5DEQA

Crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
214
Chain Sequence
MKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKRGAALYKFNGKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
total genus 45
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5deqA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5deqA01
1U8RA 2QJTA 3I0TA 1XMAA 1XSXA 1W4MA 5LGNA 3GFIA 5IT9K 2M30A 4P55A 4WWCA 2RKHA 3ECOA 2DK5A 4OINF 3Q4IA 4KG3A 2ACJA 1XN7A 3EF5A 4CICA 2F5DA 3K69A 3TDUC 1BI3A 1QQIA 3I5UA 3HHJA 1O7LA 3I59B 1KHZA 3K1NA 3DP7A 1HSTA 3T5XA 3X0RA 2KDVA 3DFGA 3KZYA 3RKWA 1NHAA 3WTWC 4I2OA 4CZZA 3IL2A 2NYXA 5GHNA 1FNNA 4Q5SF 3RKYA 1OPCA 4CGZA 4JZUA 2WC2A 2P5LC 1XGOA 1QZZA 3HRUA 1GXQA 2JSCA 2YU3A 3QAHA 4KDPA 2Y0MA 3HOTA 2XHKA 3MFKA 3C18A 5D4RA 3GRNA 4O3MA 2A6TA 1H9TA 2QKMB 1FWZA 1LEBA 4E70A 1IN4A 5ICCA 3H3UA 1ZAOA 2DW4A 4JZSA 4P9UA 4EJVA 4GCVA 2RVCA 3PQKA 3VB2A 1XD7A 1RNLA 3HSEA 3V8JA 1SMTA 2KJBA 4G7OF 1YW7A 2PQ8A 3R6SA 1ULYA 5KVRA 1L3LA 1ZH5A 1XB4A 3FXQA 2J8QA 4JQFA 2HFHA 3F3XA 3RTRA 3F23A 3X0PA 2LNBA 5ILUA 4M9ZA 3FJYA 2O5FA 3BM4A 2J5PA 1JHHA 1G3YA 3MCZA 1RZ4A 3GXOA 2HS5A 2PQVA 2H6CA 1VIQA 4UVAA 3Q9VA 1Z9CA 1KTGA 3HRMA 2FA5A 3EEUA 3DF8A 1QZYA 1PUEE 3KVHA 3DXJF 4KMUX 3HOSA 4ZYGA 3S2WA 4LG0A 1X51A 3X0JA 2PFBA 2ZCWA 4IRIA 2Z3YA 5DUKA 5DEQA 1PUSA 3WTTC 1VHZA 1ON1A 4M71A 3FK9A 2FU4A 4ON0A 2XAHA 4P9FA 3X0SA 1FBQA 2NNYA 1Q33A 1TW3A 3ZMTA 3U9GA 3K2ZA 3L2CA 4KTBA 4AVPA 1W7PB 3DV8A 2VN2A 4HLXA 4BXUA 2H6BA 1L0OC 1C0WA 4P5OA 3I7UA 4ICKA 5ERIA 1JRKA 4KICA 4LLNA 4I7HA 2XVCA 1DPUA 1U6GA 2HKXA 1QNTA 3I58A 3R0JA 3E3VA 1IUYA 2C6YA 1XSVA 1U3EM 1VC9A 2W85A 3KP6A 4WK8F 2MD5A 4A12A 4I09A 5E8IA 4HX4A 2EV6A 5CLSA 2D1VA 1FPQA 1UHMA 4K2EA 4S2XA 1S6LA 2OD5A 1V8WA 1LDDA 3CNGA 5L3EA 2EFWA 1ZLKA 3PFIA 2ZNYA 3P9KA 3BOQA 2VE9A 5D5VB 1MD0A 3U1DA 2FNAA 3L85A 2YPRA 4ESFA 3J7Ye 3F8BA 4ENNA 2EK5A 3N4MA 3X0OA 1JKNA 3P9CA 5HDNA 2EA2A 2DBBA 4S2WA 3OV8A 1SD4A 5FB2A 2VC1A 4RB0A 2L3DA 2FOKA 1TNTA 1Z6TA 1VK6A 2A8QA 4KG4A 2P5KA 3HHHA 3ID9A 1HW5A 1B9MA 1PUNA 2H94A 1SD7A 1SZ3A 3R61A 2IJLA 3GZ6A 3OGAA 2YX4A 1XSDA 1JE8A 2QBYB 1F9NA 2F5CA 1XMKA 1FZPB 4I02A 4MTEA 5HDKA 4BQAA 2PI0A 1B1BA 1R67A 4U0VA 1J2XA 2WTEA 1KU3A 4EGZA 4CXFA 2FKBA 4GYIA 2MA3A 2IA1A 3E6DA 1SFUA 2FBKA 4L18B 2PLYA 1U5TA 1D8JA 3EQLF 2YVOA 2ZFWA 4ETSA 5EEHA 2LDUA 1FC3A 4O6JA 3HTSB 1O3TA 2FVVA 1V8NA 4M73A 1B6AA 4QLCU 2HEOA 3ZN1A 2W57A 1PP8F 1IXSB 3WE2A 5LGTA 3FM5A 1KQ0A 5DCMA 2DSCA 2LF7A 3F6VA 2KIMA 1H9GA 3FCMA 1VHGA 3F8NA 4RAYA 3I53A 3FF5A 5EEGA 5HS7A 2JPCA 1T98A 3O61A 1ZG3A 4XSZF 1DUXC 3I4PA 1PP7U 4FX0A 3GVAA 2B06A 2IP2A 3WG9A 5FLXZ 4KN7X 5FGMA 5C8LA 1DDNA 1P4WA 2Z33A 3HIFA 3KP3A 2STTA 1IRGA 4RB2C 2M1BA 3F8CA 2V1DA 1IN6A 1TW2A 2Q9PA 2QZ8A 1SD6A 4OMZA 3E6CC 4I0BA 3BDDA 4U7DA 4AIJA 3R60A 2BEOA 1FYKA 1A04A 1V8SA 2CO5A 5CVJA 5D5WB 4N9IA 1FYMA 5KK1A 2E1NA 5ANVA 3CUQC 2V9VA 4RB3C 1MK1A 1USTA 4XLPF 2CGPA 2ZMEA 2HKOA 4UNOA 3BJAA 2AZWA 4PGHA 4U0WA 5BS6A 4YFXF 4FHTA 5DDGA 3GFMA 2EWNA 3E5UA 5ICEA 2R5WA 2F2EA 2H09A 2GQQA 3B02A 2GXBA 4GGGA 5JI6A 2MLKA 1HKTA 4JZTA 3LA3A 2ESHA 5LHHA 1K6OA 2A8TA 3RYRA 3CO6C 2KIUA 3IKTA 1R5HA 4HDVA 1HKSA 3QRFF 3H92A 3SXYA 2ISZA 2O3FA 3M9AA 3AC9A 2JZYA 3LA7A 2BV6A 3FMRA 1MR2A 1T38A 2O8XA 5DD4A 4ZYEA 1SOIA 4YPRA 1XGNA 4TV7A 1O7FA 5JVTA 1U20A 2G74A 1JHFA 3ZP5A 4EJUA 1FOKA 4A6EA 5GHPA 2ZKZA 3LQRA 5CVVA 4S04A 3JTGA 5K5RA 1O3SA 1G6NA 3HSRA 4HX8A 2HZTA 4HDUA 1FX7A 3ULQB 2DK8A 2MC3A 3X0MA 2EJRA 1BIBA 3IC7A 4EM0B 3FMQA 2RRKA 4G94A 2CW0F 1MQEA 1LB2A 1G3WA 5FSKA 5JFRA 1MKMA 4KYXA 4UV9A 3A6VA 1KA8A 5CVUA 3TO7A 3T8RA 2OQRA 1TQMA 3ERED 2YX7A 4KYWA 1HSJA 1KU7A 2P4WA 2VOOA 4B8XA 4I0AA 3ABTA 5ED4A 2EFOA 2CSOA 1XSAA 2DT5A 2YR2A 3IRQA 3CUQB 4ENKA 1CF7A 4UVBA 2EV5A 1JXSA 2YVNA 2XKPA 3P6YA 1ZRCA 1OYYA 2VONA 1AWCA 1VIUA 3E57A 3RYPA 5BMZA 3G73A 1YIOA 3E5QA 4UXNA 1BJAA 3V8LA 1ZRFA 2P7CB 4YPHA 1BBYA 1VTNC 4YFKF 5J6XA 3Q2SA 3MZHA 3RDIA 4PGGA 5FSIA 4YFNF 2DFIA 1OMIA 4R79A 4N0BA 4IHSA 1WI9A 1T39A 1STZA 2A07F 3WTUC 2FXAA 4L5IA 4O5VA 1RUNA 4Y17A 2M8EA 2GXGA 2K7LA 5CVRA 3K0LA 1I1SA 3DKWA 4L9VA 1LQ1A 1T6SA 2DQRA 3WTSC 3N97A 4ZZDA 2O61A 1IN5A 4GXOA 2A8RA 3F13A 4EM2A 1Y0UA 2D1HA 4S2VA 2HDCA 4LD5A 1PPVA 2QQ9A 2FEZA 3FXUA 2BYVE 3TDZC 3X0NA 2HTSA 5TJJA 2QENA 1RIOH 1RRQA 3O52A 1BOAA 1K26A 1H0MA 4A0ZA 1RI7A 4MTDA 5IW4A 2JPBA 4N9HA 4HZFA 5E1XA 2Y75A 2GWRA 5DD8A 5BPDA 3P7NA 1BI2A 1PPWA 2F5EA 1YFHA 1R36A 1XDUA 5GHJA 3KE2A 1KQ9A 4XRFA 3COAC 3O3KA 2B0LA 2NAZA 4PCQA 4EJOA 1TQPA 5HLGA 3F21A 3C7JA 1USSA 3KP4A 5DPKA 3RJPA 3CO7C 2HYGD 3MDGA 2E7WA 5FFZA 1FY7A 3U53A 3KP5A 2I6KA 4IRGA 2BE5F 3I71A 4HQEA 3JTHA 2O5WA 2FMLA 4NHJA 2IT0A 3JW4A 2I8UA 1IN7A 3P5TA 2JT1A 2ICKA 1R5GA 1O3RA 3E97A 3JAMZ 1J0RA 1ZLJA 2G9WA 2ZO4A 3O69A 5J8CA 2L02A 3KETA 1Z05A 1FSEA 1HZTA 2YVPA 1KU9A 3BPXA 5FFXA 2CFXA 4MPOA 1HX3A 3DEUA 3HTUA 3W6KB 4V14A 4JK1X 1YQAA 1V8TA 4QWQA 4LG0B 2ZBKA 3ZR1A 1YO5C 2EV0A 4U0YA 4UHTA 5L3DA 5A2QK 2RDPA 5LGUA 4KIBA 4ENJA 4A6DA 2YYHA 2V6CA 1D8KA 2R7FA 2K4JA 2A68F 2QWWA 1ZN2A 1S7OA 5D6EA 3ZR0A 1F4KA 3E6BA 3FHZA 1XSCA 3FXRA 