5DEHA

Crystal structure of staphylococcal nuclease variant delta+phs n100d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVDEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N100D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dehA00
1ENCA 3QOJA 2EY5A 3C1FA 4K8JA 5C6AA 2O4XA 2OXPA 4NP5A 5NUCA 2OF1A 3R3OA 4EQOA 1EYCA 5C3XA 2OEOA 1A3UA 4NKLA 2F0GA 3SHLA 4F7XA 3U9OA 1KAAA 5KYLA 3T13A 3SXHA 2PZUA 3SK6A 1II3A 3EJIA 5I6YA 2EYLA 5CV8A 3EVQA 3DMUA 1JOOA 3OMGA 2PZTA 2PW7A 1STNA 3ITPA 5E1FA 5IGBA 5DEHA 1SYGA 1EY5A 2F0NA 3NP8A 5CV6A 5IOCA 4MIUA 5KYIA 2ENBA 4QMGA 4RKBA 4TRDA 3P75A 1A3TA 2PQEA 1SNOA 1JOKA 3D4WA 3HEJA 3BDCA 4PMCA 4HMJA 5C4ZA 3TP8A 4DF7A 2EYMA 4IUNA 4J6HA 4KD3A 1KDBA 4KJOA 3NHHA 3OMCA 2EY1A 1STYA 1A3VA 3D6CA 3MHBA 1STAA 4KTAA 1SNMA 1EY0A 5J1ZA 2SNMA 2F0JA 4ODGA 2EYHA 2HQEA 2NUCA 2F0HA 4K5VA 2F0KA 2KQ3A 3NUCA 4KY5A 3SK8A 5M9OA 5KRUA 4PMBA 3D8GA 5I9PA 4PNYA 5EKLA 3LX0A 3MEHA 3S9WA 1JORA 1SNQA 3VA5A 4B9WA 4EQNA 4QB4A 1EZ6A 4K6DA 4QF4A 2F0QA 2QDBA 5I9OA 3E5SA 2F0TA 4OL7A 3PMFA 2F0WA 2F0PA 4G57A 3DHQA 4HMIA 3C1EA 4K2KA 4LAAA 1TT2A 5CV9A 3SK4A 3D4DA 2F0DA 3H6MA 5C5MA 3TP5A 5J39A 3BDLA 1A2UA 1STGA 1SYEA 4I65A 3RUZA 2KHSA 5JOBA 1EY6A 3V2TA 4H7BA 5C5LA 3OWFA 1SNDA 3NQTA 5IGFA 1SNPA 3EROA 2EYJA 1EY4A 2F0OA 3SR1A 5ISRA 4IALA 4RKLA 1RKNA 3T16A 5C3WA 3MXPA 5E3FA 5IIFA 4ZQ3A 4R8NA 5IGCA 2EXZA 1STBA 4N9TA 2SOBA 4F8MA 4EVOA 3HZXA 5CR3A 5IGEA 4YIJA 1F2ZA 1IHZA 4K14A 3TP7A 5IGGA 5JAVA 1EYAA 1F2MA 1EYDA 2F0LA 2PZWA 2RDFA 4IZ8A 2PYKA 5KIXA 1STHA 1EY7A 1EY9A 1SYDA 2EY6A 3NXWA 4HTHA 4KJNA 1KDCA 1EZ8A 4KY7A 5I6WA 3QB3A 4NMZA 5IODA 3ERQA 4KY6A 3TP6A 2M00A 2F3WA 4ZUJA 1KABA 2WACA 3OSOA 4N9PA 5F2DA 4NDXA 4E6IA 5EGTA 1SYFA 4KHVA 5HGTA 5KGUA 2F0SA 2RKSA 5CV7A 5K5PA 2RBMA 2F0FA 3MZ5A 4WRDA 5J22A 3P1HA 1EQVA 1SYCA 2F0MA 4DGZA 2SNSA 4J1MA 1F2YA 2EYOA 5C4HA 2EY2A 4ID6A 3MVVA 1TQOA 4KV6A 5CV4A 3TMEA 4EQPA 5CC4A 4ZUIA 4B9XA 2EYFA 2F0VA 3QOLA 4ME5A 1JOQA 1SYBA 4WORA 4DU9A 4DFAA 4KD4A 5DAUA 3NK9A 1U9RA 2LKVA 4S3SA 2EYPA 5EKKA 1A2TA 1AEXA 3SK5A 4K5XA 2F0UA 5KEEA 4K5WA 5IGDA 4K2LA 5HURA 2F0IA 1SNCA 1NUCA 1EY8A 5CV5A 4K8IA 2F0EA 2PW5A 5CGKA 2F3VA 1TR5A 1NSNS 1ENAA 1KDAA
chains in the Genus database with same CATH superfamily
1ENCA 1L1OB 1F77A 4NB3A 4ZYSA 4RGNA 3M4OH 1K3RA 3CF5A 4HJ8A 1VQHA 4NKLA 4Q5VA 2CQAA 3J81i 2ZT9C 4HJ5A 2RSNA 5CBAE 4GOPB 5ELCA 3SK6A 3J81c 3S1MB 1PFNA 1WTVA 4DV3Q 1LLRD 4QY7A 2TMPA 5IP9H 2CH4A 4FXKC 2QDLA 2B8GA 1LT3D 1KLGD 4UP7A 4RGOS 1MJEA 3NHHA 2A5HA 5I4DA 5M3MG 4QL5A 2HQEA 2R61A 5LL6S 4UP9A 4V0BA 3RLNA 5KRUA 3G71A 2QA4A 1LUZA 3J81L 2EPBA 3DWQA 4EQNA 3K80C 2ALYB 3FHWA 2CH4W 1HNXL 2PNRC 4DR3Q 5BN5A 1SJED 4EGVA 4XYOA 3VA7A 5JEAJ 5JJLA 4MTNA 1PTOD 4L5SA 1EEID 4P71A 5T1GA 1I94L 1UEBA 1OXTA 1ICFB 1NR4A 1JMCA 2Z9HA 5C4XB 1CQVA 2EXZA 1STBA 3PO3B 3I4NH 2SOBA 3K5MA 4V190 5JJKA 1Q1BA 3GTKB 3C3LA 2G9DA 1TY2A 2H5XA 3GTGH 3J7YW 1TWAB 4KY7A 3W1BA 2L9HA 2JA8G 2R92B 2AWNA 3OW7A 1ILPA 4NMZA 1I4HA 1Q12A 4K0KL 4DKAC 1MKHA 3FKIG 1R4QB 2A6EC 4DR4Q 1AE2A 1F2YA 2EYOA 3BG3A 1XNRQ 1PTOB 2Y0SE 1TWFH 2B3GA 5IYCG 1PTOF 3QIAA 1LM0A 1OTCA 2NVYH 3LWUA 4IJHA 2H1EA 3TQYA 3M4PA 1VQ4A 1DM0B 4A3FG 2LS01 1BF4A 4AQYQ 4PZ7A 1TU2B 1EY8A 1HA5A 4KN7C 5M3FG 3RN2A 1LTLA 4DR5Q 1W3SA 1CM9A 4OO1G 2AHOB 4ZKCB 5EPJA 2O4XA 4NP5A 2B2WA 3RZDH 1QOHA 1NMFA 1B8AA 4LMQD 1WCMG 4XT3B 4A3IB 3EVQA 2JA5B 3OMGA 1I4RA 3GTMB 4XIGS 1S5ED 2B29A 3R93A 2O5JC 1GUSA 1H9KA 3D4WA 2WKCA 3TP8A 4BBSB 4KHPL 1R9TH 5JJZA 4LF4Q 2ZM6Q 1I50B 2VQFQ 4FF4A 2B2YA 2KQ3A 2RCNA 1EWHA 1GD7A 4IO9A 4A3MG 3H94A 3NELA 3OYYA 3TSSA 3E0EA 4MHEA 3K81C 4RFBA 5HURA 1J8IA 2NTSA 1KQSA 2F0DA 4DK6C 4JI2Q 3IFDA 1VQAA 3RUZA 3PIPA 2KENA 4LFCL 4JCVE 5LMUL 4GKKQ 2IWHA 5E7NA 2WAQE 4JI6L 1L1OC 3JAME 2K14A 4OO1I 4DV5Q 4UPAA 1AH9A 3ONAB 2Q8TA 4FF2A 1B70B 1U5KA 1PZKD 4IPHA 4A3JB 1RF2D 5IGGA 3E3XA 1GUGA 4ABNA 1X3EA 2NN6H 1H95A 2D62A 2IX1A 3EFXD 5D3DA 3N52A 1SLJA 4EX5A 4DK1A 3ND8A 5IYDG 4HAEA 1PH4A 4RCOA 5FLXE 3BJUA 2X69A 1LTAD 2VQEL 2A6HC 2JN4A 5BR8L 1ET6A 4BY7B 1BO0A 4JC0A 3TRZA 2RA4A 2E2JH 1HNXQ 1ZYRD 3W5OA 3HOVB 4A3GH 4HCEA 2K01A 3IL8A 3T1HL 2L1BA 3AFPA 3IAYA 2A73B 1WI5A 2CW0C 4IQZA 1F9RA 3SEBA 3T1YL 5M5XH 2HT1A 3OHXC 4FO2A 5IP7G 2CFMA 4JYAL 1HZ9A 4JOIA 1SJHD 1II3A 5I6YA 1UWVA 1HQRD 1PLFA 2O2LD 4X6AH 5IGBA 1PYBA 3I7FA 3KFUA 4MIUA 1VQPA 1RTNA 4TRDA 1XXGA 5EJWA 1STEA 4K0KQ 1OXVA 3V05A 1BOSA 1U4PA 1LTBD 4ALPA 4Y7NB 1G8ZD 2KEEA 1XPOA 3NUCA 3SK8A 1MD2D 3AQQA 1PTOC 3HOYH 2VB2X 4NW2A 1O80A 1UE5A 4GN3B 4DV7L 1JORA 1EZ6A 5JJIA 5I9OA 1V8QA 2Y0SB 1QB5D 3GTQB 4B3TL 4C3HB 4BA1I 1DONA 2LFNA 3UDFA 1B9NA 4L8JA 5EKIA 2F03A 1ZXTA 5EQ0A 3VR5A 1L0YB 2BDOA 1UAPA 3CKIB 1QCBD 4A3BG 1WTWA 1I3QH 1E7ZA 1HZCA 4DV1L 1EIGA 1P8LA 3GTLH 1W2BA 3BVZA 1RIPA 2B63G 3S1QH 4A75A 3ICEA 3QWNA 1A62A 1A15A 4PV1C 2EIFA 2NZ1D 4BBRH 1SXTA 1PZJD 3HP3A 3F8TA 3ULPA 2AUKA 3H0GB 4BY1B 5M5YB 2BOSA 2ASBA 1SAPA 5CV4A 5IT9L 4IJLA 1X9NA 1MHWC 1X54A 4KD4A 1TWHH 2E2IH 4HCSA 1CSQA 2E2DC 4K5XA 4C3IB 1SFOB 2E75C 2WV6D 4XXEA 5KEEA 3A55A 4K2LA 1GUOA 1HHVA 1EEFD 3I4MG 1KNAA 1YJNA 4FYDA 3K7AB 2NZHA 4GLXA 5FO9B 2AQ1B 2R7FA 4LFCQ 3VYSA 5FJ8G 5C3EG 1A3UA 4JI6Q 3OOCA 2WAQB 2PZUA 3DWPA 4JBKA 2EYLA 1PRTB 1VQ8A 3M4OB 1JOOA 2NZOA 2A1AA 1PRTF 2B2WC 3GTJH 2UXCL 2UUAQ 3OW2A 2K04A 1SYGA 4JI3L 1ET9A 3I91A 3AMUA 3P75A 3S2DB 2PQEA 3URYA 3D6WA 4C3JB 3A74A 4GS3A 4LF9L 1E2VA 1Y8PB 1ASYA 3VYTA 1I4XA 3MHBA 4RMFA 1CSPA 1EY0A 1VQGA 2K33A 1IBML 3HOZB 4KN4C 4A3LG 5BR8Q 4MNOA 1GUNA 2ICIA 2JXMB 2Q2HA 2B2YC 1L0XB 3H6MA 1GXDC 3WOEA 5M3MH 1A2UA 4AYBB 2WINB 5BN3A 1QZGA 1K83B 1DZ1A 4H7BA 5C5LA 4X66L 4PZ6A 1FL0A 4DV6L 4JI0L 1VDZA 2JP1A 3T1HQ 2MFIA 2G5DA 2PMZE 2R93G 1EIYB 1FYCA 4O2DA 1EYDA 3CCSA 1DJRD 1EY7A 4P75A 1TWGH 3KDFA 1PA6A 1SE8A 1EZ8A 2UUCQ 3I4NB 3K6OA 2R3ZA 4A3EG 4WFN3 1BKBA 2FHTA 2KCMA 1C8CA 1IYUA 2Z6KA 5D3IB 5CV7A 3Q0AA 3S14H 3P1HA 1VQKA 2MNAA 5C0XH 1SE2A 1ZYRC 2JA8H 4DUYL 3TS0A 4H02A 3CMEA 3BS1A 4KV6A 1Q3LA 5T1IA 5COYA 4WORA 4DU9A 4DFAA 1G291 2EYPA 3G48A 1FJGL 5EKKA 3FKIH 1PH1A 1LABA 1K3BC 1D6EC 2ATWA 1TWFB 5BN4A 3I73A 4C2MB 5IYCH 1HR0L 2B8FA 5CGKA 4G7HC 4UDUC 2FXQA 2I5HA 3HOXG 2DN8A 1AFPA 1E22A 1G51A 1JQYD 3N6RA 1DYQA 4A3FH 1U0LA 1YIJA 1WTQA 1VQ5A 4A3GG 4XQNA 1I4QA 5M3FH 4DPGA 3HGBA 3C2PA 3S1RH 2PQAB 3NTKA 4JBMA 3HOWG 1CKNB 3ITPA 1G6PA 4OWWB 4DV1Q 1HJPA 2X6GA 1J9OA 3STBC 3KLRA 2D9UA 3F2BA 4J8QA 3HEJA 4PMCA 4HMJA 4RH6A 2K05A 4IUPA 2K5NA 1WCMH 1MIUA 2XWBB 4DK0A 4DAYB 4F87A 3B6YA 2NN6I 3EBEA 3E0JA 2QKIC 3CRKC 4OXPA 1YHBA 3MEHA 1Z6HA 3NSWA 1R9TB 4GNXA 1YNJC 2F0QA 1I4PA 2BE5D 3DHQA 3SK4A 1YJWA 5HGQA 1FNUA 5C5MA 3WWVA 5A35A 5IYBG 4A3DH 1CHPD 1V43A 4I65A 1YITA 4A3MH 4GN5A 4LF7L 4LF8L 1B4OA 4HSPA 1KLUD 2F0OA 3SR1A 3J80E 1E2WA 2JK8A 4U673 4YHHQ 3WOFA 5E3FA 5IIFA 2EOTA 3FRPB 1N33L 3PUVA 4ZK9B 4JI4Q 2ICEC 1SYDA 5JVH3 1B1ZA 1PRTC 5CORA 5IODA 2B2VA 3P20A 2L55A 1BBWA 2UXCQ 2F3WA 1Y8NB 4LW1A 1KAWA 4NDXA 1GO3E 4TQUS 5M5WH 5C44B 3AEVA 2F0FA 3UDXA 2WIIB 4LF9Q 1WYDA 1PH5A 2F0MA 4FNFA 4TKOB 3RLOA 1SMYC 4JPBW 1S5CD 4X3KA 3TMEA 1Q8IA 2EYFA 4K6LA 2K75A 1VS0A 5IYDH 2DJGC 4ZLTF 4JI1L 1ZEQX 2VUMG 1JC7A 2L0CA 1HPCA 5IGDA 1NBWA 1DXMA 1H9JA 2A19A 3CCJA 2E2JB 3D4RA 1HTPA 2ZTDA 1GKHA 3QG1A 4QUCA 4DV6Q 2OXPA 5CC4A 4JI0Q 2K1BA 5CMDA 2UXDQ 2RDGA 3U9OA 3T13A 1B2TA 5EPLA 1QG7A 5M5XB 3MWYW 1XWEA 1I5FA 5JEAG 3K58A 1M1KC 1QZHA 1Z9FA 2R92G 3U4VA 4AIMA 3L0OA 2A6HD 1LTSD 1U4LA 5IP7H 3H3VH 3CCVA 1H9SA 5JPMC 3BDCA 3HKZB 2ZTEA 1Q1EA 4KD3A 1V1OA 4KJOA 2Z4HA 3M4QA 1YJ9A 1Y1WG 3QO2A 2PO4A 2IW3A 4L6TB 3CCMA 5J1ZA 2E8GA 1C48A 2MO0A 2FJ2A 5LMNW 2LSSA 5DM63 3S9WA 3OTOL 2RHSB 2UUBQ 3I56A 4R1JA 4QB4A 2IX3A 3NQIA 3BVGA 3CP0A 3D4DA 2CW0D 3PIO3 3HOYB 3E6ZX 5GAEC 1SYEA 3HFZB 3VDYA 1LTRD 2JA7G 1LT5D 2EXDA 3M7NA 5FLMG 1HR0Q 3DXJC 4DV2Q 4I7AA 3I8ZA 4R4CA 1Q86C 1S40A 5KNBA 1I6VC 3PO2G 1HNWL 4P2CB 3RR5A 4F88A 1Y69U 4HTHA 4YWLA 4JV5Q 1QNKA 2EVBA 3QB3A 4IFDH 3A8IE 1VQ7A 1A0IA 2JQOA 2HCIA 1CKMA 3NWSA 4A3BH 1IL2A 3M3YB 3IKJA 5K5PA 1LO5D 1YHAA 5J3BA 2NVXB 3CQZH 2RQXA 2SEBD 5C4HA 4X3SA 2JA6B 4ID6A 4LWCA 2B63H 4X65L 4X62Q 4BBRB 5EAYA 1X3QA 2Z8LA 1K8OA 4XTCS 4B3RL 3X3NA 3I72A 1K8AC 4B3ML 3MC0B 5C0XG 5JVG3 2RDHA 5D65A 1BXTA 1TWHB 4DAPA 2A68C 1PH2A 1KRTA 2IY5B 1G6ZA 4BXXH 4LF7Q 2EDGA 4LF8Q 3QOJA 5LMNL 1IYJB 3UE0A 2PCFB 3CCEA 3A54A 2E74C 3TBIB 2X6LA 4HIOA 1AP0A 1XJVA 1N33Q 3I4MH 1CK1A 5K36H 1Q8KA 2NVTH 3J80c 1AZQA 2PW7A 4HIKA 3MA2B 2DJFC 5FJ8H 5C3EH 4APVA 1GUTA 2N3SA 4QMGA 1Q46A 1A3TA 3GTJB 1UNSA 1T9HA 3OMCA 2BE5C 1STYA 2KCCA 4A3KB 5AJ3L 4ODGA 5M9OA 1X3FA 