5DDJ2

Crystal structure of recombinant foot-and-mouth-disease virus o1m-s2093y empty capsid
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
210
structure length
210
Chain Sequence
LLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVAQAERFFKTHLFDWVTSDPFGRCHLLELPTDHKGVYGYLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNSEGAPQIKVYANIAPTNVHVAGEFPSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based energetics of protein interfaces guides foot-and-mouth disease virus vaccine design.
pubmed doi rcsb
source organism Foot-and-mouth disease virus - type o
molecule tags Virus
molecule keywords Foot and mouth disease virus, VP1
total genus 25
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5ddj200
1RMU1 5C9AB 3VBUB 1FPN2 4Q4V1 1RUG1 4CEYC 5L7OB 1EV13 2TBVA 5L7OC 5K0UB 2RS51 2WZR2 1D4M2 1HRV2 2RMU1 4QPGC 1RUE2 1POV1 1AR83 2XBO3 4GMP1 2HWE3 4Q4X2 2HWF2 3JBG2 1PIV3 2RMU2 4GB33 1OOPA 5LK7B 1FMD3 1TMF3 1RUC1 2R072 1K5MA 1TME2 3VBRB 4BCUA 4Q4V3 3JB4C 4FTBA 1RUF2 1HRI3 3CJIC 1VBA3 4RFT0 2RS11 5ACA3 2ZAHA 4IV1B 1HRI1 1PVC3 4CDWA 1NA1C 3VBHC 1BEV1 3VBOA 2PLV3 1AR81 2GH8A 3VDDB 1EV12 2R042 3VBRA 2HWB1 2QQPA 1GFF2 4YVSC 1PIV1 2BBVA 1ASJ2 4WM8A 1RUE3 1AR63 5A32A 1AYM3 4WM7A 2WS93 1OPOA 1CD3G 1TMF1 5BNNC 4JGZC 5FOJB 1NY71 1H8TC 4JGZB 1EAH2 1VB2A 2HWF1 2BUKA 1RUH2 1VRH3 1C8M1 5BNOC 2WLPA 2WFF1 1HRI2 1NCQA 4CDUB 3ZFGA 5D8AB 4WM7C 1SMVA 1RUD1 1VB4A 2RS53 2WFF3 5C8CB 4WM8C 1VBC1 1ND2C 2R071 3FBMA 5AC92 4CDXB 5ABJA 4RQPB 1BMV1 1QJX1 3VBRC 4Q4W2 5FMOS 1RUI1 5ABJC 1B35B 1NOVA 4JGYA 1AL0G 4CDWC 4RHV2 1ASJ3 1ZBE1 1QQP2 1VBE2 2MEV2 3CJIB 1AYM2 2FZ1A 3VBSB 3ZFGC 2WS92 1NCQC 2R041 1MQTB 4RHV1 1ND3C 4QPGB 1D4M1 1HRV1 4N53A 2R061 1QJU1 1FOD2 1QQP1 1MQTC 1RUE1 4Z92B 5CFDB 4EJRA 4RS5C 1COV3 4PDWC 3JD73 1FOD1 4IV3B 1RVF2 1V9U1 1FPN1 4QPGA 1C8M2 5K0UC 1QJZA 2HWD2 1IHMA 1W39A 1VBD1 2RS12 4CEYA 2BPA2 4WM8B 5DDJ3 1AL21 4JGYB 1PGL2 1QQP3 3JBG1 2VQ0A 5BNOB 3CJIA 5J98B 1BBT1 1R093 2BFUL 1ND3B 1QJX3 5C4WA 1FOD3 1R083 1ZBE2 3J8F3 1RHI3 1RUD3 4RR3C 5JZGB 4NWWA 1AR92 1C8NA 4GH4B 1B35C 1RB8G 1X36A 2ZTNA 5C8CA 1VBD3 1DDLA 3ZFFA 5CFCC 1RUJ3 1EAH1 4CEYB 5GKAC 3VBFA 1NCQB 1RUC3 2GSYA 2RS32 5L7OA 1E57A 1PGW1 4WM7B 2RS13 3VBFB 4CEWA 1PGW2 3NAPA 4Q4X1 4CDXC 2WZR3 3JB8A 3VBOB 4N43A 4Y5Z0 1ZBA2 1AR82 5D8AC 2XBO2 2WZR1 1NCRA 2HWE2 1AR91 1R082 4GH4A 1ZBE3 1Z7S1 3J8F2 3VBSA 5JZGA 2RR13 1PO11 4Q4Y3 5CFCB 2RS31 1TME3 1BEV2 4Q4V2 5AC91 1RMU3 4Q4Y1 4GH4C 3ZFEA 3DPRA 1PVC1 1VBA2 4RR3B 5ACA2 1AR71 1NCRC 5C9AC 1HXS2 4N43B 1F2NA 4GMP3 4NWVA 4AEDB 1RUJ1 1ZBA1 3TN91 5A32B 4AEDA 5C9AA 4RS5B 3ZFFB 1M06G 1AR62 4QPIA 2X5IB 1ASJ1 1AUYA 3VBFC 3M8LA 3ZFFC 3VBUA 1BBT3 4Q4Y2 1HX6A 2HWC2 1B35A 1VBC3 1ND2B 1WCDJ 2PLV1 3VBSC 2DF7A 4GB31 4RQPA 2FZ2A 4CDUC 1RUI2 2WFF2 1NCRB 1RUF1 2HWC1 2RM21 4CDQA 1FPN3 4Q4W3 4Y4YA 3VDDC 4YVWC 4CEWC 1AR72 5BNPC 1AYN2 2RR11 4RHV3 4IV1C 2R062 1VBE3 2MEV3 5CFDA 2HWF3 5K0UA 1PIV2 2RMU3 1QJU3 4YVWB 2HWB3 1POV3 2X5IA 3ZXAC 4FTSA 1VAKA 4PDWA 4CEWB 5C8CC 5BNNB 1FMD2 4RS5A 3TN93 1TMF2 1V9U3 2R073 2HWC3 4IV3C 3JD71 4RR3A 1MQTA 2RM23 5C4WC 5DDJ1 1COV2 5CFDC 4FSJA 1X33A 3JD72 4N53C 1Z7S3 4IV1A 1NG0A 4Q4W1 1RVF3 1ND3A 1C8M3 1RUG3 1TME1 5BNPA 2PLV2 3ZFEB 1PO22 1POV0 5DDJ2 2R043 5C4WB 4JGYC 1AR73 1AYN3 2HWE1 1RHI1 2R063 1R081 4CDUA 3IDEA 5FMOL 1QJU2 5ABJB 1ND2A 1NY72 2HWB2 1PO12 1QJY3 1VBB3 4IV3A 4GMP0 3TN92 1MEC2 1R1A2 4PDWB 1RVF1 1EAH3 1V9U2 1RHI2 3VBUC 1AR93 1RUH3 1VRH2 2RM22 1HXS1 2X5IC 1H8TA 5BNNA 1RUJ2 5A33B 1Z7S2 2RS52 1MEC1 1R1A1 3S6PA 2RS33 5AC93 1RUG2 2WWSA 4YVWA 3VDDA 3DPRB 1PO23 4LLFA 1CJDA 4CDQC 4CDWB 1AYM1 4N53B 3J8F1 3HAGA 1QJY1 1VBB1 3VBOC 4RQPC 1NA1A 3ZFEC 2ZZQA 2Y26A 1ZBA3 1PO13 1QJY2 1VBB2 1AL22 1MEC3 1OOPB 1R1A3 3ZFGB 1NA1B 5BNOA 1VBE1 2MEV1 2RR12 5ACA1 3NAPB 1VBA1 2BFUS 1BMV2 4QPIC 4JGZA 1PO21 1OOPC 1BEV3 1EV11 1F8VA 5D8AA 1RMU2 4AEDC 4N43C 4FTEA 1A6CA 2HWD3 4QPIB 1COV1 3NAPC 2IZWA 4YVSA 1RUH1 1HXS3 4YVSB 1HQNA 1AR61 1H8TB 1FMD1 3VBHA 2XPJA 3DPRC 5J96B 1D4M3 1HRV3 1R092 1QJX2 1PGL1 5CFCA 1OHFA 4Q4X3 1AL23 3JBG3 1RUD2 2XBO1 1AYN1 5JZGC 4CDQB 1K5MC 4GB32 5BNPB 1BBT2 2HWD1 1R091 1VBD2 4SBVA 1VBC2 1RUF3 1RUC2 3VBHB 4CDXA 1K5MB 1RUI3 2WS91 1VRH1 1PVC2 3LOBA 5A33A
chains in the Genus database with same CATH superfamily
4K8RB 1RMU1 4CCKA 2W95A 1FPN2 3K46A 4BPZA 1RUG1 1BVP1 1W9YA 2BEOA 2YFZA 5L7OB 1DZRA 2TBVA 3FMGA 1PVXA 3W5MA 3K3OA 5LEKA 4XILA 5H9QA 2YUEA 2J1TA 4ZU7A 1DYKA 3MGUA 5DN2A 5BNQA 5DAWA 3PMSA 2VZUA 1XOYA 3VHPA 3O1OA 4YZ3A 2DVBA 4XYXA 1O4ZA 3U14A 1V6NA 5KHJA 2WZ8A 4Q4X2 4Q8LA 5LCWL 1PIV3 3OOXA 2Z4FA 4W6XA 2QJVA 2LALA 4B4RA 1QMJA 1NLRA 2P3JA 1OOPA 5J37A 1UNBA 5LK7B 2ZZJA 4UW4A 1KRIA 1XU1A 1XC6A 1RUC1 4LHLA 4GXLA 4AFDA 3EO6A 1TME2 3RWKX 3BU7A 4INDA 3JB4C 2IXHA 1L7LA 1OC1A 1RUF2 3C7GA 5JIAA 1H2LA 3C7OA 4NIIA 2XJVA 4OMCA 1O8PA 4Q27A 1S0BA 1N3OA 1RIRA 2XKOA 2QUOA 4M4RA 2VW1A 1YQ8A 1UMHA 1J3QA 2OUJA 1KJLA 2EVXA 1NA1C 4OQ9A 3AYDA 3VBHC 4D0QA 4R9DA 3M1HA 1DG6A 4MX3A 3QOPA 3MEPA 3I2HA 3U4SA 5FDBA 4N7IA 4NOTA 4W4ZA 4A3XA 2QQPA 5FIXA 1O3RA 1ASJ2 4WM8A 2GMMA 4URTA 3MFCA 2WO1A 5LBEA 1H9WA 