1NFSA 4XLNF 5E18F 1TUMA 1V3FA 2A3SA 3PQJA 4S05A 4CHUA 1GA7A 2LSOA 3HRTA 1FBUA 3J80K 4UUVA 3TO6A 3V8KA 2LF8A 3E5XA 3IWZA 3NQOA 3SFZA 3RPUA 4HW0A 4JBAA 2UXNA 2KRFA 1U5TC 5IT3A 3J81Z 2M5WA 1V8LA 2EB7A 1BIAA 4XBFA 1TLHB 4CDGA 1HW2A 2MH2A 4KIGA 2Q8KA 5BPIA 2H27A 1F5TA 1JGSA 3GEZA 2A8PA 5DV5A 2STWA 2DUKA 2HQRA 1EV7A 2A61A 3ML6A 5ICFA 1B4AA 1LVAA 2FBIA 4Q47A 1VC8A 3R4KA 4LLGF 1SMYF 3GLXA 2RNJA 2ICJA 3GZ8A 4IHTA 2VBXA 4M6XA 3QPHA 2KDWA 2Q0OA 3KEQA 3GWZA 2I8TA 4OMYA 2D2WA 3OOPA 2QUFA 5HZXA 2PNYA 3GG6A 3V7RA 3EYIA 5CFIA 4HQMA 2A5YB 3W6JB 4KUMA 1CGPA 1RUOA 4ILQA 4K6EA 2OBPA 2QBYA 1KT9A 1S8NA 1MDMA 3VEPA 3B73A 2DI3A 3JSOA 2Z99A 3G0QA 2RQPA 3BPVA 4G9YA 1UCRA 1YTYA 2G7HA 1LJ9A 2QLZA 2HWVA 2EFNA 1K78A 2GB5A 2DQLA 2W84A 1WRJA 5D8LB 4NB5A 5E8GA 1SD5A 1R7JA 3E6MA 1IRYA 4CYDA 1P6RA 1BC7C 5IT9Z 3X0KA 3ZN0A 5D5UB 4R1HA 4HA8A 4KT5C 2G73A 4Q48A 3GF2A 1FSHA 3GX4X 3LA2A 2DO7A 4L9NA 4ZG0A 5D4SA 2YVMA 1I5ZA 5AIPA 3LSTA 1XGMA 3H95A 5D8KB 4A5MA 2K86A 2COMA 2E1CA 2FNPA 4AIHA 4B09A 3I7VA 5CVIA 1V8VA 3CUOA 2UXXA 3EETA 3DKUA 3TGNA 1IN8A 3H3ZA 1S7AA 4EVIA 3I9XA 3KFWX 4LFUA 2DTRA 3K9TA 3L00A 4HLYA 1TTYA 3QU6A 5LHGA 5LBQA 1P4AA 2VXZA 5D5XB 2GT2A 5FD5A 1LDKB 3RH7A 3WHWA 2IPQX 1V4RA 2ESNA 2UWMA 1HKQA 1R22A 3GZ5A 1ODDA 2OAZA 1SJYA 1BC8C 2XAFA 3BROA 2W4EA 3NEUA 3TKYA 3T1BA 4C9XA 2WV0A 3FZVA 4GYGA 1KU2A 5ANSA 5IW5A 2QQAA 3VFZA 2FMYA 4WCGA 3V7SA 3ZMDA 2CWEA 2VOPA 3SONA 3VOEA 3G3ZA 2XROA 1MJBA 4M72A 3ZQ7A 4KIFA 5L3FA 4LK1F 1SFEA 3P9IA 4U7BA 3R03A 1ZYRF 2F5FA 4OU0A 2Q2EA 3ABUA 1T2KA 2AXLA 4EGYA 2TDXA 1P92A 2VE8A 1EH6A 4RAZA 3FFUA 2FRHA 2GT4A 5F1RA 3Q5FA 3A6TA 3LQQA 4DNCA 1IW7F 2IA2A 1HW1A 2XKOA 4S2YA 2J5OA 3ECHA 2XASA 1IZ1A 4M9XA 4HBLA 4IRHA 3U2RA 1P2FA 2PMHA 4HAMA 1R1UA 1BI0A 1ZRDA 3TOBA 1PUQA 2VODA 3BHOA 3WTZA 2OZUA 5DCFA 1SFXA 3BP8A 1MP2A 1F1ZA 4NFXA 3O2PE 1BI1A 1TQIA 1XGSA 2HTJA 1FT9A 1IRFA 1YG2A 2RN7A 3TQNA 4KNYA 2Z9OA 1YW9A 3M8EA 2YSRA 5GHMA 4LB5A 3M8FA 2IVMA 4OIOF 3I64A 2QVOA 4ZZLA 2EFPA 3O6ZA 1ZREA 1ZARA 4HX7A 1OR7A 5AONA 5LRSA 3M1EA 2P8TA 5H6QA 3Q9SA 3C1DA 2DPDA 3QSJA 1LDJA 2P7VB 5LRRA 4IF4A 3DQVC 1D5VA 3BAPA 5C7QA 1NFZA 1YS7A 3MAJA 5LHIA 5LEKA 1PDNC 4IPAA 1XSBA 2ADUA 4ESJA 4G7ZF 2L54A 5ILSA 4KN4X 1REPC 4EJWA 5J8FA 2CL3A 5JR3A 5HS8A 1K79A 4WXCA 2KIFA 4M6YA 4R8HA 3QPTA 1CF7B 2G7UA 1I27A 2NNNA 3SHDA 2QQBA 2L01A 3I59A 2OU2A 1I9AA 2JTVA 3LAJA 1HQCA 4Q4ZF 2A6HF 1ZHFA 5FSNA 1MZBA 3V4GA 2VT2A 4Y15A 2VT3A 3X0QA 2K4BA 1ZGJA 4EMSA 1OKRA 2VBYA 4UV8A 1MJAA 5CFJA 2L4MA 4M74A 4RGRA 2O6GE 4HYEA 2RGVA 1KQ8A 3LAPA 4Z2YA 1T0FA 5ANTA 1KYZA 5ANUA 3TOAA 5DYMA 2L4AA 2GAUA 4MNUA 3O6BB 3A6UA 3GW2A 1PVFA 1QVJA 4WX9A 1MQWA 1Z7UA 3F8MA 5ICGA 1V8RA 4L9TA 2W25A 1ZG5A 5FLXK 1Q54A 2IRFG 4L9JA 3T0YA 1G3SA 3SZPA 4KA4A 3DPTA 5HLIA 3O8SA 1IXRC 1G3TA 5E1WA 3HYQA 3LWFA 3GYHX 1S3JA 3COUA 2HQNA 1BM9A 5GHOA 3LFKA 1WSUA 4AD9A 5H6RA 2K02A 1SU2A 1QO0D 2EA4A 2MBFA 5BQTA 3BY6A 4OIPF 3IKVA 2ISYA 5ISYA 3R0AA 4OOIA 3MQ0A 3HYIA 2P5VA 4DQ2A 2VBZA 2UZKA 4NFWA 3QU3A 1V8YA 5GHIA 2P6TA 2HR3A 3F72A 1E17A 2DSBA 1Z1DA 3HUGA 2X0LA 3QOPA 2RV8A 1V8UA 5FD6A 2B0VA 1X83A 3I54A 2O0YA 4DYWA 3QP5A 1D3YA 1OYWA 2FF4A 3RKXA 3F8FA 5CYVA 5L3CA 1W5TA 3F6OA 4HV5A 3KLOA 1NQYA 1ZGAA 4D0PA 3SQNA 3WGGA 1I6XA 5HDGA 1F3YA 4G7HF 2OA4A 2XIGA 1TNSA 2O1CA 1W7PA 1WQ2A 4LLLA 3RPQA 3EYYA 3ZMZA 2FBHA 4AWXB 2XV4S 3BWGA 2DPUA 3IRRA 4CO8A 2PMUA 2FQ3A 4WXDA 4BHPA 1IF1A 5LLQA 1FP2A 5GHQA 4ENMA 4M9SA 2M87A 4LGWA 3MCFA 2CYYA 2FSWA 3Q91A 5JHUA 2HYFA 4F7ZA 1Z91A 1WWXA 4P96A 3SHFA 2PN6A 4BHBA 1DP7P 3MGMA 3BZ6A 3NRVA 2DLLA 4A2UA 5FSOA 4MGRA 2BBYA 4MQVA 2ELHA 2CQKA 4FX4A 3EDPA 4FT8A 4G6QA 1UFMA 1OW2A 5HVQC 2RC4A 1RYAA 4I98B 1QBJA 2ZXJA 5L3BA 4ZH4F 4MEYF 1R23A 4EM1A 2O03A 3D5LA 2VC0A 4N1UA 4AIKA 1X3UA 3MWMA 2KKOA 3VODA 4HF1A 1J9IA 2VNQA 1U2WA 3MDIA 3FX3A 3ISPA 3L9FA 1ON2A 1MJ9A 3Q93A 3ZMSA 1QPMA 1XDSA 2XUBA 2Z5UA 3KCCA 3GWYA 4L0ZB 4EJTA 1HXDA 2FE3A 3SZTA 5HLHA 5FSMA 5DUIA 1SAXA 4RB1A 3K1MA 3Q2TA 5AIQA 3KLNA 1E2XA 3GUDA 2GZWA 4N1TA 2ZNZA 3TO9A 1R00A 3WU1B 1GHCA 1YLFA 2VNPA 1LNWA 3KEOA 4LB6B 4KFCA 1WKMA 4JZVA 1V8MA 3HRSA 3N9UA 4HVYA 1MGTA 1U78A 3CJNA 5H20A 3MZYA 1MDMB 1G9QA 3A6SA 2PG4A 1O3QA 2DSDA 1O57A 3EESA 3L09A 1KGSA 2JRTA 2XAJA 4LK0F 5D6FA 1NQZA 2XAQA 4RGUA 2PJPA 2JVBA 2CG4A 2ETHA 4EV0A 3HSFA 1AOYA 1K78B 4HFQA 3M7GA 3DUPA 1VRLA 3FM3A 1W5SA 4G6DA 5F6FA 2XSQA 4HV6A 1ONVA 1YYVA 1XCBA 4BAYA 2X4HA 2DHOA 1RRSA 1U5TB 1EH8A 4G8XA 4RGXA 3WU0A 5HOOA 4YOQA 4IJXA 2XAGA 1UB9A 3RI4A 1Q27A 2XRNA 2DU9A 2MH9A 1K7AA 3KP2A 1W7PD 1FLIA 1J59A 1R58A 4A0YA 4L5JA 3HHGA 3L7WA 3X0LA 5LPGA 2V1XA 4HOBA 3REOA 3ZMUA 5DCMB 1FYLA 6PAXA 5ANWA 3GFJA 3CDHA 4YIFA 5C7TA 3EXQA 4WF2A 4U88A 4L0YB 4A5NA 4LJZF 1YS6A 5E20A 4H0EA 3K1PA 3KZZA 3GO5A 3WGHA 2LKPA 3ELKA 1K2EA 3QP6A 5E17F 3J7AO 4LMYA 3IWFA 4A0XA 4EQQA 4PZJA 3SMDA 3JAMK 4ESBA 3FMSA 5LEJA 3BJOA 3EUHA 1Z6RA 4XSXF 4ZYHA 1B9NA 4BH9A 1G0SA 1V8IA 1IXCA 4IJAA 1UHWA 2R7DA 4NQWA 2OZ6A 1KYWA 1XCVA 5L3GA 4OIQF 5CJ9A 3FSPA 1P4XA 4PDKA 4Y13A 2NS0A 3FWEA 2D45A 2GA2A 2PEXA 1MUTA 2Y48A 3C3WA 3ROUA 2A6EF 4BHCA 3IHUA 2ZMEB 2OQGA 5FO5A 