5DEHA

Crystal structure of staphylococcal nuclease variant delta+phs n100d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVDEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N100D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dehA00
3C1FA 4KD3A 2F0LA 3MEHA 5CV6A 5ISRA 4IALA 3SK4A 4KV6A 5F2DA 1A3VA 5E3FA 1EY8A 1A2TA 3D6CA 2PZWA 2EYLA 2EYMA 4K6DA 3SK5A 5E1FA 1EZ6A 3MXPA 4N9PA 3U9OA 2F0DA 4NMZA 2WACA 1EYCA 3EVQA 2EY2A 5CV5A 1EYDA 5CV8A 5CGKA 5IGFA 3ITPA 1EY4A 2F0VA 4PNYA 4ME5A 5IGGA 5KGUA 3E5SA 4H7BA 2EY1A 5C6AA 4K2KA 3SK6A 1SNDA 5IGEA 2F0TA 1STBA 2F0IA 2F3VA 2SNSA 3HZXA 5CR3A 5J39A 2OEOA 1EY7A 1II3A 1SYCA 2PW5A 3NP8A 4HMJA 2OF1A 3QOJA 4HTHA 4J1MA 4K2LA 4KD4A 3BDCA 1A3TA 2O4XA 1SNOA 1STGA 3QOLA 4KY7A 1ENAA 5NUCA 3OSOA 4RKBA 3TP6A 4F7XA 3D4WA 2EYPA 1EYAA 1NSNS 2F0JA 2F0MA 4S3SA 1KDBA 2F3WA 3OMGA 3RUZA 5CC4A 1NUCA 1A3UA 3NXWA 3TP5A 2SNMA 4I65A 2LKVA 5IGDA 5CV4A 3D8GA 2F0WA 1SNQA 4N9TA 5M9OA 4HMIA 2F0UA 3EJIA 3HEJA 3DMUA 4ODGA 2EYFA 5EKLA 4EQPA 1F2MA 1F2YA 4ZUJA 5C3XA 5C4HA 3S9WA 2HQEA 5KYLA 5DAUA 3NQTA 1EY0A 5CV7A 3MZ5A 3NK9A 2KQ3A 1EY6A 1SYBA 3P1HA 2F0HA 5CV9A 1JOQA 4K8IA 4KY6A 1KDAA 5C5LA 4EQNA 3MHBA 4KJOA 5KEEA 1EY5A 3H6MA 4KJNA 3D4DA 3SK8A 4ZQ3A 1STAA 4LAAA 1U9RA 5I6YA 1STHA 4K5XA 5J1ZA 1JOKA 2F0GA 3EROA 4YIJA 5KRUA 4R8NA 5J22A 3P75A 1KABA 1RKNA 1SYDA 3BDLA 1ENCA 4G57A 4K5WA 3OMCA 2QDBA 4KHVA 3DHQA 4KTAA 5KYIA 5IOCA 5EGTA 2PQEA 2PZUA 3SHLA 4DU9A 1STNA 5I6WA 1SNPA 1EQVA 2RKSA 3MVVA 1TT2A 4QMGA 4ZUIA 5HURA 4EVOA 3QB3A 1F2ZA 4NP5A 3TP7A 5C5MA 1EZ8A 5KIXA 3PMFA 4OL7A 3NUCA 2RBMA 2EY5A 1IHZA 2F0FA 2PZTA 4WRDA 4EQOA 3TP8A 3SR1A 1STYA 3V2TA 2F0NA 3VA5A 1EY9A 1SYEA 4K14A 2F0KA 2EY6A 2SOBA 5I9OA 4K5VA 5IGCA 2F0EA 2ENBA 4B9XA 1SYGA 5JAVA 5K5PA 2KHSA 1JOOA 2EXZA 2EYOA 4QB4A 4WORA 5JOBA 1KDCA 2NUCA 4E6IA 5HGTA 5IODA 3TMEA 4DFAA 1TR5A 1JORA 4NDXA 2PYKA 1SNMA 4RKLA 4NKLA 4QF4A 2EYJA 2M00A 4MIUA 4IUNA 1SNCA 3ERQA 2F0QA 4IZ8A 4PMBA 4ID6A 2F0PA 5DEHA 3LX0A 3T16A 2F0SA 1SYFA 2PW7A 3R3OA 5IGBA 4J6HA 4F8MA 2RDFA 5C4ZA 4KY5A 1KAAA 1TQOA 2EYHA 3SXHA 4TRDA 3T13A 4B9WA 3NHHA 5C3WA 3OWFA 4K8JA 2OXPA 3C1EA 1AEXA 4DGZA 1A2UA 2F0OA 4DF7A 5I9PA 5IIFA 4PMCA 5EKKA
chains in the Genus database with same CATH superfamily
1UUPA 1RF2D 3SK4A 4FP5D 4KV6A 3KBGA 1A2TA 1KHIA 2PI2E 1Y1WB 3C46A 4P72A 2IY5B 3KLSA 4HJ5A 1SXTA 1BQQT 3VR2A 1VQ6A 4OWWB 2LY7A 2WP8J 2VUMH 2C9OA 2GVAA 1PRTB 2E2HB 2EIFA 2F3VA 2PW5A 4J1MA 5NUCA 1IBKQ 3PGZA 1G91A 1LTRD 4XQJA 2UXDQ 2IJ0A 3ONAB 3A8IE 4HCEA 4DNTB 3BYTB 4N8X1 4GZYC 1IXRA 2LMCB 3IFTA 1F2YA 1U4MA 2F1MA 4IPDA 3NQTA 1YI2A 2HDMA 1EFID 2UXCL 2N49A 1MHWC 1JE4A 1HXYD 3FMCA 2NVTB 4YY3L 1CZGA 1X6OA 1M90C 1VQMA 5AJ3Q 4JI4Q 3NBIA 1X9NA 1S3OA 4LAAA 1PMRA 5M5WH 4DUZQ 5IWAL 1WOCA 1K83B 1HA6A 5M3FH 4KK7A 3OMCA 3DWAA 3NPPA 5IOCA 3RLNA 2A6HD 4A93H 1PRTC 3MVVA 1I6HH 1E24A 1Y14B 3O13A 3QB3A 1EFWA 1WVLA 5LMNW 1VQHA 2K5HA 1FNUA 4R8IA 3H3VC 3M9BA 3RZDH 2H5XA 3SE0A 2F0EA 1CHPD 1EIYB 5TSSA 2CWAA 1PFNA 3TQYA 1H9MA 3T1YL 2BDOA 1K0RA 2CQAA 2NVYB 3CCVA 4LFBL 1HTLD 5IP7H 2R93B 3EQLC 4JI2Q 2J4XA 2CW0C 1HTPA 3OW2A 5T1GA 2MPMA 5M3MH 4A3KG 1SYFA 3R3OA 4DPGA 5JJZA 1YNXA 4JI3L 4JBMA 1G51A 4NXMQ 1SE4A 4JI1Q 2JXMB 2L15A 3T4AC 1UAPA 5KEEA 3J81L 1VDZA 1QILA 4DR4L 1WFQA 5ISRA 4IALA 2KCCA 4JOIC 4L6TB 1J5EL 1GUTA 2EYMA 1X54A 5E1FA 2AWOA 3S2DB 4GN3B 2NYZD 2Q8TA 2YYZA 2OWOA 1B2TA 2M9VA 4X66L 4IFDI 2MHVA 2NB0A 4A93G 5IGFA 5KGUA 2B2WC 5E4WC 2Z6BA 3ND9A 1BKBA 2KOLA 3VR6A 3K58A 4K2LA 2OF1A 4R8NA 1GUSA 3QOLA 4PMWA 3BVZA 4YCVA 2EXDA 4MTKA 1TS3A 2F3WA 3R2TA 1ICFB 2B63B 1N33L 4DR5Q 3H09A 2O2LD 1SNQA 1I50B 5JEAH 1YNJC 4G4KA 3DMUA 1ILPA 1Z9FA 3CQZB 2K5DA 4TSSA 5C4HA 1XMQL 1Y1WH 3R8BA 1KNAA 1TWAB 1WTRA 2VB3X 1HZBA 4IN3A 4JYAL 4K8IA 3S1QB 2NZ1D 3JAML 3HRZC 4RCOA 1SFOB 1OXTA 3RZOH 4K5XA 3A5ZB 2QCPX 3BDOA 4DAYB 4ME3A 3PIOA 1RCVD 2ICEC 3HOVB 5LHY1 3I4NB 1M4VA 2BA0A 4MHEA 1HR0Q 2K5WA 4FXKC 1SE3A 1U4LA 2KVMA 4ZUIA 2OCEA 2TSSA 4X66Q 1EEFD 2E2DC 2RHQB 3ERSX 2R7DA 4OL7A 5KIXA 2IX3A 2F0FA 3RLFA 2L9HA 4IUPA 1XPUA 4QQBX 3GV3A 4JI2L 2NVQB 2FJ2A 1BCPB 4JBJA 2EJGC 5JAVA 1JOOA 3FRPB 3A0JA 2CVRA 1AN8A 2FHTA 4HIKA 1JORA 4A3CG 4L8JA 4BY7G 4RCNA 4P74A 3GDEA 5IYCH 3CCEA 3KF6B 4QGUA 3ERQA 3PCOB 3IKJA 4POGA 5IY0A 3MXGA 5KNDA 1GUGA 1VQDA 3I4NG 3A8KE 4KY5A 3K5LA 2EYHA 4Y7NH 4IJLA 2VQEL 1N9WA 1W3SA 4LUZA 1AEXA 1LTTD 3T1YQ 4K0KQ 3CC2A 4C3IG 1DGSA 1XWEA 2JP1A 3DEPA 2XRSD 3ND8A 4A3JG 5EAYA 4DUZL 2R93G 3RN5A 1HFGA 1STEA 4JI4L 1D2BA 3K0XA 3OTOL 1D5ZC 1I94L 4HJ7A 3I4LA 1Y1VH 4HR7B 4ZKCB 3I4MB 1TS4A 3MFYA 1NE3A 1JJGA 1HRJA 1XTDA 1TWGB 3H15A 2CQOA 2F0JA 2IHEA 2WAQG 1VQGA 4P2CB 2UXDL 1D5XC 1B53A 2CFMA 5COYA 1CT1D 2F0UA 3MXNA 4A3JB 3HFZB 2CCZA 1O7LA 5T1IA 1F9QA 1EEID 1HUMA 1LT5D 3A74A 1M8AA 3WOFA 4KN4C 3GTMH 3D0FA 3IL8A 3FKIG 1PYSB 2Z1CA 3G71A 4IFDJ 5FLXE 4IFDH 2K14A 1STAA 5C44G 1UNSA 3MAQA 4LF5Q 1Y8NB 3K81C 3Q22A 4KKTA 4FF4A 4IQZA 5C4JH 3VR4A 1PLFA 1EIHA 4IJHA 2JA9A 5IYDH 3KFUA 1STNA 2RHSB 2RDGA 4A3MB 3OOCA 1DD2A 2KCTA 5ELNA 2UU9L 3AEVA 1LM0A 2EE1A 4DV0L 2DJGC 5C3EB 1X3PA 1FJGL 4XT1B 2RDHA 4PG3A 3S2HB 2N55A 5I9OA 3KUPA 4XYOA 2Z0SA 1KDCA 1G2TA 2JA7H 4HIDA 5EJWA 2FMCA 4B3TQ 2F0QA 4IZ8A 2YV5A 1BCPC 4L5QA 5G3LF 2PQAB 3AQQA 4J6HA 2ZM6Q 5C4ZA 3U58A 3F2DA 4X6AH 4DV7L 1D5MC 3QIAA 3GTLB 1GXDC 3FPPA 5C0XH 1U4RA 2AWNA 5CV6A 3NENA 4A3FG 1LLRD 2RCNA 2IWHA 5C4XB 4N9PA 5JPMC 2EOTA 2JE6I 4L5SA 2EVBA 1EYDA 1K28A 1KLUD 5JVG3 5JEAJ 3DXJC 2LXKA 4ZLTF 4QUFA 3CRLC 2Y0SB 2JA6G 3GTQH 5EPKA 2BA1A 1JC7A 3HZXA 5EKIA 3PUWA 4PQXA 1II3A 1SYCA 4OGQC 2WFWA 4X3TA 1GJXA 1NR4A 3HOWG 1YVCA 3I4MH 1ENAA 4F7XA 2IHFA 3HOUB 1Z6HA 1KXLA 2NTTA 3K59A 3I3CA 5CC4A 2EZVA 4A93B 1CTMA 1Q8KA 1LTGD 1LV9A 3GO5A 2AQ1B 2WV6D 4WFN3 1A8VA 2LKVA 4ILWA 1FVIA 1PZID 4N9TA 4FVMA 2IT1A 4ODGA 3DWPA 5FJ8H 3TS0A 2L5TA 4X65L 3E0JA 1DOKA 3NK9A 1I3QH 2KECA 2LS01 5FLXc 1EIGA 1E2WA 5A2QL 4YWLA 5BN4A 3ULJA 3K8AA 3UDGA 5I6YA 1STHA 4CBVA 1V1PB 4UHVA 3J80L 1YHQA 1QCBD 2EJMA 1GHJA 4IUUA 1KABA 3BZDB 1ENCA 1XTCD 5GAEC 4C3JG 1GUWA 2DN8A 2D0OA 3TN2A 5I6WA 5KNBA 3GTOH 3TS2A 2JQOA 4NP5A 3KBXA 2XNAC 1TWAH 2XSCA 4DR3L 4A3DG 3QO2A 2X6GA 3HOYG 1KNEA 4EQOA 3GTGB 3MWYW 3V2TA 2ASBA 1SYEA 2A6ED 1HHVA 4QB4A 3SEBA 5ELDA 2D0PA 5IYCG 3LNNA 1H95A 4LFAQ 2EYJA 4FF1A 4MIUA 1SNCA 4X64L 3GD7A 3LGJA 1X3FA 4DUYQ 1YZ6A 1K8OA 3J7AF 2F4IA 4I7ZC 2E2IB 4GN5A 4CKBA 1CM9A 3ER0A 4C2MH 1D6EC 1PA6A 3GTLH 5C44B 2P5ZX 3JAMc 3S2DH 1O7YA 1H9SA 3HOVG 4IUVA 3Q23A 4NW2A 2ALYB 5I2XA 1I4HA 3KF8A 2F4VQ 1F2LA 2OQ0A 3AFQA 1PTOC 4QCLA 1HFNA 4FF2A 1RL2A 2UUCL 2F0TA 1DXMA 1FGUA 1HCZA 5CR3A 1CKNA 1EY7A 2K32A 4IPGA 5C3EH 5EPLA 2N78A 3KDFA 3CCMA 1O78A 3D4WA 1OTCA 4OHJA 3ULLA 3CRKC 1ML0D 3BU2A 1PTOH 4DR7L 2R7ZH 3GTOB 3HOYB 2E2JH 2KJXA 3CHBD 3VR5A 4KN7C 3UDFA 3J81j 2HQEA 1G291 1HNWQ 1VMCA 1ENFA 1DONA 1GKHA 3MZ5A 4CJ1B 1F77A 4F87A 4A3EH 1WTQA 4YCUA 2A73B 3E0EA 3QR8A 3M85A 1EUJA 1WJJA 1S5FD 4A3MG 4CHTB 2NBFA 1PH4A 3GTJB 2PI2A 2K05A 2E2IH 3BDLA 2Q2UA 3S15H 1D7QA 4O0AA 2N88A 2GA4B 3GTPB 2AQ2B 1EQVA 1AW7A 2RKSA 1ZYRC 4GNXA 2GVBA 3S1RB 1R9TH 1QWYA 2F4VL 1JWSD 4X64Q 4MN3A 3TP8A 1B3QA 1VQ8A 4O1NA 2SOBA 1RIPA 1OXVA 1S5CD 1K8AC 2KHSA 5C4XH 1Y1VG 4E6IA 4DAYA 2JA8H 4QL5A 3F2CA 5IP9H 4NDXA 1HUNA 4QF4A 1FYCA 2M00A 5L37A 3MTSA 1E22A 4AYBB 1TVXA 3FDTA 1BR9A 3LX0A 2AKWB 2F0SA 3A7LA 1VQAA 4MZ9A 3EFXD 2R92G 4A3FH 3CC4A 4ZK9B 4RGTA 1KRSA 2IX1A 4A3JH 1HR0L 3I4MG 2NN6G 1X3QA 3STBC 5IT9c 4UDUC 3RMHA 1IL2A 4OO1H 1FNWA 3KDFB 2F0LA 2SEBD 4GKKQ 3M4OB 2B2VA 4DAMA 2J0TD 4CJ2C 1A3VA 2H1EA 1DM0B 4GOPC 1EWIA 5LMNL 4IOAA 1BO0A 1WCMB 1LT4D 3PO2H 1R4PB 1PFMA 4L63B 2ZTCA 1N36L 1S5DD 4UY8C 2L1BA 2MFIA 1MD2D 2NVQH 3JAMi 1BDOA 4MTNA 2F0IA 4A3FB 2G9HD 1N34Q 1LTAD 1S4ZA 1STGA 2A69C 1KAWA 3WDNA 1UWVA 1VQEA 1B9MA 4KHPL 2EPBA 3M7GA 4NXNQ 2IPKD 3ICEA 1BVSA 1WTHA 1N33Q 3NTIA 4G7HC 4OXPA 4HMIA 1XX8A 2EYFA 4AIMA 4KKUA 4Y7NB 1XMOL 2ZXPA 2RVLA 4EQPA 3HOUH 2XRQD 4ALPA 1Q82C 4C3IB 1K8MA 1U4PA 5JVH3 1YIJA 4R4IA 4DN4M 4JG2A 4GS3A 4HIMA 4J8QA 4C2MB 5DM63 1UEBA 4C3JH 2I5LX 1O7IA 5IP9G 1NY4A 5M3MB 3K5OA 1PVOA 3GTKB 2WB1G 1I50H 3S1NB 4ULLA 1CUKA 1SNPA 2VW9A 3H0GG 3J81i 4MNOA 3Q24A 2MNAA 1PFBA 5HURA 1L2FA 1BOSA 2K52A 1QVCA 1IHZA 5BN3A 1PZJD 4CKCA 1VF7A 2RCFA 2NVXB 4K14A 5IT9L 3I7FA 2ENBA 3G6JB 1SYGA 3H94A 3NWTA 4C1NK 4DV7Q 4LF6L 1AZQA 1ESRA 1MSGA 1H9SB 2AUJD 2I07B 4C3HH 2ZXRA 1HNXQ 3I56A 4LF4Q 5C0XI 2DY8A 2I46A 1HH2P 2JA6B 1E0BA 1CSPA 4RMFA 3DM3A 3SXHA 1CSQA 1MGSA 3CU7A 3GP7A 1F9RA 2K03A 4PMCA 4GOPB 1LABA 3S1MB 2XGTA 1PTOB 3J81c 4KI0A 1F9SA 3L3OC 2YU9H 2OTJA 