5DEHA

Crystal structure of staphylococcal nuclease variant delta+phs n100d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVDEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N100D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dehA00
3U9OA 5EGTA 3P1HA 1STHA 2F0SA 1EY7A 1SYEA 3H6MA 1EY6A 4B9WA 1II3A 5C5MA 5IOCA 2F0LA 3VA5A 2EYHA 2M00A 2O4XA 2SNMA 2PZWA 4NDXA 2F3VA 1EY4A 2F0TA 2PQEA 4ME5A 2PZUA 4I65A 4HMIA 4K5VA 4NP5A 5IGGA 2EY1A 3MZ5A 4PMCA 5JOBA 4K2KA 5NUCA 3NQTA 3TP5A 2PZTA 5M9OA 1SNOA 1SNQA 5DAUA 2PW5A 3V2TA 1KDCA 4S3SA 4DFAA 4KY7A 4WORA 1TT2A 4MIUA 4KD3A 4ZUJA 4EQNA 3EVQA 1SNDA 5C4HA 5HGTA 2HQEA 2EY5A 4N9TA 5EKKA 3QOJA 2F0FA 3QOLA 2EYOA 1STNA 1KDAA 2F0IA 4HMJA 4J6HA 4OL7A 3RUZA 5C6AA 1SYCA 3SR1A 2RBMA 5CV5A 3EJIA 2SOBA 1A3TA 2RDFA 5JAVA 1KABA 1A2UA 4B9XA 5KGUA 4KY6A 5KYLA 2EXZA 4RKBA 4YIJA 3DMUA 1U9RA 3TP8A 1SYFA 3OMCA 3E5SA 3T13A 4HTHA 1SNPA 3NXWA 1SYDA 4R8NA 1EQVA 4G57A 5DEHA 5HURA 3S9WA 5ISRA 1TQOA 3TP6A 4DF7A 2SNSA 2NUCA 3MVVA 1EYDA 1EY8A 3MEHA 4N9PA 5IIFA 1A3VA 2F0QA 4ODGA 5CV9A 5IGCA 5IODA 5KEEA 4IZ8A 5IGEA 4KTAA 1EYCA 3SK5A 3SK6A 4E6IA 1A3UA 4DGZA 4KD4A 1EZ8A 4KJOA 4K5XA 5CV4A 3NP8A 5C3XA 2F0OA 2F0VA 1STGA 2OF1A 3NHHA 3QB3A 5J1ZA 4ZUIA 4QB4A 5KYIA 4RKLA 4K8JA 5E1FA 1EZ6A 2F0EA 5J39A 4IUNA 2OEOA 3BDCA 4KJNA 3SK8A 1TR5A 3ITPA 3OSOA 4IALA 5CC4A 4LAAA 2F0DA 2PYKA 2KQ3A 3C1EA 4KHVA 3NK9A 4EVOA 5CV8A 2F0WA 1KAAA 2OXPA 3D4DA 3DHQA 4K14A 4K8IA 5IGBA 2F0JA 2EYLA 5I9OA 2EYMA 1ENCA 4J1MA 2EYJA 3HZXA 1NUCA 4WRDA 5I6WA 1NSNS 5EKLA 5F2DA 2F3WA 1JORA 5IGFA 3MHBA 4PMBA 3OWFA 4F8MA 1STAA 5KRUA 1EYAA 2EYPA 3PMFA 2F0KA 5CV7A 4EQPA 5C4ZA 1JOQA 3EROA 4NMZA 1JOOA 1SYBA 1SYGA 1F2YA 3HEJA 1F2MA 4QF4A 5I6YA 4NKLA 5IGDA 2EYFA 4ID6A 1JOKA 4ZQ3A 3MXPA 2F0MA 3LX0A 5K5PA 3ERQA 3P75A 4TRDA 2F0UA 5C5LA 1A2TA 2F0GA 1STYA 1RKNA 3C1FA 3SXHA 2F0PA 4KY5A 3NUCA 3R3OA 1ENAA 5CV6A 2PW7A 5I9PA 5CR3A 1AEXA 1SNCA 2F0HA 1F2ZA 2RKSA 2WACA 1EY9A 1STBA 3D8GA 5E3FA 3SHLA 3TP7A 1KDBA 5KIXA 4QMGA 3SK4A 3BDLA 4DU9A 3D4WA 4K5WA 3TMEA 4EQOA 3OMGA 4F7XA 1EY5A 4KV6A 1IHZA 1SNMA 4K6DA 5C3WA 5J22A 1EY0A 2LKVA 5CGKA 2ENBA 2QDBA 3D6CA 4K2LA 4PNYA 4H7BA 3T16A 2KHSA 2EY6A 2EY2A 2F0NA
chains in the Genus database with same CATH superfamily
4GKJQ 1CA5A 4DAPA 5FLXE 4K0KQ 1RDPD 4A3KB 1LO5D 4X62L 1LTBD 5IOCA 2XIWA 2WB1E 4UHVA 3PO2G 2PZWA 4DR2L 4EQ5A 1VS0A 1UE1A 5K36G 2BA1A 5DAUA 3V2TA 1VQJA 1ET9A 4DFAA 1OXUA 2K6AA 2HCIA 4KD3A 4QCLA 5HGTA 2EXDA 4GNXB 2VB2X 1KDAA 1XMQQ 3RUZA 3OIQA 4ZYSA 1YNJD 5C3EG 4DAYB 3NENA 1A2UA 1Z6HA 4FXKC 4OX9Q 2EOTA 4GOPC 3GTKB 3GDEA 4GN5A 2JEBI 1VQ6A 3G4SA 4R8NA 5DEHA 3CW2C 4NPSA 1D1KA 4JI2Q 4X3KA 5AFWA 3JAML 1HCZA 1SMYC 2B2YC 4A3FH 4JCVE 5IE8A 2M9VA 3K57A 5GROA 3I55A 3HGBA 2B29A 2R92B 3M4PA 1JICA 2R7ZB 3TS2A 2F0OA 3VYTA 2K5HA 2HUGA 1FVIA 3S16B 1CKOA 4JVZA 4ZKCB 2OWOA 4IFDI 1MI2A 3DWPA 1KD1C 4Y52H 3DXJC 3DM3A 1S5ED 2JP1A 3I70A 3IFDA 2EYMA 3PO3H 4C3JH 4J1MA 1G291 4O0AA 5M3MH 1LTGD 1EUJA 3OWFA 1EQTA 2NZHA 2UUAL 2A73B 1F2MA 1EU4A 1HHVA 3GTQH 4OXPA 1G91A 3UDIA 3SXHA 2Q8RE 2Z1CA 2L1BA 3W5OA 1HNXL 1JT8A 4YY3L 1SAPA 4JI1Q 2UUBQ 1KLGD 2EE1A 4DR3L 1BCPD 3PIO3 2ZT9C 1TXYA 1H9KA 3F2CA 3CQZH 4X62Q 4CHTB 1JR0D 1IYVA 2IL8A 5LMNQ 4DR2Q 3I90A 2NWGA 2L12A 1V1PA 2EY6A 4O42A 1ENFA 2MO0A 2XSCA 4QJFA 5M3MG 2EPBA 5GADC 4JBJA 1O7YA 1W6KA 1IW7C 1P8LA 4BBSB 3J81E 4B08A 5JEAG 3NPPA 4R8IA 2A74C 1EIGA 4CKBA 1YNXA 1H9RA 2NVYB 3BYYB 4CBVA 3K81C 2DJFC 1X3FA 1J5EQ 4ZUJA 2OTJA 4JYAL 3QOJA 4DV1L 1WD1A 3S14B 2L9HA 1PZID 1XYIA 2JN4A 4HN7A 4KKSA 1R4QB 5IYDH 3DMUA 3VDYA 1BCPB 1X32A 1PFNA 4KK7A 3BZCA 2JA6B 2YV5A 2Z8LA 2HDLA 5M5XB 2NUCA 3KLWA 5KEEA 1H9SA 3SK6A 1Q7YC 3S15B 4K5XA 2GVBA 1YHBA 2F0VA 1STGA 3KDFB 2VUMB 2A6ED 3TRZA 2UXBQ 3SK8A 2B8GA 4OO1H 2I46A 4G7OC 3KF8A 2UUAQ 4DAVA 2D0PA 1ZEQX 4C3IH 5IYDG 3VR5A 1NE3A 1IZ6A 4IPCA 3AQQA 4LMQD 1EFID 1K73C 3JAMc 5EKLA 5M5YB 1WYDA 1TWHB 5CV7A 4YY3Q 2F0KA 2L11A 1ML0D 4DR3Q 1O78A 5C4JH 2NVTH 4HIDA 1DJRD 3F2UA 3I73A 1M4VA 2NVXH 5K5PA 2Z6KA 1QWYA 1A2TA 2XN9C 2I0QA 1Q82C 4DPGA 1PYSB 4BWGB 3S1QH 1O7IA 4JI7L 2K04A 5CMDA 3G71A 5IP9H 2B63B 4OO1G 2Z4HA 1M8AA 2ZJPA 3OOCA 1VF7A 2RSOA 4IUVA 3GTGB 2AHOB 4C3IG 3M4OB 1ILPA 1LM0A 3VYUA 3RZDB 4DUZQ 4IOCA 1KLUD 2VQFQ 3T51B 4GKKL 1B9NA 4A93H 5JJZA 1N36Q 3E3XA 4C2MH 2B2WA 4F88A 4KMUC 3PIPA 1TT2A 3CC7A 1C8CA 3D3RA 4FF1A 4Y7NH 3RZOB 1Z47A 5IYCH 4DV5L 5IP9G 3QWNA 2K14A 1B3QA 3I4LA 4AH6A 3GTMB 3RLFA 1S40A 1E22A 4L8JA 4Z9CB 3U4VA 4YCWA 3TZDA 4TKOB 2E8GA 2B2UC 4DV6L 2MQHA 2JA8H 1VQ8A 1K9MC 3M4YA 4C56C 2DUDA 1A15A 3I3CA 2E5LQ 4A93G 3GQBA 1VQIA 4JBKA 3FKIB 1K0SA 1A3UA 1LYLA 3GTJH 5IY0A 4BY7B 1K3BC 4GNXA 2A1AA 4FF2A 4FXDA 4M1UB 4QB4A 3ZJYC 3NE5B 5IYCG 3URYA 5CBAE 2JA5B 3M7GA 1HJPA 5LMNW 4XQQA 3D4DA 5C44B 2EYLA 3ICEA 4R4OA 5AJ3L 1C48A 1GUNA 2EYJA 2GN5A 1RIPA 5IGFA 2R93H 4QY7A 2Q8TA 1X3QA 1CUKA 1C7YA 1N34L 1PH6A 4JI7Q 1JB3A 3A8KE 2VQEL 4U68A 2KCNA 3U9SA 1O7LA 2LS01 4ID6A 5T1GA 1QCBD 3F8TA 1T9HA 3S2DB 1BVSA 3SVMA 4JV5Q 5CV6A 5C0XJ 2J4XA 1NNXA 4DU9A 1I4RA 1VQFA 5E3FA 1TWAH 4P74A 4QUFA 5DM73 3NEMA 4F7XA 3D0FA 4WJ4A 2R6GA 5BN4A 2RQXA 1EWCA 4GZYC 1IKMA 4IPDA 2XRSD 2CW0D 4OEMB 3FDTA 2E2DC 1C9OA 4X65Q 3H6MA 4AYBB 3CCMA 4Q0FA 1DM0B 4A3IH 2CVRA 1WCMB 1XNQQ 2LFNA 4WORA 3BS1A 4R4CA 3K58A 2NVQB 4XTCS 5BN3A 1CHQD 3GV6A 2EYOA 1AZPA 3BVMA 1IBLL 2IJ0A 3IKJA 3VR3A 4OL7A 4DV0L 2HT1A 1DXMA 5DM63 3D6WA 3OPOA 4AYBE 4FNFA 2IX1A 5FLXc 1SYFA 1Q8KA 3ULLA 3AMUA 2CCZA 2B2VC 4OIKA 1M1KC 4HJAA 4O2DA 3TEHB 1WTVA 4C1NK 5G3LD 3P7JA 4A3IG 4NXML 2D5DA 4J15A 1I4HA 3PUWA 2DY7A 4A3DH 2ZJRA 1AP0A 3I2ZA 3BVGA 4QL5A 4RFBA 4JI6L 5AJ3Q 1H9MA 3PIP3 3I4NG 4POGA 2QEJC 4IJHA 1G2TA 1GOZA 3HFZB 4KHVA 2EIFA 2IWHA 1N34Q 5GQOA 3U50C 4R9WA 4AIMA 2VQEQ 3BDOA 4A3EB 3D4RA 2LXJA 5C0XH 4A3CH 3HRZC 1KHIA 1D5ZC 2JA7H 2VL6A 1YJNA 1VQGA 4PV1C 3PMFA 1JOQA 2A6HC 1N33Q 4CKCA 5EQ0A 4B3SQ 4A3GB 1U4LA 3KYHC 2VXWA 3KDFA 1CI3M 1RHPA 3TDQA 2UUCL 1SFOH 5C4XB 1VMCA 5C5LA 2Q2TA 4A3DG 2SDFA 1STYA 3RD4A 4KY5A 3PV0A 4LFBL 1HR0L 1B2TA 1LTTD 1PRTF 1Y1WB 2F0HA 4LF7L 1I6HH 4YHHQ 2B2TC 4FDBA 1S5CD 1HH2P 4R4IA 2WP8J 3H0GH 1UUPA 4ILWA 3OMGA 1EY5A 4DR1Q 2YTYA 1CM9A 1SNMA 3NTKA 4KHPL 3WOEA 1AE2A 1RTOA 2Z9HA 4ZKBB 5C0XG 4A3CG 2JA7G 4B9WA 3DM1A 1IKLA 4WJ3M 4UAIA 2XTIA 3GTLH 1S5DD 4BY1H 2PQEA 4K5VA 4B3RL 3TP5A 5ELFA 3HOXB 2KCTA 1QNUA 2PNRC 2PZTA 2CH4W 4ZK9B 4DXGA 5ELDA 3SGIA 1Q90A 2RHQB 1FNWA 1KAWA 5C4HA 4P75A 1XPOA 1XNRL 3M85A 3K8AA 1HNWQ 3A74A 3H0GG 3EQLC 1DOLA 1I4PA 3B6YA 1KABA 2DNCA 3STBD 1DYQA 3AB9A 2EXZA 2KA7A 5LHY1 3J7AV 5BR8L 1Y1VH 2WAQB 3H3VC 2LSSA 5I2XA 4RGMA 1TKWB 1HUNA 5FKAC 1PTOF 1Q81C 3J81c 2F0QA 5IGCA 5IGEA 4BY1G 3HOVG 4OHJA 4POFA 2K03A 1D8LA 1C4QA 1ZYRC 2MFIA 4DK6C 2K1BA 2K5VA 2M2LA 4RGTA 1EOTA 3BVZA 2Q2HA 1HNZQ 2WAQE 1RTNA 4IALA 3RR5A 1W3SA 5A35A 1X65A 2AMCB 2QW7A 2K33A 3E0JA 1CSQA 2A5HA 2UU9L 1R4PB 1O7ZA 4PG3A 1Y1VG 2R7DA 4TQUS 1PTOH 4DNIA 2UUCQ 1FL0A 2F4VQ 1EIFA 2F3WA 4V0BA 1E2WA 2MO1A 1DOMA 1VQHA 4R4QA 5C4ZA 1HR0Q 2A68C 1SYBA 2E2IH 2VY3A 3X3MA 2YYZA 1S4ZA 5GAHC 3PIOA 4HJ9A 3EBEA 1RF2D 1PHJA 1OO9B 5EJWA 1BR9A 4IO9A 1EQQA 1GXDC 3IL8A 4KHPQ 1SMYD 4ZLTF 1STBA 4RGOS 4RMFA 2RDHA 2D0OA 3J7YW 4ALPA 1VQ7A 1SBBB 3WDNA 4UY8C 3L3OC 4PZ7A 3HOUB 2IW3A 3S2HB 2C9OA 1PV4A 5T1IA 2PO4A 2ES2A 2PPBC 2BDOA 1II3A 3K7UC 3P20A 1EIYB 3HKZG 3NTHA 3S24A 2MNAA 1VQPA 3TZUA 5H1SE 2ZJQA 1GUOA 2FMCA 1R9TB 4DAMA 2KEDA 1U5KA 1X54A 4EQNA 3S1NH 3EVQA 5BR8Q 1YZ6A 2R7FA 4GOPB 3HOWH 1NR2A 1V8QA 4PZ8A 1X3PA 4HEDA 4C3HB 4RHSA 4KY6A 4UDUC 3SDZA 4CDDC 3E5SA 2VNUD 4HTHA 5ELCA 5D3DA 4KN7C 3UE1A 1X6OA 3KOJA 1CHPD 2V1CC 3CMAA 1N8RC 4KJOA 3Q8DA 1EFWA 2UU9Q 5IYBH 4HAEA 1MSHA 1OXXK 5L37A 1IW7D 2X6LA 1J9OA 1SMXA 2AQ3B 3KLRA 2IX0A 4RH6A 3HOWG 4FF3A 5M3FH 2G9DA 2HDMA 1KQSA 1GHKA 2F1MA 1N9WA 2Y0SB 5EAYA 3PUYA 4LF9L 1STAA 1F9PA 1E3PA 1J8IA 1LACA 4FO2A 1FNUA 2N8NA 4WJWA 1WTWA 4YCUA 1JOKA 3OW7A 1B44D 4DV7L 1I4GA 5IYBG 1ASYA 2VZAA 1L1OA 2BH8A 1KTKA 2QILA 4QMGA 2A69C 3SK4A 3CF5A 2Y0SE 3T1YL 5M3FG 1D7QA 2CHBD 4KV6A 3AFQA 3G6JB 2X69A 1IHZA 2XWJB 1IBKQ 2RSNA 3GTOB 1YI2A 3D6CA 4K2LA 2L5TA 3Q23A 2O5JC 3S1RH 4A3FG 2OQKA 5C5MA 4NDXA 2MPMA 3W1GA 3K59A 1GVPA 4YWLA 5NUCA 3ULPA 1B3AA 4PMWA 3TQYA 3GV3A 4JI4L 1I50B 2NTSA 1WOCA 4LFAL 2DGYA 1XMOL 2F3IA 2KOLA 4DR5L 1QJOA 2E76C 2K4KA 3UDGA 3K5MA 4A3BH 4HMJA 4J6HA 5EKIA 3PO3G 4C3JG 2FXQA 1VQOA 1EYGA 3EJIA 4DR6L 4A3MB 4KKUA 3OIPA 1PYBA 3G7LA 5JVG3 2WFWA 3I56A 1K3RA 1HR0W 2WV6D 2L0CA 1I3QH 3PUXA 2YU9H 5FJ8H 4UPAA 2BE5C 4KTAA 4LF4L 4IUUA 1B7YB 1U4RA 1CKNB 4BA2I 5C3XA 4OONA 2MJ8A 3KFUA 