5HCFA 3POSA 1LU2A 4QM9A 1GWMA 1ULOA 1PVC3 1WCQA 2VBDA 4YGDA 1AJKA 1Y7BA 3UYJA 1DU3D 4AHYA 1Y4WA 2PAKA 1URXA 2FMYA 2XBO2 4BK5A 3T0AA 2QKDA 5FZ3A 1TQ5A 3RZGA 5IVEA 4N53C 1PX4A 2YBPA 4C90A 4JVAA 4RQPA 2PMWB 3I2OA 1A34A 1H6YA 3GHNA 4XABA 2JXAA 5K8SA 4KI5M 4WM7A 5FZHA 3SH3A 3P5BA 2C6SA 1KJRA 2QJVA 2R063 4YVWB 4Z8BA 4CUBA 4LO5B 4KG0A 1WCDJ 4GXLA 1Q43A 3KHCA 1JYXA 5JVVA 2ZGUA 1OA2A 2B4KA 1EV13 1VALA 2GNTA 3WHUA 1X82A 4PBPA 3WNKA 4ZU7A 2WNUC 1QJU1 3SKVA 1RXFA 3QLQA 2P3YA 3H0OA 2RG4A 2B42B 1IG0A 1OQDA 1QEXA 3FE5A 3A21A 3S6PA 3WY6A 3AYCA 5FAXA 4JKKA 2ID4A 1CAWA 4Q4Y2 5FUNA 3UK9A 2R073 2JDAA 2GC2A 3RS6A 1PVC2 2A7AA 3ON7A 2PQQA 4DEVA 2BNOA 3AZYA 3M3EA 4P5YA 3K77A 4QPIC 1AR83 4Z07A 4Z2WA 4N7UA 4XIOA 5C70A 3ZYJB 1NZIA 1W6QB 1QXJA 3INAA 3TRSB 1ZYBA 2Z69A 2R062 2YC2A 4QPGC 5BNPC 5LY1A 5DZFA 1WLWA 1NY71 1W8WA 3CF6E 1UYZA 3ZYIB 2ZHLA 3LDBA 4NVPA 1ZM1A 2RDQA 4KL1A 4XJUA 1EV12 2BFUL 1UYYA 3GBFA 4QM8A 3QH6A 5CADA 2P6CA 1O3QA 1E5IA 4YGEA 4Y26A 5FY9A 2VW0A 1ZZBA 3WDYA 3FZ3A 3TWIA 2JDUA 1H9WA 2VZVA 1H0BA 2ZGTA 4XQ4A 1E5HA 2R072 3I97A 5CKNA 1RUE3 2YZ4A 4R4XA 2QUOA 5C9AA 1RJ8A 1DF0A 2QZ3A 4P9JA 2VCMA 1R091 4AEJA 5HPOA 1PO21 2BTVC 2WO3A 3TEZA 3IDAA 1AR82 3AK0A 5GLTA 3BKZA 2E33A 3BN6A 3VKMA 1A8MA 2RMU1 4TYSA 2WNVC 3MFAA 4A7KA 3AMPA 4AI1A 2ZEWA 4RGAA 4ATFA 5L9BA 4PLNA 2Q1MA 3POFA 1JBCA 5DZGA 5IUQA 5C8WA 1H4HA 5FXXA 3Q8BA 1XNDA 3H3ZA 5G04L 2JDKA 2WLPA 2HEVF 3T1MA 4DO0A 5FZOB 5A6YA 1QDCA 1W3VA 5E88A 1X36A 1W8ZA 2V4VA 4NO4A 4I3GA 1DCSA 4FPEA 1MACA 1LODA 3KGLA 4Q0VA 1NA1C 4CSWA 3OBAA 1ND3A 1VE0A 3L2HA 5JR2A 1RUE2 2FCUA 4JGYB 1KRIA 4AFAA 4GMP0 4AGGA 3RZJA 4B7KA 4IL7A 2HWC1 2L9LA 1GBGA 4XFCA 1PZ9A 1UY2A 2LROA 1IKPA 1FMD3 5J36A 4DFSA 1D2QA 3AKSA 2E26A 5I8TA 4L11A 2FZ2A 1PGW1 1S2KA 3APBA 4OHWA 1HB3A 4YGBA 5E8AA 1YIFA 4A44A 3SCFA 3PVBB 1PIV1 5FKCA 5KBFA 4EN0A 2CYFA 3GZUC 