5DDRC

L-glutamine riboswitch bound with l-glutamine soaked with cs+
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-glutamine riboswitch RNA (61-MER)
publication title Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 23
structure length 94
sequence length 94
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5ddrC00
1YIJS 2D9OA 1DBDA 2LXIA 1HD1A 1WHVA 2BOPA 2XS2A 1M5KC 1FNXH 3P6YC 4EGLA 1X5SA 1X4EA 4PR6A 2QA4S 3IWNC 2DIUA 3FEYB 3SMZA 1Q86T 1VBYA 4F25A 2ERRA 1WEXA 3CUNA 5EN1A 1DZ5A 1YJNS 1FXLA 3CCMS 4QU7A 2VOOA 2KRRA 1QM9A 1UW4A 3VAHA 1HD0A 1UP1A 5DDQC 2RQCA 3BS9A 2XS7A 2LA6A 2M8DB 3TO8A 4WKRA 3CC7S 3EGNA 2DHSA 3CD6S 4QPTA 4IOCQ 2CPXA 2ADBA 2VODA 3BO4A 2DH8A 1WELA 2XB2D 2G0CA 3BO3A 3CTRA 3H2UB 1VQ7S 2MKSA 3IRWP 2CQ1A 5IFMA 4YUDA 2CQ3A 5LJ3Y 1VQMS 5CYJA 2MY8A 2MJNA 4QQBA 2MXYA 1HA1A 2DGSA 1A7GE 1WTBA 1D9AA 2MKIA 3MD3A 3MXHP 3VAFA 1VQKS 4TLQA 4V19X 3G4SS 1WG1A 2F3JA 1L3KA 3MD1A 4Z2XA 1SJ4P 1OIAA 2RUGA 1U1PA 3U1MA 4C4WA 1S72S 1UAWA 2RQ4A 2X1GA 1D8ZA 1WEYA 5D78A 3FEXB 4WFAQ 4W90B 3G8TA 2CPJA 1M90T 2DB1A 1H2TZ 2DHXA 4RU2A 5DDOC 2MGZB 1KC8T 2DNGA 2HGLA 2LA4A 1WI6A 2LEAA 3UWTA 1S79A 3CCSS 2Q79A 1U1QA 1YWXA 1ZH5A 4UY8T 3H2VE 5IM0A 1IQTA 2XNRA 2DNRA 2K8GA 1U1RA 3CPWR 2LCWA 1M5VC 2MJUA 2G4BA 1VQ5S 2D3OR 1WHWA 2L9WA 3B4DA 3Q2TC 1X4DA 1ZZFA 2DGTA 2KN4A 5DDRC 2CPDA 5LJ5Y 3CCLS 2N7CA 2J0QD 2VONA 2ZJRQ 1OO0B 2PE8A 1U1NA 3CCUS 2MQOA 1VC0A 1U6FA 3B4MA 1BY9A 2K3KA 2DGVA 2DK2A 1F9FA 1OPIA 3NS5A 5LXYA 2M52A 5HL7Q 2M70A 4LIRA 3RW6A 2JWNA 3HHNB 2DNQA 1FJCA 2M0GB 3ZZYA 2MQPA 1H2UX 4FXVA 1SJ3P 2DH9A 1X5OA 1Q81T 2LYVA 2QFJA 2CQDA 1ZZNA 4W92B 3BO2A 2L08A 3DXBA 4LJMA 3VAJA 2E5JA 1DHMA 2CPZA 1VQLS 2E5GA 3J7ZT 3UD3P 3PIOQ 1KOHA 2AYMA 2XSFA 2DNMA 3MDFA 3BEGB 2HGNA 2CQPA 2MQNA 1WF1A 3CMES 1U2FA 2MKHA 2E5HA 2F9JA 4ZKAA 1SJQA 2HZCA 2RT3A 3NNCA 3MOJB 2M8HA 5DDPC 2AYEA 2HGMA 2MZRA 1X4FA 3UCGA 2NZ4A 5CA5A 3P3DA 1VBXA 5GAHU 3CCVS 2M88A 2MZ1A 2LECA 2J8AA 2KRBA 3UCZP 1NJIT 1VC5A 2HVZA 1P27B 3SDEA 2N3OA 2CPEA 1WF2A 2AYBA 3MURP 1RK8A 4CQ1A 2EK1A 2KXFA 3S7RA 1JJ4A 3G9CA 3NNHA 2KG1A 2CQ0A 2KFYA 3TYTA 4WFNQ 2LKZA 1KQSR 2YH1A 3DLLQ 3SXLA 2MZJA 2CPIA 3S8SA 1FJEB 2UP1A 1YJWS 2DHAA 2L41A 2RRAA 1O0PA 4Y00A 2MKKA 4F02A 3G96A 2DNYA 1N54B 4Y0FA 4QU6A 3CC2S 4FXWA 4C0OC 3THPA 1WWHA 3EGZA 3U1LA 5ITHA 4M5DB 3MUTP 2OSQA 3N9UC 2DNNA 2LMIA 2X1AA 2O3DA 1CVJA 2XS5A 1Q82T 2DGQA 2KT5A 1X4GA 2KYXA 1YTYA 1X4HA 1M1KT 1U1KA 1VC6A 2X1BA 3EX7B 1VQNS 4CIOA 3CMAS 1N8RT 2RS8A 3HI9A 2RU3A 3CXCR 2RNEA 2PEHA 2CQBA 3I55S 2X1FA 4TU7A 3G71S 1DRZA 1QVFR 5GADU 1N88A 2DGOA 5HO4A 4IOAQ 2MZTA 2MQMA 1X5TA 2AYGA 1UFWA 2DNKA 1KOOA 5GMKa 2FC9A 1FHTA 2G1DA 3G8SA 2KG0A 2A3JA 3ULHA 2CPYA 2CQHA 2MPUA 3THTA 1VQ4S 4YB1P 5LSLA 3CCJS 3VAMA 1W2BR 3V4MA 5DETA 1AUDA 5LXRA 5DM6Q 2MHNA 1X4AA 3VAIA 2MKCA 2DNHA 1WG5A 2CPFA 4WFBQ 3J7YU 1U1LA 2QEXS 5FJ4A 1WF0A 3VAKA 1PO6A 2FC8A 1H6KX 2OTLS 2MSTA 5IM0B 2JX2A 2MKJA 2M7SA 2ZJPQ 1SJRA 3VAGA 3CCQS 2NLWA 1X0FA 2DGWA 3NS6A 5LSOA 5H1SV 5JVGQ 3MUMP 2CQ2A 2OJ3A 2YKAA 3VALA 1N52B 3L3CA 2YTCA 2DNLA 2OIHA 3UCUP 1VQ9S 1K8AT 2I38A 3RW7A 1OWXA 3D2WA 1R8HA 2HYIB 4WCEQ 4OZ0A 3CF5Q 3P49B 3UD4P 2KHCA 1WEZA 1X4CA 1YI2S 3UE2A 2JVOA 2J76E 2U1AA 1WI8A 3P5TL 4CH1A 2DGXA 2JVRA 4BS2A 2KI2A 2N3LA 4PKDB 4UQTA 2YH0A 3MUVP 2MYFA 1HL6A 2DITA 4U67Q 2M2BA 4CH0S 3NMRA 3I56S 4P6QA 3CULA 1B7FA 2CQGA 2CJKA 2J0SD 2ADCA 1A9NB 3LPYA 1P1TA 1X5PA 2RVJA 1JMTA 3ZZZA 1SXLA 2KM8B 1QVGR 3CCES 3NNAA 2GO9A 2MSSA 2MGZA 1WG4A 5IQQA 2DISA 2XNQA 1WHXA 4OZ1A 2KH9A 1U6BA 2DO0A 2VOPA 4IUFA 2F9DA 4C7QA 2DNOA 1Q7YT 3TP2A 4ED5A 2B0GA 1SJFA 3S6EA 4LMZA 5CXTA 2I2YA 3PIPQ 1X4BA 4YOEA 2MZQA 3SDEB 1JJ2R 2U2FA 2KM8C 4ERDA 2LXUA 2E44A 2CQIA 2DIVA 3CC4S 2LQ5A 1FJ7A 1VQ6S 1G2EA 1YHQS 3MI7X 2GHPA 3CCRS 3G6ES 1K9MT 5GAGU 3LQVA 1YITS 2FHOB 2KVIA 1NU4A 1R8PA 4PRFA 2MY7A 4TU9A 1RKJA 1VQ8S 1JJHA 2KU7A 2MMYA 2RRBA 3OW2R 4IO9Q 1K73T 1PGZA 5DM7Q 2JRSA 5BJRA 3K0JA 2ZJQQ 2RS2A 2SXLA 3R27A 4J5OA 2FPHX 2DNPA 3Q2SC 1VQPS 1VQOS 2AD9A 1KD1T 2WBRA 2EVZA 2DGUA 4WF9Q 3US5A 2FY1A 2MZSA 1XN9A 4WIIA 3S01A 2V94A 2BZ2A 5D77A 2DNZA 2KXNB 1FO1A 4TU8A 2DO4A 1YJ9S 2CQCA 2MB0B 2CQ4A 4F26A 5MLCV 3R1LA 2OTJS 2DHGA 2YWKA 1WHYA 2EK6A 2CPHA 1M5PC 1U1MA 3VF0B 1NO8A 2LEBA 1H2VZ 2D9PA 2E5IA 5GVQA 1U1OA 1M5OC 4A8XA 2MQQA 2M4MA 5JVHQ 2N82B 3R1HA 1VBZA 2M9KA 2MQLA 2OSRA 1FT8A 2DH7A 1URNA 3JB9k 5GAEU 2KXHA
chains in the Genus database with same CATH superfamily