2WFWA 4PMBA 3CCRA 2J0TD 5EKLA 2E2HH 2Q2IA 1IZ6A 4BY7G 1LACA 3E5SA 3DUZA 4PG3A 1Y1VG 4IUTA 1PFSA 1TT2A 3GV3A 3HOVG 1BNZA 5C0XI 3KJPA 5ELEA 1IXRA 1EFWA 1SNPA 4A3LH 2K4KA 3DEPA 3BU2A 3GD7A 2VS1A 4L63B 4EQ5A 4R8NA 3NEMA 4A3DG 3HZXA 5IGEA 4LK1C 1F2ZA 4POGA 2PZWA 4A93H 1JWUD 1HQMC 1KNEA 3KLSX 1STHA 2EY6A 3BZCA 4QIWE 4YY3Q 1N36L 4P74A 3M7GA 1M90C 1PFBA 2XVSA 1ILQA 1MSHA 4KKTA 3L3OC 2L15A 1GHJA 1U4MA 2R93H 2RKSA 2IHFA 1VQ6A 4FDBA 4QGUA 4H13C 2B2VC 1TIID 1B3AA 1TWCH 2YTVA 4EQPA 2JA9A 4A3EH 2KCNA 1X32A 3QOLA 1SDFA 4OHJA 3I4LA 2NBFA 3S14B 3OTOQ 3RZOH 4H0LC 5FOBB 2WB1G 5LHY1 2ZJPA 2KVMA 1X56A 4C3HG 1G2TA 4I7ZC 3M9BA 2EJFC 1TVXA 2GN5A 4O1NA 2QW7A 1K8MA 1O78A 3CC4A 1YVCA 5C6AA 2EY5A 4ZRZA 4L5RC 2N49A 4RHSA 1AN8A 5C3XA 4HR7B 2YU9H 1B44D 1PH3A 1A8VA 3G4SA 2VNUD 5ELDA 1X3GA 4JI8L 4OGQC 3HOXH 2MQHA 1QE6A 2F0NA 4MZ9A 5CV6A 5IOCA 1KRSA 3TDQA 1M4VA 5M3FB 5KNCA 1VQNA 1JOKA 3K5NA 4HJAA 3P7JA 1LT6D 5TSSA 2EY1A 3KF6A 4X3UA 5EBCA 1IBKL 3HOWH 2OCEA 1SNMA 1I94Q 2ID0A 4KY5A 1MJCA 2B2UA 3CCQA 2R7ZG 3D8GA 2FFKB 1WCMB 2IL8A 2VY3A 1LTGD 2EQSA 3A56A 3PMFA 4P73A 4B3RQ 1AE3A 2C5CA 5C4JH 4B3MQ 3A5ZB 1SNDA 4IPGA 2EYJA 1VMCA 3GDEA 4QUFA 1F9PA 2L11A 4FXGC 1K28A 2QEJC 2YTXA 5IGCA 4A3MB 4DV4L 3STBD 5IYBH 4EVOA 4IOAA 1SMXA 3TP7A 4YCVA 4CJ2C 3TZDA 4CKBA 3UDGA 2XTIA 1VQFA 1I4GA 3K59A 2WP8J 4CKEA 4WJ3M 5FO8B 5EGTA 1L2FA 2RBMA 3ULLA 3S1MH 3S16B 1HCZA 1YNJD 3MZ5A 1EOVA 4IFDG 1O7IA 3CRLC 2K5QA 1SE3A 4U68A 5AJ3Q 5H1SE 4HJ9A 1QUQA 3S2HH 3U4ZA 3H3VI 5DAUA 1BVSA 4R4IA 3BYYB 3SK5A 1O7ZA 4JBWA 2HDLA 3A8JE 2F0UA 1S5DD 4HJ7A 3GTPH 3CPFA 1FR3A 1TR5A 4RHRA 2GVBA 2PPBC 3F1ZA 1PRTD 2IHEA 2VUMH 3DWAA 3R3OA 4KHPQ 1EYCA 4LNQA 1HFNA 2Z4IA 3CC2A 2SDFA 4IUUA 4R4OA 3EN2A 4BXXG 4X64L 2D5DA 4RGTA 4UAIA 3VR4A 1GOZA 1SMYD 5C4XH 4DUZL 3K7UC 2LY7A 4QIWB 3PO3H 5K36G 3GTKH 2I46A 5A2QE 2K52A 3H15A 3HS0C 5JEAH 4LF6L 1AZPA 1TWAH 3NENA 5LMUQ 2R92H 4K5VA 2DY8A 3IRBA 1C7YA 4IFDI 3Q22A 3VA5A 4LFAL 2QDBA 3KUPA 3I3CA 4N8X1 3A5UA 1D1IA 1Y1WH 1GUWA 4GKJL 3JAMc 4L5TA 1PXUA 1QVCA 1WFQA 1PTOH 2BCOA 2CQOA 3OWFA 3CMAA 1FD7D 2MPMA 1KL9A 1BR9A 3EA6A 4OONA 3IFTA 2AMCB 3GP7A 4DV0L 5E4XA 3BDOA 4GLAC 3D0FA 1D2BA 2VQEQ 4BWGB 3MXNA 1F9SA 1IW7C 2JA7H 2NWGA 5FLMH 5FLXc 3J7AF 1KDCA 1PH7A 2NVQH 4A3CG 1RCVD 3JAML 4XYQA 1TS5A 1Y8OB 3ERQA 1K73C 4KY6A 1N8RC 2V1CC 1K8GA 3Q23A 4B3SL 1VQOA 1CZGA 5DLQE 1LTID 2PI2E 2Q8RE 4A93G 3PO2H 1SROA 1OXSC 4PZ8A 2BDNA 2RF4A 2YTYA 3G6JB 4MTKA 4CDDC 1YI2A 2AQ2B 4A3BB 4G7ZC 1VCIA 1IBKQ 1K0SA 1X65A 3MVVA 3T1YQ 5HY6A 3CQZB 1SSOA 5FLXL 4JYAQ 2B63B 1FGBD 1FNVA 1I50H 3PIOA 2NB0A 4BA2I 2ES2A 1TS4A 3ND9A 1L0WA 2RVLA 4RWSC 3GTGB 4DR2L 3PUZA 1KDAA 4J1MA 2HIXA 3C1FA 1XYIA 1V1PA 2M2LA 3LWEA 1WOCA 2F0GA 3A7AB 3ZYYX 1W6KA 4DV4Q 5CV8A 5FKAC 1CFMA 2PZTA 1HA6A 4DV7Q 1J5EL 1GJXA 2BA0A 3I4MB 4KKUA 1EQRA 4B3TQ 3NWTA 3SE0A 3J81E 2NVYB 3C46A 5C3EB 3KF8A 2CCZA 5C44G 1VQJA 3W1GA 2FMCA 4XQQA 2EYHA 2F0HA 3W3AA 3DEOA 1X55A 1TXYA 1PH6A 3PF4A 5I9PA 4R4TA 4GN4B 4DV3L 3U50C 3J7ZC 1AW7A 4B9WA 2A68D 2F0TA 4OL7A 3AB9A 4HMIA 4K2KA 3RZDB 1TKWB 2RCFA 2B2UC 1XTDA 3TP5A 4DXGA 4JOIC 1STGA 2IJ0A 4DNIA 4HIMA 2KHSA 4LUZA 1IL8A 1EY6A 5JOBA 3V2TA 3HOUG 3KDFB 1YNXA 2MHVA 1EYGA 1EY4A 4JVZA 4BY7H 2VL6A 1RKNA 1Y1VH 2OQ0A 5C3WA 3TN2A 3OPOA 2BH2A 3G7LA 3HOVH 4JK1C 5CR3A 1EIHA 1GHKA 4YIJA 1IHZA 5ELBA 3TS2A 2XNAC 1C9OA 1CKOA 1F2MA 1V1PB 1D5ZC 4DR3L 1IKMA 4X64Q 1WVLA 3L9AX 3TP6A 2M00A 2OQKA 2PI2A 1XTCD 5HGTA 4ZAIA 3A0JA 3HKZG 2F0SA 1GM5A 4OIKA 1OXXK 1WJJA 2F4VL 4HN7A 3K8AA 3PUWA 2R93B 4Z9CB 5LL6X 3KF8B 4ME5A 5G3LD 1SYBA 1XPUA 1LTTD 1T5EA 1TWCB 4A3EB 1ESFA 1O7LA 3MTSA 1JWSD 2JJQA 4GKJQ 4JI3Q 1XMQL 4WJ4A 3RZOB 5KNDA 1PHJA 2F3VA 2QF7A 2J4XA 1QILA 4JI7L 1HH2P 1EQTA 4FF1A 1EUJA 4L5QA 4C3HH 1XX8A 4OWTB 3K0XA 5EPKA 3EJIA 3I55A 1QVFA 1IKLA 2CHBD 3DMUA 1IBMQ 3TZUA 4XDXA 5I2YA 1VQMA 3CCUA 5CYUA 1JT8A 1VQDA 2KA7A 2LXJA 4TSSA 3JC66 4DR5L 2ENBA 2MGSA 4RKBA 4UY8C 4GNXB 3BYTB 5G3LF 2QGQA 3S15H 4B3SQ 2OTJA 4QCLA 2N88A 4J6HA 1SN8A 2LXKA 4GOPA 4X66Q 4IOCA 4KTAA 2L12A 4JG2A 1KTKA 3GTOH 1IYVA 4A3GB 5C4XG 2OWOA 4PQXA 3PO3G 3EQLC 1JB3A 2PMZB 2XRSD 3KLWA 3HOWB 3T4AC 1M8AA 1S5BD 1UEAB 5CV9A 1RL2A 2F4IA 4CJ1B 1VQLA 5IWAL 5M5YH 4IPDA 5L37A 2R7ZH 1LT4D 4RG1A 3AU7A 4LF4L 2ZM6L 1B53A 2QEXA 3KBXA 4IUQA 3I4OA 4ILWA 5C4JB 2K7VA 4DR2Q 3J7A5 1CTMA 3U9SA 4N9TA 1OXUA 4ZKBB 3KLSA 4CDCC 1SR3A 3R2TA 4K14A 4DUYQ 1HNZL 4M8AA 1GVPA 3K7AH 3PV0A 2K03A 1RDPD 1FJGQ 3FPUB 1J5EQ 1PH9A 2WACA 4DK3C 4N9PA 1HXYD 2UXBL 1ENFA 4A4IA 4DV5L 1VQCA 4KK7A 1FGUA 4A3KG 2C35B 2KBNA 3PUYA 1NNXA 1V9PA 2F0VA 3S2DH 4C3JH 1HUNA 1ML0D 4A3IG 3LNNA 2JA5G 1DOMA 1XMOL 4O42A 1PV4A 3S2HB 1I3QB 2D2CC 3HOZH 1YNND 3GTLB 1E1TA 2A69C 1DCZA 1E0BA 4BBSG 3GTPB 3S1QB 5NUCA 3NBIA 1H9SB 3BZKA 2OT2A 5KYLA 1CA6A 2HHHL 3S17H 2Z6KC 4C56C 4KMUC 1K83H 3I2ZA 2D0OA 2J7ZA 2XGTA 2VUMB 2MP1A 4UP8A 3VR3A 4FXDA 2L5TA 1X3PA 2ZTCA 1SNOA 2E2IB 2EYMA 1A3VA 1RHPA 1Z47A 1HZBA 2F4VQ 1OO9B 1RJTA 3DM3A 1S3OA 3PUXA 2N78A 4A3JG 3J80i 3PF5A 4QF4A 1T5XD 3J81j 3EIVA 4KLKA 2AKWB 3NE5B 1DGSA 1B3QA 1BDOA 3AFQA 1KHIA 1YZ6A 1Y1WB 1XMQQ 3T16A 3MXPA 4JI7Q 1D5XC 4ZQ3A 3PGZA 2DNCA 4DR1L 1CHQD 4CGYB 4XT1B 2WB1E 4N8FA 4C2MH 2XWJB 4QJFA 1VF5C 5KIXA 3J80L 1NMGA 4KJNA 2CWAA 2VW9A 1DOLA 1NAPA 3I70A 4JI1Q 4DR7L 2DUDA 2RSOA 2JA7B 1CQFA 3X3MA 5IT9E 5ELOA 3MXUA 1K9MC 4GNXC 1SYFA 3UE1A 5KGUA 2F3IA 1DOKA 1PZID 2NVQB 3J7AV 1FNWA 2EZVA 3R8BA 5M3MB 2SNSA 3HG9A 1CA5A 4A3CH 2XSCA 2WKDA 3CXCA 1TQOA 2AWOA 3PO2B 3OIQA 2YV5A 3H91A 1U9RA 2LKVA 1IBLL 3BVMA 3CPWA 3LGJA 5IE8A 2R7DA 1D5MC 2KJXA 3Q8DA 3RNUA 1WD1A 5C0XJ 3DM1A 5CV5A 5IWAQ 4K8IA 5EBDA 4NXML 1PYWD 1JCKB 1RTOA 1UE7A 1JJGA 3F2CA 1TWGB 1IW7D 4BS9A 4K8JA 2BH8A 1XPRA 3A7LA 3H09A 3E9HA 1R4PB 4HEDA 5FO7B 2G9HD 2F52A 2Z0SA 3SXHA 2JEAI 4X3TA 2K50A 2TSSA 2HCCA 1BQQT 5E1FA 2Y0SG 5GROA 1HNZQ 2JA8B 1PDQA 3ZJYC 3CAMA 1S4ZA 3NP8A 3UDIA 1HRJA 1SBBB 3F2UA 4GZYC 3OIPA 2Q2UA 5DNFA 4DNRB 3MFYA 1U4RA 3FKIB 4KHZA 3S1NH 1ASZA 4DA2A 2UXBQ 3D6CA 1JICA 4OX9L 2Z6BA 1ESRA 3RLFA 3G6EA 2P5ZX 1UE6A 4TVAB 1SNQA 4GOPC 2UUAL 3S24A 3C1EA 5C44H 1HNWQ 1VF7A 4OWXB 4A3FB 2NTTA 4IN3A 3GO5A 2I0QA 5ELNA 1XMOQ 1H9MA 3ER0A 4NXNL 3W2DA 5CBEE 3S1RB 5IGFA 3EROA 3KOJA 4WJWA 3SDZA 3K5OA 3CCLA 4DR6L 1HUMA 4IALA 4Q0FA 4RKLA 4YCWA 3SVMA 4R8IA 1JJ2A 4BY1G 1SRUA 3H0GG 4F8MA 1Q7YC 5JAVA 1TY0A 2L4NA 1EYAA 4IZ8A 4AYBE 3HOUH 1Y1VB 1I6HH 4CJ0B 4FVMA 4X65Q 2HHHQ 2OTLA 1WTRA 1CI3M 3T51B 1JE5A 2K6AA 1A6XA 4G4KA 1NCVA 4C3IG 3PCOB 1KABA 1YBYA 5E4WC 5F2DA 3PSIA 1XNQL 1E1OA 3VYUA 1S72A 1SYCA 2GA4B 3I90A 4M1UB 3CW2C 4A3DB 5LMNQ 4ZUIA 1ZKOA 4RCNA 2WAQG 2UUCL 4H44C 1VMPA 1YNNC 2HQLA 4R4QA 1N32L 1A2TA 1E24A 1AEXA 1TS3A 5GQOA 4OELB 4DN4M 4K5WA 4HSVA 2Q8IB 4PMWA 1NUCA 3WDNA 2FINB 3RMHA 3NPPA 1ICWA 4C3JG 4R9WA 1FVIA 2VXWA 2Q2TA 4LF5L 5IP9G 2OF1A 4UHVA 4EQOA 4RGMA 2K28A 1CZWA 3QJYA 2N8NA 3SHLA 4F7XA 4ULLA 1KAAA 4DR1Q 2V4DA 3OWEB 2ZXOA 3FP9A 3MEFA 3KF6B 5M5WB 3QR8A 2F1MA 3U58A 3HOZG 2WB1B 4C1NK 4G7OC 1Q82C 3CU7A 1CUKA 5KYIA 2K5WA 2E5LL 4AYBG 5DM73 2QCPX 4DR7Q 5C4ZA 4MN3A 3BZDB 4IUNA 1KDBA 1N34L 1STAA 4OEMB 5GAHC 1B50A 4YCUA 2F0JA 1D7QA 2A74C 3RD4A 2F0KA 3S15B 2RHQB 4XQJA 2JE6I 4GLVB 5IT9c 1BBXC 1Q81C 3M3YH 4G57A 3GTOB 2XN9C 1H9RA 3R2IA 2QILA 1IBLQ 4LUOA 2NVXH 3I4NG 2HUGA 1WTPA 1N36Q 2VZAA 2B2TA 2JA6H 4JI5L 2C9OA 1NE3A 2EJMA 4NXMQ 1NTGA 1G2SA 1CT1D 4QQBX 1KIXA 2R7ZB 4CDEC 2CKZB 4KKSA 1BBUA 2I5LX 1WD0A 3KK7A 1Y14B 3FPPA 2F0LA 1F2LA 3M4YA 2RDFA 1YHQA 2UU9L 1C0AA 2AUJD 1LV9A 3D3RA 5I6WA 3JAMi 1QUQB 1EQQA 3HRZC 4OIJA 2KHIA 3OSOA 4RAUC 4E6IA 4YHHL 4IURA 2DY7A 3RN5A 1WTXA 4NPSA 5D14A 4YWMA 4ZCKA 4JI4L 2K5DA 1QWYA 1BCPD 3V96A 3MAQA 1JR0D 4JBJA 4OX9Q 4IFDJ 4C1NI 2IPKD 4S3SA 1PH8A 1KD1C 3E9IA 2YYZA 2FMMA 1E2ZA 2K5HA 1V1QA 4A3KH 1D1KA 1EU3A 3FEWX 4JI8Q 1SNCA 4LUVA 3PIP3 2E76C 2NYZD 2R6GA 2PW5A 4NXNQ 1HR0W 1ENAA 1UE1A 2XIWA 4A3IH 1NJIC 2JA5H 3KBGA 4DR6Q 1QNUA 2A8VA 3GTMH 3A8KE 3NBHA 4O0AA 1J6QA 2KECA 1O7YA 1F9QA 4IPCA 3VYRA 1K0RA 1Z7TA 1BCPB 1STNA 3UI2A 3K57A 4BBSH 5DEHA 1BCPF 3ERSX 1PMRA 2HD3A 1MI2A 1B9MA 1MGSA 3S17B 3L2PA 2KUMA 5AFWA 1LYLA 1ONLA 3Q6SA 4DF7A 2ZXPA 1D8LA 2UXDL 1XNQQ 2PQAA 2SNMA 1CKNA 3PQIA 4CBVA 2D0PA 1MSGA 1RD9D 4PNYA 4FP5D 4K6DA 1JJCB 3VR6A 1UUPA 3Q24A 3AYHB 2A69D 2CWPA 4RA8A 2KHJA 3HKZE 4LFBL 1NY4A 1N32Q 3CC7A 3BDLA 3MXNB 4DAYA 3DLLA 3F2DA 1C4QA 2PNHA 2NVTB 3NQTA 2NN6G 1HZAA 4A3JH 2Z1CA 5ISRA 3CD6A 3ULJA 1EFID 2UUBL 2MO1A 2HIVA 2AQ3B 3NTIA 4LF5Q 1EL0A 4FF3A 2DNEA 2N55A 3FMCA 4YWKA 2PYKA 3NXWA 1EWCA 5GADC 2HDMA 1BUVT 2KEDA 3HKSA 3T56B 3NBHB 4DAMA 3O13A 2E2HB 4LJZC 4ZUJA 3TREA 2K5VA 4DV2L 2EJGC 2KCTA 4KHVA 2E5LQ 4KI0A 4DXFA 2ZJRA 1A63A 2ZXRA 4DGZA 1N34Q 1JE4A 3KYHC 5JPNC 4JV5L 2MJ8A 3GV6A 3VR2A 1EU4A 4OO1H 2A6ED 3SGIA 1B7YB 2IT1A 3M85A 2ZJQA 2MUYA 2K32A 2F0EA 4A93B 1KXLA 5IY0A 4DUZQ 1NR2A 4JI5Q 1S5FD 4X62L 3K0YA 2OEOA 2IX0A 3H3VC 3T53B 4LF6Q 2BA1A 2KOLA 2I5MX 2GVAA 3TEHB 2I07B 1E3PA 1HFGA 1EWIA 4LFAQ 1EY5A 2JSOA 2UU9Q 4CKCA 4J15A 4B08A 3HOYG 4Y7NH 3FVQA 4P72A 4AH6A 2CVRA 5FK9C 4DR4L 5ELFA 1PYSB 2XRQD 1XNRL 1EIFA 1EOTA 2NUCA 3GTQH 1P16A 1MBYA 1PFMA 2B39A 1X6OA 3LX0A 3S1NB 2M9VA 4DV0Q 5GAGC 1Q90A 4CHTB 1JWMD 2JEBI 3FDTA 1JOQA 2F0WA 2F0PA 5A2QL 4LAAA 3S16H 4AQYL 4IUVA 5J39A 2YU9B 1L1OA 1VQEA 2JYOA 4DAVA 1JB7A 4A76A 3HOXB 1VQBA 1VQ9A 1PVOA 1SE4A 2B2TC 1WTHA 4DNTB 2JA6G 1DD2A 4BBRG 4ME3A 1G91A 1EY9A 3D31A 1TS2A 3MFGA 1BCPC 1WTOA 2LMCB 2EE1A 3CHBD 4BY1H 3H0GH 1HTLD 3HOUB 1I6HB 1SEBD 4JW0A 2O5IC 1QVGA 4Y52H 4CDFC 2VQFL 4WRDA 5J22A 1EQVA 4HIDA 4POFA 2H4OA 3MXGA 2VB3X 3NTHA 3L7ZC 2DGYA 2EY2A 4C3IH 1SFOH 3KJOA 3GQBA 4B9XA 1W6JA 4YY3L 5I2XA 1QJOA 3NK9A 4JI2L 1KC8C 2F0IA 1RODA 1VQIA 4LFBQ 1N9WA 4GKKL 1NSNS 1YEZA 3K5LA
