5DDPC

L-glutamine riboswitch bound with l-glutamine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
93
structure length
93
Chain Sequence
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (61-MER)
publication title Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 23
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ddpC00
2MZRA 3SDEA 3SDEB 1WG4A 2CPHA 1M90T 2RT3A 4FXVA 1PO6A 2MQQA 3CCVS 2JX2A 3CTRA 2KVIA 2CPIA 1WWHA 2CQDA 3LPYA 3TYTA 1WELA 1HA1A 2ERRA 1FJEB 1DRZA 2EK6A 1M5VC 2MZJA 2KU7A 2MJNA 2NZ4A 1N54B 1DZ5A 2MZ1A 2CQBA 2N82B 1YI2S 4A8XA 1M5PC 2M0GB 3ZZZA 5D78A 2N3LA 1X5SA 4PR6A 3V4MA 2MQLA 2KXHA 3BS9A 2MKSA 5CA5A 1WG1A 2DNOA 1Q86T 1K8AT 2DB1A 1A9NB 2UP1A 1QVGR 1KOOA 2DIVA 2MXYA 1B7FA 2ZJQQ 4ZKAA 2ZJPQ 3MDFA 3TP2A 5FJ4A 1JMTA 2KHCA 3LQVA 4F02A 2DGOA 2PE8A 2KN4A 1M5OC 1IQTA 1VQPS 2MSSA 1X0FA 1SJQA 4TU7A 3CF5Q 2AYMA 2HVZA 4Y0FA 3CD6S 2JWNA 2MQOA 3S7RA 2G4BA 3NMRA 2VONA 1F9FA 1X4DA 1FT8A 2F3JA 1HL6A 1P1TA 3Q2TC 5GAEU 1SJ3P 1KC8T 4TU9A 4CIOA 1Q7YT 2B0GA 2CPDA 3FEYB 5DM7Q 2VOPA 1NO8A 3VAFA 2MZQA 2N3OA 2XB2D 2M8HA 5GADU 2M8DB 5IM0B 4QU6A 1U1PA 4WIIA 3EGNA 3UD3P 2YH1A 2XS5A 1ZZFA 3CCMS 2AYGA 4YUDA 3S6EA 2RS2A 5EN1A 4YOEA 3MI7X 3CUNA 2M52A 1X4AA 2O3DA 4F25A 3G71S 2DGQA 1FJCA 2DH9A 1UAWA 2HZCA 2OSQA 2LXUA 4RU2A 1VQ5S 2SXLA 2U2FA 3MOJB 2M88A 2QEXS 2KG0A 1OIAA 4V19X 2DHXA 2DNLA 1U2FA 3R27A 2ZJRQ 3P5TL 1OWXA 2LMIA 2EK1A 1WHXA 2XSFA 1YJWS 2AYEA 3CCQS 1VQ4S 2DNZA 2JVRA 2X1GA 1WG5A 4BS2A 4WFBQ 2DH7A 2KI2A 5ITHA 2I2YA 3UD4P 1U1RA 2DNGA 4ERDA 2E5HA 2FPHX 1O0PA 2CPFA 1D9AA 3SMZA 1U1QA 1N8RT 2DIUA 2CQIA 2MMYA 1VC6A 2HYIB 5H1SV 2YH0A 2LEAA 1RKJA 3S8SA 2DGUA 2FY1A 5GAHU 2F9DA 4IO9Q 1N88A 3PIOQ 3MUVP 3VF0B 2KM8C 2E5GA 3K0JA 3BEGB 2CQPA 5D77A 4CQ1A 1U1LA 3RW6A 1JJHA 4FXWA 4J5OA 2DNYA 1URNA 3R1LA 2CQ3A 2I38A 2M70A 1VC0A 2CPEA 2MQPA 2DITA 4LJMA 2XNQA 5CYJA 2MQNA 5HO4A 1CVJA 2XNRA 1VBXA 3ZZYA 3VAGA 1KQSR 2X1BA 2LXIA 1SJFA 4QU7A 1X4GA 4WKRA 1M5KC 3VAKA 2OTLS 3CULA 1X4HA 5DDQC 2X1AA 1H2TZ 1WEXA 4W90B 1Q81T 4C4WA 1VQKS 1OO0B 2CPYA 2MKHA 1X4BA 2MZSA 3NS5A 2L41A 4M5DB 3EX7B 2LKZA 2KH9A 1K73T 2F9JA 5LXYA 4EGLA 2KG1A 2D9PA 2MKJA 3CCES 2AD9A 1WF2A 4TU8A 2HGMA 3CXCR 2CPJA 2KRRA 5LXRA 2DNRA 3MURP 1WTBA 1Q82T 1SXLA 1P27B 2WBRA 4C0OC 2RNEA 4TLQA 2CPXA 2DGVA 3MD3A 4YB1P 2ADBA 3UCUP 3CC7S 3CCSS 2MKIA 3BO3A 5IM0A 2DISA 4IOAQ 2OIHA 3H2VE 1G2EA 3J7ZT 2KFYA 2DGWA 1KD1T 4WFAQ 4CH1A 3DXBA 2KM8B 1UP1A 2A3JA 3CC2S 2BOPA 3H2UB 2HGNA 1VBYA 2MYFA 3IWNC 2MGZA 2MY8A 1WI6A 2MGZB 1DHMA 2PEHA 1YHQS 2CQGA 1K9MT 2N7CA 3P3DA 1W2BR 1M1KT 3VAJA 2XS2A 4PKDB 2CQHA 2U1AA 2LA4A 3SXLA 3CCJS 5LJ3Y 2FHOB 2MHNA 3I56S 2G1DA 1ZH5A 3I55S 1VQLS 1XN9A 2DO4A 1JJ4A 3MUMP 2L9WA 1YTYA 1QVFR 1WHWA 1WEZA 3OW2R 3R1HA 5GMKa 1HD1A 1A7GE 2K3KA 3DLLQ 4C7QA 3NS6A 3RW7A 2KXNB 1VQ9S 1X4EA 2M7SA 3UCGA 4Z2XA 2OJ3A 2LECA 2JRSA 1SJRA 4QPTA 5IQQA 3CPWR 1UFWA 2QA4S 2XS7A 3P49B 1WHVA 5LSOA 3VAMA 1YIJS 2CJKA 2DGTA 2LYVA 3PIPQ 5BJRA 1VC5A 2KYXA 1FXLA 3ULHA 3G8TA 4LMZA 4PRFA 4CH0S 2DNNA 2J8AA 2MZTA 2DNQA 1L3KA 4OZ0A 2GHPA 2DH8A 2D3OR 3D2WA 5GVQA 2D9OA 5DDRC 3VALA 3Q2SC 1AUDA 2FC8A 2VOOA 3J7YU 5MLCV 2OTJS 1FHTA 5CXTA 2KT5A 3UE2A 2MJUA 1U6BA 1YITS 2LCWA 4F26A 4ED5A 2FC9A 2DNPA 1H2VZ 1D8ZA 2KRBA 1YJ9S 2DHGA 3CCUS 3UWTA 2DHAA 4IUFA 4U67Q 2YKAA 2CPZA 2YTCA 3B4DA 3NNCA 3US5A 5DDOC 5JVGQ 4W92B 1X5PA 2CQCA 2LEBA 2DHSA 1YWXA 2AYBA 1U1KA 2M4MA 2E5JA 2DO0A 1VQ8S 3P6YC 1YJNS 2DNMA 1VQMS 2CQ0A 4UY8T 5GAGU 3BO4A 5HL7Q 3UCZP 5DM6Q 3S01A 3L3CA 2E5IA 2QFJA 1JJ2R 3G9CA 3NNAA 2MSTA 3FEXB 2LQ5A 1N52B 3BO2A 2JVOA 3G6ES 2V94A 1VQ7S 1X4CA 2M2BA 1H2UX 1PGZA 1FJ7A 2RS8A 3HI9A 2MKCA 3MD1A 1KOHA 4QQBA 5JVHQ 3VAIA 2RUGA 1X5OA 5IFMA 1U1NA 1R8PA 1WI8A 2EVZA 2G0CA 4Y00A 2K8GA 1FNXH 2RU3A 2RRAA 2J0SD 1VQ6S 2MQMA 3N9UC 1WEYA 2M9KA 2MPUA 3EGZA 1X4FA 3HHNB 2ADCA 2OSRA 3B4MA 1WF0A 4IOCQ 2LA6A 1VQOS 4WCEQ 1U6FA 1S72S 3G96A 3U1MA 2YWKA 1DBDA 2VODA 1WF1A 1NU4A 2DGSA 2L08A 5DETA 2DNHA 3G8SA 3CC4S 1WHYA 3G4SS 1ZZNA 2RQ4A 3VAHA 4P6QA 1U1MA 2CQ4A 1R8HA 3CCRS 3MUTP 2X1FA 4WF9Q 3U1LA 2GO9A 1RK8A 1BY9A 2CQ2A 2Q79A 2E44A 2MB0B 2DGXA 1SJ4P 3IRWP 2RVJA 3THTA 2HGLA 2MY7A 1S79A 3JB9k 3CMES 5DDPC 3TO8A 1QM9A 2KXFA 4LIRA 2DK2A 3NNHA 4UQTA 2J0QD 5LJ5Y 3MXHP 4OZ1A 4WFNQ 5LSLA 2NLWA 2BZ2A 1H6KX 1VBZA 1U1OA 2RQCA 2DNKA 1FO1A 1UW4A 3CMAS 1OPIA 3THPA 2RRBA 1X5TA 2J76E 1VQNS 2CQ1A 2MKKA 1HD0A 3CCLS 1NJIT
chains in the Genus database with same CATH superfamily