4ZYDA 4GO1A 1PPXA 5FSLA 2QM3A 2MLGA 2V79A 5K5OA 5TRDA 1GVJA 2B2KA 2V1UA 5F64A 1FBSA 1GXPA 4WXHA 2GIVA 4KMFA 4BYYA 5ILVA 2HGCA 2M45A 1X84A 3F6AA 3WE3A 1Q1HA 3WODF 4C9WA 1VCDA 3CLOA 1HBXG 4MQ9F 4RS8A 2ZJ2A 4HF2A 2A8SA 1J5YA 3DPLC 2AS5F 3WTVC 3J81K 2IW5A 2QYOA 5BONA 5A2QZ 3T8TA 3WGIA 4MEXF 3ZMVA 1IAWA 5I8UA 3RIRA 3WTYC 3X0IA 2WWYA 1FP1D 1B59A 5HS9A 2K27A 3WTXC 1BN5A 3F22A 2GA1A 3ZPLA 1ZG1A 1G4DA 2A69F 1TBXA 2R3SA 1YW8A 3ACAA 3V7CA 2IA0A 2VBWA 3J80Z 4IXAA 1I1GA 4YIIA 3JSPA 1QGPA 5K5QA 2EFQA 2HOEA 1J75A 3CUQA 3D0SA 4UVCA 3Q1PA 5K1YA 1S29A 2QJOA 1EH7A 4OIRF 4HF0A 1J7KA 2PBIA 2W24A 4I01A 5E1ZB 4ASNA 3GFLA 2E7XA 4MHGA 2P6SA 3BJ6A 2KJCA 4BNCA 1R1VA 3MEXA 5BOXA 4RGSA 1OYIA 3N77A 3AAFA 3CTAA 3KP7A 2DAOA 2NRAC 1R1TA 1LEAA 2BGCA 2XGXA 1DPRA 4YG2F 4IVNA
chains in the Genus database with same CATH superfamily
2L7FP 1U8RA 3OYIA 4XLHA 3QYEA 3S3NA 1ETVA 1DU0A 2QJTA 2M34A 4FE4A 3CZ6A 3DLAA 3I0TA 3TMOA 1XMAA 1D0YA 1N25A 4RM2A 1XSXA 1W4MA 3ZQLA 1G2HA 5LGNA 1MBEA 3GFIA 2M30A 5IT9K 4P55A 1Y1WJ 4WWCA 3LMMA 2RKHA 3ECOA 4AYBA 5F1JA 1LFBA 2DK5A 9ANTA 4OINF 3Q4IA 1AU7A 4KG3A 2ACJA 1XN7A 4W1UA 1TWHJ 3EF5A 4CICA 2GM4A 2F5DA 1ORKA 1W36D 3K69A 3TDUC 3DEEA 2OUMA 2KP6A 1BI3A 1QQIA 3I5UA 2EZIA 3HHJA 2IS6A 1O7LA 1XS9A 3I59B 2XB0X 1V54H 4IKFA 1KHZA 3IH2A 3H5RA 3K1NA 3DP7A 1OCOH 1HSTA 3T5XA 2GBYA 3X0RA 2KDVA 3DFGA 3KZYA 3RKWA 2CW8A 1RRJA 1NHAA 2JA6J 3WTWC 2F6CA 4IHVA 4I2OA 4CZZA 2M3AA 1WVRA 3IL2A 1YJ9I 3OL3A 2NYXA 2XSJC 5F04A 5GHNA 4A3MJ 4A3DJ 2EZKA 1FNNA 1RESA 2CUFA 4Q5SF 3OYDA 1TT0A 3RKYA 1OPCA 1IV8A 4CGZA 2V1NA 4PFPA 4AC0A 4JZUA 2WC2A 3IP4B 1X58A 2ZXWH 2P5LC 1XGOA 3BG9A 2CJJA 1QZZA 5FKNA 3OYBA 3HRUA 3F0CA 1GXQA 2XGDA 2JSCA 2YU3A 3QAHA 4KDPA 2Y0MA 2NS8A 2XHKA 3HOTA 4EATA 3MFKA 2OC6A 3C18A 1P7JA 3FBNB 4ABZA 5D4RA 3GRNA 4O3MA 2A6TA 2DDBA 3OYKA 4NDLA 1H9TA 2QKMB 3CLQA 1RC9A 1FWZA 1LEBA 4E70A 1IN4A 4HPQA 5ICCA 3S3OA 3G71I 3H3UA 3G6EI 4UB6C 1OISA 1ZAOA 3H1CA 3K4LA 3GTOJ 1QRYA 2DW4A 3G4SI 4JZSA 1UG0A 4P9UA 4EJVA 4GCVA 1YI2I 4XKCA 3PIOF 2RVCA 3PQKA 1DP3A 3VB2A 2R5YA 4D1QA 1XD7A 1RNLA 3HSEA 1I3QJ 3HKZN 3V8JA 1SMTA 2KJBA 4CCMA 3L2QA 2VJJA 4G7OF 3OIPA 1YW7A 2PQ8A 3R6SA 1ULYA 1R4NB 3E0JB 1VQ7I 5JVGF 5KVRA 1L3LA 2RQQA 1YJWI 1ZH5A 1XB4A 4B3XA 3FXQA 2J8QA 1VQOI 2JK3A 4JQFA 2ZXHA 2HFHA 3F3XA 3RTRA 1VQPI 1HOMA 3F23A 3X0PA 2LNBA 5ILUA 4M9ZA 3FJYA 2O5FA 1X19A 2XPVA 3BM4A 2J5PA 1JHHA 1G3YA 3MCZA 1RZ4A 3LSMA 3GXOA 2HS5A 2DXIA 2PQVA 2O7OA 1XG1A 3H36A 3ZRGA 2H6CA 1VIQA 4UVAA 3Q9VA 1Z9CA 4BQQA 1PUFA 1KTGA 3HRMA 3AG4H 4E7SA 2FA5A 3BT9A 3EEUA 3DF8A 1QZYA 2X6XA 3HUGB 2EH3A 1PUEE 3KVHA 1JGGA 3DXJF 4KMUX 3HOSA 4CYCB 4QIWN 5J40A 3S2WA 4ZYGA 3KYCB 4LG0A 4BXXJ 1D1AA 1X51A 3X0JA 2PFBA 3GCMA 2ZCWA 4IRIA 2Z3YA 2IXSA 2L2OA 3H5AA 5DEQA 5DUKA 1PUSA 2DOEA 3L2UA 3WTTC 1VHZA 4LIVA 1ON1A 4M71A 2IEKA 3FK9A 2FU4A 2HOAA 2XAHA 4P9FA 4ON0A 3VSLA 5IOYA 3X0SA 1FBQA 2NNYA 1Q33A 1TW3A 1HLVA 3GTLJ 3JRCA 2X6YA 1Y8QB 3ZMTA 3U9GA 3K2ZA 4E7HA 4NC7A 3L2CA 4KTBA 4N4NB 5F0CA 4AVPA 3TL4X 3OYFA 1W7PB 2TRTA 3DV8A 1QHGA 2BY1A 2VN2A 4HLXA 1VF9A 1JUMA 4BBSJ 2E1MC 2DT6A 4BXUA 2XPWA 2H6BA 1L0OC 1QHHD 1C0WA 4P5OA 3I7UA 4F93B 4ICKA 1Y8RB 3MD2A 5ERIA 2R5ZA 1JRKA 4KICA 3OSGA 4LLNA 3QYFA 4DBQA 1JUSA 3HEFA 1NK2P 4I7HA 3HXLA 4B44A 3CCEI 2LOOA 3CD6I 2XVCA 1DPUA 1U6GA 2HKXA 5BNGA 4JX4A 1QNTA 3I58A 3R0JA 3OS1A 2M8GX 3E3VA 4BKXA 3W6VA 1IUYA 1TL8A 5FRMA 2C6YA 1XSVA 2JN6A 5HNHA 2BHZA 1AKHB 1U3EM 1VC9A 3K2AA 2W85A 4BEHA 3KP6A 4WK8F 3OYHA 2L7MP 2BHYA 2MD5A 4A12A 3KIOA 3CMEI 4I09A 5E8IA 4HX4A 2EV6A 5CLSA 1R71A 2D1VA 2XC7A 4DBRA 4XQFA 1FPQA 2XGCA 1UHMA 3EUAA 4K2EA 4S2XA 1HF0A 1S6LA 2OD5A 3FDYA 1LDDA 1V8WA 3P5JA 3PJRA 1P9QC 3CNGA 5L3EA 2EFWA 1ZLKA 2A5WA 3PFIA 2ZNYA 4BXFA 3P9KA 3BOQA 2VE9A 5D5VB 4BQNA 1MD0A 3U1DA 4A69C 2FNAA 3L85A 2YPRA 3UKGA 4ESFA 4ZC3A 5C4JJ 3J7Ye 3F8BA 3ZGKA 4ENNA 2EK5A 3S3MA 3CCMI 4C2TA 1U8BA 1FIPA 5IY5H 3N4MA 2MFZA 3X0OA 2CQ7A 1JKNA 3P9CA 5HDNA 1BR1A 1ZGWA 2EA2A 2ELJA 1X2MA 2DODA 4D5CA 2CV0A 2DBBA 3CP8A 3DWLE 3OV8A 4S2WA 1SD4A 1ZKGA 3H0DA 2GLOA 3SDBA 2M7BA 5FB2A 1WH5A 2LD5A 4DZJA 3ERMA 2BY0A 2VC1A 1KONA 2WAFA 4RB0A 2E2HJ 2L3DA 2F4OB 1TNTA 1Z6TA 2FOKA 1VK6A 1MSEC 2A8QA 4KG4A 4PJNA 2P5KA 3HHHA 3ID9A 1HW5A 1B9MA 1PUNA 3QODA 2H94A 4BBRJ 1SD7A 1FIAA 1SZ3A 4RA2A 3R61A 2IJLA 3GZ6A 1JKRC 3OGAA 2YX4A 1VFCA 4DZPA 3CCJI 1XSDA 1JE8A 2QBYB 2DMUA 1F9NA 2F5CA 4BJTA 3EUHC 3AL0C 2XF5A 1XMKA 2VB6A 4QPQA 4M6VA 3ZCOA 1FZPB 4I02A 4MTEA 5HDKA 4BQAA 2E1MB 2GOXB 2PI0A 1B1BA 1R67A 4U0VA 1J2XA 1MIJA 1ACIA 2LY9A 2WTEA 3RQ4A 1KU3A 4EGZA 4CXFA 3S2DJ 2FKBA 5IP6A 2QEXI 1MBKA 4GYIA 2MA3A 3ASOH 2IA1A 1OFCX 3E6DA 1SFUA 2FBKA 3M4OJ 4L18B 2PLYA 3M3YJ 2OCCH 1U5TA 1D8JA 3EQLF 2YVOA 2ZFWA 4ETSA 5EEHA 3HJEA 1NK3P 2Z2SB 3GTMJ 1RKTA 1FC3A 2LDUA 4U87A 2IGOA 2E5NA 4O6JA 4X0GA 3HTSB 1O3TA 2FVVA 1V8NA 4M73A 1B6AA 2PMZA 5M5WJ 3SFIA 4QLCU 2FQ4A 4PJMA 2BXZA 2HEOA 3MZ8A 1WJ5A 1Y0NA 3ZN1A 1JJ6C 2EBIA 1MSFC 2W57A 1PP8F 1IXSB 3WE2A 5LGTA 2X48A 4ZDOA 3FM5A 1KQ0A 5DCMA 4A3IJ 2CV1A 2LF7A 2DSCA 3F6VA 1YITI 5GPAA 1SFOJ 2KIMA 1H9GA 5J1YA 3FCMA 1VHGA 3F8NA 4RAYA 