chains in the Genus database with same CATH topology
1ENCA 1F77A 4ZYSA 4RGNA 4NKLA 4Q5VA 2CQAA 2ZT9C 2RSNA 5CBAE 5ELCA 3SK6A 3S1MB 1PFNA 1WTVA 1LLRD 2TMPA 4FXKC 2B8GA 1LT3D 1KLGD 4RGOS 3NHHA 2A5HA 5I4DA 2HQEA 2R61A 5LL6S 4V0BA 5KRUA 3J81L 2EPBA 3DWQA 4EQNA 2PNRC 5BN5A 1SJED 4EGVA 4XYOA 3VA7A 5JEAJ 1PTOD 1EEID 5T1GA 1OXTA 1NR4A 5C4XB 1CQVA 2EXZA 1STBA 3PO3B 2SOBA 3K5MA 4V190 1Q1BA 3GTKB 3C3LA 2G9DA 1TY2A 3J7YW 1TWAB 4KY7A 2L9HA 2R92B 2AWNA 3OW7A 1ILPA 4NMZA 1I4HA 1Q12A 1R4QB 2A6EC 1F2YA 2EYOA 3BG3A 1PTOB 1PTOF 3QIAA 3LWUA 2H1EA 1DM0B 2LS01 1BF4A 1TU2B 1EY8A 1HA5A 4KN7C 1CM9A 4OO1G 4ZKCB 5EPJA 2O4XA 4NP5A 2B2WA 1QOHA 4LMQD 4XT3B 4A3IB 3EVQA 2JA5B 3OMGA 1I4RA 3GTMB 4XIGS 1S5ED 3R93A 2O5JC 1GUSA 1H9KA 3D4WA 2WKCA 3TP8A 4BBSB 5JJZA 1I50B 4FF4A 2B2YA 2KQ3A 1EWHA 3H94A 3TSSA 4MHEA 4RFBA 5HURA 1J8IA 2NTSA 2F0DA 3IFDA 3RUZA 2IWHA 3JAME 4OO1I 3ONAB 2Q8TA 4FF2A 1PZKD 4A3JB 1RF2D 5IGGA 1GUGA 4ABNA 2NN6H 2D62A 2IX1A 3EFXD 5D3DA 3N52A 4DK1A 3ND8A 4HAEA 4RCOA 5FLXE 2X69A 1LTAD 2A6HC 1ET6A 4BY7B 1BO0A 2RA4A 1ZYRD 3HOVB 4HCEA 2K01A 3IL8A 2L1BA 3IAYA 2A73B 2CW0C 4IQZA 3SEBA 1F9RA 3OHXC 4FO2A 1SJHD 1II3A 5I6YA 1HQRD 1PLFA 2O2LD 5IGBA 4MIUA 1RTNA 4TRDA 1XXGA 5EJWA 1STEA 1OXVA 3V05A 1BOSA 1U4PA 1LTBD 4Y7NB 1G8ZD 2KEEA 3NUCA 3SK8A 1MD2D 1PTOC 2VB2X 4NW2A 1O80A 1JORA 1EZ6A 5I9OA 1V8QA 2Y0SB 1QB5D 3GTQB 4C3HB 4BA1I 1DONA 2LFNA 1B9NA 4L8JA 5EKIA 2F03A 1ZXTA 5EQ0A 3VR5A 1L0YB 2BDOA 1UAPA 3CKIB 1QCBD 1WTWA 1EIGA 3BVZA 3QWNA 4PV1C 1A15A 2NZ1D 1SXTA 1PZJD 3HP3A 5M5YB 4BY1B 2AUKA 3H0GB 2BOSA 1SAPA 5CV4A 5IT9L 4KD4A 4HCSA 2E2DC 4K5XA 4C3IB 1SFOB 2E75C 2WV6D 4XXEA 5KEEA 3A55A 4K2LA 1GUOA 1HHVA 1EEFD 1KNAA 4FYDA 3K7AB 5FO9B 2AQ1B 3VYSA 1A3UA 3OOCA 2WAQB 2PZUA 3DWPA 2EYLA 1PRTB 3M4OB 1JOOA 1PRTF 2B2WC 2K04A 1SYGA 1ET9A 3I91A 3AMUA 3P75A 3S2DB 2PQEA 3URYA 3D6WA 4C3JB 1E2VA 1Y8PB 3VYTA 1I4XA 3MHBA 1EY0A 2K33A 3HOZB 4KN4C 1GUNA 2ICIA 2JXMB 2B2YC 1L0XB 3H6MA 1GXDC 3WOEA 1A2UA 4AYBB 2WINB 5BN3A 1K83B 1DZ1A 4H7BA 5C5LA 1VDZA 2JP1A 1FYCA 1EYDA 1DJRD 1EY7A 1EZ8A 3I4NB 3K6OA 2R3ZA 4WFN3 2FHTA 1C8CA 1IYUA 5D3IB 5CV7A 3Q0AA 3P1HA 5C0XH 1SE2A 1ZYRC 3BS1A 4KV6A 1Q3LA 5T1IA 5COYA 4WORA 4DU9A 4DFAA 1G291 2EYPA 5EKKA 1LABA 1D6EC 1TWFB 5BN4A 3I73A 4C2MB 2B8FA 5CGKA 4G7HC 4UDUC 2DN8A 1AFPA 1JQYD 3N6RA 1DYQA 1WTQA 4XQNA 1I4QA 3HGBA 3C2PA 3NTKA 3ITPA 2X6GA 1J9OA 3KLRA 2D9UA 4J8QA 3HEJA 4PMCA 4HMJA 4RH6A 2K05A 4IUPA 2XWBB 4DK0A 4F87A 2NN6I 3E0JA 2QKIC 3CRKC 3MEHA 1Z6HA 3NSWA 1R9TB 1YNJC 2F0QA 1I4PA 2BE5D 3DHQA 3SK4A 1FNUA 5C5MA 5A35A 1CHPD 1V43A 4I65A 1B4OA 4HSPA 1KLUD 2F0OA 3SR1A 3J80E 1E2WA 4U673 3WOFA 5E3FA 5IIFA 2EOTA 3FRPB 3PUVA 4ZK9B 2ICEC 1SYDA 5JVH3 1B1ZA 1PRTC 5CORA 5IODA 2B2VA 3P20A 2L55A 2F3WA 1Y8NB 4NDXA 4TQUS 5C44B 2F0FA 2WIIB 2F0MA 4FNFA 4TKOB 1SMYC 1S5CD 4X3KA 3TMEA 1Q8IA 2EYFA 4K6LA 4ZLTF 1ZEQX 1JC7A 2L0CA 1HPCA 5IGDA 1DXMA 1H9JA 2E2JB 3D4RA 1HTPA 3QG1A 4QUCA 2OXPA 5CC4A 2K1BA 5CMDA 2RDGA 3U9OA 3T13A 1B2TA 5EPLA 1QG7A 5M5XB 3MWYW 1XWEA 5JEAG 3K58A 2A6HD 1LTSD 1U4LA 1H9SA 5JPMC 3BDCA 3HKZB 1Q1EA 4KD3A 1V1OA 4KJOA 2Z4HA 3QO2A 2PO4A 2IW3A 4L6TB 5J1ZA 1C48A 2FJ2A 5DM63 3S9WA 4QB4A 2IX3A 3NQIA 3BVGA 3D4DA 2CW0D 3PIO3 3HOYB 3E6ZX 1SYEA 1LTRD 1LT5D 3M7NA 3DXJC 3I8ZA 5KNBA 1I6VC 4P2CB 4F88A 1Y69U 4HTHA 1QNKA 2EVBA 3QB3A 4IFDH 3A8IE 2HCIA 3NWSA 3M3YB 3IKJA 5K5PA 1LO5D 2NVXB 2RQXA 2SEBD 5C4HA 4X3SA 2JA6B 4ID6A 4BBRB 1X3QA 2Z8LA 1K8OA 4XTCS 3X3NA 3I72A 3MC0B 5C0XG 5JVG3 2RDHA 5D65A 1BXTA 1TWHB 4DAPA 2A68C 1G6ZA 2EDGA 3QOJA 2PCFB 3A54A 2E74C 3TBIB 2X6LA 1AP0A 1CK1A 5K36H 1AZQA 2PW7A 3MA2B 1GUTA 4QMGA 1A3TA 3GTJB 1UNSA 3OMCA 2BE5C 1STYA 2KCCA 4A3KB 4ODGA 5M9OA 4PMBA 2J0TD 5EKLA 1LACA 3E5SA 3DUZA 4IUTA 1TT2A 3GV3A 1BNZA 5C0XI 5ELEA 1SNPA 3DEPA 3GD7A 4L63B 4R8NA 3HZXA 5IGEA 4LK1C 1F2ZA 2PZWA 1JWUD 1HQMC 1KNEA 3KLSX 1STHA 2EY6A 3M7GA 1PFBA 2XVSA 1ILQA 1MSHA 4KKTA 3L3OC 1GHJA 1U4MA 2RKSA 4H13C 2B2VC 1TIID 1B3AA 4EQPA 2KCNA 1X32A 3QOLA 1SDFA 4OHJA 3I4LA 2NBFA 3S14B 4H0LC 5FOBB 5LHY1 1G2TA 2KVMA 4C3HG 4I7ZC 2EJFC 1TVXA 4O1NA 1K8MA 1O78A 5C6AA 2EY5A 4ZRZA 4RHSA 1AN8A 5C3XA 4HR7B 1B44D 2VNUD 5ELDA 4OGQC 1QE6A 2F0NA 5CV6A 5IOCA 3TDQA 1M4VA 5M3FB 5KNCA 1JOKA 3K5NA 3P7JA 1LT6D 5TSSA 2EY1A 5EBCA 4X3UA 1SNMA 2ID0A 4KY5A 2B2UA 3D8GA 2FFKB 1WCMB 2IL8A 1LTGD 3A56A 3PMFA 2C5CA 1SNDA 2EYJA 1VMCA 4QUFA 1F9PA 2L11A 4FXGC 2QEJC 4A3MB 5IGCA 4EVOA 3TP7A 4CJ2C 3TZDA 4CKBA 1I4GA 3K59A 2WP8J 4CKEA 5FO8B 5EGTA 2RBMA 3S16B 1HCZA 1YNJD 3MZ5A 4IFDG 3CRLC 2K5QA 1SE3A 4U68A 5DAUA 3BYYB 3SK5A 1O7ZA 4JBWA 2HDLA 3A8JE 2F0UA 1S5DD 1FR3A 1TR5A 4RHRA 2PPBC 1PRTD 3DWAA 3R3OA 1EYCA 1HFNA 2Z4IA 2SDFA 4IUUA 2D5DA 4RGTA 4UAIA 3VR4A 1GOZA 1SMYD 2LY7A 4QIWB 5K36G 2I46A 5A2QE 3HS0C 5JEAH 1AZPA 4K5VA 2DY8A 4IFDI 3Q22A 3VA5A 2QDBA 3KUPA 3I3CA 1D1IA 1GUWA 1PXUA 1PTOH 2BCOA 3OWFA 1FD7D 2MPMA 1BR9A 3EA6A 3IFTA 3GP7A 5E4XA 3BDOA 1D2BA 4BWGB 3MXNA 1F9SA 1IW7C 2NWGA 3J7AF 1KDCA 1RCVD 3JAML 4XYQA 1TS5A 1Y8OB 3ERQA 4KY6A 3Q23A 1CZGA 1LTID 2Q8RE 1OXSC 2BDNA 3G6JB 2AQ2B 4A3BB 4G7ZC 1VCIA 3MVVA 3CQZB 1SSOA 5FLXL 2B63B 1FGBD 1FNVA 2NB0A 4BA2I 1TS4A 3ND9A 2RVLA 4RWSC 3GTGB 3PUZA 1KDAA 4J1MA 3C1FA 1XYIA 1V1PA 2M2LA 3LWEA 2F0GA 3A7AB 3ZYYX 1W6KA 5CV8A 5FKAC 1CFMA 2PZTA 1HA6A 1GJXA 2BA0A 3I4MB 4KKUA 3NWTA 3SE0A 3J81E 2NVYB 3C46A 5C3EB 3KF8A 2FMCA 4XQQA 2EYHA 2F0HA 3W3AA 3DEOA 5I9PA 1AW7A 4B9WA 2A68D 2F0TA 4OL7A 3AB9A 4HMIA 4K2KA 3RZDB 1TKWB 2B2UC 3TP5A 4DXGA 1STGA 2IJ0A 2KHSA 5JOBA 1IL8A 1EY6A 3V2TA 2MHVA 1EY4A 1RKNA 5C3WA 3TN2A 3OPOA 3G7LA 4JK1C 5CR3A 1EIHA 1GHKA 4YIJA 1IHZA 5ELBA 2XNAC 1F2MA 1V1PB 1D5ZC 1IKMA 1WVLA 3L9AX 3TP6A 2M00A 1XTCD 5HGTA 4ZAIA 2F0SA 4OIKA 1OXXK 4HN7A 3PUWA 2R93B 4Z9CB 5LL6X 4ME5A 5G3LD 1SYBA 1LTTD 1T5EA 1TWCB 4A3EB 1ESFA 1O7LA 3MTSA 1JWSD 3RZOB 5KNDA 2F3VA 2QF7A 2J4XA 1QILA 4FF1A 1EQTA 1XX8A 5EPKA 3EJIA 1IKLA 2CHBD 3DMUA 3TZUA 4XDXA 5I2YA 5CYUA 2KA7A 4TSSA 2ENBA 2MGSA 4RKBA 3BYTB 5G3LF 4QCLA 2N88A 4J6HA 4KTAA 2L12A 1KTKA 1IYVA 4A3GB 4PQXA 3EQLC 1JB3A 2PMZB 2XRSD 3HOWB 3T4AC 1M8AA 1S5BD 1UEAB 5CV9A 2F4IA 4CJ1B 1LT4D 3AU7A 1B53A 3KBXA 4IUQA 5C4JB 4ILWA 2K7VA 1CTMA 3U9SA 4N9TA 1OXUA 4ZKBB 3KLSA 4K14A 3R2TA 4M8AA 3PV0A 2K03A 1RDPD 3FPUB 2WACA 4N9PA 1HXYD 1ENFA 4KK7A 3PUYA 2F0VA 1HUNA 1ML0D 3LNNA 1DOMA 4O42A 3S2HB 1I3QB 2D2CC 1YNND 3GTLB 2A69C 1DCZA 1E0BA 3GTPB 3S1QB 5NUCA 3NBIA 1H9SB 2OT2A 5KYLA 1CA6A 4C56C 4KMUC 2J7ZA 2VUMB 2MP1A 3VR3A 4FXDA 2L5TA 1X3PA 1SNOA 2E2IB 2EYMA 1A3VA 1RHPA 1Z47A 1OO9B 1RJTA 3PUXA 4QF4A 1T5XD 3NE5B 1BDOA 1Y1WB 3T16A 3MXPA 1D5XC 4ZQ3A 2DNCA 1CHQD 4CGYB 4XT1B 2XWJB 1VF5C 5KIXA 3J80L 4KJNA 1DOLA 1NAPA 3I70A 2RSOA 2JA7B 1CQFA 3X3MA 5IT9E 3MXUA 1SYFA 5KGUA 1DOKA 1PZID 2NVQB 3J7AV 1FNWA 2EZVA 3R8BA 5M3MB 2SNSA 3HG9A 1CA5A 2XSCA 2WKDA 1TQOA 2AWOA 3PO2B 3OIQA 3H91A 1U9RA 2LKVA 3BVMA 1D5MC 2KJXA 1WD1A 5C0XJ 3DM1A 5CV5A 5EBDA 1PYWD 1JCKB 1RTOA 1TWGB 1IW7D 4BS9A 4K8JA 3A7LA 3H09A 1R4PB 4HEDA 5FO7B 2G9HD 3SXHA 2JEAI 4X3TA 2TSSA 2HCCA 1BQQT 5E1FA 2JA8B 1PDQA 1S4ZA 3NP8A 1HRJA 1SBBB 3F2UA 4GZYC 3OIPA 5DNFA 4DNRB 3MFYA 1U4RA 3FKIB 4KHZA 4DA2A 3D6CA 1JICA 1ESRA 3RLFA 1SNQA 3C1EA 1VF7A 4A3FB 2NTTA 4IN3A 3GO5A 1H9MA 1NSNS 3W2DA 5CBEE 3S1RB 5IGFA 3EROA 4WJWA 3SDZA 3K5OA 1HUMA 4IALA 4Q0FA 4RKLA 3SVMA 4R8IA 4F8MA 5JAVA 1TY0A 2L4NA 1EYAA 4IZ8A 1Y1VB 4CJ0B 4FVMA 1WTRA 1CI3M 3T51B 2K6AA 1A6XA 4G4KA 1NCVA 4C3IG 1KABA 5E4WC 5F2DA 3VYUA 1SYCA 2GA4B 