5IYBH 5FLXL 1X3GA 4XDXA 5KNCA 5AJ3L 2I5HA 5ELCA 3V96A 1AP0A 3D6WA 1FD7D 4WJWA 1LT3D 4PNYA 3MXUA 2M2LA 1A6XA 1NAPA 2AMCB 2HDLA 3QOJA 3E6ZX 1Q81C 1SNOA 2PNHA 1XJVA 5CBAE 2BE5C 1ZEQX 1AFPA 2IW3A 4QJFA 3K7AB 3TRZA 3S16B 4LF5L 3I4NH 4P73A 3A54A 4JI8Q 4HCSA 4A3IB 1IYUA 2K28A 3A55A 4JBKA 1I4QA 5ELEA 3EJIA 5EKLA 1VQ7A 2WINB 1CKMA 3A8JE 3K6OA 1TY2A 4O2DA 1XNRQ 1EY0A 4LK1C 2K33A 1PH1A 3AMUA 1Q8IA 4IPHA 5CV9A 1JOQA 3OTOQ 2KBNA 1HQRD 3D4DA 5CBEE 2WB1B 3S16H 2Z6KA 1HZAA 2Y0SG 2A74C 3HKSA 2H4OA 1PYWD 2UXBL 3M4PA 3MEFA 5D3DA 2ZT9C 2PZUA 3SVMA 2B63H 4EX5A 4DNIA 2CKZB 1LTBD 3NUCA 3I73A 4IUQA 3HGBA 3DWQA 1EL0A 1GM5A 4LF6Q 2YTXA 5AFWA 4K0KL 5CORA 1EWHA 4KLKA 1S5ED 5IODA 3PO2B 1L1OA 2E75C 4XXEA 4UP9A 2B2TC 1XNQL 1I3QB 4A3BH 3HS0C 3T1HQ 4CDEC 2F0PA 3CAMA 3T16A 5BN5A 1I6HB 4KHZA 5DNFA 2R7FA 4DK6C 2D9UA 2K5VA 1HZCA 1C8CA 3N6RA 5EBDA 4HSPA 4NPSA 2BDNA 3EA6A 2WAQE 3EIVA 4XQNA 1O80A 1N32L 5FJ8G 2R3ZA 5EQ0A 2B2YA 1EZ6A 2QEJC 3QJYA 4FDBA 2B3GA 3PIP3 3KJOA 2HCCA 1XYIA 4A3BG 2DNCA 4JYAQ 2F0VA 3VYRA 3E5SA 4RWSC 2B8GA 3QWNA 1PYBA 2C35B 1STBA 2JA7G 4R9WA 1AH9A 4KMUC 3NP8A 1VCIA 1UE5A 3BDCA 3TZUA 2VUMG 3IAYA 3RUZA 3BJUA 1PFSA 2E2JB 3A7AB 4ZCKA 3X3MA 4BXXG 5IGDA 2KENA 5EBCA 4NXNL 4YHHQ 2N3SA 1CKOA 5C0XG 1OO9B 3KF8B 3J7AV 3UI2A 2Q8RE 2NZHA 2Q8IB 2R93H 1PH3A 2BOSA 1PV4A 4QY7A 3U4VA 1NR2A 3HP3A 4DR5L 2C5CA 3CCUA 3H6MA 2JA7B 2XWBB 3SK8A 4ZQ3A 1C48A 5LMNQ 4YIJA 1Z7TA 5C4JB 1SSOA 1J5EQ 3CXCA 2RF4A 4UP8A 2JSOA 2DJFC 4GKKL 3KLSX 4HAEA 5LL6X 5LMUQ 4B3MQ 1SEBD 4A3LH 4C3JB 4LFCL 4BBRH 1V43A 3S24A 3KOJA 2L4NA 5C0XJ 3PF5A 1YJNA 1SR3A 4JW0A 2R7ZB 2L55A 5C4XG 2ATWA 3PUVA 1Y69U 1EQRA 1LTLA 3H91A 2NWGA 3KJPA 4K5VA 4M1UB 1ET9A 2JN4A 2EYOA 4X3SA 5FO9B 4UP7A 2A1AA 4RKLA 4NXML 4NKLA 4CDCC 1SROA 1B8AA 1NJIC 4A3CH 3A5UA 4OO1I 1UEAB 1CK1A 5HGQA 1SN8A 5IGBA 2F03A 1XNQQ 1TQOA 1FNVA 1Q1EA 2ZTDA 4C1NI 3PSIA 3PO3G 5KYIA 3S15B 4EVOA 1CQFA 2A68D 1DOMA 1MKHA 4CJ0B 3C1FA 3NEMA 4J15A 1TWHB 5E3FA 1K83H 4FNFA 1Y8PB 1G2SA 1JT8A 1HR0W 1PH6A 4OELB 1WI5A 1VQCA 3EVQA 3HOZB 4XIGS 3PIPA 1C0AA 4H13C 1EY4A 4YY3Q 3FPUB 5EPJA 5GAHC 4HJ9A 1GO3E 2EY1A 1CQVA 1D1KA 3OWEB 3J80i 3W2DA 2A69D 2UXBQ 5IGCA 1D1IA 1TS2A 3NQIA 3PO3H 4PZ6A 2HD3A 1O7ZA 2A6EC 4CDFC 4ZYSA 1NSNS 1SMYC 3NELA 4AYBG 4IPCA 2Q2IA 2SNMA 4U68A 5CV4A 2K75A 2G5DA 4ZUJA 3S9WA 3S14H 3HOZH 3CW2C 1IKMA 1B9NA 1YBYA 3KF6A 4C56C 3M4OH 1HNWL 3E9IA 1FR3A 1PTOD 1NCVA 1YHAA 4P75A 2R6GA 3MHBA 1BNZA 4JI5Q 1EY5A 3FKIH 5JPNC 2JA6H 4AYBE 3P75A 2OT2A 2D2CC 1Q3LA 2PNRC 4IO9A 4AQYL 2A68C 1Q1BA 3RZDB 1X32A 2CH4W 4BBSH 4BBRB 4A3GH 1HPCA 1TT2A 4DAVA 1V1QA 4DUYL 4XT3B 3TZDA 4DV2Q 1ESFA 2PZTA 3PUZA 3P20A 1WD1A 4GLXA 3VA5A 4LFAL 1VQIA 3NBHA 3L2PA 1QZGA 4L5RC 1Y1VB 2UUAQ 2DGYA 1PXUA 4CGYB 1AE3A 2K6AA 2PCFB 3OW7A 3F2BA 1SLJA 3S1QH 2X69A 1VQ4A 1VQJA 5A35A 2CWPA 1IZ6A 4H02A 3CF5A 3CMAA 4DR3Q 1HNXL 3PUYA 3OPOA 3NE5B 3PV0A 2NVTH 3BYYB 1W6JA 1SJED 4O42A 4BXXH 4B9WA 4JI7L 4CDDC 1Q46A 1A2UA 2F0OA 1SBBB 1IBML 1BUVT 3S14B 5D65A 2RSOA 3D6CA 3HG9A 4DV1L 1TXYA 1EQQA 3BG3A 1SE8A 1UE6A 1AE2A 2ES2A 2L12A 2I5MX 4A3GG 1HQMC 4LWCA 4BY1H 2MUYA 4ME5A 1ZYRD 1LYLA 4EQ5A 4JV5L 1FL0A 5J39A 2OEOA 1U5KA 4IURA 4TVAB 4QUCA 5K36H 3RD4A 1K0SA 3ZYYX 4RAUC 3I90A 1TY0A 3RR5A 4DR6Q 4I65A 5FLMH 2F0WA 2KA7A 1J6QA 3D31A 1PH7A 3I55A 3HEJA 1WCMH 2X6LA 1K3RA 4YWMA 2ICIA 5CV7A 4BA2I 2YTYA 1X65A 1XMOQ 1EY6A 5D14A 4R4OA 3BVGA 2V4DA 3GTMB 1GD7A 3KLRA 5A2QE 3BZCA 2R92B 4BWGB 3EBEA 2E74C 1JWUD 4KHPQ 3I2ZA 3I72A 1W2BA 4A3LG 2Z8LA 5BR8L 2MGSA 4X3KA 1MSHA 1CHQD 3CMEA 4FXDA 3K7AH 4ZKBB 2JYOA 1JE5A 3HOXB 1VF5C 3HOXG 3HOWB 5C5MA 2LXJA 5K36G 2XN9C 2QEXA 3L7ZC 4DV1Q 3FEWX 2B2UA 2Z6KC 1N8RC 2KCMA 5DM73 3NSWA 1HZ9A 3I8ZA 1SFOH 5D3IB 5C44H 3Q0AA 2EXZA 1WTVA 4JC0A 1TR5A 4BY7B 1CA6A 3VYTA 1H9RA 2WB1E 4FO2A 3G6EA 4ID6A 1FGBD 5IYDG 3CCRA 4CKEA 4B3TL 1MIUA 3TREA 4F8MA 4I7AA 1QJOA 4UAIA 3TDQA 1LTSD 4K8JA 3VYUA 5I9PA 4DF7A 2UUAL 1QNUA 3GV6A 4IFDG 1I6VC 1KQSA 4HEDA 2HT1A 4DV3Q 4L5TA 3D4RA 3HOYH 1GVPA 4K6DA 4BA1I 3C3LA 3MXPA 3U9OA 5FO8B 4DV2L 4KKSA 1KTKA 4C3HB 1B7YB 2EY2A 1BBWA 5CGKA 4GNXB 1F9PA 1QUQB 3BZKA 2KUMA 4GKJL 3TEHB 4AQYQ 1A15A 2VB2X 4A3IH 2B2WA 4HMJA 1PZKD 2KEEA 4HTHA 2O4XA 4DK1A 3TP6A 5M5XH 1UE1A 1ONLA 1NUCA 4JK1C 2A5HA 4JI5L 2QW7A 3STBD 1X55A 1SRUA 3U4ZA 2HUGA 2QA4A 1Q90A 4U673 3GTPH 2LFNA 3D3RA 3N52A 3T56B 3T53B 1YHBA 2VY3A 2KQ3A 1IKLA 3K0YA 5C5LA 1Q12A 4A3EG 2O5JC 1CFMA 1DJRD 3RZOB 4LF8L 3LWEA 1EWCA 3EROA 3AFPA 3G7LA 1I4XA 2B63G 4R1JA 1RKNA 1MJCA 1JCKB 2UUCQ 2HIXA 2JA5H 4OX9L 4RH6A 3ZJYC 2RA4A 4OIKA 4DR2Q 1NMGA 4GN4B 1EQTA 4WRDA 1TKWB 1VQNA 4TKOB 2CW0D 4LJZC 3M3YB 4JI0L 4B9XA 2G9DA 4K6LA 4A3MH 5K5PA 4LNQA 5M3MG 5JOBA 2NUCA 3LWUA 2XTIA 5IT9E 3SGIA 1SJHD 4ABNA 4BY1B 5M5XB 3AU7A 2JA5B 3H0GB 4Z9CB 4HIOA 1CA5A 4A3IG 2JK8A 4R4TA 4LFCQ 1RHPA 4A3DH 3I91A 4OWTB 5LMUL 1TWHH 3GQBA 2R61A 5F2DA 3C2PA 1OXUA 1V9PA 2JA8B 1C4QA 1Q7YC 4NMZA 1EYCA 1TS5A 5CV8A 5CV5A 1SE2A 1B4OA 1L1OC 5IYBG 4IOCA 1OXSC 2B39A 4K2KA 1BCPD 1IW7D 2B2VC 4B3ML 3HOWH 4FF3A 1B3AA 4PZ8A 1XMQQ 2GN5A 1IBLQ 1YNJD 5LL6S 2NN6H 4LW1A 2MJ8A 1I4RA 1WCMG 2TMPA 4A75A 4ZAIA 1KLGD 3OMGA 4A3GB 4POFA 4LMQD 4Q5VA 3VR3A 3TP5A 1A3UA 5M3FG 2EJFC 1PH2A 4C3HG 1E1TA 1K3BC 4DXFA 1F2MA 1BF4A 4A3KB 1XPRA 3J7ZC 1IBLL 2VQFQ 2R7ZG 3RLOA 3V05A 2RSNA 1V1OA 3J7YW 1QOHA 2B2UC 2F0HA 3F1ZA 3JAME 1JJCB 2XVSA 4KJOA 1V1PA 4HN7A 1L0XB 2V1CC 5J1ZA 1DZ1A 4RA8A 2A19A 5KRUA 4BBSG 2PMZE 3VA7A 3Q8DA 3F8TA 2LSSA 5ELOA 5J3BA 1PH5A 2PQEA 2QF7A 4XYQA 4QMGA 5JJKA 1SMYD 3JC66 2WIIB 3HKZB 1F2ZA 3TP7A 4JI3Q 1IYJB 2RQXA 1YNND 1XXGA 1EY9A 3URYA 3S1MH 1JJ2A 1N32Q 5FLMG 4B3SQ 1GUOA 2E8GA 1K73C 1M1KC 4DFAA 1K8GA 1WYDA 1NMFA 5ELBA 1Z47A 1CZWA 1X56A 2UUBL 2ZM6L 3S1NH 2VUMB 1BCPF 4DR2L 1DCZA 3M4YA 4V0BA 1WTPA 4DK3C 3CP0A 3J81E 1LT6D 1I4GA 1KAAA 1A0IA 3GTJH 2IX0A 3OWFA 4OWXB 4F88A 3C1EA 5IIFA 4C3IH 4DV4L 2JJQA 4A3DB 4KD3A 2MP1A 1RODA 5M5WB 2D5DA 2SDFA 2EYLA 4DV0Q 1VS0A 2F0DA 2QGQA 2WACA 4HJ8A 3PIO3 2VZAA 2JEBI 1HJPA 5IGGA 5C6AA 4DV5L 1KD1C 1SNDA 5I2YA 1XNRL 4KD4A 3H3VH 5G3LD 3GTGH 5IWAQ 3UDIA 3I4OA 1EYAA 1Y8OB 2IL8A 1JMCA 3UE1A 3NXWA 2Z4IA 4LF9L 1NTGA 2YTVA 5M9OA 3PUXA 5GROA 1B70B 1TWFH 2KHJA 3T51B 3WWVA 5KYLA 4DXGA 4JVZA 4B08A 4QIWE 4DV5Q 1JB3A 4A76A 4M8AA 4WJ3M 4GOPA 4LF9Q 1JICA 1SDFA 4JI8L 2MO0A 1J9OA 2B2TA 1VQFA 4BS9A 4LUVA 2WKCA 3QG1A 4G57A 4DV4Q 5CMDA 3DHQA 2NN6I 4KTAA 1VQLA 3VDYA 2ZJPA 1I94Q 4RGMA 3H3VI 1TIID 3R2IA 2ZTEA 1ZKOA 1IW7C 1ET6A 3E9HA 3J80c 1C7YA 5FO7B 2EY5A 4LF7L 4IUTA 3A56A 4LF4L 3HOZG 3MA2B 1YNNC 1PRTD 1YITA 2L0CA 2Q2HA 4Q0FA 3WOEA 3R93A 2VQEQ 2B29A 2HQLA 2Y0SE 1I5FA 3CC7A 2BE5D 3W1BA 3AYHB 2I0QA 2R92H 3PO3B 1C9OA 1NBWA 1JB7A 2ID0A 3Q6SA 1E7ZA 3L9AX 3PF4A 2AHOB 4PZ7A 4A3EB 2HCIA 5IP7G 1OXXK 2UUBQ 1UE7A 3S17B 1ICWA 5GAGC 3T13A 1YJ9A 1GUNA 4JI6Q 4B3SL 2VL6A 3W1GA 5EKKA 5BR8Q 4DK0A 1TWFB 3K80C 1MJEA 1EU3A 1EY8A 4DAPA 1G6PA 1D8LA 3HOUG 5E7NA 1QG7A 1PTOF 2N8NA 4UPAA 2HHHQ 1TWCB 1BBUA 2KEDA 3CKIB 4XQQA 4V190 2F52A 1PH8A 3SK6A 1DOLA 2VQFL 1J8IA 2Z4HA 3OSOA 3U50C 5GQOA 4DV6Q 3CCJA 1ASYA 1ZXTA 4S3SA 2E5LL 3CD6A 2K04A 1Y1WG 3MC0B 3CCLA 1VQBA 2ZXOA 2K50A 4GLAC 1K9MC 2EDGA 3AB9A 2JA5G 5HY6A 2QDLA 2BH2A 2DUDA 3I70A 1QB5D 3FHWA 4QIWB 1T5XD 1S5BD 1N34L 3L0OA 4JV5Q 1SYBA 2Z9HA 3IFDA 5GADC 1W6KA 2VS1A 4LUOA 4GNXC 1PRTF 1N36Q 4OO1G 2O5IC 4KJNA 4DA2A 4GLVB 4H0LC 3BVMA 3K5MA 3TBIB 2OTLA 5J22A 2HIVA 3PO2G 1QVFA 2Q2TA 4K5WA 3M4QA 3G48A 2QDBA 3NTHA 3G4SA 1P16A 3SHLA 3NTKA 2WAQB 3S1RH 4RGOS 1R9TB 1E3PA 1QE6A 3RNUA 4OEMB 3PMFA 3DUZA 3HKZE 1S72A 3HOVH 1ASZA 1STYA 4DR1Q 2F0NA 1MI2A 4HSVA 4DR4Q 2KHIA 3S2HH 3W3AA 2FXQA 1E1OA 4WORA 4JI1L 4HJAA 2ZJRA 1WTWA 3OIPA 1LTID 4JI0Q 5H1SE 1X3EA 3FVQA 3VYSA 2NVXH 1QUQA 4IUNA 2CHBD 1VMPA 2PQAA 4PMBA 4BBRG 4RFBA 3DEOA 4A3BB 4XTCS 3CQZH 4OX9Q 1HNZL 1RJTA 4LFBQ 1VQKA 4A3KH 2PO4A 3MEHA 1PDQA 5FOBB 4RHRA 2PZWA 5M5YB 4R4CA 1RTNA 5E4XA 3SK5A 4YWKA 1H9JA 1RTOA 4FYDA 2B2YC 1JQYD 5I4DA 2K01A 3ITPA 3K7UC 1WD0A 4H7BA 3CPWA 4JPBW 4NB3A 1KRTA 4KY7A 1A3TA 1YJWA 4BY1G 4TQUS 1E2ZA 2EYPA 2VNUD 2F0MA 2QKIC 4X62L 4LF8Q 4DR7Q 4P71A 3D8GA 4YCWA 3U9SA 2CH4A 4N8FA 1TWGH 4A4IA 5C3XA 3M7NA 2UXCQ 1WTXA 3ULPA 1U0LA 2MO1A 3KK7A 5CYUA 3W5OA 4GKJQ 4EQNA 1KDAA 1B50A 2JA8G 3J80E 1Q86C 4G7OC 4X62Q 1PH9A 1U9RA 4X3UA 1JOKA 2YU9B 1SMXA 2F3IA 4JCVE 3FP9A 1IBKL 4OIJA 2NZOA 3MFGA 4JOIA 4PV1C 4KHVA 3BS1A 3MXNB 5EGTA 4RHSA 4DU9A 1HNZQ 3UE0A 4DNRB 2XWJB 2ZJQA 1EZ8A 5C3EG 1GHKA 1QNKA 2K7VA 2RBMA 3NWSA 5M5YH 4JBWA 1B44D 4R4QA 5JJLA 4DV3L 1H9KA 2E76C 2F0KA 2EY6A 5ELFA 1EIFA 4B3RL 1A62A 5HGTA 1L1OB 3B6YA 4EGVA 1EOVA 1SNMA 5FK9C 1R4QB 1B1ZA 1IYVA 2FMMA 2NTSA 1P8LA 2PMZB 1QVGA 3J7A5 1QZHA 2FINB 1IL8A 2OQKA 3OYYA 1V8QA 1LACA 3DLLA 1JR0D 4TRDA 5C3WA 4RGNA 1SAPA 3NHHA 2OXPA 3M3YH 1JWMD 4Y52H 1A63A 4H44C 3K57A 4DR1L 2MQHA 3IRBA 2J7ZA 3OHXC 4OONA 3OIQA 1G8ZD 3DM1A 5FKAC 1LUZA 2AUKA 1VQOA 1EYGA 2E2HH 1CKNB 2PPBC 2K5NA 5IGEA 2SNSA 1YEZA 4X65Q 2XIWA 3K5NA 2A8VA 4RKBA 4BBSB 1VQ9A 2BH8A 3NBHB 4WJ4A 4YHHL 1KDBA 2D62A 1WTOA 3CCSA 2K1BA 3EN2A 2DY7A 2FFKB 1VQPA 4DV6L 1DYQA 3UDXA 1EU4A 5DAUA 3KYHC 2QILA 1AZPA 1S40A 1TWCH 3KLWA 2L11A 3P1HA 2WKDA 1TU2B 5JEAG 1G6ZA 4KY6A 2HHHL 1ILQA 2NVYH 2VXWA 4FXGC 4DR6L 5DLQE 4RG1A 2E5LQ 3RN2A 2F0GA 3H0GH 3CCQA 1L0WA 5IE8A 1SYDA 1T9HA 4AH6A 3F2UA 2BCOA 1PHJA 4JI7Q 4DKAC 2EQSA 2K4KA 1BXTA 1KIXA 3P7JA 2JEAI 1I4PA 3T1HL 4G7ZC 1EOTA 1LO5D 3SR1A 1MBYA 3CPFA 1T5EA 3GTQB 1HA5A 3HOXH 2B8FA 1IBMQ 4JI6L 3E3XA 2K5QA 3TMEA 4APVA 2DNEA 2PYKA 3GTKH 1E2VA 1L0YB 2AQ3B 1CI3M 2KCNA 1FJGQ 1RD9D 4LF7Q 3PQIA 5DEHA 3TSSA 2PW7A 2UU9Q 5M3FB 3S17H 2RDFA 4ZRZA 3X3NA 4BY7H 3SDZA 1KL9A 1RDPD 1GOZA 1XPOA 1BBXC 4DGZA 2A6HC 3HKZG 1VQ5A 5JJIA 4B3RQ 1KC8C 3FKIB 1NNXA