2A2DA 2H54B 3ISNC 3K57A 1BGXT 1XNQJ 3NLCA 3LP0B 1WC6A 5J1EA 3DGVA 4DQRA 3IR6B 3CSKA 4FKXA 4LFAJ 4K59A 2VOOA 2J7WA 1J5EF 2WVEA 3G6VA 2NXNA 4MKAA 1UMJA 3C14B 3EGNA 2B43A 1F3FA 4I69A 3OL7A 2CPXA 2GAHC 4TKTA 1AXQA 3CTRA 4IFYB 5D4NA 3PW0A 3RB0A 3G82B 5GMDA 5HQLA 2DGSA 2XBPA 4JI4F 4QYZJ 4RBTA 3ZZPA 2DTJA 4Z2XA 1FESA 2H1YA 2B5JA 5J2PA 1SH3A 1SQGA 2BBEA 5DRKA 4DV2F 1RAJA 4NRUA 3FEXB 3DDNA 1SQEA 3EMTA 1V9OA 2DB1A 2KT2A 1PG5B 2J9EA 2V63A 2GGPA 4LFBF 4GKKJ 4G1QA 3R7BB 2IY5B 1B0TA 2GV1A 1U1RA 2VFRA 3I4HX 1N36F 3EJMA 3DGPA 5LJ5Y 5B08A 1LK5A 2W8LA 3SYZA 3FBFA 1U1NA 3LP0A 1FRLA 3TAQA 2R4FA 2JEFA 1RSCA 4NYOA 4CO2A 3N6MA 4FXVA 3T1HJ 5BR8J 1FWKA 2VPWB 3UN5A 1YRTA 3J7ZT 1ZM2A 2QA1A 3NKYA 3ZZ0A 1HNZJ 3V81B 2AYMA 4C11A 1T8EA 5EHHA 2RKIB 1VS3A 2E5HA 4CNZA 2AIRB 2BQRA 4O3PA 3MPUB 4OJ3A 3V6HA 3GCWP 5A8RB 1P8GA 4TY8A 1C0UB 4K2XA 3GSDA 2XLKA 4ZPBA 3UW1A 1GXLA 3SDEA 4DV1F 1XMBA 5L9NA 5KFWA 3NEKA 4F2RA 3TR5A 2J6UA 2AX1A 2HVHA 2NYIA 3CCWA 1MN7A 3ZC4A 3THVA 2FVRA 1YSJA 2VUGA 2XSJB 1N54B 4R5PB 4FXWA 4KH0B 5C5JA 3ZTPA 3I5BA 1NK7A 4WPAA 3N9UC 1RAOA 2P5VA 2GJFA 2OI2A 2CKWA 4EUVA 4OX9F 1WC0A 4Q7AA 3W8GA 2QLXA 4CRJA 1C1BB 4LF8F 2BABA 4IFVA 3R5GA 1QVFR 1UFKA 4OIXA 3CO0P 5A8WA 1RGVA 4ES1A 3ILLA 3QBCA 1QE1A 2RQMA 5THWA 4CWBA 1RA7A 3LWMA 2CJBA 4F4ZA 4C9DA 3CDEA 4OYIA 3V81A 5LSLA 2XMAA 3VAMA 4DXLA 3MWBA 2AJ1A 3OFEA 3I0RB 3BGRB 2WSCC 3M05A 3TA1A 4Y28C 4F67A 3I0SB 1VOMA 3VAGA 1T11A 3MM6B 1C0UA 3HD2A 1FJGF 2W4DA 1TKDA 3PJXA 4UOHA 1YX2A 4EMDA 3DRRB 3D2WA 3LGMA 5HN0A 3ZXWA 1WEZA 1E6VB 2DGXA 4BS2A 3R7SB 3MUVP 4ELTA 3DLEB 3DLGB 2HS4A 2M2BA 2B6AB 2QA2A 1IWGA 3RRKA 5AXMA 2CQGA 3HZEA 3PY8A 1AROP 1JMTA 1FERA 4QW8A 2KM8B 1QVGR 3R2CJ 1ZYQA 3CDAA 4DUZJ 3WX8A 1NKBA 2AWZA 4DQIA 4M94A 5GADI 3PKMA 4AE5A 3MECB 4NZ0A 2UU9J 2GHPA 3CCRS 4EEYA 2YPZA 4I67A 2KZZA 1NKCA 3HULA 4IO9Q 2UUCF 4YB7A 1VQOS 3RBXA 2WW4A 3ENWA 4OFZA 2VHGA 3MM6A 1PC5A 1CJTB 4ZJLA 2DNZA 4WTYA 4NLGA 1VRTB 1NH7A 4IQMA 2CQ4A 4JV5F 4EK2A 4QWEA 2WK4A 1RWUA 3C8YA 1UFLA 4O0NA 1GNKA 5F0UA 2HKEA 1FXDA 2VG7A 1E6VA 1Y3KA 4WFXA 3LOUA 2QA4S 2IRYA 1HPZB 4L73A 2XS2A 1G1XA 4QWDA 2A2CA 2NSCA 3GFXA 3ADAC 1X5SA 4C8LA 2VU5A 2YNGA 3IWNC 3OTEA 1GX6A 5A76A 1H98A 3CUNA 1YJNS 2ZWOA 4LR8A 4IR9A 1QM9A 5DG8A 2PMHA 4MFBB 1C0TA 2VD3A 4I0WA 3MZIA 3B82A 2DHSA 5HVFA 1DLOA 3EWGA 4IOCQ 4J9SA 1QSSA 5J2QB 3BBBA 5B0FA 4P72A 1EP4A 2L9DA 4ECQA 1YVFA 1D8YA 1FKOB 3O2IA 2VASA 3G8QA 2E66A 2RUGA 1S48A 1GMWA 3W8PA 4RKUC 1S72S 1JX4A 2V8GA 3H4BA 3G8TA 3QT8A 2UV8G 1M90T 1XEZA 1RWKB 1RE1B 4NYZA 2DNGA 2KJWA 4P7TA 5M2PA 1JLBA 5C25B 3HCXA 4PXEA 1Q1KA 2GS8A 5E3AA 4ZPWR 2RILA 3RB4A 1SC6A 3GWCA 1RWNB 3KWMA 2DGTA 2R8KA 5GAEI 3UDEA 4RW8A 1IKWA 1U6FA 2EEYA 2ZD1B 3GJRB 4R8UB 5LXYA 1PJ6A 5ETPA 3HHNB 3D6HB 2IFXA 3M2VB 2LYVA 3KLIB 1RTZA 2D74B 2CPZA 4ID5A 4MIBA 4A47A 1XMQJ 1X9MA 4CT9A 3K58A 4C48A 2PO4A 4AQYF 4DG1B 3J7AN 3KK1B 3X1LB 5HVHA 4B9SA 1UVMA 2YX4A 3VVUA 1KNZA 1WKLA 3HHLB 2F4VF 3H7HB 2JJ4D 1CS4B 3OQ2A 2FVPA 2X3DA 1YJVA 1QAIA 1FDNA 3AJDA 3K8WA 1JK9B 3QFWA 2MZJA 1U7LA 1MROA 4JI8J 1S0OA 2L41A 1W7WA 1R6VA 2Q43A 4Q0BB 4CLTA 3KDOA 3MHYA 3KG1A 4GRSA 1RTIB 4M5DB 4NRTA 2UXBJ 3TVZA 5KAKA 2V50A 3H42A 2VQEF 4P2XA 1NPRA 3EX7B 1VQNS 2RS8A 4DV6F 3CIMA 2FJBB 2IDLA 4RW7B 5I42B 4DWIA 2HW3A 5L1IA 4DV0J 3IA0A 1V5VA 4KFBB 2XMUA 2VH7A 1QTMA 4P2SA 1RI7A 2XGQA 3OLBA 4YP3A 3HHLD 4PWDA 2IBKA 3AODA 4DSJA 4LVOP 4ZVQB 5IT0A 5LXRA 3TWZA 3T1AA 3VAIA 4N41A 3O8WA 3J7YU 3W5ZA 3WZ0A 2HVEA 1KTVA 3GIKA 2HNDB 1J2VA 2OAUA 3R5JB 4J90A 3DCAA 2WSFC 3U1NA 5DO2A 1N5YA 3UNYA 4C3KA 1V5IB 3MR7A 1IKYA 1IWAA 3HVTB 5EX0A 2XCAA 1TMMA 2GHVC 3PEHA 3RW7A 1CS4A 5JJBA 3S1TA 4WCEQ 4XO0A 1N33J 2WONA 2AF6A 1S9FA 5KOWA 2YKNA 1QSLA 2KI2A 2C3PA 2DEIA 4DSLA 2Z2YB 3K2YA 5KFIA 4TVAB 3OT9A 4L3KA 2JEJA 4MTPA 4TXSA 3MMJA 4LVNP 4U96A 3C2PA 3NNAA 2MSSA 4OZLA 1U6BA 4JOUA 1FTRA 1YZ6A 2OPSA 2P9GA 3HVRA 1FI4A 4F3QA 1X0PA 1B0PA 5F8GA 3DYAB 3TAMB 2AV5A 4BC9A 1S10A 3PHTA 1TL7B 3MM5A 3T1HF 1RKJA 5FDLA 2FGCA 4JI1J 3R6LB 3PR4A 2X7IA 4LF6F 3RRHA 2EVZA 3R5AA 4Q2MA 4DU8A 4DLEA 3N4WA 5U47A 3OD2A 3M9MB 2XMMA 2EBEA 5BXIA 3MEGA 4BWMA 1HBMA 3G87A 2XHCA 4EO8A 2ZWPA 3RUBL 3TOQA 2BOPA 2OEJA 2BANA 1FNXH 1Q8KA 1J5OB 1U45A 1G4CA 1VBYA 4CYUA 1RAFB 4M5NA 1FXLA 3N6LA 1BMQB 5D0EA 4IOBA 5ETKA 1I3OB 2M8DB 5C42A 3NCPA 2UUWA 4K4YA 2YKOA 4I6AA 5G0RB 2DH8A 1T94A 3JYTA 3GJTB 3DRXA 3A1YG 3KMSA 3HKZD 5KFQA 1ZA2B 1TL7A 1WTBA 4M5LA 2W24A 2HZVA 2ATCB 1NSPA 2QLJB 1T95A 4PPZA 2X1GA 4LF2A 2K1RA 2F8HA 3DOKA 5IOLA 1P9YA 2W9BA 3EXCX 1S79A 2J9CA 4WP9A 4BWJA 1YWXA 5KFRA 2XYHB 2XNRA 1REVB 3HSJA 1WHWA 1T3OA 2KN4A 4NLOA 2C3OA 3P8BB 2ZBPA 1FFGB 2IJRA 4MMOA 1U2RA 3TNVA 1Q81T 2CQDA 5KFLA 1F5BA 2HQFA 3V6KA 3Q89A 2B9YA 2QTWA 3ZZRA 3DOMA 3GIRA 2J0WA 2D3O1 5ADZA 5FD1A 1CG2A 1AFIA 4YHHJ 1BQXA 2D69A 5GAHU 1N48A 1E6YA 1NK9A 5KFYA 1P27B 3M8ZA 4YFUA 4IG0B 3MURP 2F65A 4KGMA 5HMZA 3EVMA 2C2RA 5IWAJ 2CQ0A 2VFTA 1U0HB 3AHPA 1KFSA 4AXJA 3PKYA 5EX3A 3ENVA 4FP9A 3EDQB 1NK0A 2XMTA 4FYXB 3G96A 1DTQB 4RNOA 5KFTA 5ITHA 3FVYA 3EICA 2RF2A 1I6JA 1KN6A 1VC6A 1SUQB 5CYQA 3UI3A 2Q1LA 2RNEA 4TU7A 2OELA 3G71S 3RBZA 1JLAA 1PYSB 2K7JA 4P71A 2ZVSA 2HHTA 5T14A 1S9GB 1X5TA 2RDDA 2DNKA 4DSFA 3FEZA 1YJRA 1KOOA 2FC9A 4HHJA 4X4VA 4WWSA 1FNMA 1OY8A 4ICLB 1MWZA 5IZHA 4B3SJ 4N5SA 1X9WA 3JSMB 1CJUB 1PO6A 3CD0A 5H9FJ 5CABA 1H6KX 2E29A 3T6BA 2V2VA 2W7OA 2C42A 3NRBA 4F3OA 5JVGQ 3NGRA 3ZTOA 4BHQA 2CJ9A 2WW8A 3PYFA 4H4KA 3C16B 3C6TB 4N8OA 5JMNA 4DL7A 2UUTA 2ZOGA 2N3LA 3MCNA 3KLGB 4Q8FA 2RIJA 3O5TB 2HHVA 1BE4A 1MG7A 1AZSA 3OTCA 3FKBA 2BRLA 4F50A 1TL5A 1X5PA 4WP3A 3ZZZA 4W98A 4HACB 4O3OA 4ER8A 5L1LA 2W2NP 7FDRA 2D1CA 4YS2A 2WTFA 5E3QA 3U7JA 3ZNJ1 3GYNA 1NKEA 4IUFA 5E3RA 3HKWA 1U47A 3AFGA 2IYIA 4X4RA 5DGBA 2O5DA 1HNXJ 2DPJA 