3SDEB 1RAHB 1PO6A 3EVMA 4USIA 1ZPVA 1WELA 3KHLA 2ERRA 5AXNA 3G86A 3M2UB 4DCJB 4A8SA 4O3QA 4WE1B 1N54B 3MM9A 4ZP8A 1E6VA 5KT4A 4ES2A 1M5PC 3R5BA 5AXLA 1RDRA 4J9QA 3LP0A 2QRRA 1Q86T 1K8AT 4MIWA 1S1WA 1Q79A 2HHHJ 5G0RA 2DIVA 1I94J 4CM2A 3DLJA 3QGPA 2YX1A 2KHCA 4IG3A 4YMEA 1QE1A 4LVOP 1HARA 2OKQA 3L4BC 5F8GA 1VQPS 2UUAJ 3MGJA 2C22A 3I0RA 1SPBP 1V3ZA 2JWNA 1Q4RA 3S7RA 3RB0A 2CA9A 4B17A 4TNOA 3LPEA 3KWMA 4LSZB 4KFBA 1MMDA 1RJJA 4DV3J 3GJSB 2QG9B 1JLQB 4ZCMA 2NXJA 3CCMS 4EO6A 4MFBA 4M8LA 2BDPA 3MI7X 1X4AA 4WIQA 3K89A 3TAPA 4NLTA 3PYGA 2E7WA 2DH9A 3H90A 4WZMA 2E1PA 2HQ3A 2U2FA 4URQU 2B4PA 4CT9A 3SZ2A 3PX4A 1B3TA 5SUHA 4B9LA 4TLRA 1WC3A 2K1RB 3W5XA 4ZP6A 2A6MA 4K8RA 3PRBA 1B0VA 2CVEA 2DRAA 5HLFA 2VIHA 2Z56B 4X4OA 4DCPB 4B9UA 2YH0A 4ZLJA 1UZDA 2R8HA 3J81Y 2PT0A 5E3PA 3OTDA 3PIOQ 4ED7A 3MR2A 1TK5A 4DL5A 3DN9A 8AT1B 1U09A 4J5OA 3W8PA 1VBKA 4LUBA 2QA1A 2KT2A 1OQ6A 3GYGA 3P96A 3RRGA 2IAJB 3HVTA 3EGWB 3CJKA 1SV5B 1FKPA 1S9GA 1Z2LA 4NWBA 3I0SB 4ZA1A 3UN5A 2MKHA 5HANA 4HYKA 1TK8A 4CLZA 2XULA 4OX6A 3E51A 2HS0A 3V81B 3TNVA 1NPRA 1IBKJ 1ZS6A 4B3MF 4JYAF 3PTWA 3W5ZA 3FFIB 1TUVA 3OV7A 2YKNA 4AXIA 2ADBA 5F3ZA 1XK8A 2OIHA 5HMZA 1G2EA 4Q5VA 2PIIA 3AJ2A 4KJIA 3CC2S 5J1PA 4EZ9A 3AODA 4B9TA 2ZOGA 2HZAA 1XMBA 4ED6A 4K5SA 1RAIB 2FZCB 2V9KA 3TUIC 1KQGB 3M6VA 1CS4B 3VQTA 5A2QY 2XSJA 2FHOB 3I56S 1ZH5A 1RAJA 2DO4A 1QVFR 1C2PA 4WYWA 3RR7A 2GO8A 5K8PA 2C3UA 1N36J 9ATCB 1UFWA 3MM7A 4WP9A 1KVIA 2DXFA 1NZ8A 2W9BA 3QAEA 1T9YA 4V19J 2P6SA 1VCTA 3ULHA 1N32J 1UL3A 3UD5A 4QIFA 2OD6A 3IM9A 2D3OR 4AQYF 3D2WA 4F4KA 5MLCV 4EZ6A 2FZGB 3QT6A 4DFJA 1FRIA 2BKOA 1TU0B 3A1YG 4U67Q 3SV4A 3DC2A 4RW6B 1D9FA 2QMWA 4ZCIA 5M2PA 1RAFB 5KFIA 5GAGU 2ROPA 5KG3A 5H9EJ 3NNAA 2A2CA 2LQ5A 4ID5B 2KYZA 3DRRA 2BJ3A 2MKYA 3UN2A 4X66F 1T95A 3HM9A 2EPIA 1S49A 1TZ0A 3IFEA 4H4KC 3HHNB 1GTEA 5BYQA 4ZIVA 3C14A 1S72S 3V4IA 1K47A 3MM8A 4L3NA 3U1MA 4R5PA 3MF5A 1D8YA 3OFHA 3PYDA 1U0SA 3TA2A 1WHYA 2QLXA 3I87A 1ZZNA 2VQFF 4NE9C 1F60B 1GH8A 3WIVA 1IKYA 3IRWP 2RVJA 5EHHA 2ABYA 2E5LF 4PG7A 3CVKA 2KXFA 2IYIA 4YHHJ 3CIMA 4DEZA 2BXJA 1DARA 1H6KX 4AFFA 1VJWA 4ETZA 4OLOA 1B0TA 5ETSA 1SCJB 2OH2A 1N6QB 1JQGA 1VQNS 2MKKA 3LWLA 3IMQJ 5JMNA 3SDEA 2IRYA 3CNQP 3OHBA 1IBLJ 4DX5A 1WWHA 3UFCX 4DF8A 3M2UA 4WE1A 3RAMA 3VCDA 4ED4A 1Y10A 2HWHA 1HNIB 2JJ4D 2I0XA 1PAUB 3OSPA 1RWKB 2XYPB 1NHVA 4MK8A 3NWGA 2VA2A 3N28A 3G8QA 3TP2A 3EPIA 1YSJA 4BC9A 2CRLA 2HQDA 1UVIA 4CLFA 2UXCJ 3M8QB 3UW1A 2MSSA 5IT9Y 3KHGA 2AYMA 3QGHA 4WBFA 4PG6A 2LXFA 2PD1A 2XG8A 3MCMA 4K4VA 1HNXJ 1U1PA 2QA2A 1JLQA 3UD3P 3PJWA 3JTNA 1UEKA 1BE4A 2ZVSA 1UAWA 2YX7A 3Q8QB 3RR8A 3MOJB 1RQ0A 1S97A 1OIAA 5C5JA 1D9DA 4OX8A 1T9WA 3TW0A 2K1RA 1KN6A 4CO4A 3NL0A 3ETOA 2FLNA 5ITHA 5K8OA 3MR3A 5KT5A 4ZVQB 1YRXA 1SH3A 1O0PA 2RDDA 4ZHRB 1T05B 2IMWP 2HFZA 1RKJA 1S1UB 4PUOB 3FSXA 4O23A 1ZOTA 2CNOB 1XNQF 1TUWA 4ECWA 2WRMA 4ZVEA 1C0UB 3OTOF 2HBRB 1TL7B 1NUEA 2GZOA 1GQEA 1RHQB 4USUA 3NG8A 3JYTB 4F4AA 3HHLC 5L9XA 2IAJA 3KNAA 2LXIA 1SV5A 2IM1A 3M2RA 3CULA 2Z57B 3I0SA 1VYAA 2YWGA 1VQKS 2O66A 2A6OA 2A18A 2V0NA 3V81A 1XNRF 3OL8A 4DV2J 5CD4A 3FFIA 3N6LA 3OSNA 1EP4A 2IBOA 1U0HB 2EEYA 3UCUP 2VG7B 2HHPA 3OVBA 4IOAQ 1F6TA 4JI1F 4DG1B 4P71A 1RHJB 3MEEA 3IWNC 1IBMF 4KHPF 4OI1A 1UJ4A 1KFSA 4OZJA 1CS4A 3VTIA 2MLYA 2HFUA 3WQPA 4B3TF 2G1DA 1HFEL 4K4UA 3TQ1A 5T14A 2HMIB 5IXUA 3N01A 4ZPTR 4OZLA 2GMJA 4TY8B 2GCFA 2X3DA 2IRXA 5EWEA 4HHHA 2CZVC 2EI5A 5LSOA 2G2ZA 1XMOJ 3NCPA 3G8TA 3B82A 2MZTA 3I9V9 2Q3PA 5LT5A 1WDTA 1F9EB 3FDSA 4CDIA 3HZGA 5DQHA 4ED5A 2PMHA 5HSPA 1H3DA 4KB7A 3KJQB 2KRBA 4DSIA 5EWFA 3MAAB 3V5RA 4JV5J 4RW6A 2NSBA 1GXLA 2QLWA 2RHSB 2V2KA 1YWXA 2HBZB 4Q2MA 1YJNS 1B0PA 5LMNF 2RJZA 1EIYB 5I42B 4ID5A 2YWFA 2KHDA 1IKWB 2JVOA 1VQ7S 2W25A 2Y1JA 4OHXA 4IFYB 4OHVA 1X5OA 3D6MB 1AW0A 1FNOA 1FWKA 4MTPA 2LLZA 1F5CA 4OYZA 4NLOA 5FD1A 1CC7A 1OPZA 3M4XA 4RBUA 4CO1A 3P8BB 2R2SA 1D3WA 2BKNA 2ZFHA 3WC0A 4AT1B 2NSCA 2WVBA 3QRPA 3L7UA 4EWTA 2RQ4A 5KFVA 5B0FA 4NLXA 2C2NA 5KFRA 4OHWA 1VHFA 4PWWA 5CCMA 1I5OB 4FKXA 1FD8A 2K06A 2VZ9A 4YP3A 4HLBA 3W9HA 3PZPA 4N8OA 1RYSA 4ED8A 1KQFB 4F4ZA 5C25B 2LQ9A 2L3MA 2XLKA 1EARA 3AA8A 4L76A 1RSCA 4DL7A 1J5OB 4MIBA 4FXVA 1N0UA 2VPYB 3M6UA 2Z2MA 4CNYA 1FJEB 2PI4A 1SQGA 1WC4A 2LQJA 3D1HA 2PO4A 1WC1A 4WYLA 1XIQA 3MFHA 2GW8A 1T8EA 5F0WA 1HNIA 1Y0HA 2BQUA 4RNHA 3MMJA 1QAIA 2R3VA 1QVGR 1RT7B 4PPZA 1RCXB 3RB4A 1RT3B 2PEBA 2RIJA 3KMSA 1UVMA 3M8QA 4PAAA 2WCXA 4H4OB 2QC3A 2Y8YA 5A8RB 1I6JA 4G3IA 2B6AB 1UJ5A 3VR1A 5MAOA 2I6WA 3FGVA 3F0NA 2APOA 4DV1F 4X4SA 4NX9A 3VGTA 3I9ZA 5AE2A 3GP9A 2F4VJ 4IO1A 2XHWA 4YOEA 3WHIA 2HZCA 3D1QA 1FI4A 3IS9A 4BLGA 2SXLA 2J0XA 4J37A 5HN0A 3R27A 3KG4A 4QZVB 3GV7B 4ETXA 1NMEB 2HG4A 3BQ2A 5L8RC 1HR0F 3NWRA 2V8GA 4ZHRA 3GU0A 2C2OB 4C8OA 1T05A 1NK8A 4MKYA 4F2SA 4ZJLA 1S1UA 3K57A 2F63A 5L38A 1IXKA 2ILYA 4K0KF 2W24A 1AB8A 4IQMA 1C0UA 1TL7A 5HBMB 5J2QB 2CPEA 2LQBA 3JYTA 2XNQA 3GIRA 2MQNA 4P74A 3T1YJ 2LDIA 5F3TA 1X4GA 1CJUB 4WFZA 5E3AA 1RWNB 2ZZNA 4WKRA 1Q8KA 2OTLS 3H0PA 2FB0A 5B7WA 1A6LA 3C46A 1GMWA 1JKHB 4N77A 3KYLA 4X65J 3KMQA 3X3UA 1SIZA 4PYAA 4LQ9A 4LF8F 2R8KA 1SH0A 2B9YA 4A8MP 4C0OC 3IBFB 1DTTA 4LT6A 1U0HA 2QT7A 2VG7A 3F56A 2YY3A 1F0XA 2C3YA 3NY0A 1LWEB 1FWLA 4YR0A 4DG1A 2IIHA 1UP1A 4DOZA 1UWAA 3DRPB 5HVFA 4M1KA 4ZS6A 4PKDB 2CJ9A 2ZE2B 1QLNA 4K4WA 2JNJA 4U95A 4ZN3A 2VQEF 4DU8A 2HMIA 1PBUA 1HD1A 4DL3A 1A7GE 2FHMA 4NLYA 4TY8A 3PV8A 2KXNB 1ELOA 3GWCA 4NZ0A 4RBTA 3PIPQ 3OHAA 5CHCB 5FIIA 1FXLA 1TL5A 1RLDA 1UFKA 3DOKB 3O5TB 2WTFA 4K2XA 1PKUA 2R8IA 1ZAXA 5B0CA 1UEUA 2EBEA 5DGAA 2PGCA 4DR3F 4JI7F 2IBKA 1JNRB 2W2NP 2A2DA 2YKOA 1UPMB 1REVB 4NXMJ 3TEGA 3MAAA 4F0KA 3M9OB 3C6TB 1EHWA 5JVGQ 2DHSA 3MPVA 2AYBA 4BDPA 1NZAA 1VQSA 5I42A 2DTJA 1EETB 4R0JA 1IKWA 