1DGWX 3MPBA 2C24A 3SCGA 4HOOA 5LW9A 2NZ9A 5JSRA 4ZONA 2O14A 1AVBA 1XBFA 1M4WA 2EAKA 4E9KA 1VLNA 1S4CA 2EIEA 2RJ2A 4IEZA 3VBUC 4BISA 4OUMA 1NYWA 1H2LA 3KD4A 2UWBA 4YW5A 4GH4C 3HPNA 3POBA 3WV6A 2VE1A 4JGZC 1DYOA 2W91A 1LOGA 3HNYM 2UY9A 3JD71 4MYEA 5FZEA 4CP9B 4Y3OA 2RS11 3GZEA 2MHFA 3IT8A 3M3OA 3TN93 1CQ9A 2FBEA 4NRQA 1GUIA 1XU2A 1WCSA 4I3PA 5CFCC 5ISLA 5A7NA 4UF0B 4LHLA 4P9XA 1C57A 1K5JA 5BNOC 1FMD2 3ZN6A 3NVCA 2RS51 4I30A 5I0RA 2UURA 3CBNA 2J1UA 5E6HA 4LHKA 4CU9A 4META 2YROA 2D6NA 3JBG1 3U11A 4I0BA 2X5IC 4YW4A 3M1HA 4UOJA 4RFRB 4XE9A 5F8PA 3OG2A 5JUVA 3ME2A 2Y6GA 1C8M3 3WP4A 2PQSA 2P3IA 2JG9C 4DNYA 1SEFA 3ILRA 1UO9A 3S5QA 3CL1A 4CEYA 5L7OA 1SBEA 3PLQA 4FQZA 3T0DA 3WQ0A 1RVF1 2XKPA 4P9IA 3KMHA 4ZKTB 3MHZA 4FT8A 2ENRA 1BEV3 5IVYA 2PAEA 3AMHA 3IAQA 4HKLA 5L9RA 2R49A 1MEC1 1DQ6A 4JC1A 3TN92 4IV1A 1NCQC 2VTFA 4LITA 4HPKA 1AXYA 1CPNA 3IN9A 2XVKA 3OD0A 4FPKA 1DYKA 4UFKA 3OGRA 3H8UA 1W6MB 5A6ZA 3ZFEA 4D69A 3F95A 4LOSA 1K5MC 3MIDA 3VZOA 5J1XA 3VD4A 1KD7A 4BQWA 3ZFFB 3P3NA 4GWJA 1K3IA 4V1PA 2EALA 2IXKA 3W5NA 3K3NA 3AX4A 3OPZA 4FXKB 1UU5A 3O1MA 1C8M2 1YFYA 2WS93 3GALA 4WBBA 4Z2AA 2XHNA 5D8AB 5FOBB 3VKFC 1YJLA 1VAVA 2J1AA 1OLQA 3PUHA 4OVEA 3CLPA 2YG0A 1OUXA 3C7HA 4LQRA 1JYCA 3WDTA 5HV4A 4MG2A 4D7TA 1EYBA 4COWA 1UZZA 2Q8CA 2A75A 2XLAA 1QQP1 4XXAA 4XHBA 3ZSKA 4X6QB 2XH6A 1QOOA 1XE7A 2JENA 2W87A 3I2IA 2D6KA 5FZ7A 1CONA 3ES4A 5HXMA 1IPKA 3I49A 5LY2A 2DCTA 3AZXA 2VMGA 3NMBA 3TNQA 4C1XA 4IEVA 5FZ0A 2MEV3 4TZDA 3RZMA 5H9QA 5FV3A 3LA3A 4YW1A 5FR3A 3HN3A 4CEWC 2HBTA 5T5OA 1POV0 2GC1A 1ULPA 2OYZA 3SHRA 2PTMA 5IK5A 2PN5A 3D6EA 4AHXA 1WZXA 3OCPA 4O9EA 2VMIA 2WS92 1PMHX 4OMDA 4C8DA 4CPBD 5L9VA 1GNZA 3I7DA 1RUNA 2DTYA 3OUJA 5FUIA 5JLVA 3DYOA 4HN1A 3ZFGB 5FMBA 1KITA 3KF3A 2XQXA 3NNFA 2SLIA 3HQXA 4LO4B 4YW7A 1OHFA 2JDNA 1JN2P 2OPKA 2GZWA 2LW8A 3Q8CA 1UAIA 3B69A 