3I53A 3FF5A 5EEGA 1TT5B 5HS7A 3WHCA 1P7IA 2JPCA 1T98A 1W5CC 3O61A 1ZG3A 4XSZF 1DUXC 3FK6A 3I4PA 1PP7U 4FX0A 3FBIB 1A31A 3GVAA 2B06A 2IP2A 2L0KA 2ZXIA 3WG9A 5FLXZ 4KN7X 5FGMA 5C8LA 1DDNA 1P4WA 2Z33A 3NAUA 3FXJA 3HIFA 4ANJA 1J09A 3KP3A 1RETA 2STTA 2Y0SA 1IRGA 1DGRM 1R9TJ 2HVQA 2MD0A 5JLWA 4RB2C 2M1BA 3F8CA 2V1DA 1WPKA 3RCOA 1IN6A 3LSHA 2R7VA 1TW2A 2Q9PA 2ZJQF 2DJNA 2QZ8A 1SD6A 2WB1A 4OMZA 5E3NA 3E6CC 4I0BA 3BDDA 4U7DA 2LH9A 1Z0XA 4AIJA 3R60A 4A3CJ 2BEOA 1FYKA 2JSPA 1A04A 2X6WA 4AYBN 2OTLI 1JI8A 3K7AJ 3NWSA 1V8SA 1BR4A 2CO5A 4Y52J 2E71A 5CVJA 1LVKA 5D5WB 5IP9J 4N9IA 1ETKA 2X9DA 4M3FA 1FYMA 3CC4I 3E1SA 5KK1A 2E1NA 2LRDA 5ANVA 3AL0B 5EG0A 3CUQC 2V9VA 4RB3C 4UUTA 3QOEA 3CCSI 3S1RJ 2EQRA 1MK1A 2EIKH 1USTA 4XLPF 2KZVA 2QKLB 3LSJA 2CGPA 3TP0A 2ZMEA 2HKOA 4PJJA 3OYCA 4UNOA 3BJAA 2AZWA 4PGHA 4NQWB 4U0WA 5BS6A 2OTJI 3X2QH 4YFXF 2COBA 1V5EA 1X4PA 3A01B 4FHTA 5DDGA 3GFMA 1MH4A 2EWNA 3E5UA 5ICEA 1VQMI 1QPIA 2K85A 1XMXA 4V2FA 1MH3A 2R5WA 2F2EA 5EF6A 2H09A 2GQQA 3FHNA 3B02A 2M0MA 2NVYJ 2GXBA 4GGGA 3BTIA 5JI6A 2MLKA 1HKTA 4JZTA 3LA3A 2ESHA 2KL4A 5EEAA 5LHHA 1K6OA 2A8TA 3DBLB 3RYRA 5JHFA 3CO6C 2KIUA 3IKTA 2V6EA 1R5HA 4HDVA 1HKSA 4H4KC 4AM3A 3QRFF 3H92A 3SXYA 2ISZA 2NVUB 2O3FA 3M9AA 3AC9A 2DOFA 2JZYA 2VJ4A 2XGEA 4QTRA 3LA7A 4HEA2 2Y9YA 3L2VA 2X1DA 2BV6A 3FMRA 3CF5F 1MR2A 5M3MJ 5B1BH 1T38A 2O8XA 5DD4A 4ZYEA 1SOIA 4YPRA 3I55I 1XGNA 4TV7A 4B43A 3KYLA 2K9SA 1O7FA 5JVTA 1U20A 3N05A 1JHFA 2G74A 3LSRA 4EJUA 3ZP5A 2CS3A 2ZSHB 2ZKZA 4A6EA 1NH3A 3LQRA 2WAQN 5CVVA 4S04A 3JTGA 3NARA 1GT0C 4F91B 5K5RA 1O3SA 1G6NA 3HSRA 4HX8A 3JRBA 2HZTA 2K3FA 2Y2ZA 1FX7A 2VXDA 2Y31A 3ULQB 2DK8A 3QPLA 4HDUA 2MC3A 3X0MA 3HDDA 2EJRA 1MMSA 1BIBA 1PYVA 4AVZA 2EPFA 4XLFA 3IC7A 4EM0B 3LSPA 1XPXA 1K6YA 3HOUJ 4CSWA 3FMQA 1ZELA 1K61A 2RRKA 4G94A 1GV2A 1MW7A 2CW0F 1MQEA 1LB2A 1FJLA 1G3WA 5FSKA 1X1DA 5JFRA 1MKMA 3DLLF 2KHMA 4KYXA 3HM5A 3OR1C 2WV1A 4HNUA 2VKVA 3ONQA 2OJED 4UV9A 3A6VA 1KA8A 5CVUA 3TO7A 2UUZA 3BCAA 3T8RA 2OQRA 2EILH 3HC7A 1TQMA 1UZCA 1WH7A 2YX7A 3ERED 4KYWA 1HSJA 2E19A 3JRHA 2P4WA 5C3EJ 1KU7A 2VOOA 3OS0A 5EGOA 3BR5A 4B8XA 3S1NJ 4I0AA 3ABTA 5M3FJ 5ED4A 2Y9ZA 3C2HA 5EJCA 3B6AA 1VQ5I 2EFOA 2RAEA 3MN2A 3SEZA 2CSOA 2MYSA 1XSAA 2DT5A 1LUJB 4BGDA 2YR2A 3IRQA 3CUQB 4ENKA 2KDZA 3O8GA 1CF7A 4UVBA 1A36A 2EV5A 2H1LA 1JXSA 5GTHC 4FTHA 1I39A 2L7KA 3UR3C 2VPRA 2YVNA 2XKPA 2HU9A 3HPHA 2FOWA 4IHYA 3P6YA 2L9RA 1QZEA 2Y69H 2LKSA 2E60A 2KISA 2CUZA 1ZRCA 1OYYA 2KIQA 2VONA 1AWCA 1VIUA 3E57A 3RYPA 5BMZA 3G73A 1YIOA 2AQEA 2GIZA 3E5QA 4YEJA 3OS2A 4UXNA 1BJAA 3DKYA 3IH3A 2LBFB 3V8LA 3PSIA 4HNTA 1BBYA 3MKZA 1ZRFA 2P7CB 1VTNC 4YFKF 5J1UA 2FUG2 4DYCA 4II3A 5J6XA 3Q2SA 2QSHX 3MZHA 1H89C 2Z1DA 3RDIA 1WJEA 4M3EA 3JRFA 4PGGA 1MMGA 3HOVJ 5FSIA 3CJTB 4Y3OA 4YFNF 2LC2A 2DFIA 1OMIA 4R79A 4N0BA 4XOTA 4IHSA 1WI9A 1T39A 1STZA 2A07F 2DT7B 3WTUC 2FXAA 2ECBA 4L5IA 1Q27A 4O5VA 1Z67A 1RUNA 4Y17A 3G2BA 3KX2A 2M8EA 2GXGA 4IOCF 2ZFUA 3DKXA 2K7LA 5CVRA 2MC4A 4UY8I 2XRLA 3RZOJ 2KDOA 1ZQ3P 2MW8A 4FISA 3K0LA 4QPOA 3DKWA 4L9VA 1LQ1A 1I1SA 1T6SA 4AUXA 2DQRA 3WTSC 2VPLA 1Z3YA 1DU6A 3S93A 3N97A 1BOBA 4ZZDA 2O61A 1IN5A 1RKWA 4GXOA 4A3GJ 2A8RA 3F13A 4EM2A 2O8KA 1R5ID 4PK4A 1Y0UA 5B66C 4CCOA 2D1HA 3AG2H 4S2VA 2R4GA 2JA7J 2HDCA 4LD5A 1B72A 1PPVA 2QQ9A 4Y33A 2FEZA 4C2UA 3FXUA 1ZR2A 4B4CA 1OQYA 2BYVE 2M4KA 4RAGA 3TP3A 1EJ9A 3TDZC 3NWTA 3X0NA 2HTSA 1JKQC 3BQZA 4HRIA 3I56I 1JT6A 1UAAA 4XR6A 2K3PA 5TJJA 4CZCA 4HSTA 2QENA 1RIOH 2EIJH 4XRSA 1T8IA 2YS9A 2R93J 1RRQA 1IGNA 3O52A 4DGWB 1BOAA 2DOAA 1K26A 1H0MA 4A0ZA 1RI7A 4MTDA 5KAIC 1I50J 5IW4A 2JPBA 2HYJA 1H88C 4N9HA 4HZFA 4ZTFA 2V9KA 1MNEA 5IYCJ 5E1XA 1D0XA 2Y75A 4BE0A 2R7TA 2WAQA 2GWRA 5DD8A 2KRHA 5BPDA 1IC8A 2WA0A 1TWCJ 3P7NA 1BI2A 3CDLA 1PPWA 2F5EA 1YFHA 1R36A 3PUFA 1XDUA 5GHJA 2PX9A 5EZHA 2PJRA 3KE2A 2DA1A 1KQ9A 2F4MB 4XRFA 1X1BA 3CQZJ 1UJ8A 3COAC 3O3KA 2B0LA 2L7ZA 3U21A 3HBLA 3HB9A 1IV6A 2NAZA 4PCQA 4EJOA 2L9SA 1TQPA 2DA6A 4MO7A 5HLGA 3F21A 1AA7A 4PFOA 3C7JA 4CCNA 3J7YJ 2CU7A 1USSA 1E3OC 3GZNB 5IPAA 5GP9A 3KP4A 2Q1ZB 3ZQGA 1NG7A 3RJPA 3CO7C 5DPKA 1R49A 2HYGD 1VZ0A 1TC3C 3MDGA 2E7WA 5FFZA 4C3IJ 1FY7A 3U53A 3KP5A 3CCYA 2I6KA 3RSNA 4IRGA 2BE5F 5HLTA 4IQJA 3I71A 1OCTC 4HQEA 1TWAJ 4RLFA 3JTHA 2O5WA 1U0JA 2FMLA 3HPGA 2QF7A 4NHJA 2IT0A 2R7ZJ 2XB5A 3JW4A 2JVGA 4UUSA 2I8UA 1IN7A 3P5TA 2JT1A 2ICKA 1R4MB 2DYSH 1R5GA 3KPHA 3JRAA 3JRIA 1O3RA 3E97A 3JAMZ 1J0RA 4OAZA 1ZLJA 2KLOA 3VDXA 2G9WA 2ZO4A 4ZJZA 3O69A 5J8CA 2L02A 3KETA 1Z05A 2DMQA 1PUFB 1FSEA 1HZTA 2YVPA 5CPRB 1KU9A 2R7WA 3BPXA 5FFXA 1YE9A 2CFXA 4MPOA 1HX3A 3VSKA 3DEUA 4KT6A 2I10A 3HTUA 3QYBA 3W6KB 4V14A 4JK1X 1YQAA 1V8TA 5J4VA 4QWQA 4LG0B 2ZBKA 3ZR1A 1E3HA 2CMPA 1YO5C 2EV0A 4DYRA 4U0YA 3MVPA 2PMZN 3ZQFA 3FKIJ 3S2HJ 2NOGA 1G59A 4UHTA 1JUPA 5L3DA 5A2QK 3Q0VA 2RDPA 1LPQA 5LGUA 2OF7A 4KIBA 4M3GA 3OY9A 4ENJA 4A6DA 2E35A 2YYHA 2V6CA 3M1CA 1D8KA 3VWBA 3JCUC 2R7FA 1UMQA 2K4JA 2A68F 2QWWA 4C2MJ 1ZN2A 1S7OA 5D6EA 3ZR0A 3VYTB 1F4KA 1ZK8A 3E6BA 1GUUA 3FHZA 3FXMA 1XSCA 3FXRA 1NFSA 4XLNF 5E18F 1FEXA 1TUMA 1ZTRA 1ETWA 1V3FA 1HC8A 4YPHA 