4Q2LA 2OMLA 3H5SA 2QL5B 2IDLA 3ZC4A 1LWFB 3HI9A 1KOHA 4IFYA 4ZLLA 2K8GA 1NB7A 2PA3A 5HK4A 4K59A 1T9VA 1S0NA 3HHKA 2CG8A 3HFKA 1UEVA 1U6FA 4WCEQ 2V63A 2P6TA 2LU2A 2HHQA 2V5HG 2L08A 1MLAA 4B9MA 1FE0A 1N4LA 3IR6B 3K59A 4BWJA 1FTCA 1VRQC 4U9RA 2E44A 4KV8B 4CO0A 4LF1A 3PRVA 3BN7A 5ETRA 1CPZA 2BRKA 3AB4B 3NLCA 2HHXA 3BKUA 2BVZA 3SYZA 2XEXA 5C25A 3MEGB 3EE3A 1OPIA 4LRBA 2FTRA 2R42A 1J5OA 3SQOP 4NXNF 3WX8A 3CTRA 4ED2A 2KVIA 1DRZA 1ACMB 4XPEA 2BE2B 2KU7A 3CO0P 4ECUA 1ZM9A 1RP5A 4URSA 2HHWA 2MZ1A 4A8XA 3NAHA 4GO7X 3GJQB 5IQ6A 4ICLB 2BJ1A 1SKSA 1SBRA 2DB1A 3GFXA 2C2DA 3UNGC 1RT7A 2XMJA 3W63A 1KOOA 4F67A 1RT3A 3GYXB 4KRWA 2KZMA 3JQMA 2PFDA 4F7VA 4DUYJ 1SH2A 2OHDA 3EXCX 1N5VA 3QATA 4H4OA 3H98A 4O3NA 1KSPA 3OTBA 1F9FA 1FKAF 5A8RA 1BD6A 4TU9A 2B6AA 1ZPWX 2PA8D 5J2MB 3CD0A 3E2EA 2FHJA 3CJRA 4ECYA 2MDAA 1JIHA 5KFJA 5T41A 4DR6F 3I4HX 2DGQA 4DS4A 1N48A 4Y3CA 2O01C 2LXUA 2QEXS 3V2UC 3GSDA 2KO1A 3LGHA 5CH7B 4IG0B 4PXBA 5E3RA 1OWXA 2EK1A 1WHXA 4KKOB 3GCXP 4OYWA 3TX8A 3JQKA 3OLBA 1QTNB 4PPDA 3SCLE 3GMGA 3T3FA 2YBVA 1FD2A 2B7BB 1HBUB 3I5BA 4X62J 1WKLA 5D77A 2R7QA 1YBTA 4ZITA 4E2FB 3UDVA 2BJ8A 2GGPB 2VFVA 5F8LA 1RWVB 5HBMA 5J2QA 3EZOA 1FDBA 1SVDA 1AXQA 4DX8H 3W5YA 3W64A 4RPFA 1KQSR 5KOWA 1CJUA 1HBMB 1LWCB 4Z7CA 4YB6A 5LSRA 2JLGA 3K5OA 1JKHA 1FNMA 4HT5A 1Y5LB 2HHTA 4A8QA 1WUUA 4IR1A 4DBQA 1PJ7A 2MKJA 2HHHF 5LXRA 2R7UA 3MURP 4O4GB 3U1NA 2GVZA 2FJVA 2ASYA 4TLQA 2CPXA 2WK4A 1CSJA 2MKIA 2C2RA 1LWEA 3VGUA 4PXDA 4WFAQ 2J9DA 3ZXWA 3J7YI 1WI6A 4HT7A 3R7NB 3DRPA 2AJQA 4F2RA 1M1KT 1DY3A 4DV3F 3DM2B 2Y1RI 3HHLB 4XDDA 2ZE2A 4OHZA 3AD7C 3AOBA 3MUMP 3HO1A 2ZEJA 4ZLPA 2YPZA 2Z58B 3PW7A 3D9BA 2OJ3A 1F5BA 4P2FA 4RX6A 2XS7A 3AXMA 1WHVA 1V6HA 4OQJA 3WZ0A 3CDUA 1IM4A 3DOKA 3KLEB 1CJTB 3H4DA 2K3IA 2ZVIA 4F3OA 3BDPA 4X4NA 2WB1D 3W62A 2XGQA 5IZHA 4BWMA 1FJGJ 1T3NA 7FD1A 2MEWA 3GV8B 5KFGA 2DEIA 2L9DA 3FVYA 3RU0A 3PM9A 2VDIA 3CCUS 1REVA 2VV5A 1C1CB 1E6YB 1WSVA 3PVXA 4B02A 3C6TA 3NNCA 2CKWA 3US5A 5DDOC 3EVOA 3PYEA 1NSAA 2CQ0A 4NYZA 2ZKUA 1F3VA 2Z2YB 5B0DA 4CNZA 2V8HA 1EETA 1LKZA 2K7KA 3MHYA 1FESA 3OTCA 2FDNA 2V68A 1LWFA 4CTAA 1K44A 1MWYA 4S0MA 3QAUA 1LOUA 1WJ9A 2V2QA 3UO0A 3MM5B 4C0HA 2OPPB 2MQMA 4RW7B 3KK2A 4JI0J 1NDCA 1IBKF 3HD1A 1MN9A 1WF0A 1SKUB 2LA6A 4PXCA 2NREA 1NPPA 2CFXA 4CRJA 4DQRA 2I9SA 2P2CB 1RHMB 4O3RA 2W2OP 1RHKB 2AJ0A 1ZBTA 4KV8A 1N5YB 1RB0A 4IOBA 2XI2A 1HWUA 2AZ1A 1H0HB 2DXEA 1TV6A 3MEGA 3EGVA 2WVDA 4QYZK 2QV6A 1PJ5A 2ZUAA 5HJXA 1N36F 2HSEB 4LR7A 2XZTB 2XMVA 2MTLA 2JX2A 2V50A 2J9EA 1N32F 1M5VC 2BE2A 4DR1J 2XC9A 3PJ9A 5AT1B 3FCVA 3MECB 4O0IA 4ICLA 3CJ5A 4JV1A 1X7VA 5KOXA 1AFIA 1NJYA 1VISA 1V3SA 4C8MA 2MXYA 1RBLA 3MDFA 3KDNA 3M9MB 3LQVA 2YX4A 2VHGA 1UW9A 3QO9B 5KTQA 2O5DA 4G65A 4EYHB 3ZFVA 3C2PA 2VBYA 4LRAA 5E33A 3D67A 1FEEA 4Y0FA 2CJQA 1RGVA 1ZA2B 3W7BA 4KIAA 1M0SA 3AB2B 2B0GA 5J2MA 5DM7Q 3MMAB 3VAFA 5D0EA 3K17A 3BR8A 1BXNA 3GFHA 5EWGA 2XS5A 1ZZFA 1MROB 4EO8A 5AJ3J 3S6EA 2VPXB 4NRUA 5CQGA 2Y0BB 3G71S 1FJCA 1YGYA 3F41A 1Y3KA 1UVJA 1LXJA 2ZJRQ 4DR7J 4K4TA 1TKZB 1OQ3A 2HEKA 1YJWS 1RWOB 4WFBQ 5CAAA 4FF3A 2KI2A 4CO3A 4K2JA 4DHVA 2DNGA 4UZBA 4Q0BB 2FD2A 2JSXA 3SMZA 3LGMA 3PJXA 3A8EA 1HBUA 5D15A 2XY5A 3IM8A 4YHHF 3K0JA 3BBBA 3T19A 3TI0A 1U1LA 1GK8A 1YJ7A 2GGPA 3OL9A 4UUWA 1URNA 1PCAA 1KONA 4NLVA 5E7OB 2HZVA 3CJSA 5CABA 5BYRA 2ZM6J 1IBLF 1CQNA 4F8RA 1HBMA 3FNNA 4NA1A 3BF4A 1LWCA 2DHHA 3SEOA 4DL6A 4C8YA 3R2CJ 1WEXA 1KR4A 4OJGA 4CZCA 4JI4J 3FMBA 2COLA 1UTAA 1K73T 3QZ7A 2D9PA 4NLDA 3BSAA 3IRXB 4FP9A 2DCLA 2HAFA 3HVWA 4YR2A 4RWXA 4OI4A 2UXCF 4O3OA 3J7ZT 4FYXB 1HIYA 4CH1A 2UUTA 2ZBCA 3IBCB 3H2UB 2CQGA 3B6BA 2AGOA 3BPSP 3IR7B 2CWXA 1IM6A 4I0WA 2FVCA 3DM2A 3ZZTA 2LA4A 3SXLA 3HHLA 1HNXF 2J6SA 2W9CB 3I55S 1VQLS 1VK8A 4CH7A 4ITSA 5E2QA 4F0HA 2C3PA 3NS6A 1UMJA 2JEFA 4P7VA 3GLJA 1O51A 2DR7A 1HNZJ 2V9WA 1D1UA 2CJKA 2ZITA 1F5AA 3KLEA 1CJTA 1RISA 2V8DA 3DGVA 1M1GA 5KAKA 2EFOA 1VOMA 3L95X 4ALZA 1LW0B 3H25A 3OL7A 1D8ZA 2DHGA 4E0DA 4P72A 2F65A 1C1CA 3G82B 1R43A 1E6YA 4LBPA 4Q43A 4MAKA 2JLFA 1RADB 2CQCA 1EX8A 1YX2A 2DO0A 5ETLA 5AXKA 2ZWOA 2ZHAA 1XEZA 2OPSB 1OYEA 3SFUA 4JBCA 2ZBPA 1G3OA 3L3CA 1U8SA 5F8MA 4J9PA 1OYDA 4KPCA 4LF6J 3CGIA 3VAIA 3HK2A 1WI8A 3MM5A 2G0CA 2OGUA 1GX6A 2RU3A 3JAMU 2OPPA 4RW7A 3ZTOA 1VQ6S 2RQKA 4DV2F 1T03A 3ZZ0A 4DS5A 1TL3A 2V8PA 2YWKA 2DBBA 2JDJA 2DCUB 1RYRA 2XMWA 2W7OA 1XMQJ 4DV4J 2ALYB 4ZCKA 2CQ4A 3CJ4A 1RK8A 2AP6A 1N5YA 4PQAA 1SJ4P 2VKRA 1TUGB 4TN2A 2J7KA 1TAUA 5T7LB 4LIRA 3DDIA 1ZETA 3KJVB 4GC6A 1QUVA 2BZ2A 5ETNA 1NDLA 2EFPA 1RI7A 3CWJA 1UW4A 2J76E 4XTTA 1NJIT 2MZRA 4PQUB 4ZVSB 2CWKA 5HVHA 2YNFB 2P9CA 1SQFA 3LH2S 1NB2A 4PXEA 1XMOF 3TYTA 1HA1A 2G9OA 3UDLA 2MZJA 4NLPA 1Z1ZA 4MH8A 2IVMA 1ITPA 5DZ6A 3UPFA 2B9WA 4PG4A 4DL4A 5D78A 2MQLA 4EBEA 1Y9OA 5F8JA 4TQRA 3JSYA 3PG9A 2ZJQQ 1HHTP 3QO9A 4JV5F 2KN4A 4OFZA 2WZ1A 2Y0SD 1S5ZA 4LR9A 4C8LA 2HWTA 4A47A 3OXLA 4L3KA 3CE8A 2Y9HA 1HL6A 2L9NA 5D4PA 3Q8RB 2H1YA 1VRUB 4ED3A 3U02A 2VF3A 1YRUA 3MMAA 4URGA 1FWPA 4FYWB 1S1XB 2YH1A 4O0NA 1MROA 5IOLA 1I1GA 2VBZA 4DXLA 3OJUA 2M52A 4Y2MA 4O44B 1VQ5S 5B08A 3JSRA 1DTQB 