chains in the Genus database with same CATH topology
1UUPA 1RF2D 3SK4A 4FP5D 4KV6A 3KBGA 1A2TA 3C46A 1Y1WB 3KLSA 1SXTA 1BQQT 3VR2A 2LY7A 2WP8J 2C9OA 1PRTB 2E2HB 2F3VA 2PW5A 4J1MA 5NUCA 1G91A 1LTRD 4XQJA 2IJ0A 3ONAB 3A8IE 4HCEA 4DNTB 3BYTB 4GZYC 2LMCB 3IFTA 1F2YA 1U4MA 2F1MA 3NQTA 2HDMA 1EFID 1JE4A 1HXYD 3FMCA 2NVTB 1CZGA 3NBIA 4LAAA 1PMRA 1K83B 1HA6A 4KK7A 3OMCA 3DWAA 3NPPA 5IOCA 2A6HD 1PRTC 3MVVA 3O13A 3QB3A 1WVLA 1FNUA 4R8IA 3H3VC 3SE0A 2F0EA 1CHPD 5TSSA 1PFNA 1H9MA 2BDOA 2CQAA 2NVYB 1HTLD 2R93B 3EQLC 2J4XA 2CW0C 1HTPA 5T1GA 2MPMA 1SYFA 3R3OA 5JJZA 1SE4A 2JXMB 3T4AC 1UAPA 5KEEA 3J81L 1VDZA 1QILA 5ISRA 4IALA 2KCCA 4L6TB 1GUTA 2EYMA 5E1FA 2AWOA 3S2DB 2NYZD 2Q8TA 2YYZA 1B2TA 2M9VA 4IFDI 2MHVA 2NB0A 5IGFA 5KGUA 2B2WC 5E4WC 3ND9A 2KOLA 3VR6A 3K58A 4K2LA 2OF1A 4R8NA 1GUSA 3QOLA 4PMWA 3BVZA 1TS3A 2F3WA 3R2TA 2B63B 3H09A 2O2LD 1SNQA 5JEAH 1I50B 1YNJC 4G4KA 3DMUA 1ILPA 3CQZB 2K5DA 4TSSA 5C4HA 3R8BA 1KNAA 1TWAB 1WTRA 2VB3X 4IN3A 4K8IA 3S1QB 2NZ1D 3JAML 3HRZC 4RCOA 1SFOB 1OXTA 4K5XA 2QCPX 3BDOA 1RCVD 2ICEC 3HOVB 5LHY1 3I4NB 1M4VA 2BA0A 4MHEA 2K5WA 4FXKC 1SE3A 1U4LA 2KVMA 4ZUIA 2TSSA 1EEFD 2E2DC 5KIXA 4OL7A 2IX3A 2F0FA 3RLFA 2L9HA 4IUPA 3GV3A 2NVQB 2FJ2A 1BCPB 2EJGC 5JAVA 1JOOA 3FRPB 2CVRA 1AN8A 2FHTA 1JORA 4L8JA 4RCNA 3ERQA 3IKJA 5KNDA 3MXGA 1GUGA 3A8KE 4KY5A 3K5LA 2EYHA 1AEXA 1LTTD 4C3IG 1XWEA 2JP1A 3DEPA 2XRSD 3ND8A 1HFGA 1STEA 1D2BA 1D5ZC 3I4LA 4HR7B 4ZKCB 3I4MB 1TS4A 3MFYA 1HRJA 1TWGB 2F0JA 4P2CB 1D5XC 1B53A 5COYA 1CT1D 2F0UA 3MXNA 4A3JB 1O7LA 5T1IA 1F9QA 1EEID 1HUMA 1LT5D 1M8AA 3WOFA 4KN4C 3IL8A 2Z1CA 4IFDJ 5FLXE 4IFDH 1STAA 1UNSA 3MAQA 1Y8NB 3Q22A 4KKTA 4FF4A 4IQZA 3VR4A 1PLFA 1EIHA 1STNA 2RDGA 4A3MB 3OOCA 1DD2A 2EE1A 5C3EB 1X3PA 4XT1B 2RDHA 3S2HB 2N55A 5I9OA 3KUPA 4XYOA 1KDCA 1G2TA 5EJWA 2FMCA 2F0QA 4IZ8A 1BCPC 5G3LF 4J6HA 5C4ZA 1D5MC 3QIAA 3GTLB 1GXDC 3FPPA 5C0XH 1U4RA 2AWNA 5CV6A 1LLRD 2IWHA 5C4XB 4N9PA 5JPMC 2EOTA 2JE6I 2EVBA 1EYDA 1KLUD 5JVG3 4ZLTF 5JEAJ 3DXJC 4QUFA 3CRLC 2Y0SB 5EPKA 2BA1A 1JC7A 3HZXA 5EKIA 3PUWA 4PQXA 1II3A 1SYCA 4OGQC 4X3TA 1GJXA 1NR4A 1ENAA 4F7XA 3HOUB 1Z6HA 2NTTA 3K59A 3I3CA 5CC4A 2EZVA 4A93B 1CTMA 1LTGD 1LV9A 3GO5A 2AQ1B 2WV6D 4WFN3 4ILWA 2LKVA 1PZID 4N9TA 4FVMA 2IT1A 4ODGA 3DWPA 2L5TA 3E0JA 1DOKA 3NK9A 2KECA 2LS01 1EIGA 5A2QL 1E2WA 5BN4A 5I6YA 1STHA 4CBVA 1V1PB 3J80L 1QCBD 2EJMA 1GHJA 4IUUA 1KABA 3BZDB 1ENCA 1XTCD 4C3JG 1GUWA 2DN8A 3TN2A 5I6WA 5KNBA 4NP5A 3KBXA 2XNAC 2XSCA 3QO2A 2X6GA 1KNEA 4EQOA 3GTGB 3MWYW 3V2TA 1SYEA 2A6ED 1HHVA 4QB4A 3SEBA 5ELDA 3LNNA 2EYJA 4FF1A 4MIUA 1SNCA 3GD7A 1K8OA 3J7AF 2F4IA 4I7ZC 2E2IB 4CKBA 1CM9A 1D6EC 5C44B 1O7YA 1H9SA 4IUVA 3Q23A 4NW2A 5I2XA 1I4HA 3KF8A 1F2LA 1PTOC 4QCLA 1HFNA 4FF2A 2F0TA 1DXMA 1HCZA 5CR3A 1EY7A 2K32A 5EPLA 1O78A 3D4WA 4OHJA 3CRKC 1ML0D 1PTOH 3GTOB 3HOYB 2KJXA 3CHBD 3VR5A 4KN7C 2HQEA 1G291 1VMCA 1ENFA 1DONA 3MZ5A 4CJ1B 1F77A 4F87A 1WTQA 2A73B 3M85A 1S5FD 4CHTB 2NBFA 3GTJB 2K05A 3BDLA 2N88A 2GA4B 3GTPB 2AQ2B 1EQVA 1AW7A 2RKSA 1ZYRC 3S1RB 1QWYA 1JWSD 4MN3A 3TP8A 4O1NA 2SOBA 1OXVA 1S5CD 2KHSA 4E6IA 4DAYA 4NDXA 1HUNA 4QF4A 1FYCA 2M00A 3MTSA 4AYBB 1TVXA 3FDTA 1BR9A 3LX0A 2F0SA 3A7LA 3EFXD 4ZK9B 4RGTA 2IX1A 2NN6G 1X3QA 4UDUC 3RMHA 4OO1H 1FNWA 2F0LA 2SEBD 3M4OB 2B2VA 2J0TD 4CJ2C 1A3VA 2H1EA 1DM0B 1BO0A 1WCMB 1LT4D 1R4PB 1PFMA 4L63B 1S5DD 2L1BA 1MD2D 1BDOA 2F0IA 4A3FB 2G9HD 1LTAD 1S4ZA 1STGA 2A69C 3WDNA 1B9MA 2EPBA 3M7GA 2IPKD 3NTIA 4G7HC 4HMIA 1XX8A 2EYFA 4KKUA 4Y7NB 2ZXPA 2RVLA 4EQPA 2XRQD 4C3IB 1K8MA 1U4PA 5JVH3 4DN4M 4J8QA 4C2MB 5DM63 5M3MB 3K5OA 3GTKB 3S1NB 4ULLA 1SNPA 3Q24A 1PFBA 5HURA 1BOSA 5BN3A 1IHZA 1PZJD 4CKCA 1VF7A 2NVXB 4K14A 5IT9L 2ENBA 3G6JB 1SYGA 3H94A 3NWTA 4C1NK 1AZQA 1ESRA 1MSGA 1H9SB 2AUJD 2I07B 2ZXRA 5C0XI 2DY8A 2I46A 2JA6B 1E0BA 3SXHA 1MGSA 3CU7A 3GP7A 1F9RA 2K03A 4PMCA 1LABA 3S1MB 1PTOB 4KI0A 1F9SA 3L3OC 5FLXL 4XDXA 5KNCA 5ELCA 3V96A 1AP0A 3D6WA 1FD7D 4WJWA 1LT3D 4PNYA 3MXUA 2M2LA 1A6XA 1NAPA 2HDLA 3QOJA 3E6ZX 1SNOA 5CBAE 2BE5C 1ZEQX 1AFPA 2IW3A 3K7AB 3S16B 3A54A 4HCSA 4A3IB 1IYUA 2K28A 3A55A 1I4QA 5ELEA 3EJIA 5EKLA 2WINB 3A8JE 3K6OA 1TY2A 1EY0A 4LK1C 2K33A 3AMUA 1Q8IA 5CV9A 1JOQA 1HQRD 3D4DA 5CBEE 2WB1B 2A74C 2H4OA 1PYWD 5D3DA 2ZT9C 2PZUA 3SVMA 1LTBD 3NUCA 3I73A 4IUQA 3HGBA 3DWQA 1EL0A 5AFWA 5CORA 1EWHA 1S5ED 5IODA 3PO2B 2E75C 4XXEA 2B2TC 1I3QB 3HS0C 2F0PA 3T16A 5BN5A 1I6HB 4KHZA 5DNFA 2D9UA 1C8CA 3N6RA 5EBDA 4HSPA 2BDNA 3EA6A 4XQNA 1O80A 2R3ZA 5EQ0A 2B2YA 1EZ6A 2QEJC 3QJYA 3PIP3 2HCCA 1XYIA 2DNCA 2F0VA 3VYRA 3E5SA 4RWSC 2B8GA 3QWNA 1STBA 4R9WA 4KMUC 3NP8A 1VCIA 3BDCA 3TZUA 3IAYA 3RUZA 2E2JB 3A7AB 3X3MA 5IGDA 5EBCA 5C0XG 1OO9B 3J7AV 3UI2A 2Q8RE 2Q8IB 2BOSA 1NR2A 3HP3A 2C5CA 3H6MA 2JA7B 2XWBB 3SK8A 4ZQ3A 1C48A 4YIJA 1Z7TA 5C4JB 1SSOA 2JSOA 3KLSX 4HAEA 5LL6X 1SEBD 4C3JB 1V43A 2L4NA 5C0XJ 2R7ZB 2L55A 3PUVA 1Y69U 3H91A 2NWGA 4K5VA 4M1UB 1ET9A 2EYOA 4X3SA 5FO9B 4RKLA 4NKLA 4OO1I 1UEAB 1CK1A 2F03A 5IGBA 1TQOA 1FNVA 1Q1EA 4C1NI 5KYIA 3S15B 4EVOA 1DOMA 2A68D 1CQFA 4CJ0B 3C1FA 1TWHB 5E3FA 4FNFA 1Y8PB 1G2SA 3EVQA 3HOZB 4XIGS 4H13C 1EY4A 3FPUB 5EPJA 2EY1A 1CQVA 1D1KA 3OWEB 3W2DA 2A69D 5IGCA 1D1IA 1TS2A 3NQIA 1O7ZA 2A6EC 4ZYSA 1NSNS 1SMYC 2SNMA 4U68A 5CV4A 4ZUJA 3S9WA 1IKMA 1B9NA 4C56C 1FR3A 1PTOD 1NCVA 2R6GA 3MHBA 1BNZA 1EY5A 5JPNC 3P75A 2OT2A 2D2CC 1Q3LA 2PNRC 2A68C 1Q1BA 3RZDB 1X32A 4BBRB 1HPCA 1TT2A 4DAVA 4XT3B 3TZDA 1ESFA 2PZTA 3PUZA 3P20A 1WD1A 3VA5A 3NBHA 1Y1VB 1PXUA 4CGYB 2K6AA 2PCFB 3OW7A 2X69A 5A35A 3PUYA 3OPOA 3NE5B 3PV0A 3BYYB 1W6JA 1SJED 4O42A 4B9WA 1A2UA 2F0OA 1SBBB 1BUVT 3S14B 5D65A 2RSOA 3D6CA 3HG9A 3BG3A 2L12A 1HQMC 2MUYA 1ZYRD 4ME5A 5J39A 2OEOA 4IURA 4QUCA 5K36H 3RD4A 3ZYYX 4RAUC 3I90A 1TY0A 4I65A 2F0WA 2KA7A 3D31A 3HEJA 2X6LA 2ICIA 5CV7A 4BA2I 1EY6A 5D14A 3BVGA 2V4DA 3GTMB 3KLRA 5A2QE 2R92B 4BWGB 2E74C 1JWUD 3I72A 2Z8LA 2MGSA 4X3KA 1MSHA 1CHQD 4FXDA 4ZKBB 2JYOA 3HOXB 1VF5C 3HOWB 5C5MA 5K36G 2XN9C 3L7ZC 3FEWX 2B2UA 5DM73 3NSWA 3I8ZA 3Q0AA 5D3IB 2EXZA 1WTVA 1TR5A 4BY7B 1CA6A 3VYTA 1H9RA 4FO2A 4ID6A 1FGBD 4CKEA 4F8MA 1QJOA 4UAIA 3TDQA 1LTSD 4K8JA 3VYUA 5I9PA 4DF7A 1QNUA 3GV6A 4IFDG 1I6VC 4HEDA 3D4RA 4K6DA 4BA1I 3C3LA 3MXPA 3U9OA 5FO8B 4KKSA 1KTKA 4C3HB 2EY2A 5CGKA 1F9PA 2KUMA 1A15A 2VB2X 2B2WA 4HMJA 1PZKD 2KEEA 4HTHA 2O4XA 4DK1A 3TP6A 1ONLA 1NUCA 4JK1C 2A5HA 2HUGA 1Q90A 4U673 2LFNA 3D3RA 3N52A 3T56B 3T53B 2KQ3A 1IKLA 3K0YA 5C5LA 1Q12A 2O5JC 1CFMA 1DJRD 3RZOB 3LWEA 1EWCA 3EROA 3G7LA 1I4XA 1RKNA 1JCKB 4RH6A 2RA4A 4OIKA 1EQTA 4WRDA 1TKWB 4TKOB 2CW0D 4LJZC 3M3YB 4B9XA 2G9DA 4K6LA 5K5PA 5JOBA 2NUCA 3LWUA 5IT9E 1SJHD 4ABNA 4BY1B 5M5XB 3AU7A 2JA5B 3H0GB 4Z9CB 1CA5A 1RHPA 3I91A 3GQBA 2R61A 5F2DA 3C2PA 1OXUA 2JA8B 1C4QA 4NMZA 1EYCA 1TS5A 5CV8A 5CV5A 1SE2A 1B4OA 1OXSC 2B39A 4K2KA 1BCPD 1IW7D 2B2VC 4FF3A 1B3AA 1YNJD 5LL6S 2NN6H 2MJ8A 1I4RA 2TMPA 4ZAIA 1KLGD 3OMGA 4A3GB 4LMQD 4Q5VA 3VR3A 3TP5A 1A3UA 2EJFC 4C3HG 4DXFA 1F2MA 1BF4A 4A3KB 3V05A 2RSNA 1V1OA 3J7YW 1QOHA 2B2UC 2F0HA 3JAME 2XVSA 4KJOA 1V1PA 4HN7A 1L0XB 5J1ZA 1DZ1A 4RA8A 5KRUA 3VA7A 2PQEA 2QF7A 4XYQA 4QMGA 1SMYD 2WIIB 3HKZB 1F2ZA 3TP7A 2RQXA 1YNND 1XXGA 1EY9A 3URYA 1GUOA 4DFAA 5ELBA 1Z47A 1CZWA 2VUMB 1BCPF 1DCZA 3M4YA 4V0BA 1WTPA 3J81E 1LT6D 1I4GA 1KAAA 2IX0A 3OWFA 4F88A 3C1EA 5IIFA 4A3DB 4KD3A 2MP1A 1RODA 5M5WB 2D5DA 2SDFA 2EYLA 2F0DA 2WACA 3PIO3 2JEBI 5IGGA 5C6AA 1SNDA 5I2YA 4KD4A 5G3LD 1EYAA 1Y8OB 2IL8A 3NXWA 2Z4IA 