3I90A 4M1UB 4A3DB 4ZUIA 1ZKOA 4RCNA 4H44C 1VMPA 1YNNC 1A2TA 1TS3A 1AEXA 4DN4M 4K5WA 4HSVA 2Q8IB 4PMWA 1NUCA 3WDNA 2FINB 3RMHA 3NPPA 1ICWA 4C3JG 4R9WA 2VXWA 2OF1A 4EQOA 4RGMA 2K28A 1CZWA 3QJYA 3SHLA 4F7XA 4ULLA 1KAAA 2V4DA 3OWEB 2ZXOA 5M5WB 2F1MA 2WB1B 4C1NK 4G7OC 3CU7A 5KYIA 2K5WA 5DM73 2QCPX 5C4ZA 4MN3A 3BZDB 4IUNA 1KDBA 1STAA 1B50A 2F0JA 2A74C 3RD4A 2F0KA 3S15B 4XQJA 2JE6I 1BBXC 4G57A 3GTOB 2XN9C 1H9RA 3R2IA 2QILA 2HUGA 1WTPA 2B2TA 2C9OA 2EJMA 1G2SA 1CT1D 2R7ZB 4KKSA 1WD0A 3KK7A 2F0LA 1F2LA 3FPPA 3M4YA 2RDFA 2AUJD 1LV9A 3D3RA 5I6WA 3HRZC 4OIJA 3OSOA 4RAUC 4E6IA 4IURA 2DY7A 1WTXA 5D14A 2K5DA 1QWYA 1BCPD 3V96A 3MAQA 1JR0D 4IFDJ 4C1NI 2IPKD 4S3SA 2YYZA 2FMMA 1E2ZA 1D1KA 1EU3A 3FEWX 1SNCA 3PIP3 2E76C 2NYZD 2R6GA 2PW5A 1ENAA 2XIWA 3KBGA 1QNUA 3A8KE 3NBHA 2KECA 1O7YA 1F9QA 3VYRA 1Z7TA 1BCPB 1STNA 3UI2A 3K57A 5DEHA 1BCPF 1PMRA 1MI2A 1B9MA 1MGSA 3S17B 2KUMA 5AFWA 3Q6SA 1ONLA 4DF7A 2ZXPA 2SNMA 4CBVA 1MSGA 1RD9D 4PNYA 4FP5D 4K6DA 3VR6A 1UUPA 3Q24A 4RA8A 2A69D 3BDLA 4DAYA 1C4QA 2NVTB 3NQTA 2NN6G 2Z1CA 5ISRA 1EFID 2AQ3B 3NTIA 1EL0A 4FF3A 2DNEA 2N55A 3FMCA 2PYKA 3NXWA 1EWCA 2HDMA 1BUVT 2KEDA 3T56B 3O13A 2E2HB 4LJZC 4ZUJA 2EJGC 4KHVA 4KI0A 4DXFA 2ZXRA 4DGZA 1JE4A 5JPNC 2MJ8A 3GV6A 3VR2A 1EU4A 4OO1H 2A6ED 2IT1A 3M85A 2MUYA 2K32A 2F0EA 4A93B 1NR2A 1S5FD 3K0YA 2OEOA 2IX0A 3H3VC 3T53B 2BA1A 2KOLA 2I07B 1HFGA 1EY5A 2JSOA 4CKCA 4B08A 3FVQA 2CVRA 5FK9C 5ELFA 2XRQD 1EOTA 2NUCA 1MBYA 1PFMA 2B39A 3LX0A 3S1NB 2M9VA 1Q90A 4CHTB 1JWMD 2JEBI 3FDTA 1JOQA 2F0WA 2F0PA 5A2QL 4LAAA 4IUVA 5J39A 2YU9B 2JYOA 4DAVA 3HOXB 1SE4A 2B2TC 4DNTB 1DD2A 1G91A 1EY9A 3D31A 1TS2A 3MFGA 1BCPC 1WTOA 2LMCB 2EE1A 3CHBD 1HTLD 3HOUB 1I6HB 1SEBD 2O5IC 4WRDA 5J22A 1EQVA 2H4OA 3MXGA 2VB3X 3NTHA 3L7ZC 2EY2A 3GQBA 4B9XA 1W6JA 5I2XA 1QJOA 3NK9A 2F0IA 1RODA 4K8IA 3K5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENC A;  3QOJ A;  2EY5 A;  3C1F A;  4K8J A;  5C6A A;  2O4X A;  2OXP A;  4NP5 A;  5NUC A;  2OF1 A;  3R3O A;  4EQO A;  1EYC A;  5C3X A;  2OEO A;  1A3U A;  4NKL A;  2F0G A;  3SHL A;  4F7X A;  3U9O A;  1KAA A;  5KYL A;  3T13 A;  3SXH A;  2PZU A;  3SK6 A;  1II3 A;  3EJI A;  5I6Y A;  2EYL A;  5CV8 A;  3EVQ A;  3DMU A;  1JOO A;  3OMG A;  2PZT A;  2PW7 A;  1STN A;  3ITP A;  5E1F A;  5IGB A;  5DEH A;  1SYG A;  1EY5 A;  2F0N A;  3NP8 A;  5CV6 A;  5IOC A;  4MIU A;  5KYI A;  2ENB A;  4QMG A;  4RKB A;  4TRD A;  3P75 A;  1A3T A;  2PQE A;  1SNO A;  1JOK A;  3D4W A;  3HEJ A;  3BDC A;  4PMC A;  4HMJ A;  5C4Z A;  3TP8 A;  4DF7 A;  2EYM A;  4IUN A;  4J6H A;  4KD3 A;  1KDB A;  4KJO A;  3NHH A;  3OMC A;  2EY1 A;  1STY A;  1A3V A;  3D6C A;  3MHB A;  1STA A;  4KTA A;  1SNM A;  1EY0 A;  5J1Z A;  2SNM A;  2F0J A;  4ODG A;  2EYH A;  2HQE A;  2NUC A;  2F0H A;  4K5V A;  2F0K A;  2KQ3 A;  3NUC A;  4KY5 A;  3SK8 A;  5M9O A;  5KRU A;  4PMB A;  3D8G A;  5I9P A;  4PNY A;  5EKL A;  3LX0 A;  3MEH A;  3S9W A;  1JOR A;  1SNQ A;  3VA5 A;  4B9W A;  4EQN A;  4QB4 A;  1EZ6 A;  4K6D A;  4QF4 A;  2F0Q A;  2QDB A;  5I9O A;  3E5S A;  2F0T A;  4OL7 A;  3PMF A;  2F0W A;  2F0P A;  4G57 A;  3DHQ A;  4HMI A;  3C1E A;  4K2K A;  4LAA A;  1TT2 A;  5CV9 A;  3SK4 A;  3D4D A;  2F0D A;  3H6M A;  5C5M A;  3TP5 A;  5J39 A;  3BDL A;  1A2U A;  1STG A;  1SYE A;  4I65 A;  3RUZ A;  2KHS A;  5JOB A;  1EY6 A;  3V2T A;  4H7B A;  5C5L A;  3OWF A;  1SND A;  3NQT A;  5IGF A;  1SNP A;  3ERO A;  2EYJ A;  1EY4 A;  2F0O A;  3SR1 A;  5ISR A;  4IAL A;  4RKL A;  1RKN A;  3T16 A;  5C3W A;  3MXP A;  5E3F A;  5IIF A;  4ZQ3 A;  4R8N A;  5IGC A;  2EXZ A;  1STB A;  4N9T A;  2SOB A;  4F8M A;  4EVO A;  3HZX A;  5CR3 A;  5IGE A;  4YIJ A;  1F2Z A;  1IHZ A;  4K14 A;  3TP7 A;  5IGG A;  5JAV A;  1EYA A;  1F2M A;  1EYD A;  2F0L A;  2PZW A;  2RDF A;  4IZ8 A;  2PYK A;  5KIX A;  1STH A;  1EY7 A;  1EY9 A;  1SYD A;  2EY6 A;  3NXW A;  4HTH A;  4KJN A;  1KDC A;  1EZ8 A;  4KY7 A;  5I6W A;  3QB3 A;  4NMZ A;  5IOD A;  3ERQ A;  4KY6 A;  3TP6 A;  2M00 A;  2F3W A;  4ZUJ A;  1KAB A;  2WAC A;  3OSO A;  4N9P A;  5F2D A;  4NDX A;  4E6I A;  5EGT A;  1SYF A;  4KHV A;  5HGT A;  5KGU A;  2F0S A;  2RKS A;  5CV7 A;  5K5P A;  2RBM A;  2F0F A;  3MZ5 A;  4WRD A;  5J22 A;  3P1H A;  1EQV A;  1SYC A;  2F0M A;  4DGZ A;  2SNS A;  4J1M A;  1F2Y A;  2EYO A;  5C4H A;  2EY2 A;  4ID6 A;  3MVV A;  1TQO A;  4KV6 A;  5CV4 A;  3TME A;  4EQP A;  5CC4 A;  4ZUI A;  4B9X A;  2EYF A;  2F0V A;  3QOL A;  4ME5 A;  1JOQ A;  1SYB A;  4WOR A;  4DU9 A;  4DFA A;  4KD4 A;  5DAU A;  3NK9 A;  1U9R A;  2LKV A;  4S3S A;  2EYP A;  5EKK A;  1A2T A;  1AEX A;  3SK5 A;  4K5X A;  2F0U A;  5KEE A;  4K5W A;  5IGD A;  4K2L A;  5HUR A;  2F0I A;  1SNC A;  1NUC A;  1EY8 A;  5CV5 A;  4K8I A;  2F0E A;  2PW5 A;  5CGK A;  2F3V A;  1TR5 A;  1NSN S;  1ENA A;  1KDA A; 
#chains in the Genus database with same CATH topology
 1ENC A;  1L1O B;  1F77 A;  4NB3 A;  4ZYS A;  4RGN A;  3M4O H;  1K3R A;  3CF5 A;  4HJ8 A;  1VQH A;  4NKL A;  4Q5V A;  2CQA A;  3J81 i;  2ZT9 C;  4HJ5 A;  2RSN A;  5CBA E;  4GOP B;  5ELC A;  3SK6 A;  3J81 c;  3S1M B;  1PFN A;  1WTV A;  4DV3 Q;  1LLR D;  4QY7 A;  2TMP A;  5IP9 H;  2CH4 A;  4FXK C;  2QDL A;  2B8G A;  1LT3 D;  1KLG D;  4UP7 A;  4RGO S;  1MJE A;  3NHH A;  2A5H A;  5I4D A;  5M3M G;  4QL5 A;  2HQE A;  2R61 A;  5LL6 S;  4UP9 A;  4V0B A;  3RLN A;  5KRU A;  3G71 A;  2QA4 A;  1LUZ A;  3J81 L;  2EPB A;  3DWQ A;  4EQN A;  3K80 C;  2ALY B;  3FHW A;  2CH4 W;  1HNX L;  2PNR C;  4DR3 Q;  5BN5 A;  1SJE D;  4EGV A;  4XYO A;  3VA7 A;  5JEA J;  5JJL A;  4MTN A;  1PTO D;  4L5S A;  1EEI D;  4P71 A;  5T1G A;  1I94 L;  1UEB A;  1OXT A;  1ICF B;  1NR4 A;  1JMC A;  2Z9H A;  5C4X B;  1CQV A;  2EXZ A;  1STB A;  3PO3 B;  3I4N H;  2SOB A;  3K5M A;  4V19 0;  5JJK A;  1Q1B A;  3GTK B;  3C3L A;  2G9D A;  1TY2 A;  2H5X A;  3GTG H;  3J7Y W;  1TWA B;  4KY7 A;  3W1B A;  2L9H A;  2JA8 G;  2R92 B;  2AWN A;  3OW7 A;  1ILP A;  4NMZ A;  1I4H A;  1Q12 A;  4K0K L;  4DKA C;  1MKH A;  3FKI G;  1R4Q B;  2A6E C;  4DR4 Q;  1AE2 A;  1F2Y A;  2EYO A;  3BG3 A;  1XNR Q;  1PTO B;  2Y0S E;  1TWF H;  2B3G A;  5IYC G;  1PTO F;  3QIA A;  1LM0 A;  1OTC A;  2NVY H;  3LWU A;  4IJH A;  2H1E A;  3TQY A;  3M4P A;  1VQ4 A;  1DM0 B;  4A3F G;  2LS0 1;  1BF4 A;  4AQY Q;  4PZ7 A;  1TU2 B;  1EY8 A;  1HA5 A;  4KN7 C;  5M3F G;  3RN2 A;  1LTL A;  4DR5 Q;  1W3S A;  1CM9 A;  4OO1 G;  2AHO B;  4ZKC B;  5EPJ A;  2O4X A;  4NP5 A;  2B2W A;  3RZD H;  1QOH A;  1NMF A;  1B8A A;  4LMQ D;  1WCM G;  4XT3 B;  4A3I B;  3EVQ A;  2JA5 B;  3OMG A;  1I4R A;  3GTM B;  4XIG S;  1S5E D;  2B29 A;  3R93 A;  2O5J C;  1GUS A;  1H9K A;  3D4W A;  2WKC A;  3TP8 A;  4BBS B;  4KHP L;  1R9T H;  5JJZ A;  4LF4 Q;  2ZM6 Q;  1I50 B;  2VQF Q;  4FF4 A;  2B2Y A;  2KQ3 A;  2RCN A;  1EWH A;  1GD7 A;  4IO9 A;  4A3M G;  3H94 A;  3NEL A;  3OYY A;  3TSS A;  3E0E A;  4MHE A;  3K81 C;  4RFB A;  5HUR A;  1J8I A;  2NTS A;  1KQS A;  2F0D A;  4DK6 C;  4JI2 Q;  3IFD A;  1VQA A;  3RUZ A;  3PIP A;  2KEN A;  4LFC L;  4JCV E;  5LMU L;  4GKK Q;  2IWH A;  5E7N A;  2WAQ E;  4JI6 L;  1L1O C;  3JAM E;  2K14 A;  4OO1 I;  4DV5 Q;  4UPA A;  1AH9 A;  3ONA B;  2Q8T A;  4FF2 A;  1B70 B;  1U5K A;  1PZK D;  4IPH A;  4A3J B;  1RF2 D;  5IGG A;  3E3X A;  1GUG A;  4ABN A;  1X3E A;  2NN6 H;  1H95 A;  2D62 A;  2IX1 A;  3EFX D;  5D3D A;  3N52 A;  1SLJ A;  4EX5 A;  4DK1 A;  3ND8 A;  5IYD G;  4HAE A;  1PH4 A;  4RCO A;  5FLX E;  3BJU A;  2X69 A;  1LTA D;  2VQE L;  2A6H C;  2JN4 A;  5BR8 L;  1ET6 A;  4BY7 B;  1BO0 A;  4JC0 A;  3TRZ A;  2RA4 A;  2E2J H;  1HNX Q;  1ZYR D;  3W5O A;  3HOV B;  4A3G H;  4HCE A;  2K01 A;  3IL8 A;  3T1H L;  2L1B A;  3AFP A;  3IAY A;  2A73 B;  1WI5 A;  2CW0 C;  4IQZ A;  1F9R A;  3SEB A;  3T1Y L;  5M5X H;  2HT1 A;  3OHX C;  4FO2 A;  5IP7 G;  2CFM A;  4JYA L;  1HZ9 A;  4JOI A;  1SJH D;  1II3 A;  5I6Y A;  1UWV A;  1HQR D;  1PLF A;  2O2L D;  4X6A H;  5IGB A;  1PYB A;  3I7F A;  3KFU A;  4MIU A;  1VQP A;  1RTN A;  4TRD A;  1XXG A;  5EJW A;  1STE A;  4K0K Q;  1OXV A;  3V05 A;  1BOS A;  1U4P A;  1LTB D;  4ALP A;  4Y7N B;  1G8Z D;  2KEE A;  1XPO A;  3NUC A;  3SK8 A;  1MD2 D;  3AQQ A;  1PTO C;  3HOY H;  2VB2 X;  4NW2 A;  1O80 A;  1UE5 A;  4GN3 B;  4DV7 L;  1JOR A;  1EZ6 A;  5JJI A;  5I9O A;  1V8Q A;  2Y0S B;  1QB5 D;  3GTQ B;  4B3T L;  4C3H B;  4BA1 I;  1DON A;  2LFN A;  3UDF A;  1B9N A;  4L8J A;  5EKI A;  2F03 A;  1ZXT A;  5EQ0 A;  3VR5 A;  1L0Y B;  2BDO A;  1UAP A;  3CKI B;  1QCB D;  4A3B G;  1WTW A;  