3AHPA 1TKZA 2LMIA 4NYPA 3MFIA 2DNZA 4TYBA 2ACMA 3NEKA 4Q0BA 4ERDA 3DLEB 2W7PA 2C1EB 4DSJA 1ZAWA 4XAKA 1IKXB 3MMCB 3J80Y 3MUVP 2OEKA 2HVIA 3TA0A 3KKFA 3EYZA 3H4BA 4HHJA 3K8VA 2FVPA 2M70A 1IR0A 3NGRA 4E8UA 2XNRA 4L73A 1JLAB 2IJFA 3U27A 1HI8A 1IR1A 4F3QA 3VZHA 3RZAA 4A46A 4HDGA 4ZP7A 4U8YA 4DL0C 1H38A 1S59A 3H5XA 1FA0A 4H4MA 2XWXA 4KGZB 3DHWC 3TANA 1TKDA 3M8SA 3RG6A 1YK9A 3IRXA 2CIMA 1WKKA 4DPOA 2DISA 2VG5B 1U4BA 2FLPA 1DHMA 3KJNB 2VB6A 3H8YA 2BR0A 3J7Z5 3AY0A 1VGYA 2WBMA 2AU0A 2U1AA 1G7CB 3HULA 2W9CA 3FC9A 2F4VF 3GFZA 4N56A 1WEZA 2AX1A 2QSFA 1YJTA 4V1Ak 1NDKA 3L7OA 4OX9J 4QPTA 5KFTA 2E29A 1F2HA 1AFJA 1WC6A 1X9WA 1LQ9A 2VOOA 3D6HB 1LW0A 2HKEA 2OTJS 4UZCA 3AD9C 2KT5A 1MG7A 3WBZA 4LF7J 1YITS 3DI6B 2IVFB 3N5FA 3I82A 3G82A 1D09B 3DCAA 1WC5A 3EDRB 4WFYA 3GE9A 3MM9B 2V2ZA 3P6YC 3KLHB 2OPSA 3T1YF 1SC4B 5FDLB 3P4UB 3JXOA 1SL0A 2V94A 1H2UX 5A0YB 3Q86A 3MD1A 3FCHA 4QQBA 1WDDA 2VKZG 1G1XA 3NGTA 3I0RB 1HBOB 4X65F 2E9RX 4Y00A 3R6LB 2C3MA 2ZKTA 3EDQB 1NKEA 4KH0B 4LRCA 2MPUA 2ZHBA 2HFSA 4C98A 4KFBB 3GR0A 2UV8A 3EXYA 1WOSA 3WC2A 2ZUGA 3HHEA 1FRXA 1WF1A 1H98A 4JV0A 4YY3J 1YJUA 4HH1A 4LF4J 3FRZA 3VGSA 1HWLA 3QSIA 2IM3A 2BBEA 5T7LA 2FJDB 4JI8J 1QM9A 3W61A 2E1AA 3KJVA 2ALZA 1CG2A 5HP1B 4ZVPB 4GKJJ 4LR8A 3THPA 3HX9A 1NJWA 2QIFA 4LIWA 3AOCA 3D28A 1FDDA 4PQUA 5IT4A 3Q8UA 2YNFA 1NLKL 5CZVA 2BYCA 6AT1B 3HKWA 1H7XA 1PAEX 1DZ5A 1YI2S 4O3SA 1UJ6A 4ID8A 5DRKA 1GEHA 2MLZA 3K58A 3BS9A 1KTQA 2OPQA 1A9NB 5C2GA 2DEJA 4LFCJ 4OYMA 4UOHA 4IH5A 2Q43A 3G87A 4FS1A 4Q8FA 1JMTA 4NXMF 1YJRA 3C66A 3D0GE 2F7VA 4QBUA 1WSRA 4YR3A 4TU7A 2W7AA 4ECQA 1B7YB 4KAIA 1LW2B 1TMMA 4USWA 3NMRA 1X4DA 2F3JA 1R3NA 2HHUA 5C2CA 5IC6B 2KFNA 2YKPA 1XERA 1NBEB 2JZ5A 2BACA 4Q7AA 1S1XA 4G6VB 3OD2A 1NSQA 1YRTA 1QSLA 3QPIA 2D74B 4O44A 3UN3A 2RUSA 5KG2A 4OI2A 1DTQA 2FGOA 5I3QA 3G6VA 1AT1B 1S1VB 4YFUA 1WG5A 1ZTWA 1AA1B 2DY1A 4J9OA 2DH7A 5L46A 4I6WA 3DLEA 3QWUA 4J9SA 4CLPA 4LRFA 3GIJA 3G2XA 3IO1A 1IKXA 1V3RA 3PKMA 3MM7B 3MMCA 2FY1A 2EG2A 4CLSA 3F44A 2AEFA 4EFAC 2FQQB 2E7VA 2OFHX 1ZAVA 3AQPA 4J7CA 2DNYA 3ZZPA 1C4CA 1NK4A 3IG1B 1Q8IA 4ZOSA 1J5EJ 4NA3A 1QTMA 4USKA 2R7RA 1PJ6A 1JLAA 1RBOB 2NQPA 2GJIA 2UUWA 2AJ2A 4W90B 4ENOA 3RJMB 1VIXA 1OO0B 2E1CA 4KC5A 4ZCLA 2IY5B 2CYYA 2KG1A 1QAYA 1SC3B 1WF2A 1Q82T 3M2VB 4LF9J 3CSKA 4DUYF 2CAJA 2CZ4A 5IM0A 5D0GA 5LMUJ 3LP2A 2GHVC 2VG5A 3W2VB 1YKWA 2CVIA 2GHWA 3OXGA 2IM2A 2DR6A 2HGNA 1NAQA 4B08A 1YDLA 2IC3B 2QX0A 2VFRA 2N7CA 1NK5A 4EBCA 2CQHA 4C0BA 2L9WA 5A76A 3Q83A 1FRJA 4QR1A 2K3KA 4NEYA 5EUHA 3LAKA 2M7SA 3QLHB 5GAGI 3NOCA 4OI6A 4DWIA 2IA0A 4K4ZA 3D3BJ 2OELA 1VC5A 1IVZA 3GYNA 3QRRA 3I31A 4OZ0A 2DNQA 1N5QA 2OPRB 1EZZB 3VALA 5CYMB 1U49A 2F5GA 3DI6A 4U8VA 1QAXA 4A8WA 3QQCD 5HQ8A 2PSZA 3FEZA 1SJ1A 4X4QA 2YQ0A 4DPTA 1VR6A 1RT1B 2R7XA 3C3LA 2ZD1B 4C8ZA 1W2IA 3KHHA 4LF5J 1S48A 5KFXA 3KLHA 4FYDA 4UY8T 5DQIA 1U02A 2ZH7A 4ER8A 3KLFB 2QFJA 5FDLA 1HHQA 1NH7A 3DOMB 3AOAA 3MTKA 5A0YA 4FPIA 1YBUA 2RS8A 3UDCA 4L74A 2NPIA 1HBOA 1T11A 2YPYA 2OEJA 2J0SD 3DMJB 3GR1A 2FGCA 5DLGA 3AFGA 4PZVA 4LREA 1RHRB 4XK8C 2ADCA 4U96A 1W26A 1VQOS 3DXSX 4DV5J 1EB0A 4CI0B 3FBFA 3PR5B 2XM3A 3MPUB 1NU4A 3HMJG 3HFZB 1QJHA 3M1VB 4P6QA 3AAWB 7AT1B 1BGXT 1R8HA 4EEYA 2DD8S 1NJZA 4WF9Q 1GXUA 3D4JA 2LDYA 1K1QA 1TFWA 3ZZRA 2MY7A 2BQ3A 2OMOA 2N4CA 3C16B 5HP1A 3GZ7A 4X84A 3SCJE 4C3LA 3LWMA 3I4PA 1HI1A 2HFOA 4DU7A 1W7WA 2K7JA 3DNCA 2CPHA 1L5UA 3OT9A 1Z4UA 4NLQA 4K7QA 3LPYA 2IPOB 1YQHA 1HWIA 5L1IA 2XCAA 2C2MB 1RT4B 4F36A 2RU9A 1FJGF 5KFOA 4X2BA 5IWAF 4N41A 5E41A 3ILIA 1SL2A 1H73A 3KXDA 2DR9A 1B7FA 3CJ2A 5DGBA 3DGPA 3UVJB 3M2RB 2ZDPA 2UZAA 3HD2A 2GIRA 3V6JA 3O1LA 4DPXA 1LW2A 1HW8A 3RUBL 2MQOA 3SQGB 2ZWPA 1XC9A 3DLHA 2GQ2A 3M8PB 3KUGA 1EP4B 2FJEB 1CLFA 5G4DA 4M5KA 2N3OA 2M8HA 2M8DB 3BB5A 1SIWB 3FBCA 5KFFA 4LFBJ 2C42A 3D6FB 3S1TA 4YUDA 2RKIB 1GFWB 2UXDJ 3MEEB 2WSFC 5KFPA 3UDEA 1QAJA 1T0TV 2XSFA 1S1VA 5DQGA 3PFOA 1VQ4S 1X9SA 3I6PA 4TXSA 2B4UA 1APSA 4CLWA 2QSWA 2W1BA 4NLWA 2FLLA 1IQZA 4G1IA 1EJ7L 2VPZB 2XCPA 1A0OB 1NHUA 2RQMA 3PW5A 4OV6A 1ULRA 2JEGA 1DFDA 3D0HE 1HQUA 1TFYA 2CZ9A 3IG1A 5HO4A 1VBXA 2V67A 4ES1A 1KLNA 3L7PA 3O2IA 3BQ0A 1JLGB 5KT3A 3Q24A 2MQ8A 1AROP 1UVLA 2GJFA 4HVZA 1X4HA 5DDQC 3PW0A 3DU6A 4DR1F 4QW8A 4LBHA 1ZYQA 4MIAA 2D3O1 4DFPA 4K4SA 5U47A 3ZTSA 4U7UK 2L48A 5DG7A 9RUBA 4ZPCA 2AD9A 3QJJA 2BE9B 4PWUA 3M2VA 3GILA 1SXLA 2XZDB 1BC6A 2OUGA 4NMXA 2DGVA 4YB1P 1NSPA 2QTWA 1RTDB 1HWKA 2KFYA 4PWDB 3W2VA 1KD1T 1DQAA 4Q45A 1D0EA 1RACB 2A3JA 4UT4A 1VBYA 3G6YA 2IC3A 2W4CA 2H65B 4HI2A 3KNGA 1KQKA 1W2BR 1TKXB 1IN0A 3EJMA 3W8GA 1Q95G 3J81U 4AE5A 4UTGA 3GTYX 4B3RJ 1LWXA 4N8NA 1YTYA 1WHWA 4WP3A 1FFGB 3TEHB 3QLHA 3P49B 2KFZA 4AL6A 4X64J 2WVFA 3HHDA 4TY9A 2ZNZA 4DR7F 2Z8QA 5IS2A 4DR4J 5LL6d 2HS4A 2NYHA 4LFAJ 4PRFA 1WD6A 4XIUA 2OPRA 1ZM4A 1C1BB 1Q16B 3AH6A 4RW9B 5CYMA 2R4FA 3FBEA 5CXTA 3SSRA 5ETKA 1R0BG 1T02A 4RR5A 4DR2J 2FHKA 2RRNA 1BUXA 2YWEA 5HJYA 1FRMA 5D0RA 1RT1A 1V5VA 5GADI 2ZD1A 2YTCA 4OJ3A 2P5VA 1X5PA 3FCWA 1U1KA 1IKVB 1JWWA 2J6UA 4RBVA 5C7PA 5HROB 3KLFA 2ZM6F 2J6TA 1F1BB 3DOMA 4TVAB 1N52B 3A13A 2ZH2A 3M7VA 