2A3SA 3PQJA 4S05A 4CHUA 4RMNA 1GA7A 1BJZA 3DTIA 2LTPA 2LSOA 3HRTA 2H8RA 2NOJB 1FBUA 3J80K 4A3JJ 1MBJA 2O9LA 4UUVA 3H3VK 3TO6A 1Q1VA 2QSGX 2LREA 2R5ZB 2IS4A 2LF8A 3IWZA 3E5XA 3NQOA 2Y0SN 3SFZA 3V8KA 2R7QA 4Z6YA 1WZ2A 4ZYAA 3RPUA 1FOYA 1TP4A 4HW0A 5F08A 2ZJRF 1G8XA 4JBAA 2UXNA 2KRFA 1JKPC 1U5TC 5IT3A 4BS9A 2XF7A 5KCMA 2W82A 4IHXA 3HOXJ 3J81Z 2M5WA 1ETOA 1V8LA 2EB7A 3EUKL 1BIAA 1NG6A 2HZDA 4XBFA 2WB1N 4DIQA 3RZDJ 1TLHB 4CDGA 1HW2A 2MH2A 4KIGA 1FMVA 2CRGA 2Q8KA 5BPIA 4KJZA 4KISA 1WJDA 2JQ7A 2H27A 1F5TA 3M07A 1JGSA 2MABA 3S17J 3GEZA 2A8PA 3W2VA 3LOCA 5DV5A 3CCQI 2STWA 2DUKA 2HQRA 1YJNI 1EV7A 2A61A 3ML6A 5ICFA 3IAS2 4ITVA 1B4AA 1LVAA 2AQFA 3PSFA 3HL2A 1EA3A 2FBIA 4BJ5C 4Q47A 1VC8A 3H0GJ 3KEYA 1HA8A 3R4KA 1U9OA 4F52A 3LNQA 4LLGF 2V4JC 2NS7A 1SMYF 2JWTA 3GLXA 5FRNA 5E3LA 1ETQA 5EYRA 2RNJA 2ECCA 4XOPA 1VQ4I 3FXOA 1MNDA 2ICJA 3GZ8A 4IHTA 2AHQA 3UNGC 2JVHA 2VBXA 3HZJA 3QPHA 4M6XA 1WHUA 1WI3A 2OCEA 2Q0OA 3GWZA 3KEQA 2I8TA 2KDWA 4OMYA 2ICWG 2D2WA 1QA6A 3OOPA 2QUFA 4JOMA 4A3BJ 5HZXA 2NVQJ 2PNYA 3GG6A 4GFBA 3V7RA 3EYIA 3WG7H 5CFIA 2A5YB 4HQMA 3W6JB 4KUMA 1CGPA 2NXNB 1RUOA 3KZIC 1GV5A 4ZDLA 3SEQA 4ILQA 4K6EA 2OBPA 2QBYA 1KT9A 1S8NA 3VYRB 1MDMA 2VQHA 3IH4A 3VEPA 3B73A 4BACA 2DI3A 2E5ZA 3JSOA 2Z99A 2IGKA 3AKZA 3G0QA 4V2GA 3D1NI 3BZCA 2K40A 1IUFA 2RQPA 3BPVA 4G9YA 3DBRB 1UCRA 1YTYA 2BW3A 2CW7A 1LJ9A 2G7HA 1X3WB 2R92J 3HOYJ 2QLZA 2HWVA 2EFNA 1K78A 3CMYA 2GB5A 2DQLA 2W84A 1WRJA 5D8LB 4NB5A 5E8GA 1SD5A 2KFDA 4CA0A 1R7JA 2QGUA 3E6MA 1A35A 1IRYA 4CYDA 3OOUA 1P6RA 4BY7J 1BC7C 2VKEA 3DCFA 5IT9Z 3X0KA 2LR8A 3ZN0A 3K10A 5D5UB 1SEUA 1X2NA 4R1HA 3HGGA 4HA8A 3DU6A 4KT5C 2R7RA 2G73A 4Q48A 2M0CA 2CUEA 3GF2A 1TWFJ 1FSHA 3GX4X 3LA2A 4I99C 2DO7A 2ZMEC 3OL4A 4L9NA 4ZG0A 5D4SA 2YVMA 4M3DA 1D0ZA 1I5ZA 5AIPA 3LSTA 1XGMA 3FK7A 3H95A 3A2KA 1T56A 5D8KB 4A5MA 2K86A 1LE8A 2COMA 1K4TA 2E1CA 2FNPA 4AIHA 1X3ZB 4B09A 3PO3J 3I7VA 5CVIA 1V8VA 2JA2A 3CUOA 2UXXA 4G12A 1IO2A 3EETA 3DKUA 4C3HJ 4NNJA 3TGNA 1IN8A 3A4CA 4V19K 3F9KA 3L1PA 4I76A 3H3ZA 1S7AA 2X1CA 3OIOA 1O4XA 1S9HA 4EVIA 4LG3A 4RBOA 3I9XA 3KFWX 4LFUA 2DTRA 1LKXA 1Z21A 3H5NA 3K9TA 1OLTA 3L00A 1OCPA 3PIPF 3CCVI 4HLYA 1BR2A 1Z77A 1TTYA 3QU6A 4G6TB 5LHGA 5LBQA 2H8WA 3M8JA 4A93J 1P4AA 2VXZA 5D5XB 1PVEA 3BG7A 4E6KG 5FD5A 4X6AJ 4IEJA 2GT2A 1LDKB 3RH7A 4JX6A 3A03A 2CUJA 3WHWA 2IPQX 5KHDA 1QVUA 1V4RA 2ESNA 5FKMA 2UWMA 5GAHJ 1HKQA 1X1AA 2KQRA 1R22A 3GZ5A 1ODDA 1YRNA 4P1WA 2OAZA 1SJYA 4DJAA 4C30A 1BC8C 4J19A 2XAFA 2DJIA 2XF6A 3BROA 5JLXA 1ERDA 1N75A 2W4EA 3NEUA 4JP0A 3TKYA 3T1BA 4E4HA 2DA4A 4XONA 2QQ8A 3OYAA 2BY3A 5FLMJ 3FXLA 3LSIA 5EDNA 4E7JA 2WV0A 3RPUD 3DTEA 4C9XA 4J01A 3FZVA 4GYGA 4BE1A 1KU2A 3W3CA 5ANSA 2B7EA 5IW5A 2QQAA 1W0TA 3VFZA 3BG5A 2FMYA 4WCGA 2HDWA 3V7SA 3ZMDA 1QVTA 2CWEA 2VOPA 3SONA 3VOEA 3G3ZA 1VQ6I 2XROA 1MJBA 2M9HA 4M72A 3ZQ7A 4KIFA 5L3FA 4LK1F 2H1KA 1ETYA 1SFEA 2CQQA 4XKWA 2FD5A 2K9QA 3P9IA 4U7BA 5IOZA 3FIWA 1ZYRF 2F5FA 2LP0A 3R03A 2AO9A 4OU0A 5K7HA 3A01A 1WJAA 2Q2EA 3ABUA 5TISC 1T2KA 2AXLA 3L2WA 4EGYA 3GLLA 3BLYA 2TDXA 1P92A 2VE8A 1EH6A 3J7ZI 2FJ1A 4RAZA 3FFUA 2FRHA 5EG0B 3BTCA 2GT4A 5F27A 5F1RA 1R6RA 3Q5FA 3ZQQA 3A6TA 3LQQA 4DNCA 3IAM2 2DA5A 3MKYB 1IW7F 2V26A 1Y39A 1V5FA 3QQAA 2IA2A 1HW1A 2BY2A 2XKOA 5GADJ 4S2YA 1XC5A 2GOMA 2J5OA 3ECHA 1SVOA 2X6OA 2XASA 2BVMA 1IZ1A 4M9XA 1Y6IA 4HBLA 4IRHA 3U2RA 2B9SA 2HQAA 4NC8A 1P2FA 2PMHA 5F0FA 4HAMA 3RQIA 1BL0A 3JR9A 1R1UA 1VI0A 2VQLA 3I3LA 3Q0UA 4XMYA 1UHSA 1BI0A 5IYBJ 1ZRDA 3TOBA 1PUQA 2VODA 3BHOA 1MMAA 3WTZA 2OZUA 5DCFA 1SFXA 4IHWA 3ZQHA 3BP8A 1MP2A 1B8IA 1F1ZA 2BXYA 3BR3A 2HOTA 3BC8A 2K9NA 5LFAA 4NFXA 1MBFA 3C2BA 3ZQCA 3O2PE 3V42A 1X1CA 2L9VA 1BI1A 4MFEA 5E3MA 3DTKA 1TQIA 5C4XJ 3I4NJ 1XGSA 2HTJA 1FT9A 1IRFA 1YG2A 3VYUB 2RN7A 3H9QA 3TQNA 4KNYA 1Z7LA 1LFPA 1YW9A 2Z9OA 1JJ8C 3M8EA 2YSRA 5GHMA 4LB5A 2Z16A 3M8FA 2W00A 2IVMA 2VJIA 1K83J 3DBHB 4OIOF 3I64A 2QVOA 4ZZLA 3AG3H 4UB8C 2EFPA 3O6ZA 2JJ7A 1X4OA 1ZREA 1ZARA 4HX7A 1OR7A 5AONA 5LRSA 1E3PA 2TCTA 4FCYA 4CUGA 1ITYA 2QCOA 4XRMA 4XIDA 3K6GA 2E2IJ 1VQKI 3M1EA 2P8TA 3CJRB 4CCKA 2JA8J 3HGYA 4PSXA 1XX5A 5H6QA 3Q9SA 3C1DA 2DPDA 1KZHA 3QSJA 4XK4A 1LDJA 2R7UA 2P7VB 3VPRA 2W7NA 5LRRA 4IF4A 4BUPA 3DQVC 3ABMH 4PUSA 3U1KA 5DM7F 2V7FA 1FOKA 4DOZA 1D5VA 3BAPA 4Y7NJ 2A05A 4RDUA 5C7QA 2VQGA 3D5RC 1YS7A 1GLNA 1TZLA 1NFZA 2LLKA 3MAJA 3ZOBA 5LHIA 2VL8A 5LEKA 1PDNC 4XM3A 4IPAA 2IS2A 1XSBA 2ADUA 4RAFA 4ESJA 4G7ZF 2DFFA 2BOLA 2L54A 5ILSA 4KN4X 1REPC 1Y56A 5EGOB 4EJWA 4BL0B 5J8FA 2CL3A 5JR3A 4CH7A 5HS8A 2LG4A 3K4BA 4NC6A 4WXCA 1K79A 3OYLA 2KIFA 4M6YA 3H9GA 4R8HA 3DU5A 4GRIA 1S5LC 3QPTA 1CF7B 2F5VA 3PNVA 2G7UA 2DA3A 3B6CA 1GVDA 1I27A 2NNNA 3SHDA 4OAYA 3K4KA 2QQBA 2L01A 3I59A 2OU2A 4FETA 1I9AA 2JTVA 3LAJA 2WAEA 1HQCA 4Q4ZF 4EEFG 2A6HF 1ZHFA 2DFEA 5FSNA 1MZBA 4HG2A 2JA5J 3V4GA 2VT2A 3GTPJ 4Y15A 2VT3A 1T08B 5DTDA 4FQGA 3X0QA 2K4BA 4IOAF 1ZGJA 4EMSA 1OKRA 2VBYA 4UV8A 1MJAA 1FTZA 5CFJA 1I6HJ 2L4MA 1S7EA 4GDFA 1PJRA 5GAGJ 4M74A 4NBQA 4ZDPA 3SJMA 4RGRA 3K70C 2VLAA 4HYEA 2LK2A 2RGVA 5DM6F 2O6GE 1KQ8A 3LAPA 4Z2YA 2HI3A 4AIDA 3BZKA 1T0FA 