1I3Q H;  1E7Z A;  1HZC A;  4DV1 L;  1EIG A;  1P8L A;  3GTL H;  1W2B A;  3BVZ A;  1RIP A;  2B63 G;  3S1Q H;  4A75 A;  3ICE A;  3QWN A;  1A62 A;  1A15 A;  4PV1 C;  2EIF A;  2NZ1 D;  4BBR H;  1SXT A;  1PZJ D;  3HP3 A;  3F8T A;  3ULP A;  2AUK A;  3H0G B;  4BY1 B;  5M5Y B;  2BOS A;  2ASB A;  1SAP A;  5CV4 A;  5IT9 L;  4IJL A;  1X9N A;  1MHW C;  1X54 A;  4KD4 A;  1TWH H;  2E2I H;  4HCS A;  1CSQ A;  2E2D C;  4K5X A;  4C3I B;  1SFO B;  2E75 C;  2WV6 D;  4XXE A;  5KEE A;  3A55 A;  4K2L A;  1GUO A;  1HHV A;  1EEF D;  3I4M G;  1KNA A;  1YJN A;  4FYD A;  3K7A B;  2NZH A;  4GLX A;  5FO9 B;  2AQ1 B;  2R7F A;  4LFC Q;  3VYS A;  5FJ8 G;  5C3E G;  1A3U A;  4JI6 Q;  3OOC A;  2WAQ B;  2PZU A;  3DWP A;  4JBK A;  2EYL A;  1PRT B;  1VQ8 A;  3M4O B;  1JOO A;  2NZO A;  2A1A A;  1PRT F;  2B2W C;  3GTJ H;  2UXC L;  2UUA Q;  3OW2 A;  2K04 A;  1SYG A;  4JI3 L;  1ET9 A;  3I91 A;  3AMU A;  3P75 A;  3S2D B;  2PQE A;  3URY A;  3D6W A;  4C3J B;  3A74 A;  4GS3 A;  4LF9 L;  1E2V A;  1Y8P B;  1ASY A;  3VYT A;  1I4X A;  3MHB A;  4RMF A;  1CSP A;  1EY0 A;  1VQG A;  2K33 A;  1IBM L;  3HOZ B;  4KN4 C;  4A3L G;  5BR8 Q;  4MNO A;  1GUN A;  2ICI A;  2JXM B;  2Q2H A;  2B2Y C;  1L0X B;  3H6M A;  1GXD C;  3WOE A;  5M3M H;  1A2U A;  4AYB B;  2WIN B;  5BN3 A;  1QZG A;  1K83 B;  1DZ1 A;  4H7B A;  5C5L A;  4X66 L;  4PZ6 A;  1FL0 A;  4DV6 L;  4JI0 L;  1VDZ A;  2JP1 A;  3T1H Q;  2MFI A;  2G5D A;  2PMZ E;  2R93 G;  1EIY B;  1FYC A;  4O2D A;  1EYD A;  3CCS A;  1DJR D;  1EY7 A;  4P75 A;  1TWG H;  3KDF A;  1PA6 A;  1SE8 A;  1EZ8 A;  2UUC Q;  3I4N B;  3K6O A;  2R3Z A;  4A3E G;  4WFN 3;  1BKB A;  2FHT A;  2KCM A;  1C8C A;  1IYU A;  2Z6K A;  5D3I B;  5CV7 A;  3Q0A A;  3S14 H;  3P1H A;  1VQK A;  2MNA A;  5C0X H;  1SE2 A;  1ZYR C;  2JA8 H;  4DUY L;  3TS0 A;  4H02 A;  3CME A;  3BS1 A;  4KV6 A;  1Q3L A;  5T1I A;  5COY A;  4WOR A;  4DU9 A;  4DFA A;  1G29 1;  2EYP A;  3G48 A;  1FJG L;  5EKK A;  3FKI H;  1PH1 A;  1LAB A;  1K3B C;  1D6E C;  2ATW A;  1TWF B;  5BN4 A;  3I73 A;  4C2M B;  5IYC H;  1HR0 L;  2B8F A;  5CGK A;  4G7H C;  4UDU C;  2FXQ A;  2I5H A;  3HOX G;  2DN8 A;  1AFP A;  1E22 A;  1G51 A;  1JQY D;  3N6R A;  1DYQ A;  4A3F H;  1U0L A;  1YIJ A;  1WTQ A;  1VQ5 A;  4A3G G;  4XQN A;  1I4Q A;  5M3F H;  4DPG A;  3HGB A;  3C2P A;  3S1R H;  2PQA B;  3NTK A;  4JBM A;  3HOW G;  1CKN B;  3ITP A;  1G6P A;  4OWW B;  4DV1 Q;  1HJP A;  2X6G A;  1J9O A;  3STB C;  3KLR A;  2D9U A;  3F2B A;  4J8Q A;  3HEJ A;  4PMC A;  4HMJ A;  4RH6 A;  2K05 A;  4IUP A;  2K5N A;  1WCM H;  1MIU A;  2XWB B;  4DK0 A;  4DAY B;  4F87 A;  3B6Y A;  2NN6 I;  3EBE A;  3E0J A;  2QKI C;  3CRK C;  4OXP A;  1YHB A;  3MEH A;  1Z6H A;  3NSW A;  1R9T B;  4GNX A;  1YNJ C;  2F0Q A;  1I4P A;  2BE5 D;  3DHQ A;  3SK4 A;  1YJW A;  5HGQ A;  1FNU A;  5C5M A;  3WWV A;  5A35 A;  5IYB G;  4A3D H;  1CHP D;  1V43 A;  4I65 A;  1YIT A;  4A3M H;  4GN5 A;  4LF7 L;  4LF8 L;  1B4O A;  4HSP A;  1KLU D;  2F0O A;  3SR1 A;  3J80 E;  1E2W A;  2JK8 A;  4U67 3;  4YHH Q;  3WOF A;  5E3F A;  5IIF A;  2EOT A;  3FRP B;  1N33 L;  3PUV A;  4ZK9 B;  4JI4 Q;  2ICE C;  1SYD A;  5JVH 3;  1B1Z A;  1PRT C;  5COR A;  5IOD A;  2B2V A;  3P20 A;  2L55 A;  1BBW A;  2UXC Q;  2F3W A;  1Y8N B;  4LW1 A;  1KAW A;  4NDX A;  1GO3 E;  4TQU S;  5M5W H;  5C44 B;  3AEV A;  2F0F A;  3UDX A;  2WII B;  4LF9 Q;  1WYD A;  1PH5 A;  2F0M A;  4FNF A;  4TKO B;  3RLO A;  1SMY C;  4JPB W;  1S5C D;  4X3K A;  3TME A;  1Q8I A;  2EYF A;  4K6L A;  2K75 A;  1VS0 A;  5IYD H;  2DJG C;  4ZLT F;  4JI1 L;  1ZEQ X;  2VUM G;  1JC7 A;  2L0C A;  1HPC A;  5IGD A;  1NBW A;  1DXM A;  1H9J A;  2A19 A;  3CCJ A;  2E2J B;  3D4R A;  1HTP A;  2ZTD A;  1GKH A;  3QG1 A;  4QUC A;  4DV6 Q;  2OXP A;  5CC4 A;  4JI0 Q;  2K1B A;  5CMD A;  2UXD Q;  2RDG A;  3U9O A;  3T13 A;  1B2T A;  5EPL A;  1QG7 A;  5M5X B;  3MWY W;  1XWE A;  1I5F A;  5JEA G;  3K58 A;  1M1K C;  1QZH A;  1Z9F A;  2R92 G;  3U4V A;  4AIM A;  3L0O A;  2A6H D;  1LTS D;  1U4L A;  5IP7 H;  3H3V H;  3CCV A;  1H9S A;  5JPM C;  3BDC A;  3HKZ B;  2ZTE A;  1Q1E A;  4KD3 A;  1V1O A;  4KJO A;  2Z4H A;  3M4Q A;  1YJ9 A;  1Y1W G;  3QO2 A;  2PO4 A;  2IW3 A;  4L6T B;  3CCM A;  5J1Z A;  2E8G A;  1C48 A;  2MO0 A;  2FJ2 A;  5LMN W;  2LSS A;  5DM6 3;  3S9W A;  3OTO L;  2RHS B;  2UUB Q;  3I56 A;  4R1J A;  4QB4 A;  2IX3 A;  3NQI A;  3BVG A;  3CP0 A;  3D4D A;  2CW0 D;  3PIO 3;  3HOY B;  3E6Z X;  5GAE C;  1SYE A;  3HFZ B;  3VDY A;  1LTR D;  2JA7 G;  1LT5 D;  2EXD A;  3M7N A;  5FLM G;  1HR0 Q;  3DXJ C;  4DV2 Q;  4I7A A;  3I8Z A;  4R4C A;  1Q86 C;  1S40 A;  5KNB A;  1I6V C;  3PO2 G;  1HNW L;  4P2C B;  3RR5 A;  4F88 A;  1Y69 U;  4HTH A;  4YWL A;  4JV5 Q;  1QNK A;  2EVB A;  3QB3 A;  4IFD H;  3A8I E;  1VQ7 A;  1A0I A;  2JQO A;  2HCI A;  1CKM A;  3NWS A;  4A3B H;  1IL2 A;  3M3Y B;  3IKJ A;  5K5P A;  1LO5 D;  1YHA A;  5J3B A;  2NVX B;  3CQZ H;  2RQX A;  2SEB D;  5C4H A;  4X3S A;  2JA6 B;  4ID6 A;  4LWC A;  2B63 H;  4X65 L;  4X62 Q;  4BBR B;  5EAY A;  1X3Q A;  2Z8L A;  1K8O A;  4XTC S;  4B3R L;  3X3N A;  3I72 A;  1K8A C;  4B3M L;  3MC0 B;  5C0X G;  5JVG 3;  2RDH A;  5D65 A;  1BXT A;  1TWH B;  4DAP A;  2A68 C;  1PH2 A;  1KRT A;  2IY5 B;  1G6Z A;  4BXX H;  4LF7 Q;  2EDG A;  4LF8 Q;  3QOJ A;  5LMN L;  1IYJ B;  3UE0 A;  2PCF B;  3CCE A;  3A54 A;  2E74 C;  3TBI B;  2X6L A;  4HIO A;  1AP0 A;  1XJV A;  1N33 Q;  3I4M H;  1CK1 A;  5K36 H;  1Q8K A;  2NVT H;  3J80 c;  1AZQ A;  2PW7 A;  4HIK A;  3MA2 B;  2DJF C;  5FJ8 H;  5C3E H;  4APV A;  1GUT A;  2N3S A;  4QMG A;  1Q46 A;  1A3T A;  3GTJ B;  1UNS A;  1T9H A;  3OMC A;  2BE5 C;  1STY A;  2KCC A;  4A3K B;  5AJ3 L;  4ODG A;  5M9O A;  1X3F A;  2WFW A;  4PMB A;  3CCR A;  2J0T D;  5EKL A;  2E2H H;  2Q2I A;  1IZ6 A;  4BY7 G;  1LAC A;  3E5S A;  3DUZ A;  4PG3 A;  1Y1V G;  4IUT A;  1PFS A;  1TT2 A;  3GV3 A;  3HOV G;  1BNZ A;  5C0X I;  3KJP A;  5ELE A;  1IXR A;  1EFW A;  1SNP A;  4A3L H;  2K4K A;  3DEP A;  3BU2 A;  3GD7 A;  2VS1 A;  4L63 B;  4EQ5 A;  4R8N A;  3NEM A;  4A3D G;  3HZX A;  5IGE A;  4LK1 C;  1F2Z A;  4POG A;  2PZW A;  4A93 H;  1JWU D;  1HQM C;  1KNE A;  3KLS X;  1STH A;  2EY6 A;  3BZC A;  4QIW E;  4YY3 Q;  1N36 L;  4P74 A;  3M7G A;  1M90 C;  1PFB A;  2XVS A;  1ILQ A;  1MSH A;  4KKT A;  3L3O C;  2L15 A;  1GHJ A;  1U4M A;  2R93 H;  2RKS A;  2IHF A;  1VQ6 A;  4FDB A;  4QGU A;  4H13 C;  2B2V C;  1TII D;  1B3A A;  1TWC H;  2YTV A;  4EQP A;  2JA9 A;  4A3E H;  2KCN A;  1X32 A;  3QOL A;  1SDF A;  4OHJ A;  3I4L A;  2NBF A;  3S14 B;  3OTO Q;  3RZO H;  4H0L C;  5FOB B;  2WB1 G;  5LHY 1;  2ZJP A;  2KVM A;  1X56 A;  4C3H G;  1G2T A;  4I7Z C;  3M9B A;  2EJF C;  1TVX A;  2GN5 A;  4O1N A;  2QW7 A;  1K8M A;  1O78 A;  3CC4 A;  1YVC A;  5C6A A;  2EY5 A;  4ZRZ A;  4L5R C;  2N49 A;  4RHS A;  1AN8 A;  5C3X A;  4HR7 B;  2YU9 H;  1B44 D;  1PH3 A;  1A8V A;  3G4S A;  2VNU D;  5ELD A;  1X3G A;  4JI8 L;  4OGQ C;  3HOX H;  2MQH A;  1QE6 A;  2F0N A;  4MZ9 A;  5CV6 A;  5IOC A;  1KRS A;  3TDQ A;  1M4V A;  5M3F B;  5KNC A;  1VQN A;  1JOK A;  3K5N A;  4HJA A;  3P7J A;  1LT6 D;  5TSS A;  2EY1 A;  3KF6 A;  4X3U A;  5EBC A;  1IBK L;  3HOW H;  2OCE A;  1SNM A;  1I94 Q;  2ID0 A;  4KY5 A;  1MJC A;  2B2U A;  3CCQ A;  2R7Z G;  3D8G A;  2FFK B;  1WCM B;  2IL8 A;  2VY3 A;  1LTG D;  2EQS A;  3A56 A;  3PMF A;  4P73 A;  4B3R Q;  1AE3 A;  2C5C A;  5C4J H;  4B3M Q;  3A5Z B;  1SND A;  4IPG A;  2EYJ A;  1VMC A;  3GDE A;  4QUF A;  1F9P A;  2L11 A;  4FXG C;  1K28 A;  2QEJ C;  2YTX A;  5IGC A;  4A3M B;  4DV4 L;  3STB D;  5IYB H;  4EVO A;  4IOA A;  1SMX A;  3TP7 A;  4YCV A;  4CJ2 C;  3TZD A;  4CKB A;  3UDG A;  2XTI A;  1VQF A;  1I4G A;  3K59 A;  2WP8 J;  4CKE A;  4WJ3 M;  5FO8 B;  5EGT A;  1L2F A;  2RBM A;  3ULL A;  3S1M H;  3S16 B;  1HCZ A;  1YNJ D;  3MZ5 A;  1EOV A;  4IFD G;  1O7I A;  3CRL C;  2K5Q A;  1SE3 A;  4U68 A;  5AJ3 Q;  5H1S E;  4HJ9 A;  1QUQ A;  3S2H H;  3U4Z A;  3H3V I;  5DAU A;  1BVS A;  4R4I A;  3BYY B;  3SK5 A;  1O7Z A;  4JBW A;  2HDL A;  3A8J E;  2F0U A;  1S5D D;  4HJ7 A;  3GTP H;  3CPF A;  1FR3 A;  1TR5 A;  4RHR A;  2GVB A;  2PPB C;  3F1Z A;  1PRT D;  2IHE A;  2VUM H;  3DWA A;  3R3O A;  4KHP Q;  1EYC A;  4LNQ A;  1HFN A;  2Z4I A;  3CC2 A;  2SDF A;  4IUU A;  4R4O A;  3EN2 A;  4BXX G;  4X64 L;  2D5D A;  4RGT A;  4UAI A;  3VR4 A;  1GOZ A;  1SMY D;  5C4X H;  4DUZ L;  3K7U C;  2LY7 A;  4QIW B;  3PO3 H;  5K36 G;  3GTK H;  2I46 A;  5A2Q E;  2K52 A;  3H15 A;  3HS0 C;  