5M9OA 3PUXA 3T51B 5KYLA 4DXGA 4B08A 1JB3A 4M8AA 1JICA 1SDFA 1J9OA 2B2TA 4BS9A 2WKCA 3QG1A 4G57A 5CMDA 3DHQA 2NN6I 4KTAA 4RGMA 1TIID 3R2IA 1ZKOA 1IW7C 1ET6A 5FO7B 2EY5A 4IUTA 3A56A 3MA2B 1YNNC 1PRTD 2L0CA 4Q0FA 3WOEA 3R93A 2BE5D 3PO3B 2ID0A 3Q6SA 3L9AX 4A3EB 2HCIA 1OXXK 3S17B 1ICWA 3T13A 1GUNA 5EKKA 4DK0A 1TWFB 1EU3A 1EY8A 4DAPA 1QG7A 1PTOF 1TWCB 2KEDA 3CKIB 4XQQA 4V190 3SK6A 1DOLA 1J8IA 2Z4HA 3OSOA 1ZXTA 4S3SA 2K04A 3MC0B 2ZXOA 2EDGA 3AB9A 3I70A 1QB5D 4QIWB 1T5XD 1S5BD 1SYBA 3IFDA 1W6KA 1PRTF 4OO1G 2O5IC 4KJNA 4DA2A 4H0LC 3BVMA 3K5MA 3TBIB 5J22A 4K5WA 2QDBA 3NTHA 3SHLA 3NTKA 2WAQB 1R9TB 4RGOS 1QE6A 3PMFA 3DUZA 1STYA 2F0NA 1MI2A 4HSVA 3W3AA 4WORA 1WTWA 3OIPA 1LTID 3FVQA 3VYSA 4IUNA 2CHBD 1VMPA 4PMBA 4RFBA 3DEOA 4A3BB 4XTCS 1RJTA 2PO4A 3MEHA 1PDQA 5FOBB 4RHRA 2PZWA 5M5YB 3SK5A 1RTNA 5E4XA 1H9JA 1RTOA 4FYDA 2B2YC 1JQYD 5I4DA 2K01A 3ITPA 1WD0A 4H7BA 4KY7A 1A3TA 4TQUS 1E2ZA 2EYPA 2VNUD 2F0MA 2QKIC 3D8GA 3U9SA 5C3XA 3M7NA 1WTXA 3KK7A 5CYUA 4EQNA 1KDAA 1B50A 3J80E 4G7OC 1U9RA 4X3UA 1JOKA 2YU9B 4OIJA 3MFGA 4PV1C 4KHVA 3BS1A 5EGTA 4RHSA 4DU9A 4DNRB 2XWJB 1EZ8A 1GHKA 1QNKA 2K7VA 2RBMA 3NWSA 4JBWA 1B44D 1H9KA 2E76C 2F0KA 2EY6A 5ELFA 5HGTA 4EGVA 1SNMA 5FK9C 1R4QB 1B1ZA 1IYVA 2FMMA 2NTSA 2PMZB 2FINB 1IL8A 1V8QA 1LACA 1JR0D 4TRDA 5C3WA 4RGNA 1SAPA 3NHHA 2OXPA 1JWMD 4H44C 3K57A 2J7ZA 3OHXC 3OIQA 1G8ZD 3DM1A 5FKAC 2AUKA 2PPBC 5IGEA 2SNSA 2XIWA 3K5NA 4RKBA 4BBSB 1KDBA 2D62A 1WTOA 2K1BA 2DY7A 2FFKB 1DYQA 1EU4A 5DAUA 2QILA 1AZPA 2L11A 3P1HA 2WKDA 1TU2B 5JEAG 1G6ZA 4KY6A 1ILQA 2VXWA 4FXGC 2F0GA 1SYDA 3F2UA 2BCOA 1BXTA 3P7JA 2JEAI 1I4PA 4G7ZC 1EOTA 1LO5D 3SR1A 1MBYA 1T5EA 3GTQB 1HA5A 2B8FA 2K5QA 3TMEA 2DNEA 2PYKA 1E2VA 1L0YB 2AQ3B 1CI3M 2KCNA 1RD9D 5DEHA 3TSSA 2PW7A 5M3FB 2RDFA 4ZRZA 3X3NA 3SDZA 1RDPD 1GOZA 1BBXC 4DGZA 2A6HC 3FKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1F A;  4KD3 A;  2F0L A;  3MEH A;  5CV6 A;  5ISR A;  4IAL A;  3SK4 A;  4KV6 A;  5F2D A;  1A3V A;  5E3F A;  1EY8 A;  1A2T A;  3D6C A;  2PZW A;  2EYL A;  2EYM A;  4K6D A;  3SK5 A;  5E1F A;  1EZ6 A;  3MXP A;  4N9P A;  3U9O A;  2F0D A;  4NMZ A;  2WAC A;  1EYC A;  3EVQ A;  2EY2 A;  5CV5 A;  1EYD A;  5CV8 A;  5CGK A;  5IGF A;  3ITP A;  1EY4 A;  2F0V A;  4PNY A;  4ME5 A;  5IGG A;  5KGU A;  3E5S A;  4H7B A;  2EY1 A;  5C6A A;  4K2K A;  3SK6 A;  1SND A;  5IGE A;  2F0T A;  1STB A;  2F0I A;  2F3V A;  2SNS A;  3HZX A;  5CR3 A;  5J39 A;  2OEO A;  1EY7 A;  1II3 A;  1SYC A;  2PW5 A;  3NP8 A;  4HMJ A;  2OF1 A;  3QOJ A;  4HTH A;  4J1M A;  4K2L A;  4KD4 A;  3BDC A;  1A3T A;  2O4X A;  1SNO A;  1STG A;  3QOL A;  4KY7 A;  1ENA A;  5NUC A;  3OSO A;  4RKB A;  3TP6 A;  4F7X A;  3D4W A;  2EYP A;  1EYA A;  1NSN S;  2F0J A;  2F0M A;  4S3S A;  1KDB A;  2F3W A;  3OMG A;  3RUZ A;  5CC4 A;  1NUC A;  1A3U A;  3NXW A;  3TP5 A;  2SNM A;  4I65 A;  2LKV A;  5IGD A;  5CV4 A;  3D8G A;  2F0W A;  1SNQ A;  4N9T A;  5M9O A;  4HMI A;  2F0U A;  3EJI A;  3HEJ A;  3DMU A;  4ODG A;  2EYF A;  5EKL A;  4EQP A;  1F2M A;  1F2Y A;  4ZUJ A;  5C3X A;  5C4H A;  3S9W A;  2HQE A;  5KYL A;  5DAU A;  3NQT A;  1EY0 A;  5CV7 A;  3MZ5 A;  3NK9 A;  2KQ3 A;  1EY6 A;  1SYB A;  3P1H A;  2F0H A;  5CV9 A;  1JOQ A;  4K8I A;  4KY6 A;  1KDA A;  5C5L A;  4EQN A;  3MHB A;  4KJO A;  5KEE A;  1EY5 A;  3H6M A;  4KJN A;  3D4D A;  3SK8 A;  4ZQ3 A;  1STA A;  4LAA A;  1U9R A;  5I6Y A;  1STH A;  4K5X A;  5J1Z A;  1JOK A;  2F0G A;  3ERO A;  4YIJ A;  5KRU A;  4R8N A;  5J22 A;  3P75 A;  1KAB A;  1RKN A;  1SYD A;  3BDL A;  1ENC A;  4G57 A;  4K5W A;  3OMC A;  2QDB A;  4KHV A;  3DHQ A;  4KTA A;  5KYI A;  5IOC A;  5EGT A;  2PQE A;  2PZU A;  3SHL A;  4DU9 A;  1STN A;  5I6W A;  1SNP A;  1EQV A;  2RKS A;  3MVV A;  1TT2 A;  4QMG A;  4ZUI A;  5HUR A;  4EVO A;  3QB3 A;  1F2Z A;  4NP5 A;  3TP7 A;  5C5M A;  1EZ8 A;  5KIX A;  3PMF A;  4OL7 A;  3NUC A;  2RBM A;  2EY5 A;  1IHZ A;  2F0F A;  2PZT A;  4WRD A;  4EQO A;  3TP8 A;  3SR1 A;  1STY A;  3V2T A;  2F0N A;  3VA5 A;  1EY9 A;  1SYE A;  4K14 A;  2F0K A;  2EY6 A;  2SOB A;  5I9O A;  4K5V A;  5IGC A;  2F0E A;  2ENB A;  4B9X A;  1SYG A;  5JAV A;  5K5P A;  2KHS A;  1JOO A;  2EXZ A;  2EYO A;  4QB4 A;  4WOR A;  5JOB A;  1KDC A;  2NUC A;  4E6I A;  5HGT A;  5IOD A;  3TME A;  4DFA A;  1TR5 A;  1JOR A;  4NDX A;  2PYK A;  1SNM A;  4RKL A;  4NKL A;  4QF4 A;  2EYJ A;  2M00 A;  4MIU A;  4IUN A;  1SNC A;  3ERQ A;  2F0Q A;  4IZ8 A;  4PMB A;  4ID6 A;  2F0P A;  5DEH A;  3LX0 A;  3T16 A;  2F0S A;  1SYF A;  2PW7 A;  3R3O A;  5IGB A;  4J6H A;  4F8M A;  2RDF A;  5C4Z A;  4KY5 A;  1KAA A;  1TQO A;  2EYH A;  3SXH A;  4TRD A;  3T13 A;  4B9W A;  3NHH A;  5C3W A;  3OWF A;  4K8J A;  2OXP A;  3C1E A;  1AEX A;  4DGZ A;  1A2U A;  2F0O A;  4DF7 A;  5I9P A;  5IIF A;  4PMC A;  5EKK A; 
#chains in the Genus database with same CATH topology
 1UUP A;  1RF2 D;  3SK4 A;  4FP5 D;  4KV6 A;  3KBG A;  1A2T A;  1KHI A;  2PI2 E;  1Y1W B;  3C46 A;  4P72 A;  2IY5 B;  3KLS A;  4HJ5 A;  1SXT A;  1BQQ T;  3VR2 A;  1VQ6 A;  4OWW B;  2LY7 A;  2WP8 J;  2VUM H;  2C9O A;  2GVA A;  1PRT B;  2E2H B;  2EIF A;  2F3V A;  2PW5 A;  4J1M A;  5NUC A;  1IBK Q;  3PGZ A;  1G91 A;  1LTR D;  4XQJ A;  2UXD Q;  2IJ0 A;  3ONA B;  3A8I E;  4HCE A;  4DNT B;  3BYT B;  4N8X 1;  4GZY C;  1IXR A;  2LMC B;  3IFT A;  1F2Y A;  1U4M A;  2F1M A;  4IPD A;  3NQT A;  1YI2 A;  2HDM A;  1EFI D;  2UXC L;  2N49 A;  1MHW C;  1JE4 A;  1HXY D;  3FMC A;  2NVT B;  4YY3 L;  1CZG A;  1X6O A;  1M90 C;  1VQM A;  5AJ3 Q;  4JI4 Q;  3NBI A;  1X9N A;  1S3O A;  4LAA A;  1PMR A;  5M5W H;  4DUZ Q;  5IWA L;  1WOC A;  1K83 B;  1HA6 A;  5M3F H;  4KK7 A;  3OMC A;  3DWA A;  3NPP A;  5IOC A;  3RLN A;  2A6H D;  4A93 H;  1PRT C;  3MVV A;  1I6H H;  1E24 A;  1Y14 B;  3O13 A;  3QB3 A;  1EFW A;  1WVL A;  5LMN W;  1VQH A;  2K5H A;  1FNU A;  4R8I A;  3H3V C;  3M9B A;  3RZD H;  2H5X A;  3SE0 A;  2F0E A;  1CHP D;  1EIY B;  5TSS A;  2CWA A;  1PFN A;  3TQY A;  1H9M A;  3T1Y L;  2BDO A;  1K0R A;  2CQA A;  2NVY B;  3CCV A;  4LFB L;  1HTL D;  5IP7 H;  2R93 B;  3EQL C;  4JI2 Q;  2J4X A;  2CW0 C;  1HTP A;  3OW2 A;  5T1G A;  2MPM A;  5M3M H;  4A3K G;  1SYF A;  3R3O A;  4DPG A;  5JJZ A;  1YNX A;  4JI3 L;  4JBM A;  1G51 A;  4NXM Q;  1SE4 A;  4JI1 Q;  2JXM B;  2L15 A;  3T4A C;  1UAP A;  5KEE A;  3J81 L;  1VDZ A;  1QIL A;  4DR4 L;  1WFQ A;  5ISR A;  4IAL A;  2KCC A;  4JOI C;  4L6T B;  1J5E L;  1GUT A;  2EYM A;  1X54 A;  5E1F A;  2AWO A;  3S2D B;  4GN3 B;  2NYZ D;  2Q8T A;  2YYZ A;  2OWO A;  1B2T A;  2M9V A;  4X66 L;  4IFD I;  2MHV A;  2NB0 A;  4A93 G;  5IGF A;  5KGU A;  2B2W C;  5E4W C;  2Z6B A;  3ND9 A;  1BKB A;  2KOL A;  3VR6 A;  3K58 A;  4K2L A;  2OF1 A;  4R8N A;  1GUS A;  3QOL A;  4PMW A;  3BVZ A;  4YCV A;  2EXD A;  4MTK A;  1TS3 A;  2F3W A;  3R2T A;  1ICF B;  2B63 B;  1N33 L;  4DR5 Q;  3H09 A;  2O2L D;  1SNQ A;  1I50 B;  5JEA H;  1YNJ C;  4G4K A;  3DMU A;  1ILP A;  1Z9F A;  3CQZ B;  2K5D A;  4TSS A;  5C4H A;  1XMQ L;  1Y1W H;  3R8B A;  1KNA A;  1TWA B;  1WTR A;  2VB3 X;  1HZB A;  4IN3 A;  4JYA L;  4K8I A;  3S1Q B;  2NZ1 D;  3JAM L;  3HRZ C;  4RCO A;  1SFO B;  1OXT A;  3RZO H;  4K5X A;  3A5Z B;  2QCP X;  3BDO A;  4DAY B;  4ME3 A;  3PIO A;  1RCV D;  2ICE C;  3HOV B;  5LHY 1;  3I4N B;  1M4V A;  2BA0 A;  4MHE A;  1HR0 Q;  2K5W A;  4FXK C;  1SE3 A;  1U4L A;  2KVM A;  4ZUI A;  2OCE A;  2TSS A;  4X66 Q;  1EEF D;  2E2D C;  2RHQ B;  3ERS X;  2R7D A;  4OL7 A;  5KIX A;  2IX3 A;  2F0F A;  3RLF A;  2L9H A;  4IUP A;  1XPU A;  4QQB X;  3GV3 A;  4JI2 L;  2NVQ B;  2FJ2 A;  1BCP B;  4JBJ A;  2EJG C;  5JAV A;  1JOO A;  3FRP B;  3A0J A;  2CVR A;  1AN8 A;  2FHT A;  4HIK A;  1JOR A;  4A3C G;  4L8J A;  4BY7 G;  4RCN A;  4P74 A;  3GDE A;  5IYC H;  3CCE A;  3KF6 B;  4QGU A;  3ERQ A;  3PCO B;  3IKJ A;  4POG A;  5IY0 A;  3MXG A;  5KND A;  1GUG A;  1VQD A;  3I4N G;  3A8K E;  4KY5 A;  3K5L A;  2EYH A;  4Y7N H;  4IJL A;  2VQE L;  1N9W A;  1W3S A;  4LUZ A;  1AEX A;  1LTT D;  3T1Y Q;  4K0K Q;  3CC2 A;  4C3I G;  1DGS A;  1XWE A;  2JP1 A;  3DEP A;  2XRS D;  3ND8 A;  4A3J G;  5EAY A;  4DUZ L;  2R93 G;  3RN5 A;  1HFG A;  1STE A;  4JI4 L;  1D2B A;  3K0X A;  3OTO L;  1D5Z C;  1I94 L;  4HJ7 A;  3I4L A;  1Y1V H;  4HR7 B;  4ZKC B;  3I4M B;  1TS4 A;  3MFY A;  1NE3 A;  1JJG A;  1HRJ A;  1XTD A;  1TWG B;  3H15 A;  2CQO A;  2F0J A;  2IHE A;  2WAQ G;  1VQG A;  4P2C B;  2UXD L;  1D5X C;  1B53 A;  2CFM A;  5COY A;  1CT1 D;  2F0U A;  3MXN A;  4A3J B;  3HFZ B;  