1YNJC 4L5SA 1AN8A 3PQIA 4FVMA 2E75C 5IWAL 4A3BG 4QIWB 3RN2A 2JQOA 2ICIA 3M9BA 4A3KH 4LAAA 1VF5C 4DV3L 1HTLD 2J7ZA 4K14A 4X66L 3HOYB 3NELA 1DOKA 1NUCA 5CBEE 5F2DA 2IHEA 4DV7Q 3DWQA 1MD2D 2WB1G 1F77A 2N55A 4I7ZC 4N8X1 5FJ8G 2YTXA 4G4KA 2MP1A 2WIIB 1QUQA 3U58A 3J80c 3T1YQ 4ZAIA 2B3GA 4QIWE 1TS4A 4LFCL 3A55A 1RL2A 2RVLA 3GTKH 2E2HB 3MFYA 4HCEA 4L5TA 4CDFC 2RKSA 1KRTA 3JAMi 3BG3A 4A3KG 3M7NA 3CC2A 3A56A 3H3VI 2O2LD 1HNXQ 4PNYA 2R92H 1RD9D 2ZXRA 4MIUA 2F0NA 2R7ZH 4J8QA 3TN2A 4JI4Q 1PFBA 4JOIA 2UXCL 1XMOQ 4M8AA 3S16H 1D2BA 4I65A 5M9OA 1N32L 4C1NI 3PSIA 4CJ1B 2HCCA 2AWNA 2VS1A 3QO2A 1XWEA 4DUYL 1NAPA 5JAVA 1GKHA 2RF4A 2A8VA 1GJXA 4H0LC 4BXXH 5KYLA 3I7FA 4RKBA 4N8FA 5FLXL 2R92G 4FYDA 1EQVA 2C5CA 4JYAQ 1EIHA 3R2TA 3V96A 2QEXA 3TP6A 4DV1Q 3JC66 3MEHA 3CD6A 4DNRB 3I4NB 2NN6H 1EYCA 5IWAQ 2MUYA 3LWEA 1PDQA 4RCNA 3K5NA 4GOPA 1FYCA 1TS3A 3NHHA 3F2BA 5KYIA 4XIGS 1MIUA 2K5WA 3BDCA 4H02A 1BCPF 1L0XB 1GM5A 1FJGL 1I94L 2PQAB 2JK8A 2B2YA 4BBSH 2BA0A 2KCMA 2AQ2B 4WRDA 4F87A 1TWCB 3L0OA 2NVYH 4LFCQ 3MHBA 4F8MA 3IFTA 4A3LH 1EYAA 4XYQA 3K0XA 3S14H 4JI0L 3NBHB 2NN6G 1NY4A 5EBCA 2EYFA 3K7AB 1PA6A 3L2PA 1HA6A 2JJQA 4DAYA 4DK0A 3NSWA 5E4XA 5D14A 3MXGA 1GO3E 1AEXA 1SNCA 2WACA 1F2ZA 3K0YA 2JA6H 5FOBB 5M5XH 2FHTA 4HSPA 2ZTCA 2QKIC 2ZXPA 2UXCQ 4LWCA 2JA8G 4BBSG 1HZCA 1D1IA 2OTLA 1JWSD 3S15H 2EJMA 2G9HD 2TSSA 2ZM6L 3CU7A 2Z6BA 1TIID 2VUMH 4A3LG 4JI3L 1TY2A 2WKCA 3CCRA 4FP5D 1W6JA 5EPJA 3FVQA 1E1OA 1K83B 1UEBA 2KEEA 1NMGA 5M5WB 4HR7B 4QUCA 1SLJA 1X55A 3KLSX 4GKKQ 1EOVA 4DV4L 5IT9c 4A3JB 4IPHA 2JA6G 3M3YB 3EFXD 1GUTA 1FNVA 5M5YH 1TWHH 4H44C 1E24A 2NBFA 4BA1I 3VR2A 3QG1A 1V1QA 4G7HC 4LF8L 2Q8IB 1JCKB 2R93G 5HGQA 4YIJA 3HOVB 3HOZB 3CCLA 3J7A5 3S17B 2RCNA 1G8ZD 4G57A 2JE6I 1TWGB 3F2DA 4DV5Q 2QF7A 2SNSA 3J81L 2VUMG 1TWFB 1A3VA 5IIFA 1BBUA 1PFMA 5CV9A 2UXDL 4IZ8A 5I2YA 3SK5A 2EDGA 4JPBW 5COYA 2B63H 1I94Q 1EL0A 2E2JB 1K28A 1PZJD 3QR8A 3S1MB 4DV6Q 3GTGH 4JBMA 5DLQE 2QGQA 3C2PA 3FP9A 3QB3A 3M4OH 5A2QE 3MTSA 3RZDH 2K7VA 3ITPA 3I4MB 2KECA 4IFDJ 2V4DA 3VR4A 1PZKD 2EJGC 2F0WA 3G6EA 1S5FD 5IGBA 1CK1A 1DONA 2K5NA 2KENA 1PH8A 2JEAI 1XTDA 1F9RA 1JORA 2PI2E 3ULJA 1PRTC 1S72A 4NMZA 3CAMA 2EJFC 3M4QA 3RZOH 1CKNA 1BQQT 1PH9A 4OO1I 2I07B 1OXTA 2B63G 3GTPB 3GTMH 2E74C 2F0MA 4LUZA 3P75A 2F0UA 1SN8A 3C1FA 2I5MX 4RAUC 5CR3A 2XWBB 1PFSA 5JJKA 3SHLA 2ZM6Q 4DNTB 4LF6L 4IOAA 1UEAB 1EEID 1ZYRD 4IN3A 3FKIH 2LKVA 3A54A 5CGKA 2ENBA 1X3GA 4JI5L 1U4PA 4BY7H 1WFQA 5FO9B 3ZYYX 3E0EA 1EY7A 4AQYL 1D5XC 3VA5A 1MGSA 3K6OA 4DV4Q 1EY4A 2F0TA 3HP3A 4X6AH 2JA5H 2FFKB 3MZ5A 3CHBD 3JAME 3CP0A 5KNDA 1LT6D 4P2CB 4CJ0B 1VMPA 5C44H 4KY7A 1IYJB 4GLVB 1SR3A 2I5HA 1PH5A 3PO2B 2A68D 2CKZB 1W2BA 1PTOC 1STNA 4IQZA 2F0IA 1Y69U 1G2SA 4UP9A 1SYCA 5CV5A 2SOBA 1A3TA 2UXDQ 3NQIA 1SRUA 4KLKA 4BY7G 3S2DH 1FR3A 2NN6I 1XX8A 3LGJA 2Q2UA 4B3ML 5KNBA 2VB3X 1IBLQ 4DV0Q 2CWPA 1EY8A 5C3EB 4IFDH 2KBNA 3A7AB 4L5QA 4LF5L 3RLNA 2JA5G 5ELEA 5E4WC 3ND8A 1QG7A 3Q24A 2B2UA 2LMCB 4K8JA 2OEOA 4JI8L 2DNEA 3O13A 2F0DA 2KCCA 4NXMQ 5CV8A 1TS2A 4K8IA 4FF4A 1YVCA 1Y8PB 1WCMH 4JI6Q 5ELNA 1SE8A 3F1ZA 3T53B 1LT4D 1BDOA 4BBRH 2O5IC 2NVQH 1HFNA 4KI0A 1BKBA 2KJXA 1VQ4A 4IFDG 1SYGA 2ATWA 1K8GA 5I6YA 5IGDA 1JMCA 4KHZA 2WINB 1G51A 1YHAA 1DGSA 1X56A 3WWVA 5HY6A 1ENAA 1B50A 2H1EA 5FO8B 4KKTA 3A8JE 2PQAA 1VDZA 1ZKOA 1DD2A 1GHJA 4K0KL 3V05A 4A3FB 4OWWB 1ILQA 4AYBG 4AQYQ 1PLFA 3K5LA 1NCVA 4IURA 1EY0A 1KIXA 1WJJA 2QDBA 3Q22A 4LFBQ 3AFPA 1WCMG 2EY2A 2QCPX 4LF7Q 4MTNA 1DCZA 3NBHA 2OQ0A 1SYEA 4BBRG 4L5RC 3HKSA 2SNMA 2O4XA 3KF8B 1JE4A 3J81j 1XMQL 2VW9A 3PO3B 4C3JB 5G3LF 2K28A 2RDGA 5BN5A 5M3MB 4OX9L 3BYTB 4A3EH 3A5ZB 2K75A 2D62A 2L4NA 5EKKA 5D3IB 2Q2IA 4GN4B 3UI2A 2AUKA 3NTIA 4HCSA 4B3RQ 3GTQB 3SR1A 4JI2L 3MEFA 1HZ9A 5CYUA 2TMPA 4A3GH 4LF5Q 3TP8A 1YNNC 4ZCKA 1QZHA 1XNRQ 2L55A 3NWSA 4CKEA 5C4XH 5JJIA 3R2IA 3CCEA 4DF7A 2A69D 3MVVA 2I5LX 3CQZB 1Y1WH 1RCVD 4JI8Q 4X64L 2Z4IA 1YHQA 1SEBD 4XDXA 1L2FA 3CC4A 4RHRA 2OCEA 1UWVA 4OGQC 1S5BD 3E9IA 4A3EG 3HG9A 5E1FA 1GUGA 3G48A 2B2VA 3ONAB 1JWUD 3STBC 5CC4A 4ULLA 4I7AA 1K8MA 3C1EA 1MJCA 2YU9B 1I4XA 1MHWC 2Z6KC 1KL9A 1HFGA 3OWEB 4A3GG 2J0TD 2R3ZA 3HOXH 1CKMA 5I6WA 1TVXA 2CQOA 5C4XG 1YJ9A 4PMBA 5JPMC 1HQMC 4JI1L 1NBWA 1JOOA 1UE5A 2PI2A 3DUZA 4RCOA 3HEJA 1F2YA 1GD7A 3EIVA 1NR4A 2RCFA 1Y1WG 3UDXA 3J80L 4JW0A 3EA6A 3TSSA 1HA5A 1HTPA 1BF4A 4MTKA 5LMNL 4DKAC 2N88A 4DR7L 3GP7A 2BE5D 2NZOA 4RGNA 2IX3A 5C0XI 3IAYA 2AWOA 3PCOB 1L0WA 3D4WA 2B2WC 3FPUB 3TMEA 1CQVA 3UDFA 4U673 2K32A 3CMEA 3HOXG 2KHSA 2LY7A 1Q46A 1ESFA 1J5EL 3KLSA 2H4OA 4MZ9A 2B2TA 5IGGA 3T4AC 4C3IB 5DNFA 5JOBA 4PMCA 3X3NA 4K2KA 1A0IA 3NQTA 3A5UA 1Z9FA 1SXTA 1SNQA 4P73A 2PW5A 1KDCA 3DEPA 2EZVA 2CFMA 2WAQG 3FMCA 3H15A 4LJZC 1WTRA 5C4JB 2NVTB 3U4ZA 5KNCA 1CFMA 4FXGC 2H5XA 2NVXB 1BBXC 4YCVA 5IP7H 4L6TB 2P5ZX 3A0JA 3TBIB 4GNXC 1S3OA 1AZQA 2HIVA 4XT3B 4X64Q 4GLAC 3S1QB 1XJVA 3E6ZX 4RWSC 2XRQD 4HJ5A 2KHJA 1RODA 3R93A 2F52A 4N9PA 2UXBL 5LMUL 1AW7A 5IODA 3L9AX 3W2DA 1VQEA 3EN2A 2R61A 1A63A 4XQNA 3NP8A 2FMMA 1VQNA 5J1ZA 5JEAH 5JJLA 1ASZA 3HOUH 3S2HH 1EZ6A 2F0EA 5J39A 1MJEA 4A93B 4KJNA 3A7LA 1ONLA 4C2MB 4HSVA 2N3SA 4RG1A 1QVCA 5ELOA 4YWKA 5IP7G 1LT3D 4NB3A 3TREA 4HJ7A 2BCOA 1I6VC 1R9TH 1TU2B 4Y7NB 4DV2L 5KRUA 2EYPA 1NJIC 2K5DA 4P71A 4DR7Q 1HZBA 1KRSA 1PH4A 3ERQA 4C3HH 4LUOA 4TRDA 2JA8B 1XTCD 1BNZA 2D2CC 4LF9Q 1O80A 2F0PA 3NUCA 2NYZD 4L63B 3HOUG 1LV9A 1NTGA 4HIKA 4DUZL 1EY9A 2VQFL 1SE2A 3GTJB 4ABNA 1N36L 4K6DA 1OXVA 1GUSA 3W3AA 1IBML 3KF6B 5J22A 1I5FA 2QDLA 3J80i 1KC8C 3FHWA 2HIXA 1BBWA 4CJ2C 5EGTA 5ELBA 1STHA 2F0SA 4IUQA 2N49A 1EY6A 1Q3LA 1T5EA 1U0LA 2X6GA 5EBDA 4Q5VA 2F0LA 2HQLA 4MHEA 2F3VA 2ASBA 1UE7A 2K52A 2PZUA 4XT1B 3RMHA 3CCJA 2KVMA 2PCFB 1SNOA 3MXUA 1Q1BA 4C3HG 1PH1A 2R93B 3VA7A 3C46A 3AYHB 2SEBD 1AH9A 2OT2A 5IT9L 3RNUA 2F0FA 3TS0A 3MA2B 1L0YB 4HIOA 2A19A 2E5LL 2RDFA 5LMUQ 5KGUA 1K0RA 3HS0C 1SJED 3AEVA 1T5XD 1PVOA 3OMCA 4LFAQ 4CGYB 2GVAA 1STEA 1SYDA 2IT1A 3I91A 4GS3A 5HURA 3S9WA 5ISRA 4DR5Q 1TWAB 1VQBA 2CH4A 1UAPA 1F2LA 1E7ZA 3Q0AA 1BCPC 4DR6Q 4E6IA 1EWHA 2EQSA 1AFPA 4IPGA 1LUZA 3R8BA 3GTOH 2OF1A 1E0BA 4DA2A 2JYOA 2Y0SG 3LNNA 1TR5A 1QNKA 3OSOA 4DK3C 4DV2Q 1RJTA 3FEWX 4KN4C 4A3IB 3N52A 3NK9A 3NWTA 4LF4Q 2OXPA 2R7ZG 2F0JA 5I9OA 3H09A 1ET6A 1I50H 1B9MA 1OTCA 3I8ZA 4JV5L 1YBYA 4DV3Q 3EROA 5FK9C 2FJ2A 1P16A 3OTOL 4X66Q 4X3SA 3PGZA 3D31A 3DLLA 5I4DA 1X9NA 3MXPA 1NMFA 1WTPA 4A3MH 1BO0A 4OWXB 2F0GA 2FINB 1IBMQ 5I9PA 1PMRA 4BXXG 5KIXA 4X65L 1CTMA 1VQAA 1Y8OB 1A8VA 4UP7A 4XYOA 1FGBD 1V1OA 3VYRA 1U4MA 2JXMB 4A3DB 1JWMD 1CZWA 3K5OA 1BOSA 1KNEA 1XNQL 4GLXA 3KJPA 1KNAA 1Q12A 3P1HA 3C3LA 1PYWD 1WTOA 2XGTA 1SDFA 4NXNL 3T56B 1WTQA 2A6EC 4EQPA 2M00A 1QILA 4ME5A 3Q6SA 5EPKA 4MNOA 3HOYH 3W1BA 3CCSA 3MXNB 5LL6X 4A3MG 2WKDA 4S3SA 2JA7B 3MAQA 4IJLA 3KJOA 3CCVA 1PRTD 2HQEA 3H91A 3I72A 1LTID 4DR4L 2F4IA 2ZTDA 4PZ6A 1A6XA 2RHSB 1MSGA 1SFOB 4B9XA 1H95A 1SJHD 5CORA 3VR6A 1XPRA 1N32Q 1VCIA 3T13A 2QA4A 1DZ1A 5TSSA 3WOFA 4DUYQ 1I6HB 1TQOA 4DN4M 1WVLA 2PNHA 3H0GB 2E2HH 2K05A 3N6RA 2NTTA 3UE0A 1LTRD 3FRPB 4KD4A 2A6HD 4PQXA 2HHHL 3HOYG 2MHVA 5CV4A 4QQBX 4WFN3 1JE5A 1CSPA 2G5DA 2Z0SA 1AE3A 3GD7A 4APVA 4IUNA 1LTSD 3J7ZC 3GTLB 4BY1B 1YJWA 2KQ3A 1HXYD 1YITA 1N33L 1Q8IA 4B3SL 3OTOQ 1PRTB 4CDCC 4JC0A 4NW2A 1ENCA 2LXKA 1B70B 1NSNS 3GO5A 1PTOD 1KXLA 1WI5A 1FJGQ 5LL6S 1SSOA 1E2VA 2BH2A 5GAEC 1ESRA 1F9QA 4YHHL 1VQLA 3BJUA 1WTXA 1K8OA 4BS9A 1Y1VB 4DR1L 1PXUA 2K5QA 1A62A 4LUVA 4X3UA 1IYUA 3BU2A 3H94A 4LK1C 2AKWB 4QGUA 4H13C 1PH3A 3CKIB 1K8AC 4JI0Q 1KDBA 1QOHA 2B39A 4BBRB 4K5WA 4NXNQ 3KBGA 4EX5A 1LABA 3I4NH 1F9SA 1EQRA 1BXTA 3I4OA 2XVSA 2ALYB 4OIJA 3CPWA 1QZGA 1LT5D 2B8FA 1E2ZA 2NB0A 1G6PA 1QVFA 4YWMA 2ID0A 1HUMA 2KUMA 4RA8A 2EYHA 3BZKA 4DR4Q 1HNWL 1Z7TA 4GN3B 1YEZA 4NP5A 5GAGC 3SE0A 1PTOB 1VQ9A 2DY8A 1TWCH 4JI3Q 1JJGA 1EWIA 4JK1C 4O1NA 3QOLA 3MFGA 3SEBA 2E2IB 3J80E 1TY0A 1UNSA 3HKZB 3KF6A 1M90C 2RBMA 4OWTB 1MBYA 1JJ2A 3PF5A 2NZ1D 1SE4A 5EPLA 3CRKC 1LLRD 1LTAD 3K7AH 2GA4B 3NXWA 2D9UA 1L1OB 2HHHQ 1EYDA 3A8IE 3DWAA 2XNAC 2JA9A 1HNZL 3FPPA 4LF8Q 4R1JA 4LNQA 1JC7A 1CA6A 3NBIA 1VQMA 3HKZE 1IL8A 3J7AF 1HPCA 4HIMA 4X3TA 4ZUIA 4RKLA 3K80C 2CW0C 2F4VL 3IRBA 3FKIG 2CWAA 3KBXA 3LWUA 2DN8A 2PYKA 1ICFB 1CQFA 1KAAA 1Y14B 1K83H 3CPFA 1CT1D 3S1NB 3HZXA 5M5WH 1XPUA 2DJGC 5FO7B 1BUVT 1Q1EA 1L1OC 3HOWB 4LW1A 2IHFA 2K50A 3CRLC 4V190 1V1PB 3AU7A 4A3JH 3DEOA 3M3YH 1V9PA 4DXFA 5C44G 3T1HL 4QF4A 1YIJA 1YNND 3OYYA 4ZQ3A 1J6QA 3BZDB 3HOVH 4B3TL 3L7ZC 3S17H 3HOZH 3J81i 4UP8A 1D5MC 1EEFD 1D6EC 1SROA 1V43A 4CDEC 3D8GA 1TWGH 1EU3A 3PUZA 4R4TA 4JBWA 5JVH3 1TWFH 1HZAA 2CQAA 4MN3A 3T16A 4TSSA 5J3BA 4H7BA 2E2JH 1PH7A 1JJCB 3S1MH 3U9OA 1GUWA 2EVBA 1H9JA 1E1TA 4LF6Q 2N78A 4DK1A 1B4OA 2IY5B 5M3FB 4G7ZC 4A3JG 5D65A 3I4MH 4HMIA 2JSOA 2EY1A 2RA4A 1ZXTA 4A4IA 4JI5Q 4GKJL 1H9SB 4TVAB 1HRJA 1JQYD 3MWYW 4A75A 3HOZG 1VQKA 1SNDA 2EY5A 4OELB 4N9TA 2PMZB 3QIAA 3KK7A 5E7NA 4K6LA 2BDNA 1QUQB 5C6AA 1LTLA 1WTHA 1XXGA 1VQCA 2YTVA 3ERSX 4EGVA 3GTPH 1U9RA 3VYSA 4XQJA 1SNPA 1X3EA 2ICEC 2MGSA 1PH2A 3ER0A 4ODGA 1QVGA 3PF4A 3MXNA 3I4MG 1C0AA 1TS5A 1JB7A 2PMZE 2ZTEA 4DGZA 2AUJD 2BOSA 1EZ8A 1B8AA 4B3MQ 2HD3A 3S1RB 2L15A 1SE3A 1FGUA 4ME3A 5JPNC 1OXSC 3OHXC 4HJ8A 4EVOA 5FLMH 1IL2A 3DHQA 3T1HQ 1QB5D 2K01A 3E9HA 2IPKD 3KUPA 1UE6A 1QE6A 4JG2A 3CCUA 1HQRD 5IT9E 1FD7D 1B1ZA 1CZGA 4A3BB 1MKHA 2C35B 4B3TQ 1VQ5A 3ND9A 3PO2H 3RN5A 3OW2A 1B53A 1Q86C 4P72A 3H3VH 1I4QA 4NKLA 5K36H 1ICWA 3RLOA 2F03A 5A2QL 3LX0A 1IBKL 4XXEA 4A76A 1RKNA 2WB1B 3R3OA 3QJYA 2PW7A 2ZXOA 1I3QB 3CCQA 4JOIC 4IUTA 4ZRZA 3MC0B 3TP7A 3BDLA 2AQ1B 5C3EH 1G6ZA 4EQOA 5FLMG 5JEAJ 1WD0A 1IXRA 5C3WA 4IUPA 1Y8NB 2UUBL 2KHIA 3PUVA 1VQDA 3CXCA