2KRCA 3PL8A 1KYZA 5ANTA 4IL6C 5ANUA 3TOAA 4BDYA 5DYMA 2L4AA 2GAUA 3MKWB 2DYRH 1SAUA 1TWGJ 3O6BB 3Q3SA 4MNUA 2LY1A 3A6UA 3GW2A 2DMTA 1PVFA 4LITA 1QVJA 4AU7A 4WX9A 1MQWA 1Z7UA 3F8MA 3LSKA 3O8HA 5ICGA 1F43A 5TGTA 1V8RA 4L9TA 2HOSA 4DW6A 4YIRX 3TW6A 2W25A 3JRDA 3S15J 1VQ9I 1WGXA 1ZG5A 5FLXK 1Q54A 2IRFG 4L9JA 3T0YA 2VIXA 1G3SA 3SZPA 4KA4A 1B72B 2EZHA 3DPTA 4BE2A 2DMNA 5HLIA 3ZR8X 3A1YA 1T33A 1IXRC 3OYMA 3O8SA 1SANA 1G3TA 5E1WA 4C9YA 3DEWA 3HYQA 3SZGA 3LWFA 3GYHX 3ABKH 1S3JA 3COUA 1OJLA 1MBGA 2HQNA 1BM9A 4X1EA 2ID6A 2JRMA 3A0BC 3S1MJ 5GHOA 3LFKA 1WSUA 4AD9A 4F3QA 4CCJA 5H6RA 5GTIC 1UELB 2K02A 1SU2A 1QO0D 2EA4A 1A5JA 2MBFA 5BQTA 3BY6A 4OIPF 3IKVA 2ISYA 5ISYA 3R0AA 4OOIA 2VASA 3MQ0A 3BTJA 2WY8Q 4KITB 3ASNH 3HYIA 3PO2J 2P5VA 4DQ2A 5J1RA 2IBDA 2VBZA 2UZKA 5B3SH 1NTCA 4NFWA 3QU3A 1V8YA 5J4YA 5GHIA 2R5YB 4E7KA 1RPWA 1U9NA 2P6TA 2HR3A 3VYSB 2DFHA 3F72A 4A3LJ 2KT0A 2PJRB 4IQ4A 3BR1A 1E17A 1SVMA 2DSBA 1Z1DA 4HNVA 4XN3A 2XDVA 4J7HA 3CCLI 3HUGA 2X0LA 2CQXA 3QOPA 1ETXA 4XNFA 4F92B 2RV8A 1V8UA 5FD6A 4CYCA 2B0VA 1X83A 4IZZA 3I54A 2O0YA 1MMNA 4DYWA 5C44J 3QP5A 1BA5A 1X1PA 1D3YA 1OYWA 2FF4A 2VJ5A 3CC2I 1HDDC 3BCBA 1YHQI 5FLVA 4XLAA 3RKXA 4E7LA 3F8FA 1XTAA 5CYVA 3GBGA 5L3CA 5M5YJ 1BW6A 1W5TA 3F6OA 4HV5A 1EKEA 3KLOA 3PUBA 1NQYA 4JYKA 1ZGAA 4D0PA 1V5GA 3SQNA 3WGGA 1I6XA 2F4IA 3Q0WA 4BY1J 5HDGA 3MKLA 3WU2C 4XLEA 3BG6A 3PNYA 2M7AA 1F3YA 4G7HF 4UUSB 1OCCH 1K4SA 2OA4A 3JRGA 1GDTA 5HODA 3GTKJ 2XIGA 1TNSA 5HNFA 2O1CA 1W7PA 4A3FJ 1WQ2A 3TBIA 4LLLA 3RPQA 3EYYA 3ZMZA 2FBHA 4AWXB 1ENHA 2E34A 3PM1A 3GTGJ 2XV4S 3BWGA 1AHDP 2DPUA 2IGNA 2OV7A 4D5FA 3IRRA 1QU3A 1HCRA 4CO8A 4Y4RA 2PMUA 2ID3A 3S16J 2IGMA 2FQ3A 5J3LA 2B63J 1WFXA 4WXDA 4BHPA 4RM3A 1JT0A 1IF1A 3CC7I 5LLQA 1SC7A 5IYDJ 1FP2A 3GTJJ 2YU9J 5GHQA 4E7IA 1AKHA 2EIMH 4ENMA 1A6IA 2VKHA 4M9SA 1E0EA 5KAFC 2M87A 4LGWA 3OYEA 3MCFA 1YOVB 5CKTA 3CF2A 2CYYA 2FSWA 2Y30A 3LFUA 3Q91A 3K4JA 4PJLA 5JHUA 2ZB9A 1VNDA 2HYFA 4PJ0C 1Z91A 1WWXA 2P81A 4P96A 2PN6A 3SHFA 4F7ZA 2RNGA 4YELA 2KZGA 4BHBA 1DP7P 3MGMA 1WCMJ 2NVXJ 3BZ6A 3NRVA 2DLLA 4A2UA 3G1MA 5FSOA 4IO9F 4MGRA 2BBYA 4MQVA 5LD2C 2ELHA 2CQKA 4XL9A 5IP7J 4FX4A 3EDPA 4FT8A 4XN0A 2D5VA 4G6QA 1UFMA 3IUOA 1OW2A 3MMYB 5GPCA 2LVSA 5HVQC 2RC4A 1RYAA 4I98B 2O5RA 1QBJA 2FX0A 4BEHB 2CQNA 2ZXJA 5L3BA 2CFOA 4ZH4F 2IS1A 3BR2A 4D7NA 4A3EJ 4MEYF 1R23A 4EM1A 2O03A 2R7SA 1WJCA 3KYDB 2X51A 2CV2A 3D5LA 2VC0A 4N1UA 2KPMA 4B47A 3LSGA 4AIKA 2QA4I 1X3UA 3MWMA 1RR8C 2KKOA 3H35A 3VODA 4I6ZA 2VKDA 2WBMA 4HF1A 1J9IA 2VNQA 1U2WA 2HXOA 3MDIA 4D7MA 2MGQA 3FX3A 3ISPA 3G1LA 3L9FA 1ON2A 1WJBA 1MJ9A 1H8AC 3Q93A 3CP2A 3IV5A 3OYJA 1MBHA 3H9JA 1FOWA 1QPMA 3ZMSA 1IG7A 1XDSA 2XUBA 2Z5UA 3KCCA 3GWYA 1FOXA 4L0ZB 1IRXA 2UV1A 3S1QJ 2IAIA 4EJTA 1HXDA 2VQCA 2FE3A 2YUSA 5FKLA 3SZTA 5HLHA 5FSMA 3HG9A 5FKKA 5DUIA 2I8DA 4II2A 1N78A 1SAXA 3BTLA 4RB1A 3HKZA 3K1MA 3Q2TA 2P0WA 5AIQA 4L5EA 3OYNA 3KLNA 2V9PA 1E2XA 2RREA 2K5CA 3GUDA 3RKQA 2GZWA 4N1TA 2ZNZA 3TO9A 2ME0A 1R00A 3WU1B 1GHCA 1YLFA 3FISA 4S0HB 1LNWA 3KEOA 2VNPA 5F0HA 1SFKA 4MFDA 5J47A 4LB6B 4KFCA 2E1OA 1LFUP 2KMUA 1WKMA 4JZVA 1V8MA 3HRSA 1W1WE 3QPSA 3N9UA 2R7OA 2EINH 3DPUA 4F55A 1M1EB 4HVYA 2ZC2A 1MGTA 1S72I 1U78A 1V55H 1W36C 5M5XJ 3CJNA 5H20A 1N77A 3MZYA 1MDMB 1G9QA 3A6SA 2HXIA 1CQTA 2VI6A 5E79C 2PG4A 1O3QA 1JKOC 2DSDA 1O57A 2ELKA 3EESA 4ZTJA 2JUCA 3L09A 1KGSA 2JRTA 4LIUA 2XAJA 4LK0F 5D6FA 1NQZA 2XAQA 4RGUA 2PJPA 2JVBA 3L2RA 3ZXSA 3ZQIA 3JREA 3AFHA 2CG4A 2ETHA 2X1EA 4PSWA 4XLCA 2BW3B 4EV0A 3HSFA 1AOYA 2HPIA 4M3BA 1K78B 3K70D 3LL7A 4HFQA 3M7GA 3DUPA 2XSDC 1VRLA 3FM3A 1W0UA 1W5SA 4G6DA 5F6FA 2XSQA 4HV6A 1ONVA 1YYVA 1XCBA 4BAYA 1RR7A 2X4HA 4BQOA 2DHOA 1WJFA 2LYCA 1RRSA 4E7ZA 1U5TB 1EH8A 3S32A 4XICA 4G8XA 4RGXA 1OCRH 3OIQA 3WU0A 5HOOA 4YOQA 4IJXA 2XAGA 2XPUA 1JTXA 1UB9A 1SVLA 3BG3A 2WY7Q 1DQUA 2DU9A 1OCZH 2MH9A 2XRNA 3C2GA 2ZJPF 1K7AA 3I4MJ 4A3KJ 2W48A 3OMYA 3KP2A 4MLOA 1POGA 1W7PD 5CQEA 3HOWJ 4J7GA 1FLIA 3FKJA 5KNLA 2I5UA 1J59A 1I3AA 1R58A 4A0YA 4B3AA 4L5JA 2BVLA 2MG4A 3HHGA 3L7WA 3X0LA 1LE8B 5LPGA 2V1XA 4HOBA 3REOA 3ZMUA 3ABLH 5DCMB 1FYLA 6PAXA 3CDIA 5ANWA 3GFJA 1Y1VJ 1YIJI 1IDZA 3GMEA 4YRVA 3CDHA 2DMPA 1F36A 2DN0A 3CJQB 4YIFA 3OSFA 5C7TA 3D5SC 3EXQA 4WF2A 4XKVA 4U88A 1D1CA 2DTZA 5B1AH 4B1RA 4L0YB 4A5NA 1IDYA 3CMAI 4LJZF 1YS6A 5E20A 4DYQA 4H0EA 2HQ5A 4XRSG 3K1PA 3K4CA 3GO5A 3KZZA 3WGHA 2LKPA 2QSFX 2E36A 2EZLA 3ELKA 3QP6A 1K2EA 2K9LA 5E17F 5GHPA 3J7AO 2F48A 4LMYA 4XKBA 2MSYA 1VQLI 2DDAA 3IWFA 4A0XA 4EQQA 4PZJA 3SDGA 3SMDA 2XAUA 3JAMK 4ESBA 1YRNB 3FMSA 3PFYA 5LEJA 3BJOA 3EUHA 3SYTA 1Z6RA 1OR7C 4XSXF 4ZYHA 1D1BA 4W97A 1B9NA 3OWTA 4BH9A 5H2FC 2LFBA 1G0SA 1V8IA 4JX5A 1IXCA 3W2AA 3AG1H 2WADA 3CESA 4IJAA 2DA2A 1UHWA 2R7DA 4NQWA 2OZ6A 1KYWA 1XCVA 3S14J 5L3GA 4FE7A 1D5YA 5CJ9A 4OIQF 5GAEJ 1JTYA 1A6QA 3FSPA 4BU2A 1P4XA 4PDKA 4MIMA 1VQNI 2LY2A 4Y13A 2NS0A 3FWEA 2D45A 2GA2A 5B5EC 2L5QA 2JUGA 1APLC 2PEXA 2W1OA 1MUTA 2HNHA 2Y48A 3C3WA 4RLQA 3ROUA 2A6EF 3OYGA 4BHCA 3IHUA 2ZMEB 1MNMC 3I9V2 2OQGA 5FO5A 4ZYDA 1YX5A 4GO1A 1PPXA 4N4OB 3TW7A 5FSLA 2QM3A 3S8PA 2MLGA 2V79A 