5JEA H;  4LF6 L;  1AZP A;  1TWA H;  3NEN A;  5LMU Q;  2R92 H;  4K5V A;  2DY8 A;  3IRB A;  1C7Y A;  4IFD I;  3Q22 A;  3VA5 A;  4LFA L;  2QDB A;  3KUP A;  3I3C A;  4N8X 1;  3A5U A;  1D1I A;  1Y1W H;  1GUW A;  4GKJ L;  3JAM c;  4L5T A;  1PXU A;  1QVC A;  1WFQ A;  1PTO H;  2BCO A;  2CQO A;  3OWF A;  3CMA A;  1FD7 D;  2MPM A;  1KL9 A;  1BR9 A;  3EA6 A;  4OON A;  3IFT A;  2AMC B;  3GP7 A;  4DV0 L;  5E4X A;  3BDO A;  4GLA C;  3D0F A;  1D2B A;  2VQE Q;  4BWG B;  3MXN A;  1F9S A;  1IW7 C;  2JA7 H;  2NWG A;  5FLM H;  5FLX c;  3J7A F;  1KDC A;  1PH7 A;  2NVQ H;  4A3C G;  1RCV D;  3JAM L;  4XYQ A;  1TS5 A;  1Y8O B;  3ERQ A;  1K73 C;  4KY6 A;  1N8R C;  2V1C C;  1K8G A;  3Q23 A;  4B3S L;  1VQO A;  1CZG A;  5DLQ E;  1LTI D;  2PI2 E;  2Q8R E;  4A93 G;  3PO2 H;  1SRO A;  1OXS C;  4PZ8 A;  2BDN A;  2RF4 A;  2YTY A;  3G6J B;  4MTK A;  4CDD C;  1YI2 A;  2AQ2 B;  4A3B B;  4G7Z C;  1VCI A;  1IBK Q;  1K0S A;  1X65 A;  3MVV A;  3T1Y Q;  5HY6 A;  3CQZ B;  1SSO A;  5FLX L;  4JYA Q;  2B63 B;  1FGB D;  1FNV A;  1I50 H;  3PIO A;  2NB0 A;  4BA2 I;  2ES2 A;  1TS4 A;  3ND9 A;  1L0W A;  2RVL A;  4RWS C;  3GTG B;  4DR2 L;  3PUZ A;  1KDA A;  4J1M A;  2HIX A;  3C1F A;  1XYI A;  1V1P A;  2M2L A;  3LWE A;  1WOC A;  2F0G A;  3A7A B;  3ZYY X;  1W6K A;  4DV4 Q;  5CV8 A;  5FKA C;  1CFM A;  2PZT A;  1HA6 A;  4DV7 Q;  1J5E L;  1GJX A;  2BA0 A;  3I4M B;  4KKU A;  1EQR A;  4B3T Q;  3NWT A;  3SE0 A;  3J81 E;  2NVY B;  3C46 A;  5C3E B;  3KF8 A;  2CCZ A;  5C44 G;  1VQJ A;  3W1G A;  2FMC A;  4XQQ A;  2EYH A;  2F0H A;  3W3A A;  3DEO A;  1X55 A;  1TXY A;  1PH6 A;  3PF4 A;  5I9P A;  4R4T A;  4GN4 B;  4DV3 L;  3U50 C;  3J7Z C;  1AW7 A;  4B9W A;  2A68 D;  2F0T A;  4OL7 A;  3AB9 A;  4HMI A;  4K2K A;  3RZD B;  1TKW B;  2RCF A;  2B2U C;  1XTD A;  3TP5 A;  4DXG A;  4JOI C;  1STG A;  2IJ0 A;  4DNI A;  4HIM A;  2KHS A;  4LUZ A;  1IL8 A;  1EY6 A;  5JOB A;  3V2T A;  3HOU G;  3KDF B;  1YNX A;  2MHV A;  1EYG A;  1EY4 A;  4JVZ A;  4BY7 H;  2VL6 A;  1RKN A;  1Y1V H;  2OQ0 A;  5C3W A;  3TN2 A;  3OPO A;  2BH2 A;  3G7L A;  3HOV H;  4JK1 C;  5CR3 A;  1EIH A;  1GHK A;  4YIJ A;  1IHZ A;  5ELB A;  3TS2 A;  2XNA C;  1C9O A;  1CKO A;  1F2M A;  1V1P B;  1D5Z C;  4DR3 L;  1IKM A;  4X64 Q;  1WVL A;  3L9A X;  3TP6 A;  2M00 A;  2OQK A;  2PI2 A;  1XTC D;  5HGT A;  4ZAI A;  3A0J A;  3HKZ G;  2F0S A;  1GM5 A;  4OIK A;  1OXX K;  1WJJ A;  2F4V L;  4HN7 A;  3K8A A;  3PUW A;  2R93 B;  4Z9C B;  5LL6 X;  3KF8 B;  4ME5 A;  5G3L D;  1SYB A;  1XPU A;  1LTT D;  1T5E A;  1TWC B;  4A3E B;  1ESF A;  1O7L A;  3MTS A;  1JWS D;  2JJQ A;  4GKJ Q;  4JI3 Q;  1XMQ L;  4WJ4 A;  3RZO B;  5KND A;  1PHJ A;  2F3V A;  2QF7 A;  2J4X A;  1QIL A;  4JI7 L;  1HH2 P;  1EQT A;  4FF1 A;  1EUJ A;  4L5Q A;  4C3H H;  1XX8 A;  4OWT B;  3K0X A;  5EPK A;  3EJI A;  3I55 A;  1QVF A;  1IKL A;  2CHB D;  3DMU A;  1IBM Q;  3TZU A;  4XDX A;  5I2Y A;  1VQM A;  3CCU A;  5CYU A;  1JT8 A;  1VQD A;  2KA7 A;  2LXJ A;  4TSS A;  3JC6 6;  4DR5 L;  2ENB A;  2MGS A;  4RKB A;  4UY8 C;  4GNX B;  3BYT B;  5G3L F;  2QGQ A;  3S15 H;  4B3S Q;  2OTJ A;  4QCL A;  2N88 A;  4J6H A;  1SN8 A;  2LXK A;  4GOP A;  4X66 Q;  4IOC A;  4KTA A;  2L12 A;  4JG2 A;  1KTK A;  3GTO H;  1IYV A;  4A3G B;  5C4X G;  2OWO A;  4PQX A;  3PO3 G;  3EQL C;  1JB3 A;  2PMZ B;  2XRS D;  3KLW A;  3HOW B;  3T4A C;  1M8A A;  1S5B D;  1UEA B;  5CV9 A;  1RL2 A;  2F4I A;  4CJ1 B;  1VQL A;  5IWA L;  5M5Y H;  4IPD A;  5L37 A;  2R7Z H;  1LT4 D;  4RG1 A;  3AU7 A;  4LF4 L;  2ZM6 L;  1B53 A;  2QEX A;  3KBX A;  4IUQ A;  3I4O A;  4ILW A;  5C4J B;  2K7V A;  4DR2 Q;  3J7A 5;  1CTM A;  3U9S A;  4N9T A;  1OXU A;  4ZKB B;  3KLS A;  4CDC C;  1SR3 A;  3R2T A;  4K14 A;  4DUY Q;  1HNZ L;  4M8A A;  1GVP A;  3K7A H;  3PV0 A;  2K03 A;  1RDP D;  1FJG Q;  3FPU B;  1J5E Q;  1PH9 A;  2WAC A;  4DK3 C;  4N9P A;  1HXY D;  2UXB L;  1ENF A;  4A4I A;  4DV5 L;  1VQC A;  4KK7 A;  1FGU A;  4A3K G;  2C35 B;  2KBN A;  3PUY A;  1NNX A;  1V9P A;  2F0V A;  3S2D H;  4C3J H;  1HUN A;  1ML0 D;  4A3I G;  3LNN A;  2JA5 G;  1DOM A;  1XMO L;  4O42 A;  1PV4 A;  3S2H B;  1I3Q B;  2D2C C;  3HOZ H;  1YNN D;  3GTL B;  1E1T A;  2A69 C;  1DCZ A;  1E0B A;  4BBS G;  3GTP B;  3S1Q B;  5NUC A;  3NBI A;  1H9S B;  3BZK A;  2OT2 A;  5KYL A;  1CA6 A;  2HHH L;  3S17 H;  2Z6K C;  4C56 C;  4KMU C;  1K83 H;  3I2Z A;  2D0O A;  2J7Z A;  2XGT A;  2VUM B;  2MP1 A;  4UP8 A;  3VR3 A;  4FXD A;  2L5T A;  1X3P A;  2ZTC A;  1SNO A;  2E2I B;  2EYM A;  1A3V A;  1RHP A;  1Z47 A;  1HZB A;  2F4V Q;  1OO9 B;  1RJT A;  3DM3 A;  1S3O A;  3PUX A;  2N78 A;  4A3J G;  3J80 i;  3PF5 A;  4QF4 A;  1T5X D;  3J81 j;  3EIV A;  4KLK A;  2AKW B;  3NE5 B;  1DGS A;  1B3Q A;  1BDO A;  3AFQ A;  1KHI A;  1YZ6 A;  1Y1W B;  1XMQ Q;  3T16 A;  3MXP A;  4JI7 Q;  1D5X C;  4ZQ3 A;  3PGZ A;  2DNC A;  4DR1 L;  1CHQ D;  4CGY B;  4XT1 B;  2WB1 E;  4N8F A;  4C2M H;  2XWJ B;  4QJF A;  1VF5 C;  5KIX A;  3J80 L;  1NMG A;  4KJN A;  2CWA A;  2VW9 A;  1DOL A;  1NAP A;  3I70 A;  4JI1 Q;  4DR7 L;  2DUD A;  2RSO A;  2JA7 B;  1CQF A;  3X3M A;  5IT9 E;  5ELO A;  3MXU A;  1K9M C;  4GNX C;  1SYF A;  3UE1 A;  5KGU A;  2F3I A;  1DOK A;  1PZI D;  2NVQ B;  3J7A V;  1FNW A;  2EZV A;  3R8B A;  5M3M B;  2SNS A;  3HG9 A;  1CA5 A;  4A3C H;  2XSC A;  2WKD A;  3CXC A;  1TQO A;  2AWO A;  3PO2 B;  3OIQ A;  2YV5 A;  3H91 A;  1U9R A;  2LKV A;  1IBL L;  3BVM A;  3CPW A;  3LGJ A;  5IE8 A;  2R7D A;  1D5M C;  2KJX A;  3Q8D A;  3RNU A;  1WD1 A;  5C0X J;  3DM1 A;  5CV5 A;  5IWA Q;  4K8I A;  5EBD A;  4NXM L;  1PYW D;  1JCK B;  1RTO A;  1UE7 A;  1JJG A;  3F2C A;  1TWG B;  1IW7 D;  4BS9 A;  4K8J A;  2BH8 A;  1XPR A;  3A7L A;  3H09 A;  3E9H A;  1R4P B;  4HED A;  5FO7 B;  2G9H D;  2F52 A;  2Z0S A;  3SXH A;  2JEA I;  4X3T A;  2K50 A;  2TSS A;  2HCC A;  1BQQ T;  5E1F A;  2Y0S G;  5GRO A;  1HNZ Q;  2JA8 B;  1PDQ A;  3ZJY C;  3CAM A;  1S4Z A;  3NP8 A;  3UDI A;  1HRJ A;  1SBB B;  3F2U A;  4GZY C;  3OIP A;  2Q2U A;  5DNF A;  4DNR B;  3MFY A;  1U4R A;  3FKI B;  4KHZ A;  3S1N H;  1ASZ A;  4DA2 A;  2UXB Q;  3D6C A;  1JIC A;  4OX9 L;  2Z6B A;  1ESR A;  3RLF A;  3G6E A;  2P5Z X;  1UE6 A;  4TVA B;  1SNQ A;  4GOP C;  2UUA L;  3S24 A;  3C1E A;  5C44 H;  1HNW Q;  1VF7 A;  4OWX B;  4A3F B;  2NTT A;  4IN3 A;  3GO5 A;  2I0Q A;  5ELN A;  1XMO Q;  1H9M A;  3ER0 A;  4NXN L;  3W2D A;  5CBE E;  3S1R B;  5IGF A;  3ERO A;  3KOJ A;  4WJW A;  3SDZ A;  3K5O A;  3CCL A;  4DR6 L;  1HUM A;  4IAL A;  4Q0F A;  4RKL A;  4YCW A;  3SVM A;  4R8I A;  1JJ2 A;  4BY1 G;  1SRU A;  3H0G G;  4F8M A;  1Q7Y C;  5JAV A;  1TY0 A;  2L4N A;  1EYA A;  4IZ8 A;  4AYB E;  3HOU H;  1Y1V B;  1I6H H;  4CJ0 B;  4FVM A;  4X65 Q;  2HHH Q;  2OTL A;  1WTR A;  1CI3 M;  3T51 B;  1JE5 A;  2K6A A;  1A6X A;  4G4K A;  1NCV A;  4C3I G;  3PCO B;  1KAB A;  1YBY A;  5E4W C;  5F2D A;  3PSI A;  1XNQ L;  1E1O A;  3VYU A;  1S72 A;  1SYC A;  2GA4 B;  3I90 A;  4M1U B;  3CW2 C;  4A3D B;  5LMN Q;  4ZUI A;  1ZKO A;  4RCN A;  2WAQ G;  2UUC L;  4H44 C;  1VMP A;  1YNN C;  2HQL A;  4R4Q A;  1N32 L;  1A2T A;  1E24 A;  1AEX A;  1TS3 A;  5GQO A;  4OEL B;  4DN4 M;  4K5W A;  4HSV A;  2Q8I B;  4PMW A;  1NUC A;  3WDN A;  2FIN B;  3RMH A;  3NPP A;  1ICW A;  4C3J G;  4R9W A;  1FVI A;  2VXW A;  2Q2T A;  4LF5 L;  5IP9 G;  2OF1 A;  4UHV A;  4EQO A;  4RGM A;  2K28 A;  1CZW A;  3QJY A;  2N8N A;  3SHL A;  4F7X A;  4ULL A;  1KAA A;  4DR1 Q;  2V4D A;  3OWE B;  2ZXO A;  3FP9 A;  3MEF A;  3KF6 B;  5M5W B;  3QR8 A;  2F1M A;  3U58 A;  3HOZ G;  2WB1 B;  4C1N K;  4G7O C;  1Q82 C;  3CU7 A;  1CUK A;  5KYI A;  2K5W A;  2E5L L;  4AYB G;  5DM7 3;  2QCP X;  4DR7 Q;  5C4Z A;  4MN3 A;  3BZD B;  4IUN A;  1KDB A;  1N34 L;  1STA A;  4OEM B;  5GAH C;  1B50 A;  4YCU A;  2F0J A;  1D7Q A;  2A74 C;  3RD4 A;  2F0K A;  3S15 B;  2RHQ B;  4XQJ A;  2JE6 I;  4GLV B;  5IT9 c;  1BBX C;  1Q81 C;  3M3Y H;  4G57 A;  3GTO B;  2XN9 C;  1H9R A;  3R2I A;  2QIL A;  1IBL Q;  4LUO A;  2NVX H;  3I4N G;  2HUG A;  1WTP A;  1N36 Q;  2VZA A;  2B2T A;  2JA6 H;  4JI5 L;  2C9O A;  1NE3 A;  2EJM A;  4NXM Q;  1NTG A;  1G2S A;  1CT1 D;  4QQB X;  1KIX A;  2R7Z B;  4CDE C;  2CKZ B;  4KKS A;  1BBU A;  2I5L X;  1WD0 A;  3KK7 A;  1Y14 B;  3FPP A;  2F0L A;  1F2L A;  3M4Y A;  2RDF A;  1YHQ A;  2UU9 L;  1C0A A;  2AUJ D;  1LV9 A;  3D3R A;  5I6W A;  3JAM i;  1QUQ B;  1EQQ A;  3HRZ C;  4OIJ A;  2KHI A;  3OSO A;  4RAU C;  4E6I A;  4YHH L;  4IUR A;  2DY7 A;  3RN5 A;  1WTX A;  4NPS A;  