2BOIA 2PHFA 1T2XA 1GNZA 1LOEA 4F83A 1W3VA 5FO9B 1Y9MA 2HBTA 3CZJA 3U11A 5FBJA 2NMOA 3WDUA 3MLLA 5C5UA 3BB6A 1DQ0A 2I45A 4JGZC 3T4HB 1MPXA 4FP3A 4A2UA 5FOJB 4S2DA 1NY71 3N3HA 3DYPA 3B9CA 3RZJA 1C8M1 4OLLA 2HLEA 2C5DA 1O3TA 1HRI2 4OFGA 2Y60A 5FP9A 2WR9A 2K0GA 1SMVA 5FYMA 3K48A 1LRHA 1RUD1 1Q3EA 5KHGA 3HQRA 4XHXA 4OI4A 3QACA 4FFHA 1QEXA 1S0JA 4DEVA 4V2WA 1QGLA 4I01A 1VRBA 1BMV1 3VBRC 3P3PA 1S0EA 1SBDA 2ENRA 5EV7A 1SFYA 4XACA 2YMZA 1JYTA 5A3OA 1D2QA 3LEGA 2D5FA 2WUHA 4XPVA 4RHV2 3WLUA 1JYIA 1ASJ3 4Q0UA 4M01A 1T6BX 2D6PA 2WS92 2VCAA 4RHV1 3ZR5A 5CG8A 4QPGB 4A6OA 1HRV1 1UIKA 3OEBA 1URXA 2QQWA 2WWJA 1WW7A 1Y9QA 4XFCA 3ZIXA 2KXLA 2ILMA 4E4SA 3DYMA 5C8WA 5J36A 2WNUB 4JCKA 2QKDA 2ET7A 3I3EA 1LNSA 3O0WA 5CFDB 1JOBA 1BCXA 3OD4A 4PDWC 1YFXA 4IERA 1HW5A 4COVA 2AGSA 1MACA 1OQDA 1CPMA 5DQ0A 1FOD1 4CCOA 2B8MA 2IWGB 1RVF2 1W6NB 1FPN1 3RDIA 1C8M2 3TAYA 4K7JA 3I59B 1ACCA 4AAXA 1IHMA 4JHTA 2VG9A 3CIHA 3TN93 2AH2A 2OPKA 2YBPA 1PZ7A 1VBD1 1X9TA 2A6YA 2OVUA 5F6KA 4NIHA 3LPGA 4WVWA 1DQ4A 2J42A 5C3SA 3LWCA 4O65A 4Y5TA 3N9LA 4RFRB 4BHPA 1A34A 1JZ2A 1GOHA 1FV2A 1G7YA 1XBFA 3FN9A 4HN1A 4BK5A 1OH3A 4ASKA 3O1VA 2BNOA 3OPTA 2E53A 3RI8A 2BFUL 3S0MA 4DY3A 2LUWA 1GBGA 4RN5A 2ZS6B 1R64A 1DGWX 3AX4A 3BTAA 4NRMA 2FDKA 1ZA7A 1UMIA 1FOD3 1OI6A 1R083 1CAUB 1UU6A 2Y64A 1ZBE2 1SBEA 3UGGA 3RZGA 3KV6A 3WINE 3WDWA 4NWWA 4YYOA 4GH4B 4QXCA 3RGBA 1X50A 3W59A 1X36A 4BOWA 4D7TA 3A7QA 2Z2SB 3WP6A 4HMZA 4AI8A 2P3KA 3WNMA 4CEYB 4YW1A 2O8OA 3VZOA 1RUC3 4GJYA 1D4VB 2GMEA 4NPRA 3WP4A 1LB2A 1NYWA 1UKRA 3NRUA 5L7OA 5IFTA 1FX5A 2WQZC 2VGDA 1LOBA 4HKOA 4COYA 5IK8A 3N7JA 4XF3A 3FLTA 5J3UA 4CEWA 5DUXA 3B94A 4ARXA 1O8SA 3FUQA 4A41A 2BV4A 1CWPA 1O91A 4Q4X1 1YFUA 1PK6B 2WZR3 3JQXA 2JENA 3M3CA 3T1LA 4ZKTB 3AZXA 2HEVF 2DCTA 1AR82 2DWRA 3I3MA 1CAWA 3GBFA 2F4LA 2XBO2 3T1MA 1DYOA 4G9SB 4QGLA 5JXIA 3IIAA 4YZ2A 1DP0A 1RGSA 1R082 4GH4A 4MYEA 4Y22A 2XJUA 1Z7S1 3ZO0B 1XNTA 1G8WA 3UKTA 1H0BA 5JZGA 1LODA 2F4PA 4OHYA 3K75B 4BLIA 3DV8A 3WW1A 4P9GA 4XF4A 4CCJA 5FQ0A 1MS5A 1XRUA 1ZX5A 1KJRA 2JDUA 2ZKLA 2DVGA 4XF0A 3LCPA 5GM0A 4Q4V2 2CTVA 2VULA 4EN7B 2VNOA 4GH4C 4Q4Y1 4XQDA 5HBAA 3S5AA 4E2GA 5IJRA 1UY3A 4RR3B 4XXAA 1GP6A 3LFIA 4KQ7A 3T2OA 1GV9A 4CYDA 5JUVA 3L2YA 1QDCA 2WC2A 5HPOA 1VMJA 5FXVA 1O4TA 1YEWA 1ZZ8A 4NWVA 1QOSA 2VZSA 2GP5A 3BN6A 1LHNA 2C6SA 3SCHA 2D3PA 1QKQA 4R9CA 3VD3A 1ZBA1 3AMNA 1SZBA 2MHFA 1W6NA 3J7MA 3BI3A 3GXUA 1RL3A 2P3IA 5A32B 2JE7A 3WV6A 4AEDA 5FYHA 5EFUA 1VPHA 2VZQA 3ZFFB 1M06G 3O1MA 3SKJE 2X10A 3WQ0A 3DN7A 3B69A 1DLLA 3C7EA 1S0IA 2A6ZA 1UOGA 4QPIA 3NV1A 3CNAA 5EHDA 4LLOA 1ASJ1 1CIWA 3B00A 3OD0A 2P2KA 1IOAA 5GZDA 3M8LA 1ULGA 4L8QA 3LA3A 3KGZA 1OFSA 2A3YA 3D0SA 2EXJA 4B4PA 2DFCA 3WG1A 1HX6A 4CP1A 5JXHA 4A7KA 1FATA 4I0WB 1VBC3 4HSLA 2PLV1 1V6IA 2XG3A 4MHRA 3VBSC 3C7FA 4N9HA 5FPZA 2XKPA 2FZ2A 1OF3A 2YG0A 3VKMA 4A7YA 1PX3A 4CCDA 1RUI2 2OA2A 1NCRB 1RUF1 3OPZA 4LEJA 1YQ6A 4HLTA 3CHXA 2RM21 4K9SA 3FLRA 5L19A 4AW7A 3RMYA 2E51A 2VECA 2VBBA 4YGCA 5F2SA 2FD8A 4B29A 3I3QA 1HV1A 2W0XA 4BM8A 5CVRA 2QQUA 5A6YA 5BNPC 2DURA 4QGNA 4OI2A 3NVCA 4YW3A 2ZPXA 1V6KA 3HPNA 4H2AA 5CIRA 2E32A 4IV1C 3TNQA 2VMDA 2YC4A 3ZX7A 3PVOA 4AVAA 3ZMNA 1XNBA 2EF6A 5I93A 1UU5A 2C0ZA 2QBXA 2BRTA 1QJU3 2Y6KA 3U1XA 2EXIA 2HWB3 1POV3 1LHUA 4AQTA 3T0DA 1J59A 3APBA 4G3YC 3IIIA 1US3A 1UIJA 3H9AA 1ST8A 3MYXA 1VAKA 4AEMA 5FP3A 1EPZA 5BNNB 1FMD2 1ULOA 1DQ5A 3KQRA 1I3HA 4IESA 5K4LA 2Q8CA 1QIQA 1CN1A 1V9U3 2VZRA 3MO4A 5I91A 2BU9A 2G19A 4K21A 2WABA 3IDAA 4R9BA 3T0BA 2RM23 3WDYA 3S57A 1F4AA 3PU8A 3N9PA 5DDJ1 3PU3A 1UX7A 2VNRA 2WSVA 4KWUA 2Q5TA 4IV1A 5M0TA 2YV8A 3D0JA 4EN9B 5IAXA 5EPAA 2VZ1A 1W8OA 1RUG3 1TME1 2YXSA 1C1LA 4YPJA 3EMRA 1QHDA 3T08A 1CPNA 2EIDA 1S55A 3PVNA 3AMMA 3PL0A 3IBMA 3WNKA 4FQZA 2D5HA 4QHOA 5C4WB 1SLIA 1AR73 3ETQA 3ZKYA 4NPLA 5FJHA 1AYN3 3UJQA 4JKKA 4XABA 3ACFA 2CDOA 2WNVA 5C7GA 5A1AA 4QQOA 1NT0A 3DCQA 1A8DA 2D3RA 1BYHA 2WO2A 3F2ZA 5ABJB 4QKBA 3BVCA 5A7NA 2PHXA 4FXGB 2KR2A 4GMP0 4XBLA 2X53S 5SV8A 4OI1A 4O9GA 1RVF1 1F5JA 2DU1A 5FY1A 4LBNA 1CGPA 5F3EA 2WYSA 3AFKA 4IE0A 1AR93 2D6KA 5C71A 3BYWA 2A75A 5CISA 1H2KA 1GZCA 4AFCA 1A8MA 2WZPP 5CAZA 3JUUA 2VZOA 4FPEA 1CAXB 1N1SA 3DF0A 2JE8A 4ZPIA 3AJYA 2BZDA 4A42A 2DU0A 3FHIB 1KXGA 1RUJ2 4BIFA 1MZFA 2RS52 3KVAA 1R1A1 3J4UH 3VDBA 1DFQA 1E5IA 1Q8OA 2RS33 4Z82A 1J1TA 5EQUA 1X8EA 3OTFA 3VDDA 4YZ1A 3POWA 3M3QA 3DEMA 3TYJA 3H50A 3WT3A 4CDQC 2GMPA 2SBAA 1OD3A 3AKQA 3KHBA 1WW6A 2X09A 1IQAA 4M3CB 4XFIA 2XH6A 4QT6A 5DZGA 5JR7B 4R52A 4BLJA 2VOKA 3POSA 1LEMA 1SHWB 1YFWA 3ZR6A 5A7SA 4CXYA 3D3AA 1W8WA 4YM2A 5F3CA 1NLSA 3WF0A 4I2OA 1NA1A 3ZFEC 3GBGA 2D98A 1ZBA3 2A6XA 2WA4A 3LPFA 4FPCA 1W3XA 2D6MA 1W2UA 1UYZA 1AL22 4DUVA 1UZZA 2OIIA 2QQVA 2VCMA 2IXKA 1Y43B 5FLJA 1W6MA 2D7FA 2OKXA 3PVBB 3VN4A 5SV5A 4FBFA 3IDCB 2BFUS 2OUHA 2WIIB 3ETPA 5EXOA 5CNAA 1U5YA 2UWBA 1IS3A 4JGZA 1OOPC 1ENSA 3UL2A 4I30A 3POJA 2IXCA 1UYXA 1Y9GA 2MPFA 4NUBA 2JECA 4FOVA 4ISQA 1XQNA 4BQWA 2CAVA 1A6CA 4Q29A 2AEZA 1NUKA 4QPIB 2ZGPA 4KBZA 3IM0A 4QB6A 1WLCA 5FPBA 2IZWA 1UD1A 1YUDA 4NHYA 3AVSA 1HIXA 3I2FA 2ZX0A 2CGOA 3RRDA 5FPUA 5CU1A 4YVSB 3O1UA 3HJRA 1AR61 5HCFA 1NZIA 