3OGGA 4IQPA 4Y1ZA 5FK7A 3TOJA 1COV1 4EE2A 5AFBA 1WW5A 1BZWA 3QACA 1CJDA 3NNGA 1LCLA 5JXHA 2RDNA 4MGIE 3CHXA 4IW3A 3WNNA 5F2SA 1QJEA 1NUKA 3H1MA 3FC0A 1EUTA 4XBLA 1XC6A 4JGYC 3B9CA 3MBWA 1DGWA 1NG0A 4PI0A 5J96B 4IGPA 2P6HA 4LO8A 1TMF3 5GALA 2XVGA 1VAMA 4OI0A 1SCRA 4MADA 3NQHA 3ZPOA 5FYZA 1S0FA 3KB5A 4ES8A 1H9PA 4A45A 2WQ4A 2ARCA 3LKJA 3ZDVA 3T3YA 4C1WA 2Z42A 2RDSA 1W9YA 1JOPA 1PIV2 4AFDA 3POGA 3WF3A 3D3AA 1CAUA 2FCVA 3WQ7A 1SPPB 1SFYA 4M3CB 2W3JA 1OF4A 2VW1A 3KV9A 1TEIA 2ZEZA 5A3OA 2Q8OA 1DQ5A 1OLRA 4A3ZA 1ZRRA 4TLFA 2YUEA 3B9IA 4ES9A 1N3QA 2OKXA 1UXZA 4LE4A 3VBOA 1QJX1 3OY8B 4P5HA 3WP5A 3BTYA 3DCQA 1SBDA 2GDFA 3R05A 5ABJA 2VBPA 3ACIA 2Y6FA 1OI6A 5T5PA 2VZTA 3WR0A 1LOEA
chains in the Genus database with same CATH topology
2UYAA 1TMF2 1ZBA1 1PM7A 3ZVXA 5LRRA 5AC93 3WXPA 1OA3A 2ZX0A 1S0GA 1AR71 4RL7A 1GZCA 2EVXA 2JG8A 3KGZA 4HZFA 3WW4A 3JBG2 3N7JA 4JDOA 4UW6A 4NHKA 1GV9A 3ECQA 1C4RA 4RA0A 4PJYA 1S2BA 1LHOA 1QH7A 3VBRA 1U5ZA 5I91A 2DTWA 2XGXA 2DVGA 4IEWA 5J09A 4NOTA 1GLHA 4IEYA 3IPVB 5LRSA 1UF2C 1RVF2 3RI8A 1G9BA 2BGCA 3MLJA 3VBHA 3OD4A 1DG6A 2PFWA 5C4WC 2VQ0A 3DL3A 1QQP3 1MEC2 1OSGA 1W6NA 3LGRA 2KA3A 1AR93 2EF6A 1ZBE3 2V09A 3NKTA 1W6PB 5GLVA 2Z5WA 3LAGA 2CAVA 3IIAA 3L9JT 4M3CF 5AC92 5L36A 2VGDA 4XMIA 1RUJ1 3WDVA 1QOSA 1RC6A 4K1YA 2FHRA 4XF0A 4LNVA 3S30A 4IV3C 4CYDA 1ZA4A 1B35A 3ZXKA 1X33A 3WP6A 2Q5TA 3USUA 5KHHA 5IK8A 5T5JA 5A32B 4W6YA 1MS3A 4FAGA 2IXIA 3MFCA 3FBYA 1MS8A 2QCSB 4XOGA 3OJBA 5KHKA 2WFF3 5BYNA 4XJZA 3WX5A 3NAPC 3ALQA 3BOWA 2E6VA 3MW4A 1MS9A 4GB31 1QQP2 1MZ5A 2WINB 4LBOA 3LA7A 2VG9A 3RYRA 1AR92 1ZBE2 3SXWA 1WA4A 5JI7A 2XWJB 5FMOL 3SLIA 2B46X 1VB2A 1VBC3 5CG8A 1JUHA 2BYVE 2E7AA 4XYXA 3B01A 1GFF2 1N3OA 1RJ7A 3AB0A 4HVOA 4EROA 1KS4A 2DUOA 1ZREA 4GULA 3WG2A 5CU1A 1UPSA 1V00A 1VR3A 1ZNPA 3J4UH 5J37A 1BCXA 4K6BA 3E5UA 1ZZ8A 2WFF2 1XU1A 