4OYOA 4UY85 4IH6A 5A2QU 5KG5A 5IFMA 4JI4F 2NYIA 2K2PA 3DMJA 4OLPA 2YWWA 4LVNP 2HRYA 3DU5A 2OSRA 3GQCA 3ILLA 4ECRA 1DBDA 3VV2B 3HHLD 4WTOB 1S6QB 4DLEA 4JI5J 2D3ZA 3MTJA 3G4SS 3M1VA 4IR9A 4RUHA 3TWZA 3A4TA 3SSSA 2YNHA 3IS9B 4ZVRB 4ZLNA 1JK9B 4N7TA 3FSIA 4KE5A 2HLUA 4MKAA 3R5CA 3PACA 3NNHA 4UQTA 1Y5NB 3C16A 2BX6A 4AYBD 2AGPA 2AJ1A 4KBIA 4ZDNA 2MLXA 2CQ1A 1U7LA 3HCXA 2JEJA 1FRLA 2GAGC 1CQMA 1HNZF 1JLFB 2WB4A 2GVDB 1OY6A 2CQDA 4LSNB 3O8WA 4DV0J 1U26A 3FSYA 3FZBA 1RT4A 1ZM2A 4CCHA 4I2PA 1S10A 5IT0A 5KFWA 2ACYA 1X5SA 4N5SA 2MKSA 1WG1A 2F40A 2EXUA 3TVYA 1U24A 4ZKAA 3UVJA 4U6PA 4NI2B 4ATNA 4F02A 1XBWA 1GNKA 4CO2A 4FN5A 1RAAB 4KHMA 4ECTA 3QNWB 3SQGA 1RT6B 2CADA 3M6XA 3RB6A 5H9FK 3M8PA 4DUZJ 2E1MC 1DTTB 4ED1A 1NO8A 3T5HA 4FNIA 3Q0AA 4LF6F 2XB2D 2QL9B 3DDKA 4J9VA 2R7VA 4J9NA 2AGQA 5D3GB 4WU2A 2RKIA 4UF4A 2C2EA 2NS1B 3K5PA 3HF5A 5HMYA 1U45A 4V19X 2G2OA 2YKMB 4FF2A 3R5JB 4RWWA 1XMQF 3PO5A 2G0JA 4DV4F 2R8JA 1TL1B 3CDAA 2M5YA 4TQSA 3CCTA 3IWLA 4C3KA 1DQ8A 1JLEB 4RKUC 4C11B 2E9TA 3S8SA 4RUBA 4DV6J 2IDEA 1N88A 1VK3A 2H3EB 3M8YA 1R0CB 1IJEB 2IHR1 2FJBB 1TR0A 3N0VA 2MQPA 4DCOB 5IT9U 2HNZB 2NXEA 3VAGA 1JLGA 4CLLA 1M5KC 2VJVA 2KKHA 4C9DA 3K7RA 3AJ1A 1HQEB 1VMBA 3HSZA 5LXYA 3W2WB 4NLUA 1NK7A 3N79A 1OSDA 1NSKL 2CJYB 3HVRA 1FEHA 1RTDA 1KHWA 3CC7S 5B0BA 4USHA 2ATCB 3H2VE 4U7UD 4PWDA 1QUPA 2Y1LB 4QOTA 4AD6A 3CJ3A 5THWA 3A8IA 1QDUB 4Y2AA 2B43A 3TOQA 2F8MA 1TKXA 1RBAA 2ZBQA 3M6WA 1KVKA 2BE7D 2Z0GA 2ROGA 2MHNA 2G0IA 2BA9A 5AE1A 1XN9A 1VLYA 1RUSA 4WP8A 4FYVB 2XY7A 2AEJA 3CJ0A 3T9NA 4NCGB 1CEZA 3RW7A 2DPJA 5CD4H 3QFWA 2LECA 1HNWJ 1O6XA 2JRSA 3GIKA 3M32B 2FVQA 5KFUA 1JXLA 2QZ8A 1K0TA 2ZHOA 1SQEA 3ZTQA 2GMHA 4I7FB 4XDCA 1MU2B 1C1BA 4A8OA 4RW9A 3IGVA 3H7HB 2FC8A 1ROFA 2LU1A 4KTQA 1X8DA 2XMAA 5KFKA 2JOQA 3BM7A 1U6BA 5L39A 1U47A 5GAEI 2DHAA 1RZMA 5HAOA 2RDJA 3J81j 1PC4A 1VIOA 2HWIA 1IKVA 2M4MA 2E5JA 4M5HA 4BHQA 3RBZA 2DRBA 3RYLA 2AV5A 5F9LA 5KFQA 5HROA 5E0OA 5HMWA 3BN4A 2MSTA 3PDNA 3EUNA 5ETMA 4K50A 4GVLA 1WOPA 4I67A 2XO7A 1NKBA 3NXZA 3V6DB 5GAHI 3R5GA 2X51A 1HMVB 4GRSA 2BANB 1S6QA 1LNQA 4IRKA 2DGSA 5DETA 2JHEA 3CCZA 1WTFA 1U1MA 1UVKA 2PDAA 3LF0A 3CCRS 1TKTA 2EFNA 3DYAB 2MB0B 2DGXA 4OX7A 2H5JB 4GVBB 4L75A 3UI3A 3KHRA 5LJ5Y 5J2NB 2DPIA 4HACB 2RQCA 1DLOB 1FE4A 4OYXA 2J5AA 3DRYA 4OX9F 2UXBJ 4XO0A 3H5YA 2FVRA 4R8UA 1JLFA 2RT3A 2GVDA 3VHQA 2QFIA 3B54A 2XHCA 1VLOA 3CT9A 4LSNA 1P9YA 2HK3A 5JUMA 5GMEA 4W98A 3GONA 1OY9A 4PR6A 1VFJA 3T5LA 4LF7F 3JS9A 2WSCC 3BH7B 4NI2A 5FJ4A 2VC1A 3MR7A 3AXKA 1C4AA 4CLUA 3RAQA 3SIPB 2H54B 5KFDA 4J9KA 4JI6J 1RT6A 1P1TA 3BREA 1SJ3P 2GVZB 2DYAA 5BR8F 5IV4A 3BBFA 2QE5A 1SC6A 2C28A 3Q8SB 3KTQA 2LVWA 4Q44A 2UUCJ 2QL7B 5D3GA 3ENVA 2AYGA 4WJBA 1FX4A 2J9CA 2O3DA 3ELHA 2FJXA 3N6MA 2OSQA 2FYXA 2KG0A 3QT8A 2R9LA 2DHXA 3TRGA 5AXMA 3OTEA 3K5MA 3NOGA 2X3GA 2YKMA 3CCQS 4I69A 2JVRA 5DZ7A 4ELVA 4QIEA 4YY3F 4GC7A 4JUZA 4A4JA 1TL1A 3UD4P 1PIEA 4LF4F 1JLEA 3L09A 4HI1A 3ENAA 1JXVA 4C11A 2ZZMA 2LEAA 1NNDA 1RTIB 1ZTTA 4FBTA 1FKOB 4JI8F 3CDBA 2VICA 4KGXB 3GIMA 3FRYA 2UVWA 2JC0A 3TZWA 4FXWA 4GKJF 3R1LA 5KFSA 2PMWA 4ECZA 2ZH8A 3ISND 3J7A1 2B7CB 5CYJA 5D4LA 2RHQB 2HNZA 2OP5A 4RNFA 4RJVA 4DSFA 1R8CA 4LSLB 2HVEA 3HZEA 2X1AA 4C4WA 3NGKA 1HQEA 2WW4A 3W2WA 1FX2A 2HHSA 4LFCF 2CJXB 4WU3A 2KRRA 5H9EK 3SSQA 1KKHA 1P27B 2WBRA 1VDHA 2H9ZA 4JI3J 4CTAB 3MD3A 1RAOA 3ZO7A 3DXBA 3KK2B 3OR2B 1XJWB 2H5EA 2MGZB 2HW3A 3X1LB 4ZPDA 2HK2A 2XO6A 2EKYA 4WZQA 1HI0P 1SI9A 3ISNC 3CB4A 1N34J 2BM0A 4M5GA 3OW2R 4NCGA 1IUJA 3T9ZA 4N47A 1VQ9S 3UCGA 1Y7PA 3PEJA 1SJRA 3CPWR 3M32A 1G4CA 2XGPA 2LYVA 4YDXA 4I7FA 1TV6B 4WWSA 1MU2A 1YZ7A 5B0AA 1T9XA 2VC0A 4ZVOB 2D7SA 4C3MA 4I68A 2V4JB 1FHTA 4J9LA 2LCWA 3R8YA 4F26A 4ECXA 3FQKA 4C8NA 5E3CA 1B64A 3D7SB 2LEBA 1UPPA 1KP6A 1WOOA 1J5EF 3D5MA 4ECSA 3BO4A 1F9HA 3LA0A 3FEXB 5A8KA 3TJ9A 1H7WA 2UUBJ 4DDFA 1SKRA 3OPKA 4ZK7M 3I32A 3RBDA 1KBRA 4J9RA 1U1NA 3K5NA 3BDEA 2BW2A 2POKA 1X4FA 3V6DA 6FD1A 4DX6A 2AF6A 4LF9F 5K9FA 1HMVA 2R2RA 3M9NB 2BANA 2D1CA 5LMUF 4DV7J 3JTPA 3QGGA 2DNHA 2XBPA 4ZVUB 3VAHA 4QIGA 3DYAA 3MUTP 1JLBB 2X1FA 3E8OA 1SL1A 3TZZA 3OFGA 1KHVA 4GVBA 4CT8A 2F8HA 1S99A 5J2NA 3MXHP 1MNEA 4HACA 3QYYA 1JNZB 1DLOA 4P9SA 3A8JA 3UR3C 2MQQA 4R25A 2RAQA 3HSJA 3KLIB 1IR2A 3D68A 2CPIA 4Z37A 4NMLA 2ASLA 2EK6A 1RWWB 5K8NA 1S9EB 2NZ4A 4KH1B 2IMOA 2BM1A 2W01A 1R6YA 3K5LA 2AQ4A 3V4MA 4Y65A 2UP1A 1WC0A 3NCQA 5FLXY 4U7CA 3GJTB 2W9AA 3HPOA 4LF5F 1S57A 1XTZA 4KPYA 4JV2A 3CIZA 1I94F 3BSCA 2Z4PA 2F8EX 1AYEA 4QU6A 4P75A 2UUAF 4HH0A 2H48B 4QWCA 1HPZB 3M30B 1FDNA 3KK1A 4ZN1A 1S4EA 1U48A 4W4MA 1VS3A 1KTVA 5D8HB 4DV5F 1FF2A 3SBMA 2XLJA 5ETPA 1U1RA 4ZIWA 5F41A 2CPFA 4Y34A 4X4VA 2Y8WA 2W2PP 3KK3B 1NRKA 3BSNA 1RTIA 1FKOA 3HDSA 2KM8C 2AX0A 2RSQA 2QLFB 2CQPA 3RBEA 1KS2A 1Y11A 3L9ZA 3EM1A 2VASA 3BZQA 2JEIA 1U8WA 1VC0A 1UVNA 3QJLA 2EFQA 2DRDA 4HTJA 2VD3A 1Y00A 3ZZYA 3MR5A 2R7OA 2JC1A 4KYZA 1NK0A 1RCOB 4LSLA 1RU2A 3LTOA 2B8QA 3PY8A 4KO0B 2BKPA 3K8WA 2QYCA 2WW8A 2EC2A 2RNEA 3NBPB 5M2UA 2CXEA 2B5JB 2GQQA 4DLGA 3CCSS 1TK0A 2ROEA 4DQPA 4ILRA 2ATLA 3KG0A 2W2MP 1N0VC 3P45B 3OR2A 2MGZA 