4Q0PA 1OF4A 5FYIA 3MW4A 2R49A 1W2NA 1STMA 3GZAA 5JOWA 2C9KA 3RNSA 3SQOA 2VTXA 1ULDA 2WO3A 5L9VA 4FPOB 4UAPA 1DGWA 1UXZA 2WNVB 1R092 5BY5A 4P9XA 5FZFA 4CSWA 4P14A 4EYUA 1OKQA 4HONA 5TSWA 2QQNA 2YU1A 1OHFA 1WW5A 4ISRA 4AEJA 2ATFA 4QXKA 5FYBA 1JZ4A 1DLCA 3EJKA 5JOZA 2BDRA 2ZABA 3MW3A 4LULA 2X29A 2OPWA 2ZX4A 5AVAA 1O5LA 3ROUA 3O1PA 1F15A 3I2OA 4N7UA 2VQAA 3GJBA 3MV11 1ULFA 4IQPA 1RUC2 5FBZA 3ZSJA 2YBSA 3IT8A 3KV5A 1JW6A 2ZACA 5FZCA 3UGHA 4BQXA 3CF6E 2JD4A 4AE2A 1UY1A 5FMDA 2D97A 5IUQA 5HI0A 4QQHA 5J7MA 1H8VA 2EALA 5IVCA 5D1IA 4FPJA 4L9BA 4WVMB 3RSJA 3WOGA 1XE0A 2VW2A 2ZX3A 4MGTA 4FQ4A 4HKWA 3N35A 4LUMA 3ZN5A 4NROA 1O5UA 1Z0HA 5EJ3A 3VB9A 1D4M2 4GJZA 2RMU1 4KL1A 5CB7A 2CHHA 3LDRA 4XHBA 1AR83 4Z07A 1ZZ9A 3AXEA 4AQ2A 2RDQA 3WCSA 1N1YA 3B02A 3SEEA 3JBG2 2RMU2 3GCXA 4JDOA 4UFIA 4H14A 2EAAA 5FRAA 2ZGKA 3OJBA 1HQLA 2ZHMA 1POQA 3PUQA 3M3EA 1LHOA 5BV6A 4GB33 1I5PA 1FMD3 3S7IA 1F4HA 3HD8B 2PHTA 3ZXEA 2W87A 4BCUA 4D7SA 3MF9A 2DVDA 3FFQA 4Q4V3 3TNPB 3B7MA 4H7LA 1HRI3 2JXAA 3CJIC 4META 4NHKA 4AQSA 5A3PA 1VBA3 4RFT0 5KXBA 2ZGMA 3BCWA 2R32A 3I97A 1SFPA 5DXDA 1US2A 1TEIA 2ZAHA 5GLZA 4IV1B 1VAVA 3OGVA 1LOCA 4YW2A 2PLV3 1VMFA 2QQIA 5JMCA 2GH8A 1E5SA 1S0GA 3WVJA 1VR3A 3VBRA 2Z69A 1W04A 2A71A 3BTZA 3PNAA 4C8DA 1DZQA 1GFF2 1WMEA 4XFHA 5DAPA 1H1AA 1PIV1 2IFRA 1RUE3 2CYFA 1AR63 2CDPA 2OQ6A 3ALQA 4XF9A 1O7FA 5JDBA 2W08A 2WJSA 3E5QA 4LBKA 4HK9A 2WNUA 5FZDA 5A7PA 1K5JA 4QHZA 3I8TA 1LOAA 2WFPA 4AGVA 1PMIA 4QU2A 3F95A 1WA4A 5BNNC 4MUVA 4UBGA 2DUPA 1MS9A 2VUCA 3ILNA 3N7MA 4Q0SA 2XJPA 3ACIA 5FY8A 1RXFA 1ZZ6A 3RQ0A 4B4QA 3ZSMA 3MLKA 1S0FA 2JDKA 2ADDA 2XMLA 2XWBB 3OG2A 4YG6A 3WUDA 3WW4A 1JZ7A 1RUH2 1VRH3 1XNKA 4E8DA 3V0AB 2WLPA 3AKRA 2WFF1 4QX8A 3C7HA 3TWIA 4CDUB 1NCQA 5D8AB 2XR4A 3MI8A 4AVTA 2NPIA 2RS53 2LM3A 2WRAA 4BDVB 4WM8C 4XAAA 2B7YA 3FBMA 5AC92 3I2GA 1JU4A 4YARA 1ENRA 1EYBA 2LTNA 2W47A 2XJTA 1BJQA 3LOIA 3MBWA 3POEA 3QD6A 4B1LA 1LHWA 3I3BA 2Y38A 2P1BA 5FYZA 1YCIA 3V64A 4GWMA 3KF3A 1OH4A 1FI2A 1NOVA 1YYNA 3FL7A 3UK9A 1AXKA 4M3CA 3ZKUA 3I4IA 2YYOA 1LTEA 1ZBE1 4M00A 3RYRA 2B5HA 1VBE2 2MEV2 2ZGLA 5KHIA 1UYPA 3CJIB 4KBBA 3ZFGC 2FZ1A 5LASA 3VBSB 4H55A 5FV3A 2R041 1UXXX 1KFXL 4BK4A 4E9KA 4BMEA 5HV4A 3ZN6A 3M3OA 4IEQA 1D4M1 3U4XA 4N53A 5KWRA 4FPHA 1OSGA 2WNEA 4UFKA 2JX9A 4IEWA 1FOD2 2ZAAA 1C57A 4HXCA 1QNWA 2OXBA 2PHLA 4XCAA 5FZBA 5FWJA 3RJRA 1MQTC 1TG7A 1W8FA 3ZYRA 5HCHA 4ZU4A 1RUE1 4QU1A 1IS6A 2BVVA 4EJRA 4LORA 1TE1B 2VUAA 3OGJA 5IK5A 1COV3 1OFNA 4J25A 3JD73 1KITA 3AK0A 5E16A 3ORJA 4CE8A 2BGOA 1W2OA 5JI9A 1DU3D 5FY9A 4AI3A 5FUNA 4AHWA 3H1WA 1QJZA 1SLLA 2VMHA 3EXUA 4XFBA 3GZTB 3WHTA 4AAPA 1SLTA 1ENXA 2D44A 5A3NA 5JXJA 4QWNA 3H8OA 1LOFA 3LSDA 2BPA2 1CX1A 1JZ8A 4DRRA 5A1FA 3TOJA 3ON7A 2C4XA 3I54A 1PMHX 1AL21 4JGYB 2F6BA 3T2QA 4EWAA 1PGL2 3WZ1A 4MGKE 3S5QA 2E26A 3JBG1 5FO7B 2VQ0A 3DKQA 4NHMA 5BNOB 2VZ3A 2UURA 3SCGA 5I8SA 4YZ5A 1XNDA 1YC61 3WG2A 1BBT1 1YFYA 4HKLA 4YG3A 5I8TA 2XWJB 4O61A 3KQ4B 4JDNA 1XPWA 2ETEA 2HEYF 1N1TA 3D82A 4LHNA 4FOYA 1NE4A 3FJSA 4DFSA 1RYYA 4FVVA 5C5TA 1RHI3 2LRPA 4RR3C 4QB1A 5HCAA 4EROA 4LTAA 3IB3A 3Q8FA 1B35C 2C24A 2V73A 3MUZ1 5IAVA 2I74A 4YW5A 1VBD3 3CLPA 5F37A 3ZFFA 4FPLA 2EA7A 3OBRA 1S2BA 1NCQB 4QHBA 3JZVA 4ES8A 3BOWA 1E57A 1JXNA 1AX0A 2GALA 3LEMA 2BQPA 1W28A 4F7ZA 5JLVA 5A7QA 3X29B 2QQOA 4CRQA 1TNFA 4XE9A 2ARCA 2GN3A 2DBIA 2PHRA 2IC1A 1Z78A 3K4ZA 3I2KA 3KT7A 3JB8A 1IS4A 1O59A 3VBOB 4FP2A 3E5UA 3UJOA 1ZBA2 4MXVA 1V6JA 4S2FA 2WZR1 1GP5A 1NCRA 2WAOA 4TYSA 1AR91 1GSLA 3KLSA 1V6LA 3C2UA 2MNGA 3ACLA 2ORZA 4Q8KA 1H4HA 1KFUL 1ODNA 2RR13 5CA6A 4TZDA 2NLRA 5A1LA 1PO11 1REEA 2W92A 4CUCA 4JC1A 2RHPA 2YPDA 4W65A 3DL3A 1JTZX 2RS31 3BIWE 3U78A 5EJ1B 2QZ2A 4MG2A 1ENQA 1RMU3 5FUPA 3GHMA 2H6CA 4HVQA 1PVC1 3D6EA 1FAYA 4LJHA 4J6GA 3V56A 2ID4A 1ULEA 1MS4A 4G4FA 4UXAA 2DV9A 2JKBA 3PTYA 4XC9A 5ANNA 3KD4A 4XJ9A 3ZVXA 1UY2A 4ASMB 4DZGA 2CWMA 1H30A 3HIFA 4N43B 2ZGTA 1CVNA 4LA3A 5DAQA 2Q8OA 5CYYA 1PZ8A 3ME2A 1QOTA 3TN91 4EWEA 2CY6A 1NXD1 3BGAA 5DAXA 3ZYFA 1ZNPA 2YROA 4YM1A 1Y7BA 1W8NA 1PHMA 2GAUA 3ECQA 4FFGA 4IEOA 3UYJA 3ZDVA 4KGGA 4C1XA 1W8UA 2XLGA 5LWBA 3OB8A 2ARAA 4LR4A 1PZ9A 1VE0A 4UT5A 5A7WB 1N47A 4GD4A 4Z2WA 5JWPA 1W6MB 4YRDA 5LEJA 4NJ4A 2ZMLA 4JQRA 4F8AA 1RC6A 2PAEA 1GQHA 2FDJA 4M4PA 4YW4A 2XPJA 2D6OX 4QX7A 4Q4Y2 2OYZA 2PQQA 1VALA 1QJEA 1KD7A 1ND2B 4E27A 1UKGA 2FDFA 5I0SA 4RSUA 3I7DA 1OQ1A 4UF0A 3TEWA 3SNMA 2X8KA 1WCUA 4U2AA 1MS0A 3M7AA 2WFF2 1H2NA 4JTOA 3KSCA 2ARXA 4QAWA 4MGQA 5KC5A 2WNOA 2XLFA 1RJ7A 4ITCA 1HLCA 5HXMA 3NKGA 2OT7A 4QQ2A 1K3IA 4Y4YA 4YVWC 2X05A 2WT2A 4NMIA 4YW7A 3T2PA 3HQUA 3MLJA 4Z8BA 2G1MA 3WNPA 3IDBB 1LCLA 4GZ9A 2R062 1VBE3 2MEV3 4I3PA 5AFEA 3N7KA 2R30A 3MPBA 1C1FA 5A7OA 2W3JA 2X5IA 3GF6A 4IL7A 4AFBA 3WEZA 2EXHA 2JICA 3WF4A 3GGLA 3KZ4C 5GJ6A 4QX3A 2A5ZA 4PDWA 1JI6A 5C8CC 4XETA 2FMDA 4RGGA 2YGMA 2R073 5CKQA 2HWC3 3SITA 4CUBA 2N7GA 1IG3A 5FP8A 3I49A 1SG3A 5F5CA 4ARYA 5C4WC 3B5LB 2J1EA 2JWPA 2PELA 3GNEA 3SXWA 2Y6JA 1X33A 5JPNB 4FSJA 4BQ4A 5KBFA 1T6GC 2JIJA 1XB9A 5IVJA 3USUB 1RVF3 4LBLA 4DINB 2Q1MA 3MF6A 2PLV2 1JS9A 3ZFEB 4RL7A 4LO8A 5BUVA 1W8HA 1KGYA 1UZ0A 2R043 2RJKA 4TSVA 