3P3PA 2WSUA 4S2GA 4YVWA 5CG9A 4Q4X3 2RM21 2PHDA 2XPJA 4KG8A 1SLIA 4YW2A 3BALA 4OHVA 2JDZA 3A0NA 3AM2A 4LBLA 2DURA 4LUKA 1EPWA 3CNAA 4N43C 4S2DA 2GNMA 1GSLA 5CB7A 1VBC2 4AXOA 1MS4A 1U12A 4M01A 1PO11 2UU8A 3HAGA 5K9YA 1A6CA 4GWMA 4MGYE 2DF7A 1ZRDA 4PLOA 1Q56A 2HEWF 4KQ7A 5HI0A 2E7TA 4LEJA 1AR73 1NQJA 5D1IA 3WQ1A 1WCKA 2Z2SB 4DPNA 5C33A 4Z1VA 4Q0PA 2XBO1 1MS1A 1VBE3 1E57A 3EHKA 2I2SA 1EAH3 4N53B 2ZX3A 1FYUA 3B7MA 1QXPA 5AFEA 4COZA 1H1MA 3J8F1 1YXWA 1ZZCA 3IKWA 2C0ZA 2RS33 5JR7B 3W59A 4AVAA 2VH9A 4E2QA 5JZGB 4A7ZA 1AX2A 2PA7A 2WNUB 2PHWA 5GZFA 1ZBA2 3V65A 2GN7A 3OBTA 1AR72 1GZ9A 4QX5A 4B4RA 1PVC1 1FXZA 2ZKNA 4Y22B 1Q8QA 3QOPA 2BVVA 5DUVA 1Q8PA 1VBE2 4MVTA 1WBLA 2D97A 3N4MA 4QPIB 3BPZA 4C0BA 1EAH2 1O5UA 5EYYA 1G6NA 2G9FA 3KT1A 5FPXA 3AZWA 3LWCA 4E27A 3RWNA 1AX0A 2R061 1ND3C 1UCXA 4QPGB 4AEKA 3RRDA 4XQWA 2DUPA 1QY4A 1U5IA 4CDXC 2WSVA 1J1TA 1EV11 4DZGA 4GB33 4YZ1A 3M8LA 3AFKA 2ZMNA 3VL8A 1TNRA 2H0VA 2R071 4P9YA 3ACLA 2VUAA 2D3RA 4Y5Z0 1L3JA 4E2GA 5FO9B 5KXEA 2ZCWA 2AGSA 4QPYA 2ZPXA 3B5LB 2WA3A 1AR81 1QNWA 4JTNA 3ZYGA 2WNVB 3DGTA 2NM1A 1RITA 4X6RB 4YVSC 1WMDA 5CFDC 5T55A 1HQNA 1IGOA 3WT3A 2DVBA 1QWRA 1WGPA 4DOUA 4GB32 3RMYA 1FATA 3WHTA 1JXNA 5FTTC 3URFA 2EXJA 5DDJ1 3FLRA 3JZVA 1F9KA 1NA1B 1CX4A 1EP0A 2XJSA 1VRH3 2DVDA 2XJPA 4RR3C 1AR63 2VVEA 2RJLA 4PIXA 1ZVFA 2XKOA 3H7YA 3WG3A 5BNQA 4AE2A 2WQZC 4UW5A 2WWSA 4OHYA 1PVXA 1DQ0A 3ZXEA 1V6KA 1CAXA 4XFBA 4A7YA 1NLSA 4BMBA 4Z92B 1RHI3 1YRZA 5FLJA 1LTEA 1N1YA 4BWOA 3AKRA 4HMZA 1VB4A 2EXHA 4PDWC 3VBUB 3J8F3 1FI2A 3ZFEC 2ZGNA 1PK6A 4GH4B 3ZIXA 1OOPC 3BIWE 4JGZB 1ENQA 3USSA 2VNRA 2WT1A 1W6MA 1VRH2 1PO12 2QZ2A 4FPLA 2N7GA 1A3KA 4JCKA 5CFCB 3MIEA 1LR5A 1UKRA 1FMD1 5BNOB 2X53S 2XHKA 3O0VA 2JKBA 2VNOA 4WVWA 2RHPA 1NLRA 2A73B 2AREA 4OFGA 4J1XA 4Q1PA 4D94A 3OTFA 2X5IB 4XQDA 5KXDA 4NHMA 1A78A 4GWNA 4OZXA 5E89A 