chains in the Genus database with same CATH topology
1CA5A 4DAPA 5FLXE 1RDPD 4A3KB 1LO5D 1LTBD 5IOCA 2XIWA 2PZWA 5K36G 2BA1A 5DAUA 3V2TA 1ET9A 4DFAA 1OXUA 2K6AA 2HCIA 4KD3A 4QCLA 5HGTA 2VB2X 1KDAA 3RUZA 3OIQA 4ZYSA 1YNJD 1A2UA 1Z6HA 4FXKC 2EOTA 3GTKB 2JEBI 4R8NA 5DEHA 1D1KA 4X3KA 5AFWA 3JAML 1HCZA 1SMYC 2B2YC 2M9VA 3K57A 3HGBA 2R92B 1JICA 2R7ZB 2F0OA 3VYTA 2HUGA 3S16B 4ZKCB 4IFDI 1MI2A 3DWPA 3DXJC 1S5ED 2JP1A 3I70A 3IFDA 2EYMA 4J1MA 1G291 1LTGD 3OWFA 1EQTA 2A73B 1F2MA 1EU4A 1HHVA 1G91A 3SXHA 2Q8RE 2Z1CA 2L1BA 1SAPA 1KLGD 2EE1A 1BCPD 3PIO3 2ZT9C 1H9KA 4CHTB 1JR0D 1IYVA 2IL8A 3I90A 2NWGA 2L12A 1V1PA 2EY6A 4O42A 1ENFA 2XSCA 2EPBA 1O7YA 1W6KA 1IW7C 4BBSB 3J81E 4B08A 5JEAG 3NPPA 4R8IA 2A74C 1EIGA 4CKBA 1H9RA 2NVYB 3BYYB 4CBVA 4ZUJA 3QOJA 1WD1A 3S14B 2L9HA 1PZID 1XYIA 4HN7A 4KKSA 1R4QB 3DMUA 1BCPB 1X32A 1PFNA 4KK7A 2JA6B 2Z8LA 2HDLA 5M5XB 2NUCA 5KEEA 1H9SA 3SK6A 3S15B 4K5XA 2F0VA 1STGA 2VUMB 2A6ED 3SK8A 2B8GA 4OO1H 2I46A 4G7OC 3KF8A 4DAVA 1ZEQX 3VR5A 4LMQD 1EFID 5EKLA 5M5YB 1TWHB 5CV7A 2F0KA 2L11A 1ML0D 1O78A 1DJRD 3F2UA 3I73A 1M4VA 5K5PA 1QWYA 1A2TA 2XN9C 4BWGB 2K04A 5CMDA 2B63B 4OO1G 2Z4HA 1M8AA 3OOCA 1VF7A 2RSOA 4IUVA 3GTGB 4C3IG 3M4OB 1ILPA 3VYUA 3RZDB 1KLUD 3T51B 1B9NA 5JJZA 2B2WA 4F88A 4KMUC 1TT2A 1C8CA 3D3RA 4FF1A 3RZOB 1Z47A 3QWNA 3I4LA 3GTMB 3RLFA 4L8JA 4Z9CB 3TZDA 4TKOB 2B2UC 3M4YA 4C56C 1A15A 3I3CA 3GQBA 3FKIB 1A3UA 4BY7B 4FF2A 4FXDA 4M1UB 4QB4A 3NE5B 3URYA 5CBAE 2JA5B 3M7GA 4XQQA 3D4DA 5C44B 2EYLA 1C48A 1GUNA 2EYJA 5IGFA 2Q8TA 1X3QA 1JB3A 3A8KE 4U68A 3U9SA 2KCNA 1O7LA 2LS01 4ID6A 5T1GA 1QCBD 3S2DB 3SVMA 5CV6A 5C0XJ 2J4XA 4DU9A 1I4RA 5E3FA 4QUFA 5DM73 4F7XA 2R6GA 5BN4A 2RQXA 1EWCA 4GZYC 1IKMA 2XRSD 2CW0D 3FDTA 2E2DC 3H6MA 4AYBB 4Q0FA 1DM0B 2CVRA 1WCMB 2LFNA 4WORA 3BS1A 3K58A 2NVQB 4XTCS 5BN3A 1CHQD 3GV6A 2EYOA 1AZPA 3BVMA 2IJ0A 3IKJA 3VR3A 4OL7A 1DXMA 5DM63 3D6WA 3OPOA 4FNFA 2IX1A 1SYFA 3AMUA 2B2VC 4OIKA 1WTVA 4C1NK 5G3LD 3P7JA 2D5DA 1I4HA 3PUWA 2DY7A 1AP0A 3BVGA 4RFBA 1H9MA 3PIP3 2QEJC 1G2TA 1GOZA 4KHVA 2IWHA 4R9WA 3BDOA 4A3EB 3D4RA 5C0XH 3HRZC 1D5ZC 4PV1C 3PMFA 1JOQA 2A6HC 4CKCA 5EQ0A 4A3GB 1U4LA 2VXWA 1CI3M 1RHPA 3TDQA 5C4XB 1VMCA 5C5LA 2SDFA 1STYA 3RD4A 4KY5A 3PV0A 1B2TA 1LTTD 1PRTF 1Y1WB 2F0HA 2B2TC 1S5CD 2WP8J 1UUPA 4ILWA 3OMGA 1EY5A 1CM9A 1SNMA 3NTKA 3WOEA 1RTOA 4ZKBB 5C0XG 4B9WA 3DM1A 1IKLA 4UAIA 1S5DD 2PQEA 4K5VA 3TP5A 5ELFA 3HOXB 1QNUA 2PNRC 2PZTA 4ZK9B 4DXGA 5ELDA 1Q90A 1FNWA 5C4HA 3M85A 3EQLC 1DOLA 1I4PA 1KABA 2DNCA 1DYQA 3AB9A 2EXZA 2KA7A 5LHY1 3J7AV 2WAQB 3H3VC 5I2XA 4RGMA 1TKWB 1HUNA 5FKAC 1PTOF 2F0QA 5IGCA 5IGEA 4OHJA 2K03A 1C4QA 1ZYRC 2K1BA 2M2LA 4RGTA 1EOTA 3BVZA 1RTNA 4IALA 5A35A 2K33A 3E0JA 2A5HA 1R4PB 1O7ZA 4TQUS 1PTOH 2F3WA 4V0BA 1E2WA 1DOMA 5C4ZA 2A68C 1SYBA 3X3MA 2YYZA 1S4ZA 1RF2D 1OO9B 5EJWA 1BR9A 1GXDC 3IL8A 1SMYD 4ZLTF 1STBA 4RGOS 2RDHA 3J7YW 1SBBB 3WDNA 3L3OC 3HOUB 2IW3A 3S2HB 2C9OA 5T1IA 2PO4A 2PPBC 2BDOA 1II3A 3P20A 3NTHA 3TZUA 1GUOA 2FMCA 1R9TB 2KEDA 4EQNA 3EVQA 1NR2A 1V8QA 1X3PA 4HEDA 4C3HB 4RHSA 4KY6A 4UDUC 3SDZA 3E5SA 2VNUD 4HTHA 5ELCA 5D3DA 4KN7C 1CHPD 4KJOA 4HAEA 1MSHA 1OXXK 1IW7D 2X6LA 1J9OA 2AQ3B 3KLRA 2IX0A 4RH6A 4FF3A 2G9DA 2HDMA 1GHKA 2F1MA 2Y0SB 3PUYA 1STAA 1F9PA 1J8IA 1LACA 4FO2A 1FNUA 4WJWA 1WTWA 1JOKA 3OW7A 1B44D 1I4GA 1KTKA 2QILA 4QMGA 2A69C 3SK4A 2CHBD 4KV6A 3G6JB 2X69A 1IHZA 2XWJB 2RSNA 3GTOB 3D6CA 4K2LA 2L5TA 3Q23A 2O5JC 5C5MA 4NDXA 2MPMA 3K59A 5NUCA 1B3AA 4PMWA 3GV3A 1I50B 2NTSA 2KOLA 1QJOA 2E76C 3K5MA 4HMJA 4J6HA 5EKIA 4C3JG 3EJIA 4A3MB 4KKUA 3OIPA 3G7LA 5JVG3 2WV6D 2L0CA 3PUXA 2BE5C 4KTAA 4IUUA 1U4RA 4BA2I 5C3XA 2MJ8A 1YNJC 1AN8A 4FVMA 2E75C 4QIWB 2ICIA 4LAAA 1VF5C 1HTLD 2J7ZA 4K14A 3HOYB 1DOKA 1NUCA 5CBEE 5F2DA 3DWQA 1MD2D 1F77A 2N55A 4I7ZC 4G4KA 2MP1A 2WIIB 4ZAIA 1TS4A 3A55A 2RVLA 2E2HB 3MFYA 4HCEA 2RKSA 3BG3A 3M7NA 3A56A 2O2LD 4PNYA 1RD9D 2ZXRA 4MIUA 2F0NA 4J8QA 3TN2A 1PFBA 4M8AA 1D2BA 4I65A 5M9OA 4C1NI 4CJ1B 2HCCA 2AWNA 3QO2A 1XWEA 1NAPA 5JAVA 1GJXA 4H0LC 5KYLA 4RKBA 5FLXL 4FYDA 1EQVA 2C5CA 1EIHA 3R2TA 3V96A 3TP6A 3MEHA 4DNRB 3I4NB 2NN6H 1EYCA 2MUYA 3LWEA 1PDQA 4RCNA 3K5NA 1FYCA 1TS3A 3NHHA 5KYIA 4XIGS 2K5WA 3BDCA 1BCPF 1L0XB 2B2YA 2BA0A 2AQ2B 4WRDA 4F87A 1TWCB 3MHBA 4F8MA 3IFTA 1EYAA 4XYQA 2NN6G 5EBCA 2EYFA 3K7AB 1HA6A 4DAYA 4DK0A 3NSWA 5E4XA 5D14A 3MXGA 1AEXA 1SNCA 2WACA 1F2ZA 3K0YA 5FOBB 2FHTA 4HSPA 2ZXPA 2QKIC 1D1IA 1JWSD 2EJMA 2G9HD 2TSSA 3CU7A 1TIID 1TY2A 2WKCA 4FP5D 1W6JA 5EPJA 3FVQA 1K83B 2KEEA 5M5WB 4HR7B 4QUCA 3KLSX 4A3JB 3M3YB 3EFXD 1GUTA 1FNVA 4H44C 2NBFA 4BA1I 3VR2A 3QG1A 4G7HC 2Q8IB 1JCKB 3HOVB 4YIJA 3HOZB 3S17B 1G8ZD 4G57A 2JE6I 1TWGB 2QF7A 2SNSA 3J81L 1TWFB 1A3VA 5IIFA 1PFMA 5CV9A 4IZ8A 5I2YA 3SK5A 2EDGA 5COYA 1EL0A 2E2JB 1PZJD 3S1MB 3C2PA 3QB3A 5A2QE 3MTSA 2K7VA 3ITPA 3I4MB 2KECA 4IFDJ 2V4DA 3VR4A 1PZKD 2EJGC 2F0WA 1S5FD 5IGBA 1CK1A 1DONA 2JEAI 1F9RA 1JORA 1PRTC 4NMZA 2EJFC 1BQQT 4OO1I 2I07B 1OXTA 3GTPB 2E74C 2F0MA 3P75A 2F0UA 3C1FA 4RAUC 5CR3A 2XWBB 3SHLA 4DNTB 1UEAB 1EEID 1ZYRD 4IN3A 2LKVA 3A54A 5CGKA 2ENBA 1U4PA 5FO9B 3ZYYX 1EY7A 1D5XC 3VA5A 1MGSA 3K6OA 1EY4A 2F0TA 3HP3A 2FFKB 3MZ5A 3CHBD 3JAME 5KNDA 1LT6D 4CJ0B 4P2CB 1VMPA 4KY7A 3PO2B 2A68D 1PTOC 1STNA 4IQZA 2F0IA 1Y69U 1G2SA 1SYCA 5CV5A 2SOBA 1A3TA 3NQIA 1FR3A 2NN6I 1XX8A 5KNBA 2VB3X 1EY8A 5C3EB 4IFDH 3A7AB 5ELEA 5E4WC 3ND8A 1QG7A 3Q24A 2B2UA 2LMCB 4K8JA 2OEOA 2DNEA 3O13A 2F0DA 2KCCA 5CV8A 1TS2A 4K8IA 4FF4A 1Y8PB 3T53B 1LT4D 1BDOA 2O5IC 1HFNA 4KI0A 2KJXA 4IFDG 1SYGA 5I6YA 5IGDA 4KHZA 2WINB 1ENAA 1B50A 2H1EA 5FO8B 4KKTA 3A8JE 1VDZA 1ZKOA 1DD2A 1GHJA 3V05A 4A3FB 1ILQA 1PLFA 3K5LA 1NCVA 4IURA 1EY0A 2QDBA 3Q22A 2EY2A 2QCPX 1DCZA 3NBHA 1SYEA 2SNMA 2O4XA 1JE4A 3PO3B 4C3JB 5G3LF 2K28A 2RDGA 5BN5A 5M3MB 3BYTB 2D62A 2L4NA 5EKKA 5D3IB 3UI2A 2AUKA 3NTIA 4HCSA 3GTQB 3SR1A 5CYUA 2TMPA 3TP8A 1YNNC 2L55A 3NWSA 4CKEA 3R2IA 4DF7A 2A69D 3MVVA 3CQZB 1RCVD 2Z4IA 1SEBD 4XDXA 4RHRA 4OGQC 1S5BD 3HG9A 5E1FA 1GUGA 2B2VA 3ONAB 1JWUD 5CC4A 4ULLA 1K8MA 3C1EA 2YU9B 1I4XA 3OWEB 1HFGA 2J0TD 2R3ZA 5I6WA 1TVXA 4PMBA 5JPMC 1HQMC 1JOOA 3DUZA 4RCOA 1F2YA 3HEJA 1NR4A 3J80L 3EA6A 3TSSA 1HA5A 1HTPA 1BF4A 2N88A 3GP7A 2BE5D 5C0XI 4RGNA 2IX3A 3IAYA 2AWOA 3D4WA 2B2WC 3FPUB 3TMEA 1CQVA 4U673 2K32A 2KHSA 2LY7A 1ESFA 3KLSA 2H4OA 2B2TA 5IGGA 3T4AC 4C3IB 3X3NA 5DNFA 4PMCA 5JOBA 4K2KA 3NQTA 1SXTA 1SNQA 2PW5A 1KDCA 3DEPA 2EZVA 3FMCA 4LJZC 1WTRA 5C4JB 2NVTB 5KNCA 1CFMA 4FXGC 2NVXB 1BBXC 4L6TB 3TBIB 1AZQA 4XT3B 3S1QB 3E6ZX 4RWSC 2XRQD 1RODA 3R93A 4N9PA 1AW7A 5IODA 3L9AX 3W2DA 2R61A 4XQNA 3NP8A 2FMMA 5J1ZA 5JEAH 1EZ6A 2F0EA 5J39A 4A93B 4KJNA 3A7LA 1ONLA 4C2MB 4HSVA 1LT3D 2BCOA 1I6VC 1TU2B 4Y7NB 5KRUA 2EYPA 2K5DA 3ERQA 4TRDA 2JA8B 1XTCD 1BNZA 2D2CC 1O80A 2F0PA 3NUCA 2NYZD 4L63B 1LV9A 1EY9A 1SE2A 3GTJB 4ABNA 4K6DA 1OXVA 1GUSA 3W3AA 5J22A 4CJ2C 5EGTA 5ELBA 1STHA 2F0SA 4IUQA 1EY6A 1Q3LA 1T5EA 2X6GA 5EBDA 4Q5VA 2F0LA 4MHEA 2F3VA 3RMHA 2PZUA 4XT1B 2KVMA 2PCFB 1SNOA 3MXUA 1Q1BA 4C3HG 2R93B 3VA7A 3C46A 2SEBD 2OT2A 5IT9L 2F0FA 3MA2B 1L0YB 2RDFA 5KGUA 3HS0C 1SJED 1T5XD 3OMCA 4CGYB 1STEA 1SYDA 2IT1A 3I91A 5HURA 3S9WA 5ISRA 1TWAB 1UAPA 1F2LA 3Q0AA 1BCPC 4E6IA 1EWHA 1AFPA 3R8BA 2OF1A 1E0BA 4DA2A 2JYOA 3LNNA 1TR5A 1QNKA 3OSOA 1RJTA 3FEWX 4KN4C 4A3IB 3N52A 3NK9A 3NWTA 2OXPA 2F0JA 5I9OA 3H09A 1ET6A 1B9MA 3I8ZA 3EROA 5FK9C 2FJ2A 4X3SA 3D31A 5I4DA 3MXPA 1WTPA 1BO0A 2F0GA 2FINB 5I9PA 1PMRA 5KIXA 