5DDJ2 1IS5A 4LBQA 3S30A 3NNLA 4QX2A 3Q8EA 1WCQA 1HB1A 2BNNA 4LIUA 1E5HA 3NJXA 2YDEA 4HL0A 4UOJA 4DPNA 4XF1A 3WF1A 4CDUA 4GKYA 3VD5A 4XBNA 3J9SA 2G9ZA 4FOWA 5C33A 1JZ3A 1H6YA 3GJAA 3VGIA 3RZMA 1NY72 2HWB2 1YI9A 1CIYA 3OUJA 4MLOA 1QJY3 5EYYA 3VD9A 2H6BA 3VDCA 3TN92 1R1A2 5F39A 3LA7A 2O8QA 1EAH3 2GDFA 2NQYA 3R0RA 4AHXA 4QM9A 5FZ4A 1HB2A 1PK6A 1RUH3 1VRH2 2JDPA 3LAGA 2R0HA 2RM22 1Q8SA 2PYTA 1S2EA 2X5IC 3P1IA 1Q8QA 1G6NA 3LF7A 1GANA 1H8TA 4A44A 3OBZA 3RVHA 3L2HA 4L99A 4BYYA 1QJFA 5D21A 5JSPA 1QXPA 1OUXA 2A70A 4DUXA 3PDQA 1OLQA 5AC93 1HJFA 4LQRA 3FLPA 4YVWA 1WMFA 1K45A 5B2GB 2ZGRA 1PO23 2BOJA 2Z79A 3FWEA 5BXXA 2CSGA 2W91A 1GQGA 3VZJA 4ASLA 4CDWB 1OKOA 3VKLA 3E1F1 5IHRA 3MIFA 4FPGA 1JN2P 3VZMA 4FCAA 3O14A 3URFA 5F5AA 4AFAA 2VZTA 3HAGA 1NAEA 2WN2A 4XZPA 5EZWA 5CEHA 4R9AA 2ZZQA 2Y26A 2C1FA 2LW8A 4QGMA 3AP6A 1VBB2 4AG4A 4IE5A 4GWIA 3OUIA 3LFMA 1NA1B 2DYCA 3TB0A 5BNOA 1H6XA 4X8PA 2VQUA 4NRPA 3U37A 4CP9A 2RR12 5ACA1 1MR5A 3IMMA 1W06A 2XVKA 1BMV2 2V09A 1PO21 2YBKA 5FYCA 4JAAA 1BEV3 2WWUA 4URAA 5D8AA 2FDHA 5K9YA 4IGQA 4N43C 4OHVA 3HQXA 4EQVA 1FXZA 4IGPA 5LW9A 2WDBA 2HWD3 2IXLA 3KMHA 3THTA 5JSOA 4YWAA 2DCJA 5FZ6A 5GLWA 5ACA2 2CAUA 2A6VA 3NAPC 4YVSA 1RUH1 2C26A 3LB9A 2H0BA 3QLQA 3LZZA 1HQNA 4L97A 3PJQA 1CR7A 3ZPYA 5JR2A 4NAOA 2IUWA 1FMD1 1RINA 5GLTA 5H9RA 3RWNA 2P34A 4CU8A 4EE2A 1LULA 1LGBA 1W6QA 3FC0A 3DPRC 3LQCA 1OD5A 2W5FA 2ZGQA 4YG0A 1HRV3 1V6OA 2G9GA 2JG8A 3Q9OA 3SH4A 5C3QA 2PFWA 3NMBA 4XEZA 5FZMA 1QJX2 1NQJA 1W9FA 5JOXA 4LBJA 1ZRIA 2QCSB 1PM7A 5CFCA 2FDIA 4LBQD 3SHRA 1BZWA 3JBG3 3KV4A 2Y6HA 4PBPA 3CDZB 3VHRA 3WNLA 3ZDSA 3VV1A 1W90A 4I09A 4UW6A 2Y6FA 3HT2A 1C5IA 1CAUA 4GB32 2VJXA 1IQDC 3AKSA 4PJYA 3WW2A 4D8MA 1BBT2 2HWD1 1R091 4BH9A 2HYXA 3POBA 5ERLA 5AFBA 2J1AA 1VBD2 3RZLA 2V72A 1TVGA 1XNCA 3AP9A 2XB6C 2Y0IA 4UBHA 4UW3A 3ZYBA 2PQSA 1QH7A 1U0AA 3C8XA 4CDXA 1RUI3 1YQ5A 3ASIA 2WL1A 4IEYA 1VRH1 4LO6B 5A33A 3WDVA 4J1WA 2D3SA 3VBUB 5C9AB 4LKFA 2D43A 5LA2A 4OZXA 2W1UA 4Q4V1 1N3QA 1VLNA 4CEYC 1JOPA 2VZPA 3I3DA 3HBZA 4BXSV 1D0GA 2WN3A 3AYCA 4W6YA 5FFOC 2FDGA 1HRV2 4IDZA 2KD7A 3T30A 4IEPA 1ZYBA 2RG4A 2DUOA 2HWE3 1SLCA 2YHJA 2ZHNA 5AVPA 2HWF2 1L7QA 1OLRA 3CQOA 3RS6A 4Y20A 4PI2A 5JXGA 1XE8A 2QQKA 1JH5A 1ZRCA 2XONA 2B42B 3PURA 2VXRA 3ZIWA 4BISA 1YLLA 2XL9A 4FPFA 4NO4A 1UZWA 1K5MA 1PM4A 3A4UA 2IVJA 4ZHNA 2DTYA 4LUKA 1KS5A 5FR3A 4FTBA 4QXBA 2VR4A 2VXJA 4V2VA 4Y22B 4MHUA 4XJ8A 1O3QA 3S7EA 5A3MA 3B93A 3EB7A 4AYUA 2JG8C 4LBQB 1XNAA 5FZ0A 3H0OA 5KHHA 4BQ1A 3VBOA 1AR81 5JCTA 2ET1A 4D6QA 1LOFC 5JOYA 2WBKA 1QXRA 4XDOA 3VDDB 1EV12 3MIHA 5FZGA 3O7OA 2JG9A 2HWB1 2IXIA 3AMPA 3CU7A 4Q2FA 4CUGA 3WHUA 4EN8B 4YVSC 3CJXA 2W94A 3EHKA 3R05A 2BBVA 2ZEXA 4BU2A 3TBDA 5A32A 2XUMA 3VZNA 4RGKA 1MZEA 1OPOA 1AVBA 4JV4A 1CD3G 3TEZA 1ZM1A 1OBNA 3GCWA 2EICA 4FAGA 1G86A 4TN7A 5FCCA 1YI7A 1W6OB 2VMGA 5FZEA 1MZ5A 4BQ2A 2NP0A 1JBCA 2B46X 3JU9A 2Y6GA 1UPIA 3AP4A 1VB2A 3OEAA 4GKXA 2HWF1 4JGZB 2RVAA 5GZEA 2BUKA 4B7KA 4DS0A 1AF9A 5BNOC 1TQ5A 1E5RA 3KV9A 3POGA 4QKDA 5DUUA 5GZFA 1UAIA 4QQPA 2ADEA 4UI9L 3UKVA 4P9LA 2W1SA 4WM7C 3KB5A 1ULPA 4S2HA 2GC0A 1VBC1 3FE5A 1ND2C 2IXJA 2R071 5LBBA 4N8MA 5LY1A 4I0AA 4CDXB 5ABJA 4Y1ZA 3CO2A 2SLIA 3MIGA 4Q4W2 4X6RB 3A23A 4LK6A 5FMOS 3R6SA 4AI9A 1RUI1 5ABJC 3AZWA 4CPBA 1XJAA 2B9UA 4CDWC 2VW0A 2NZ9A 3AZZA 1QQP2 4LO4B 3R4SA 5A80A 1AYM2 3VHNA 1MQTB 3ZXJA 1WGPA 4IE7A 4W6WA 5FZAA 3RFRA 3M2MA 2DBNA 1MVEA 5EIYB 5DZFA 3H7YA 1QJU1 2E9QA 2XOMA 4PIXA 1WMDA 1QF3A 1UU4A 4XFAA 4AVSA 4M0NA 3H3ZA 3POYA 5FTTC 4XUPA 4Z92B 4A7ZA 1UOBA 1UOFA 2PXJA 5H9SA 5FZOA 2VU9A 2DCYA 4NIDA 3E6DA 5GLVA 3PIJA 3VL8A 3DKWA 4TWTA 1AJKA 3HOBA 2FCVA 3IMNA 2O1QA 3N9NA 4IV3B 1V9U1 3OUHA 2BGCA 4QPGA 4KG8A 1U12A 3WSOA 5K0UC 5DZEA 1H2MA 2HWD2 5FREA 1DGRA 4W50A 1UZYA 1GMMA 2ZX2A 1W39A 4QX0A 2QTWB 4XJWA 2Q8EA 4CEYA 1BXHA 3OYWB 4XMAA 1B09A 1S1AA 5FY4A 4CUAA 3J7HA 5FK8A 4CU7A 2R1BA 4UFHA 2HYKA 1GNYA 2RJLA 4FXKB 3RZZA 2K46A 5FZ9A 3ZYHA 1CZVA 3N7LA 3J7LA 1VP6A 4GWNA 5J98B 1LESA 1DGRN 3MIDA 3AYAA 1ND3B 1QJX3 3BPSA 5L9RA 5LATA 2DTWA 3WNNA 4CU6A 4MO3M 1EUUA 5C4WA 4HT1T 4L11A 4OUMA 2J1VA 3SH5A 4ZY9A 2IVIB 3MICA 5JZGB 1XYNA 2J1UA 2PHDA 1AR92 2W39A 2W2IA 4OHWA 3TEXA 4F3JA 2WT1A 5T5PA 2HJIA 3THPA 2AREA 3KS7A 4YLZA 4R4XA 4KI5M 2A73B 2ZTNA 4MGZE 3JXSA 5C8CA 4KWLA 1UX6A 3A21A 2PAMA 2VVEA 4JVAA 4JKLA 5CFCC 1PMJX 1ULCA 2CL2A 3AZVA 3BODA 3GM8A 5GKAC 3V65A 3VBFA 4B1MA 5DUVA 4MXWA 5IFPA 2CV6A 4JKMA 5ISLA 4K1YA 4D69A 2CGNA 2GSYA 2OZ6A 2RS32 2XJSA 5IW0A 4HPKB 4O7XA 1WWYA 2FCTA 4JHZA 4Z2AA 4IUGA 2RS13 4YM0A 4OUSA 5FYSA 2A1XA 4D94A 4BIOA 4NIGA 1WCKA 2UWAA 1W03A 1D2SA 4MV2A 5FP4A 4BXFA 1CAXA 3LE0A 3PUSA 2B39A 1YQCA 2QDRA 3PUHA 3BIEA 5FPAA 1CZSA 2JE9A 5A3UA 4CDXC 4QDSA 1TNRA 4K8FA 5K8SA 4YW6A 1C4RA 4E2SA 3N4MA 4EWDA 4IEUA 2JIGA 1NZCA 1DZTA 2AYHA 3JCIA 5D8AC 3CL1A 2HWE2 2VD7A 1AJOA 1FYUA 4Y1UA 2W46A 3H7JA 2Q8DA 1ZBE3 2UWCA 3VLBB 5A3WA 4DXSA 3NSTA 1S0DA 3D5OA 3NV2A 3WCRA 1NXMA 2PTMA 4D7YA 2EXKA 4Q4Y3 5CFCB 3HR9A 2XJQA 1TME3 3NNJA 4OQ8A 2I2SA 1BEV2 3AM2A 4BZ4A 2PHUA 1W0PA 3DPRA 4M3CE 3U0ZA 3NWKA 2Q0AA 1F35A 2KA3A 2E63A 3H42B 1H4GA 2NM1A 1WBLA 2EIBA 3J7NA 4IEZA 