2ROPA 4HI1A 4X64J 3KUHA 1IR2A 4ERDA 1M0SA 1EETB 4LSLB 4TQSA 4JI5F 2BM1A 5D3GB 4X4NA 3W2WA 2VC0A 3MOZA 2B51A 1ZAXA 2VPYB 2G2YA 3MMBB 3A3OB 1D0EA 1PGZA 3GJSB 2VDIA 2OP5A 2SXLA 4EYIB 2FDNA 4RNMA 2YXLA 2V9WA 1FRMA 5CAAA 1XMQF 4F4KA 5MLCV 3UN2A 1RWOB 5DGAA 2XLIA 2HAIA 4ECXA 1RBLA 2LEBA 1TL3A 5GVQA 2W2PP 4OYMA 3C6TA 4GO7X 4WIQA 3JB9k 2BEFA 2ZC4A 4M8LA 2WOMB 5K9FA 1M5KC 3KHGA 1NHVA 4V19J 2HRUA 3SIPB 1R8CA 2WBMA 1NB7A 2DR5A 2DRAA 5L1JA 1HD0A 4QOTA 3DI6A 2RQCA 4XTTA 2BQUA 4CO1A 3IMQJ 2HRYA 3I87A 4ZP6A 1SPBP 4LSLA 3TUJC 5KT7A 3IG1B 4LF7F 2VL1A 1RT3B 1RA6A 4DV0F 2B9EA 4E8UA 1VQKS 3T5HA 4CI0B 3HHLC 2ABYA 1FRXA 4J37A 1I1GA 4USKA 3M2RA 3C15B 5KG0A 4W90B 4BDPA 3NCQA 3NGDA 2O01C 2KYZA 2R7TA 2MGZB 1TK8A 1KC8T 3W3SA 3HFVA 5E2QA 3LP1B 3M8RA 3I32A 1XJWB 4YEAA 2L9WA 2WOMA 3B4DA 2VB6A 3M8PB 3MPDA 4D3GA 3W2VB 1I5OB 5HANA 2ACMA 1G6BA 3RAQA 1N33F 4O4GA 2HSEB 2HVDA 1X5OA 4JI3F 1ZZNA 5HP1A 2L08A 2CNOB 3SBMA 2E5GA 1R89A 1M5HA 4CLSA 1NJWA 2ZE2A 3PTWA 2RT3A 3NNCA 2R9LA 2E1AA 4FYDA 2N4DA 4I68A 2F1FA 2YNFB 5LL6d 3Q8PB 2PMZD 2UUBF 1T9YA 3MTJA 1WDTA 3GCXP 1HNVA 4CLZA 3HT0A 3DLLQ 4DF4A 1P6TA 1RT6A 2F8MA 4JI1F 1IR0A 1LOUA 1SKSA 2E9TA 4ECRA 2K3IA 3DLKA 4DPUA 3OL6A 3VGTA 5CD4H 1ZA1B 3WC2A 3PX4A 3SCKE 3QO9B 4DR7J 3SQGB 4KJIA 2JEGA 3IBFB 3A8IA 1L3UA 1D9FA 1FVQA 3W62A 3FFIA 1VYAA 1HBUA 4JI7F 4LF9J 4DV7F 1NSAA 4U7CA 3BPSP 2JEIA 1SL2A 3R6GB 4DCPB 1NSQA 5IM0B 4A8YA 4KB7A 5EWGA 3CCQS 3KUGA 4KPYA 2R8IA 4IR1A 4OI4A 4RUBA 1JLFB 2YTCA 1Z2ZA 3CIZA 4DQSA 4EBCA 2QRRA 3SCLE 4OYWA 2W9CB 4X4OA 1HIYA 1N0UA 3M8QB 1LKZA 2J76E 1WI8A 3M2UA 2AJ0A 1GXTA 2AEMA 1WJ9A 1OSCA 4ZPDA 1NJZA 4C8NA 3LUYA 4LR9A 1T03B 2BXJA 1FF2A 2QZ8A 1XR5A 1A9NB 1V3SA 4GO5X 2G0IA 3M6VA 3LH2S 1RTDA 1U09A 4PUOA 2XWXA 3CWJA 4IDKA 1PILA 3QO9A 3CD5A 1UEUA 4WYWA 2FLNA 5IT9U 2NREA 3IP0A 1HHTP 1WSRA 4LT6A 4F36A 1S59A 5C2CA 4CTAB 2OEMA 4I64A 4KO0A 3G6ES 1K9MT 4DPTA 2A6OA 4KQZA 1V3RA 1K73T 5DQHA 4OYZA 5KFAA 4UW2A 4A48A 1TELA 3HT3A 3M9OB 2DO4A 2CQCA 3AQPA 1LWEB 3Q83A 4IQXA 3KMQA 4GVLA 4C3LA 2EFOA 3VF0B 3U02A 4O0IA 2AZ3A 1P1LA 5I3QA 2DH7A 1CBKA 1SL0A 3CJ0A 5HMXA 4USHA 1LQ9A 3QJLA 1N32J 2CDRB 2BV3A 3QSYB 2DIUA 3H2LA 1HWIA 5IS2A 2HQIA 1NNDA 3OTDA 2H65B 1EKRA 2KKHA 2LEPA 5KTQA 4ECTA 4G65A 3QATA 4X4QA 4DHVA 3NBPB 3DRYA 2ACYA 3TQEA 5LJ3Y 4HTIA 1SKRA 1L5UA 3SSQA 3CJ5A 3KFWX 3OR1B 3BM7A 1UWBB 1Z1ZA 2XQCA 3CJ2A 1HI8A 1FRJA 1NXIA 4LRBA 1NZAA 3V4IB 2Y1RI 3W61A 2FHJD 3DOLB 1DJ0A 4Q5VA 3TUPA 4B3SF 2LU1A 2FJVA 2CZ9A 5KFPA 3NGSA 4X65J 3DM2A 3PCOB 2YKMB 4WE1B 2FJWA 1FDAA 4J9OA 4DSKA 5DLFA 2IVYA 4LQ9A 2P6TA 1XR7A 4FXDA 2CG8A 5SUHA 3D1QA 4KV8B 4CNYA 2FHJA 4ALZA 1Y10A 4IH7A 2AGQA 1SB6A 2BW7A 1F9FA 5J2NB 5B0DA 3ENAA 3D0GE 4DV4J 4NLWA 4FPIA 2MQPA 1NCLA 1X8DA 4ILLA 4FKYA 2COLA 5E3CA 2QFJA 4RBVA 2AJ2A 3BO2A 3DXBA 5K5MA 2AX0A 2HNYB 3I9V9 4JV0A 4RNFA 1S1UA 4FN5A 5BYSA 2WB4A 1RAGB 3GIMA 2LXFA 3H59A 2ATLA 2F5GA 2VBXA 1H72C 4QYZK 2Y1LB 2ZHBA 4X64F 3Q0AA 5CQGA 4FYVB 3UVJA 3VGSA 1KTQA 4ZJQA 2EG2A 3SCJE 3B8HA 2APOA 4WFNQ 3AOBA 1HKAA 4ED8A 4K0KF 1RT7B 5HSPA 2YWEA 3BN7A 3WIVA 5KFBA 1MNEA 2VICA 2FHMA 3CC2S 3THPA 2EFVA 3OPKA 1AYEA 2OSQA 3BB5A 3ILOA 4WK3A 3DRPA 5JUMA 3OJUA 2V9KA 2CJAA 3GR0A 4KV8A 3TARA 2PEHA 2VIHA 4PQUA 4NCBA 3HSGA 4C8OA 3IXQA 4YY3J 4O44B 2OHDA 3L7UA 1RHKB 2VPZB 3T19A 2MZTA 1KQGB 1VMBA 4FYWB 3RRGA 4KHPF 3ETMA 2XI2A 2IMWP 2H5IB 2GFFA 5DETA 1O8BA 4F4AA 1Q5VA 2Y8WA 8RUCA 4O23A 4JI6J 4PWUA 3JSRA 2ZFHA 2R8JA 2NLWA 5HBMB 3PZPA 3EPGA 5LSOA 5HLFA 3I6PA 1TKTA 2VG5B 2GIRA 3ICLA 3KLHA 4ETXA 2DVIA 3DRSB 3OXFA 1R8HA 2R7OA 5LMUJ 2JLEA 3H5YA 4XPEA 1TUWA 3TX8A 4EO6A 4LF5J 2XI3A 1PBAA 2J0SD 4FBTA 4USUA 1GX5A 3PXGa 2N4CA 3N79A 4O44A 4CLPA 2HURA 5H9EK 4MJKA 5T7LA 2MZQA 2E44A 2CQIA 2V4JA 2BACA 3W1YC 3UQSA 1VDHA 4MKVA 2IC3A 3UN3A 4ILMA 4DR6J 2KVIA 3FK4A 2GO8A 2UZAA 4YN3B 5A8KB 3AOCA 5BJRA 3MAQA 1JLGB 1NPPA 1R0CB 2DNPA 1BQMA 3Q8QB 5DS7A 2B3TB 2Q3PA 2VG5A 4UF4A 2HG4A 1C1CA 2HEKA 3LALA 2XGPA 1V3ZA 1LWFB 2H4YB 3ELHA 4QWCA 1N34J 1URNA 2V69A 4MAKA 1X9SA 1UPPA 4FYYB 4FDFA 2BJ3A 4DFPA 1D09B 3OTBA 3OUYA 2IAJB 3RTVA 1I94J 3UDLA 1FNOA 2YX1A 4UQGA 1Z2LA 5A0YB 1RISA 2BKNA 8AT1B 4TQRA 2IA6A 4ZCLA 5ETNA 3QGGA 3CD6S 3J81j 1S6PB 1S57A 1RT5A 2R7SA 5DQGA 1UW9A 1SBRA 2NYHA 3ISND 4I2PA 4DR7F 1K1SA 2Z2MA 4URGA 3M32A 1J5EJ 1S7HA 1GMUA 4K2JA 3WIUA 2XMJA 1WEYA 4LF9F 3WX4A 1MMDA 4TN2A 3SFGA 3FBEA 1B64A 4B3RF 1R8AA 2HFUA 1HNIB 4GVBB 4KT0C 2K8GA 4DL2A 2XWYA 4ZVPB 5I3UA 5KFDA 1MMLA 3JTNA 1IKXA 3DU6A 3K5NA 3BPDA 2PIIA 3JQMA 1RAEB 4K4WA 2MQOA 3KNGA 5L39A 1WC4A 3OHAA 2W01A 4WKYA 2QLFB 1CULA 4J9LA 5A0YA 4NLDA 5EUHA 3AB2B 4MKYA 4OI6A 2ZBIA 1RHRB 1NRKA 2ASYA 3OSPA 3C19A 1N36J 1VRQC 3IRXA 5DDPC 2HGMA 1EB0A 1SH0A 1YRUA 3AD7C 1YZ7A 2GVDB 3W60A 1BXNA 1ELOA 4H4MA 2QO3A 4M1KA 3TJ9A 1SH2A 2UXCJ 2DEJA 4B3OA 3IWXA 2YNIB 4OQJA 5KG4A 1FJEB 4O3NA 1DQAA 2RRAA 2BE2B 1VR6A 3QNWB 4F02A 2A6MA 3GFZA 1JNZB 1HQEA 2FZGB 5IXUA 2X1AA 2KT5A 2W7AA 2EKYA 3DMJB 2VJUA 2I9SA 4TLRA 2MTLA 1S49A 5KT2A 5KG3A 3M1VA 3LO3A 5GADU 2EC2A 5IV3A 3HHEA 4ES3A 1FVSA 2XLJA 3FUYA 1KQFB 1WOSA 1N32F 1IBLF 3G8SA 2V2QA 2DR8A 