1CTMA 1Y8OB 4XYOA 1FGBD 1V1OA 3VYRA 1U4MA 2JXMB 4A3DB 1JWMD 1CZWA 3K5OA 1BOSA 1KNEA 1KNAA 1Q12A 3P1HA 3C3LA 1PYWD 1WTOA 1SDFA 3T56B 1WTQA 2A6EC 4EQPA 2M00A 1QILA 4ME5A 3Q6SA 5EPKA 5LL6X 2WKDA 4S3SA 2JA7B 3MAQA 1PRTD 2HQEA 3H91A 3I72A 1LTID 2F4IA 1A6XA 1MSGA 1SFOB 4B9XA 1SJHD 5CORA 3VR6A 1VCIA 3T13A 1DZ1A 5TSSA 3WOFA 1I6HB 1TQOA 4DN4M 1WVLA 3H0GB 2K05A 3N6RA 2NTTA 1LTRD 3FRPB 4KD4A 2A6HD 4PQXA 2MHVA 5CV4A 4WFN3 3GD7A 4IUNA 1LTSD 3GTLB 4BY1B 2KQ3A 1HXYD 1Q8IA 1PRTB 4NW2A 1ENCA 1NSNS 3GO5A 1PTOD 5LL6S 1SSOA 1E2VA 1ESRA 1F9QA 1WTXA 1K8OA 4BS9A 1Y1VB 1PXUA 2K5QA 4X3UA 1IYUA 3H94A 4LK1C 4H13C 3CKIB 1KDBA 1QOHA 2B39A 4BBRB 4K5WA 3KBGA 1LABA 1F9SA 1BXTA 2XVSA 4OIJA 1LT5D 2B8FA 1E2ZA 2NB0A 2ID0A 1HUMA 2KUMA 4RA8A 2EYHA 1Z7TA 4NP5A 3SE0A 1PTOB 2DY8A 4JK1C 4O1NA 3QOLA 3MFGA 3SEBA 2E2IB 3J80E 1TY0A 1UNSA 3HKZB 2RBMA 1MBYA 2NZ1D 1SE4A 5EPLA 3CRKC 1LLRD 1LTAD 2GA4B 3NXWA 2D9UA 1EYDA 3A8IE 3DWAA 2XNAC 3FPPA 1JC7A 1CA6A 3NBIA 1IL8A 3J7AF 1HPCA 4X3TA 4ZUIA 4RKLA 2CW0C 3KBXA 3LWUA 2DN8A 2PYKA 1CQFA 1KAAA 1CT1D 3S1NB 3HZXA 5FO7B 1BUVT 1Q1EA 3HOWB 3CRLC 4V190 1V1PB 3AU7A 3DEOA 4DXFA 4QF4A 1YNND 4ZQ3A 3BZDB 3L7ZC 1D5MC 1EEFD 1D6EC 1V43A 3D8GA 1EU3A 3PUZA 4JBWA 5JVH3 2CQAA 4MN3A 3T16A 4TSSA 4H7BA 3U9OA 1GUWA 2EVBA 1H9JA 4DK1A 1B4OA 5M3FB 4G7ZC 5D65A 4HMIA 2JSOA 2EY1A 2RA4A 1ZXTA 1H9SB 1HRJA 1JQYD 3MWYW 1SNDA 2EY5A 4N9TA 2PMZB 3QIAA 3KK7A 4K6LA 2BDNA 5C6AA 1XXGA 4EGVA 1U9RA 3VYSA 4XQJA 1SNPA 2ICEC 2MGSA 4ODGA 3MXNA 1TS5A 4DGZA 2AUJD 2BOSA 1EZ8A 3S1RB 1SE3A 5JPNC 1OXSC 3OHXC 4EVOA 3DHQA 1QB5D 2K01A 3KUPA 2IPKD 1QE6A 1HQRD 5IT9E 1FD7D 1B1ZA 1CZGA 4A3BB 3ND9A 1B53A 1I4QA 4NKLA 5K36H 1ICWA 2F03A 5A2QL 3LX0A 4XXEA 1RKNA 2WB1B 3R3OA 3QJYA 2PW7A 2ZXOA 1I3QB 4IUTA 4ZRZA 3MC0B 3TP7A 3BDLA 2AQ1B 1G6ZA 4EQOA 5JEAJ 1WD0A 5C3WA 4IUPA 1Y8NB 3PUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U9O A;  5EGT A;  3P1H A;  1STH A;  2F0S A;  1EY7 A;  1SYE A;  3H6M A;  1EY6 A;  4B9W A;  1II3 A;  5C5M A;  5IOC A;  2F0L A;  3VA5 A;  2EYH A;  2M00 A;  2O4X A;  2SNM A;  2PZW A;  4NDX A;  2F3V A;  1EY4 A;  2F0T A;  2PQE A;  4ME5 A;  2PZU A;  4I65 A;  4HMI A;  4K5V A;  4NP5 A;  5IGG A;  2EY1 A;  3MZ5 A;  4PMC A;  5JOB A;  4K2K A;  5NUC A;  3NQT A;  3TP5 A;  2PZT A;  5M9O A;  1SNO A;  1SNQ A;  5DAU A;  2PW5 A;  3V2T A;  1KDC A;  4S3S A;  4DFA A;  4KY7 A;  4WOR A;  1TT2 A;  4MIU A;  4KD3 A;  4ZUJ A;  4EQN A;  3EVQ A;  1SND A;  5C4H A;  5HGT A;  2HQE A;  2EY5 A;  4N9T A;  5EKK A;  3QOJ A;  2F0F A;  3QOL A;  2EYO A;  1STN A;  1KDA A;  2F0I A;  4HMJ A;  4J6H A;  4OL7 A;  3RUZ A;  5C6A A;  1SYC A;  3SR1 A;  2RBM A;  5CV5 A;  3EJI A;  2SOB A;  1A3T A;  2RDF A;  5JAV A;  1KAB A;  1A2U A;  4B9X A;  5KGU A;  4KY6 A;  5KYL A;  2EXZ A;  4RKB A;  4YIJ A;  3DMU A;  1U9R A;  3TP8 A;  1SYF A;  3OMC A;  3E5S A;  3T13 A;  4HTH A;  1SNP A;  3NXW A;  1SYD A;  4R8N A;  1EQV A;  4G57 A;  5DEH A;  5HUR A;  3S9W A;  5ISR A;  1TQO A;  3TP6 A;  4DF7 A;  2SNS A;  2NUC A;  3MVV A;  1EYD A;  1EY8 A;  3MEH A;  4N9P A;  5IIF A;  1A3V A;  2F0Q A;  4ODG A;  5CV9 A;  5IGC A;  5IOD A;  5KEE A;  4IZ8 A;  5IGE A;  4KTA A;  1EYC A;  3SK5 A;  3SK6 A;  4E6I A;  1A3U A;  4DGZ A;  4KD4 A;  1EZ8 A;  4KJO A;  4K5X A;  5CV4 A;  3NP8 A;  5C3X A;  2F0O A;  2F0V A;  1STG A;  2OF1 A;  3NHH A;  3QB3 A;  5J1Z A;  4ZUI A;  4QB4 A;  5KYI A;  4RKL A;  4K8J A;  5E1F A;  1EZ6 A;  2F0E A;  5J39 A;  4IUN A;  2OEO A;  3BDC A;  4KJN A;  3SK8 A;  1TR5 A;  3ITP A;  3OSO A;  4IAL A;  5CC4 A;  4LAA A;  2F0D A;  2PYK A;  2KQ3 A;  3C1E A;  4KHV A;  3NK9 A;  4EVO A;  5CV8 A;  2F0W A;  1KAA A;  2OXP A;  3D4D A;  3DHQ A;  4K14 A;  4K8I A;  5IGB A;  2F0J A;  2EYL A;  5I9O A;  2EYM A;  1ENC A;  4J1M A;  2EYJ A;  3HZX A;  1NUC A;  4WRD A;  5I6W A;  1NSN S;  5EKL A;  5F2D A;  2F3W A;  1JOR A;  5IGF A;  3MHB A;  4PMB A;  3OWF A;  4F8M A;  1STA A;  5KRU A;  1EYA A;  2EYP A;  3PMF A;  2F0K A;  5CV7 A;  4EQP A;  5C4Z A;  1JOQ A;  3ERO A;  4NMZ A;  1JOO A;  1SYB A;  1SYG A;  1F2Y A;  3HEJ A;  1F2M A;  4QF4 A;  5I6Y A;  4NKL A;  5IGD A;  2EYF A;  4ID6 A;  1JOK A;  4ZQ3 A;  3MXP A;  2F0M A;  3LX0 A;  5K5P A;  3ERQ A;  3P75 A;  4TRD A;  2F0U A;  5C5L A;  1A2T A;  2F0G A;  1STY A;  1RKN A;  3C1F A;  3SXH A;  2F0P A;  4KY5 A;  3NUC A;  3R3O A;  1ENA A;  5CV6 A;  2PW7 A;  5I9P A;  5CR3 A;  1AEX A;  1SNC A;  2F0H A;  1F2Z A;  2RKS A;  2WAC A;  1EY9 A;  1STB A;  3D8G A;  5E3F A;  3SHL A;  3TP7 A;  1KDB A;  5KIX A;  4QMG A;  3SK4 A;  3BDL A;  4DU9 A;  3D4W A;  4K5W A;  3TME A;  4EQO A;  3OMG A;  4F7X A;  1EY5 A;  4KV6 A;  1IHZ A;  1SNM A;  4K6D A;  5C3W A;  5J22 A;  1EY0 A;  2LKV A;  5CGK A;  2ENB A;  2QDB A;  3D6C A;  4K2L A;  4PNY A;  4H7B A;  3T16 A;  2KHS A;  2EY6 A;  2EY2 A;  2F0N A; 
#chains in the Genus database with same CATH topology
 4GKJ Q;  1CA5 A;  4DAP A;  5FLX E;  4K0K Q;  1RDP D;  4A3K B;  1LO5 D;  4X62 L;  1LTB D;  5IOC A;  2XIW A;  2WB1 E;  4UHV A;  3PO2 G;  2PZW A;  4DR2 L;  4EQ5 A;  1VS0 A;  1UE1 A;  5K36 G;  2BA1 A;  5DAU A;  3V2T A;  1VQJ A;  1ET9 A;  4DFA A;  1OXU A;  2K6A A;  2HCI A;  4KD3 A;  4QCL A;  5HGT A;  2EXD A;  4GNX B;  2VB2 X;  1KDA A;  1XMQ Q;  3RUZ A;  3OIQ A;  4ZYS A;  1YNJ D;  5C3E G;  4DAY B;  3NEN A;  1A2U A;  1Z6H A;  4FXK C;  4OX9 Q;  2EOT A;  4GOP C;  3GTK B;  3GDE A;  4GN5 A;  2JEB I;  1VQ6 A;  3G4S A;  4R8N A;  5DEH A;  3CW2 C;  4NPS A;  1D1K A;  4JI2 Q;  4X3K A;  5AFW A;  3JAM L;  1HCZ A;  1SMY C;  2B2Y C;  4A3F H;  4JCV E;  5IE8 A;  2M9V A;  3K57 A;  5GRO A;  3I55 A;  3HGB A;  2B29 A;  2R92 B;  3M4P A;  1JIC A;  2R7Z B;  3TS2 A;  2F0O A;  3VYT A;  2K5H A;  2HUG A;  1FVI A;  3S16 B;  1CKO A;  4JVZ A;  4ZKC B;  2OWO A;  4IFD I;  1MI2 A;  3DWP A;  1KD1 C;  4Y52 H;  3DXJ C;  3DM3 A;  1S5E D;  2JP1 A;  3I70 A;  3IFD A;  2EYM A;  3PO3 H;  4C3J H;  4J1M A;  1G29 1;  4O0A A;  5M3M H;  1LTG D;  1EUJ A;  3OWF A;  1EQT A;  2NZH A;  2UUA L;  2A73 B;  1F2M A;  1EU4 A;  1HHV A;  3GTQ H;  4OXP A;  1G91 A;  3UDI A;  3SXH A;  2Q8R E;  2Z1C A;  2L1B A;  3W5O A;  1HNX L;  1JT8 A;  4YY3 L;  1SAP A;  4JI1 Q;  2UUB Q;  1KLG D;  2EE1 A;  4DR3 L;  1BCP D;  3PIO 3;  2ZT9 C;  1TXY A;  1H9K A;  3F2C A;  3CQZ H;  4X62 Q;  4CHT B;  1JR0 D;  1IYV A;  2IL8 A;  5LMN Q;  4DR2 Q;  3I90 A;  2NWG A;  2L12 A;  1V1P A;  2EY6 A;  4O42 A;  1ENF A;  2MO0 A;  2XSC A;  4QJF A;  5M3M G;  2EPB A;  5GAD C;  4JBJ A;  1O7Y A;  1W6K A;  1IW7 C;  1P8L A;  4BBS B;  3J81 E;  4B08 A;  5JEA G;  3NPP A;  4R8I A;  2A74 C;  1EIG A;  4CKB A;  1YNX A;  1H9R A;  2NVY B;  3BYY B;  4CBV A;  3K81 C;  2DJF C;  1X3F A;  1J5E Q;  4ZUJ A;  2OTJ A;  4JYA L;  3QOJ A;  4DV1 L;  1WD1 A;  3S14 B;  2L9H A;  1PZI D;  1XYI A;  2JN4 A;  4HN7 A;  4KKS A;  1R4Q B;  5IYD H;  3DMU A;  3VDY A;  1BCP B;  1X32 A;  1PFN A;  4KK7 A;  3BZC A;  2JA6 B;  2YV5 A;  2Z8L A;  2HDL A;  5M5X B;  2NUC A;  3KLW A;  5KEE A;  1H9S A;  3SK6 A;  1Q7Y C;  3S15 B;  4K5X A;  2GVB A;  1YHB A;  2F0V A;  1STG A;  3KDF B;  2VUM B;  2A6E D;  3TRZ A;  2UXB Q;  3SK8 A;  2B8G A;  4OO1 H;  2I46 A;  4G7O C;  3KF8 A;  2UUA Q;  4DAV A;  2D0P A;  1ZEQ X;  4C3I H;  5IYD G;  3VR5 A;  1NE3 A;  1IZ6 A;  4IPC A;  3AQQ A;  4LMQ D;  1EFI D;  1K73 C;  3JAM c;  5EKL A;  5M5Y B;  1WYD A;  1TWH B;  5CV7 A;  4YY3 Q;  2F0K A;  2L11 A;  1ML0 D;  4DR3 Q;  1O78 A;  5C4J H;  2NVT H;  4HID A;  1DJR D;  3F2U A;  3I73 A;  1M4V A;  2NVX H;  5K5P A;  2Z6K A;  1QWY A;  1A2T A;  2XN9 C;  2I0Q A;  1Q82 C;  4DPG A;  1PYS B;  4BWG B;  3S1Q H;  1O7I A;  4JI7 L;  2K04 A;  5CMD A;  3G71 A;  5IP9 H;  2B63 B;  4OO1 G;  2Z4H A;  1M8A A;  2ZJP A;  3OOC A;  1VF7 A;  2RSO A;  4IUV A;  3GTG B;  2AHO B;  4C3I G;  3M4O B;  1ILP A;  1LM0 A;  3VYU A;  3RZD B;  4DUZ Q;  4IOC A;  1KLU D;  2VQF Q;  3T51 B;  4GKK L;  1B9N A;  4A93 H;  5JJZ A;  1N36 Q;  3E3X A;  4C2M H;  2B2W A;  4F88 A;  4KMU C;  3PIP A;  1TT2 A;  3CC7 A;  1C8C A;  3D3R A;  4FF1 A;  4Y7N H;  3RZO B;  1Z47 A;  5IYC H;  4DV5 L;  5IP9 G;  3QWN A;  2K14 A;  1B3Q A;  3I4L A;  4AH6 A;  3GTM B;  3RLF A;  1S40 A;  1E22 A;  4L8J A;  4Z9C B;  3U4V A;  4YCW A;  3TZD A;  4TKO B;  2E8G A;  2B2U C;  4DV6 L;  2MQH A;  2JA8 H;  1VQ8 A;  1K9M C;  3M4Y A;  4C56 C;  2DUD A;  1A15 A;  3I3C A;  2E5L Q;  4A93 G;  3GQB A;  1VQI A;  4JBK A;  3FKI B;  1K0S A;  1A3U A;  1LYL A;  3GTJ H;  5IY0 A;  4BY7 B;  1K3B C;  4GNX A;  2A1A A;  4FF2 A;  4FXD A;  4M1U B;  4QB4 A;  3ZJY C;  3NE5 B;  5IYC G;  