1PZ8A 1RHI2 3VUOA 2JG9B 4BYYA 2OVUA 5I0UA 4ORFA 3J8F2 4K9SA 1CAVB 1IHMA 5BPXA 1D0GA 3VBSB 5J7MA 3UJQA 5JZGC 4CDQA 4XJAA 3IMNA 3R4SA 3TN91 3QCWA 1NCQB 4OI1A 2PHFA 3NKGA 1F2NA 4QGLA 4HSJA 2AENA 4YM1A 5I0SA 3O0XA 4R52A 1K5MB 4OUSA 5IK7A 1HQLA 5I8YA 1DFQA 4LBQD 4E4SA 2WNEA 1C8M1 1J1LA 4HL0A 3ZFGA 1NE6A 1DYPA 2Q1ZB 3SMHA 3WZ1A 1LHWA 3PTYA 4QGNA 2ZAAA 3KT7A 2TNFA 3KQRA 4AGRA 1BEV1 1ND2C 4JDNA 3DV8A 4LE3A 3JUUA 1V9U3 4K7JA 1NQDA 2AZ5A 2PHRA 1PGSA 1ULFA 3PVNA 3ZSEA 5DDJ3 1V6OA 3T1LA 1QF3A 3IWZA 5A33B 5C8CC 3AP7A 4URTA 1I6XA 4ISRA 1H4GA 2CAUA 4F3JA 1S1AA 5CVRA 1KS5A 3L2YA 1S0JA 4AQSA 4CEWB 2F6BA 2ZGPA 4YFZA 4Q0UA 2IWGB 2WS91 3KM5A 4M3CA 1UIKA 4EWDA 3S7IA 1CESA 4BIFA 5ABJC 2GNBA 4IEPA 5T50A 4AI8A 4N9HA 4UW3A 2CL2A 3OY8A 3ZSJA 4YM2A 4FP2A 2GN3A 1V9U2 3B3QE 1LOAA 4CDWA 3W9AA 5BUVA 5KHIA 2D5HA 4BPZA 1N1TA 5DDJ2 2JG8C 2W68A 4JRLA 1S0BA 2O8QA 1H8TC 5FREA 3VZNA 2MEV1 1H1IA 1G9AA 1B09A 1HX6A 1VBA3 3FLPA 2OZJA 1JOJA 1LHNA 3CO2A 2D3PA 5I0TA 1HQWA 2E51A 4R9CA 1QH6A 3LSEA 3VBFA 1ULEA 1LGNA 3UKNA 3EO6A 1RMU3 1SACA 4Y1VA 3WW2A 4DB5A 4RHV3 4AFMA 2B7YA 3M70A 4RD7A 1QOTA 1MVQA 3IPVA 4H3WA 2R1BA 5HXVA 1LRHA 1SQ4A 4I01A 4CZSA 2E63A 3AKTA 4YSFA 3ZXAC 1Y43B 1C1FA 4XF4A 4R9AA 2R043 2VW2A 4LBNA 1DQ2A 2ILMA 3A0KA 1SLCA 1TNFA 1D4M3 2B39A 1ZX5A 4AEMA 1W6PA 4M3CE 2ZX1A 1NCRC 1VBA2 4XJWA 5BNNC 1W39A 3M3IA 5I93A 4PLMA 5F5QA 1V6JA 3NV4A 1LOFC 1TMF1 1IS4A 5CBLA 2ERFA 4N9IA 3AYAA 1RMU2 4J6GA 4O9GA 5LEJA 2XJUA 3MEPA 4RHV2 5J48A 1W0OA 2A71A 2VOKA 1I9RA 4BHPA 4A3XA 5A32A 5JOYA 2ET7A 1DLLA 4YARA 1Q8SA 4DRRA 3T2TA 2GALA 3NW4A 4CRQA 2QDNA 2R042 3WW1A 3VBSC 4GALA 4SBVA 1AXZA 2CWMA 2O1QA 4Q8KA 1D4M2 3PVEA 5C4WB 2ZBJA 3KCXA 1RTVA 1O91A 2O0OA 3D0JA 5F1RA 3GBGA 2A3YA 3FFZA 4EN9B 5AC91 4B4QA 4HFSA 3M2MA 4F7ZA 1AYM3 1XRUA 3GNEA 3E6DA 4XIKA 5FQ0B 1XE8A 4AFCA 4AEDC 1IPJA 1XYPA 1AYN3 1IZ3A 