2CZ4A 5CYMA 4OX9J 3H4DA 2VG6A 1JWWA 4CDIA 1R8BA 2FJDB 4CLKA 3VAKA 3PJ9A 2HFZA 3IS9A 1TKZB 1RHJB 1UVLA 3V6DB 5K8NA 5KT3A 1TKXA 3VR1A 4ZVTB 1FXRA 3B78A 2YKAA 2NQPA 1VQ9S 2ZZMA 2DXFA 3P45B 5CD4A 4WYLA 1XMOJ 1ZOTA 2BKPA 2BVZA 4F3MA 1VJWA 5A2QY 2XMVA 1UVKA 4DMZA 2BE2A 3KJVA 2BE9B 1QAYA 2HFSA 1NK5A 2W9AA 2IM0A 1B7FA 2W4CA 1RHQB 4DR4F 4DSIA 2ADCA 5IQ6A 3I4PA 2GW8A 3DMJA 4OI1A 1WD6A 3FCWA 1PC4A 1KLMB 1JLQA 3KK2B 2XC9A 2B4OA 3MAAA 3TP2A 2B0GA 5KG7A 4ETZA 4QJVA 4L72B 4ZMMA 1RT1A 2FJXA 5D4PA 1G2EA 4Y2KA 4OX6A 3D3BJ 3X3UA 4KIAA 1FKPB 3PJWA 3KTQA 5KT4A 2HWTA 4OYAA 1C4AA 1VRUB 2HNZA 3CJKA 2Y8YA 4I4BA 3R5CA 2MZSA 4OYBA 3S01A 4OI0A 4ZCKA 1TL1B 4NOHA 2EW9A 4JUZA 4F26A 3Q23A 2OTJS 5K14A 1YLXA 1HYSA 2DHGA 2HK3A 4J7CA 3GONA 1WHYA 2EK6A 1TVRA 2PSZA 1S12A 2BMBA 3PX6A 3R1HA 2ZNYA 5GAEU 4PYAA 1WHVA 5E7OB 5EDWA 3LA0A 2HFVA 4QR0A 3FBCA 4NXMF 3MM9A 5KFKA 3QWUA 3CCMS 4QU7A 2KRRA 5B0EA 4FS1A 3KG4A 5DDQC 3OHBA 3UNGC 3C46A 1B4SA 1K44A 3R9LA 2CNLB 4I6WA 2W2QP 2QC3A 1WELA 3D7SB 3BKUA 1LW2B 3MR5A 2CFXA 1F1BB 3QYYA 4YY3F 2ZH5A 3GMGA 1CJVB 4IRDA 1FRIA 2OD6A 1FKPA 2IM2A 1WG1A 1VRUA 3T3FA 3IBCB 2V0NA 3JAMU 4FF2A 2J5AA 1TV6A 4RU2A 3ET6A 2QJ3A 2R7UA 4JV2A 1TAUA 2LEAA 3UWTA 4Y2MA 4I56A 3AH6A 3GG1A 1RTJB 4BC7A 3BGOP 4X84A 1OSDA 4AYBD 4ZLPA 4EBDA 4DPWA 2R7QA 2CPDA 4OI3A 5ETOA 1T05A 5JXSA 3EVWA 3K59A 3MEDA 3WC0A 3EZUA 5K8MA 4URQU 1OPIA 5LMUF 2ZNZA 1MWYA 3MMCB 1U8SA 4WZMA 3RZAA 4NLSA 4XPCA 4NXNJ 4LF5F 3QWPA 2PDAA 1KP6A 2DNMA 3VGVA 1JKHA 2HK2A 2HGNA 1U2FA 5GMEA 1Q78A 3GLJA 2LQ9A 3SSRA 4H4OB 2M88A 2LECA 3OR2A 2JOQA 2KRBA 2VBWA 1S1TB 1B70B 1WF2A 2C2MB 1L3TA 4GMKA 4HR2A 5J1EB 2RD5C 3N28A 5KT6A 1M1GA 4DX6A 4CH7A 4YR0A 2W2MP 4Y00A 2MKKA 1HWKA 1S0NA 2WRMA 4C0OC 4I2QA 4ZVHA 1WWHA 1RCOB 1UVJA 2LMIA 1NUEA 3D6MB 3DDIA 4LF1A 4PYDA 1SV5A 3ZZOA 2NUHA 4DN9A 3T5KA 1S77D 4ZP7A 2DCLA 4DL5A 2FJEB 2ILZA 1AB8A 2IVFB 5ETMA 3HVWA 3SV4A 2HIQA 1N34F 4RO0A 3QJPA 5AJ3F 3L7PA 1UFWA 3A13A 4IH5A 2W2OP 2VC1A 5J2PB 1KS2A 4DS5A 2IYGA 4TYAA 1H7WA 4EZ9A 1T9VA 2GGPB 1WF0A 4G1QB 3GIJA 5KFJA 2AEFA 2I8EA 4DI6A 1Q79A 4H4OA 5I3PA 4PXDA 4C8YA 1GK8A 2BUNA 2CRLA 1IBMJ 1K47A 3HDSA 4OX8A 3DGPB 1S1TA 1JLCA 4GKJJ 5F8HA 3MR3A 3UD4P 4K4TA 4RU9A 3UDCA 4ECYA 4PKDB 2HHHF 1HLWA 4DX7A 2ZM6J 3M8SA 1PYTA 3MMAA 3HSZA 2YPYA 5HJXA 1FFSB 2Y9HA 1R0BG 2GJ2A 1VQYA 3JAMY 4ZIVA 4C11B 2ZBQA 1NPKA 2LVWA 2M5YA 4X2BA 4NLVA 1DQ9A 1Y3JA 1OMSA 2KH9A 3D5MA 5ETLA 2MQ8A 2IJNA 1QLNA 2ZC3A 4LQ3A 4TY8B 3S6EA 4K50A 2I2YA 1IKVA 1NJYA 4LBIA 2YKPA 3SDEB 1ZETA 1JJ2R 3OFFA 1WOOA 2CVIA 1BHNA 4CO4A 5K8OA 5B7WA 2CNNB 1K1QA 2XO7A 3TQ1A 2PN6A 4WXOA 2B7BB 4TU9A 5DM7Q 2JRSA 4OL8A 4DV5J 1RHMB 2BJ7A 4DLGA 3MPYA 4J9MA 1LFWA 1TFYA 1Q16B 2ZH9A 1H0HB 1FO1A 1YJ9S 2MB0B 1NDCA 4DZ6A 1TAQA 2FVSA 4ANEA 1LW0A 1M5PC 1S76D 4IFVB 3RB3A 1HNWF 5A8WB 5E33A 1QE1B 2LXIA 3A12A 4OZ5A 4C8MA 3KHLA 3RBEA 3P6YC 2OPRA 1RJJA 2UXCF 4DX8H 4LF6J 1D3WA 4C6AA 1RBAA 5EN1A 3OL9A 4UUWA 1KQKA 1XERA 2OH2A 2AHOB 4DL0C 4ES2A 1HBOB 3BS9A 5HMWA 1S1XA 3N01A 2LA6A 3TO8A 4WKRA 3CC7S 3TX0A 2Z4PA 1NHUA 1ZM9A 5CHCB 1ZPVA 2VA3A 1MSWD 1YBTA 2XB2D 1TR0A 4KKOB 1R0AA 4L3NA 4HI2A 2CQ3A 3GR1A 4ZIWA 2MJNA 4X66F 1RACB 4LIWA 1HQUA 2MKIA 3MD3A 2XEXA 3G4SS 1UJ5A 4DFKA 3OXLA 4U95A 1X31C 4YDDB 1UJ4A 3GPAA 1HW9A 1NHKL 2B8PA 2FYXA 1S1VA 1WI6A 1IM4A 1Z4UA 2HMIA 4YR2A 1KFDA 1WC3A 4L75A 5KFXA 2HZAA 1U25A 2HHSA 4DR2J 2ZKTA 2KTQA 1SIWB 5DDRC 2ZJRQ 1OO0B 1XMOF 2PA8D 2XULA 4NI2A 3RW6A 4JYAF 3RBDA 1MWQA 2EC0A 3HHKA 1HBOA 3VAJA 2E5JA 2J7KA 2MLZA 1XQIA 1HHSA 1LNQA 2CQPA 3CNQP 1CC7A 2MKYA 2YWGA 2QL7B 2GIQA 4KKOA 2M8HA 2MZRA 1X4FA 3UCGA 5CCLA 3P3DA 4YDXA 2VG7B 2XG8A 4KHMA 1S0VA 1HQ2A 2GAGC 1RWMB 2FD2A 1RK8A 1U2CA 2EK1A 3MM8A 3S7RA 4P73A 2XMKA 4J9QA 2YNGB 2CVEA 2B9XA 4ZPVR 2GCFA 3MEEA 3LAKA 1EQMA 1RAIB 2UP1A 2YY3A 1UEVA 1C0TB 4RUHA 3QLHA 2Y0SD 3K5OA 3PO5A 1S0MA 2DNNA 1DLOB 4LUBA 2JZ5A 2DGQA 3BBCA 3EM1A 2MEWA 2AJ4A 5F8IA 1L3SA 5D4OA 3J81Y 3PFEA 4ED0A 2X1FA 1EP4B 2L48A 3ITHA 3PX0A 1Q4RA 2ZH8A 5CCMA 2MQMA 4USVA 4CO3A 4OX7A 3DLJA 2I1RA 3EZOA 3IR7B 2CDQA 2IJFA 4EYHB 2ZH6A 3AB4B 3LP2A 3ULHA 4YB1P 3CCJS 4OYOA 2DNHA 5D15A 2BX6A 1HWLA 1JLBB 2ZJPQ 3QQCD 2ZUAA 3JSBA 4RUAA 3TW0A 4HHUA 4ITSA 1OYEA 3JSYA 4ZP9A 3VALA 3CJSA 4LBHA 4QW9A 4RW8B 2I38A 1IKWB 1Q5YA 2GZOA 1DQ8A 4LSZB 3BSNA 1VCTA 4Q44A 3SFUA 1FRKA 3OXGA 1VJQA 3K5LA 4QIEA 5IC6B 2H4WB 2VBYA 2Q6CA 4NMXA 1LXNA 5M2RA 3F0NA 5D8HB 4ID5B 4F4WA 1F9EB 2E5LJ 1GMWD 3LPYA 4A8OA 2KHDA 4GC7A 3CCES 1IJEB 2HLUA 3VV2B 3H25A 2IBOA 3PIPQ 1SJ1A 4PABA 2G9OA 5D4LA 3H0PA 1S9EA 2EWHA 3G6XA 2EKNA 2XZDB 1X7VA 2GMHA 1ACMB 4OJ1A 1YITS 3GTYX 7FD1A 1MROB 3EGVA 3V2UC 2NXJA 3GP9A 3GV5B 2ZEJA 3OW2R 4NXNF 2UUAJ 4RW6A 3KUEA 3K0JA 1TUGB 1RYSA 1KD1T 3BKFA 3UR0A 5SZTA 4ZHRA 2GVZA 3QIPA 1F60B 5J2MB 4HL9A 4JI5J 4U7UD 3CGIA 5L8RC 2ILYA 2KVQE 1U1OA 2MQQA 4G3IA 2N82B 2M9KA 4NZ7A 4P52A 2Z8QA 4AD6A 4UT4A 2YX7A 3PYEA 4PG8A 2OFGX 4PWDB 2FY8A 3EDRB 4DJBA 3BQ1A 3SMZA 2HHWA 4ZVRB 4M95A 2HRTA 2GNKA 1UP1A 4RW4A 2PFFB 2VPXB 1LFPA 3CJQA 3HPOA 3HO1A 1N5YB 3MR6A 4C8ZA 1WC1A 3AD9C 2LFVA 2MDAA 1IKYB 4EU0A 2VODA 1JLEA 2FZCB 3K8VA 2CQ1A 