3URY A;  5CBA E;  2JA5 B;  3M7G A;  1HJP A;  5LMN W;  4XQQ A;  3D4D A;  5C44 B;  2EYL A;  3ICE A;  4R4O A;  5AJ3 L;  1C48 A;  1GUN A;  2EYJ A;  2GN5 A;  1RIP A;  5IGF A;  2R93 H;  4QY7 A;  2Q8T A;  1X3Q A;  1CUK A;  1C7Y A;  1N34 L;  1PH6 A;  4JI7 Q;  1JB3 A;  3A8K E;  2VQE L;  4U68 A;  2KCN A;  3U9S A;  1O7L A;  2LS0 1;  4ID6 A;  5T1G A;  1QCB D;  3F8T A;  1T9H A;  3S2D B;  1BVS A;  3SVM A;  4JV5 Q;  5CV6 A;  5C0X J;  2J4X A;  1NNX A;  4DU9 A;  1I4R A;  1VQF A;  5E3F A;  1TWA H;  4P74 A;  4QUF A;  5DM7 3;  3NEM A;  4F7X A;  3D0F A;  4WJ4 A;  2R6G A;  5BN4 A;  2RQX A;  1EWC A;  4GZY C;  1IKM A;  4IPD A;  2XRS D;  2CW0 D;  4OEM B;  3FDT A;  2E2D C;  1C9O A;  4X65 Q;  3H6M A;  4AYB B;  3CCM A;  4Q0F A;  1DM0 B;  4A3I H;  2CVR A;  1WCM B;  1XNQ Q;  2LFN A;  4WOR A;  3BS1 A;  4R4C A;  3K58 A;  2NVQ B;  4XTC S;  5BN3 A;  1CHQ D;  3GV6 A;  2EYO A;  1AZP A;  3BVM A;  1IBL L;  2IJ0 A;  3IKJ A;  3VR3 A;  4OL7 A;  4DV0 L;  2HT1 A;  1DXM A;  5DM6 3;  3D6W A;  3OPO A;  4AYB E;  4FNF A;  2IX1 A;  5FLX c;  1SYF A;  1Q8K A;  3ULL A;  3AMU A;  2CCZ A;  2B2V C;  4OIK A;  1M1K C;  4HJA A;  4O2D A;  3TEH B;  1WTV A;  4C1N K;  5G3L D;  3P7J A;  4A3I G;  4NXM L;  2D5D A;  4J15 A;  1I4H A;  3PUW A;  2DY7 A;  4A3D H;  2ZJR A;  1AP0 A;  3I2Z A;  3BVG A;  4QL5 A;  4RFB A;  4JI6 L;  5AJ3 Q;  1H9M A;  3PIP 3;  3I4N G;  4POG A;  2QEJ C;  4IJH A;  1G2T A;  1GOZ A;  3HFZ B;  4KHV A;  2EIF A;  2IWH A;  1N34 Q;  5GQO A;  3U50 C;  4R9W A;  4AIM A;  2VQE Q;  3BDO A;  4A3E B;  3D4R A;  2LXJ A;  5C0X H;  4A3C H;  3HRZ C;  1KHI A;  1D5Z C;  2JA7 H;  2VL6 A;  1YJN A;  1VQG A;  4PV1 C;  3PMF A;  1JOQ A;  2A6H C;  1N33 Q;  4CKC A;  5EQ0 A;  4B3S Q;  4A3G B;  1U4L A;  3KYH C;  2VXW A;  3KDF A;  1CI3 M;  1RHP A;  3TDQ A;  2UUC L;  1SFO H;  5C4X B;  1VMC A;  5C5L A;  2Q2T A;  4A3D G;  2SDF A;  1STY A;  3RD4 A;  4KY5 A;  3PV0 A;  4LFB L;  1HR0 L;  1B2T A;  1LTT D;  1PRT F;  1Y1W B;  2F0H A;  4LF7 L;  1I6H H;  4YHH Q;  2B2T C;  4FDB A;  1S5C D;  1HH2 P;  4R4I A;  2WP8 J;  3H0G H;  1UUP A;  4ILW A;  3OMG A;  1EY5 A;  4DR1 Q;  2YTY A;  1CM9 A;  1SNM A;  3NTK A;  4KHP L;  3WOE A;  1AE2 A;  1RTO A;  2Z9H A;  4ZKB B;  5C0X G;  4A3C G;  2JA7 G;  4B9W A;  3DM1 A;  1IKL A;  4WJ3 M;  4UAI A;  2XTI A;  3GTL H;  1S5D D;  4BY1 H;  2PQE A;  4K5V A;  4B3R L;  3TP5 A;  5ELF A;  3HOX B;  2KCT A;  1QNU A;  2PNR C;  2PZT A;  2CH4 W;  4ZK9 B;  4DXG A;  5ELD A;  3SGI A;  1Q90 A;  2RHQ B;  1FNW A;  1KAW A;  5C4H A;  4P75 A;  1XPO A;  1XNR L;  3M85 A;  3K8A A;  1HNW Q;  3A74 A;  3H0G G;  3EQL C;  1DOL A;  1I4P A;  3B6Y A;  1KAB A;  2DNC A;  3STB D;  1DYQ A;  3AB9 A;  2EXZ A;  2KA7 A;  5LHY 1;  3J7A V;  5BR8 L;  1Y1V H;  2WAQ B;  3H3V C;  2LSS A;  5I2X A;  4RGM A;  1TKW B;  1HUN A;  5FKA C;  1PTO F;  1Q81 C;  3J81 c;  2F0Q A;  5IGC A;  5IGE A;  4BY1 G;  3HOV G;  4OHJ A;  4POF A;  2K03 A;  1D8L A;  1C4Q A;  1ZYR C;  2MFI A;  4DK6 C;  2K1B A;  2K5V A;  2M2L A;  4RGT A;  1EOT A;  3BVZ A;  2Q2H A;  1HNZ Q;  2WAQ E;  1RTN A;  4IAL A;  3RR5 A;  1W3S A;  5A35 A;  1X65 A;  2AMC B;  2QW7 A;  2K33 A;  3E0J A;  1CSQ A;  2A5H A;  2UU9 L;  1R4P B;  1O7Z A;  4PG3 A;  1Y1V G;  2R7D A;  4TQU S;  1PTO H;  4DNI A;  2UUC Q;  1FL0 A;  2F4V Q;  1EIF A;  2F3W A;  4V0B A;  1E2W A;  2MO1 A;  1DOM A;  1VQH A;  4R4Q A;  5C4Z A;  1HR0 Q;  2A68 C;  1SYB A;  2E2I H;  2VY3 A;  3X3M A;  2YYZ A;  1S4Z A;  5GAH C;  3PIO A;  4HJ9 A;  3EBE A;  1RF2 D;  1PHJ A;  1OO9 B;  5EJW A;  1BR9 A;  4IO9 A;  1EQQ A;  1GXD C;  3IL8 A;  4KHP Q;  1SMY D;  4ZLT F;  1STB A;  4RGO S;  4RMF A;  2RDH A;  2D0O A;  3J7Y W;  4ALP A;  1VQ7 A;  1SBB B;  3WDN A;  4UY8 C;  3L3O C;  4PZ7 A;  3HOU B;  2IW3 A;  3S2H B;  2C9O A;  1PV4 A;  5T1I A;  2PO4 A;  2ES2 A;  2PPB C;  2BDO A;  1II3 A;  3K7U C;  3P20 A;  1EIY B;  3HKZ G;  3NTH A;  3S24 A;  2MNA A;  1VQP A;  3TZU A;  5H1S E;  2ZJQ A;  1GUO A;  2FMC A;  1R9T B;  4DAM A;  2KED A;  1U5K A;  1X54 A;  4EQN A;  3S1N H;  3EVQ A;  5BR8 Q;  1YZ6 A;  2R7F A;  4GOP B;  3HOW H;  1NR2 A;  1V8Q A;  4PZ8 A;  1X3P A;  4HED A;  4C3H B;  4RHS A;  4KY6 A;  4UDU C;  3SDZ A;  4CDD C;  3E5S A;  2VNU D;  4HTH A;  5ELC A;  5D3D A;  4KN7 C;  3UE1 A;  1X6O A;  3KOJ A;  1CHP D;  2V1C C;  3CMA A;  1N8R C;  4KJO A;  3Q8D A;  1EFW A;  2UU9 Q;  5IYB H;  4HAE A;  1MSH A;  1OXX K;  5L37 A;  1IW7 D;  2X6L A;  1J9O A;  1SMX A;  2AQ3 B;  3KLR A;  2IX0 A;  4RH6 A;  3HOW G;  4FF3 A;  5M3F H;  2G9D A;  2HDM A;  1KQS A;  1GHK A;  2F1M A;  1N9W A;  2Y0S B;  5EAY A;  3PUY A;  4LF9 L;  1STA A;  1F9P A;  1E3P A;  1J8I A;  1LAC A;  4FO2 A;  1FNU A;  2N8N A;  4WJW A;  1WTW A;  4YCU A;  1JOK A;  3OW7 A;  1B44 D;  4DV7 L;  1I4G A;  5IYB G;  1ASY A;  2VZA A;  1L1O A;  2BH8 A;  1KTK A;  2QIL A;  4QMG A;  2A69 C;  3SK4 A;  3CF5 A;  2Y0S E;  3T1Y L;  5M3F G;  1D7Q A;  2CHB D;  4KV6 A;  3AFQ A;  3G6J B;  2X69 A;  1IHZ A;  2XWJ B;  1IBK Q;  2RSN A;  3GTO B;  1YI2 A;  3D6C A;  4K2L A;  2L5T A;  3Q23 A;  2O5J C;  3S1R H;  4A3F G;  2OQK A;  5C5M A;  4NDX A;  2MPM A;  3W1G A;  3K59 A;  1GVP A;  4YWL A;  5NUC A;  3ULP A;  1B3A A;  4PMW A;  3TQY A;  3GV3 A;  4JI4 L;  1I50 B;  2NTS A;  1WOC A;  4LFA L;  2DGY A;  1XMO L;  2F3I A;  2KOL A;  4DR5 L;  1QJO A;  2E76 C;  2K4K A;  3UDG A;  3K5M A;  4A3B H;  4HMJ A;  4J6H A;  5EKI A;  3PO3 G;  4C3J G;  2FXQ A;  1VQO A;  1EYG A;  3EJI A;  4DR6 L;  4A3M B;  4KKU A;  3OIP A;  1PYB A;  3G7L A;  5JVG 3;  2WFW A;  3I56 A;  1K3R A;  1HR0 W;  2WV6 D;  2L0C A;  1I3Q H;  3PUX A;  2YU9 H;  5FJ8 H;  4UPA A;  2BE5 C;  4KTA A;  4LF4 L;  4IUU A;  1B7Y B;  1U4R A;  1CKN B;  4BA2 I;  5C3X A;  4OON A;  2MJ8 A;  3KFU A;  1YNJ C;  4L5S A;  1AN8 A;  3PQI A;  4FVM A;  2E75 C;  5IWA L;  4A3B G;  4QIW B;  3RN2 A;  2JQO A;  2ICI A;  3M9B A;  4A3K H;  4LAA A;  1VF5 C;  4DV3 L;  1HTL D;  2J7Z A;  4K14 A;  4X66 L;  3HOY B;  3NEL A;  1DOK A;  1NUC A;  5CBE E;  5F2D A;  2IHE A;  4DV7 Q;  3DWQ A;  1MD2 D;  2WB1 G;  1F77 A;  2N55 A;  4I7Z C;  4N8X 1;  5FJ8 G;  2YTX A;  4G4K A;  2MP1 A;  2WII B;  1QUQ A;  3U58 A;  3J80 c;  3T1Y Q;  4ZAI A;  2B3G A;  4QIW E;  1TS4 A;  4LFC L;  3A55 A;  1RL2 A;  2RVL A;  3GTK H;  2E2H B;  3MFY A;  4HCE A;  4L5T A;  4CDF C;  2RKS A;  1KRT A;  3JAM i;  3BG3 A;  4A3K G;  3M7N A;  3CC2 A;  3A56 A;  3H3V I;  2O2L D;  1HNX Q;  4PNY A;  2R92 H;  1RD9 D;  2ZXR A;  4MIU A;  2F0N A;  2R7Z H;  4J8Q A;  3TN2 A;  4JI4 Q;  1PFB A;  4JOI A;  2UXC L;  1XMO Q;  4M8A A;  3S16 H;  1D2B A;  4I65 A;  5M9O A;  1N32 L;  4C1N I;  3PSI A;  4CJ1 B;  2HCC A;  2AWN A;  2VS1 A;  3QO2 A;  1XWE A;  4DUY L;  1NAP A;  5JAV A;  1GKH A;  2RF4 A;  2A8V A;  1GJX A;  4H0L C;  4BXX H;  5KYL A;  3I7F A;  4RKB A;  4N8F A;  5FLX L;  2R92 G;  4FYD A;  1EQV A;  2C5C A;  4JYA Q;  1EIH A;  3R2T A;  3V96 A;  2QEX A;  3TP6 A;  4DV1 Q;  3JC6 6;  3MEH A;  3CD6 A;  4DNR B;  3I4N B;  2NN6 H;  1EYC A;  5IWA Q;  2MUY A;  3LWE A;  1PDQ A;  4RCN A;  3K5N A;  4GOP A;  1FYC A;  1TS3 A;  3NHH A;  3F2B A;  5KYI A;  4XIG S;  1MIU A;  2K5W A;  3BDC A;  4H02 A;  1BCP F;  1L0X B;  1GM5 A;  1FJG L;  1I94 L;  2PQA B;  2JK8 A;  2B2Y A;  4BBS H;  2BA0 A;  2KCM A;  2AQ2 B;  4WRD A;  4F87 A;  1TWC B;  3L0O A;  2NVY H;  4LFC Q;  3MHB A;  4F8M A;  3IFT A;  4A3L H;  1EYA A;  4XYQ A;  3K0X A;  3S14 H;  4JI0 L;  3NBH B;  2NN6 G;  1NY4 A;  5EBC A;  2EYF A;  3K7A B;  1PA6 A;  3L2P A;  1HA6 A;  2JJQ A;  4DAY A;  4DK0 A;  3NSW A;  5E4X A;  5D14 A;  3MXG A;  1GO3 E;  1AEX A;  1SNC A;  2WAC A;  1F2Z A;  3K0Y A;  2JA6 H;  5FOB B;  5M5X H;  2FHT A;  4HSP A;  2ZTC A;  2QKI C;  2ZXP A;  2UXC Q;  4LWC A;  2JA8 G;  4BBS G;  1HZC A;  1D1I A;  2OTL A;  1JWS D;  3S15 H;  2EJM A;  2G9H D;  2TSS A;  2ZM6 L;  3CU7 A;  2Z6B A;  1TII D;  2VUM H;  4A3L G;  4JI3 L;  1TY2 A;  2WKC A;  3CCR A;  4FP5 D;  1W6J A;  5EPJ A;  3FVQ A;  1E1O A;  1K83 B;  1UEB A;  2KEE A;  1NMG A;  5M5W B;  4HR7 B;  4QUC A;  1SLJ A;  1X55 A;  3KLS X;  4GKK Q;  1EOV A;  4DV4 L;  5IT9 c;  4A3J B;  4IPH A;  2JA6 G;  3M3Y B;  3EFX D;  1GUT A;  1FNV A;  5M5Y H;  1TWH H;  4H44 C;  1E24 A;  2NBF A;  4BA1 I;  3VR2 A;  3QG1 A;  1V1Q A;  4G7H C;  4LF8 L;  2Q8I B;  1JCK B;  2R93 G;  5HGQ A;  4YIJ A;  3HOV B;  3HOZ B;  3CCL A;  3J7A 5;  3S17 B;  2RCN A;  1G8Z D;  4G57 A;  2JE6 I;  1TWG B;  3F2D A;  4DV5 Q;  2QF7 A;  2SNS A;  3J81 L;  2VUM G;  1TWF B;  1A3V A;  5IIF A;  1BBU A;  1PFM A;  5CV9 A;  2UXD L;  4IZ8 A;  5I2Y A;  