4IV3B 4WM8C 4YFWA 2YY1A 1AL0G 3N36A 2QDRA 4R4ZA 5FRAA 4BZ4A 3EBRA 1C5HA 3CJIB 2ZS6B 3ZXLA 1SLAA 4JV4A 1JYIA 1POV3 1NXD1 1OPMA 1O3SA 1REFA 2D6OX 2XL7A 1BEV2 3NAPB 3VKLA 4LUMA 2XLFA 5LEKA 4OI4A 1DHKB 3ZN5A 1OQ1A 3D82A 5JOXA 1AR91 4B29A 1ZBE1 1XNKA 2IC1A 3FBMA 3NV3A 3PNAA 2MNGA 4KBBA 3OBRA 5GLUA 4Y20B 3SH4A 1UW8A 5F6KA 3TNPB 1VJ2A 2ZKLA 1AYN2 2CWSA 2GAUA 3MDPA 2VVDA 4G9SB 1WW6A 3RI9A 2XL9A 3D8CA 3E6BA 4FCAA 3X29B 2ZA9A 2R32A 5EJ3A 3N3HA 4DS0A 4E4ZA 4N53A 3ZMNA 1BYHA 3OYWB 2WFF1 2AR6A 3MGUA 3WD5A 3HIFA 2A5ZA 3C2UA 3I2DA 2ZTNA 1DBNA 2XWBB 4IEUA 3MIGA 1KFXL 4P14A 4HBNA 3LOBA 1AX1A 3MF9A 2D6MA 1OFNA 2WNUA 4RGGA 2ZHKA 5SV8A 1VBC1 4AK3A 4N43B 2MEV2 1V6LA 5BXXA 4LT5A 4NR1A 2NQYA 2ZMLA 1C8NA 2HJIA 4W65A 1S55A 3PJYA 3K51A 4Y22A 4FTBA 3DPRA 2K2SA 1KJLA 3O12A 3OF1A 3AMNA 3VHNA 1ULGA 4QPIA 5B2GB 5GZDA 1I3HA 5KHJA 1ZZ9A 2PHUA 3DKWA 1QXRA 3WNXA 2VNGA 1YFXA 4BMEA 5IT6A 1D4VB 3ZYPA 2B9UA 4QD2A 4ASMB 2D93A 1GANA 4Q4X1 4QPGA 3HWJA 1S0EA 3LB9A 5BNPA 4QT6A 4JDMA 2RJKA 1WLCA 2CNAA 1QDOA 4NPRA 5K0UC 4JAAA 1UKGA 1VBB1 4MXVA 3PJQA 2GC3A 4AVVA 2BNNA 2ZZJA 4K21A 4RS5C 1I5ZA 4Q4V1 4DINB 1G7YA 1XNBA 2CTVA 4Q8LA 2WNVA 1V6MA 1UMZA 3AKPA 1VBE1 1OKQA 2NYYA 5FBZA 4LO6B 2NN8A 1EAH1 3ROUA 2BW8A 2ZX2A 2WJSA 2H0BA 4HANA 2VU9A 3TYJA 1A8DA 1NE4A 5F6LB 5JSPA 4YM3A 1ND3B 3V0BA 2IZWA 2RS31 4GKYA 2WLQA 4YG6A 3SH5A 1Q3EA 4CDXB 4HSLA 1RUG3 1NA1A 1H2MA 1HIXA 3VDDC 4YW3A 2PHTA 3VLBB 1PGL2 4PIZA 4FO9A 2DUQA 5EWSA 2D5FA 1HRI3 3WLUA 1WMFA 3S7EA 4AVCA 4XHXA 3LOIA 2ZACA 1WBFA 4KNCA 5L19A 1SLTA 4FOWA 2C1FA 1ULCA 2OUHA 3ZYRA 4CDUA 3UL2A 5H9RA 5EZWA 2ZGLA 1OD5A 2DCZA 3CJIC 3N35A 2WFPA 4ZU5A 1OMIA 4EJRA 1PK6C 1S0CA 5CFDB 4YVSB 3ZPYA 4WV8A 3UJOA 1MR5A 3VBUA 1X50A 2YHJA 1HV0A 3I8TA 4LHNA 5GM0A 3WDXA 2JEMA 4GH4A 1OA4A 1WUVA 5BY5A 4JGZA 1RUG2 3VL9A 1MQTC 3ZN6B 5GKAC 5AVPA 3SISA 1MS0A 1DGRN 1HRI2 