5D14 A;  4YWM A;  4ZCK A;  4JI4 L;  2K5D A;  1QWY A;  1BCP D;  3V96 A;  3MAQ A;  1JR0 D;  4JBJ A;  4OX9 Q;  4IFD J;  4C1N I;  2IPK D;  4S3S A;  1PH8 A;  1KD1 C;  3E9I A;  2YYZ A;  2FMM A;  1E2Z A;  2K5H A;  1V1Q A;  4A3K H;  1D1K A;  1EU3 A;  3FEW X;  4JI8 Q;  1SNC A;  4LUV A;  3PIP 3;  2E76 C;  2NYZ D;  2R6G A;  2PW5 A;  4NXN Q;  1HR0 W;  1ENA A;  1UE1 A;  2XIW A;  4A3I H;  1NJI C;  2JA5 H;  3KBG A;  4DR6 Q;  1QNU A;  2A8V A;  3GTM H;  3A8K E;  3NBH A;  4O0A A;  1J6Q A;  2KEC A;  1O7Y A;  1F9Q A;  4IPC A;  3VYR A;  1K0R A;  1Z7T A;  1BCP B;  1STN A;  3UI2 A;  3K57 A;  4BBS H;  5DEH A;  1BCP F;  3ERS X;  1PMR A;  2HD3 A;  1MI2 A;  1B9M A;  1MGS A;  3S17 B;  3L2P A;  2KUM A;  5AFW A;  1LYL A;  1ONL A;  3Q6S A;  4DF7 A;  2ZXP A;  1D8L A;  2UXD L;  1XNQ Q;  2PQA A;  2SNM A;  1CKN A;  3PQI A;  4CBV A;  2D0P A;  1MSG A;  1RD9 D;  4PNY A;  4FP5 D;  4K6D A;  1JJC B;  3VR6 A;  1UUP A;  3Q24 A;  3AYH B;  2A69 D;  2CWP A;  4RA8 A;  2KHJ A;  3HKZ E;  4LFB L;  1NY4 A;  1N32 Q;  3CC7 A;  3BDL A;  3MXN B;  4DAY A;  3DLL A;  3F2D A;  1C4Q A;  2PNH A;  2NVT B;  3NQT A;  2NN6 G;  1HZA A;  4A3J H;  2Z1C A;  5ISR A;  3CD6 A;  3ULJ A;  1EFI D;  2UUB L;  2MO1 A;  2HIV A;  2AQ3 B;  3NTI A;  4LF5 Q;  1EL0 A;  4FF3 A;  2DNE A;  2N55 A;  3FMC A;  4YWK A;  2PYK A;  3NXW A;  1EWC A;  5GAD C;  2HDM A;  1BUV T;  2KED A;  3HKS A;  3T56 B;  3NBH B;  4DAM A;  3O13 A;  2E2H B;  4LJZ C;  4ZUJ A;  3TRE A;  2K5V A;  4DV2 L;  2EJG C;  2KCT A;  4KHV A;  2E5L Q;  4KI0 A;  4DXF A;  2ZJR A;  1A63 A;  2ZXR A;  4DGZ A;  1N34 Q;  1JE4 A;  3KYH C;  5JPN C;  4JV5 L;  2MJ8 A;  3GV6 A;  3VR2 A;  1EU4 A;  4OO1 H;  2A6E D;  3SGI A;  1B7Y B;  2IT1 A;  3M85 A;  2ZJQ A;  2MUY A;  2K32 A;  2F0E A;  4A93 B;  1KXL A;  5IY0 A;  4DUZ Q;  1NR2 A;  4JI5 Q;  1S5F D;  4X62 L;  3K0Y A;  2OEO A;  2IX0 A;  3H3V C;  3T53 B;  4LF6 Q;  2BA1 A;  2KOL A;  2I5M X;  2GVA A;  3TEH B;  2I07 B;  1E3P A;  1HFG A;  1EWI A;  4LFA Q;  1EY5 A;  2JSO A;  2UU9 Q;  4CKC A;  4J15 A;  4B08 A;  3HOY G;  4Y7N H;  3FVQ A;  4P72 A;  4AH6 A;  2CVR A;  5FK9 C;  4DR4 L;  5ELF A;  1PYS B;  2XRQ D;  1XNR L;  1EIF A;  1EOT A;  2NUC A;  3GTQ H;  1P16 A;  1MBY A;  1PFM A;  2B39 A;  1X6O A;  3LX0 A;  3S1N B;  2M9V A;  4DV0 Q;  5GAG C;  1Q90 A;  4CHT B;  1JWM D;  2JEB I;  3FDT A;  1JOQ A;  2F0W A;  2F0P A;  5A2Q L;  4LAA A;  3S16 H;  4AQY L;  4IUV A;  5J39 A;  2YU9 B;  1L1O A;  1VQE A;  2JYO A;  4DAV A;  1JB7 A;  4A76 A;  3HOX B;  1VQB A;  1VQ9 A;  1PVO A;  1SE4 A;  2B2T C;  1WTH A;  4DNT B;  2JA6 G;  1DD2 A;  4BBR G;  4ME3 A;  1G91 A;  1EY9 A;  3D31 A;  1TS2 A;  3MFG A;  1BCP C;  1WTO A;  2LMC B;  2EE1 A;  3CHB D;  4BY1 H;  3H0G H;  1HTL D;  3HOU B;  1I6H B;  1SEB D;  4JW0 A;  2O5I C;  1QVG A;  4Y52 H;  4CDF C;  2VQF L;  4WRD A;  5J22 A;  1EQV A;  4HID A;  4POF A;  2H4O A;  3MXG A;  2VB3 X;  3NTH A;  3L7Z C;  2DGY A;  2EY2 A;  4C3I H;  1SFO H;  3KJO A;  3GQB A;  4B9X A;  1W6J A;  4YY3 L;  5I2X A;  1QJO A;  3NK9 A;  4JI2 L;  1KC8 C;  2F0I A;  1ROD A;  1VQI A;  4LFB Q;  1N9W A;  4GKK L;  1NSN S;  1YEZ A;  3K5L A; 
#chains in the Genus database with same CATH homology
 1ENC A;  1F77 A;  4ZYS A;  4RGN A;  4NKL A;  4Q5V A;  2CQA A;  2ZT9 C;  2RSN A;  5CBA E;  5ELC A;  3SK6 A;  3S1M B;  1PFN A;  1WTV A;  1LLR D;  2TMP A;  4FXK C;  2B8G A;  1LT3 D;  1KLG D;  4RGO S;  3NHH A;  2A5H A;  5I4D A;  2HQE A;  2R61 A;  5LL6 S;  4V0B A;  5KRU A;  3J81 L;  2EPB A;  3DWQ A;  4EQN A;  2PNR C;  5BN5 A;  1SJE D;  4EGV A;  4XYO A;  3VA7 A;  5JEA J;  1PTO D;  1EEI D;  5T1G A;  1OXT A;  1NR4 A;  5C4X B;  1CQV A;  2EXZ A;  1STB A;  3PO3 B;  2SOB A;  3K5M A;  4V19 0;  1Q1B A;  3GTK B;  3C3L A;  2G9D A;  1TY2 A;  3J7Y W;  1TWA B;  4KY7 A;  2L9H A;  2R92 B;  2AWN A;  3OW7 A;  1ILP A;  4NMZ A;  1I4H A;  1Q12 A;  1R4Q B;  2A6E C;  1F2Y A;  2EYO A;  3BG3 A;  1PTO B;  1PTO F;  3QIA A;  3LWU A;  2H1E A;  1DM0 B;  2LS0 1;  1BF4 A;  1TU2 B;  1EY8 A;  1HA5 A;  4KN7 C;  1CM9 A;  4OO1 G;  4ZKC B;  5EPJ A;  2O4X A;  4NP5 A;  2B2W A;  1QOH A;  4LMQ D;  4XT3 B;  4A3I B;  3EVQ A;  2JA5 B;  3OMG A;  1I4R A;  3GTM B;  4XIG S;  1S5E D;  3R93 A;  2O5J C;  1GUS A;  1H9K A;  3D4W A;  2WKC A;  3TP8 A;  4BBS B;  5JJZ A;  1I50 B;  4FF4 A;  2B2Y A;  2KQ3 A;  1EWH A;  3H94 A;  3TSS A;  4MHE A;  4RFB A;  5HUR A;  1J8I A;  2NTS A;  2F0D A;  3IFD A;  3RUZ A;  2IWH A;  3JAM E;  4OO1 I;  3ONA B;  2Q8T A;  4FF2 A;  1PZK D;  4A3J B;  1RF2 D;  5IGG A;  1GUG A;  4ABN A;  2NN6 H;  2D62 A;  2IX1 A;  3EFX D;  5D3D A;  3N52 A;  4DK1 A;  3ND8 A;  4HAE A;  4RCO A;  5FLX E;  2X69 A;  1LTA D;  2A6H C;  1ET6 A;  4BY7 B;  1BO0 A;  2RA4 A;  1ZYR D;  3HOV B;  4HCE A;  2K01 A;  3IL8 A;  2L1B A;  3IAY A;  2A73 B;  2CW0 C;  4IQZ A;  3SEB A;  1F9R A;  3OHX C;  4FO2 A;  1SJH D;  1II3 A;  5I6Y A;  1HQR D;  1PLF A;  2O2L D;  5IGB A;  4MIU A;  1RTN A;  4TRD A;  1XXG A;  5EJW A;  1STE A;  1OXV A;  3V05 A;  1BOS A;  1U4P A;  1LTB D;  4Y7N B;  1G8Z D;  2KEE A;  3NUC A;  3SK8 A;  1MD2 D;  1PTO C;  2VB2 X;  4NW2 A;  1O80 A;  1JOR A;  1EZ6 A;  5I9O A;  1V8Q A;  2Y0S B;  1QB5 D;  3GTQ B;  4C3H B;  4BA1 I;  1DON A;  2LFN A;  1B9N A;  4L8J A;  5EKI A;  2F03 A;  1ZXT A;  5EQ0 A;  3VR5 A;  1L0Y B;  2BDO A;  1UAP A;  3CKI B;  1QCB D;  1WTW A;  1EIG A;  3BVZ A;  3QWN A;  4PV1 C;  1A15 A;  2NZ1 D;  1SXT A;  1PZJ D;  3HP3 A;  5M5Y B;  4BY1 B;  2AUK A;  3H0G B;  2BOS A;  1SAP A;  5CV4 A;  5IT9 L;  4KD4 A;  4HCS A;  2E2D C;  4K5X A;  4C3I B;  1SFO B;  2E75 C;  2WV6 D;  4XXE A;  5KEE A;  3A55 A;  4K2L A;  1GUO A;  1HHV A;  1EEF D;  1KNA A;  4FYD A;  3K7A B;  5FO9 B;  2AQ1 B;  3VYS A;  1A3U A;  3OOC A;  2WAQ B;  2PZU A;  3DWP A;  2EYL A;  1PRT B;  3M4O B;  1JOO A;  1PRT F;  2B2W C;  2K04 A;  1SYG A;  1ET9 A;  3I91 A;  3AMU A;  3P75 A;  3S2D B;  2PQE A;  3URY A;  3D6W A;  4C3J B;  1E2V A;  1Y8P B;  3VYT A;  1I4X A;  3MHB A;  1EY0 A;  2K33 A;  3HOZ B;  4KN4 C;  1GUN A;  2ICI A;  2JXM B;  2B2Y C;  1L0X B;  3H6M A;  1GXD C;  3WOE A;  1A2U A;  4AYB B;  2WIN B;  5BN3 A;  1K83 B;  1DZ1 A;  4H7B A;  5C5L A;  1VDZ A;  2JP1 A;  1FYC A;  1EYD A;  1DJR D;  1EY7 A;  1EZ8 A;  3I4N B;  3K6O A;  2R3Z A;  4WFN 3;  2FHT A;  1C8C A;  1IYU A;  5D3I B;  5CV7 A;  3Q0A A;  3P1H A;  5C0X H;  1SE2 A;  1ZYR C;  3BS1 A;  4KV6 A;  1Q3L A;  5T1I A;  5COY A;  4WOR A;  4DU9 A;  4DFA A;  1G29 1;  2EYP A;  5EKK A;  1LAB A;  1D6E C;  1TWF B;  5BN4 A;  3I73 A;  4C2M B;  2B8F A;  5CGK A;  4G7H C;  4UDU C;  2DN8 A;  1AFP A;  1JQY D;  3N6R A;  1DYQ A;  1WTQ A;  4XQN A;  1I4Q A;  3HGB A;  3C2P A;  3NTK A;  3ITP A;  2X6G A;  1J9O A;  3KLR A;  2D9U A;  4J8Q A;  3HEJ A;  4PMC A;  4HMJ A;  4RH6 A;  2K05 A;  4IUP A;  2XWB B;  4DK0 A;  4F87 A;  2NN6 I;  3E0J A;  2QKI C;  3CRK C;  3MEH A;  1Z6H A;  3NSW A;  1R9T B;  1YNJ C;  2F0Q A;  1I4P A;  2BE5 D;  3DHQ A;  3SK4 A;  1FNU A;  5C5M A;  5A35 A;  1CHP D;  1V43 A;  4I65 A;  1B4O A;  4HSP A;  1KLU D;  2F0O A;  3SR1 A;  3J80 E;  1E2W A;  4U67 3;  3WOF A;  5E3F A;  5IIF A;  2EOT A;  3FRP B;  3PUV A;  4ZK9 B;  2ICE C;  1SYD A;  5JVH 3;  1B1Z A;  1PRT C;  5COR A;  5IOD A;  2B2V A;  3P20 A;  2L55 A;  2F3W A;  1Y8N B;  4NDX A;  4TQU S;  5C44 B;  2F0F A;  2WII B;  2F0M A;  4FNF A;  4TKO B;  1SMY C;  1S5C D;  4X3K A;  3TME A;  1Q8I A;  2EYF A;  4K6L A;  4ZLT F;  1ZEQ X;  1JC7 A;  2L0C A;  1HPC A;  5IGD A;  1DXM A;  1H9J A;  2E2J B;  3D4R A;  1HTP A;  3QG1 A;  4QUC A;  2OXP A;  5CC4 A;  2K1B A;  5CMD A;  2RDG A;  3U9O A;  3T13 A;  1B2T A;  5EPL A;  1QG7 A;  5M5X B;  3MWY W;  1XWE A;  5JEA G;  3K58 A;  2A6H D;  1LTS D;  1U4L A;  1H9S A;  5JPM C;  3BDC A;  3HKZ B;  1Q1E A;  4KD3 A;  1V1O A;  4KJO A;  2Z4H A;  3QO2 A;  2PO4 A;  2IW3 A;  4L6T B;  5J1Z A;  1C48 A;  2FJ2 A;  5DM6 3;  3S9W A;  4QB4 A;  2IX3 A;  3NQI A;  3BVG A;  3D4D A;  2CW0 D;  3PIO 3;  3HOY B;  3E6Z X;  1SYE A;  1LTR D;  1LT5 D;  3M7N A;  3DXJ C;  3I8Z A;  5KNB A;  1I6V C;  4P2C B;  4F88 A;  1Y69 U;  4HTH A;  1QNK A;  2EVB A;  3QB3 A;  4IFD H;  3A8I E;  2HCI A;  3NWS A;  3M3Y B;  3IKJ A;  5K5P A;  1LO5 D;  2NVX B;  2RQX A;  2SEB D;  5C4H A;  4X3S A;  2JA6 B;  4ID6 A;  4BBR B;  1X3Q A;  2Z8L A;  1K8O A;  4XTC S;  3X3N A;  3I72 A;  3MC0 B;  5C0X G;  5JVG 3;  2RDH A;  5D65 A;  1BXT A;  1TWH B;  4DAP A;  2A68 C;  1G6Z A;  2EDG A;  3QOJ A;  2PCF B;  3A54 A;  2E74 C;  3TBI B;  2X6L A;  1AP0 A;  1CK1 A;  5K36 H;  1AZQ A;  2PW7 A;  3MA2 