2X85A 2Q2EB 2DCEA 2K9MA 5FJ8J 2HVRA 5K5OA 1IRZA 5TRDA 5E3OA 1GVJA 4HSRA 1T95A 2B2KA 2V1UA 5F64A 1FBSA 2R0QC 4QSHA 3TEDA 1GXPA 2G0EA 4WXHA 3G1OA 2CH0A 2GIVA 4KMFA 4BYYA 5ILVA 2HGCA 2M45A 1X84A 3W2WA 2ZSIB 3F6AA 3WE3A 1Q1HA 3WODF 3K4NA 5EZGA 4C9WA 1VCDA 2JMWA 2ME6A 3CLOA 1HBXG 2R7XA 4MQ9F 1BW5A 4RS8A 2ZJ2A 2M4GA 4HF2A 2A8SA 3EPZA 1J5YA 3DPLC 2HDDA 3E7LA 4C3JJ 2AS5F 3J81K 3WTVC 2IW5A 2LKXA 2QYOA 5BONA 5A2QZ 3T8TA 3WGIA 4MEXF 1FTTA 4BDZA 3ZMVA 1IAWA 2CZRA 4J00A 2VUMJ 5I8UA 3HOZJ 2NVTJ 3CCUI 3RIRA 3WTYC 3X0IA 2WWYA 3A0HC 1FP1D 4IX7A 1B8IB 1B59A 5HS9A 4D9JA 1Z3XA 2E2JJ 1FMWA 2K27A 3WTXC 1BN5A 3CCRI 1T0FC 3ESWB 3F22A 2GA1A 3PNTA 3BR0A 3ZPLA 2LMDA 1EF4A 3A02A 5K7FA 1ZG1A 1G4DA 2A69F 1TBXA 2R3SA 1YW8A 1HDPA 1UG2A 3ACAA 3V7CA 2IA0A 2VBWA 3J80Z 1ZR4A 3OR2C 4IXAA 4NUBA 5DS9A 2N8GA 3RI4A 1I1GA 4YIIA 3JSPA 4FASD 1QGPA 5FROA 4LOCA 4BJ6C 2W4SA 3BR6A 5K5QA 2EFQA 3FXKA 2HOEA 1J75A 1VQ8I 3J7AY 2M2EA 3CUQA 3D0SA 4UVCA 2HVSA 3Q1PA 2GXAA 5K1YA 1S29A 1YX3A 4B48A 2AXTC 1EH7A 2QJOA 2DA7A 4OIRF 4OWRB 4HF0A 1J7KA 2PBIA 5K7ZA 4CCLA 2W24A 4I01A 2HPMA 5E1ZB 4ASNA 3GFLA 5CQGA 1MMDA 2E7XA 4MHGA 2P6SA 3BJ6A 2KJCA 4BNCA 1R1VA 1IJWC 3K4MA 3MEXA 2BZTA 1DGWY 5BOXA 4RGSA 1OYIA 2LBFA 2OPTA 3BQYA 3AAFA 3GTQJ 3N77A 3CTAA 3QWLA 3KP7A 2DAOA 3WHBA 2NRAC 3CMMA 1R1TA 1LEAA 2BGCA 2L9NA 2XGXA 1DPRA 4XORA 5FKOA 4YG2F 4IVNA
chains in the Genus database with same CATH topology
1U8RA 2QJTA 3I0TA 1XMAA 1XSXA 1W4MA 5LGNA 3GFIA 5IT9K 2M30A 4P55A 4WWCA 2RKHA 3ECOA 2DK5A 4OINF 3Q4IA 4KG3A 2ACJA 1XN7A 3EF5A 4CICA 2F5DA 3K69A 3TDUC 1BI3A 1QQIA 3I5UA 3HHJA 1O7LA 3I59B 1KHZA 3K1NA 3DP7A 1HSTA 3T5XA 3X0RA 2KDVA 3DFGA 3KZYA 3RKWA 1NHAA 3WTWC 4I2OA 4CZZA 3IL2A 2NYXA 5GHNA 1FNNA 4Q5SF 3RKYA 1OPCA 4CGZA 4JZUA 2WC2A 2P5LC 1XGOA 1QZZA 3HRUA 1GXQA 2JSCA 2YU3A 3QAHA 4KDPA 2Y0MA 3HOTA 2XHKA 3MFKA 3C18A 5D4RA 3GRNA 4O3MA 2A6TA 1H9TA 2QKMB 1FWZA 1LEBA 4E70A 1IN4A 5ICCA 3H3UA 1ZAOA 2DW4A 4JZSA 4P9UA 4EJVA 4GCVA 2RVCA 3PQKA 3VB2A 1XD7A 1RNLA 3HSEA 3V8JA 1SMTA 2KJBA 4G7OF 1YW7A 2PQ8A 3R6SA 1ULYA 5KVRA 1L3LA 1ZH5A 1XB4A 3FXQA 2J8QA 4JQFA 2HFHA 3F3XA 3RTRA 3F23A 3X0PA 2LNBA 5ILUA 4M9ZA 3FJYA 2O5FA 3BM4A 2J5PA 1JHHA 1G3YA 3MCZA 1RZ4A 3GXOA 2HS5A 2PQVA 2H6CA 1VIQA 4UVAA 3Q9VA 1Z9CA 1KTGA 3HRMA 2FA5A 3EEUA 3DF8A 1QZYA 1PUEE 3KVHA 3DXJF 4KMUX 3HOSA 4ZYGA 3S2WA 4LG0A 1X51A 3X0JA 2PFBA 2ZCWA 4IRIA 2Z3YA 5DUKA 5DEQA 1PUSA 3WTTC 1VHZA 1ON1A 4M71A 3FK9A 2FU4A 4ON0A 2XAHA 4P9FA 3X0SA 1FBQA 2NNYA 1Q33A 1TW3A 3ZMTA 3U9GA 3K2ZA 3L2CA 4KTBA 4AVPA 1W7PB 3DV8A 2VN2A 4HLXA 4BXUA 2H6BA 1L0OC 1C0WA 4P5OA 3I7UA 4ICKA 5ERIA 1JRKA 4KICA 4LLNA 4I7HA 2XVCA 1DPUA 1U6GA 2HKXA 1QNTA 3I58A 3R0JA 3E3VA 1IUYA 2C6YA 1XSVA 1U3EM 1VC9A 2W85A 3KP6A 4WK8F 2MD5A 4A12A 4I09A 5E8IA 4HX4A 2EV6A 5CLSA 2D1VA 1FPQA 1UHMA 4K2EA 4S2XA 1S6LA 2OD5A 1V8WA 1LDDA 3CNGA 5L3EA 2EFWA 1ZLKA 3PFIA 2ZNYA 3P9KA 3BOQA 2VE9A 5D5VB 1MD0A 3U1DA 2FNAA 3L85A 2YPRA 4ESFA 3J7Ye 3F8BA 4ENNA 2EK5A 3N4MA 3X0OA 1JKNA 3P9CA 5HDNA 2EA2A 2DBBA 4S2WA 3OV8A 1SD4A 5FB2A 2VC1A 4RB0A 2L3DA 2FOKA 1TNTA 1Z6TA 1VK6A 2A8QA 4KG4A 2P5KA 3HHHA 3ID9A 1HW5A 1B9MA 1PUNA 2H94A 1SD7A 1SZ3A 3R61A 2IJLA 3GZ6A 3OGAA 2YX4A 1XSDA 1JE8A 2QBYB 1F9NA 2F5CA 1XMKA 1FZPB 4I02A 4MTEA 5HDKA 4BQAA 2PI0A 1B1BA 1R67A 4U0VA 1J2XA 2WTEA 1KU3A 4EGZA 4CXFA 2FKBA 4GYIA 2MA3A 2IA1A 3E6DA 1SFUA 2FBKA 4L18B 2PLYA 1U5TA 1D8JA 3EQLF 2YVOA 2ZFWA 4ETSA 5EEHA 2LDUA 1FC3A 4O6JA 3HTSB 1O3TA 2FVVA 1V8NA 4M73A 1B6AA 4QLCU 2HEOA 3ZN1A 2W57A 1PP8F 1IXSB 3WE2A 5LGTA 3FM5A 1KQ0A 5DCMA 2DSCA 2LF7A 3F6VA 2KIMA 1H9GA 3FCMA 1VHGA 3F8NA 4RAYA 3I53A 3FF5A 5EEGA 5HS7A 2JPCA 1T98A 3O61A 1ZG3A 4XSZF 1DUXC 3I4PA 1PP7U 4FX0A 3GVAA 2B06A 2IP2A 3WG9A 5FLXZ 4KN7X 5FGMA 5C8LA 1DDNA 1P4WA 2Z33A 3HIFA 3KP3A 2STTA 1IRGA 4RB2C 2M1BA 3F8CA 2V1DA 1IN6A 1TW2A 2Q9PA 2QZ8A 1SD6A 4OMZA 3E6CC 4I0BA 3BDDA 4U7DA 4AIJA 3R60A 2BEOA 1FYKA 1A04A 1V8SA 2CO5A 5CVJA 5D5WB 4N9IA 1FYMA 5KK1A 2E1NA 5ANVA 3CUQC 2V9VA 4RB3C 1MK1A 1USTA 4XLPF 2CGPA 2ZMEA 2HKOA 4UNOA 3BJAA 2AZWA 4PGHA 4U0WA 5BS6A 4YFXF 4FHTA 5DDGA 3GFMA 2EWNA 3E5UA 5ICEA 2R5WA 2F2EA 2H09A 2GQQA 3B02A 2GXBA 4GGGA 5JI6A 2MLKA 1HKTA 4JZTA 3LA3A 2ESHA 5LHHA 1K6OA 2A8TA 3RYRA 3CO6C 2KIUA 3IKTA 1R5HA 4HDVA 1HKSA 3QRFF 3H92A 3SXYA 2ISZA 2O3FA 3M9AA 3AC9A 2JZYA 3LA7A 2BV6A 3FMRA 1MR2A 1T38A 2O8XA 5DD4A 4ZYEA 1SOIA 4YPRA 1XGNA 4TV7A 1O7FA 5JVTA 1U20A 2G74A 1JHFA 3ZP5A 4EJUA 1FOKA 4A6EA 5GHPA 2ZKZA 3LQRA 5CVVA 4S04A 3JTGA 5K5RA 1O3SA 1G6NA 3HSRA 4HX8A 2HZTA 4HDUA 1FX7A 3ULQB 2DK8A 2MC3A 3X0MA 2EJRA 1BIBA 3IC7A 4EM0B 3FMQA 2RRKA 4G94A 2CW0F 1MQEA 1LB2A 1G3WA 5FSKA 5JFRA 1MKMA 4KYXA 4UV9A 3A6VA 1KA8A 5CVUA 3TO7A 3T8RA 2OQRA 1TQMA 3ERED 2YX7A 4KYWA 1HSJA 1KU7A 2P4WA 2VOOA 4B8XA 4I0AA 3ABTA 5ED4A 2EFOA 2CSOA 1XSAA 2DT5A 2YR2A 3IRQA 3CUQB 4ENKA 1CF7A 4UVBA 2EV5A 1JXSA 2YVNA 2XKPA 3P6YA 1ZRCA 1OYYA 2VONA 1AWCA 1VIUA 3E57A 3RYPA 5BMZA 3G73A 1YIOA 3E5QA 4UXNA 1BJAA 3V8LA 1ZRFA 2P7CB 4YPHA 1BBYA 1VTNC 4YFKF 5J6XA 3Q2SA 3MZHA 3RDIA 4PGGA 5FSIA 4YFNF 2DFIA 1OMIA 4R79A 4N0BA 4IHSA 1WI9A 1T39A 1STZA 