1RT4A 1N6QA 2WONB 3W64A 2YKNB 2HBQB 4TLQA 4WJBA 2QV6A 3MD1A 4PAAA 2UV8A 4C4WA 5AE1A 2I5JA 5L38A 1H2TZ 3OTOF 2NXUA 3CCSS 5J2MA 5FLXU 3KXDA 3D6TB 5L9XA 3RAXA 2OPSB 4V1Ak 4A8QA 4LF7J 2G4BA 2YWWA 2LU2A 1IBMF 4MK9A 4I6YA 1X4DA 3KHRA 3I96A 1UA1A 4GKJF 3TZYA 1FK9A 2RSQA 4HEA9 2D3ZA 2P6SA 4LIRA 2JWNA 3MM5B 4WU2A 1UA0A 5FDLB 1IQZA 4K4ZA 4JP8A 3CCTA 2ZM6F 1RWXB 2RDIA 4UZBA 1S6OA 1J27A 5DQIA 3M30A 2OPPA 1LWXA 2HHUA 2R2SA 4USMA 5ETTA 2ROEA 2MQNA 1GMVA 2JHEA 3I9ZA 3MEGB 1A6LA 1HBMB 1UZHA 3M8WA 1VFJA 4F8RA 2B4PA 3IM9A 1H74A 1RABB 2Y3YA 1VC5A 1RADB 3KJQB 5C2GA 2BANB 3VVTA 3C3LA 4JI3J 5KFUA 3TJ8A 4AT1B 3H8YA 2KFYA 2LKZA 1FX4A 2J9DE 3PRBA 3M9NB 3SXLA 4CYUB 5DZ6A 4DQPA 3S8SA 2PMWA 4ZCIA 4FS2A 4DV5F 4Y0FA 4HHHA 3SSSA 1LEOA 4B08A 3JXOA 5C42B 3P5BP 2DT9A 4Q45A 2ALYB 4X62F 1Y4ZB 3FNNA 3LPEA 3PYDA 3J80Y 4AFFA 1HMVA 4LRFA 3JYTB 3Q8VA 4DZDA 2FLOA 2UUBJ 2CQBA 4UY85 2HHPA 3JS9A 5T41A 2R2TA 3SV3A 1FWLA 5DZ7A 3BSCA 4ED6A 3D0IE 4YMEA 1CEZA 4RL1A 4TYBA 1OY6A 2K1RB 1EARA 3DOKB 3FJ2A 3TEHB 2HQCA 1XK8A 2W9BB 6FDRA 2CPFA 5HQ8A 2OPQB 4A46A 1S99A 3CVKA 4OLOA 1NMEB 4QIVA 3OLAA 3NS6A 2HFOA 5H1SV 2V6AA 3FGVA 2O66A 4KGKA 3UCUP 4DOZA 3BGUA 3T5JA 1UKUA 4ZN1A 1GT8A 4F0HA 1WTFA 4JI7J 1SC4B 1QD1A 1N0VC 4DV7J 1IVZA 2JVOA 1GAOA 3O1LA 1VIXA 3P5TL 4CH1A 4U67Q 4M5HA 3CO9A 4CH0S 2H9ZA 3FSIA 2R8HA 5LMNF 3HSDA 4FVMA 3DOMB 3FRZA 2VFUA 1S6QA 3PO4A 4WZQA 4OZ3A 4KHRA 3W5XA 5FLXY 3AA9A 1QJHA 1E6YB 3PYGA 3BYRA 4DV3J 3KLFA 1RWWB 4XK8C 4DR2F 3FSYA 2DIVA 1YQHA 3A8JA 1FJ7A 1VLOA 1HI1A 3VQSA 3LQVA 4NE9C 2YWFA 3GB0A 3L4BC 3J7A1 2MY7A 2RRBA 4IG3A 4WXWA 2OPQA 3R27A 2ZDOA 1MU2A 4RWXA 1ZM4A 3QGHA 4R0EA 2RF2B 2BZ2A 2WAQD 4IRCA 2E1MC 3CMQA 2RH3A 3R1LA 5CYQB 4MT1A 3PFOA 4CO0A 5ETVA 3OSNA 3KJFB 1XBWA 3IR5B 2D9PA 1JLAB 4M5GA 2MQLA 3CDUA 1RQ0A 2V2ZA 1URRA 2Z30B 2WVBA 4A8SA 3C6UA 1HBNA 3H98A 1Q8LA 4B9NA 1Q86T 1GH8A 3QRPA 4NCGA 3WHIA 1BQNA 2AKWB 4Z37A 1OS5A 2XO6A 2KFNA 2YQ0A 1RDRA 2HWIA 5IV4A 1KVIA 2R42A 3HMJG 2UXDJ 3ZNUA 1QTNB 5HROA 1K0TA 2WHOA 2MHEA 1L3VA 5D0RA 3OFGA 3HXMA 2ZH4A 3NOCA 3BO3A 1QAJA 3FCVA 3IRWP 2HQDA 2WVFA 2UVWA 2VFSA 4QQBA 2A0FB 3BJYA 5GAGI 1D9AA 2V8VA 2F3JA 1R7IA 4DFMA 1AZSB 1NH8A 2QSWA 3Q22A 4OMFG 3NGKA 3LWLA 4NEZA 2LDIA 2DHHA 2HS0A 4WP8A 4DR3F 1KR4A 3L09A 1ZH5A 3H2VE 4WFZA 4Y3CA 1IQTA 2DNRA 3BGFA 4N47A 2VQFF 2D3OR 5A6PA 3Q2TC 4OZNA 4AL7A 2NS1B 2PE8A 4UUXA 3W2WB 4DPOA 4FBUA 4KPCA 2DNQA 4QPXA 1FJCA 4ECSA 3MCMA 1DTTA 3BQ2A 2R2UA 4EZ6A 2VKRA 1XNRJ 2EPIA 4K4VA 1U48A 4G1PA 3LW5C 2E5LF 1UVIA 2JC0A 2YKQA 3Q86A 5I4MA 2AW0A 2Y1IA 5HK4A 4USIA 4KR0B 4YB6A 2AYEA 2O67A 3NCRA 1TL3B 1D1UA 1NEEA 1WC5A 5F8NA 4B3TJ 4K7QA 3IO1A 4CQ1A 2VV5A 4DBQA 3NNHA 2A1BA 1REGX 4RLEA 4FNHA 2LQBA 4A4JA 2CPIA 4ECWA 3DU5A 2FJAB 2UUAF 2BQ3A 3DI6B 2Z2ZA 1RAHB 3QZ8A 4P10A 2HS3A 4LRCA 2B4UA 4FF1A 2H48B 3FMWA 1VLYA 1U1KA 1FKAF 1RAAB 3K5MA 4N77A 2Z2LA 3R5DA 3CXCR 5F8MA 5HI7A 2GA7A 2H51B 3O6QA 4K0KJ 2DGOA 4ZVFA 4X4TA 3H40A 3NAHA 1CQMA 1HWJA 1NM2A 3PRDA 3M2RB 4ZVSB 2QYCA 4CZCA 1R43A 2Z58B 2MHNA 3K7RA 3PNIA 2RRNA 4K5RA 1N5TA 2BA9A 2JX2A 2MKJA 4IRKA 3C14A 1BD6A 1JJCB 3V5RA 1N4LA 4NA3A 4DUYF 1N52B 6FD1A 1OY9A 1CQNA 4J9UE 4IFYA 3G82A 4KHPJ 4O4GB 2KHCA 3M6UA 3B6BA 3VZHA 4A8MP 1VIOA 3E01B 4W4MA 5LM7E 4UQTA 4AL6A 1EIYB 1HL6A 3CE8A 5HP1B 2EFNA 4URSA 1O6XA 2ZKUA 1Y7PA 2XY7A 1P1TA 3TI0A 2RVJA 4WK1A 5D0GA 1XIQA 2ZE2B 5AXKA 2QSFA 3JQJA 1Y0HA 1WG4A 1T9TA 2EXUA 3O3LA 4LRAA 2WVCA 2ZBRA 2F9DA 1K0VA 3BH6B 4NLPA 1SJFA 1UL3A 1NBEB 2P9EA 4XAKA 4HH0A 3A4TA 1HNVB 3D1HA 1R8PA 1RT6B 2NPIA 4ECUA 5H9EJ 2OO4A 3G2XA 3MAHA 3DLKB 4MYTA 2X51A 2RKIA 4A8KA 4G1IA 3BV8A 4R0JA 4OYPA 1TTHB 2M3DA 3GG0A 1U1MA 1NO8A 2JSXA 3KLEB 4A8XA 1Q8BA 5A8RA 1VBZA 2AZ1A 2OSRA 4Y34A 3E01A 1DBDA 1U6ZA 4I1TA 3FFIB 3WBZA 4BLGA 1HBUB 4PR6A 4RR5A 4Y6IA 2E9ZA 2L9NA 3W65A 3LGHA 1Y5IB 3RU0A 4HYKA 1UCNA 5FIIA 2C22A 3POTB 3BH7B 1PCAA 2LLZA 2XSJA 3DHXA 4R5PA 2AJFE 3MCSA 1YG0A 3QAUA 1Y5LB 2Z56B 1RT2B 3NG8A 1H73A 3M4XA 4MK7A 2EBGA 5C7PA 2G0CA 1AUSL 1C1BA 3NP5A 1VQ7S 2HHXA 2IMOA 3W63A 3TZXA 2F63A 2MXYA 2ZDPA 3KLVA 1UZDA 4WBFA 4N8NA 2B7CB 3L7OA 3M2UB 4KGXB 2ZZNA 3VAFA 1U1PA 3U1MA 1IXKA 1TQLA 3MM7B 3D3CJ 3BDEA 2CPJA 5CZVA 5HAOA 3I0RA 1RTDB 3BGRA 4PUOB 4ZLNA 2C2EA 4IDKB 3E51A 2FVCA 3KLEA 3I0SA 1G7CB 3FCHA 2LCWA 3JTOA 1NAQA 5D0HA 2VFVA 4LFCF 3DRRA 4KO0B 2CG4A 3CCZA 3PV8A 4PG6A 3GFYA 4TY9A 1ZBTA 2M0GB 1PBUA 4OHWA 1Q53A 3POTA 4B3RJ 3DLGA 3DLEA 4KBIA 4P75A 2B6AA 4MH8A 4JI0J 3H20A 3UDVA 2R3VA 2J6SA 1EQ0A 4EWTA 1RT2A 1KOHA 5D6GA 2FUG9 1Q8IA 1WF1A 5M2UA 4ZKAA 4Q2LA 1T0TV 3AY0A 2JLFA 4OHYA 4F7VA 4GC6A 5E5NA 3MPVA 4DV3F 1VBKA 3PW5A 4L76A 4EFAC 4CP5A 2AU0A 4NLUA 4CLYA 1SVDA 2KXFA 4MKBA 2K06A 3MECA 2ZOMA 3IBWA 2CNKB 1JIHA 3MM7A 2V4QA 5B09A 3GJQB 4C2MA 3HF5A 4OHZA 3RG6A 5F9NA 1ZTWA 1CJTA 3T41A 5EWEA 3VCDA 1VRTA 1EZZB 2ASJA 1IR1A 4CIOA 2IA0A 2RDJA 2IRXA 3DLHA 4UOCA 2H5EA 3FMBA 4DF8A 4P2FA 1HPZA 4USTA 1FRHA 2XCPA 4RNNA 1IM6A 2IM3A 1RP5A 5DM6Q 2MKCA 3DM2B 4MFBA 2AMCB 2UXDF 2OD4A 3NMAA 4YQWA 4OZ2A 3LAMA 1QDUB 2OIHA 1BLUA 4JBCA 1IBCB 5J2QA 1ZM3A 4ZP8A 1IBLJ 3D4JA 3W5YA 1VHIA 4ZVOB 1FKOA 3MCOA 