3TBDA 1N1SA 2GMPA 5CIRA 2WZR1 4FXGB 3ZXFA 5BNOA 3RMXA 5JI9A 1FAYA 4COUA 4RR3B 4EV0A 1D0HA 1RUD3 2CGPA 5FLHA 4RQPC 2X5IA 1YFUA 5I8SA 4WM7C 3V64A 4XEZA 2A3WA 5EV7A 1REEA 4Q4W3 1Y9QA 3AP4A 3R4DB 2JG9A 4GQ7A 4CDQC 2CY6A 2RR13 5E1RA 3GBWA 3ZDSA 2QNKA 3MYXA 5FO8B 1CAVA 1BVVA 4MUVA 5TSWA 2Y0IA 4QXKA 1YCIA 1ZZ7A 2EA7A 4PDWB 1MZEA 4Q0QA 3ZFEB 1NCQA 4PF5A 1Y3TA 4Q26A 1OOPB 1LHUA 1Z78A 2GNDA 5DG1A 1VRH1 1MZ6A 1Z7S1 3SITA 1VBB3 1AR61 2DVFA 2YXSA 4WZFA 4KU8A 3GYDA 3FWEA 1K5MA 1RUD2 4F83A 3N7LA 4Q4V3 3JQXA 1MS5A 1YNAA 5HCAA 2XG3A 4Q0SA 1DGRA 3MIBA 4Q4W2 4M00A 1T6GC 1HRV1 3I54A 4XFHA 4AW7A 3SNMA 1W6QA 2RR12 4L2NA 4LO7A 2HWB1 3JB8A 3A4UA 1CR7A 2ZAHA 2CV6A 1RHI1 3FFQA 2XLGA 4Q4X2 1VAKA 3TAYA 4OHXA 3WINE 3N7MA 4HK9A 2I45A 3KSCA 5EFUA 2KXLA 2PYTA 4IESA 2XUMA 2D6PA 5C9AC 1R083 2NMNA 1V70A 3ZX7A 1VBB2 1ZZ6A 2G4IA 1BBT1 4QQLA 2WC2A 5C6CA 2DU1A 2Z79A 4OULA 4OHZA 3ZSLA 3H1YA 4Q4V2 4CEWA 4AHWA 4BA6A 1DZQA 2ZGRA 4W6XA 2DFBA 2GU9A 2D7FA 3HD8B 5FFOC 2G9GA 2VPVA 3U4XA 2NLRA 1EPZA 2B5HA 2B45X 3HN1A 2ATFA 4K40A 1CN1A 3MI8A 3W58A 1LOBA 3AP9A 1OQEA 2LM3A 1ASJ3 1FNYA 2HWD3 1LEDA 1ND2B 2RS32 3B93A 4AF9A 1R082 1BXHA 1FT9A 2XVLA 2HWE1 4UBGA 3WG1A 4JGYA 1JTZX 1W2UA 3THPA 2WZR3 1H30A 1UD1A 3QBQA 5C8CB 4BLIA 1QNYA 2JECA 1OPOA 1JHNA 3POYA 1CJPA 1RUF3 1BKZA 2HWF3 1GYKA 2OIIA 5GJ6A 2A3XA 1LB2A 1IOAA 1PHMA 2VOVA 4MX3A 4XMAA 4H55A 4QHBA 4TSVA 3ZN4A 2VECA 1AL23 3WOGA 5ABJB 1ASJ2 2PHXA 2D44A 2GC0A 1V9U1 3RDIA 1SLLA 2QE3A 2Y0OA 4X8PA 2NMOA 1HXS3 5KC6A 1U0AA 1HW5A 2JG8B 4AGVA 1RL3A 3POWA 4G4FA 2WZR2 4HK8A 1H8TB 4LBQB 2ET1A 5CAZA 1BMV1 4XF9A 2WT0A 3RZZA 3G6JB 1Z7S3 3NWKA 2TUNA 1FPN1 5T3NA 1ULDA 2W39A 2EXIA 1WD3A 1RUF2 4WVVA 2HWF2 4BE3A 4CEYC 5L7OC 4FOQA 4KH9A 4YNIA 1LENA 4FOYA 1HRV3 3AMMA 1QJZA 5AVAA 4XF3A 5JIAA 1AL22 5DUUA 2HWB3 3MICA 4IV1C 3PVOA 3U10A 4MXWB 4M0NA 4I0AA 1RUC3 4FPOB 