3SK5 A;  2EDG A;  4JPB W;  5COY A;  2B63 H;  1I94 Q;  1EL0 A;  2E2J B;  1K28 A;  1PZJ D;  3QR8 A;  3S1M B;  4DV6 Q;  3GTG H;  4JBM A;  5DLQ E;  2QGQ A;  3C2P A;  3FP9 A;  3QB3 A;  3M4O H;  5A2Q E;  3MTS A;  3RZD H;  2K7V A;  3ITP A;  3I4M B;  2KEC A;  4IFD J;  2V4D A;  3VR4 A;  1PZK D;  2EJG C;  2F0W A;  3G6E A;  1S5F D;  5IGB A;  1CK1 A;  1DON A;  2K5N A;  2KEN A;  1PH8 A;  2JEA I;  1XTD A;  1F9R A;  1JOR A;  2PI2 E;  3ULJ A;  1PRT C;  1S72 A;  4NMZ A;  3CAM A;  2EJF C;  3M4Q A;  3RZO H;  1CKN A;  1BQQ T;  1PH9 A;  4OO1 I;  2I07 B;  1OXT A;  2B63 G;  3GTP B;  3GTM H;  2E74 C;  2F0M A;  4LUZ A;  3P75 A;  2F0U A;  1SN8 A;  3C1F A;  2I5M X;  4RAU C;  5CR3 A;  2XWB B;  1PFS A;  5JJK A;  3SHL A;  2ZM6 Q;  4DNT B;  4LF6 L;  4IOA A;  1UEA B;  1EEI D;  1ZYR D;  4IN3 A;  3FKI H;  2LKV A;  3A54 A;  5CGK A;  2ENB A;  1X3G A;  4JI5 L;  1U4P A;  4BY7 H;  1WFQ A;  5FO9 B;  3ZYY X;  3E0E A;  1EY7 A;  4AQY L;  1D5X C;  3VA5 A;  1MGS A;  3K6O A;  4DV4 Q;  1EY4 A;  2F0T A;  3HP3 A;  4X6A H;  2JA5 H;  2FFK B;  3MZ5 A;  3CHB D;  3JAM E;  3CP0 A;  5KND A;  1LT6 D;  4P2C B;  4CJ0 B;  1VMP A;  5C44 H;  4KY7 A;  1IYJ B;  4GLV B;  1SR3 A;  2I5H A;  1PH5 A;  3PO2 B;  2A68 D;  2CKZ B;  1W2B A;  1PTO C;  1STN A;  4IQZ A;  2F0I A;  1Y69 U;  1G2S A;  4UP9 A;  1SYC A;  5CV5 A;  2SOB A;  1A3T A;  2UXD Q;  3NQI A;  1SRU A;  4KLK A;  4BY7 G;  3S2D H;  1FR3 A;  2NN6 I;  1XX8 A;  3LGJ A;  2Q2U A;  4B3M L;  5KNB A;  2VB3 X;  1IBL Q;  4DV0 Q;  2CWP A;  1EY8 A;  5C3E B;  4IFD H;  2KBN A;  3A7A B;  4L5Q A;  4LF5 L;  3RLN A;  2JA5 G;  5ELE A;  5E4W C;  3ND8 A;  1QG7 A;  3Q24 A;  2B2U A;  2LMC B;  4K8J A;  2OEO A;  4JI8 L;  2DNE A;  3O13 A;  2F0D A;  2KCC A;  4NXM Q;  5CV8 A;  1TS2 A;  4K8I A;  4FF4 A;  1YVC A;  1Y8P B;  1WCM H;  4JI6 Q;  5ELN A;  1SE8 A;  3F1Z A;  3T53 B;  1LT4 D;  1BDO A;  4BBR H;  2O5I C;  2NVQ H;  1HFN A;  4KI0 A;  1BKB A;  2KJX A;  1VQ4 A;  4IFD G;  1SYG A;  2ATW A;  1K8G A;  5I6Y A;  5IGD A;  1JMC A;  4KHZ A;  2WIN B;  1G51 A;  1YHA A;  1DGS A;  1X56 A;  3WWV A;  5HY6 A;  1ENA A;  1B50 A;  2H1E A;  5FO8 B;  4KKT A;  3A8J E;  2PQA A;  1VDZ A;  1ZKO A;  1DD2 A;  1GHJ A;  4K0K L;  3V05 A;  4A3F B;  4OWW B;  1ILQ A;  4AYB G;  4AQY Q;  1PLF A;  3K5L A;  1NCV A;  4IUR A;  1EY0 A;  1KIX A;  1WJJ A;  2QDB A;  3Q22 A;  4LFB Q;  3AFP A;  1WCM G;  2EY2 A;  2QCP X;  4LF7 Q;  4MTN A;  1DCZ A;  3NBH A;  2OQ0 A;  1SYE A;  4BBR G;  4L5R C;  3HKS A;  2SNM A;  2O4X A;  3KF8 B;  1JE4 A;  3J81 j;  1XMQ L;  2VW9 A;  3PO3 B;  4C3J B;  5G3L F;  2K28 A;  2RDG A;  5BN5 A;  5M3M B;  4OX9 L;  3BYT B;  4A3E H;  3A5Z B;  2K75 A;  2D62 A;  2L4N A;  5EKK A;  5D3I B;  2Q2I A;  4GN4 B;  3UI2 A;  2AUK A;  3NTI A;  4HCS A;  4B3R Q;  3GTQ B;  3SR1 A;  4JI2 L;  3MEF A;  1HZ9 A;  5CYU A;  2TMP A;  4A3G H;  4LF5 Q;  3TP8 A;  1YNN C;  4ZCK A;  1QZH A;  1XNR Q;  2L55 A;  3NWS A;  4CKE A;  5C4X H;  5JJI A;  3R2I A;  3CCE A;  4DF7 A;  2A69 D;  3MVV A;  2I5L X;  3CQZ B;  1Y1W H;  1RCV D;  4JI8 Q;  4X64 L;  2Z4I A;  1YHQ A;  1SEB D;  4XDX A;  1L2F A;  3CC4 A;  4RHR A;  2OCE A;  1UWV A;  4OGQ C;  1S5B D;  3E9I A;  4A3E G;  3HG9 A;  5E1F A;  1GUG A;  3G48 A;  2B2V A;  3ONA B;  1JWU D;  3STB C;  5CC4 A;  4ULL A;  4I7A A;  1K8M A;  3C1E A;  1MJC A;  2YU9 B;  1I4X A;  1MHW C;  2Z6K C;  1KL9 A;  1HFG A;  3OWE B;  4A3G G;  2J0T D;  2R3Z A;  3HOX H;  1CKM A;  5I6W A;  1TVX A;  2CQO A;  5C4X G;  1YJ9 A;  4PMB A;  5JPM C;  1HQM C;  4JI1 L;  1NBW A;  1JOO A;  1UE5 A;  2PI2 A;  3DUZ A;  4RCO A;  3HEJ A;  1F2Y A;  1GD7 A;  3EIV A;  1NR4 A;  2RCF A;  1Y1W G;  3UDX A;  3J80 L;  4JW0 A;  3EA6 A;  3TSS A;  1HA5 A;  1HTP A;  1BF4 A;  4MTK A;  5LMN L;  4DKA C;  2N88 A;  4DR7 L;  3GP7 A;  2BE5 D;  2NZO A;  4RGN A;  2IX3 A;  5C0X I;  3IAY A;  2AWO A;  3PCO B;  1L0W A;  3D4W A;  2B2W C;  3FPU B;  3TME A;  1CQV A;  3UDF A;  4U67 3;  2K32 A;  3CME A;  3HOX G;  2KHS A;  2LY7 A;  1Q46 A;  1ESF A;  1J5E L;  3KLS A;  2H4O A;  4MZ9 A;  2B2T A;  5IGG A;  3T4A C;  4C3I B;  5DNF A;  5JOB A;  4PMC A;  3X3N A;  4K2K A;  1A0I A;  3NQT A;  3A5U A;  1Z9F A;  1SXT A;  1SNQ A;  4P73 A;  2PW5 A;  1KDC A;  3DEP A;  2EZV A;  2CFM A;  2WAQ G;  3FMC A;  3H15 A;  4LJZ C;  1WTR A;  5C4J B;  2NVT B;  3U4Z A;  5KNC A;  1CFM A;  4FXG C;  2H5X A;  2NVX B;  1BBX C;  4YCV A;  5IP7 H;  4L6T B;  2P5Z X;  3A0J A;  3TBI B;  4GNX C;  1S3O A;  1AZQ A;  2HIV A;  4XT3 B;  4X64 Q;  4GLA C;  3S1Q B;  1XJV A;  3E6Z X;  4RWS C;  2XRQ D;  4HJ5 A;  2KHJ A;  1ROD A;  3R93 A;  2F52 A;  4N9P A;  2UXB L;  5LMU L;  1AW7 A;  5IOD A;  3L9A X;  3W2D A;  1VQE A;  3EN2 A;  2R61 A;  1A63 A;  4XQN A;  3NP8 A;  2FMM A;  1VQN A;  5J1Z A;  5JEA H;  5JJL A;  1ASZ A;  3HOU H;  3S2H H;  1EZ6 A;  2F0E A;  5J39 A;  1MJE A;  4A93 B;  4KJN A;  3A7L A;  1ONL A;  4C2M B;  4HSV A;  2N3S A;  4RG1 A;  1QVC A;  5ELO A;  4YWK A;  5IP7 G;  1LT3 D;  4NB3 A;  3TRE A;  4HJ7 A;  2BCO A;  1I6V C;  1R9T H;  1TU2 B;  4Y7N B;  4DV2 L;  5KRU A;  2EYP A;  1NJI C;  2K5D A;  4P71 A;  4DR7 Q;  1HZB A;  1KRS A;  1PH4 A;  3ERQ A;  4C3H H;  4LUO A;  4TRD A;  2JA8 B;  1XTC D;  1BNZ A;  2D2C C;  4LF9 Q;  1O80 A;  2F0P A;  3NUC A;  2NYZ D;  4L63 B;  3HOU G;  1LV9 A;  1NTG A;  4HIK A;  4DUZ L;  1EY9 A;  2VQF L;  1SE2 A;  3GTJ B;  4ABN A;  1N36 L;  4K6D A;  1OXV A;  1GUS A;  3W3A A;  1IBM L;  3KF6 B;  5J22 A;  1I5F A;  2QDL A;  3J80 i;  1KC8 C;  3FHW A;  2HIX A;  1BBW A;  4CJ2 C;  5EGT A;  5ELB A;  1STH A;  2F0S A;  4IUQ A;  2N49 A;  1EY6 A;  1Q3L A;  1T5E A;  1U0L A;  2X6G A;  5EBD A;  4Q5V A;  2F0L A;  2HQL A;  4MHE A;  2F3V A;  2ASB A;  1UE7 A;  2K52 A;  2PZU A;  4XT1 B;  3RMH A;  3CCJ A;  2KVM A;  2PCF B;  1SNO A;  3MXU A;  1Q1B A;  4C3H G;  1PH1 A;  2R93 B;  3VA7 A;  3C46 A;  3AYH B;  2SEB D;  1AH9 A;  2OT2 A;  5IT9 L;  3RNU A;  2F0F A;  3TS0 A;  3MA2 B;  1L0Y B;  4HIO A;  2A19 A;  2E5L L;  2RDF A;  5LMU Q;  5KGU A;  1K0R A;  3HS0 C;  1SJE D;  3AEV A;  1T5X D;  1PVO A;  3OMC A;  4LFA Q;  4CGY B;  2GVA A;  1STE A;  1SYD A;  2IT1 A;  3I91 A;  4GS3 A;  5HUR A;  3S9W A;  5ISR A;  4DR5 Q;  1TWA B;  1VQB A;  2CH4 A;  1UAP A;  1F2L A;  1E7Z A;  3Q0A A;  1BCP C;  4DR6 Q;  4E6I A;  1EWH A;  2EQS A;  1AFP A;  4IPG A;  1LUZ A;  3R8B A;  3GTO H;  2OF1 A;  1E0B A;  4DA2 A;  2JYO A;  2Y0S G;  3LNN A;  1TR5 A;  1QNK A;  3OSO A;  4DK3 C;  4DV2 Q;  1RJT A;  3FEW X;  4KN4 C;  4A3I B;  3N52 A;  3NK9 A;  3NWT A;  4LF4 Q;  2OXP A;  2R7Z G;  2F0J A;  5I9O A;  3H09 A;  1ET6 A;  1I50 H;  1B9M A;  1OTC A;  3I8Z A;  4JV5 L;  1YBY A;  4DV3 Q;  3ERO A;  5FK9 C;  2FJ2 A;  1P16 A;  3OTO L;  4X66 Q;  4X3S A;  3PGZ A;  3D31 A;  3DLL A;  5I4D A;  1X9N A;  3MXP A;  1NMF A;  1WTP A;  4A3M H;  1BO0 A;  4OWX B;  2F0G A;  2FIN B;  1IBM Q;  5I9P A;  1PMR A;  4BXX G;  5KIX A;  4X65 L;  1CTM A;  1VQA A;  1Y8O B;  1A8V A;  4UP7 A;  4XYO A;  1FGB D;  1V1O A;  3VYR A;  1U4M A;  2JXM B;  4A3D B;  1JWM D;  1CZW A;  3K5O A;  1BOS A;  1KNE A;  1XNQ L;  4GLX A;  3KJP A;  1KNA A;  1Q12 A;  3P1H A;  3C3L A;  1PYW D;  1WTO A;  2XGT A;  1SDF A;  4NXN L;  3T56 B;  1WTQ A;  2A6E C;  4EQP A;  2M00 A;  1QIL A;  4ME5 A;  3Q6S A;  5EPK A;  4MNO A;  3HOY H;  3W1B A;  3CCS A;  3MXN B;  5LL6 X;  4A3M G;  2WKD A;  4S3S A;  2JA7 B;  3MAQ A;  4IJL A;  3KJO A;  3CCV A;  1PRT D;  2HQE A;  3H91 A;  3I72 A;  1LTI D;  4DR4 L;  2F4I A;  2ZTD A;  4PZ6 A;  1A6X A;  2RHS B;  1MSG A;  1SFO B;  4B9X A;  1H95 A;  1SJH D;  5COR A;  3VR6 A;  1XPR A;  1N32 Q;  1VCI A;  3T13 A;  2QA4 A;  1DZ1 A;  5TSS A;  3WOF A;  4DUY Q;  1I6H B;  1TQO A;  4DN4 M;  1WVL A;  2PNH A;  3H0G B;  2E2H H;  2K05 A;  3N6R A;  2NTT A;  3UE0 A;  1LTR D;  3FRP B;  4KD4 A;  2A6H D;  4PQX A;  2HHH L;  3HOY G;  2MHV A;  5CV4 A;  4QQB X;  4WFN 3;  1JE5 A;  1CSP A;  2G5D A;  2Z0S A;  1AE3 A;  3GD7 A;  4APV A;  4IUN A;  1LTS D;  3J7Z C;  3GTL B;  4BY1 B;  1YJW A;  2KQ3 A;  1HXY D;  1YIT A;  1N33 L;  1Q8I A;  4B3S L;  3OTO Q;  1PRT B;  4CDC C;  4JC0 A;  4NW2 A;  1ENC A;  2LXK A;  1B70 B;  1NSN S;  3GO5 A;  1PTO D;  1KXL A;  1WI5 A;  1FJG Q;  5LL6 S;  1SSO A;  1E2V A;  2BH2 A;  5GAE C;  1ESR A;  1F9Q A;  4YHH L;  1VQL A;  3BJU A;  1WTX A;  1K8O A;  4BS9 A;  1Y1V B;  4DR1 L;  1PXU A;  2K5Q A;  1A62 A;  4LUV A;  4X3U A;  1IYU A;  3BU2 A;  3H94 A;  4LK1 C;  2AKW B;  4QGU A;  4H13 C;  1PH3 A;  3CKI B;  1K8A C;  4JI0 Q;  1KDB A;  1QOH A;  2B39 A;  4BBR B;  4K5W A;  4NXN Q;  3KBG A;  