2CCZ A;  1O7L A;  5T1I A;  1F9Q A;  1EEI D;  1HUM A;  1LT5 D;  3A74 A;  1M8A A;  3WOF A;  4KN4 C;  3GTM H;  3D0F A;  3IL8 A;  3FKI G;  1PYS B;  2Z1C A;  3G71 A;  4IFD J;  5FLX E;  4IFD H;  2K14 A;  1STA A;  5C44 G;  1UNS A;  3MAQ A;  4LF5 Q;  1Y8N B;  3K81 C;  3Q22 A;  4KKT A;  4FF4 A;  4IQZ A;  5C4J H;  3VR4 A;  1PLF A;  1EIH A;  4IJH A;  2JA9 A;  5IYD H;  3KFU A;  1STN A;  2RHS B;  2RDG A;  4A3M B;  3OOC A;  1DD2 A;  2KCT A;  5ELN A;  2UU9 L;  3AEV A;  1LM0 A;  2EE1 A;  4DV0 L;  2DJG C;  5C3E B;  1X3P A;  1FJG L;  4XT1 B;  2RDH A;  4PG3 A;  3S2H B;  2N55 A;  5I9O A;  3KUP A;  4XYO A;  2Z0S A;  1KDC A;  1G2T A;  2JA7 H;  4HID A;  5EJW A;  2FMC A;  4B3T Q;  2F0Q A;  4IZ8 A;  2YV5 A;  1BCP C;  4L5Q A;  5G3L F;  2PQA B;  3AQQ A;  4J6H A;  2ZM6 Q;  5C4Z A;  3U58 A;  3F2D A;  4X6A H;  4DV7 L;  1D5M C;  3QIA A;  3GTL B;  1GXD C;  3FPP A;  5C0X H;  1U4R A;  2AWN A;  5CV6 A;  3NEN A;  4A3F G;  1LLR D;  2RCN A;  2IWH A;  5C4X B;  4N9P A;  5JPM C;  2EOT A;  2JE6 I;  4L5S A;  2EVB A;  1EYD A;  1K28 A;  1KLU D;  5JVG 3;  5JEA J;  3DXJ C;  2LXK A;  4ZLT F;  4QUF A;  3CRL C;  2Y0S B;  2JA6 G;  3GTQ H;  5EPK A;  2BA1 A;  1JC7 A;  3HZX A;  5EKI A;  3PUW A;  4PQX A;  1II3 A;  1SYC A;  4OGQ C;  2WFW A;  4X3T A;  1GJX A;  1NR4 A;  3HOW G;  1YVC A;  3I4M H;  1ENA A;  4F7X A;  2IHF A;  3HOU B;  1Z6H A;  1KXL A;  2NTT A;  3K59 A;  3I3C A;  5CC4 A;  2EZV A;  4A93 B;  1CTM A;  1Q8K A;  1LTG D;  1LV9 A;  3GO5 A;  2AQ1 B;  2WV6 D;  4WFN 3;  1A8V A;  2LKV A;  4ILW A;  1FVI A;  1PZI D;  4N9T A;  4FVM A;  2IT1 A;  4ODG A;  3DWP A;  5FJ8 H;  3TS0 A;  2L5T A;  4X65 L;  3E0J A;  1DOK A;  3NK9 A;  1I3Q H;  2KEC A;  2LS0 1;  5FLX c;  1EIG A;  1E2W A;  5A2Q L;  4YWL A;  5BN4 A;  3ULJ A;  3K8A A;  3UDG A;  5I6Y A;  1STH A;  4CBV A;  1V1P B;  4UHV A;  3J80 L;  1YHQ A;  1QCB D;  2EJM A;  1GHJ A;  4IUU A;  1KAB A;  3BZD B;  1ENC A;  1XTC D;  5GAE C;  4C3J G;  1GUW A;  2DN8 A;  2D0O A;  3TN2 A;  5I6W A;  5KNB A;  3GTO H;  3TS2 A;  2JQO A;  4NP5 A;  3KBX A;  2XNA C;  1TWA H;  2XSC A;  4DR3 L;  4A3D G;  3QO2 A;  2X6G A;  3HOY G;  1KNE A;  4EQO A;  3GTG B;  3MWY W;  3V2T A;  2ASB A;  1SYE A;  2A6E D;  1HHV A;  4QB4 A;  3SEB A;  5ELD A;  2D0P A;  5IYC G;  3LNN A;  1H95 A;  4LFA Q;  2EYJ A;  4FF1 A;  4MIU A;  1SNC A;  4X64 L;  3GD7 A;  3LGJ A;  1X3F A;  4DUY Q;  1YZ6 A;  1K8O A;  3J7A F;  2F4I A;  4I7Z C;  2E2I B;  4GN5 A;  4CKB A;  1CM9 A;  3ER0 A;  4C2M H;  1D6E C;  1PA6 A;  3GTL H;  5C44 B;  2P5Z X;  3JAM c;  3S2D H;  1O7Y A;  1H9S A;  3HOV G;  4IUV A;  3Q23 A;  4NW2 A;  2ALY B;  5I2X A;  1I4H A;  3KF8 A;  2F4V Q;  1F2L A;  2OQ0 A;  3AFQ A;  1PTO C;  4QCL A;  1HFN A;  4FF2 A;  1RL2 A;  2UUC L;  2F0T A;  1DXM A;  1FGU A;  1HCZ A;  5CR3 A;  1CKN A;  1EY7 A;  2K32 A;  4IPG A;  5C3E H;  5EPL A;  2N78 A;  3KDF A;  3CCM A;  1O78 A;  3D4W A;  1OTC A;  4OHJ A;  3ULL A;  3CRK C;  1ML0 D;  3BU2 A;  1PTO H;  4DR7 L;  2R7Z H;  3GTO B;  3HOY B;  2E2J H;  2KJX A;  3CHB D;  3VR5 A;  4KN7 C;  3UDF A;  3J81 j;  2HQE A;  1G29 1;  1HNW Q;  1VMC A;  1ENF A;  1DON A;  1GKH A;  3MZ5 A;  4CJ1 B;  1F77 A;  4F87 A;  4A3E H;  1WTQ A;  4YCU A;  2A73 B;  3E0E A;  3QR8 A;  3M85 A;  1EUJ A;  1WJJ A;  1S5F D;  4A3M G;  4CHT B;  2NBF A;  1PH4 A;  3GTJ B;  2PI2 A;  2K05 A;  2E2I H;  3BDL A;  2Q2U A;  3S15 H;  1D7Q A;  4O0A A;  2N88 A;  2GA4 B;  3GTP B;  2AQ2 B;  1EQV A;  1AW7 A;  2RKS A;  1ZYR C;  4GNX A;  2GVB A;  3S1R B;  1R9T H;  1QWY A;  2F4V L;  1JWS D;  4X64 Q;  4MN3 A;  3TP8 A;  1B3Q A;  1VQ8 A;  4O1N A;  2SOB A;  1RIP A;  1OXV A;  1S5C D;  1K8A C;  2KHS A;  5C4X H;  1Y1V G;  4E6I A;  4DAY A;  2JA8 H;  4QL5 A;  3F2C A;  5IP9 H;  4NDX A;  1HUN A;  4QF4 A;  1FYC A;  2M00 A;  5L37 A;  3MTS A;  1E22 A;  4AYB B;  1TVX A;  3FDT A;  1BR9 A;  3LX0 A;  2AKW B;  2F0S A;  3A7L A;  1VQA A;  4MZ9 A;  3EFX D;  2R92 G;  4A3F H;  3CC4 A;  4ZK9 B;  4RGT A;  1KRS A;  2IX1 A;  4A3J H;  1HR0 L;  3I4M G;  2NN6 G;  1X3Q A;  3STB C;  5IT9 c;  4UDU C;  3RMH A;  1IL2 A;  4OO1 H;  1FNW A;  3KDF B;  2F0L A;  2SEB D;  4GKK Q;  3M4O B;  2B2V A;  4DAM A;  2J0T D;  4CJ2 C;  1A3V A;  2H1E A;  1DM0 B;  4GOP C;  1EWI A;  5LMN L;  4IOA A;  1BO0 A;  1WCM B;  1LT4 D;  3PO2 H;  1R4P B;  1PFM A;  4L63 B;  2ZTC A;  1N36 L;  1S5D D;  4UY8 C;  2L1B A;  2MFI A;  1MD2 D;  2NVQ H;  3JAM i;  1BDO A;  4MTN A;  2F0I A;  4A3F B;  2G9H D;  1N34 Q;  1LTA D;  1S4Z A;  1STG A;  2A69 C;  1KAW A;  3WDN A;  1UWV A;  1VQE A;  1B9M A;  4KHP L;  2EPB A;  3M7G A;  4NXN Q;  2IPK D;  3ICE A;  1BVS A;  1WTH A;  1N33 Q;  3NTI A;  4G7H C;  4OXP A;  4HMI A;  1XX8 A;  2EYF A;  4AIM A;  4KKU A;  4Y7N B;  1XMO L;  2ZXP A;  2RVL A;  4EQP A;  3HOU H;  2XRQ D;  4ALP A;  1Q82 C;  4C3I B;  1K8M A;  1U4P A;  5JVH 3;  1YIJ A;  4R4I A;  4DN4 M;  4JG2 A;  4GS3 A;  4HIM A;  4J8Q A;  4C2M B;  5DM6 3;  1UEB A;  4C3J H;  2I5L X;  1O7I A;  5IP9 G;  1NY4 A;  5M3M B;  3K5O A;  1PVO A;  3GTK B;  2WB1 G;  1I50 H;  3S1N B;  4ULL A;  1CUK A;  1SNP A;  2VW9 A;  3H0G G;  3J81 i;  4MNO A;  3Q24 A;  2MNA A;  1PFB A;  5HUR A;  1L2F A;  1BOS A;  2K52 A;  1QVC A;  1IHZ A;  5BN3 A;  1PZJ D;  4CKC A;  1VF7 A;  2RCF A;  2NVX B;  4K14 A;  5IT9 L;  3I7F A;  2ENB A;  3G6J B;  1SYG A;  3H94 A;  3NWT A;  4C1N K;  4DV7 Q;  4LF6 L;  1AZQ A;  1ESR A;  1MSG A;  1H9S B;  2AUJ D;  2I07 B;  4C3H H;  2ZXR A;  1HNX Q;  3I56 A;  4LF4 Q;  5C0X I;  2DY8 A;  2I46 A;  1HH2 P;  2JA6 B;  1E0B A;  1CSP A;  4RMF A;  3DM3 A;  3SXH A;  1CSQ A;  1MGS A;  3CU7 A;  3GP7 A;  1F9R A;  2K03 A;  4PMC A;  4GOP B;  1LAB A;  3S1M B;  2XGT A;  1PTO B;  3J81 c;  4KI0 A;  1F9S A;  3L3O C;  2YU9 H;  2OTJ A;  5IYB H;  5FLX L;  1X3G A;  4XDX A;  5KNC A;  5AJ3 L;  2I5H A;  5ELC A;  3V96 A;  1AP0 A;  3D6W A;  1FD7 D;  4WJW A;  1LT3 D;  4PNY A;  3MXU A;  2M2L A;  1A6X A;  1NAP A;  2AMC B;  2HDL A;  3QOJ A;  3E6Z X;  1Q81 C;  1SNO A;  2PNH A;  1XJV A;  5CBA E;  2BE5 C;  1ZEQ X;  1AFP A;  2IW3 A;  4QJF A;  3K7A B;  3TRZ A;  3S16 B;  4LF5 L;  3I4N H;  4P73 A;  3A54 A;  4JI8 Q;  4HCS A;  4A3I B;  1IYU A;  2K28 A;  3A55 A;  4JBK A;  1I4Q A;  5ELE A;  3EJI A;  5EKL A;  1VQ7 A;  2WIN B;  1CKM A;  3A8J E;  3K6O A;  1TY2 A;  4O2D A;  1XNR Q;  1EY0 A;  4LK1 C;  2K33 A;  1PH1 A;  3AMU A;  1Q8I A;  4IPH A;  5CV9 A;  1JOQ A;  3OTO Q;  2KBN A;  1HQR D;  3D4D A;  5CBE E;  2WB1 B;  3S16 H;  2Z6K A;  1HZA A;  2Y0S G;  2A74 C;  3HKS A;  2H4O A;  1PYW D;  2UXB L;  3M4P A;  3MEF A;  5D3D A;  2ZT9 C;  2PZU A;  3SVM A;  2B63 H;  4EX5 A;  4DNI A;  2CKZ B;  1LTB D;  3NUC A;  3I73 A;  4IUQ A;  3HGB A;  3DWQ A;  1EL0 A;  1GM5 A;  4LF6 Q;  2YTX A;  5AFW A;  4K0K L;  5COR A;  1EWH A;  4KLK A;  1S5E D;  5IOD A;  3PO2 B;  1L1O A;  2E75 C;  4XXE A;  4UP9 A;  2B2T C;  1XNQ L;  1I3Q B;  4A3B H;  3HS0 C;  3T1H Q;  4CDE C;  2F0P A;  3CAM A;  3T16 A;  5BN5 A;  1I6H B;  4KHZ A;  5DNF A;  2R7F A;  4DK6 C;  2D9U A;  2K5V A;  1HZC A;  1C8C A;  3N6R A;  5EBD A;  4HSP A;  4NPS A;  2BDN A;  3EA6 A;  2WAQ E;  3EIV A;  4XQN A;  1O80 A;  1N32 L;  5FJ8 G;  2R3Z A;  5EQ0 A;  2B2Y A;  1EZ6 A;  2QEJ C;  3QJY A;  4FDB A;  2B3G A;  3PIP 3;  3KJO A;  2HCC A;  1XYI A;  4A3B G;  2DNC A;  4JYA Q;  2F0V A;  3VYR A;  3E5S A;  4RWS C;  2B8G A;  3QWN A;  1PYB A;  2C35 B;  1STB A;  2JA7 G;  4R9W A;  1AH9 A;  4KMU C;  3NP8 A;  1VCI A;  1UE5 A;  3BDC A;  3TZU A;  2VUM G;  3IAY A;  3RUZ A;  3BJU A;  1PFS A;  2E2J B;  3A7A B;  4ZCK A;  3X3M A;  4BXX G;  5IGD A;  2KEN A;  5EBC A;  4NXN L;  4YHH Q;  2N3S A;  1CKO A;  5C0X G;  1OO9 B;  3KF8 B;  3J7A V;  3UI2 A;  2Q8R E;  2NZH A;  2Q8I B;  2R93 H;  1PH3 A;  2BOS A;  1PV4 A;  4QY7 A;  3U4V A;  1NR2 A;  3HP3 A;  4DR5 L;  2C5C A;  3CCU A;  3H6M A;  2JA7 B;  2XWB B;  3SK8 A;  4ZQ3 A;  1C48 A;  5LMN Q;  4YIJ A;  1Z7T A;  5C4J B;  1SSO A;  1J5E Q;  3CXC A;  2RF4 A;  4UP8 A;  2JSO A;  2DJF C;  4GKK L;  3KLS X;  4HAE A;  5LL6 X;  5LMU Q;  4B3M Q;  1SEB D;  4A3L H;  4C3J B;  4LFC L;  4BBR H;  1V43 A;  3S24 A;  3KOJ A;  2L4N A;  5C0X J;  3PF5 A;  1YJN A;  1SR3 A;  4JW0 A;  2R7Z B;  2L55 A;  5C4X G;  2ATW A;  3PUV A;  1Y69 U;  1EQR A;  1LTL A;  3H91 A;  2NWG A;  3KJP A;  4K5V A;  4M1U B;  1ET9 A;  2JN4 A;  2EYO A;  4X3S A;  5FO9 B;  4UP7 A;  2A1A A;  4RKL A;  4NXM L;  4NKL A;  4CDC C;  1SRO A;  1B8A A;  1NJI C;  4A3C H;  3A5U A;  4OO1 I;  1UEA B;  1CK1 A;  5HGQ A;  1SN8 A;  5IGB A;  2F03 A;  1XNQ Q;  1TQO A;  1FNV A;  1Q1E A;  