2A07F 3WTUC 2FXAA 4L5IA 4O5VA 1RUNA 4Y17A 2M8EA 2GXGA 2K7LA 5CVRA 3K0LA 1I1SA 3DKWA 4L9VA 1LQ1A 1T6SA 2DQRA 3WTSC 3N97A 4ZZDA 2O61A 1IN5A 4GXOA 2A8RA 3F13A 4EM2A 1Y0UA 2D1HA 4S2VA 2HDCA 4LD5A 1PPVA 2QQ9A 2FEZA 3FXUA 2BYVE 3TDZC 3X0NA 2HTSA 5TJJA 2QENA 1RIOH 1RRQA 3O52A 1BOAA 1K26A 1H0MA 4A0ZA 1RI7A 4MTDA 5IW4A 2JPBA 4N9HA 4HZFA 5E1XA 2Y75A 2GWRA 5DD8A 5BPDA 3P7NA 1BI2A 1PPWA 2F5EA 1YFHA 1R36A 1XDUA 5GHJA 3KE2A 1KQ9A 4XRFA 3COAC 3O3KA 2B0LA 2NAZA 4PCQA 4EJOA 1TQPA 5HLGA 3F21A 3C7JA 1USSA 3KP4A 5DPKA 3RJPA 3CO7C 2HYGD 3MDGA 2E7WA 5FFZA 1FY7A 3U53A 3KP5A 2I6KA 4IRGA 2BE5F 3I71A 4HQEA 3JTHA 2O5WA 2FMLA 4NHJA 2IT0A 3JW4A 2I8UA 1IN7A 3P5TA 2JT1A 2ICKA 1R5GA 1O3RA 3E97A 3JAMZ 1J0RA 1ZLJA 2G9WA 2ZO4A 3O69A 5J8CA 2L02A 3KETA 1Z05A 1FSEA 1HZTA 2YVPA 1KU9A 3BPXA 5FFXA 2CFXA 4MPOA 1HX3A 3DEUA 3HTUA 3W6KB 4V14A 4JK1X 1YQAA 1V8TA 4QWQA 4LG0B 2ZBKA 3ZR1A 1YO5C 2EV0A 4U0YA 4UHTA 5L3DA 5A2QK 2RDPA 5LGUA 4KIBA 4ENJA 4A6DA 2YYHA 2V6CA 1D8KA 2R7FA 2K4JA 2A68F 2QWWA 1ZN2A 1S7OA 5D6EA 3ZR0A 1F4KA 3E6BA 3FHZA 1XSCA 3FXRA 1NFSA 4XLNF 5E18F 1TUMA 1V3FA 2A3SA 3PQJA 4S05A 4CHUA 1GA7A 2LSOA 3HRTA 1FBUA 3J80K 4UUVA 3TO6A 3V8KA 2LF8A 3E5XA 3IWZA 3NQOA 3SFZA 3RPUA 4HW0A 4JBAA 2UXNA 2KRFA 1U5TC 5IT3A 3J81Z 2M5WA 1V8LA 2EB7A 1BIAA 4XBFA 1TLHB 4CDGA 1HW2A 2MH2A 4KIGA 2Q8KA 5BPIA 2H27A 1F5TA 1JGSA 3GEZA 2A8PA 5DV5A 2STWA 2DUKA 2HQRA 1EV7A 2A61A 3ML6A 5ICFA 1B4AA 1LVAA 2FBIA 4Q47A 1VC8A 3R4KA 4LLGF 1SMYF 3GLXA 2RNJA 2ICJA 3GZ8A 4IHTA 2VBXA 4M6XA 3QPHA 2KDWA 2Q0OA 3KEQA 3GWZA 2I8TA 4OMYA 2D2WA 3OOPA 2QUFA 5HZXA 2PNYA 3GG6A 3V7RA 3EYIA 5CFIA 4HQMA 2A5YB 3W6JB 4KUMA 1CGPA 1RUOA 4ILQA 4K6EA 2OBPA 2QBYA 1KT9A 1S8NA 1MDMA 3VEPA 3B73A 2DI3A 3JSOA 2Z99A 3G0QA 2RQPA 3BPVA 4G9YA 1UCRA 1YTYA 2G7HA 1LJ9A 2QLZA 2HWVA 2EFNA 1K78A 2GB5A 2DQLA 2W84A 1WRJA 5D8LB 4NB5A 5E8GA 1SD5A 1R7JA 3E6MA 1IRYA 4CYDA 1P6RA 1BC7C 5IT9Z 3X0KA 3ZN0A 5D5UB 4R1HA 4HA8A 4KT5C 2G73A 4Q48A 3GF2A 1FSHA 3GX4X 3LA2A 2DO7A 4L9NA 4ZG0A 5D4SA 2YVMA 1I5ZA 5AIPA 3LSTA 1XGMA 3H95A 5D8KB 4A5MA 2K86A 2COMA 2E1CA 2FNPA 4AIHA 4B09A 3I7VA 5CVIA 1V8VA 3CUOA 2UXXA 3EETA 3DKUA 3TGNA 1IN8A 3H3ZA 1S7AA 4EVIA 3I9XA 3KFWX 4LFUA 2DTRA 3K9TA 3L00A 4HLYA 1TTYA 3QU6A 5LHGA 5LBQA 1P4AA 2VXZA 5D5XB 2GT2A 5FD5A 1LDKB 3RH7A 3WHWA 2IPQX 1V4RA 2ESNA 2UWMA 1HKQA 1R22A 3GZ5A 1ODDA 2OAZA 1SJYA 1BC8C 2XAFA 3BROA 2W4EA 3NEUA 3TKYA 3T1BA 4C9XA 2WV0A 3FZVA 4GYGA 1KU2A 5ANSA 5IW5A 2QQAA 3VFZA 2FMYA 4WCGA 3V7SA 3ZMDA 2CWEA 2VOPA 3SONA 3VOEA 3G3ZA 2XROA 1MJBA 4M72A 3ZQ7A 4KIFA 5L3FA 4LK1F 1SFEA 3P9IA 4U7BA 3R03A 1ZYRF 2F5FA 4OU0A 2Q2EA 3ABUA 1T2KA 2AXLA 4EGYA 2TDXA 1P92A 2VE8A 1EH6A 4RAZA 3FFUA 2FRHA 2GT4A 5F1RA 3Q5FA 3A6TA 3LQQA 4DNCA 1IW7F 2IA2A 1HW1A 2XKOA 4S2YA 2J5OA 3ECHA 2XASA 1IZ1A 4M9XA 4HBLA 4IRHA 3U2RA 1P2FA 2PMHA 4HAMA 1R1UA 1BI0A 1ZRDA 3TOBA 1PUQA 2VODA 3BHOA 3WTZA 2OZUA 5DCFA 1SFXA 3BP8A 1MP2A 1F1ZA 4NFXA 3O2PE 1BI1A 1TQIA 1XGSA 2HTJA 1FT9A 1IRFA 1YG2A 2RN7A 3TQNA 4KNYA 2Z9OA 1YW9A 3M8EA 2YSRA 5GHMA 4LB5A 3M8FA 2IVMA 4OIOF 3I64A 2QVOA 4ZZLA 2EFPA 3O6ZA 1ZREA 1ZARA 4HX7A 1OR7A 5AONA 5LRSA 3M1EA 2P8TA 5H6QA 3Q9SA 3C1DA 2DPDA 3QSJA 1LDJA 2P7VB 5LRRA 4IF4A 3DQVC 1D5VA 3BAPA 5C7QA 1NFZA 1YS7A 3MAJA 5LHIA 5LEKA 1PDNC 4IPAA 1XSBA 2ADUA 4ESJA 4G7ZF 2L54A 5ILSA 4KN4X 1REPC 4EJWA 5J8FA 2CL3A 5JR3A 5HS8A 1K79A 4WXCA 2KIFA 4M6YA 4R8HA 3QPTA 1CF7B 2G7UA 1I27A 2NNNA 3SHDA 2QQBA 2L01A 3I59A 2OU2A 1I9AA 2JTVA 3LAJA 1HQCA 4Q4ZF 2A6HF 1ZHFA 5FSNA 1MZBA 3V4GA 2VT2A 4Y15A 2VT3A 3X0QA 2K4BA 1ZGJA 4EMSA 1OKRA 2VBYA 4UV8A 1MJAA 5CFJA 2L4MA 4M74A 4RGRA 2O6GE 4HYEA 2RGVA 1KQ8A 3LAPA 4Z2YA 1T0FA 5ANTA 1KYZA 5ANUA 3TOAA 5DYMA 2L4AA 2GAUA 4MNUA 3O6BB 3A6UA 3GW2A 1PVFA 1QVJA 4WX9A 1MQWA 1Z7UA 3F8MA 5ICGA 1V8RA 4L9TA 2W25A 1ZG5A 5FLXK 1Q54A 2IRFG 4L9JA 3T0YA 1G3SA 3SZPA 4KA4A 3DPTA 5HLIA 3O8SA 1IXRC 1G3TA 5E1WA 3HYQA 3LWFA 3GYHX 1S3JA 3COUA 2HQNA 1BM9A 5GHOA 3LFKA 1WSUA 4AD9A 5H6RA 2K02A 1SU2A 1QO0D 2EA4A 2MBFA 5BQTA 3BY6A 4OIPF 3IKVA 2ISYA 5ISYA 3R0AA 4OOIA 3MQ0A 3HYIA 2P5VA 4DQ2A 2VBZA 2UZKA 4NFWA 3QU3A 1V8YA 5GHIA 2P6TA 2HR3A 3F72A 1E17A 2DSBA 1Z1DA 4J7HA 3HUGA 2X0LA 3QOPA 2RV8A 1V8UA 5FD6A 2B0VA 1X83A 3I54A 2O0YA 4DYWA 3QP5A 1D3YA 1OYWA 2FF4A 3RKXA 3F8FA 5CYVA 5L3CA 1W5TA 3F6OA 4HV5A 3KLOA 1NQYA 1ZGAA 4D0PA 3SQNA 3WGGA 1I6XA 5HDGA 1F3YA 4G7HF 2OA4A 2XIGA 1TNSA 2O1CA 1W7PA 1WQ2A 4LLLA 3RPQA 3EYYA 3ZMZA 2FBHA 4AWXB 2XV4S 3BWGA 2DPUA 3IRRA 4CO8A 2PMUA 2FQ3A 4WXDA 4BHPA 1IF1A 5LLQA 1FP2A 5GHQA 4ENMA 4M9SA 2M87A 4LGWA 3MCFA 2CYYA 2FSWA 3Q91A 5JHUA 2HYFA 4F7ZA 1Z91A 1WWXA 4P96A 3SHFA 2PN6A 4BHBA 1DP7P 3MGMA 3BZ6A 3NRVA 2DLLA 4A2UA 5FSOA 4MGRA 2BBYA 4MQVA 2ELHA 2CQKA 4FX4A 3EDPA 4FT8A 4G6QA 1UFMA 1OW2A 5HVQC 2RC4A 1RYAA 4I98B 1QBJA 2ZXJA 5L3BA 4ZH4F 4MEYF 1R23A 4EM1A 2O03A 3D5LA 2VC0A 4N1UA 4AIKA 1X3UA 3MWMA 2KKOA 3VODA 4HF1A 1J9IA 2VNQA 1U2WA 3MDIA 3FX3A 3ISPA 3L9FA 1ON2A 1MJ9A 3Q93A 3ZMSA 1QPMA 1XDSA 2XUBA 2Z5UA 3KCCA 3GWYA 4L0ZB 4EJTA 1HXDA 2FE3A 3SZTA 5HLHA 5FSMA 5DUIA 1SAXA 4RB1A 3K1MA 3Q2TA 5AIQA 3KLNA 1E2XA 3GUDA 2GZWA 4N1TA 2ZNZA