4EX5 A;  1LAB A;  3I4N H;  1F9S A;  1EQR A;  1BXT A;  3I4O A;  2XVS A;  2ALY B;  4OIJ A;  3CPW A;  1QZG A;  1LT5 D;  2B8F A;  1E2Z A;  2NB0 A;  1G6P A;  1QVF A;  4YWM A;  2ID0 A;  1HUM A;  2KUM A;  4RA8 A;  2EYH A;  3BZK A;  4DR4 Q;  1HNW L;  1Z7T A;  4GN3 B;  1YEZ A;  4NP5 A;  5GAG C;  3SE0 A;  1PTO B;  1VQ9 A;  2DY8 A;  1TWC H;  4JI3 Q;  1JJG A;  1EWI A;  4JK1 C;  4O1N A;  3QOL A;  3MFG A;  3SEB A;  2E2I B;  3J80 E;  1TY0 A;  1UNS A;  3HKZ B;  3KF6 A;  1M90 C;  2RBM A;  4OWT B;  1MBY A;  1JJ2 A;  3PF5 A;  2NZ1 D;  1SE4 A;  5EPL A;  3CRK C;  1LLR D;  1LTA D;  3K7A H;  2GA4 B;  3NXW A;  2D9U A;  1L1O B;  2HHH Q;  1EYD A;  3A8I E;  3DWA A;  2XNA C;  2JA9 A;  1HNZ L;  3FPP A;  4LF8 Q;  4R1J A;  4LNQ A;  1JC7 A;  1CA6 A;  3NBI A;  1VQM A;  3HKZ E;  1IL8 A;  3J7A F;  1HPC A;  4HIM A;  4X3T A;  4ZUI A;  4RKL A;  3K80 C;  2CW0 C;  2F4V L;  3IRB A;  3FKI G;  2CWA A;  3KBX A;  3LWU A;  2DN8 A;  2PYK A;  1ICF B;  1CQF A;  1KAA A;  1Y14 B;  1K83 H;  3CPF A;  1CT1 D;  3S1N B;  3HZX A;  5M5W H;  1XPU A;  2DJG C;  5FO7 B;  1BUV T;  1Q1E A;  1L1O C;  3HOW B;  4LW1 A;  2IHF A;  2K50 A;  3CRL C;  4V19 0;  1V1P B;  3AU7 A;  4A3J H;  3DEO A;  3M3Y H;  1V9P A;  4DXF A;  5C44 G;  3T1H L;  4QF4 A;  1YIJ A;  1YNN D;  3OYY A;  4ZQ3 A;  1J6Q A;  3BZD B;  3HOV H;  4B3T L;  3L7Z C;  3S17 H;  3HOZ H;  3J81 i;  4UP8 A;  1D5M C;  1EEF D;  1D6E C;  1SRO A;  1V43 A;  4CDE C;  3D8G A;  1TWG H;  1EU3 A;  3PUZ A;  4R4T A;  4JBW A;  5JVH 3;  1TWF H;  1HZA A;  2CQA A;  4MN3 A;  3T16 A;  4TSS A;  5J3B A;  4H7B A;  2E2J H;  1PH7 A;  1JJC B;  3S1M H;  3U9O A;  1GUW A;  2EVB A;  1H9J A;  1E1T A;  4LF6 Q;  2N78 A;  4DK1 A;  1B4O A;  2IY5 B;  5M3F B;  4G7Z C;  4A3J G;  5D65 A;  3I4M H;  4HMI A;  2JSO A;  2EY1 A;  2RA4 A;  1ZXT A;  4A4I A;  4JI5 Q;  4GKJ L;  1H9S B;  4TVA B;  1HRJ A;  1JQY D;  3MWY W;  4A75 A;  3HOZ G;  1VQK A;  1SND A;  2EY5 A;  4OEL B;  4N9T A;  2PMZ B;  3QIA A;  3KK7 A;  5E7N A;  4K6L A;  2BDN A;  1QUQ B;  5C6A A;  1LTL A;  1WTH A;  1XXG A;  1VQC A;  2YTV A;  3ERS X;  4EGV A;  3GTP H;  1U9R A;  3VYS A;  4XQJ A;  1SNP A;  1X3E A;  2ICE C;  2MGS A;  1PH2 A;  3ER0 A;  4ODG A;  1QVG A;  3PF4 A;  3MXN A;  3I4M G;  1C0A A;  1TS5 A;  1JB7 A;  2PMZ E;  2ZTE A;  4DGZ A;  2AUJ D;  2BOS A;  1EZ8 A;  1B8A A;  4B3M Q;  2HD3 A;  3S1R B;  2L15 A;  1SE3 A;  1FGU A;  4ME3 A;  5JPN C;  1OXS C;  3OHX C;  4HJ8 A;  4EVO A;  5FLM H;  1IL2 A;  3DHQ A;  3T1H Q;  1QB5 D;  2K01 A;  3E9H A;  2IPK D;  3KUP A;  1UE6 A;  1QE6 A;  4JG2 A;  3CCU A;  1HQR D;  5IT9 E;  1FD7 D;  1B1Z A;  1CZG A;  4A3B B;  1MKH A;  2C35 B;  4B3T Q;  1VQ5 A;  3ND9 A;  3PO2 H;  3RN5 A;  3OW2 A;  1B53 A;  1Q86 C;  4P72 A;  3H3V H;  1I4Q A;  4NKL A;  5K36 H;  1ICW A;  3RLO A;  2F03 A;  5A2Q L;  3LX0 A;  1IBK L;  4XXE A;  4A76 A;  1RKN A;  2WB1 B;  3R3O A;  3QJY A;  2PW7 A;  2ZXO A;  1I3Q B;  3CCQ A;  4JOI C;  4IUT A;  4ZRZ A;  3MC0 B;  3TP7 A;  3BDL A;  2AQ1 B;  5C3E H;  1G6Z A;  4EQO A;  5FLM G;  5JEA J;  1WD0 A;  1IXR A;  5C3W A;  4IUP A;  1Y8N B;  2UUB L;  2KHI A;  3PUV A;  1VQD A;  3CXC A; 
#chains in the Genus database with same CATH homology
 1CA5 A;  4DAP A;  5FLX E;  1RDP D;  4A3K B;  1LO5 D;  1LTB D;  5IOC A;  2XIW A;  2PZW A;  5K36 G;  2BA1 A;  5DAU A;  3V2T A;  1ET9 A;  4DFA A;  1OXU A;  2K6A A;  2HCI A;  4KD3 A;  4QCL A;  5HGT A;  2VB2 X;  1KDA A;  3RUZ A;  3OIQ A;  4ZYS A;  1YNJ D;  1A2U A;  1Z6H A;  4FXK C;  2EOT A;  3GTK B;  2JEB I;  4R8N A;  5DEH A;  1D1K A;  4X3K A;  5AFW A;  3JAM L;  1HCZ A;  1SMY C;  2B2Y C;  2M9V A;  3K57 A;  3HGB A;  2R92 B;  1JIC A;  2R7Z B;  2F0O A;  3VYT A;  2HUG A;  3S16 B;  4ZKC B;  4IFD I;  1MI2 A;  3DWP A;  3DXJ C;  1S5E D;  2JP1 A;  3I70 A;  3IFD A;  2EYM A;  4J1M A;  1G29 1;  1LTG D;  3OWF A;  1EQT A;  2A73 B;  1F2M A;  1EU4 A;  1HHV A;  1G91 A;  3SXH A;  2Q8R E;  2Z1C A;  2L1B A;  1SAP A;  1KLG D;  2EE1 A;  1BCP D;  3PIO 3;  2ZT9 C;  1H9K A;  4CHT B;  1JR0 D;  1IYV A;  2IL8 A;  3I90 A;  2NWG A;  2L12 A;  1V1P A;  2EY6 A;  4O42 A;  1ENF A;  2XSC A;  2EPB A;  1O7Y A;  1W6K A;  1IW7 C;  4BBS B;  3J81 E;  4B08 A;  5JEA G;  3NPP A;  4R8I A;  2A74 C;  1EIG A;  4CKB A;  1H9R A;  2NVY B;  3BYY B;  4CBV A;  4ZUJ A;  3QOJ A;  1WD1 A;  3S14 B;  2L9H A;  1PZI D;  1XYI A;  4HN7 A;  4KKS A;  1R4Q B;  3DMU A;  1BCP B;  1X32 A;  1PFN A;  4KK7 A;  2JA6 B;  2Z8L A;  2HDL A;  5M5X B;  2NUC A;  5KEE A;  1H9S A;  3SK6 A;  3S15 B;  4K5X A;  2F0V A;  1STG A;  2VUM B;  2A6E D;  3SK8 A;  2B8G A;  4OO1 H;  2I46 A;  4G7O C;  3KF8 A;  4DAV A;  1ZEQ X;  3VR5 A;  4LMQ D;  1EFI D;  5EKL A;  5M5Y B;  1TWH B;  5CV7 A;  2F0K A;  2L11 A;  1ML0 D;  1O78 A;  1DJR D;  3F2U A;  3I73 A;  1M4V A;  5K5P A;  1QWY A;  1A2T A;  2XN9 C;  4BWG B;  2K04 A;  5CMD A;  2B63 B;  4OO1 G;  2Z4H A;  1M8A A;  3OOC A;  1VF7 A;  2RSO A;  4IUV A;  3GTG B;  4C3I G;  3M4O B;  1ILP A;  3VYU A;  3RZD B;  1KLU D;  3T51 B;  1B9N A;  5JJZ A;  2B2W A;  4F88 A;  4KMU C;  1TT2 A;  1C8C A;  3D3R A;  4FF1 A;  3RZO B;  1Z47 A;  3QWN A;  3I4L A;  3GTM B;  3RLF A;  4L8J A;  4Z9C B;  3TZD A;  4TKO B;  2B2U C;  3M4Y A;  4C56 C;  1A15 A;  3I3C A;  3GQB A;  3FKI B;  1A3U A;  4BY7 B;  4FF2 A;  4FXD A;  4M1U B;  4QB4 A;  3NE5 B;  3URY A;  5CBA E;  2JA5 B;  3M7G A;  4XQQ A;  3D4D A;  5C44 B;  2EYL A;  1C48 A;  1GUN A;  2EYJ A;  5IGF A;  2Q8T A;  1X3Q A;  1JB3 A;  3A8K E;  4U68 A;  3U9S A;  2KCN A;  1O7L A;  2LS0 1;  4ID6 A;  5T1G A;  1QCB D;  3S2D B;  3SVM A;  5CV6 A;  5C0X J;  2J4X A;  4DU9 A;  1I4R A;  5E3F A;  4QUF A;  5DM7 3;  4F7X A;  2R6G A;  5BN4 A;  2RQX A;  1EWC A;  4GZY C;  1IKM A;  2XRS D;  2CW0 D;  3FDT A;  2E2D C;  3H6M A;  4AYB B;  4Q0F A;  1DM0 B;  2CVR A;  1WCM B;  2LFN A;  4WOR A;  3BS1 A;  3K58 A;  2NVQ B;  4XTC S;  5BN3 A;  1CHQ D;  3GV6 A;  2EYO A;  1AZP A;  3BVM A;  2IJ0 A;  3IKJ A;  3VR3 A;  4OL7 A;  1DXM A;  5DM6 3;  3D6W A;  3OPO A;  4FNF A;  2IX1 A;  1SYF A;  3AMU A;  2B2V C;  4OIK A;  1WTV A;  4C1N K;  5G3L D;  3P7J A;  2D5D A;  1I4H A;  3PUW A;  2DY7 A;  1AP0 A;  3BVG A;  4RFB A;  1H9M A;  3PIP 3;  2QEJ C;  1G2T A;  1GOZ A;  4KHV A;  2IWH A;  4R9W A;  3BDO A;  4A3E B;  3D4R A;  5C0X H;  3HRZ C;  1D5Z C;  4PV1 C;  3PMF A;  1JOQ A;  2A6H C;  4CKC A;  5EQ0 A;  4A3G B;  1U4L A;  2VXW A;  1CI3 M;  1RHP A;  3TDQ A;  5C4X B;  1VMC A;  5C5L A;  2SDF A;  1STY A;  3RD4 A;  4KY5 A;  3PV0 A;  1B2T A;  1LTT D;  1PRT F;  1Y1W B;  2F0H A;  2B2T C;  1S5C D;  2WP8 J;  1UUP A;  4ILW A;  3OMG A;  1EY5 A;  1CM9 A;  1SNM A;  3NTK A;  3WOE A;  1RTO A;  4ZKB B;  5C0X G;  4B9W A;  3DM1 A;  1IKL A;  4UAI A;  1S5D D;  2PQE A;  4K5V A;  3TP5 A;  5ELF A;  3HOX B;  1QNU A;  2PNR C;  2PZT A;  4ZK9 B;  4DXG A;  5ELD A;  1Q90 A;  1FNW A;  5C4H A;  3M85 A;  3EQL C;  1DOL A;  1I4P A;  1KAB A;  2DNC A;  1DYQ A;  3AB9 A;  2EXZ A;  2KA7 A;  5LHY 1;  3J7A V;  2WAQ B;  3H3V C;  5I2X A;  4RGM A;  1TKW B;  1HUN A;  5FKA C;  1PTO F;  2F0Q A;  5IGC A;  5IGE A;  4OHJ A;  2K03 A;  1C4Q A;  1ZYR C;  2K1B A;  2M2L A;  4RGT A;  1EOT A;  3BVZ A;  1RTN A;  4IAL A;  5A35 A;  2K33 A;  3E0J A;  2A5H A;  1R4P B;  1O7Z A;  4TQU S;  1PTO H;  2F3W A;  4V0B A;  1E2W A;  1DOM A;  5C4Z A;  2A68 C;  1SYB A;  3X3M A;  2YYZ A;  1S4Z A;  1RF2 D;  1OO9 B;  5EJW A;  1BR9 A;  1GXD C;  3IL8 A;  1SMY D;  4ZLT F;  1STB A;  4RGO S;  2RDH A;  3J7Y W;  1SBB B;  3WDN A;  3L3O C;  3HOU B;  2IW3 A;  3S2H B;  2C9O A;  5T1I A;  2PO4 A;  2PPB C;  2BDO A;  1II3 A;  3P20 A;  3NTH A;  3TZU A;  1GUO A;  2FMC A;  1R9T B;  2KED A;  4EQN A;  3EVQ A;  1NR2 A;  1V8Q A;  1X3P A;  4HED A;  4C3H B;  4RHS A;  4KY6 A;  4UDU C;  3SDZ A;  3E5S A;  2VNU D;  4HTH A;  5ELC A;  5D3D A;  4KN7 C;  1CHP D;  4KJO A;  4HAE A;  1MSH A;  1OXX K;  1IW7 D;  2X6L A;  1J9O A;  2AQ3 B;  3KLR A;  2IX0 A;  4RH6 A;  4FF3 A;  2G9D A;  2HDM A;  1GHK A;  2F1M A;  2Y0S B;  3PUY A;  1STA A;  1F9P A;  1J8I A;  1LAC A;  4FO2 A;  1FNU A;  4WJW A;  1WTW A;  1JOK A;  3OW7 A;  1B44 D;  1I4G A;  1KTK A;  2QIL A;  4QMG A;  2A69 C;  3SK4 A;  2CHB D;  4KV6 A;  3G6J B;  2X69 A;  1IHZ A;  2XWJ B;  2RSN A;  3GTO B;  3D6C A;  4K2L A;  2L5T A;  3Q23 A;  2O5J C;  5C5M A;  4NDX A;  2MPM A;  3K59 A;  5NUC A;  1B3A A;  4PMW A;  3GV3 A;  1I50 B;  2NTS A;  2KOL A;  1QJO A;  2E76 C;  3K5M A;  4HMJ A;  4J6H A;  5EKI A;  4C3J G;  3EJI A;  4A3M B;  4KKU A;  3OIP A;  3G7L A;  5JVG 3;  2WV6 D;  2L0C A;  3PUX A;  2BE5 