3PKYA 1T03B 2LP4A 3IR5B 1TL3B 2BOAA 2QLBB 1NEEA 4GKKJ 4DPUA 4LFBF 1Z2ZA 3A12A 4QWDA 1PC5A 2UXDF 3OXFA 3OUYB 2CNNB 3PEHA 1XR5A 4ELUA 5J2PB 4M5LA 1QD1A 4ANDA 1YJVA 4IKAA 2HS3A 1RTJB 2HFVA 5FLXU 4ZVFA 2CJBA 4WFXA 2BUNA 2GHPA 1FTRA 3C6UB 2V4JA 3R7SB 2ZH5A 2OAUA 2H4WB 3CDEA 2KTQA 3FK4A 1U25A 2FVSA 3MZIA 2DNPA 4H4KA 1HKAA 4KT0C 4FBUA 3TJ8A 1M5SA 4I6YA 2BEFA 3TQEA 4W92B 1VQ8S 3RRHA 1ZA1B 5KFBA 4MK9A 2YWHA 3S01A 4C48A 2VA3A 2WSEC 4F4XA 4M5NA 1RKIA 1WNEA 4NLSA 1NK6A 2RMLA 2EVZA 1FCAA 3O3LA 3O6QA 3KFWX 1Q53A 1S9FA 5AE3A 1C0TB 3KDOA 3QGIA 2J7WA 3G96A 1T9TA 1HNVB 2HBQB 3ETMA 3VGVA 2FY8A 3MPYA 5EGYA 2PFFB 3MR6A 1JLBA 5F8NA 2UU9J 5L1JA 3Q89A 1B4SA 2GO9A 1JLCB 2HGLA 1F2GA 2LQ8A 5LM7E 4B3RF 3MAQA 2B4VA 2ZH6A 2VDHA 3E3XA 3TUPA 1M1HA 3CCLS 1GAOA 1ICEB 3DFEA 2XQCA 2Y1IA 1RWUA 4ECVA 1BQNB 4X64F 3D0IE 1UA0A 3KLIA 4AXJA 4DR4F 4J90A 5F8IA 4PABA 4LFAF 3QIDA 1S9EA 3EZ5A 4KSEB 4DQSA 2BJDA 2CQBA 2BMBA 2G2YA 2GC8A 2VBWA 2BV3A 2WVCA 2DNOA 4USVA 4DR2F 3HLUA 2E1RA 3HSDA 2EC0A 1EQ0A 1RABB 4DFKA 1L3VA 4HKQA 2JLEA 3H40A 1M5OC 1IQTA 4EI2A 1X0FA 4H4MB 2HHVA 1HW9A 5KG6A 5EX0A 5DJBA 2JFDA 2Q1LA 2GQCA 2ASJA 4RW4B 2CPDA 4ANEA 2B3TB 3THVA 2MZQA 5GADU 4WXOA 3BKFA 4WIIA 1P8GA 4RNMA 4NLRA 4NLGA 1HPZA 3M30A 2BABA 2R7TA 4Y6IA 3WIUA 4RU2A 2B56A 2HQCA 2NR0A 1Y4ZB 2XI3A 2AYEA 4K4XA 4ES3A 2X1GA 4JI5F 4QYZJ 3SFGA 4OIXA 3EWGA 4ZP9A 5KFNA 2R7WA 2QYGA 4BBYA 2CUYA 1N6QA 4DF4A 1Q0NA 3KK3A 1VC6A 4MKVA 3ZZUA 1MSWD 2F9DA 3ZNJ1 2E9ZA 3FUYA 2Q6BA 1KNZA 3T1HJ 1H72C 4CLYA 1JJHA 4WPAA 4AUKA 3Q8PB 1TELA 3R7BB 2GAHC 3DOLB 3PR4A 1IWAA 4DI6A 2GMLA 3IC1A 3OVAA 1J27A 2N4DA 3IP0A 1PYTA 3ISZA 2D3UA 4KHRA 4DV0F 3JQJA 4OI0A 3B78A 4LQ3A 2CPYA 3H20A 1WACA 1X4BA 4P2MA 3NS5A 2L41A 2FUG9 2W4DA 2KL8A 1M5HA 3MM6B 4KO0A 4TU8A 3CXCR 3NBPA 2B5JA 3QSYB 1Q1KA 1UZHA 1AZSB 3NCRA 2IFXA 3HVAA 4PCQA 2BOPA 4KR0B 2NXNA 4DUZF 4IH7A 3IN5A 3NKYA 5KFAA 3DHXA 4FVMA 2XS2A 3VAJA 1P6TA 1S7IA 2JH3A 3PW2A 2W4PA 5JXSA 4P7TA 3V6HA 3PW4A 3OUYA 2ZZTA 1KFDA 3DLLQ 1REGX 3FMWA 2QA4S 1O8BA 5J2PA 5K8MA 1NDPA 2C3OA 3VAMA 3W9JA 4PUOA 2DGTA 1RTJA 2EBGA 4MMOA 2KZZA 4WTYA 1HYSB 2O1PA 2B4OA 3QIPB 2OFGX 4IDKB 3C6UA 2D9OA 3Q2SC 3LP1B 4ILMA 4DV6F 2HAIA 1H2VZ 3ENWA 4LBIA 3UWTA 2D69A 2PMZD 1PBAA 5B0GA 2OPQB 1Q5YA 1YBAA 5DM6Q 4RZRA 5KFLA 2EKNA 4F04B 3BO2A 3G6ES 3ILOA 2M2BA 3AJDA 4N76A 4B3SJ 3T5JA 4DQQA 1XR7A 1UA1A 1LK5A 1C0TA 2P9EA 3CEDA 2M9KA 1XR6A 3B4MA 4IOCQ 4O4RA 5KT6A 2QGFB 2ZDOA 2HPUA 1SB6A 2HQFA 1HNVA 1RLCL 4GO5X 3G8SA 3CC4S 3H5UA 5A8WB 2FJWA 2IJRA 2FZKB 3MWBA 1UWBB 4NZ7A 1GMUA 2YKQA 1JLCA 1RE1B 4RW8B 3IAM9 3A3NB 1CJVB 2XYGB 4JI2J 1S79A 3NRBA 1KEKA 4OL8A 4D3GA 5ADZA 4NOHA 3GCWP 3TZXA 1FO1A 2RRBA 3K2YA 1TAQA 1HNWF 1BQNA 2XWYA 2Z2ZA 1B99A 4RU9A 3ICLA 1T9UA 5A6PA 3UR0A 4DR5J 2P8IA 2WOMB 3SI8A 3ZZZA 3I5CA 1FXDA 3OFFA 3DKDA 3QMQA 8RUCA 3C15B 1KVJA 4B9NA 3HKZD 2ZJPQ 4EYIB 2J0WA 3TAMB 3PHEA 2RF2B 3AT1B 2ZC4A 1CC8A 1SJQA 1FK9B 3HFVA 1FDAA 4P10A 1IJFB 2GFFA 2VONA 4RW4A 3Q2TC 1RXOB 5GAEU 1Q7YT 3TZYA 2DKOB 2NUUG 5KFHA 1NCLA 5IM0B 3LUYA 2ZOFA 3LP2B 5B09A 1X0PA 2XY6A 1K0VA 5EN1A 2AT1B 3CUNA 5K20B 4F50A 4F25A 3R9LA 3SCKE 4NL5A 2DNLA 5HVGA 3P5TL 1RAGB 1NK9A 4JOUA 4I6AA 4OYIA 3TVKA 1PILA 2EFVA 2FPHX 2BRLA 4OHYA 3QBCA 5BYSA 4QR0A 2DIUA 4ZMMA 5GAHU 4QJVA 3RRKA 3ZZOA 2E5GA 1EKSA 4MJKA 1HQ2A 3AA9A 2ZBRA 2UXBF 3DOLA 1R0AB 5KFCA 1Y3JA 2OD4A 2NCKL 3D54A 4YS2A 2BQRA 3C19A 2DY9A 2QA4G 4HTIA 2AMCB 1NPKA 8ATCB 2MZSA 1JXEA 2Z30B 5KG1A 5HI7A 5D6GA 4EGLA 4KGMA 2AWZA 3MM6A 2CNLB 1WTBA 3TX0A 1L3UA 4BCAA 1S6UA 3IBWA 1WKJA 3POTB 4OYPA 5BXIA 4C2MA 4IYQA 1AZSA 1X9MA 5L9NA 1HLWA 2KM8B 4JI6F 3I96A 2ASDA 1SUQB 2UVVA 5C24B 2VFSA 2W8KA 1S77D 1S0MA 3CCJS 3GV5B 1DAXA 2UUCF 3J80U 2VUGA 2V34A 3N5BA 3SV3A 2AZ3A 1L3SA 1N33J 4C7QA 4PG8A 1RU1A 4ANCA 1LFPA 1CULB 1NHKL 1X4EA 4Z2XA 4OZ5A 4EK2A 3RTVA 4NYOA 2B51A 2V2VA 1H74A 5ETQA 3JSBA 1MW7A 4ZPBA 2CG4A 4HHUA 1HYSA 4YN3B 3QIPA 4IDKA 2DH8A 5GVQA 4DSLA 2A10A 3LP1A 5GMDA 4Y2CA 3DLGB 1FFWB 4RO0A 3UE2A 2MJUA 2NXCA 4ILLA 1FERA 4EMDA 1X60A 4M94A 4ZJQA 1YJ9S 1GT8A 3OR1B 4YB5A 1HBNB 4EUVA 1R7IA 3B4DA 3KJFB 2NUHA 2ZH1A 3CJQA 4C8KA 2IVYA 1VQMS 4X4PA 1S1TB 2E5IA 2CJAA 1PYSB 4USTA 4KQZA 3DGPB 2HNYB 1Q5VA 1X4CA 1LEOA 2HNDB 5KG0A 2VU5A 2MKCA 3TA1A 4OYAA 4R0EA 5JVHQ 1R8BA 3UNYA 1FNXH 1BQXA 2M3DA 2RRAA 3OVSA 1WEYA 3W9IA 1LXNA 2OEMA 5JJBA 1T3OA 4AL5A 2XTJP 1UFLA 2HRTA 4JI3F 4PEOA 3LANA 3W60A 3M8WA 2R8GA 3FBBA 3BR9A 4CLKA 2DT9A 1N5SA 1TL4A 5A8WA 2Q66A 1UWBA 5ETTA 3IAS9 2GNKA 3HJVA 3GB0A 1NH8A 1VJQA 4RW8A 1F3FA 1CJVA 4E98A 5CYQB 3JB9k 1I3OB 1N34F 4ZJOA 4OZ1A 4MYUA 4WFNQ 3ET6B 2NLWA 1VBZA 4FNHA 2WONB 3R5DA 2XZWA 4J9MA 2AKWB 4NASA 5IWAJ 2A1BA 4RLEA 2A0FB 3GFYA 5I3PA 2MJNA 2WOMA 2V4QA 1HQUB 3H59A 3WDOA 1JB0C 4OJ1A 2XMTA 2N3LA 3C15A 1YVFA 2KXHA 1TQLA 3PCOB 4NPOA 4A48A 2F1FA 4DN0A 2YXLA 1VHIA 4B3MJ 3VZIA 4AL7A 4JYAJ 3TAMA 2ZC3A 5I3UB 3EZUA 2RILA 2RF2A 5KFYA 4XPCA 2GX8A 2VBXA 4M5MA 4FDFA 3CF5Q 3TUJC 1FK9A 3CD6S 3DRXA 1FT8A 4NRTA 4CIOA 4TKTA 3OL6A 2C2KB 2UUBF 1OJ4A 4BC7A 2VOPA 3MEKA 4IFVB 3PO4A 4DX7A 4ZPAA 3EGNA 1RTHB 2QMUB 3D66A 2KJVA 3KUEA 4WK1A 3C8YA 