2ZTD A;  4C1N I;  3PSI A;  3PO3 G;  5KYI A;  3S15 B;  4EVO A;  1CQF A;  2A68 D;  1DOM A;  1MKH A;  4CJ0 B;  3C1F A;  3NEM A;  4J15 A;  1TWH B;  5E3F A;  1K83 H;  4FNF A;  1Y8P B;  1G2S A;  1JT8 A;  1HR0 W;  1PH6 A;  4OEL B;  1WI5 A;  1VQC A;  3EVQ A;  3HOZ B;  4XIG S;  3PIP A;  1C0A A;  4H13 C;  1EY4 A;  4YY3 Q;  3FPU B;  5EPJ A;  5GAH C;  4HJ9 A;  1GO3 E;  2EY1 A;  1CQV A;  1D1K A;  3OWE B;  3J80 i;  3W2D A;  2A69 D;  2UXB Q;  5IGC A;  1D1I A;  1TS2 A;  3NQI A;  3PO3 H;  4PZ6 A;  2HD3 A;  1O7Z A;  2A6E C;  4CDF C;  4ZYS A;  1NSN S;  1SMY C;  3NEL A;  4AYB G;  4IPC A;  2Q2I A;  2SNM A;  4U68 A;  5CV4 A;  2K75 A;  2G5D A;  4ZUJ A;  3S9W A;  3S14 H;  3HOZ H;  3CW2 C;  1IKM A;  1B9N A;  1YBY A;  3KF6 A;  4C56 C;  3M4O H;  1HNW L;  3E9I A;  1FR3 A;  1PTO D;  1NCV A;  1YHA A;  4P75 A;  2R6G A;  3MHB A;  1BNZ A;  4JI5 Q;  1EY5 A;  3FKI H;  5JPN C;  2JA6 H;  4AYB E;  3P75 A;  2OT2 A;  2D2C C;  1Q3L A;  2PNR C;  4IO9 A;  4AQY L;  2A68 C;  1Q1B A;  3RZD B;  1X32 A;  2CH4 W;  4BBS H;  4BBR B;  4A3G H;  1HPC A;  1TT2 A;  4DAV A;  1V1Q A;  4DUY L;  4XT3 B;  3TZD A;  4DV2 Q;  1ESF A;  2PZT A;  3PUZ A;  3P20 A;  1WD1 A;  4GLX A;  3VA5 A;  4LFA L;  1VQI A;  3NBH A;  3L2P A;  1QZG A;  4L5R C;  1Y1V B;  2UUA Q;  2DGY A;  1PXU A;  4CGY B;  1AE3 A;  2K6A A;  2PCF B;  3OW7 A;  3F2B A;  1SLJ A;  3S1Q H;  2X69 A;  1VQ4 A;  1VQJ A;  5A35 A;  2CWP A;  1IZ6 A;  4H02 A;  3CF5 A;  3CMA A;  4DR3 Q;  1HNX L;  3PUY A;  3OPO A;  3NE5 B;  3PV0 A;  2NVT H;  3BYY B;  1W6J A;  1SJE D;  4O42 A;  4BXX H;  4B9W A;  4JI7 L;  4CDD C;  1Q46 A;  1A2U A;  2F0O A;  1SBB B;  1IBM L;  1BUV T;  3S14 B;  5D65 A;  2RSO A;  3D6C A;  3HG9 A;  4DV1 L;  1TXY A;  1EQQ A;  3BG3 A;  1SE8 A;  1UE6 A;  1AE2 A;  2ES2 A;  2L12 A;  2I5M X;  4A3G G;  1HQM C;  4LWC A;  4BY1 H;  2MUY A;  4ME5 A;  1ZYR D;  1LYL A;  4EQ5 A;  4JV5 L;  1FL0 A;  5J39 A;  2OEO A;  1U5K A;  4IUR A;  4TVA B;  4QUC A;  5K36 H;  3RD4 A;  1K0S A;  3ZYY X;  4RAU C;  3I90 A;  1TY0 A;  3RR5 A;  4DR6 Q;  4I65 A;  5FLM H;  2F0W A;  2KA7 A;  1J6Q A;  3D31 A;  1PH7 A;  3I55 A;  3HEJ A;  1WCM H;  2X6L A;  1K3R A;  4YWM A;  2ICI A;  5CV7 A;  4BA2 I;  2YTY A;  1X65 A;  1XMO Q;  1EY6 A;  5D14 A;  4R4O A;  3BVG A;  2V4D A;  3GTM B;  1GD7 A;  3KLR A;  5A2Q E;  3BZC A;  2R92 B;  4BWG B;  3EBE A;  2E74 C;  1JWU D;  4KHP Q;  3I2Z A;  3I72 A;  1W2B A;  4A3L G;  2Z8L A;  5BR8 L;  2MGS A;  4X3K A;  1MSH A;  1CHQ D;  3CME A;  4FXD A;  3K7A H;  4ZKB B;  2JYO A;  1JE5 A;  3HOX B;  1VF5 C;  3HOX G;  3HOW B;  5C5M A;  2LXJ A;  5K36 G;  2XN9 C;  2QEX A;  3L7Z C;  4DV1 Q;  3FEW X;  2B2U A;  2Z6K C;  1N8R C;  2KCM A;  5DM7 3;  3NSW A;  1HZ9 A;  3I8Z A;  1SFO H;  5D3I B;  5C44 H;  3Q0A A;  2EXZ A;  1WTV A;  4JC0 A;  1TR5 A;  4BY7 B;  1CA6 A;  3VYT A;  1H9R A;  2WB1 E;  4FO2 A;  3G6E A;  4ID6 A;  1FGB D;  5IYD G;  3CCR A;  4CKE A;  4B3T L;  1MIU A;  3TRE A;  4F8M A;  4I7A A;  1QJO A;  4UAI A;  3TDQ A;  1LTS D;  4K8J A;  3VYU A;  5I9P A;  4DF7 A;  2UUA L;  1QNU A;  3GV6 A;  4IFD G;  1I6V C;  1KQS A;  4HED A;  2HT1 A;  4DV3 Q;  4L5T A;  3D4R A;  3HOY H;  1GVP A;  4K6D A;  4BA1 I;  3C3L A;  3MXP A;  3U9O A;  5FO8 B;  4DV2 L;  4KKS A;  1KTK A;  4C3H B;  1B7Y B;  2EY2 A;  1BBW A;  5CGK A;  4GNX B;  1F9P A;  1QUQ B;  3BZK A;  2KUM A;  4GKJ L;  3TEH B;  4AQY Q;  1A15 A;  2VB2 X;  4A3I H;  2B2W A;  4HMJ A;  1PZK D;  2KEE A;  4HTH A;  2O4X A;  4DK1 A;  3TP6 A;  5M5X H;  1UE1 A;  1ONL A;  1NUC A;  4JK1 C;  2A5H A;  4JI5 L;  2QW7 A;  3STB D;  1X55 A;  1SRU A;  3U4Z A;  2HUG A;  2QA4 A;  1Q90 A;  4U67 3;  3GTP H;  2LFN A;  3D3R A;  3N52 A;  3T56 B;  3T53 B;  1YHB A;  2VY3 A;  2KQ3 A;  1IKL A;  3K0Y A;  5C5L A;  1Q12 A;  4A3E G;  2O5J C;  1CFM A;  1DJR D;  3RZO B;  4LF8 L;  3LWE A;  1EWC A;  3ERO A;  3AFP A;  3G7L A;  1I4X A;  2B63 G;  4R1J A;  1RKN A;  1MJC A;  1JCK B;  2UUC Q;  2HIX A;  2JA5 H;  4OX9 L;  4RH6 A;  3ZJY C;  2RA4 A;  4OIK A;  4DR2 Q;  1NMG A;  4GN4 B;  1EQT A;  4WRD A;  1TKW B;  1VQN A;  4TKO B;  2CW0 D;  4LJZ C;  3M3Y B;  4JI0 L;  4B9X A;  2G9D A;  4K6L A;  4A3M H;  5K5P A;  4LNQ A;  5M3M G;  5JOB A;  2NUC A;  3LWU A;  2XTI A;  5IT9 E;  3SGI A;  1SJH D;  4ABN A;  4BY1 B;  5M5X B;  3AU7 A;  2JA5 B;  3H0G B;  4Z9C B;  4HIO A;  1CA5 A;  4A3I G;  2JK8 A;  4R4T A;  4LFC Q;  1RHP A;  4A3D H;  3I91 A;  4OWT B;  5LMU L;  1TWH H;  3GQB A;  2R61 A;  5F2D A;  3C2P A;  1OXU A;  1V9P A;  2JA8 B;  1C4Q A;  1Q7Y C;  4NMZ A;  1EYC A;  1TS5 A;  5CV8 A;  5CV5 A;  1SE2 A;  1B4O A;  1L1O C;  5IYB G;  4IOC A;  1OXS C;  2B39 A;  4K2K A;  1BCP D;  1IW7 D;  2B2V C;  4B3M L;  3HOW H;  4FF3 A;  1B3A A;  4PZ8 A;  1XMQ Q;  2GN5 A;  1IBL Q;  1YNJ D;  5LL6 S;  2NN6 H;  4LW1 A;  2MJ8 A;  1I4R A;  1WCM G;  2TMP A;  4A75 A;  4ZAI A;  1KLG D;  3OMG A;  4A3G B;  4POF A;  4LMQ D;  4Q5V A;  3VR3 A;  3TP5 A;  1A3U A;  5M3F G;  2EJF C;  1PH2 A;  4C3H G;  1E1T A;  1K3B C;  4DXF A;  1F2M A;  1BF4 A;  4A3K B;  1XPR A;  3J7Z C;  1IBL L;  2VQF Q;  2R7Z G;  3RLO A;  3V05 A;  2RSN A;  1V1O A;  3J7Y W;  1QOH A;  2B2U C;  2F0H A;  3F1Z A;  3JAM E;  1JJC B;  2XVS A;  4KJO A;  1V1P A;  4HN7 A;  1L0X B;  2V1C C;  5J1Z A;  1DZ1 A;  4RA8 A;  2A19 A;  5KRU A;  4BBS G;  2PMZ E;  3VA7 A;  3Q8D A;  3F8T A;  2LSS A;  5ELO A;  5J3B A;  1PH5 A;  2PQE A;  2QF7 A;  4XYQ A;  4QMG A;  5JJK A;  1SMY D;  3JC6 6;  2WII B;  3HKZ B;  1F2Z A;  3TP7 A;  4JI3 Q;  1IYJ B;  2RQX A;  1YNN D;  1XXG A;  1EY9 A;  3URY A;  3S1M H;  1JJ2 A;  1N32 Q;  5FLM G;  4B3S Q;  1GUO A;  2E8G A;  1K73 C;  1M1K C;  4DFA A;  1K8G A;  1WYD A;  1NMF A;  5ELB A;  1Z47 A;  1CZW A;  1X56 A;  2UUB L;  2ZM6 L;  3S1N H;  2VUM B;  1BCP F;  4DR2 L;  1DCZ A;  3M4Y A;  4V0B A;  1WTP A;  4DK3 C;  3CP0 A;  3J81 E;  1LT6 D;  1I4G A;  1KAA A;  1A0I A;  3GTJ H;  2IX0 A;  3OWF A;  4OWX B;  4F88 A;  3C1E A;  5IIF A;  4C3I H;  4DV4 L;  2JJQ A;  4A3D B;  4KD3 A;  2MP1 A;  1ROD A;  5M5W B;  2D5D A;  2SDF A;  2EYL A;  4DV0 Q;  1VS0 A;  2F0D A;  2QGQ A;  2WAC A;  4HJ8 A;  3PIO 3;  2VZA A;  2JEB I;  1HJP A;  5IGG A;  5C6A A;  4DV5 L;  1KD1 C;  1SND A;  5I2Y A;  1XNR L;  4KD4 A;  3H3V H;  5G3L D;  3GTG H;  5IWA Q;  3UDI A;  3I4O A;  1EYA A;  1Y8O B;  2IL8 A;  1JMC A;  3UE1 A;  3NXW A;  2Z4I A;  4LF9 L;  1NTG A;  2YTV A;  5M9O A;  3PUX A;  5GRO A;  1B70 B;  1TWF H;  2KHJ A;  3T51 B;  3WWV A;  5KYL A;  4DXG A;  4JVZ A;  4B08 A;  4QIW E;  4DV5 Q;  1JB3 A;  4A76 A;  4M8A A;  4WJ3 M;  4GOP A;  4LF9 Q;  1JIC A;  1SDF A;  4JI8 L;  2MO0 A;  1J9O A;  2B2T A;  1VQF A;  4BS9 A;  4LUV A;  2WKC A;  3QG1 A;  4G57 A;  4DV4 Q;  5CMD A;  3DHQ A;  2NN6 I;  4KTA A;  1VQL A;  3VDY A;  2ZJP A;  1I94 Q;  4RGM A;  3H3V I;  1TII D;  3R2I A;  2ZTE A;  1ZKO A;  1IW7 C;  1ET6 A;  3E9H A;  3J80 c;  1C7Y A;  5FO7 B;  2EY5 A;  4LF7 L;  4IUT A;  3A56 A;  4LF4 L;  3HOZ G;  3MA2 B;  1YNN C;  1PRT D;  1YIT A;  2L0C A;  2Q2H A;  4Q0F A;  3WOE A;  3R93 A;  2VQE Q;  2B29 A;  2HQL A;  2Y0S E;  1I5F A;  3CC7 A;  2BE5 D;  3W1B A;  3AYH B;  2I0Q A;  2R92 H;  3PO3 B;  1C9O A;  1NBW A;  1JB7 A;  2ID0 A;  3Q6S A;  1E7Z A;  3L9A X;  3PF4 A;  2AHO B;  4PZ7 A;  4A3E B;  2HCI A;  5IP7 G;  1OXX K;  2UUB Q;  1UE7 A;  3S17 B;  1ICW A;  5GAG C;  3T13 A;  1YJ9 A;  1GUN A;  4JI6 Q;  4B3S L;  2VL6 A;  3W1G A;  5EKK A;  5BR8 Q;  4DK0 A;  1TWF B;  3K80 C;  1MJE A;  1EU3 A;  1EY8 A;  4DAP A;  1G6P A;  1D8L A;  3HOU G;  5E7N A;  1QG7 A;  1PTO F;  2N8N A;  4UPA A;  2HHH Q;  1TWC B;  1BBU A;  2KED A;  3CKI B;  4XQQ A;  4V19 0;  2F52 A;  1PH8 A;  3SK6 A;  1DOL A;  2VQF L;  1J8I A;  2Z4H A;  3OSO A;  3U50 C;  5GQO A;  4DV6 Q;  3CCJ A;  1ASY A;  1ZXT A;  4S3S A;  2E5L L;  3CD6 A;  2K04 A;  1Y1W G;  3MC0 B;  3CCL A;  1VQB A;  2ZXO A;  2K50 A;  4GLA C;  1K9M C;  2EDG A;  3AB9 A;  2JA5 G;  5HY6 A;  2QDL A;  2BH2 A;  2DUD A;  3I70 A;  1QB5 D;  3FHW A;  4QIW B;  1T5X D;  1S5B D;  1N34 L;  3L0O A;  4JV5 Q;  1SYB A;  2Z9H A;  3IFD A;  5GAD C;  1W6K A;  2VS1 A;  4LUO A;  4GNX C;  1PRT F;  1N36 Q;  4OO1 G;  2O5I C;  4KJN A;  4DA2 A;  4GLV B;  4H0L C;  3BVM A;  3K5M A;  3TBI B;  2OTL A;  5J22 A;  2HIV A;  3PO2 G;  1QVF A;  2Q2T A;  4K5W A;  3M4Q A;  3G48 A;  2QDB A;  3NTH A;  3G4S A;  1P16 A;  3SHL A;  3NTK A;  2WAQ B;  3S1R H;  4RGO S;  1R9T B;  1E3P A;  1QE6 A;  3RNU A;  4OEM B;  3PMF A;  3DUZ A;  3HKZ E;  1S72 A;  3HOV H;  1ASZ A;  1STY A;  4DR1 Q;  2F0N A;  1MI2 A;  4HSV A;  4DR4 Q;  2KHI A;  