C;  4KTA A;  4IUU A;  1U4R A;  4BA2 I;  5C3X A;  2MJ8 A;  1YNJ C;  1AN8 A;  4FVM A;  2E75 C;  4QIW B;  2ICI A;  4LAA A;  1VF5 C;  1HTL D;  2J7Z A;  4K14 A;  3HOY B;  1DOK A;  1NUC A;  5CBE E;  5F2D A;  3DWQ A;  1MD2 D;  1F77 A;  2N55 A;  4I7Z C;  4G4K A;  2MP1 A;  2WII B;  4ZAI A;  1TS4 A;  3A55 A;  2RVL A;  2E2H B;  3MFY A;  4HCE A;  2RKS A;  3BG3 A;  3M7N A;  3A56 A;  2O2L D;  4PNY A;  1RD9 D;  2ZXR A;  4MIU A;  2F0N A;  4J8Q A;  3TN2 A;  1PFB A;  4M8A A;  1D2B A;  4I65 A;  5M9O A;  4C1N I;  4CJ1 B;  2HCC A;  2AWN A;  3QO2 A;  1XWE A;  1NAP A;  5JAV A;  1GJX A;  4H0L C;  5KYL A;  4RKB A;  5FLX L;  4FYD A;  1EQV A;  2C5C A;  1EIH A;  3R2T A;  3V96 A;  3TP6 A;  3MEH A;  4DNR B;  3I4N B;  2NN6 H;  1EYC A;  2MUY A;  3LWE A;  1PDQ A;  4RCN A;  3K5N A;  1FYC A;  1TS3 A;  3NHH A;  5KYI A;  4XIG S;  2K5W A;  3BDC A;  1BCP F;  1L0X B;  2B2Y A;  2BA0 A;  2AQ2 B;  4WRD A;  4F87 A;  1TWC B;  3MHB A;  4F8M A;  3IFT A;  1EYA A;  4XYQ A;  2NN6 G;  5EBC A;  2EYF A;  3K7A B;  1HA6 A;  4DAY A;  4DK0 A;  3NSW A;  5E4X A;  5D14 A;  3MXG A;  1AEX A;  1SNC A;  2WAC A;  1F2Z A;  3K0Y A;  5FOB B;  2FHT A;  4HSP A;  2ZXP A;  2QKI C;  1D1I A;  1JWS D;  2EJM A;  2G9H D;  2TSS A;  3CU7 A;  1TII D;  1TY2 A;  2WKC A;  4FP5 D;  1W6J A;  5EPJ A;  3FVQ A;  1K83 B;  2KEE A;  5M5W B;  4HR7 B;  4QUC A;  3KLS X;  4A3J B;  3M3Y B;  3EFX D;  1GUT A;  1FNV A;  4H44 C;  2NBF A;  4BA1 I;  3VR2 A;  3QG1 A;  4G7H C;  2Q8I B;  1JCK B;  3HOV B;  4YIJ A;  3HOZ B;  3S17 B;  1G8Z D;  4G57 A;  2JE6 I;  1TWG B;  2QF7 A;  2SNS A;  3J81 L;  1TWF B;  1A3V A;  5IIF A;  1PFM A;  5CV9 A;  4IZ8 A;  5I2Y A;  3SK5 A;  2EDG A;  5COY A;  1EL0 A;  2E2J B;  1PZJ D;  3S1M B;  3C2P A;  3QB3 A;  5A2Q E;  3MTS A;  2K7V A;  3ITP A;  3I4M B;  2KEC A;  4IFD J;  2V4D A;  3VR4 A;  1PZK D;  2EJG C;  2F0W A;  1S5F D;  5IGB A;  1CK1 A;  1DON A;  2JEA I;  1F9R A;  1JOR A;  1PRT C;  4NMZ A;  2EJF C;  1BQQ T;  4OO1 I;  2I07 B;  1OXT A;  3GTP B;  2E74 C;  2F0M A;  3P75 A;  2F0U A;  3C1F A;  4RAU C;  5CR3 A;  2XWB B;  3SHL A;  4DNT B;  1UEA B;  1EEI D;  1ZYR D;  4IN3 A;  2LKV A;  3A54 A;  5CGK A;  2ENB A;  1U4P A;  5FO9 B;  3ZYY X;  1EY7 A;  1D5X C;  3VA5 A;  1MGS A;  3K6O A;  1EY4 A;  2F0T A;  3HP3 A;  2FFK B;  3MZ5 A;  3CHB D;  3JAM E;  5KND A;  1LT6 D;  4CJ0 B;  4P2C B;  1VMP A;  4KY7 A;  3PO2 B;  2A68 D;  1PTO C;  1STN A;  4IQZ A;  2F0I A;  1Y69 U;  1G2S A;  1SYC A;  5CV5 A;  2SOB A;  1A3T A;  3NQI A;  1FR3 A;  2NN6 I;  1XX8 A;  5KNB A;  2VB3 X;  1EY8 A;  5C3E B;  4IFD H;  3A7A B;  5ELE A;  5E4W C;  3ND8 A;  1QG7 A;  3Q24 A;  2B2U A;  2LMC B;  4K8J A;  2OEO A;  2DNE A;  3O13 A;  2F0D A;  2KCC A;  5CV8 A;  1TS2 A;  4K8I A;  4FF4 A;  1Y8P B;  3T53 B;  1LT4 D;  1BDO A;  2O5I C;  1HFN A;  4KI0 A;  2KJX A;  4IFD G;  1SYG A;  5I6Y A;  5IGD A;  4KHZ A;  2WIN B;  1ENA A;  1B50 A;  2H1E A;  5FO8 B;  4KKT A;  3A8J E;  1VDZ A;  1ZKO A;  1DD2 A;  1GHJ A;  3V05 A;  4A3F B;  1ILQ A;  1PLF A;  3K5L A;  1NCV A;  4IUR A;  1EY0 A;  2QDB A;  3Q22 A;  2EY2 A;  2QCP X;  1DCZ A;  3NBH A;  1SYE A;  2SNM A;  2O4X A;  1JE4 A;  3PO3 B;  4C3J B;  5G3L F;  2K28 A;  2RDG A;  5BN5 A;  5M3M B;  3BYT B;  2D62 A;  2L4N A;  5EKK A;  5D3I B;  3UI2 A;  2AUK A;  3NTI A;  4HCS A;  3GTQ B;  3SR1 A;  5CYU A;  2TMP A;  3TP8 A;  1YNN C;  2L55 A;  3NWS A;  4CKE A;  3R2I A;  4DF7 A;  2A69 D;  3MVV A;  3CQZ B;  1RCV D;  2Z4I A;  1SEB D;  4XDX A;  4RHR A;  4OGQ C;  1S5B D;  3HG9 A;  5E1F A;  1GUG A;  2B2V A;  3ONA B;  1JWU D;  5CC4 A;  4ULL A;  1K8M A;  3C1E A;  2YU9 B;  1I4X A;  3OWE B;  1HFG A;  2J0T D;  2R3Z A;  5I6W A;  1TVX A;  4PMB A;  5JPM C;  1HQM C;  1JOO A;  3DUZ A;  4RCO A;  1F2Y A;  3HEJ A;  1NR4 A;  3J80 L;  3EA6 A;  3TSS A;  1HA5 A;  1HTP A;  1BF4 A;  2N88 A;  3GP7 A;  2BE5 D;  5C0X I;  4RGN A;  2IX3 A;  3IAY A;  2AWO A;  3D4W A;  2B2W C;  3FPU B;  3TME A;  1CQV A;  4U67 3;  2K32 A;  2KHS A;  2LY7 A;  1ESF A;  3KLS A;  2H4O A;  2B2T A;  5IGG A;  3T4A C;  4C3I B;  3X3N A;  5DNF A;  4PMC A;  5JOB A;  4K2K A;  3NQT A;  1SXT A;  1SNQ A;  2PW5 A;  1KDC A;  3DEP A;  2EZV A;  3FMC A;  4LJZ C;  1WTR A;  5C4J B;  2NVT B;  5KNC A;  1CFM A;  4FXG C;  2NVX B;  1BBX C;  4L6T B;  3TBI B;  1AZQ A;  4XT3 B;  3S1Q B;  3E6Z X;  4RWS C;  2XRQ D;  1ROD A;  3R93 A;  4N9P A;  1AW7 A;  5IOD A;  3L9A X;  3W2D A;  2R61 A;  4XQN A;  3NP8 A;  2FMM A;  5J1Z A;  5JEA H;  1EZ6 A;  2F0E A;  5J39 A;  4A93 B;  4KJN A;  3A7L A;  1ONL A;  4C2M B;  4HSV A;  1LT3 D;  2BCO A;  1I6V C;  1TU2 B;  4Y7N B;  5KRU A;  2EYP A;  2K5D A;  3ERQ A;  4TRD A;  2JA8 B;  1XTC D;  1BNZ A;  2D2C C;  1O80 A;  2F0P A;  3NUC A;  2NYZ D;  4L63 B;  1LV9 A;  1EY9 A;  1SE2 A;  3GTJ B;  4ABN A;  4K6D A;  1OXV A;  1GUS A;  3W3A A;  5J22 A;  4CJ2 C;  5EGT A;  5ELB A;  1STH A;  2F0S A;  4IUQ A;  1EY6 A;  1Q3L A;  1T5E A;  2X6G A;  5EBD A;  4Q5V A;  2F0L A;  4MHE A;  2F3V A;  3RMH A;  2PZU A;  4XT1 B;  2KVM A;  2PCF B;  1SNO A;  3MXU A;  1Q1B A;  4C3H G;  2R93 B;  3VA7 A;  3C46 A;  2SEB D;  2OT2 A;  5IT9 L;  2F0F A;  3MA2 B;  1L0Y B;  2RDF A;  5KGU A;  3HS0 C;  1SJE D;  1T5X D;  3OMC A;  4CGY B;  1STE A;  1SYD A;  2IT1 A;  3I91 A;  5HUR A;  3S9W A;  5ISR A;  1TWA B;  1UAP A;  1F2L A;  3Q0A A;  1BCP C;  4E6I A;  1EWH A;  1AFP A;  3R8B A;  2OF1 A;  1E0B A;  4DA2 A;  2JYO A;  3LNN A;  1TR5 A;  1QNK A;  3OSO A;  1RJT A;  3FEW X;  4KN4 C;  4A3I B;  3N52 A;  3NK9 A;  3NWT A;  2OXP A;  2F0J A;  5I9O A;  3H09 A;  1ET6 A;  1B9M A;  3I8Z A;  3ERO A;  5FK9 C;  2FJ2 A;  4X3S A;  3D31 A;  5I4D A;  3MXP A;  1WTP A;  1BO0 A;  2F0G A;  2FIN B;  5I9P A;  1PMR A;  5KIX A;  1CTM A;  1Y8O B;  4XYO A;  1FGB D;  1V1O A;  3VYR A;  1U4M A;  2JXM B;  4A3D B;  1JWM D;  1CZW A;  3K5O A;  1BOS A;  1KNE A;  1KNA A;  1Q12 A;  3P1H A;  3C3L A;  1PYW D;  1WTO A;  1SDF A;  3T56 B;  1WTQ A;  2A6E C;  4EQP A;  2M00 A;  1QIL A;  4ME5 A;  3Q6S A;  5EPK A;  5LL6 X;  2WKD A;  4S3S A;  2JA7 B;  3MAQ A;  1PRT D;  2HQE A;  3H91 A;  3I72 A;  1LTI D;  2F4I A;  1A6X A;  1MSG A;  1SFO B;  4B9X A;  1SJH D;  5COR A;  3VR6 A;  1VCI A;  3T13 A;  1DZ1 A;  5TSS A;  3WOF A;  1I6H B;  1TQO A;  4DN4 M;  1WVL A;  3H0G B;  2K05 A;  3N6R A;  2NTT A;  1LTR D;  3FRP B;  4KD4 A;  2A6H D;  4PQX A;  2MHV A;  5CV4 A;  4WFN 3;  3GD7 A;  4IUN A;  1LTS D;  3GTL B;  4BY1 B;  2KQ3 A;  1HXY D;  1Q8I A;  1PRT B;  4NW2 A;  1ENC A;  1NSN S;  3GO5 A;  1PTO D;  5LL6 S;  1SSO A;  1E2V A;  1ESR A;  1F9Q A;  1WTX A;  1K8O A;  4BS9 A;  1Y1V B;  1PXU A;  2K5Q A;  4X3U A;  1IYU A;  3H94 A;  4LK1 C;  4H13 C;  3CKI B;  1KDB A;  1QOH A;  2B39 A;  4BBR B;  4K5W A;  3KBG A;  1LAB A;  1F9S A;  1BXT A;  2XVS A;  4OIJ A;  1LT5 D;  2B8F A;  1E2Z A;  2NB0 A;  2ID0 A;  1HUM A;  2KUM A;  4RA8 A;  2EYH A;  1Z7T A;  4NP5 A;  3SE0 A;  1PTO B;  2DY8 A;  4JK1 C;  4O1N A;  3QOL A;  3MFG A;  3SEB A;  2E2I B;  3J80 E;  1TY0 A;  1UNS A;  3HKZ B;  2RBM A;  1MBY A;  2NZ1 D;  1SE4 A;  5EPL A;  3CRK C;  1LLR D;  1LTA D;  2GA4 B;  3NXW A;  2D9U A;  1EYD A;  3A8I E;  3DWA A;  2XNA C;  3FPP A;  1JC7 A;  1CA6 A;  3NBI A;  1IL8 A;  3J7A F;  1HPC A;  4X3T A;  4ZUI A;  4RKL A;  2CW0 C;  3KBX A;  3LWU A;  2DN8 A;  2PYK A;  1CQF A;  1KAA A;  1CT1 D;  3S1N B;  3HZX A;  5FO7 B;  1BUV T;  1Q1E A;  3HOW B;  3CRL C;  4V19 0;  1V1P B;  3AU7 A;  3DEO A;  4DXF A;  4QF4 A;  1YNN D;  4ZQ3 A;  3BZD B;  3L7Z C;  1D5M C;  1EEF D;  1D6E C;  1V43 A;  3D8G A;  1EU3 A;  3PUZ A;  4JBW A;  5JVH 3;  2CQA A;  4MN3 A;  3T16 A;  4TSS A;  4H7B A;  3U9O A;  1GUW A;  2EVB A;  1H9J A;  4DK1 A;  1B4O A;  5M3F B;  4G7Z C;  5D65 A;  4HMI A;  2JSO A;  2EY1 A;  2RA4 A;  1ZXT A;  1H9S B;  1HRJ A;  1JQY D;  3MWY W;  1SND A;  2EY5 A;  4N9T A;  2PMZ B;  3QIA A;  3KK7 A;  4K6L A;  2BDN A;  5C6A A;  1XXG A;  4EGV A;  1U9R A;  3VYS A;  4XQJ A;  1SNP A;  2ICE C;  2MGS A;  4ODG A;  3MXN A;  1TS5 A;  4DGZ A;  2AUJ D;  2BOS A;  1EZ8 A;  3S1R B;  1SE3 A;  5JPN C;  1OXS C;  3OHX C;  4EVO A;  3DHQ A;  1QB5 D;  2K01 A;  3KUP A;  2IPK D;  1QE6 A;  1HQR D;  5IT9 E;  1FD7 D;  1B1Z A;  1CZG A;  4A3B B;  3ND9 A;  1B53 A;  1I4Q A;  4NKL A;  5K36 H;  1ICW A;  2F03 A;  5A2Q L;  3LX0 A;  4XXE A;  1RKN A;  2WB1 B;  3R3O A;  3QJY A;  2PW7 A;  2ZXO A;  1I3Q B;  4IUT A;  4ZRZ A;  3MC0 B;  3TP7 A;  3BDL A;  2AQ1 B;  1G6Z A;  4EQO A;  5JEA J;  1WD0 A;  5C3W A;  4IUP A;  1Y8N B;  3PUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...