4Y3OA 5C9AC 2ZHLA 2VOWA 3MIBA 4W8JA 2O14A 4Q1RA 1JHJA 4AVCA 4NVPA 4DO0A 1HXS2 4ATEA 1W6OA 1F2NA 2UY8A 1GNHA 2ZMNA 4GMP3 3VUOA 3V0BA 1YRZA 1FNYA 1V00A 5FUIA 4ES9A 3RYPA 5LY2A 4AFMA 3PHMA 1ALYA 4JRLA 3QBQA 4AL9A 5FY0A 1LENA 1QY4A 1GWKA 5DPNA 2ZGOA 3OGRA 3BPZA 5C9AA 3FUOA 2ZEYA 5T3NA 3M3IA 1AR62 3WQ7A 4XUQA 3RZKA 2VMCA 4QPYA 3ATGA 3QH6A 1IZ3A 5IVVA 3AL5A 3RYKA 4WVVA 4K40A 4AHYA 3AXDA 1OXCA 1XSQA 3CKHA 3HN1A 4P5HA 4LIVA 4KMQA 5FZLA 1YHFA 2B45X 4JZRA 1QWRA 2R7EB 3A0KA 5DG1A 3VBUA 3H8RA 3HNBM 5C70A 1IKPA 4FT8A 5IVYA 4L92A 2WQ8A 4SLIA 4PF5A 3NV3A 2WAAA 2XLAA 3AVRA 4UF0B 1V6MA 1X7NA 4Y1VA 1UMZA 2A6WA 4XW3A 2AC1A 3W9AA 4OULA 3HWJA 3W58A 5C3PA 1CAVA 1IPJA 3B9IA 4EN6B 1SLAA 5C6CA 3Q8CA 2JDAA 4PQQA 2HWC1 5J48A 4XUOA 1HQWA 3N9MA 3SC7X 4CDQA 1FPN3 2IFWA 4UW5A 4WV8A 3HMYA 4KGQA 3ST7A 2GH2A 1HJGA 3ZOIA 4HSJA 1AR72 1Q5OA 3THDA 1AYN2 2RDNA 3WF3A 5IT6A 5IK4A 2UU8A 3DECA 4QX5A 4Z1VA 2A7AA 1WZXA 5CFDA 1O3SA 5K0UA 2RMU3 4YVWB 4CZSA 1CJPA 2JDYA 2R16A 1J3RA 1Q43A 1PK6C 1DF0A 3EBRA 4OZOA 2P17A 3C3VA 3SEPA 3T09A 3LD8A 1J83A 4CEWB 4RS5A 1LGNA 1W9TA 2BP6A 4YZ4A 3ITQA 3WR0A 2AZ5A 2ZMKA 4NR1A 3MHZA 1GOGA 4H7MA 2JDNA 2WQ4A 5E1RA 5D2AA 2GNBA 2QDNA 1KDKA 1UWWA 2YC0A 3O12A 2V4VA 3ACGA 1COV2 1UOJA 4LK7A 4OCTA 5T52A 4NPMA 3DXUA 5CFDC 4JX0A 1Z7S3 2WNVC 5E89A 2VBPA 1CONA 2L9LA 1ND3A 4EV0A 2WT0A 1SPPA 5L9BA 1O4YA 5EWSA 2BGPA 2JDZA 2P4EA 4CP9B 1PO22 1POV0 3U07A 4Y4RA 3O1SA 1S2KA 3E5XA 4BE3A 5FXZA 5T50A 4IE4A 4AGRA 2XJRA 1AXYA 3NV4A 4JGYC 3ZSEA 1EY2A 1ODMA 3OSDA 1WCSA 4E2QA 2ZX1A 1A78A 4MGYE 3H3LA 2HWE1 1DQ2A 4P9IA 2DFBA 4WBBA 4HANA 1R081 1KEXA 1UW8A 3LIHA 1WLWA 1BHGA 2VL4A 3AZYA 3IDEA 3M70A 4PQ9A 5FMOL 3ZM8A 1N1VA 3WD5A 3BKZA 1ND2A 3LGRA 4LHKA 1BVVA 4CPBD 1W05A 4LBMA 1V70A 2AENA 4PLNA 4WVZA 4B3NA 1VBB3 1AZDA 1OLMA 2VUJA 3VKFC 1H1MA 1SFNA 2VMIA 2XHKA 4XJUA 1W9SA 5T5OA 5CBLA 3VD4A 4BQ3A 1MEC2 1RTVA 1V9U2 2R0FA 1RHI2 3POFA 3VBUC 2YGLA 2JDMA 2VUDA 2Z5WA 3AC0A 1AX2A 4OI0A 1WLTA 3A0NA 3AL6A 4XXPA 3HT1A 1Z7S2 1SLBA 3INAA 2GC3A 1DBNA 1EP0A 1GYKA 2V4AA 3S6PA 5FY5A 1K42A 2J22A 5FZ7A 1X82A 2W1WA 4XJAA 1WA6X 1CJDA 3HNMA 4R8HA 2P37A 2VCCA 3M4FA 2VOTA 4LHSA 2VMEA 1LGCA 4HVOA 2ZGUA 3T3YA 4AI0A 4XTPA 4AOCA 2JG9B 4COZA 5KHKA 3J8F1 3SMHA 1MZ6A 1FNZA 4P5YA 1GKBA 1JZ5A 5FO8B 4ZXEA 1QJY1 3VBOC 2PMWB 1RITA 1LU1A 1QNYA 4QKNA 1YIPA 3ES4A 4PCRA 4E4HA 1QJY2 3N9OA 2ZGNA 2ZKNA 5JSRA 1CAVB 2K2SA 5FMBA 3DXTA 1MEC3 2ERFA 4MOAA 4A45A 1NKGA 2Y34A 4MH0E 1XSRA 3QH7A 2VH9A 3PMEA 1L7RA 3ZYJB 5A7WA 3CZUA 2NYYA 3NAPB 3NL1A 4Y20B 4NRQA 2CU5A 5I0TA 5FZHA 3BUCA 3B01A 4TLGA 2VM9A 2CWSA 3FZ3A 4ONUA 4CCEA 4AWDA 1F8VA 2BYVE 3VL9A 4MVTA 3CMGA 2ES3A 4UFMA 3ZXFA 3KT1A 3UGFA 4AEDC 1G9AA 1JUHA 2GC1A 1OLME 1L3JA 4XQ4A 4AVVA 1COV1 2XXZA 3AJZA 3AP5A 4ZZ5A 5E6HA 2QQJA 2VTFA 3G7DA 2JG9C 2VQTA 2VAUA 2KM2A 5C3RA 4Q0VA 4XZUG 5FLIA 4AR2A 1H8TB 1I9RA 4XBQA 3RPQA 4LKDA 1BLZA 1UYYA 2EIGA 1C28A 4XFGA 3ZYIB 2AR6A 1OUSA 1YQ2A 3G6JB 5LK5A 1D4M3 4KH9A 1ZVFA 3TRSB 3DYOA 3EYPA 3CBNA 4A6SA 1PGL1 3PVEA 4XDQA 2XVGA 1AL23 4OUEA 4FOQA 2UY9A 5KR7A 4AQ6A 1M4WA 1I5ZA 2XBO1 5FYTA 1AYN1 5JZGC 1YIFA 4CDQB 1K5MC 1JODA 4Q1PA 1N3PA 3R4DB 2PAKA 3K51A 5FPLA 4X6QB 1P8JA 3O1RA 3A22A 2VTXJ 1BQPA 3ZYGA 4XQWA 2AACA 3SKVA 3ZSKA 4BWOA 5DMYA 1SBFA 4IGOA 3WW3A 4QPWA 4U36A 2BJSA 3GYDA 1W0OA 4DRVA 2XQRA 3ACHA 3WNXA 4E8CA 3GZEA 1F9KA 1EPWA 2ZHKA 3AKPA 1BK0A 3ZMOA 2DCKA 3DUIA 3OBAA 1EV13 2VOVA 1RUOA 1PGSA 4AXOA 2RS51 5K0UB 5F6LB 2WZR2 5L7OC 1OA2A 5A6XA 3BOPA 5F9TA 4P02B 1XYPA 4QPGC 5IK7A 1RUE2 1POV1 1YXWA 4PBOA 1WD3A 2XBO3 5FXWA 3NO8A 5F3GA 5T5JA 1W0NA 2GU9A 4GMP1 4GIQA 2WA3A 4MSVA 4OMDA 2BW8A 3ABZA 4UFLA 4Y5SA 5H9PA 4A3ZA 2FHRA 3RJ2X 4DXZA 5I0RA 5L36A 2RDSA 4XOGA 2HKXA 1DHKB 3H3UA 3W20A 1K12A 1S4CA 5DAVA 2HH9A 1SCRA 1GZTA 3VHOA 1GLHA 1TMF3 3B3QE 2R072 4PIZA 5A3TA 2GNDA 3VBRB 2JJ6A 2WZEA 1OVPA 5L73A 3UKNA 1X9PA 1MS3A 1YWKA 3E6BA 1HV0A 3ZLIA 3MPPG 2NN8A 4MGSA 4P00B 4DEQA 2RS11 2GN7A 5ACA3 1MVQA 2UYBA 3WDTA 3LKJA 1HRI1 1GOFA 4P9YA 1PVC3 3OGSA 4XVHA 4XAEA 5E88A 4CDWA 3D8CA 3LA2A 4OHXA 4AI1A 1BEV1 2JB4A 4LOSA 3SISA 3ZXDA 1J1LA 4CU9A 1KDMA 2R042 1BK1A 3OY8A 3MDPA 3ZPOA 1HN1A 3AB0A 3J26N 1CAWB 4MGIE 4CVUA 3OYWA 2QE3A 4CCLA 3NJZA 4CCNA 3NKTA 1AYM3 4WM7A 2WS93 1WD4A 1LOGA 2VOXA 2W9XA 2WSUA 3H8XA 4JQTA 1TMF1 2RDRA 4FAHA 2BERA 1NE6A 5GALA 5JMOA 1GR3A 2WLQA 4ZU5A 2EIEA 5EJZB 3GALA 5IYYA 3HVDA 4R4ZA 2LS6A 1H8TC 1EAH2 2VC9A 5LRSA 1GQPA 2ARBA 2GZWA 5FKBA 3JQWA 5F8PA 3I2IA 5FZ1A 5F1RA 2XDVA 1GUIA 1X8MA 2GP3A 1AXZA 2ZGSA 3ZFGA 4DNYA 3ENRA 3I2DA 2D40A 3WP3A 2ZA9A 4QQLA 1GICA 1W2TA 1VB4A 2OQ7A 2P5BA 5LZ6A 2WFF3 5C8CB 1F31A 3FBYA 2HBUA 5I8YA 3N9QA 4ZS2A 4COUA 1F5FA 5EYXA 4NIAA 1Y3TA 4RQPB 1QJX1 1PNFA 3HEIA 3MZHA 2CGPA 4HETA 1SDDB 2DVFA 1JYXA 1WKYA 4LO5B 4BQ5A 1B35B 1OA4A 4JGYA 5A70A 1AL0G 3ILRA 5I0UA 3ES1A 1AX1A 3L9JT 1EUTA 2GNTA 3P3NA 4C90A 2ZJCA 1JU3A 1NCQC 4ZZ8A 5A6QA 2W52A 1ND3C 4ORFA 1JHNA 1Y4WA 3NW4A 1JZ6A 3BTYA 1UQXA 3EQEA 4RD7A 2HEWF 2R061 4CA9A 4DB5A 4XIKA 1QQP1 1APNA 2CNAA 1GWLA 2J1RA 2I07B 4HK8A 5FZOB 2FMYA 4HPKA 4C1WA 4LKEA 4YFZA 1XU2A 2WNUC 1OPMA 1YNAA 1S0CA 2VVDA 4FI9A 4JTNA 1UL9A 3IN9A 4K1ZA 1YO8A 