2V34A 2MYFA 3CJRA 4J9KA 3HZGA 2C1EB 4Y65A 4QZVB 4HH1A 3H90A 2CJKA 5E0OA 1HHQA 5AXNA 3FZ2A 4DSEA 2DISA 4YR3A 5IC4B 1S1UB 4OZ1A 2RU9A 3W7BA 4OJGA 2DNOA 1Q7YT 5C25A 4B9VA 4ED5A 4K4SA 4YOEA 4NLXA 5J1NA 3CDWA 1YJUA 3NS7B 3UVJB 3MI7X 2ZD1A 3AA8A 4PWWA 4DR4J 4R8UA 4H4KC 1YKWA 4OZJA 2OLWA 4NZ6A 1JJHA 2KU7A 2MMYA 3TUZC 3KDNA 3M2VA 2RS2A 1XNRF 3KLIA 3VTIA 1XNQF 3T1YJ 1VQPS 3QAEA 2ROGA 2AD9A 3HK2A 3F56A 2FY1A 2QE5A 2FQQB 3PR5B 4LFAF 1CJKB 4TU8A 1F6TA 3DRPB 3ILIA 3QJJA 4XDCA 2W1BA 4NL5A 1YJTA 4PQUB 3HJFA 4DG1A 3KK1A 2XMWA 2M4MA 8ATCB 4B3TF 1FT8A 4CLWA 3TRGA 3HHLA 3R8YA 5C24B 1HD1A 4NYPA 3JQKA 3Q24A 1DURA 3T6JA 3OJSA 2YQ1A 5KFNA 2ERRA 3TEGA 2WSEC 2W25A 3BSOA 2VA2A 4Q0BA 2VBZA 1RTIA 4M5DA 1I51B 4PG5A 3OFHA 1YJ7A 2QLWA 2A18A 4C97A 2R7VA 3DN9A 5HLFB 1TKTB 2B9WA 2DR7A 4UOGA 3BO4A 1CPZA 3KLHB 4J9PA 4GKKF 3D9BA 2GQQA 4L6V3 1MMNA 1WUUA 4YUDA 4RW7A 5ETQA 5I42A 4KH1B 4NXMJ 3H5XA 1A7GE 1QY7A 4D3HA 3MXHP 3QFHA 4QCLA 4KFBA 1L3KA 2ZBCA 1KONA 1SJ4P 1OIAA 3NOGA 1UAWA 4RUCA 2KZMA 3N5BA 1CJKA 2DHXA 5BR8F 2HGLA 4C0HA 2OEKA 2HNDA 4QYRA 4B3MJ 3QT5A 2EFQA 3SZ2A 1HNZF 2E7XA 2MJUA 3TANA 3M7VA 1DY3A 5T7LB 3HVTA 2GMJA 5C24A 2J0XA 3CCLS 3H5UA 2V4JB 3O44A 3ENQA 3QIDA 4ZVGA 2IC3B 3EXYA 2M70A 3WDOA 2W7PA 4B9MA 2BOAA 3D0HE 2D7SA 2C2DA 3CJTA 3HP6A 1BQMB 1Q95G 2FLLA 3MFIA 4CO5A 2CJXB 3GIIA 4DUTA 4OLPA 3R7NB 1C1CB 5B0AA 3PVXA 2GJIA 1SJQA 2VKZG 3AD8C 1WOPA 5CA5A 2DD8S 2YNHB 2DKOB 3QPIA 2DCUB 3MFHA 4UTGA 4LREA 1BC6A 2CWXA 3DYAA 4KSEB 3TYTA 3OUYB 3TAMA 4B9TA 1KQSR 2XZWA 4IYQA 2J8SA 1YJWS 1O0PA 1H3DA 3D6FB 3HVAA 4O3QA 2ZH2A 3LANA 2ZH1A 5G4DA 2FLPA 1RUSA 3UPFA 1M1KT 1RT5B 3VGUA 2BJEA 1N8RT 1RU1A 3JTPA 3E8OA 2RU3A 2DRDA 4PXBA 4JV1A 4I2PB 3I55S 2IDEA 1N88A 2YWHA 2UVVA 5HO4A 2AQ4A 2QG9B 2RAQA 1FD2A 5AT1B 3OVAA 4DCOB 3M32B 5BYQA 5KOXA 2ZZTA 2Y0BB 3GE9A 3TA0A 5GMKa 1QUVA 1FHTA 2UVRA 2J7UA 2G1DA 1J5OA 2KG0A 1RTHB 1VQ4S 3V4MA 4NMLA 4P2MA 1RKIA 1WG5A 2KDOA 3OBIA 4OI2A 2EG1A 1SL1A 2FC8A 2OTLS 4A8FA 1PJ5A 4DFJA 3J7Z5 2XTJP 1RB0A 2YNHA 5EWFA 5I3UB 1X0FA 4Y2IA 2QN6B 1PAEX 4ZCMA 1IKXB 4M5KA 5G0RA 4DUZF 5AJ3J 1OWXA 4Z7YA 1DARA 1HARA 4OZ0A 2YBVA 1YI2S 3SCIE 4QIWD 3UE2A 3VWSA 4HTJA 1CULB 2DITA 2F8EX 4J9RA 1R6YA 2VF3A 3RR7A 4P6QA 2UU9F 1EJ7L 4FF4A 1AFJA 2V5HG 3IRXB 1PIEA 1WHXA 3IC1A 2QMUB 2DO0A 1P9QC 5A2QU 4U8YA 4QIFA 3EUNA 1REVA 4CT8A 1Y11A 2DXDA 4LMZA 4ZLLA 1VK8A 1T3NA 4MYUA 2KM8C 2QGFB 4H4MB 3I82A 2HHHJ 3BR8A 2ZITA 2LQ5A 1VQ6S 3HFZB 1YHQS 4B3OB 2XYPB 1LXJA 2IVMA 1RTHA 3KJNB 1RBOB 3NWGA 1Q7LB 4JI0F 4K4UA 2FPHX 3UO0A 2AT1B 4O4RA 1TFWA 1YRXA 1HQEB 2NXEA 3TUIC 4JB8B 4XDDA 4ZLJA 3M1VB 1H2VZ 2E5IA 5JVHQ 4ELUA 3PW2A 3AQOA 3TZZA 1XR6A 1YIJS 2E9RX 4IG0A 2XZTB 4ED3A 3NAIA 5HMYA 4LSNB 4NLQA 5AXLA 1U0HA 3WQPA 1KLNA 2EFPA 2EFGA 3D1OA 4X4SA 3RYLA 4HT7A 1WEXA 5CYMB 5MAOA 4B9UA 2VG6B 2ZVIA 1KRPA 1DTQA 2GX8A 2LQJA 4NLRA 1WSVA 4RW9B 3IS9B 1HNWJ 2XY6A 1TKXB 5HJYA 1UTAA 5KFFA 1SUQA 3T5LA 1FE4A 1QUPA 2H3EB 2FIUA 4Q43A 1VHFA 3AAWB 1G3OA 2HLTA 4F0MA 3KJVB 3KKFA 1C2PA 1S9GA 1NLKL 4Q8EA 4RX6A 4QR1A 3BQ0A 2CA9A 1KVKA 1MN9A 5D78A 4E0DA 2V8PA 1KWMA 4BBYA 1VISA 1C4CA 2G13A 4ICLA 4L74A 4KC5A 2L3MA 2OMLA 4ZS6A 4C98A 1CSJA 3JSMA 1CJUA 1JLQB 4J91A 3MAAB 1WNEA 4NLTA 3BKTA 1OQ6A 4X66J 2BR0A 4PCQA 1U49A 2R8GA 2N7CA 1RT1B 3C66A 3IAS9 4LSNA 2DGVA 3C16A 5HL7Q 4U9RA 4DR1J 4J9VA 4U6PA 4EBEA 3KLGA 2K2PA 4A8WA 3Q8SB 2DY9A 2HNZB 4W92B 4NASA 3GSIA 3CJKB 4LJMA 4RW9A 1YBAA 5KG1A 4S0MA 2DPIA 4JI8F 2AP6A 2HFNA 2UVUA 3MDFA 1RYRA 3IGNA 1NDKA 2ZH7A 4HACA 5K14B 2HZCA 3A8EA 2JL9A 1HYSB 4M5IA 2RE1A 3TAPA 2NZ4A 1TVRB 2UXBF 4LBPA 1KSPA 2MZ1A 5BYRA 4ZJOA 2B4VA 1R3NA 3UCZP 4JYAJ 5HQMA 2HVIA 2N3OA 5KFVA 2BJ8A 3M8YA 1JJ4A 1EETA 1NB2A 2NR0A 4OYXA 5D3GA 2X3GA 1R31A 2CZVC 3MM9B 1NSKL 2DHAA 1FEEA 3MMBA 2F7VA 3BDPA 3GYXB 3T1YF 1NZ8A 3U1LA 1FDBA 1W26A 3QRQA 1APSA 1BUXA 2XS5A 4NWBA 1YK9A 2MLYA 1X4HA 3FC9A 3FZBA 3F41A 2BE7D 3CMAS 3I5AA 3SEOA 4ZDNA 4RZRA 3NY0A 2DXEA 5LSRA 3VHQA 2AGPA 1DAXA 1FTCA 2W4PA 2A10A 4IOAQ 4DQQA 1YGYA 2RHSB 3GFHA 3A3PB 2MPUA 1RHUB 1TV6B 5DJBA 1W2BR 2C3YA 3ET6B 1AW0A 1QAXA 4KY3A 5FJ4A 1GXUA 2GC8A 1TU0B 3PG9A 2CWKA 4FZVA 2MSTA 1SJRA 1T9UA 2PT0A 2DGWA 4U8VA 1WKJA 3IAM9 3L3CA 1SKUB 2DNLA 4QWAA 1T05B 4CLFA 1K8AT 3EGWB 2ASLA 2ASDA 3BZQA 3MEDB 3P49B 3IG1A 1RT3A 3GV8B 4NEYA 2C2ZB 4ZPTR 1XWLA 1OYDA 3I56S 1T7PA 2B8QA 1UVNA 1U8WA 3C15A 2P9CA 4N7TA 1N56A 1JKHB 4HVZA 5AE2A 2GO9A 2MGZA 1OQ3A 1T9WA 2ZUGA 4B3MF 3OR2B 2QMWA 3LP1A 3M8PA 3Q8YA 2U2FA 2LXUA 3IGVA 3W2VA 4DN0A 4DPYA 3D28A 2CXEA 3ILJA 4FPRA 2IM1A 2HQ3A 1O5JA 2HPUA 2HBZB 2ZJQQ 4ED4A 4I2QB 4DL6A 3J7YI 2DGUA 4JI2J 4F4YA 4ECVA 3G6YA 2QYGA 1SV5B 3TVKA 4IH6A 3N0VA 4KE5A 3QGIA 2BYCA 5KT5A 1RCXB 9ATCB 2ZHOA 2IIHA 1SQFA 4IO1A 1N5VA 2YNFA 4O3SA 3NXZA 1OPZA 2CJYB 3HFKA 1X4EA 2ZOFA 2Q66A 4ID8A 5F8LA 1W25A 2E1RA 1UW4A 3R97A 1FX2A 3NWRA 4ATNA 1N5QA 1HR0J 1SI9A 2O1PA 1KBRA 3EPIA 4QPTA 4USJC 2NUUG 3Q8UA 4F4XA 1JLCB 1HWUA 4ED1A 3SI8A 1KEKA 5IFMA 2C2OB 1VQMS 3DNCA 5CYJA 3GILA 2CADA 3SQGA 5AE3A 1VI7A 1EX8A 3T9NA 1H38A 2I0XA 3MMAB 2C2KB 1EHWA 2RQ4A 3P96A 1JQGA 1TK0A 2JFKA 2R7WA 3QZ7A 2V4RA 4F2SA 