B;  1GUT A;  4QMG A;  1A3T A;  3GTJ B;  1UNS A;  3OMC A;  2BE5 C;  1STY A;  2KCC A;  4A3K B;  4ODG A;  5M9O A;  4PMB A;  2J0T D;  5EKL A;  1LAC A;  3E5S A;  3DUZ A;  4IUT A;  1TT2 A;  3GV3 A;  1BNZ A;  5C0X I;  5ELE A;  1SNP A;  3DEP A;  3GD7 A;  4L63 B;  4R8N A;  3HZX A;  5IGE A;  4LK1 C;  1F2Z A;  2PZW A;  1JWU D;  1HQM C;  1KNE A;  3KLS X;  1STH A;  2EY6 A;  3M7G A;  1PFB A;  2XVS A;  1ILQ A;  1MSH A;  4KKT A;  3L3O C;  1GHJ A;  1U4M A;  2RKS A;  4H13 C;  2B2V C;  1TII D;  1B3A A;  4EQP A;  2KCN A;  1X32 A;  3QOL A;  1SDF A;  4OHJ A;  3I4L A;  2NBF A;  3S14 B;  4H0L C;  5FOB B;  5LHY 1;  1G2T A;  2KVM A;  4C3H G;  4I7Z C;  2EJF C;  1TVX A;  4O1N A;  1K8M A;  1O78 A;  5C6A A;  2EY5 A;  4ZRZ A;  4RHS A;  1AN8 A;  5C3X A;  4HR7 B;  1B44 D;  2VNU D;  5ELD A;  4OGQ C;  1QE6 A;  2F0N A;  5CV6 A;  5IOC A;  3TDQ A;  1M4V A;  5M3F B;  5KNC A;  1JOK A;  3K5N A;  3P7J A;  1LT6 D;  5TSS A;  2EY1 A;  5EBC A;  4X3U A;  1SNM A;  2ID0 A;  4KY5 A;  2B2U A;  3D8G A;  2FFK B;  1WCM B;  2IL8 A;  1LTG D;  3A56 A;  3PMF A;  2C5C A;  1SND A;  2EYJ A;  1VMC A;  4QUF A;  1F9P A;  2L11 A;  4FXG C;  2QEJ C;  4A3M B;  5IGC A;  4EVO A;  3TP7 A;  4CJ2 C;  3TZD A;  4CKB A;  1I4G A;  3K59 A;  2WP8 J;  4CKE A;  5FO8 B;  5EGT A;  2RBM A;  3S16 B;  1HCZ A;  1YNJ D;  3MZ5 A;  4IFD G;  3CRL C;  2K5Q A;  1SE3 A;  4U68 A;  5DAU A;  3BYY B;  3SK5 A;  1O7Z A;  4JBW A;  2HDL A;  3A8J E;  2F0U A;  1S5D D;  1FR3 A;  1TR5 A;  4RHR A;  2PPB C;  1PRT D;  3DWA A;  3R3O A;  1EYC A;  1HFN A;  2Z4I A;  2SDF A;  4IUU A;  2D5D A;  4RGT A;  4UAI A;  3VR4 A;  1GOZ A;  1SMY D;  2LY7 A;  4QIW B;  5K36 G;  2I46 A;  5A2Q E;  3HS0 C;  5JEA H;  1AZP A;  4K5V A;  2DY8 A;  4IFD I;  3Q22 A;  3VA5 A;  2QDB A;  3KUP A;  3I3C A;  1D1I A;  1GUW A;  1PXU A;  1PTO H;  2BCO A;  3OWF A;  1FD7 D;  2MPM A;  1BR9 A;  3EA6 A;  3IFT A;  3GP7 A;  5E4X A;  3BDO A;  1D2B A;  4BWG B;  3MXN A;  1F9S A;  1IW7 C;  2NWG A;  3J7A F;  1KDC A;  1RCV D;  3JAM L;  4XYQ A;  1TS5 A;  1Y8O B;  3ERQ A;  4KY6 A;  3Q23 A;  1CZG A;  1LTI D;  2Q8R E;  1OXS C;  2BDN A;  3G6J B;  2AQ2 B;  4A3B B;  4G7Z C;  1VCI A;  3MVV A;  3CQZ B;  1SSO A;  5FLX L;  2B63 B;  1FGB D;  1FNV A;  2NB0 A;  4BA2 I;  1TS4 A;  3ND9 A;  2RVL A;  4RWS C;  3GTG B;  3PUZ A;  1KDA A;  4J1M A;  3C1F A;  1XYI A;  1V1P A;  2M2L A;  3LWE A;  2F0G A;  3A7A B;  3ZYY X;  1W6K A;  5CV8 A;  5FKA C;  1CFM A;  2PZT A;  1HA6 A;  1GJX A;  2BA0 A;  3I4M B;  4KKU A;  3NWT A;  3SE0 A;  3J81 E;  2NVY B;  3C46 A;  5C3E B;  3KF8 A;  2FMC A;  4XQQ A;  2EYH A;  2F0H A;  3W3A A;  3DEO A;  5I9P A;  1AW7 A;  4B9W A;  2A68 D;  2F0T A;  4OL7 A;  3AB9 A;  4HMI A;  4K2K A;  3RZD B;  1TKW B;  2B2U C;  3TP5 A;  4DXG A;  1STG A;  2IJ0 A;  2KHS A;  5JOB A;  1IL8 A;  1EY6 A;  3V2T A;  2MHV A;  1EY4 A;  1RKN A;  5C3W A;  3TN2 A;  3OPO A;  3G7L A;  4JK1 C;  5CR3 A;  1EIH A;  1GHK A;  4YIJ A;  1IHZ A;  5ELB A;  2XNA C;  1F2M A;  1V1P B;  1D5Z C;  1IKM A;  1WVL A;  3L9A X;  3TP6 A;  2M00 A;  1XTC D;  5HGT A;  4ZAI A;  2F0S A;  4OIK A;  1OXX K;  4HN7 A;  3PUW A;  2R93 B;  4Z9C B;  5LL6 X;  4ME5 A;  5G3L D;  1SYB A;  1LTT D;  1T5E A;  1TWC B;  4A3E B;  1ESF A;  1O7L A;  3MTS A;  1JWS D;  3RZO B;  5KND A;  2F3V A;  2QF7 A;  2J4X A;  1QIL A;  4FF1 A;  1EQT A;  1XX8 A;  5EPK A;  3EJI A;  1IKL A;  2CHB D;  3DMU A;  3TZU A;  4XDX A;  5I2Y A;  5CYU A;  2KA7 A;  4TSS A;  2ENB A;  2MGS A;  4RKB A;  3BYT B;  5G3L F;  4QCL A;  2N88 A;  4J6H A;  4KTA A;  2L12 A;  1KTK A;  1IYV A;  4A3G B;  4PQX A;  3EQL C;  1JB3 A;  2PMZ B;  2XRS D;  3HOW B;  3T4A C;  1M8A A;  1S5B D;  1UEA B;  5CV9 A;  2F4I A;  4CJ1 B;  1LT4 D;  3AU7 A;  1B53 A;  3KBX A;  4IUQ A;  5C4J B;  4ILW A;  2K7V A;  1CTM A;  3U9S A;  4N9T A;  1OXU A;  4ZKB B;  3KLS A;  4K14 A;  3R2T A;  4M8A A;  3PV0 A;  2K03 A;  1RDP D;  3FPU B;  2WAC A;  4N9P A;  1HXY D;  1ENF A;  4KK7 A;  3PUY A;  2F0V A;  1HUN A;  1ML0 D;  3LNN A;  1DOM A;  4O42 A;  3S2H B;  1I3Q B;  2D2C C;  1YNN D;  3GTL B;  2A69 C;  1DCZ A;  1E0B A;  3GTP B;  3S1Q B;  5NUC A;  3NBI A;  1H9S B;  2OT2 A;  5KYL A;  1CA6 A;  4C56 C;  4KMU C;  2J7Z A;  2VUM B;  2MP1 A;  3VR3 A;  4FXD A;  2L5T A;  1X3P A;  1SNO A;  2E2I B;  2EYM A;  1A3V A;  1RHP A;  1Z47 A;  1OO9 B;  1RJT A;  3PUX A;  4QF4 A;  1T5X D;  3NE5 B;  1BDO A;  1Y1W B;  3T16 A;  3MXP A;  1D5X C;  4ZQ3 A;  2DNC A;  1CHQ D;  4CGY B;  4XT1 B;  2XWJ B;  1VF5 C;  5KIX A;  3J80 L;  4KJN A;  1DOL A;  1NAP A;  3I70 A;  2RSO A;  2JA7 B;  1CQF A;  3X3M A;  5IT9 E;  3MXU A;  1SYF A;  5KGU A;  1DOK A;  1PZI D;  2NVQ B;  3J7A V;  1FNW A;  2EZV A;  3R8B A;  5M3M B;  2SNS A;  3HG9 A;  1CA5 A;  2XSC A;  2WKD A;  1TQO A;  2AWO A;  3PO2 B;  3OIQ A;  3H91 A;  1U9R A;  2LKV A;  3BVM A;  1D5M C;  2KJX A;  1WD1 A;  5C0X J;  3DM1 A;  5CV5 A;  5EBD A;  1PYW D;  1JCK B;  1RTO A;  1TWG B;  1IW7 D;  4BS9 A;  4K8J A;  3A7L A;  3H09 A;  1R4P B;  4HED A;  5FO7 B;  2G9H D;  3SXH A;  2JEA I;  4X3T A;  2TSS A;  2HCC A;  1BQQ T;  5E1F A;  2JA8 B;  1PDQ A;  1S4Z A;  3NP8 A;  1HRJ A;  1SBB B;  3F2U A;  4GZY C;  3OIP A;  5DNF A;  4DNR B;  3MFY A;  1U4R A;  3FKI B;  4KHZ A;  4DA2 A;  3D6C A;  1JIC A;  1ESR A;  3RLF A;  1SNQ A;  3C1E A;  1VF7 A;  4A3F B;  2NTT A;  4IN3 A;  3GO5 A;  1H9M A;  1NSN S;  3W2D A;  5CBE E;  3S1R B;  5IGF A;  3ERO A;  4WJW A;  3SDZ A;  3K5O A;  1HUM A;  4IAL A;  4Q0F A;  4RKL A;  3SVM A;  4R8I A;  4F8M A;  5JAV A;  1TY0 A;  2L4N A;  1EYA A;  4IZ8 A;  1Y1V B;  4CJ0 B;  4FVM A;  1WTR A;  1CI3 M;  3T51 B;  2K6A A;  1A6X A;  4G4K A;  1NCV A;  4C3I G;  1KAB A;  5E4W C;  5F2D A;  3VYU A;  1SYC A;  2GA4 B;  3I90 A;  4M1U B;  4A3D B;  4ZUI A;  1ZKO A;  4RCN A;  4H44 C;  1VMP A;  1YNN C;  1A2T A;  1TS3 A;  1AEX A;  4DN4 M;  4K5W A;  4HSV A;  2Q8I B;  4PMW A;  1NUC A;  3WDN A;  2FIN B;  3RMH A;  3NPP A;  1ICW A;  4C3J G;  4R9W A;  2VXW A;  2OF1 A;  4EQO A;  4RGM A;  2K28 A;  1CZW A;  3QJY A;  3SHL A;  4F7X A;  4ULL A;  1KAA A;  2V4D A;  3OWE B;  2ZXO A;  5M5W B;  2F1M A;  2WB1 B;  4C1N K;  4G7O C;  3CU7 A;  5KYI A;  2K5W A;  5DM7 3;  2QCP X;  5C4Z A;  4MN3 A;  3BZD B;  4IUN A;  1KDB A;  1STA A;  1B50 A;  2F0J A;  2A74 C;  3RD4 A;  2F0K A;  3S15 B;  4XQJ A;  2JE6 I;  1BBX C;  4G57 A;  3GTO B;  2XN9 C;  1H9R A;  3R2I A;  2QIL A;  2HUG A;  1WTP A;  2B2T A;  2C9O A;  2EJM A;  1G2S A;  1CT1 D;  2R7Z B;  4KKS A;  1WD0 A;  3KK7 A;  2F0L A;  1F2L A;  3FPP A;  3M4Y A;  2RDF A;  2AUJ D;  1LV9 A;  3D3R A;  5I6W A;  3HRZ C;  4OIJ A;  3OSO A;  4RAU C;  4E6I A;  4IUR A;  2DY7 A;  1WTX A;  5D14 A;  2K5D A;  1QWY A;  1BCP D;  3V96 A;  3MAQ A;  1JR0 D;  4IFD J;  4C1N I;  2IPK D;  4S3S A;  2YYZ A;  2FMM A;  1E2Z A;  1D1K A;  1EU3 A;  3FEW X;  1SNC A;  3PIP 3;  2E76 C;  2NYZ D;  2R6G A;  2PW5 A;  1ENA A;  2XIW A;  3KBG A;  1QNU A;  3A8K E;  3NBH A;  2KEC A;  1O7Y A;  1F9Q A;  3VYR A;  1Z7T A;  1BCP B;  1STN A;  3UI2 A;  3K57 A;  5DEH A;  1BCP F;  1PMR A;  1MI2 A;  1B9M A;  1MGS A;  3S17 B;  2KUM A;  5AFW A;  3Q6S A;  1ONL A;  4DF7 A;  2ZXP A;  2SNM A;  4CBV A;  1MSG A;  1RD9 D;  4PNY A;  4FP5 D;  4K6D A;  3VR6 A;  1UUP A;  3Q24 A;  4RA8 A;  2A69 D;  3BDL A;  4DAY A;  1C4Q A;  2NVT B;  3NQT A;  2NN6 G;  2Z1C A;  5ISR A;  1EFI D;  2AQ3 B;  3NTI A;  1EL0 A;  4FF3 A;  2DNE A;  2N55 A;  3FMC A;  2PYK A;  3NXW A;  1EWC A;  2HDM A;  1BUV T;  2KED A;  3T56 B;  3O13 A;  2E2H B;  4LJZ C;  4ZUJ A;  2EJG C;  4KHV A;  4KI0 A;  4DXF A;  2ZXR A;  4DGZ A;  1JE4 A;  5JPN C;  2MJ8 A;  3GV6 A;  3VR2 A;  1EU4 A;  4OO1 H;  2A6E D;  2IT1 A;  3M85 A;  2MUY A;  2K32 A;  2F0E A;  4A93 B;  1NR2 A;  1S5F D;  3K0Y A;  2OEO A;  2IX0 A;  3H3V C;  3T53 B;  2BA1 A;  2KOL A;  2I07 B;  1HFG A;  1EY5 A;  2JSO A;  4CKC A;  4B08 A;  3FVQ A;  2CVR A;  5FK9 C;  5ELF A;  2XRQ D;  1EOT A;  2NUC A;  1MBY A;  1PFM A;  2B39 A;  3LX0 A;  3S1N B;  2M9V A;  1Q90 A;  4CHT B;  1JWM D;  2JEB I;  3FDT A;  1JOQ A;  2F0W A;  2F0P A;  5A2Q L;  4LAA A;  4IUV A;  5J39 A;  2YU9 B;  2JYO A;  4DAV A;  3HOX B;  1SE4 A;  2B2T C;  4DNT B;  1DD2 A;  1G91 A;  1EY9 A;  3D31 A;  1TS2 A;  3MFG A;  1BCP C;  1WTO A;  2LMC B;  2EE1 A;  3CHB D;  1HTL D;  3HOU B;  1I6H B;  1SEB D;  2O5I C;  4WRD A;  5J22 A;  1EQV A;  2H4O A;  3MXG A;  2VB3 X;  3NTH A;  3L7Z C;  2EY2 A;  3GQB A;  4B9X A;  1W6J A;  5I2X A;  1QJO A;  3NK9 A;  2F0I A;  1ROD A;  4K8I A;  3K5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...