3N36A 4RS5C 4RA0A 1W99A 5IVBA 2ZXQA 4N9IA 4WZCA 1SEFA 2FBEA 3ZN6B 1JYCA 1PNGA 1DQ6A 4NHXA 3VDAA 5B4NA 1SACA 3MV01 5FZIA 4DY5A 1HB4A 1SCSA 2RV9A 1UZVA 1DIWA 3IAQA 2RS12 4AZZA 3GHNA 4WM8B 5DDJ3 1ZZ7A 3PTRB 4BJ0A 5J09A 5JPMB 4I0BA 4XCBA 1QQP3 3NNFA 1XYOA 2Q30A 2WINB 4PI0A 5FYYA 3CJIA 5GZGA 2TEPA 2NMNA 1UPSA 4H3WA 4HBNA 1R093 2PHWA 2V5YA 5ANQA 4A4AA 1RJ8A 1ZRDA 1JOJA 1OMIA 4LE3A 3VKOA 2XGXA 4FPYA 3T0AA 3WX5A 4LMFA 2E33A 3WNOA 4DXRA 5F5QA 3J8F3 3WQ1A 1RUD3 4LXLA 2QVSB 3LSEA 2FQPA 1C8NA 4QMAA 1RB8G 5APAA 1G9DA 1A3KA 4GALA 2FCUA 2YY1A 5FPVA 1UY4A 2QQLA 1DDLA 2BBAA 4O9EA 4E4ZA 1RUJ3 1EAH1 4D6RA 1W6QB 1UCXA 5JI7A 4P08A 5FPXA 3V0AA 4K20A 2ZBJA 1CESA 3U75A 1PGW1 3AYEA 4LO7A 4BMBA 4C0HA 4WM7B 5T5LA 4YM3A 4CP0A 4C91A 5LA0A 2PN5A 5FY7A 3VBFB 3PLQA 1JYWA 3VD7A 4LOTA 1JMUB 2D93A 4K6BA 1PGW2 3LDBA 3RG0A 5FWEA 3NAPA 5LRRA 4CCCA 4BQYA 3O0XA 4QXHA 5LBFA 2XHNA 4LPLA 2R1DA 4FFFA 4MADA 3AFGA 1TZOA 4N43A 4Y5Z0 1C5HA 1YJKA 4YGDA 3ZSLA 3NNGA 5FKCA 2OS2A 1G9FA 5F7UA 1BKZA 5A6ZA 3WP5A 1MS8A 2D6LX 2YFUA 1UO9A 1SDWA 4JDMA 2ZOEB 3J8F2 1YJLA 2LROA 3VBSA 1ZREA 1OURA 4P9WA 3Q8AA 5F3IA 3RMXA 1UY0A 1IGOA 4COWA 1KQRA 5FQ0B 3POIA 3UT0A 4CP2A 3THCA 5KC6A 5AC91 3T4VA 2WKKA 1XXNA 1XE7A 2E6VA 2YPJA 3PUAA 3ZFEA 3KM5A 4HN0A 5FLHA 1VBA2 1V0AA 3OCPA 4M0HA 5EP9A 1AR71 1DCSA 1NCRC 1QOOA 4QDRA 4FPKA 1WW4A 3I2JA 4HOOA 5LA9A 3BTXA 2Y6LA 4AK3A 2B4KA 2VO5A 1O6UA 3GDBA 2QZ3A 4AEDB 3KF5A 2PA7A 1PX4A 4Y33A 5FZ8A 4LNVA 5FYUA 3IZOA 3P6BA 1RUJ1 2JKXA 1WBFA 1G9CA 1W2AX 2YZ4A 4WVMA 1VAMA 3MIEA 3K77A 5HXVA 3V0BB 3FHQA 4RS5B 4LT5A 1R1ZA 2JD9A 4XIOA 2VZVA 1ZZCA 4UYBA 1W6PB 2Y0OA 3BALA 3GBWA 4L2NA 2AEYA 4S2GA 2X5IB 4Q0QA 1KS4A 4XMIA 1AUYA 5HCBA 1UF2C 3VBFC 4MXWB 4RGAA 4EN0A 3ZFFC 3GZUC 4XTMA 3WG4A 3WDXA 5I0DA 4HG6B 1BBT3 2ZEWA 2RJ2A 5JAXA 3OF1A 2HWC2 3H8UA 1B35A 4OVEA 1GP4A 3WY6A 3AMHA 4WZFA 5DUWA 1WCDJ 3U10A 3RZHA 4PT6A 5F5IA 4OYUA 1JUIA 1LR5A 2DF7A 2XUEA 5FJKA 4GWJA 4MZUA 5E8AA 4GB31 4QX1A 4RQPA 4Y26A 5CKNA 3BU0A 2JEMA 4ZONA 4Y1XA 2DUQA 1ZA4A 1Q56A 2BWAA 2BTVC 2D6NA 2QFEA 4CDUC 4M3CF 4TLFA 3USUA 4AEKA 2OX0A 1NQDA 2O0OA 3NJVA 1HB3A 3UNPA 3NJYA 4TTGA 4EZ4A 1FT9A 3NQHA 4D3WA 4GAZA 3E97A 4Q4W3 1NX9A 4CCMA 1J58A 1LJ7A 1GZWB 4GA9A 3VDDC 3E6CC 5CG9A 3KCCA 4CEWC 1REFA 2Y8KA 1CQ9A 2Q1FA 3UESA 2RR11 4RHV3 1HKDA 2H0VA 3K3NA 2VNVA 4IW3A 4HZFA 3VKNA 1GZ9A 3MFAA 2C9AA 5DABA 3K4DA 2OZJA 2VMFA 2HWF3 4K3UA 1PIV2 5JVVA 5JIUA 2UYAA 4LA2A 4P9JA 4DIQA 1G9BA 3KHCA 4HFSA 2K9ZA 3SCFA 3ZXAC 4FTSA 4NN0A 5FK7A 4B8EA 4DUWA 4FFIA 4KWJA 5FZ3A 4LKSA 1TMF2 5CZKA 5GZCA 1D7PM 4IV3C 3JD71 4LBOA 4RR3A 1MQTA 4YSFA 1ONAA 4HVRA 5T55A 3IWZA 1I1EA 4XURA 3RI9A 5IATA 1CX4A 3H1YA 3SLIA 3JD72 1IG0A 4JRAA 4N53C 5LBCA 1NG0A 1QXJA 4Q4W1 3VZLA 4ZXKA 4NHLA 3O1TA 2YC2A 1C8M3 3AMQA 4C0BA 5FXXA 1LU2A 2J1SA 4QDQA 4IEVA 3T2TA 2GC2A 5BNPA 1AHSA 4BA6A 4E4DX 1DYPA 1UN1A 4BB3A 4ZS3A 2ZCWA 4N90A 4XFFA 1U5ZA 4QKFA 3UETA 3D4KA 4AI2A 2VNGA 5IVFA 2VE1A 4QD2A 5FMCA 1RHI1 3WG3A 2R063 2E7QA 1GU3A 1C3HA 2JB8A 2XVLA 5C3OA 1U5XA 4Q26A 1VMHA 3FHAA 1IPKA 1QJU2 3PJYA 3I59A 3CEWA 1WUVA 4Q5OA 1PO12 4EZHA 2B9VA 3PUIA 4IETA 2BWCA 4QB2A 2DVAA 2XQXA 2YB7A 2YU2A 4IV3A 4KU8A 5FAXA 5K7PA 3OBTA 4PDWB 1LKNA 3LDKA 1I6XA 4KU7A 4XUNA 4NE9A 2WO7A 3UV9A 3O0VA 1ZRFA 1NLQA 1W8TA 1HXS1 4AVBA 5FP7A 1W6PA 2A3WA 2VVFA 3LEKA 4D6SA 3KCYA 1LECA 5A33B 5BNNA 4IXLA 3K4AA 4DQAA 1MEC1 2GNMA 2F17A 1W8ZA 1QH6A 4NAMA 3OY8B 1LEDA 1RUG2 3KGLA 1D0HA 2WWSA 5CADA 3AP7A 1OVSA 4XDPA 3DPRB 2J7MA 1J84A 3VZKA 5J1XA 4LLFA 3AKTA 5FZKA 3OGGA 4CXWA 1WMXA 2P6CA 2WYFA 3HBKA 1AYM1 3R4UA 3DGTA 4N53B 1JYVA 4UFJA 3OPWA 1GZWA 4YGEA 2XL7A 1MS1A 1VBB1 4XJZA 3ZXGA 4RQPC 1DGLA 2VY0A 4FO9A 5LB6A 1CZTA 4OHZA 4PLOA 1QDOA 5GLUA 3ZXKA 3SH3A 5KXEA 3KT4A 4LE4A 4Y24A 1PO13 4XUTA 2Y33A 4ATFA 1VIWB 3MW2A 1RXGA 1WLDA 1OQEA 3ZYPA 1OOPB 1R1A3 4I02A 4PF1A 3ZFGB 3ILFA 3TEYA 1VBE1 2MEV1 5G04L 1HDKA 4UWDA 4YGBA 3ZXLA 1OA3A 4QM8A 3IPVB 5A3LA 4KG0A 1VBA1 1U5IA 4QPIC 4YNIA 5IVEA 4Y1YA 2EAKA 4PHZA 3WXPA 1DQ1A 1ZRRA 3IAPA 1H1IA 1REDA 1EV11 1GWMA 3W21A 4IEXA 1OT5A 1RMU2 3ZN4A 1VJ2A 5BYNA 5F32A 5KXDA 2QQMA 2W1QA 1ZZBA 3PIGA 5G05L 4FTEA 1LAJA 2R6QA 2DCZA 5CKMA 2G4IA 2QNKA 4L0PA 2Q1ZB 4DXTA 3K2OA 3USSA 3HN3A 4KWKA 4ET7A 4CXXA 5LA1A 3W5NA 2BNMA 1HXS3 2OW4A 4RYDA 2TUNA 3WQBA 2VBDA 2JDHA 1HN0A 4GULA 3WF2A 5IWFA 1JYNA 2AUYA 4IE6A 1Q8VA 2P3YA 2DDUA 1W9WA 3KWVA 4I3GA 2VCBA 2P6HA 3VBHA 1RUNA 2E31A 4AGGA 5FOBB 4DOUA 4B7EA 3NNMA 1H9PA 5J96B 4V1PA 2BVBA 4AF9A 3KCXA 1QU0A 4GQ7A 5B4XA 4AHZA 5FYVA 3QCWA 3O5SA 4Q4X3 4X8NA 5F2WA 2ORXA 2TNFA 2E7TA 3IPVA 5BPXA 1Q8PA 1RUD2 1FV3A 2W68A 2G9FA 2ZEZA 3MUY1 4PIYA 1LHVA 1IPSA 5BNPB 5HV0A 4J1XA 1SQ4A 2RE9A 1J3PA 4CTEA 3H1MA 4SBVA 4DMIA 1VBC2 2VPVA 5DG2A 4PLMA 5KXCA 1IKQA 2A3XA 2JG8B 2Z42A 2E7AA 3KVBA 1RUF3 2Q4SA 2V5DA 3FFZA 3VBHB 3P5BA 1SPPB 3WUCA 3LIGA 3HNYM 3FX3A 3ELNA 4TXWA 1K5MB 4YFWA 3IKWA 3LOBA 4LITA 3LEIA 2WS91 4KNCA 1PVC2 3Q8BA 5T54A
chains in the Genus database with same CATH topology