2KM2A 3HT1A 4XTPA 4FPCA 1JH5A 1HXS2 2ARBA 5KC5A 1R1ZA 4B7EA 5JPMB 2BNMA 2R6QA 1FX5A 2ZGMA 1HV1A 1VBA1 4COYA 1NCRB 1O4ZA 1Z7S2 2AH2A 1AR62 5BNNB 1BBT3 5FQ0A 2CGOA 1RUH3 3RJ2X 3ZFFA 3R0RA 3IDCB 1RMU1 2P3KA 3MZHA 1MZFA 2WA4A 4KGGA 4RHV1 5HCBA 4XTMA 4MLOA 1HRV2 1KQRA 1ALYA 1V6NA 3MW2A 5D8AA 5IK4A 5GLZA 2HWB2 2W08A 4ITCA 1F5JA 4D7YA 5JOWA 2YYOA 2VVFA 4FP3A 1RUC2 1FNZA 4W6WA 2R041 1FOD3 3DN7A 2WIIB 4YZ3A 5FO7B 2DCKA 5L73A 4XXPA 2FZ1A 1D4M1 2GH2A 2VULA 4Q4Y3 3JU9A 3RYKA 4EN7B 5DXDA 4FPGA 4R9BA 5DUWA 5J98B 2HWE3 4AYUA 1BBT2 4Y20A 2D98A 1RUH2 3MIFA 5JWPA 3JQWA 1N47A 2DCYA 3NV2A 2VXRA 4BQ1A 1KDKA 4EWEA 4S2FA 2JX9A 3THTA 4AEDB 4WM8B 5JSOA 2I74A 1G9CA 4AWDA 3OYWA 5EYXA 1GQGA 2EIGA 5GZEA 2ES3A 2ZGQA 3BTAA 4OLLA 4XDQA 1DZRA 3V0AB 1FOD2 4L9BA 2E9QA 5DG2A 3BCWA 2ZGKA 1GZWB 1YI9A 3MPPG 2XJQA 2AUYA 3S0MA 1H8VA 1HLCA 3RNSA 3DPRC 3B02A 4N43A 1U5XA 2HWE2 3AP6A 4Y1YA 4MGKE 3EJKA 4A2UA 2A6ZA 2R16A 3AMQA 4PBOA 1CPMA 5SV5A 1AYM1 2DYCA 4IERA 3ILNA 2X29A 1FPN3 1AYN1 3H3UA 1Q8OA 1RINA 3CU7A 4GKXA 4XBNA 2AYHA 3PMEA 1DQ1A 3VBOC 3U0ZA 4H7LA 4IEQA 1C28A 4GMP3 1POV1 2TEPA 3MF6A 1XYNA 2BUKA 3M3CA 1J3QA 4R9DA 1Q5OA 2D40A 3RJRA 3O7OA 1GKBA 4I09A 2FQPA 4QQOA 1IS6A 2PELA 1UZYA 4QQPA 3Q9OA 1VBD1 4TWTA 4ZXKA 4XFIA 4YYOA 1BMV2 1X8EA 2BQPA 3LSDA 3VBRC 1QJY1 4UXAA 1FPN2 5FLIA 2FMDA 4HVRA 5LK7B 4XETA 2TBVA 2BBVA 2ZOEB 4MGZE 3VN4A 1Q8VA 3D5OA 3FUOA 4WZCA 3VHRA 4AG4A 3QH7A 3VBHC 1X7NA 2DFCA 4B3NA 2XJRA 3ZXDA 1LEMA 4HVQA 1QHDA 4BLJA 4DQAA 2QVSB 3H9AA 1R1A3 2DCJA 1AZDA 2ZABA 3MLKA 1S0IA 4DXZA 4CDXA 3KCYA 1LU1A 1TME1 3NL1A 1SMVA 2ZHMA 1IS5A 1UN1A 5JDBA 3BODA 2UWAA 3ZXGA 5K0UB 1B35C 2W52A 2P34A 3FLTA 4CDUC 1RGSA 5BV6A 1DGLA 3IBMA 4F8AA 4XW3A 4BM8A 2CGNA 3GF6A 4AQTA 4Q29A 5KWRA 1KXGA 4RS5B 2D43A 4FPYA 3EXUA 2P17A 3ZMOA 3RQ0A 4RSUA 1Z0HA 1PNGA 4LLFA 2F4PA 3GZTB 4YVSA 5CFDA 2R0FA 3BOPA <