1W2IA 4ZITA 2NCKL 3ZTRA 4UY8T 5IM0A 5DG7A 3Q8RB 4N56A 3F44A 3CPWR 1F2HA 1IKVB 3DKDA 3SQOP 4LF4J 1JLFA 2AGOA 2VONA 4AUKA 4YHHF 4CM2A 2BDPA 2WCXA 4K4XA 2HHQA 2QT7A 3CCUS 2W9CA 3DDKA 4FF3A 3M8QA 1GTEA 3NS5A 3W9IA 2JH3A 1R27B 2D3UA 1S1WB 3OTOJ 1SJ3P 1QSYA 3OVSA 2I6WA 1PAUB 5IWAF 1JXVA 4P74A 1T03A 1Y9OA 3BEGB 5K8PA 4M5MA 2F9JA 3M6XA 1LW0B 4DR5J 1ZTTA 4KGVB 1TK5A 5IT4A 4RBUA 1VBXA 1KDNA 5KFMA 3CCVS 4FNIA 5HATA 4QBUA 5ETSA 1IBKJ 3AJ1A 2HVZA 2BKOA 2V2KA 2R7XA 2OPRB 3G9CA 1JB0C 4CTAA 3QT7A 3OV7A 4NA2A 4RJVA 2E7WA 3ONQA 4QU6A 3RAMA 2FVQA 1S1XB 4NCAA 3GU0A 3MUTP 4Y2AA 3W66A 2J9DA 1X4GA 3EYZA 5E3PA 1LWEA 3CJ8A 2ZH3A 1S7IA 1R0AB 2R7RA 2BJ1A 5B0GA 4KTQA 1LV5A 1DRZA 3D54A 1HQUB 5H9FK 1S1WA 4ECZA 4KAIA 4AL5A 3PW7A 4CLLA 3BN4A 5L1KA 4UZCA 2HIYA 2FB0A 5KG2A 1U02A 1WKKA 3MTKA 2YQ3A 1KHWA 4X62J 2WVDA 4MIAA 3J81U 1F3VA 2W8KA 3AXKA 1BWVA 1S1VB 3BGLA 4TNOA 2QEXS 2ZHAA 5F41A 2HMIB 2ALZA 4DDFA 2PEBA 2XM3A 5LOQA 1S6UA 4E98A 2V68A 5GAHI 2OJ3A 3ZO7A 3CB4A 3NBPA 1U24A 2HYIB 3MPWA 4NI2B 1HNXF 2HQGA 3OR1A 4QIGA 1UWBA 5IT9Y 4ZN3A 2YH0A 3BYPA 4MIWA 3QT6A 1DFDA 3NMRA 4DPXA 1UJ6A 4C0BA 4XIUA 3E3XA 3N6NA 3V4IA 4CCHA 3IM8A 3DOLA 1SXLA 4I7FB 1JNRB 1V6HA 2YKMA 4WE1A 2KT3A 2VOPA 2N7YA 4PG4A 1O51A 4DL4A 5CXTA 3CT9A 4ED7A 3NGTA 3MM8B 2IRUA 2RJZA 1GFWB 1T9XA 5LMNJ 5GAGU 3L9ZA 3MEEB 2Y1JA 3EVOA 5J2NA 3UFCX 1NU4A 2DY1A 2HAFA 4DR1F 5DG9A 1H7XA 1KKHA 5K20B 2PFDA 1NDLA 3EE3A 4J5OA 4DX5A 3QLHB 3Q2SC 4CLUA 2WBRA 4WF9Q 2PI4A 3HM9A 3IWLA 3R5BA 3VZIA 2V94A 5D77A 2KL8A 1VK3A 4WU3A 2C3UA 2HNYA 3P4UB 4QR2A 4DL3A 2YVSA 2YWKA 2CPHA 3BREA 3NL0A 1WDDA 3AT1B 3ITHB 5F9LA 2KXHA 2G1HA 3N5FA 2KFZA 1TZ0A 3F73A 3IN5A 4EGLA 3PDNA 3HJVA 1ZAVA 3LP2B 1RZMA 1RT7A 1DZ5A 1UETA 2OUGA 4I7FA 1AT1B 3TJAA 2XY5A 3VAHA 3FSXA 1IN0A 1NK8A 3ISZA 2VDHA 2DBBA 4ZPAA 2VZ9A 2MKSA 3D68A 4OV1A 1RLCL 3KG0A 2MY8A 2HBYB 1FFWB 1HA1A 2KB2A 5L46A 2BJ9A 4ED2A 1SKWA 1BWEA 3ZTQA 1FA0A 1Q0NA 3W9JA 3A3NB 5KG6A 1GQEA 4USWA 4PZVA 3BF4A 3RJMB 4WFYA 1PYOB 2LA4A 1U1QA 2JDJA 1NJXA 4P9SA 3KK3B 3PM9A 5HBMA 3D66A 2K7KA 4NX9A 1S4EA 2IHR1 1ZZFA 1S9EB 2J0QD 2PC6A 5B0BA 3DRSA 3G86A 2V8DA 1VC0A 3BSAA 2QX0A 1BY9A 3RB6A 1UPMB 2DK2A 2QL9B 5KFSA 3ZZYA 4RW6B 4NA1A 5HVGA 4DR3J 5KFHA 4HDHA 3B54A 3PIOQ 2Q6BA 4ZHRB 2XYGB 3FBBA 3PEJA 2XSFA 3T9ZA 2GVZB 1EKSA 2VQFJ 3CMES 2MKHA 3QIPB 3QGPA 1HI0P 1HFEL 3UR3C 4B17A 4N76A 3HD1A 4KGZB 2J6TA 3RR8A 1NJIT 1U4BA 2CPEA 2AYBA 2QLBB 4X4UA 4F04B 4RWWA 2KG1A 3CW2C 2F4FA 2QA4G 2AJQA 4B02A 4X4PA 2C28A 2B56A 1RLDA 1F0XA 3U27A 5A8KA 4PXCA 1JLGA 3CEDA 4RW4B 2OKQA 4H54A 5KFGA 3RGIA 4JI2F 1U0SA 6AT1B 5DLGA 3L95X 3KK3A 3CJ4A 4ZA1A 4C8KA 2KYXA 1YTYA 1JLEB 4U7UK 2X1BA 2OMOA 2JC1A 1AA1B 1IJFB 1RT4B 1LWFA 2G2ZA 3FRYA 1N6QB 4ZOSA 2CAJA 1YBUA 3DLBA 2XHWA 1B0VA 1ITPA 4JI4J 2I5JB 1UWAA 4DV2J 2FHKA 2IAJA 4PPDA 4QWBA 2PA3A 2CPYA 2CQHA 2F40A 3J80U 1AUDA 3V6JA 2G2OA 3R2DJ 1U1LA 3UD5A 3ZTSA 4C3MA 1PSDA 3AJ2A 4DU7A 4LFBJ 1HR0F 1RWPB 2M7SA 2PGCA 3DXSX 1A0OB 1FE0A 3MUMP 1FD8A 1S6PA 4RNHA 3K5PA 1KHVA 3AXMA 1S5ZA 1FK9B 4KYZA 3ETOA 5LT5A 3PW4A 1NK6A 2JNJA 4PEOA 2RUSA 2U1AA 4ZVEA 2DR9A 2E1PA 4EI2A 3M30B 2OPPB 4OHXA 4LRDA 4F0KA 3GQCA 1PKUA 3D67A 3CJ3A 4OV6A 3HX9A 4DS4A 1D9DA 1S4FA 4DUYJ 2XNQA 4ZVUB 4Y2CA 1HNIA 4C7QA 1LWCB 4GVBA 2JFDA 4O3RA 1XTZA 5F8JA 1ZS6A 1X4BA 3IFEA 4LF4F 4DEZA 4DV1J 1B7YB 2PD1A 4LR7A 1FWPA 3MEKA 2FHOB 2QMXA 1T02A 2KO1A 1U26A 2D41A 1M5SA 1WORA 4K5SA 3E2EA 2P2CB 1F2GA 3FQLA 2KXNB 3ZZUA 4DR5F 1HMVB 3K17A 1ICEB 3OVBA 4LF8J 1IUJA 4KRWA 2R2RA 4RPFA 2HWHA 1IBKF 2GVDA 5CZXA 1Y5NB 2D9OA 3TA2A 3DFEA 2GHWA 5F3TA 2YNIA 3FEYB 1YDLA 3BR9A 4F25A 4HKQA 2NSBA 5KFZA 3TZWA 3M6WA 2C3MA 2NXCA 2PI5A 2XS7A 1LWCA 1M1HA 1EAYC 1FCAA 5KFEA 2ADBA 2CYYA 1FJGJ 2AEJA 4X65F 4NLYA 2RB7A 3H2UB 3CD7A 1VQSA 1ULRA 4WTOB 4ILRA 2GIFA 2GQCA 3LTOA 4ELVA 4V19X 4ANDA 2DJWA 3AOAA 1TL4A 5EGYA 1GEHA 3A8KA 5E41A 1D8ZA 3KYLA 4WFAQ 1SIZA 4DV4F 7AT1B 5DDOC 1S6QB 4ANCA 1F9HA 2Q79A 1PJ7A 1FDDA 1TKZA 3KLFB 2BRKA 1M5VC 2FZKB 3V6DA 2POKA 1VQ5S 5KFCA 3K89A 1SCJB 3KOAA 1UEKA 3B4MA 2K3KA 2QIFA 4ENOA 2M52A 3GZ7A 4PG7A 1NDPA 5RUBA 1H2UX 2DH9A 4IG3B 2DR6A 2UUCJ 3EZ5A 1MU2B 1DHMA 1VQLS 3UD3P 2RMLA 3HHDA 1KVJA 1S97A 4FVCA 2GMLA 2OFHX 2WB1D 4IKAA 3NGUA 2QL5B 2EI5A 2RQKA 3MF5A 4JV5J 1KLMA 3PRVA 3MOJB 4DCJB 1N5SA 3KK2A 4LFCJ 4J9NA 2J8AA 3QMQA 2KJVA 3C6UB 1HBNB 1GTHA 1RWVB 3KNAA 2P8IA 2YH1A 2FTRA 2OGUA 3FDSA 1B3TA 3PACA 4NCGB 4Z7CA 4MK8A 1BQNB 4OJHA 2DNYA 1JXLA 1HW8A 5F3ZA 1SC1B 3I5CA 1Y00A 4OHVA 1TUVA 3EGZA 1OJ4A 4HT5A 1NK4A 3FQKA 2O3DA 1CVJA 1Q82T 5HROB 1TL1A 4B9LA 3OL8A 5J1PA 4ZK7M 2E1CA 3HI9A 4P7VA 4JI6F 1SC3B 1B99A 5F0WA 9RUBA 3GV7B 2AYGA 5A6WA 5ETRA 2IPOB 2NZCA 3QSIA 3MGJA 2A3JA 4HDGA 3THTA 2JLGA 1X4AA 4WFBQ 2GQ2A 4PQAA 3PHEA 2MLXA 4CM0A 3HLUA 1FEHA 5B0CA 3ZFVA 4HLBA 3LF0A 2G0JA 2NPFA 2CQ2A 2Z0GA 1VGYA 1ROFA 1LW2A 4M5JA 5CH7B 3CF5Q 1X4CA 2WZ1A 1F5AA 2Z57B 1CJVA 3ZZTA 3DC2A 1DTTB 2JVRA 2RHQB 3CDBA 2LDYA 2FGOA 3KHHA 3VQTA 2E7VA 3CULA 3BBFA 3TVYA 4AXIA 4DR6F 2CIMA 2LP4A 2DRBA 2C2NA 3W9HA 2VJVA 4G6VB 5KG5A 5IQQA 3MR2A 2V8HA 4AQYJ 4UOFA 2DYAA 2V67A 1RXOB 4YB5A 2HBRB 1ZPWX 2CUYA 1CC8A 1LK7A 1RTJA 4BCAA 1WACA 1CLFA 2CJQA 4E2FB 1JXEA 2LQ8A 2F4VJ 5KFOA 3CC4S 3H5SA 1XC9A 2BW2A 1F5CA 4PRFA 2H5JB 3DHWC 3I31A 3MMCA 3LGNA 1VQ8S 4R25A 2B5JB 4M63A 3US5A 1I94F 2BJDA 3R3TA 1XN9A 4WIIA 1TP7A 1MLAA 1RU2A 4ZPCA 3QRRA 3GYGA 2VQEJ 1X60A 2QFIA 1TMJA 2BM0A 4DV6J 4NPOA 1M5OC 4K8RA 1MW7A 1ZAWA