1RMU1 1FPN2 4BPZA 1RUG1 1BVP1 2BEOA 5L7OB 1DZRA 2TBVA 3FMGA 1PVXA 5LEKA 4XILA 5H9QA 2YUEA 4ZU7A 1DYKA 3MGUA 5BNQA 3PMSA 3VHPA 4YZ3A 2DVBA 4XYXA 1O4ZA 1V6NA 5KHJA 4Q4X2 4Q8LA 1PIV3 4W6XA 2QJVA 2LALA 4B4RA 1QMJA 1NLRA 2P3JA 1OOPA 5J37A 5LK7B 2ZZJA 4UW4A 1KRIA 1XU1A 1RUC1 4LHLA 4GXLA 4AFDA 3EO6A 1TME2 3BU7A 4INDA 3JB4C 2IXHA 1RUF2 5JIAA 1H2LA 2XJVA 4Q27A 1S0BA 1N3OA 1RIRA 2XKOA 2QUOA 2VW1A 1J3QA 2OUJA 1KJLA 2EVXA 1NA1C 3AYDA 3VBHC 4R9DA 3M1HA 1DG6A 4MX3A 3QOPA 3MEPA 5FDBA 4N7IA 4NOTA 4A3XA 2QQPA 1O3RA 1ASJ2 4WM8A 2GMMA 4URTA 3MFCA 1H9WA 2PHFA 1GNZA 1LOEA 4F83A 5FO9B 3U11A 3WDUA 2NMOA 3MLLA 3BB6A 1DQ0A 2I45A 4JGZC 5FOJB 4FP3A 4A2UA 4S2DA 1NY71 3N3HA 3B9CA 1C8M1 4OLLA 2C5DA 1O3TA 1HRI2 4OFGA 2K0GA 1SMVA 3K48A 1LRHA 1RUD1 1Q3EA 5KHGA 4XHXA 4OI4A 3QACA 1S0JA 1QGLA 4I01A 1BMV1 3VBRC 3P3PA 1S0EA 1SBDA 2ENRA 5EV7A 1SFYA 2YMZA 1D2QA 2D5FA 4XPVA 4RHV2 3WLUA 1JYIA 1ASJ3 4Q0UA 4M01A 2D6PA 2WS92 4RHV1 5CG8A 4QPGB 1HRV1 1UIKA 1URXA 1WW7A 1Y9QA 4XFCA 3ZIXA 2KXLA 2ILMA 4E4SA 5C8WA 5J36A 2WNUB 4JCKA 2QKDA 2ET7A 3O0WA 5CFDB 1BCXA 3OD4A 4PDWC 1YFXA 4IERA 1HW5A 4COVA 2AGSA 1MACA 1OQDA 1CPMA 1FOD1 2B8MA 2IWGB 1RVF2 1W6NB 1FPN1 3RDIA 1C8M2 3TAYA 4K7JA 3I59B 1IHMA 2VG9A 2AH2A 2OPKA 1PZ7A 1VBD1 2A6YA 5F6KA 2OVUA 4WVWA 1DQ4A 3LWCA 4BHPA 1FV2A 1G7YA 4HN1A 2BNOA 2E53A 3RI8A 2BFUL 3S0MA 4DY3A 2LUWA 1GBGA 2ZS6B 1DGWX 3AX4A 3BTAA 1FOD3 1OI6A 1R083 1CAUB 1UU6A 1ZBE2 1SBEA 3WINE 3WDWA 4NWWA 4YYOA 4GH4B 1X50A 3W59A 1X36A 4BOWA 4D7TA 2Z2SB 3WP6A 4HMZA 4AI8A 2P3KA 4CEYB 4YW1A 2O8OA 3VZOA 1RUC3 1D4VB 2GMEA 4NPRA 3WP4A 1LB2A 1NYWA 1UKRA 5L7OA 1FX5A 2WQZC 2VGDA 1LOBA 4HKOA 4COYA 5IK8A 3N7JA 4XF3A 3FLTA 5J3UA 4CEWA 5DUXA 3B94A 3FUQA 1O91A 4Q4X1 1YFUA 1PK6B 2WZR3 3JQXA 2JENA 3M3CA 3T1LA 4ZKTB 3AZXA 2HEVF 2DCTA 1AR82 2DWRA 1CAWA 3GBFA 2XBO2 3T1MA 4G9SB 4QGLA 3IIAA 4YZ2A 1RGSA 1R082 4GH4A 4MYEA 4Y22A 2XJUA 1Z7S1 3ZO0B 1G8WA 3UKTA 1H0BA 5JZGA 1LODA 2F4PA 4OHYA 4BLIA 3DV8A 3WW1A 4P9GA 4XF4A 5FQ0A 1MS5A 1XRUA 1ZX5A 1KJRA 2ZKLA 2DVGA 4XF0A 3LCPA 5GM0A 4Q4V2 2CTVA 2VULA 4EN7B 2VNOA 4GH4C 4Q4Y1 4XQDA 5HBAA 4E2GA 4RR3B 4XXAA 4KQ7A 1GV9A 4CYDA 3L2YA 1QDCA 2WC2A 1O4TA 1ZZ8A 4NWVA 1QOSA 1LHNA 3SCHA 2D3PA 1QKQA 4R9CA 1ZBA1 3AMNA 2MHFA 1W6NA 1RL3A 2P3IA 5A32B 2JE7A 3WV6A 4AEDA 5EFUA 1M06G 3ZFFB 3WQ0A 3DN7A 3B69A 1DLLA 1S0IA 2A6ZA 4QPIA 3NV1A 3CNAA 4LLOA 1ASJ1 1CIWA 3B00A 3OD0A 2P2KA 1IOAA 5GZDA 3M8LA 1ULGA 4L8QA 3LA3A 3KGZA 1OFSA 2A3YA 3D0SA 2EXJA 4B4PA 2DFCA 1HX6A 4CP1A 4A7KA 1FATA 4I0WB 1VBC3 4HSLA 2PLV1 1V6IA 2XG3A 3VBSC 4N9HA 5FPZA 2XKPA 2FZ2A 3VKMA 4A7YA 1RUI2 2OA2A 1NCRB 1RUF1 3OPZA 4LEJA 4HLTA 2RM21 4K9SA 3FLRA 5L19A 3RMYA 2E51A 2VECA 4YGCA 4B29A 1HV1A 2W0XA 4BM8A 5CVRA 5BNPC 2DURA 4QGNA 4OI2A 3NVCA 4YW3A 2ZPXA 1V6KA 5CIRA 4IV1C 3TNQA 3ZX7A 3PVOA 4AVAA 3ZMNA 1XNBA 2EF6A 5I93A 1UU5A 2C0ZA 1QJU3 2EXIA 2HWB3 1POV3 1LHUA 4AQTA 1J59A 3APBA 4G3YC 3H9AA 1UIJA 4AEMA 3MYXA 1VAKA 1EPZA 5BNNB 1FMD2 4IESA 1DQ5A 3KQRA 1I3HA 3TN93 5FOBB 5I91A 1V9U3 1CN1A 4K21A 4R9BA 3WDYA 2RM23 5DDJ1 2VNRA 2WSVA 2Q5TA 4IV1A 2YV8A 3D0JA 4EN9B 1RUG3 1TME1 2YXSA 1C1LA 1QHDA 1CPNA 1S55A 3PVNA 3AMMA 3IBMA 4FQZA 2D5HA 5C4WB 1SLIA 1AR73 3ETQA 3UJQA 1AYN3 2WNVA 4QQOA 1A8DA 2D3RA 1BYHA 5ABJB 2PHXA 4FXGB 4GMP0 4XBLA 2X53S 5SV8A 4OI1A 4O9GA 1RVF1 1F5JA 2DU1A 4LBNA 1CGPA 3AFKA 1AR93 2D6KA 2A75A 1H2KA 1GZCA 4AFCA 1A8MA 2WZPP 5CAZA 3JUUA 4FPEA 1CAXB 1N1SA 3DF0A 3AJYA 2DU0A 3FHIB 1KXGA 1RUJ2 4BIFA 1MZFA 2RS52 1R1A1 3J4UH 1DFQA 1Q8OA 2RS33 4Z82A 1J1TA 1X8EA 3OTFA 3VDDA 3POWA 3M3QA 3TYJA 3H50A 3WT3A 4CDQC 2GMPA 2SBAA 3AKQA 5DZGA 1WW6A 4M3CB 1IQAA 4XFIA 2XH6A 4QT6A 5JR7B 4BLJA 4R52A 2VOKA 3POSA 1LEMA 1YFWA 4YM2A 1NLSA 4I2OA 1NA1A 3ZFEC 3GBGA 2D98A 1ZBA3 2A6XA 2WA4A 4FPCA 2D6MA 1W2UA 1AL22 1UZZA 2OIIA 5FLJA 2IXKA 1Y43B 1W6MA 2D7FA 3PVBB 3VN4A 5SV5A 4FBFA 3IDCB 2BFUS 2OUHA 2WIIB 5EXOA 5CNAA 1U5YA 2UWBA 1IS3A 4JGZA 1OOPC 1ENSA 3UL2A 4I30A 2IXCA 2MPFA 2JECA 4FOVA 4ISQA 1XQNA 2CAVA 1A6CA 4Q29A 4QPIB 2ZGPA 3IM0A 1WLCA 2IZWA 1UD1A 1YUDA 1HIXA 2ZX0A 2CGOA 3RRDA 5CU1A 4YVSB 1AR61 5HCFA 4Q0PA 3MW4A 2R49A 3GZAA 5JOWA 3RNSA 1ULDA 4FPOB 1DGWA 2WNVB 1R092 5BY5A 4P9XA 4P14A 1OKQA 5TSWA 1OHFA 1WW5A 4ISRA 4AEJA 2ATFA 4QXKA 3EJKA 5JOZA 2ZABA 3MW3A 4LULA 2X29A 2ZX4A 5AVAA 1O5LA 3ROUA 4N7UA 2VQAA 1ULFA 4IQPA 1RUC2 5FBZA 3ZSJA 3IT8A 1JW6A 2ZACA 3CF6E 2JD4A 4AE2A 2D97A 5IUQA 5HI0A 4QQHA 5J7MA 1H8VA 2EALA 5D1IA 4FPJA 4L9BA 4WVMB 3RSJA 3WOGA 2VW2A 2ZX3A 4FQ4A 4HKWA 3N35A 4LUMA 3ZN5A 1O5UA 1Z0HA 5EJ3A 1D4M2 2RMU1 4KL1A 5CB7A 4XHBA 1AR83 4Z07A 1ZZ9A 3AXEA 4AQ2A 3WCSA 1N1YA 3B02A 3JBG2 2RMU2 4JDOA 5FRAA 4H14A 2EAAA 2ZGKA 3OJBA 1HQLA 2ZHMA 3M3EA 1LHOA 5BV6A 4GB33 1FMD3 3S7IA 3HD8B 2PHTA 3ZXEA 4BCUA 4D7SA 3MF9A 2DVDA 3FFQA 4Q4V3 3TNPB 3B7MA 4H7LA 1HRI3 2JXAA 3CJIC 4META 4NHKA 4AQSA 5KXBA 1VBA3 4RFT0 2ZGMA 3BCWA 2R32A 5DXDA 1TEIA 2ZAHA 5GLZA 4IV1B 1VAVA 1LOCA 4YW2A 2PLV3 5JMCA 2GH8A 1S0GA 3WVJA 1VR3A 3VBRA 2Z69A 2A71A 3PNAA 1DZQA 1GFF2 1WMEA 4XFHA 1H1AA 1PIV1 2IFRA 1RUE3 2CYFA 1AR63 3ALQA 4XF9A 1O7FA 5JDBA 2W08A 2WJSA 3E5QA 4LBKA 4HK9A 2WNUA 3I8TA 1LOAA 2WFPA 4AGVA 1PMIA 4QU2A 1WA4A 5BNNC 4MUVA 4UBGA 2DUPA 1MS9A 3ILNA 4Q0SA 3N7MA 4YZ1A 2XJPA 3RQ0A 4B4QA 1ZZ6A 3ZSMA 3MLKA 1S0FA 2XWBB 3WW4A 4YG6A 3WUDA 1RUH2 1VRH3 1XNKA 3V0AB 2WLPA 3AKRA 2WFF1 