3S2H H;  3W3A A;  2FXQ A;  1E1O A;  4WOR A;  4JI1 L;  4HJA A;  2ZJR A;  1WTW A;  3OIP A;  1LTI D;  4JI0 Q;  5H1S E;  1X3E A;  3FVQ A;  3VYS A;  2NVX H;  1QUQ A;  4IUN A;  2CHB D;  1VMP A;  2PQA A;  4PMB A;  4BBR G;  4RFB A;  3DEO A;  4A3B B;  4XTC S;  3CQZ H;  4OX9 Q;  1HNZ L;  1RJT A;  4LFB Q;  1VQK A;  4A3K H;  2PO4 A;  3MEH A;  1PDQ A;  5FOB B;  4RHR A;  2PZW A;  5M5Y B;  4R4C A;  1RTN A;  5E4X A;  3SK5 A;  4YWK A;  1H9J A;  1RTO A;  4FYD A;  2B2Y C;  1JQY D;  5I4D A;  2K01 A;  3ITP A;  3K7U C;  1WD0 A;  4H7B A;  3CPW A;  4JPB W;  4NB3 A;  1KRT A;  4KY7 A;  1A3T A;  1YJW A;  4BY1 G;  4TQU S;  1E2Z A;  2EYP A;  2VNU D;  2F0M A;  2QKI C;  4X62 L;  4LF8 Q;  4DR7 Q;  4P71 A;  3D8G A;  4YCW A;  3U9S A;  2CH4 A;  4N8F A;  1TWG H;  4A4I A;  5C3X A;  3M7N A;  2UXC Q;  1WTX A;  3ULP A;  1U0L A;  2MO1 A;  3KK7 A;  5CYU A;  3W5O A;  4GKJ Q;  4EQN A;  1KDA A;  1B50 A;  2JA8 G;  3J80 E;  1Q86 C;  4G7O C;  4X62 Q;  1PH9 A;  1U9R A;  4X3U A;  1JOK A;  2YU9 B;  1SMX A;  2F3I A;  4JCV E;  3FP9 A;  1IBK L;  4OIJ A;  2NZO A;  3MFG A;  4JOI A;  4PV1 C;  4KHV A;  3BS1 A;  3MXN B;  5EGT A;  4RHS A;  4DU9 A;  1HNZ Q;  3UE0 A;  4DNR B;  2XWJ B;  2ZJQ A;  1EZ8 A;  5C3E G;  1GHK A;  1QNK A;  2K7V A;  2RBM A;  3NWS A;  5M5Y H;  4JBW A;  1B44 D;  4R4Q A;  5JJL A;  4DV3 L;  1H9K A;  2E76 C;  2F0K A;  2EY6 A;  5ELF A;  1EIF A;  4B3R L;  1A62 A;  5HGT A;  1L1O B;  3B6Y A;  4EGV A;  1EOV A;  1SNM A;  5FK9 C;  1R4Q B;  1B1Z A;  1IYV A;  2FMM A;  2NTS A;  1P8L A;  2PMZ B;  1QVG A;  3J7A 5;  1QZH A;  2FIN B;  1IL8 A;  2OQK A;  3OYY A;  1V8Q A;  1LAC A;  3DLL A;  1JR0 D;  4TRD A;  5C3W A;  4RGN A;  1SAP A;  3NHH A;  2OXP A;  3M3Y H;  1JWM D;  4Y52 H;  1A63 A;  4H44 C;  3K57 A;  4DR1 L;  2MQH A;  3IRB A;  2J7Z A;  3OHX C;  4OON A;  3OIQ A;  1G8Z D;  3DM1 A;  5FKA C;  1LUZ A;  2AUK A;  1VQO A;  1EYG A;  2E2H H;  1CKN B;  2PPB C;  2K5N A;  5IGE A;  2SNS A;  1YEZ A;  4X65 Q;  2XIW A;  3K5N A;  2A8V A;  4RKB A;  4BBS B;  1VQ9 A;  2BH8 A;  3NBH B;  4WJ4 A;  4YHH L;  1KDB A;  2D62 A;  1WTO A;  3CCS A;  2K1B A;  3EN2 A;  2DY7 A;  2FFK B;  1VQP A;  4DV6 L;  1DYQ A;  3UDX A;  1EU4 A;  5DAU A;  3KYH C;  2QIL A;  1AZP A;  1S40 A;  1TWC H;  3KLW A;  2L11 A;  3P1H A;  2WKD A;  1TU2 B;  5JEA G;  1G6Z A;  4KY6 A;  2HHH L;  1ILQ A;  2NVY H;  2VXW A;  4FXG C;  4DR6 L;  5DLQ E;  4RG1 A;  2E5L Q;  3RN2 A;  2F0G A;  3H0G H;  3CCQ A;  1L0W A;  5IE8 A;  1SYD A;  1T9H A;  4AH6 A;  3F2U A;  2BCO A;  1PHJ A;  4JI7 Q;  4DKA C;  2EQS A;  2K4K A;  1BXT A;  1KIX A;  3P7J A;  2JEA I;  1I4P A;  3T1H L;  4G7Z C;  1EOT A;  1LO5 D;  3SR1 A;  1MBY A;  3CPF A;  1T5E A;  3GTQ B;  1HA5 A;  3HOX H;  2B8F A;  1IBM Q;  4JI6 L;  3E3X A;  2K5Q A;  3TME A;  4APV A;  2DNE A;  2PYK A;  3GTK H;  1E2V A;  1L0Y B;  2AQ3 B;  1CI3 M;  2KCN A;  1FJG Q;  1RD9 D;  4LF7 Q;  3PQI A;  5DEH A;  3TSS A;  2PW7 A;  2UU9 Q;  5M3F B;  3S17 H;  2RDF A;  4ZRZ A;  3X3N A;  4BY7 H;  3SDZ A;  1KL9 A;  1RDP D;  1GOZ A;  1XPO A;  1BBX C;  4DGZ A;  2A6H C;  3HKZ G;  1VQ5 A;  5JJI A;  4B3R Q;  1KC8 C;  3FKI B;  1NNX A; 
#chains in the Genus database with same CATH homology
 1UUP A;  1RF2 D;  3SK4 A;  4FP5 D;  4KV6 A;  3KBG A;  1A2T A;  3C46 A;  1Y1W B;  3KLS A;  1SXT A;  1BQQ T;  3VR2 A;  2LY7 A;  2WP8 J;  2C9O A;  1PRT B;  2E2H B;  2F3V A;  2PW5 A;  4J1M A;  5NUC A;  1G91 A;  1LTR D;  4XQJ A;  2IJ0 A;  3ONA B;  3A8I E;  4HCE A;  4DNT B;  3BYT B;  4GZY C;  2LMC B;  3IFT A;  1F2Y A;  1U4M A;  2F1M A;  3NQT A;  2HDM A;  1EFI D;  1JE4 A;  1HXY D;  3FMC A;  2NVT B;  1CZG A;  3NBI A;  4LAA A;  1PMR A;  1K83 B;  1HA6 A;  4KK7 A;  3OMC A;  3DWA A;  3NPP A;  5IOC A;  2A6H D;  1PRT C;  3MVV A;  3O13 A;  3QB3 A;  1WVL A;  1FNU A;  4R8I A;  3H3V C;  3SE0 A;  2F0E A;  1CHP D;  5TSS A;  1PFN A;  1H9M A;  2BDO A;  2CQA A;  2NVY B;  1HTL D;  2R93 B;  3EQL C;  2J4X A;  2CW0 C;  1HTP A;  5T1G A;  2MPM A;  1SYF A;  3R3O A;  5JJZ A;  1SE4 A;  2JXM B;  3T4A C;  1UAP A;  5KEE A;  3J81 L;  1VDZ A;  1QIL A;  5ISR A;  4IAL A;  2KCC A;  4L6T B;  1GUT A;  2EYM A;  5E1F A;  2AWO A;  3S2D B;  2NYZ D;  2Q8T A;  2YYZ A;  1B2T A;  2M9V A;  4IFD I;  2MHV A;  2NB0 A;  5IGF A;  5KGU A;  2B2W C;  5E4W C;  3ND9 A;  2KOL A;  3VR6 A;  3K58 A;  4K2L A;  2OF1 A;  4R8N A;  1GUS A;  3QOL A;  4PMW A;  3BVZ A;  1TS3 A;  2F3W A;  3R2T A;  2B63 B;  3H09 A;  2O2L D;  1SNQ A;  5JEA H;  1I50 B;  1YNJ C;  4G4K A;  3DMU A;  1ILP A;  3CQZ B;  2K5D A;  4TSS A;  5C4H A;  3R8B A;  1KNA A;  1TWA B;  1WTR A;  2VB3 X;  4IN3 A;  4K8I A;  3S1Q B;  2NZ1 D;  3JAM L;  3HRZ C;  4RCO A;  1SFO B;  1OXT A;  4K5X A;  2QCP X;  3BDO A;  1RCV D;  2ICE C;  3HOV B;  5LHY 1;  3I4N B;  1M4V A;  2BA0 A;  4MHE A;  2K5W A;  4FXK C;  1SE3 A;  1U4L A;  2KVM A;  4ZUI A;  2TSS A;  1EEF D;  2E2D C;  5KIX A;  4OL7 A;  2IX3 A;  2F0F A;  3RLF A;  2L9H A;  4IUP A;  3GV3 A;  2NVQ B;  2FJ2 A;  1BCP B;  2EJG C;  5JAV A;  1JOO A;  3FRP B;  2CVR A;  1AN8 A;  2FHT A;  1JOR A;  4L8J A;  4RCN A;  3ERQ A;  3IKJ A;  5KND A;  3MXG A;  1GUG A;  3A8K E;  4KY5 A;  3K5L A;  2EYH A;  1AEX A;  1LTT D;  4C3I G;  1XWE A;  2JP1 A;  3DEP A;  2XRS D;  3ND8 A;  1HFG A;  1STE A;  1D2B A;  1D5Z C;  3I4L A;  4HR7 B;  4ZKC B;  3I4M B;  1TS4 A;  3MFY A;  1HRJ A;  1TWG B;  2F0J A;  4P2C B;  1D5X C;  1B53 A;  5COY A;  1CT1 D;  2F0U A;  3MXN A;  4A3J B;  1O7L A;  5T1I A;  1F9Q A;  1EEI D;  1HUM A;  1LT5 D;  1M8A A;  3WOF A;  4KN4 C;  3IL8 A;  2Z1C A;  4IFD J;  5FLX E;  4IFD H;  1STA A;  1UNS A;  3MAQ A;  1Y8N B;  3Q22 A;  4KKT A;  4FF4 A;  4IQZ A;  3VR4 A;  1PLF A;  1EIH A;  1STN A;  2RDG A;  4A3M B;  3OOC A;  1DD2 A;  2EE1 A;  5C3E B;  1X3P A;  4XT1 B;  2RDH A;  3S2H B;  2N55 A;  5I9O A;  3KUP A;  4XYO A;  1KDC A;  1G2T A;  5EJW A;  2FMC A;  2F0Q A;  4IZ8 A;  1BCP C;  5G3L F;  4J6H A;  5C4Z A;  1D5M C;  3QIA A;  3GTL B;  1GXD C;  3FPP A;  5C0X H;  1U4R A;  2AWN A;  5CV6 A;  1LLR D;  2IWH A;  5C4X B;  4N9P A;  5JPM C;  2EOT A;  2JE6 I;  2EVB A;  1EYD A;  1KLU D;  5JVG 3;  4ZLT F;  5JEA J;  3DXJ C;  4QUF A;  3CRL C;  2Y0S B;  5EPK A;  2BA1 A;  1JC7 A;  3HZX A;  5EKI A;  3PUW A;  4PQX A;  1II3 A;  1SYC A;  4OGQ C;  4X3T A;  1GJX A;  1NR4 A;  1ENA A;  4F7X A;  3HOU B;  1Z6H A;  2NTT A;  3K59 A;  3I3C A;  5CC4 A;  2EZV A;  4A93 B;  1CTM A;  1LTG D;  1LV9 A;  3GO5 A;  2AQ1 B;  2WV6 D;  4WFN 3;  4ILW A;  2LKV A;  1PZI D;  4N9T A;  4FVM A;  2IT1 A;  4ODG A;  3DWP A;  2L5T A;  3E0J A;  1DOK A;  3NK9 A;  2KEC A;  2LS0 1;  1EIG A;  5A2Q L;  1E2W A;  5BN4 A;  5I6Y A;  1STH A;  4CBV A;  1V1P B;  3J80 L;  1QCB D;  2EJM A;  1GHJ A;  4IUU A;  1KAB A;  3BZD B;  1ENC A;  1XTC D;  4C3J G;  1GUW A;  2DN8 A;  3TN2 A;  5I6W A;  5KNB A;  4NP5 A;  3KBX A;  2XNA C;  2XSC A;  3QO2 A;  2X6G A;  1KNE A;  4EQO A;  3GTG B;  3MWY W;  3V2T A;  1SYE A;  2A6E D;  1HHV A;  4QB4 A;  3SEB A;  5ELD A;  3LNN A;  2EYJ A;  4FF1 A;  4MIU A;  1SNC A;  3GD7 A;  1K8O A;  3J7A F;  2F4I A;  4I7Z C;  2E2I B;  4CKB A;  1CM9 A;  1D6E C;  5C44 B;  1O7Y A;  1H9S A;  4IUV A;  3Q23 A;  4NW2 A;  5I2X A;  1I4H A;  3KF8 A;  1F2L A;  1PTO C;  4QCL A;  1HFN A;  4FF2 A;  2F0T A;  1DXM A;  1HCZ A;  5CR3 A;  1EY7 A;  2K32 A;  5EPL A;  1O78 A;  3D4W A;  4OHJ A;  3CRK C;  1ML0 D;  1PTO H;  3GTO B;  3HOY B;  2KJX A;  3CHB D;  3VR5 A;  4KN7 C;  2HQE A;  1G29 1;  1VMC A;  1ENF A;  1DON A;  3MZ5 A;  4CJ1 B;  1F77 A;  4F87 A;  1WTQ A;  2A73 B;  3M85 A;  1S5F D;  4CHT B;  2NBF A;  3GTJ B;  2K05 A;  3BDL A;  2N88 A;  2GA4 B;  3GTP B;  2AQ2 B;  1EQV A;  1AW7 A;  2RKS A;  1ZYR C;  3S1R B;  1QWY A;  1JWS D;  4MN3 A;  3TP8 A;  4O1N A;  2SOB A;  1OXV A;  1S5C D;  2KHS A;  4E6I A;  4DAY A;  4NDX A;  1HUN A;  4QF4 A;  1FYC A;  2M00 A;  3MTS A;  4AYB B;  1TVX A;  3FDT A;  1BR9 A;  3LX0 A;  2F0S A;  3A7L A;  3EFX D;  4ZK9 B;  4RGT A;  2IX1 A;  2NN6 G;  1X3Q A;  4UDU C;  3RMH A;  4OO1 H;  1FNW A;  2F0L A;  2SEB D;  3M4O B;  2B2V A;  2J0T D;  4CJ2 C;  1A3V A;  2H1E A;  1DM0 B;  1BO0 A;  1WCM B;  1LT4 D;  1R4P B;  1PFM A;  4L63 B;  1S5D D;  2L1B A;  1MD2 D;  1BDO A;  2F0I A;  4A3F B;  2G9H D;  1LTA D;  1S4Z A;  1STG A;  2A69 C;  3WDN A;  1B9M A;  2EPB A;  3M7G A;  2IPK D;  3NTI A;  4G7H C;  4HMI A;  1XX8 A;  2EYF A;  4KKU A;  4Y7N B;  2ZXP A;  2RVL A;  4EQP A;  2XRQ D;  4C3I B;  1K8M A;  1U4P A;  5JVH 3;  4DN4 M;  4J8Q A;  4C2M B;  5DM6 3;  5M3M B;  3K5O A;  3GTK B;  3S1N B;  4ULL A;  1SNP