chains in the Genus database with same CATH topology
1YIJS 4NZ7A 1SL0A 2Z8QA 3CJ0A 2E9RX 4IG0A 5HMXA 2A2DA 3ISNC 4USHA 2YX7A 3K57A 1LQ9A 4PG8A 4ED3A 3QJLA 1BGXT 2OFGX 3NAIA 5HMYA 3NLCA 4PWDB 4LSNB 3LP0B 4NLQA 5AXLA 5J1EA 4DQRA 2BV3A 3IR6B 4DJBA 3BQ1A 1KLNA 2DIUA 3SMZA 2EFPA 2EFGA 3D1OA 4X4SA 3RYLA 3CSKA 4HT7A 1WEXA 3H2LA 5CYMB 2HHWA 5MAOA 4M95A 4K59A 4B9UA 2VOOA 2VG6B 2J7WA 1HWIA 1J5EF 2GNKA 5IS2A 1KRPA 1DTQA 2HQIA 1NNDA 3G6VA 2GX8A 1UP1A 3OTDA 4RW4A 2PFFB 2VPXB 1LFPA 2LQJA 4NLRA 4RW9B 3HPOA 4MKAA 1UMJA 3HO1A 3IS9B 3EGNA 1N5YB 2KKHA 2LEPA 3MR6A 4C8ZA 5KTQA 2B43A 2XY6A 4ECTA 4I69A 1TKXB 3OL7A 2CPXA 2MDAA 1IKYB 4EU0A 5KFFA 2VODA 1JLEA 3K8VA 4TKTA 4X4QA 1SUQA 3T5LA 1AXQA 3CTRA 4DHVA 2CQ1A 3NBPB 4IFYB 3DRYA 2ACYA 1FE4A 5D4NA 1RT4A 5LJ3Y 3PW0A 4HTIA 3RB0A 1SKRA 1QUPA 1L5UA 1N6QA 3SSQA 2WONB 2FIUA 4Q43A 3CJ5A 1VHFA 3KFWX 3OR1B 2YKNB 3AAWB 2DGSA 3BM7A 1G3OA 1UWBB 1Z1ZA 2HLTA 3CJ2A 3KJVB 2XBPA 3KKFA 1HI8A 1FRJA 4TLQA 4JI4F 4QYZJ 1C2PA 1S9GA 4RBTA 4WJBA 2QV6A 3ZZPA 2DTJA 3MD1A 4Z2XA 4Q8EA 1FESA 4RX6A 2UV8A 4QR1A 1NZAA 4C4WA 3BQ0A 5AE1A 2B5JA 2Y1RI 5J2PA 1SH3A 3V4IB 2BBEA 5DRKA 4DV2F 2I5JA 5D78A 4E0DA 1RAJA 4NRUA 3FEXB 4BBYA 2FHJD 5L38A 3DOLB 3DDNA 1C4CA 1DJ0A 1SQEA 1V9OA 2DB1A 4Q5VA 1H2TZ 2G13A 3OTOF 4B3SF 4ICLA 2LU1A 2NXUA 2FJVA 2KT2A 2J9EA 5KFPA 4KC5A 2L3MA 2OMLA 4ZS6A 4C98A 1CSJA 3DM2A 3JSMA 2GGPA 4LFBF 2YKMB 4WE1B 1JLQB 3CCSS 5J2MA 4G1QA 2FJWA 1FDAA 4J9OA 4DSKA 5DLFA 1WNEA 4NLTA 2IVYA 1B0TA 5L9XA 2GV1A 3RAXA 2OPSB 1U1RA 1OQ6A 4A8QA 4LQ9A 2VFRA 2P6TA 2G4BA 1XR7A 2BR0A 2LU2A 3I4HX 4PCQA 1IBMF 4FXDA 4MK9A 1N36F 1U49A 4I6YA 5SUHA 2R8GA 3D1QA 1X4DA 3DGPA 3KHRA 3I96A 5LJ5Y 4KV8B 2N7CA 5B08A 1UA1A 4GKJF 1RT1B 3C66A 4CNYA 1LK5A 1FK9A 2FHJA 4ALZA 2W8LA 3SYZA 1U1NA 4IH7A 3IAS9 2RSQA 4LSNA 3LP0A 4HEA9 2D3ZA 2AGQA 1SB6A 2DGVA 2P6SA 1F9FA 5J2NB 5B0DA 5HL7Q 1FRLA 4LIRA 3D0GE 2R4FA 2JWNA 4NLWA 4U9RA 3TAQA 2JEFA 4NYOA 3MM5B 4WU2A 4EBEA 4U6PA 4CO2A 1UA0A 2MQPA 3N6MA 5FDLB 4FXVA 1IQZA 4K4ZA 2VPWB 3CCTA 3KLGA 1X8DA 2ZM6F 4ILLA 2COLA 2RDIA 2K2PA 5E3CA 2QFJA 3Q8SB 4RBVA 4A8WA 2HNZB 4W92B 3BO2A 3CJKB 3DXBA 4LJMA 1S6OA 4RW9A 5K5MA 1YBAA 1YRTA 5KG1A 3J7ZT 5DQIA 3M30A 2OPPA 1ZM2A 2QA1A 3NKYA 3ZZ0A 2R2SA 2HHUA 2AX0A 2DPIA 3V81B 4JI8F 2AP6A 2AYMA 4C11A 2HFNA 1T8EA 3MDFA 2UVUA 5EHHA 2ROEA 2MQNA 2RKIB 1RYRA 3IGNA 1VS3A 2E5HA 2ZH7A 2HNYB 3I9V9 2JHEA 5K14B 4JV0A 3I9ZA 2HZCA 3A8EA 2JL9A 4CNZA 1HYSB 4RNFA 3MEGB 1A6LA 1HBMB 1S1UA 2BQRA 4O3PA 4FN5A 2RE1A 5BYSA 3TAPA 2NZ4A 1TVRB 2WB4A 4OJ3A 2UXBF 1VFJA 3GIMA 2LXFA 3H59A 3V6HA 2B4PA 2MZ1A 2ATLA 5BYRA 1KSPA 2VBXA 4F8RA 5A8RB 2B4VA 1R3NA 1P8GA 4TY8A 1C0UB 3UCZP 4K2XA 3GSDA 4X64F 2ZHBA 1VC5A 2XLKA 3Q0AA 2HVIA 4ZPBA 3UW1A 1GXLA 3SDEA 4DV1F 5CQGA 2N3OA 5KFVA 1XMBA 2BANB 5L9NA 5KFWA 3C3LA 1JJ4A 1EETA 5KFUA 4F2RA 2NR0A 1KTQA 3TR5A 3H8YA 2KFYA 5D3GA 2EG2A 3SCJE 3B8HA 2APOA 2AX1A 2LKZA 2X3GA 4WFNQ 1R31A 2J9DE 2J6UA 2HVHA 3PRBA 3M9NB 2NYIA 3SXLA 4ED8A 4K0KF 1RT7B 2CZVC 3CCWA 3MM9B 3ZC4A 4DQPA 3S8SA 2YWEA 3BN7A 2DHAA 3THVA 1FEEA 4ZCIA 2FVRA 3MMBA 2F7VA 1YSJA 3BDPA 5KFBA 1MNEA 2VUGA 3GYXB 2XSJB 4FS2A 1N54B 4DV5F 4Y0FA 2FHMA 4R5PB 4FXWA 3CC2S 3T1YF 3THPA 2EFVA 3SSSA 4B08A 3U1LA 1FDBA 5C5JA 3I5BA 3OPKA 1NK7A 5C42B 2OSQA 3N9UC 3BB5A 2DT9A 2P5VA 4Q45A 1APSA 2XS5A 4NWBA 4X62F 4WK3A 2CKWA 3DRPA 5JUMA 4EUVA 1X4HA 1Y4ZB 3OJUA 4OX9F 3FNNA 3FZBA 2V9KA 3F41A 3J80Y 4Q7AA 3CMAS 2CJAA 3GR0A 2QLXA 1HMVA 1C1BB 3I5AA 4KV8A 3SEOA 4ZDNA 4AFFA 4RZRA 3JYTB 3TARA 4LF8F 2BABA 2FLOA 2PEHA 2CQBA 4UY85 4PQUA 4IFVA 4NCBA 2HHPA 1QVFR 4C8OA 4OIXA 5LSRA 3IXQA 4O44B 5T41A 2AGPA 2R2TA 3SV3A 5A8WA 1DAXA 1FTCA 1RGVA 2W4PA 4ES1A 2A10A 4IOAQ 4DQQA 2VPZB 3T19A 1QE1A 1YGYA 2MZTA 2RQMA 3BSCA 5THWA 4ED6A 3D0IE 4YMEA 1KQGB 1VMBA 1RA7A 3RRGA 4KHPF 3LWMA 1CEZA 2CJBA 2XI2A 3GFHA 4F4ZA 4TYBA 4C9DA 2K1RB 2MPUA 3CDEA 2IMWP 3DOKB 3FJ2A 3V81A 1TV6B 5DJBA 5LSLA 3VAMA 1W2BR 5DETA 2GFFA 2C3YA 3MWBA 1O8BA 2AJ1A 1AW0A 1QAXA 1XK8A 2W9BB 6FDRA 2CPFA 5HQ8A 3OFEA 2OPQB 5FJ4A 4A46A 3I0RB 1GXUA 1S99A 2GC8A 3BGRB 2WSCC 4O23A 4FZVA 3M05A 3CVKA 4OLOA 2MSTA 3TA1A 4PWUA 4Y28C 4F67A 1SJRA 3I0SB 1VOMA 3JSRA 2ZFHA 3VAGA 2R8JA 3MM6B 2NLWA 4QIVA 5HBMB 2PT0A 3PZPA 3EPGA 3OLAA 2DGWA 1C0UA 3NS6A 5LSOA 5HLFA 2HFOA 1TKTA 2VG5B 3I6PA 5H1SV 1FJGF 2W4DA 3IAM9 3FGVA 3L3CA 2GIRA 2O66A 4KGKA 2DNLA 3ICLA 3KLHA 4QWAA 3UCUP 1T05B 3PJXA 3BGUA 4DOZA 4ETXA 3T5JA 1TKDA 1K8AT 3EGWB 2DVIA 3DRSB 1UKUA 2ASLA 3OXFA 3DRRB 2ASDA 3BZQA 1GT8A 3D2WA 3LGMA 1R8HA 1WTFA 3MEDB 5HN0A 3P49B 3IG1A 1WEZA 1N0VC 1E6VB 2R7OA 2JVOA 1GAOA 2JLEA 3O1LA 3H5YA 4XPEA 3TX8A 1RT3A 1VIXA 3P5TL 4CH1A 3GV8B 2DGXA 4BS2A 3MUVP 4ZPTR 4ELTA 3DLEB 3DLGB 2HS4A 1XWLA 2M2BA 4EO6A 2B6AB 3CO9A 4U67Q 4CH0S 2QA2A 3I56S 2H9ZA 3FSIA 2R8HA