2M88A 3DRSB 1MN7A 1URRA 1FVSA 4DL2A 4ZPWR 3TUZC 4DV7F 4OZ2A 3PXGa 3GSIA 1I51B 2I2YA 1L3TA 1T94A 4AQYJ 4FPRA 3N4WA 2E7XA 2E5HA 3EPGA 2IM0A 2CQIA 2MMYA 4C6AA 4EBDA 4B9SA 1LFWA 2DGUA 3VWSA 3VF0B 3FKBA 3CCWA 3JTOA 3Q8YA 4CQ1A 4OI3A 1CJKB 2AJ4A 3A3OB 2C2ZB 2AEMA 3ILJA 2HLTA 5CCLA 2DITA 1R0AA 3LALA 3MAHA 3NMAA 4F4WA 3R97A 1CVJA 4QYRA 1AUSL 3G6XA 1CBKA 2QJ3A 5IV3A 4X62F 2AW0A 3VAKA 1UETA 4C97A 1Q81T 4Y28C 1RWXB 5F8HA 2YQ1A 4UOFA 1FRKA 4JP8A 4I1TA 3GJRB 4X66J 4DN9A 1OS5A 4MKBA 2LKZA 1BLUA 3LGNA 3BGFA 1V5IB 4QIWD 1YG0A 3POTA 5HMXA 3QT7A 4MYTA 4OJHA 3TVZA 3QWPA 3EICA 2VQFJ 3IXQA 1SUQA 5KFEA 4HDHA 2MYFA 3DLKB 5C24A 4DSEA 4DFMA 1YHQS 3D6TB 3GG0A 2E5LJ 4IG0A 2GJ2A 1PG5B 4X4TA 2HFNA 4KKOA 4CLTA 5LJ3Y 4QWAA 3MEDB 3JAMY 1VRTB 3R1HA 3W3SA 2YNHB 1CULA 3CO9A 1Q7LB 3I5AA 3B8HA 3NGDA 5IQQA 3CJ8A 5E3QA 1S6OA 4YDDB 2MHEA 4CH0S 2DNNA 2IRUA 2BJEA 4Z7YA 1KRPA 2VL1A 5C42B 1X31C 3T6BA 4RNOA 3PX0A 2QMXA 3J7YU 3BGLA 3KUHA 3DLGA 4QCLA 4P2SA 2AHOB 4M5JA 3MMBB 3W1YC 2ZNYA 1ZM3A 1RT2B 3OR1A 5B0EA 1HBNA 1V9OA 4MT1A 1JX4A 5M2RA 5RUBA 4I2PB 6FDRA 1UKUA 5F9NA 3T1AA 5DS7A 2DNMA 1S1TA 2JFKA 3LOUA 5HATA 5HL7Q 3UCZP 5DLFA 1GXTA 1OY8A 2BJ7A 3OLAA 2HNYA 4O4GA 1U6ZA 2HNDA 2HQGA 3W65A 2RUGA 1R8PA 5DG9A 1YZ6A 2FLOA 3KLGB 2WHOA 2PN6A 3EGZA 2Q6CA 3AQOA 1UCNA 1RT5B 5J1EB 2I1RA 4A8FA 2VODA 2ZH4A 1Q8BA 2DVIA 1FRHA 4DPWA 2VPWB 1PYOB 4NZ6A 2JL9A 2IYGA 4JI0F 2EW9A 4L6V3 2G13A 3U1LA 1BY9A 1KWMA 5CYQA 3CMES 3BPDA 4GKKF 3TO8A 2XMMA 4FYYB 3Q8VA 3ET6A 2J0QD 1XNQJ 2V6AA 2WONA 3FZ2A 1QSYA 1R6VA 3CMAS 2G1HA 3ZTPA 3OTOJ 1HD0A 4K5RA 3TJAA 2PI5A 5L1LA 1WG4A 1M90T 4QIVA 4KGKA 3BYPA 3PHTA 3D3CJ 1R31A 3H2LA 2KJWA 4Y2KA 4I4BA 1XNRJ 4FF4A 2E66A 2F4FA 1RA6A 2AIRB 4QW9A 2R2TA 1S76D 2YNGB 3JSMB 5I3UA 3FQLA 2DGOA 2PE8A 5KG4A 2H4YB 2ZOMA 4PYDA 4JI1J 1IWGA 5DO2A 3NGSA 3LO3A 1IBMJ 4RNNA 3CD7A 4KHPJ 3IWXA 3D1OA 3Q23A 1KC8T 2XMKA 2DXDA 1S6PB 2EWHA 2N7YA 4ZVHA 4IFVA 1XWLA 4DUTA 3HP6A 4B3TJ 1RTHA 3VVUA 3FJ2A 2EG1A 3TR5A 1YLXA 4RUCA 2DJWA 3DRSA 2HQIA 3MCSA 7FDRA 3ITHB 4B3OB 2BJ9A 5AJ3F 2XYHB 2LFVA 4BS2A 2KB2A 4LRDA 3N6NA 1MWQA 5CZXA 2UU9F 2ZBIA 2V4RA 1D9AA 1N8RT 4CWBA 3M05A 3BYRA 4K4YA 5DG8A 4I64A 4IO9Q 1TVRB 4F3MA 4DPYA 3WX4A 3QT5A 1OSCA 1CJKA 4HR2A 4Q8EA 4OMFG 3RW6A 3J7AN 1FXRA 3ONQA 2CQ3A 2WAQD 2I38A 3MECA 4ED0A 5KFZA 5LMNJ 3T6JA 2YVSA 4M95A 3PX6A 4LF2A 4D3HA 4UW2A 2X1BA 3R2DJ 4QU7A 4I2QB 4USJC 2HIQA 3QFHA 3KG1A 2R7SA 3HT3A 4UQGA 4QPXA 1Q78A 1HWJA 4M5DB 2KH9A 2ZH3A 3BKTA 3RGIA 3R3TA 3CCES 3A3PB 2HGMA 2FIUA 2DNRA 5KT7A 2CDRB 2KVQE 3NP5A 1FFSB 3UQSA 4RL1A 4WK3A 3A8KA 2I5JB 2GA7A 3MPDA 1N56A 5K14B 2OI2A 3DLKA 3H42A 1K9MT 2HRUA 3NGUA 3P3DA 2IA6A 5D4NA 3MEDA 2OLWA 3PYFA 1VRTA 5GMKa 5K5MA 4QWEA 1BQMB 4FXDA 1TKTB 2VG6B 4CYUB 2VH7A 4YB7A 2NPFA 3MPWA 1YIJS 2H5IB 2W2QP 3BSOA 3V6KA 5BJRA 4G1QB 2J8AA 1L3KA 1NM2A 3BJYA 1RTZA 5C42A 2I8EA 5DDRC 1S0VA 1AUDA 1S12A 4R8UB 3MMBA 2FC9A 2ZH9A 1RT2A 3M8RA 3U7JA 4WXWA 3BH6B 4I56A 3GPAA 1P9QC 3T1HF 2W8LA 2CPZA 1R89A 3PRDA 1T7PA 4DZ6A 1DURA 1U2RA 5KG7A 3M8ZA 4USMA 4UOGA 1GX5A 3BQ1A 3E01B 2GIFA 3G9CA 3MOZA 3PFEA 4J91A 1S0OA 1PGZA 4NCBA 2QN6B 2YNIB 4DV1J 1HHSA 3EVWA 2J8SA 3BV8A 2GS8A 3NAIA 3KLGA 1BWEA 1KLMB 3RAXA 1PSDA 2ILZA 4A8KA 3N9UC 1O5JA 3QRQA 4IRCA 5HQMA 2R2UA 1RT5A 1XQIA 1MMLA 4IRDA 5J1EA 3NS7B 2UVRA 2NZCA 3LW5C 4KY3A 2XLIA 3AD8C 4O3PA 2HVDA 1HR0J 4GMKA 2CQ2A 2IJNA 1DQ9A 5ETVA 5DDPC 2HBYB 2AJFE 2DK2A 1P1LA 5LSLA 4F0MA 2HVHA 1RWPB 4OV1A 4K0KJ 3ENQA 4B9VA 3BGRB 1MWZA 1X5TA 4EU0A 3HSGA 4QR2A 3CCVS 2FJAB 2UVUA 3PNIA 1NJXA 2DR5A 1FVQA 2HURA 3TAQA 1K1SA 4DZDA 4UOCA 2N82B 5J1NA 1E6VB 2M0GB 1GMWD 3T5KA 1QY7A 5HQLA 3LP0B 4YQWA 5CA5A 4Y2IA 5KT2A 1S1WB 4LF8J 3OFEA 5G0RB 2YNGA 4H54A 4RUAA 3JSMA 1JJCB 3QJPA 4IG3B 5BR8J 4P52A 1QE1B 3GIIA 3HXMA 1BWVA 2RE1A 4YEAA 4ELTA 2V8VA 3P5BP 2HVZA 4DQIA 2G4BA 1OMSA 1S6PA 3FEYB 1G6BA 3T41A 2VFTA 4B3SF 1NXIA 2RS2A 2LEPA 4MFBB 2VQEJ 3R5AA 1W25A 4A8YA 4QWBA 2QLJB 3OBIA 4ZPVR 3VQSA 4HL9A 4OYBA 5ETOA 1U2FA 3ITHA 4B3OA 3BBCA 4ZVGA 5D0HA 1TMJA 4TYAA 2VJUA 1S7HA 1RHUB 2VFUA 5IC4B 3CMQA 3W66A 1U1QA 2RB7A 3KLVA 1BHNA 4JB8B 5HLFB 1U2CA 4DR3J 2HYIB 4JI7J 5H1SV 3OJSA 1VI7A 2B9EA 2Z2LA 4JI2F 1QSSA 3HJFA 3ADAC 5A6WA 1TVRA 3CDWA 4CM0A 3BEGB 4DJBA 4G1PA 4LJMA 2D41A 3RBXA 3IA0A 4M5IA 1SJFA 3HVTB 4I2QA 4FS2A 4F4YA 3KOAA 3CJKB 5I4MA 1EAYC 1FKPB 1S9GB 4DR5F 1H2TZ 3DDNA 5SZTA 2RH3A 3CD5A 4WKYA 2O67A 4IQXA 4M5DA 3EX7B 2F9JA 5EDWA 5H9FJ 2J7UA 4J9UE 4ZVTB 2CPJA 4MK7A 1RAEB 2H51B 5A8KB 1VRUA 4CP5A 2XMUA 1Y5IB 1TTHB 4X4UA 2YKNB 1N5TA 4UUXA 3BO3A 3Q22A 4L72B 2I5JA 3VVTA 2DGWA 1VQYA 1R8AA 5K14A 2MY8A 2PEHA 1B70B 2V69A 2EFGA 1LV5A 3HT0A 1Q8LA 1RWMB 3R6GB 4FVCA 1KDNA 2UV8G 3ZNUA 2XSJB 2Y3YA 1DJ0A 5D4OA 2J9DE 1JJ4A 4PG5A 3SCIE 2CDQA 1BQMA 2VG6A 4CYUA 3DLBA 4DSKA 4KGVB 1MMNA 4HEA9 2CNKB 3EMTA 1LK7A 4NXNJ 4NCAA 4CO5A 2KYXA 2W9BB 4G1QA 1IBCB 3LAMA 3BGUA 3TARA 4LMZA 3O44A 2WVEA 5EX3A 2KDOA 1BMQB 4X4RA 2HIYA 2B9XA 4NA2A 4M63A 5KFMA 4FZVA 3ZTRA 4IUFA 2YQ3A 4P2XA 2RD5C 2YKAA 3GG1A 2NXUA 3BGOP 4NEZA 4P73A 1SC1B 1R27B 1J2VA 3E01A 3IGNA 1GTHA 4OZNA 1JJ2R 2PC6A 4FF1A 2YNIA 1FJ7A 3DRRB 2FHJD 3F73A 2BW7A 1WORA 1GMVA 4DMZA 1KLMA 3RB3A 4DR6J 1SKWA 2DR8A 3CJTA 2X7IA 5E5NA 3C14B 1EQMA 3V4IB 3MM8B 4R5PB 3MCNA 5F0UA 2B8PA 2OO4A 2GV1A 3CW2C 3KK1B 1EKRA 2P9GA 2Q79A 4OZ3A 3MCOA 1IKYB 2QO3A 1NKCA 3THTA 3OQ2A 3QZ8A 5LOQA 1RA7A 1U1OA 2DNKA 1N33F 5L1KA 3BGRA 2RDIA 1TP7A 2KT3A 1S4FA 4FKYA 2GIQA