3TWIA 4CDUB 1NCQA 5D8AB 3MI8A 4AVTA 2NPIA 2RS53 2LM3A 4WM8C 2B7YA 3FBMA 5AC92 4YARA 1ENRA 1EYBA 2LTNA 3LOIA 2XJTA 1BJQA 3QD6A 1LHWA 2Y38A 3V64A 1YCIA 4GWMA 1FI2A 1NOVA 1YYNA 3UK9A 1AXKA 4M3CA 3I4IA 2YYOA 1LTEA 1ZBE1 4M00A 3RYRA 2B5HA 1VBE2 2MEV2 2ZGLA 5KHIA 3CJIB 4KBBA 3ZFGC 2FZ1A 3VBSB 4H55A 2R041 1KFXL 4E9KA 4BMEA 3ZN6A 3M3OA 4IEQA 1D4M1 3U4XA 4N53A 5KWRA 4FPHA 1OSGA 2WNEA 2JX9A 4IEWA 1FOD2 2ZAAA 1C57A 1QNWA 2PHLA 3RJRA 1MQTC 3ZYRA 4ZU4A 1RUE1 1IS6A 2BVVA 4EJRA 1TE1B 2VUAA 3OGJA 5IK5A 1COV3 1OFNA 3JD73 1KITA 3AK0A 5E16A 1DU3D 4AI3A 4AHWA 3H1WA 1QJZA 1SLLA 2VMHA 3EXUA 4XFBA 3GZTB 3WHTA 1SLTA 1ENXA 2D44A 1LOFA 3LSDA 2BPA2 4DRRA 3TOJA 3I54A 1AL21 4JGYB 2F6BA 4EWAA 1PGL2 3WZ1A 4MGKE 3JBG1 5FO7B 2VQ0A 4NHMA 5BNOB 2UURA 3SCGA 5I8SA 4YZ5A 1XNDA 5I8TA 3WG2A 1BBT1 1YFYA 4HKLA 4YG3A 2XWJB 4JDNA 2ETEA 2HEYF 1N1TA 3D82A 4LHNA 4FOYA 1NE4A 3FJSA 4DFSA 4FVVA 1RHI3 4RR3C 5HCAA 4EROA 4LTAA 1B35C 2V73A 2I74A 4YW5A 1VBD3 3CLPA 3ZFFA 4FPLA 2EA7A 3OBRA 1S2BA 1NCQB 4QHBA 3JZVA 4ES8A 3BOWA 1E57A 1JXNA 1AX0A 2GALA 2BQPA 4F7ZA 5JLVA 3X29B 4CRQA 1TNFA 4XE9A 2GN3A 2PHRA 2IC1A 1Z78A 3KT7A 3JB8A 1IS4A 3VBOB 4FP2A 3E5UA 3UJOA 1ZBA2 4MXVA 1V6JA 4S2FA 2WZR1 1NCRA 4TYSA 1AR91 1GSLA 3KLSA 1V6LA 3C2UA 2MNGA 3ACLA 4Q8KA 1H4HA 1KFUL 5CA6A 2RR13 4TZDA 2NLRA 1PO11 1REEA 4JC1A 2RHPA 4W65A 3DL3A 1JTZX 2RS31 3BIWE 2QZ2A 1ENQA 1RMU3 3GHMA 2H6CA 4HVQA 1PVC1 3D6EA 1FAYA 4J6GA 3V56A 1ULEA 1MS4A 4G4FA 4UXAA 2DV9A 2JKBA 3PTYA 3ZVXA 4ASMB 3KD4A 4XJ9A 4DZGA 2CWMA 1H30A 3HIFA 4N43B 2ZGTA 1CVNA 4LA3A 2Q8OA 1PZ8A 3ME2A 1QOTA 3TN91 4EWEA 2CY6A 1NXD1 1ZNPA 2YROA 4YM1A 1Y7BA 1PHMA 2GAUA 3ECQA 4IEOA 4KGGA 4C1XA 2XLGA 4LR4A 1PZ9A 1N47A 4Z2WA 5JWPA 5LEJA 1W6MB 4YRDA 4F8AA 2ZMLA 4JQRA 5I8YA 1RC6A 2PAEA 1GQHA 4YW4A 2D6OX 4Q4Y2 2OYZA 2PQQA 1VALA 1KD7A 1ND2B 4E27A 1UKGA 5I0SA 4RSUA 3I7DA 1OQ1A 3SNMA 2X8KA 4U2AA 1MS0A 3M7AA 2WFF2 1H2NA 4JTOA 3KSCA 2ARXA 5KC5A 2XLFA 1RJ7A 4ITCA 1HLCA 3NKGA 4QQ2A 4Y4YA 4YVWC 2WT2A 3MLJA 4Z8BA 3IDBB 1LCLA 4I3PA 2R062 1VBE3 2MEV3 5AFEA 3N7KA 2R30A 3MPBA 1C1FA 3GF6A 2X5IA 4IL7A 4AFBA 2EXHA 2JICA 5GJ6A 3KZ4C 2A5ZA 4PDWA 5C8CC 4XETA 2FMDA 4RGGA 2YGMA 2R073 2HWC3 3SITA 2N7GA 5C4WC 3B5LB 2PELA 3GNEA 3SXWA 4FSJA 1X33A 5JPNB 1T6GC 3USUB 1RVF3 4LBLA 4DINB 2Q1MA 3MF6A 2PLV2 3ZFEB 4RL7A 4LO8A 5BUVA 2RJKA 2R043 4TSVA 5DDJ2 1IS5A 4LBQA 3S30A 2BNNA 4DPNA 2YDEA 4HL0A 4XF1A 4CDUA 4GKYA 4XBNA 3J9SA 4FOWA 5C33A 3VGIA 1NY72 2HWB2 1YI9A 4MLOA 1QJY3 5EYYA 2H6BA 3TN92 1R1A2 3LA7A 1EAH3 2GDFA 2NQYA 2O8QA 3R0RA 4AHXA 4QM9A 1PK6A 1RUH3 1VRH2 3LAGA 2R0HA 2RM22 2X5IC 1Q8SA 2PYTA 1Q8QA 1G6NA 1GANA 1H8TA 3L2HA 4L99A 4BYYA 5JSPA 1QXPA 2A70A 1OLQA 5AC93 3FLPA 4YVWA 1WMFA 5B2GB 2ZGRA 1PO23 2Z79A 3FWEA 5BXXA 1GQGA 3VZJA 4ASLA 4CDWB 3VKLA 3MIFA 4FPGA 1JN2P 3VZMA 4FCAA 3O14A 3URFA 4AFAA 3HAGA 5EZWA 4XZPA 4R9AA 2ZZQA 2Y26A 2C1FA 4QGMA 3AP6A 1VBB2 4AG4A 1NA1B 2DYCA 3TB0A 5BNOA 4X8PA 2RR12 5ACA1 1MR5A 2XVKA 1BMV2 2V09A 1PO21 4JAAA 1BEV3 5D8AA 5K9YA 4OHVA 4N43C 3HQXA 1FXZA 2HWD3 2IXLA 3KMHA 3THTA 5JSOA 2DCJA 5GLWA 2CAUA 2A6VA 3NAPC 4YVSA 1RUH1 3LB9A 2H0BA 3QLQA 3LZZA 1HQNA 4L97A 3PJQA 1CR7A 3ZPYA 1FMD1 1RINA 5GLTA 5H9RA 3RWNA 2P34A 1LULA 1LGBA 1W6QA 3FC0A 3DPRC 5KBFA 1OD5A 4YG0A 2ZGQA 2XPJA 1HRV3 1V6OA 2G9GA 2JG8A 3Q9OA 3SH4A 2PFWA 4XEZA 1QJX2 1NQJA 5JOXA 4LBJA 5CFCA 2QCSB 1PM7A 4LBQD 3SHRA 1BZWA 3JBG3 4PBPA 3VHRA 3ZDSA 3VV1A 4I09A 4UW6A 3HT2A 1C5IA 1CAUA 4GB32 3WW2A 3AKSA 4PJYA 1BBT2 2HWD1 1R091 4BH9A 5AFBA 1VBD2 1XNCA 3AP9A 2XB6C 2Y0IA 4UBHA 4UW3A 4CDXA 1QH7A 1U0AA 1RUI3 3ASIA 2WL1A 4IEYA 1VRH1 4LO6B 5A33A 3WDVA 4J1WA 2D3SA 3VBUB 5C9AB 2D43A 4OZXA 4Q4V1 1N3QA 1VLNA 4CEYC 3HBZA 1D0GA 3AYCA 4W6YA 5FFOC 1HRV2 4IEPA 1ZYBA 2DUOA 2HWE3 2YHJA 1SLCA 2ZHNA 5AVPA 2HWF2 1OLRA 3RS6A 4Y20A 1XE8A 1JH5A 1ZRCA 2B42B 2VXRA 3ZIWA 1YLLA 2XL9A 4FPFA 4NO4A 1K5MA 3A4UA 2DTYA 4LUKA 1KS5A 4FTBA 4Y22B 4XJ8A 1O3QA 3S7EA 5A3MA 3B93A 4AYUA 2JG8C 4LBQB 3H0OA 5KHHA 4BQ1A 3VBOA 1AR81 5JCTA 2ET1A 5JOYA 1LOFC 1QXRA 3VDDB 1EV12 3MIHA 3O7OA 2JG9A 2HWB1 2IXIA 3AMPA 3CU7A 4Q2FA 4EN8B 3WHUA 4YVSC 3CJXA 3EHKA 3R05A 2BBVA 3TBDA 5A32A 2XUMA 3VZNA 1MZEA 1OPOA 1AVBA 4JV4A 1CD3G 1ZM1A 1G86A 5FCCA 1YI7A 1W6OB 2VMGA 2NP0A 1MZ5A 1JBCA 2B46X 3JU9A 4JGZB 1UPIA 3AP4A 1VB2A 4GKXA 5GZEA 2HWF1 2BUKA 4B7KA 4DS0A 1AF9A 5BNOC 1TQ5A 5GZFA 5DUUA 1UAIA 4QQPA 3UKVA 4P9LA 4WM7C 3KB5A 4S2HA 2GC0A 1VBC1 3FE5A 1ND2C 2IXJA 2R071 4I0AA 4CDXB 5ABJA 4Y1ZA 3CO2A 2SLIA 3MIGA 4Q4W2 4X6RB 5FMOS 3R6SA 1RUI1 5ABJC 3AZWA 2B9UA 4CDWC 2VW0A 2NZ9A 3AZZA 1QQP2 4LO4B 3R4SA 1AYM2 3VHNA 1MQTB 3ZXJA 1WGPA 4W6WA 3M2MA 1MVEA 5DZFA 3H7YA 1QJU1 2E9QA 4PIXA 1WMDA 1QF3A 1UU4A 4XFAA 4AVSA 4M0NA 3H3ZA 3POYA 5FTTC 4Z92B 4A7ZA 5H9SA 2VU9A 2DCYA 3E6DA 5GLVA 3VL8A 3DKWA 4TWTA 1AJKA 3IMNA 2O1QA 4IV3B 1V9U1 4QPGA 2BGCA 4KG8A 1U12A 5K0UC 5DZEA 1H2MA 2HWD2 5FREA 1DGRA 1UZYA 2ZX2A 1W39A 4XJWA 4CEYA 1BXHA 3OYWB 4XMAA 1B09A 1S1AA 2R1BA 2HYKA 2RJLA 4FXKB 3RZZA 3N7LA 1VP6A 4GWNA 5J98B 1LESA 1DGRN 3MIDA 3AYAA 1ND3B 1QJX3 2DTWA 5C4WA 4HT1T 4L11A 4OUMA 3SH5A 3MICA 5JZGB 1XYNA 2PHDA 1AR92 2W39A 4OHWA 4F3JA 2WT1A 5T5PA 2HJIA 3THPA