A;  3Q24 A;  1PFB A;  5HUR A;  1BOS A;  5BN3 A;  1IHZ A;  1PZJ D;  4CKC A;  1VF7 A;  2NVX B;  4K14 A;  5IT9 L;  2ENB A;  3G6J B;  1SYG A;  3H94 A;  3NWT A;  4C1N K;  1AZQ A;  1ESR A;  1MSG A;  1H9S B;  2AUJ D;  2I07 B;  2ZXR A;  5C0X I;  2DY8 A;  2I46 A;  2JA6 B;  1E0B A;  3SXH A;  1MGS A;  3CU7 A;  3GP7 A;  1F9R A;  2K03 A;  4PMC A;  1LAB A;  3S1M B;  1PTO B;  4KI0 A;  1F9S A;  3L3O C;  5FLX L;  4XDX A;  5KNC A;  5ELC A;  3V96 A;  1AP0 A;  3D6W A;  1FD7 D;  4WJW A;  1LT3 D;  4PNY A;  3MXU A;  2M2L A;  1A6X A;  1NAP A;  2HDL A;  3QOJ A;  3E6Z X;  1SNO A;  5CBA E;  2BE5 C;  1ZEQ X;  1AFP A;  2IW3 A;  3K7A B;  3S16 B;  3A54 A;  4HCS A;  4A3I B;  1IYU A;  2K28 A;  3A55 A;  1I4Q A;  5ELE A;  3EJI A;  5EKL A;  2WIN B;  3A8J E;  3K6O A;  1TY2 A;  1EY0 A;  4LK1 C;  2K33 A;  3AMU A;  1Q8I A;  5CV9 A;  1JOQ A;  1HQR D;  3D4D A;  5CBE E;  2WB1 B;  2A74 C;  2H4O A;  1PYW D;  5D3D A;  2ZT9 C;  2PZU A;  3SVM A;  1LTB D;  3NUC A;  3I73 A;  4IUQ A;  3HGB A;  3DWQ A;  1EL0 A;  5AFW A;  5COR A;  1EWH A;  1S5E D;  5IOD A;  3PO2 B;  2E75 C;  4XXE A;  2B2T C;  1I3Q B;  3HS0 C;  2F0P A;  3T16 A;  5BN5 A;  1I6H B;  4KHZ A;  5DNF A;  2D9U A;  1C8C A;  3N6R A;  5EBD A;  4HSP A;  2BDN A;  3EA6 A;  4XQN A;  1O80 A;  2R3Z A;  5EQ0 A;  2B2Y A;  1EZ6 A;  2QEJ C;  3QJY A;  3PIP 3;  2HCC A;  1XYI A;  2DNC A;  2F0V A;  3VYR A;  3E5S A;  4RWS C;  2B8G A;  3QWN A;  1STB A;  4R9W A;  4KMU C;  3NP8 A;  1VCI A;  3BDC A;  3TZU A;  3IAY A;  3RUZ A;  2E2J B;  3A7A B;  3X3M A;  5IGD A;  5EBC A;  5C0X G;  1OO9 B;  3J7A V;  3UI2 A;  2Q8R E;  2Q8I B;  2BOS A;  1NR2 A;  3HP3 A;  2C5C A;  3H6M A;  2JA7 B;  2XWB B;  3SK8 A;  4ZQ3 A;  1C48 A;  4YIJ A;  1Z7T A;  5C4J B;  1SSO A;  2JSO A;  3KLS X;  4HAE A;  5LL6 X;  1SEB D;  4C3J B;  1V43 A;  2L4N A;  5C0X J;  2R7Z B;  2L55 A;  3PUV A;  1Y69 U;  3H91 A;  2NWG A;  4K5V A;  4M1U B;  1ET9 A;  2EYO A;  4X3S A;  5FO9 B;  4RKL A;  4NKL A;  4OO1 I;  1UEA B;  1CK1 A;  2F03 A;  5IGB A;  1TQO A;  1FNV A;  1Q1E A;  4C1N I;  5KYI A;  3S15 B;  4EVO A;  1DOM A;  2A68 D;  1CQF A;  4CJ0 B;  3C1F A;  1TWH B;  5E3F A;  4FNF A;  1Y8P B;  1G2S A;  3EVQ A;  3HOZ B;  4XIG S;  4H13 C;  1EY4 A;  3FPU B;  5EPJ A;  2EY1 A;  1CQV A;  1D1K A;  3OWE B;  3W2D A;  2A69 D;  5IGC A;  1D1I A;  1TS2 A;  3NQI A;  1O7Z A;  2A6E C;  4ZYS A;  1NSN S;  1SMY C;  2SNM A;  4U68 A;  5CV4 A;  4ZUJ A;  3S9W A;  1IKM A;  1B9N A;  4C56 C;  1FR3 A;  1PTO D;  1NCV A;  2R6G A;  3MHB A;  1BNZ A;  1EY5 A;  5JPN C;  3P75 A;  2OT2 A;  2D2C C;  1Q3L A;  2PNR C;  2A68 C;  1Q1B A;  3RZD B;  1X32 A;  4BBR B;  1HPC A;  1TT2 A;  4DAV A;  4XT3 B;  3TZD A;  1ESF A;  2PZT A;  3PUZ A;  3P20 A;  1WD1 A;  3VA5 A;  3NBH A;  1Y1V B;  1PXU A;  4CGY B;  2K6A A;  2PCF B;  3OW7 A;  2X69 A;  5A35 A;  3PUY A;  3OPO A;  3NE5 B;  3PV0 A;  3BYY B;  1W6J A;  1SJE D;  4O42 A;  4B9W A;  1A2U A;  2F0O A;  1SBB B;  1BUV T;  3S14 B;  5D65 A;  2RSO A;  3D6C A;  3HG9 A;  3BG3 A;  2L12 A;  1HQM C;  2MUY A;  1ZYR D;  4ME5 A;  5J39 A;  2OEO A;  4IUR A;  4QUC A;  5K36 H;  3RD4 A;  3ZYY X;  4RAU C;  3I90 A;  1TY0 A;  4I65 A;  2F0W A;  2KA7 A;  3D31 A;  3HEJ A;  2X6L A;  2ICI A;  5CV7 A;  4BA2 I;  1EY6 A;  5D14 A;  3BVG A;  2V4D A;  3GTM B;  3KLR A;  5A2Q E;  2R92 B;  4BWG B;  2E74 C;  1JWU D;  3I72 A;  2Z8L A;  2MGS A;  4X3K A;  1MSH A;  1CHQ D;  4FXD A;  4ZKB B;  2JYO A;  3HOX B;  1VF5 C;  3HOW B;  5C5M A;  5K36 G;  2XN9 C;  3L7Z C;  3FEW X;  2B2U A;  5DM7 3;  3NSW A;  3I8Z A;  3Q0A A;  5D3I B;  2EXZ A;  1WTV A;  1TR5 A;  4BY7 B;  1CA6 A;  3VYT A;  1H9R A;  4FO2 A;  4ID6 A;  1FGB D;  4CKE A;  4F8M A;  1QJO A;  4UAI A;  3TDQ A;  1LTS D;  4K8J A;  3VYU A;  5I9P A;  4DF7 A;  1QNU A;  3GV6 A;  4IFD G;  1I6V C;  4HED A;  3D4R A;  4K6D A;  4BA1 I;  3C3L A;  3MXP A;  3U9O A;  5FO8 B;  4KKS A;  1KTK A;  4C3H B;  2EY2 A;  5CGK A;  1F9P A;  2KUM A;  1A15 A;  2VB2 X;  2B2W A;  4HMJ A;  1PZK D;  2KEE A;  4HTH A;  2O4X A;  4DK1 A;  3TP6 A;  1ONL A;  1NUC A;  4JK1 C;  2A5H A;  2HUG A;  1Q90 A;  4U67 3;  2LFN A;  3D3R A;  3N52 A;  3T56 B;  3T53 B;  2KQ3 A;  1IKL A;  3K0Y A;  5C5L A;  1Q12 A;  2O5J C;  1CFM A;  1DJR D;  3RZO B;  3LWE A;  1EWC A;  3ERO A;  3G7L A;  1I4X A;  1RKN A;  1JCK B;  4RH6 A;  2RA4 A;  4OIK A;  1EQT A;  4WRD A;  1TKW B;  4TKO B;  2CW0 D;  4LJZ C;  3M3Y B;  4B9X A;  2G9D A;  4K6L A;  5K5P A;  5JOB A;  2NUC A;  3LWU A;  5IT9 E;  1SJH D;  4ABN A;  4BY1 B;  5M5X B;  3AU7 A;  2JA5 B;  3H0G B;  4Z9C B;  1CA5 A;  1RHP A;  3I91 A;  3GQB A;  2R61 A;  5F2D A;  3C2P A;  1OXU A;  2JA8 B;  1C4Q A;  4NMZ A;  1EYC A;  1TS5 A;  5CV8 A;  5CV5 A;  1SE2 A;  1B4O A;  1OXS C;  2B39 A;  4K2K A;  1BCP D;  1IW7 D;  2B2V C;  4FF3 A;  1B3A A;  1YNJ D;  5LL6 S;  2NN6 H;  2MJ8 A;  1I4R A;  2TMP A;  4ZAI A;  1KLG D;  3OMG A;  4A3G B;  4LMQ D;  4Q5V A;  3VR3 A;  3TP5 A;  1A3U A;  2EJF C;  4C3H G;  4DXF A;  1F2M A;  1BF4 A;  4A3K B;  3V05 A;  2RSN A;  1V1O A;  3J7Y W;  1QOH A;  2B2U C;  2F0H A;  3JAM E;  2XVS A;  4KJO A;  1V1P A;  4HN7 A;  1L0X B;  5J1Z A;  1DZ1 A;  4RA8 A;  5KRU A;  3VA7 A;  2PQE A;  2QF7 A;  4XYQ A;  4QMG A;  1SMY D;  2WII B;  3HKZ B;  1F2Z A;  3TP7 A;  2RQX A;  1YNN D;  1XXG A;  1EY9 A;  3URY A;  1GUO A;  4DFA A;  5ELB A;  1Z47 A;  1CZW A;  2VUM B;  1BCP F;  1DCZ A;  3M4Y A;  4V0B A;  1WTP A;  3J81 E;  1LT6 D;  1I4G A;  1KAA A;  2IX0 A;  3OWF A;  4F88 A;  3C1E A;  5IIF A;  4A3D B;  4KD3 A;  2MP1 A;  1ROD A;  5M5W B;  2D5D A;  2SDF A;  2EYL A;  2F0D A;  2WAC A;  3PIO 3;  2JEB I;  5IGG A;  5C6A A;  1SND A;  5I2Y A;  4KD4 A;  5G3L D;  1EYA A;  1Y8O B;  2IL8 A;  3NXW A;  2Z4I A;  5M9O A;  3PUX A;  3T51 B;  5KYL A;  4DXG A;  4B08 A;  1JB3 A;  4M8A A;  1JIC A;  1SDF A;  1J9O A;  2B2T A;  4BS9 A;  2WKC A;  3QG1 A;  4G57 A;  5CMD A;  3DHQ A;  2NN6 I;  4KTA A;  4RGM A;  1TII D;  3R2I A;  1ZKO A;  1IW7 C;  1ET6 A;  5FO7 B;  2EY5 A;  4IUT A;  3A56 A;  3MA2 B;  1YNN C;  1PRT D;  2L0C A;  4Q0F A;  3WOE A;  3R93 A;  2BE5 D;  3PO3 B;  2ID0 A;  3Q6S A;  3L9A X;  4A3E B;  2HCI A;  1OXX K;  3S17 B;  1ICW A;  3T13 A;  1GUN A;  5EKK A;  4DK0 A;  1TWF B;  1EU3 A;  1EY8 A;  4DAP A;  1QG7 A;  1PTO F;  1TWC B;  2KED A;  3CKI B;  4XQQ A;  4V19 0;  3SK6 A;  1DOL A;  1J8I A;  2Z4H A;  3OSO A;  1ZXT A;  4S3S A;  2K04 A;  3MC0 B;  2ZXO A;  2EDG A;  3AB9 A;  3I70 A;  1QB5 D;  4QIW B;  1T5X D;  1S5B D;  1SYB A;  3IFD A;  1W6K A;  1PRT F;  4OO1 G;  2O5I C;  4KJN A;  4DA2 A;  4H0L C;  3BVM A;  3K5M A;  3TBI B;  5J22 A;  4K5W A;  2QDB A;  3NTH A;  3SHL A;  3NTK A;  2WAQ B;  1R9T B;  4RGO S;  1QE6 A;  3PMF A;  3DUZ A;  1STY A;  2F0N A;  1MI2 A;  4HSV A;  3W3A A;  4WOR A;  1WTW A;  3OIP A;  1LTI D;  3FVQ A;  3VYS A;  4IUN A;  2CHB D;  1VMP A;  4PMB A;  4RFB A;  3DEO A;  4A3B B;  4XTC S;  1RJT A;  2PO4 A;  3MEH A;  1PDQ A;  5FOB B;  4RHR A;  2PZW A;  5M5Y B;  3SK5 A;  1RTN A;  5E4X A;  1H9J A;  1RTO A;  4FYD A;  2B2Y C;  1JQY D;  5I4D A;  2K01 A;  3ITP A;  1WD0 A;  4H7B A;  4KY7 A;  1A3T A;  4TQU S;  1E2Z A;  2EYP A;  2VNU D;  2F0M A;  2QKI C;  3D8G A;  3U9S A;  5C3X A;  3M7N A;  1WTX A;  3KK7 A;  5CYU A;  4EQN A;  1KDA A;  1B50 A;  3J80 E;  4G7O C;  1U9R A;  4X3U A;  1JOK A;  2YU9 B;  4OIJ A;  3MFG A;  4PV1 C;  4KHV A;  3BS1 A;  5EGT A;  4RHS A;  4DU9 A;  4DNR B;  2XWJ B;  1EZ8 A;  1GHK A;  1QNK A;  2K7V A;  2RBM A;  3NWS A;  4JBW A;  1B44 D;  1H9K A;  2E76 C;  2F0K A;  2EY6 A;  5ELF A;  5HGT A;  4EGV A;  1SNM A;  5FK9 C;  1R4Q B;  1B1Z A;  1IYV A;  2FMM A;  2NTS A;  2PMZ B;  2FIN B;  1IL8 A;  1V8Q A;  1LAC A;  1JR0 D;  4TRD A;  5C3W A;  4RGN A;  1SAP A;  3NHH A;  2OXP A;  1JWM D;  4H44 C;  3K57 A;  2J7Z A;  3OHX C;  3OIQ A;  1G8Z D;  3DM1 A;  5FKA C;  2AUK A;  2PPB C;  5IGE A;  2SNS A;  2XIW A;  3K5N A;  4RKB A;  4BBS B;  1KDB A;  2D62 A;  1WTO A;  2K1B A;  2DY7 A;  2FFK B;  1DYQ A;  1EU4 A;  5DAU A;  2QIL A;  1AZP A;  2L11 A;  3P1H A;  2WKD A;  1TU2 B;  5JEA G;  1G6Z A;  4KY6 A;  1ILQ A;  2VXW A;  4FXG C;  2F0G A;  1SYD A;  3F2U A;  2BCO A;  1BXT A;  3P7J A;  2JEA I;  1I4P A;  4G7Z C;  1EOT A;  1LO5 D;  3SR1 A;  1MBY A;  1T5E A;  3GTQ B;  1HA5 A;  2B8F A;  2K5Q A;  3TME A;  2DNE A;  2PYK A;  1E2V A;  1L0Y B;  2AQ3 B;  1CI3 M;  2KCN A;  1RD9 D;  5DEH A;  3TSS A;  2PW7 A;  5M3F B;  2RDF A;  4ZRZ A;  3X3N A;  3SDZ A;  1RDP D;  1GOZ A;  1BBX C;  4DGZ A;  2A6H C;  3FKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...