chains in the Genus database with same CATH topology
2JEJA 1FRLA 3SDEB 1BQNA 1CQMA 1HNZF 1JLFB 2WB4A 1PO6A 4USIA 2XWYA 1ZPVA 2XMVA 2JX2A 2CQDA 1WELA 4RU9A 3KHLA 2ERRA 2J9EA 5AXNA 4LSNB 3G86A 3ICLA 3O8WA 1M5VC 1N32F 2BE2A 1U26A 3M2UB 5A6PA 4A8SA 4O3QA 3FSYA 3FZBA 4WE1B 1RT4A 2WOMB 1N54B 1ZM2A 3MM9A 4ZP8A 4CCHA 4I2PA 1E6VA 5KT4A 4ES2A 1M5PC 3SI8A 1S10A 3R5BA 3I5CA 3MECB 1FXDA 3ZZZA 5IT0A 5AXLA 4O0IA 1RDRA 3OFFA 5KFWA 4J9QA 2ACYA 3QMQA 1X5SA 4ICLA 3LP0A 2QRRA 4N5SA 3CJ5A 4JV1A 2MKSA 1X7VA 5KOXA 1AFIA 1WG1A 1NJYA 1Q86T 2F40A 1K8AT 4MIWA 1KVJA 1S1WA 1Q79A 1V3SA 3TVYA 4B9NA 5G0RA 2DIVA 4C8MA 2MXYA 3HKZD 3DLJA 3UR0A 1U24A 4ZKAA 3QGPA 3MDFA 2ZJPQ 3M9MB 2YX1A 4U6PA 2KHCA 3LQVA 4IG3A 4ATNA 2YX4A 4EYIB 4YMEA 1QE1A 2J0WA 4LVOP 3TAMB 3PHEA 4F02A 1XBWA 3QO9B 5KTQA 2O5DA 4EYHB 1HARA 2RF2B 1GNKA 2OKQA 3ZFVA 5F8GA 2ZC4A 1CC8A 1VQPS 3C2PA 2VBYA 3MGJA 4CO2A 4FN5A 2C22A 1SJQA 3I0RA 5E33A 4KHMA 1FEEA 4Y0FA 1FK9B 1V3ZA 2CJQA 2JWNA 1FDAA 4ECTA 1IJFB 2GFFA 1Q4RA 3SQGA 3S7RA 1RGVA 1RT6B 2VONA 3M6XA 3RB0A 4B17A 4RW4A 3RB6A 4TNOA 3M8PA 3W7BA 3Q2TC 5GAEU 4KIAA 1M0SA 3AB2B 2B0GA 3KWMA 5J2MA 2E1MC 1Q7YT 1DTTB 4ED1A 4KFBA 5DM7Q 3MMAB 2NUUG 1NO8A 5KFHA 4FNIA 3T5HA 1MMDA 3VAFA 3Q0AA 1RJJA 4LF6F 2XB2D 3BR8A 3DDKA 5IM0B 3GFHA 3LUYA 5EWGA 2ZOFA 3LP2B 5B09A 1X0PA 2XS5A 1JLQB 2R7VA 1ZZFA 4ZCMA 4J9NA 2AGQA 3CCMS 1MROB 4EO8A 2XY6A 4EO6A 5D3GB 3S6EA 2VPXB 2RKIA 4WU2A 4MFBA 1K0VA 4M8LA 5EN1A 2BDPA 3MI7X 3CUNA 2NS1B 1X4AA 3K5PA 4NRUA 2C2EA 5CQGA 3TAPA 4NLTA 4F50A 2E7WA 4F25A 3G71S 1FJCA 2DH9A 3SCKE 4WZMA 1YGYA 3HF5A 2HQ3A 2U2FA 4URQU 3F41A 5HMYA 1U45A 2B4PA 1Y3KA 4CT9A 4V19X 1UVJA 4NL5A 3SZ2A 1LXJA 2DNLA 3PX4A 2ZJRQ 3P5TL 4K4TA 1TKZB 5SUHA 1NK9A 4B9LA 1OQ3A 4TLRA 1YJWS 2YKMB 4FF2A 2K1RB 4JOUA 4ZP6A 4RWWA 4WFBQ 1XMQF 3PO5A 4FF3A 2KI2A 4CO3A 4I6AA 4DHVA 4DV4F 2R8JA 3TVKA 1PILA 2DNGA 3PRBA 1TL1B 1B0VA 2CVEA 3CDAA 2DRAA 2EFVA 2M5YA 2FPHX 4TQSA 4Q0BB 2BRLA 3CCTA 3IWLA 4C3KA 4OHYA 2FD2A 1DQ8A 1JLEB 2JSXA 3SMZA 4QR0A 5BYSA 2DIUA 5HLFA 3LGMA 3PJXA 4X4OA 4B9UA 4RKUC 4ZMMA 2YH0A 4C11B 2R8HA 3A8EA 2E9TA 3S8SA 1HBUA 3J81Y 2PT0A 5E3PA 4QJVA 5GAHU 2XY5A 3OTDA 3RRKA 1N88A 1VK3A 3PIOQ 4YHHF 3ZZOA 4ED7A 2E5GA 3MR2A 1TK5A 1IJEB 4DL5A 3T19A 3K0JA 3DN9A 3TI0A 1U1LA 4MJKA 2GGPA 3OL9A 4UUWA 1U09A 4J5OA 1URNA 2IHR1 2FJBB 3AA9A 1TR0A 4LUBA 1KONA 4NLVA 3N0VA 2MQPA 2QA1A 2KT2A 3DOLA 2UXBF 1R0AB 1OQ6A 5E7OB 5BYRA 5KFCA 2HNZB 3P96A 1Y3JA 2OD4A 3VAGA 1CQNA 1IBLF 1JLGA 3RRGA 4F8RA 2IAJB 3HVTA 1HBMA 3FNNA 4NA1A 3BF4A 3D54A 1LWCA 3EGWB 2BQRA 3CJKA 1M5KC 2QA4G 1SV5B 3SEOA 1FKPA 4DL6A 2KKHA 1S9GA 4C8YA 1Z2LA 4HTIA 4C9DA 4NWBA 3K7RA 3I0SB 1WEXA 1KR4A 4OJGA 4ZA1A 3AJ1A 1HQEB 2MKHA 4CZCA 3FMBA 2COLA 2MZSA 1VMBA 4HYKA 1TK8A 2XULA 1JXEA 4OX6A 3E51A 5KG1A 5HI7A 1K73T 5LXYA 5D6GA 3W2WB 3QZ7A 4EGLA 4KGMA 2AWZA 2HS0A 3MM6A 3V81B 2D9PA 3TNVA 4NLUA 1NK7A 3N79A 4B3MF 1WTBA 4JYAF 4NLDA 3BSAA 1L3UA 4BCAA 3FFIB 1OSDA 3IRXB 1TUVA 2DCLA 4FP9A 3OV7A 1S6UA 2YKNA 3IBWA 4AXIA 3HVRA 1FEHA 1RTDA 2ADBA 1KHWA 3POTB 5F3ZA 3CC7S 1XK8A 3HVWA 4YR2A 5B0BA 4RWXA 4USHA 4OI4A 2UXCF 2OIHA 5HMZA 3H2VE 4O3OA 1G2EA 4PWDA 4Q5VA 3J7ZT 1QUPA 4C2MA 4IYQA 2PIIA 4CH1A 2UUTA 2ZBCA 3AJ2A 4QOTA 1X9MA 5L9NA 3CJ3A 2KM8B 4JI6F 5THWA 3I96A 3CC2S 5J1PA 4EZ9A 4KJIA 4B9TA 2ZOGA 3H2UB 2ASDA 1SUQB 4Y2AA 2UVVA 1XMBA 4ED6A 2B43A 4K5SA 3TOQA 5C24B 2CQGA 2F8MA 2AGOA 3IR7B 2V9KA 3TUIC 1KQGB 1TKXA 2VFSA 3M6VA 4I0WA 2W8KA 3VQTA 5A2QY 2FVCA 3M6WA 3DM2A 3ZZTA 2LA4A 3SXLA 2XSJA 3HHLA 1HNXF 1S0MA 3CCJS 2Z0GA 2W9CB 2ROGA 2J6SA 1S77D 3GV5B 2FHOB 1DAXA 2MHNA 3I56S 2UUCF 1ZH5A 2BA9A 1RAJA 5AE1A 3I55S 2VUGA 1XN9A 2DO4A 1VQLS 3N5BA 1VK8A 1QVFR 3SV3A 1C2PA 1VLYA 4CH7A 4ITSA 4WYWA 3RR7A 5E2QA 1L3SA 2XY7A 2C3PA 2GO8A 4C7QA 3NS6A 3CJ0A 3T9NA 4PG8A 4NCGB 1LFPA 1CEZA 5K8PA 3RW7A 1UMJA 2DPJA 2JEFA 4P7VA 1X4EA 5CD4H 4Z2XA 2C3UA 4OZ5A 2LECA 2JRSA 3RTVA 4NYOA 1UFWA 2B51A 3GIKA 3M32B 1O51A 2DR7A 2FVQA 5KFUA 1JXLA 2V9WA 3MM7A 1D1UA 2CJKA 1KVIA 2QZ8A 3JSBA 1K0TA 1MW7A 2ZITA 4ZPBA 2CG4A 2W9BA 3QAEA 4V19J 1F5AA 2ZHOA 2P6SA 3KLEA 1HYSA 1RISA 1SQEA 3ULHA 2V8DA 1UL3A 2GMHA 3QIPA 4I7FB 4QIFA 4XDCA 1MU2B 4IDKA 5KAKA 1C1BA 2EFOA 4A8OA 2OD6A 2DH8A 4RW9A 4AQYF 2D3OR 3D2WA 5GVQA 3IGVA 4DSLA 2A10A 2FC8A 1ROFA 2LU1A 3LP1A 1VOMA 1X8DA 4F4KA 4KTQA 4Y2CA 3L95X 5MLCV 4ALZA 1LW0B 5KFKA 4EZ6A 3H25A 2JOQA 3DLGB 3UE2A 2MJUA 3BM7A 4ILLA 1U6BA 3OL7A 1FERA 5L39A 4DFJA 1U47A 5GAEI 1FRIA 4M94A 1D8ZA 1YJ9S 2DHGA 4E0DA 1C1CA 1GT8A 3OR1B 2DHAA 4YB5A 1R43A 1E6YA 3A1YG 1HBNB 4U67Q 4EUVA 4Q43A 3SV4A 4MAKA 1R7IA 3DC2A 2RDJA 4RW6B 1D9FA 2JLFA 3B4DA 1PC4A 2NUHA 2QMWA 4ZCIA 1VIOA 2CQCA 2HWIA 2ZH1A 4C8KA 1IKVA 2M4MA 2E5JA 2DO0A 2IVYA 5M2PA 5AXKA 2ZHAA 1VQMS 4BHQA 5KFIA 4X4PA 1S1TB 1XEZA 2DRBA 2OPSB 5GAG