5DEQA

Crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
214
Chain Sequence
MKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKRGAALYKFNGKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
total genus 45
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5deqA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5deqA01
5ANSA 2R7FA 1JKNA 3X0RA 1JGSA 5L3FA 2BV6A 1BC8C 4U7BA 1RRSA 3K2ZA 2ICKA 2OQRA 2YVPA 2KKOA 1RYAA 5FSNA 1ZARA 1MJBA 3FXRA 3I53A 1VIQA 3D0SA 2PFBA 2F5FA 2CWEA 3WGHA 2DO7A 3IKVA 2XROA 3E5XA 2W84A 3WTTC 1VK6A 3ZN1A 4G9YA 3Q2TA 1GXQA 2JPBA 1V8SA 1P92A 3V8LA 2IA1A 2FMLA 1UFMA 2ADUA 3I7UA 3TQNA 3BZ6A 4IRHA 4IHTA 1W7PB 1ZH5A 1UHMA 3GYHX 1TNTA 1S7AA 1ZLKA 1CGPA 2E7WA 2DPUA 4JZTA 1GVJA 5FLXZ 4LG0A 2B0VA 3IWZA 4L9TA 1XD7A 4Q5SF 4KTBA 4LB6B 4K6EA 4NQWA 1QBJA 5D5UB 1ZRDA 5LRSA 2Q2EA 1MJAA 4AD9A 5F1RA 1JRKA 3TKYA 2Y48A 2KRFA 2FMYA 5LHGA 3N4MA 1XCVA 1DUXC 3BM4A 4PGGA 5HVQC 5CFJA 4ETSA 3WU0A 3WE3A 2LSOA 3RDIA 4MNUA 2LF8A 2GIVA 2PJPA 5LGTA 3BDDA 2GQQA 1ZG1A 4KN4X 3DEUA 3GF2A 2LKPA 2QYOA 1MDMB 2D45A 3O6ZA 2IPQX 4A0ZA 1E2XA 2MC3A 2Y75A 2M30A 3GFMA 4XBFA 1FYMA 2H27A 5H6QA 2CFXA 2AZWA 5IW4A 2D1VA 2UWMA 2JPCA 5CYVA 2H09A 1MGTA 2KDVA 1EH8A 5DCMB 4G7OF 5LHIA 2HOEA 1YLFA 3GFLA 4HA8A 3X0NA 4LB5A 1IN7A 1NQYA 4XSXF 2DBBA 4YG2F 4G6QA 2DFIA 2FF4A 5HS7A 1P4AA 2A6EF 1XN7A 3U9GA 2OQGA 2MLGA 4WX9A 3GZ8A 3SONA 4U7DA 1R00A 3W6JB 4N1UA 3LSTA 3GZ5A 4QWQA 2QLZA 4KUMA 2R3SA 1TLHB 2NRAC 2G7UA 1KU3A 4EJWA 3QSJA 4KIBA 3FF5A 4HQEA 3SXYA 1R5GA 3JSOA 4YIFA 1KHZA 1T6SA 3R0JA 1FZPB 1U20A 3GG6A 4BAYA 5FFXA 1D3YA 3GWZA 4I01A 3R61A 3BJOA 2EFPA 4HZFA 6PAXA 2AXLA 1U5TC 4ON0A 3ID9A 3R0AA 1PPVA 3ELKA 2JSCA 1R1VA 4D0PA 4NB5A 2O03A 1VHGA 1HKSA 3EESA 1S7OA 1Z6TA 4KIGA 3O8SA 4L0YB 1SFEA 1F5TA 1CF7B 1YW8A 1BIAA 4IRGA 2Z3YA 1PP7U 3F6VA 5CVJA 3TDZC 4OMZA 3SHDA 3M9AA 4I0AA 5DCFA 1LDJA 2MA3A 1ZN2A 3CUQA 3TGNA 2FNAA 3FX3A 4I7HA 1FPQA 5L3DA 2G7HA 4P9FA 2P5KA 4WCGA 2EFWA 3E5UA 4MQVA 2RGVA 2O1CA 1Z9CA 5L3GA 3L00A 2GT2A 1H9GA 1FBSA 3HHJA 1IN8A 4NHJA 4L5JA 3EUHA 3ZMUA 1XSAA 1XMKA 2EV0A 3IRRA 1USTA 1Z1DA 2B06A 2Z5UA 2ZCWA 3I59A 2M1BA 2ZBKA 5BQTA 2I8UA 2XVCA 3KP5A 2VT3A 1VCDA 3I58A 4ZYGA 2CO5A 4UV8A 3RKXA 2VN2A 2FQ3A 1JE8A 2W25A 4Y15A 2D1HA 5J6XA 1C0WA 4NFWA 1K78B 4L18B 3GWYA 4M6YA 3DQVC 4O5VA 2DK8A 2B0LA 1MQEA 1RI7A 5J8CA 3FMRA 1DP7P 3CUQB 3FMSA 3Q2SA 5GHJA 1O7FA 1B4AA 3D5LA 3A6UA 1X83A 3BAPA 3LAPA 2Z9OA 2K4BA 4MPOA 5FSKA 1Q54A 3TO9A 4A2UA 3VEPA 1P2FA 5FFZA 1W4MA 1YQAA 3V8KA 3WTXC 4O3MA 2EFNA 1QGPA 3LQQA 3OGAA 4M71A 1LDKB 5BPIA 4WWCA 1JXSA 5ISYA 3X0OA 2O61A 3WU1B 3QPTA 3H3UA 1K26A 2PBIA 4LLLA 3JAMZ 3C3WA 1TQPA 2F5EA 1SMTA 3RKYA 5J8FA 3CTAA 2XV4S 5FLXK 5FSIA 2KIMA 3WGGA 1T39A 3QP6A 5E20A 1FC3A 4KNYA 2BGCA 1FBQA 5FD6A 3HOTA 4TV7A 4RAYA 5GHMA 5ICEA 4BNCA 4CICA 5GHOA 4EV0A 3K0LA 4V14A 5JHUA 2XKPA 1U78A 5E1ZB 1PPWA 3EEUA 4HX7A 5LHHA 1BC7C 5DD4A 3DFGA 1HW2A 4CDGA 1MDMA 1K7AA 1J0RA 1T0FA 1G9QA 2WV0A 4G8XA 1D5VA 3HTSB 5GHIA 4EJOA 4R8HA 4IF4A 2VXZA 2PQVA 3SFZA 3QOPA 1PDNC 2DK5A 4M73A 3GFIA 2RVCA 2XUBA 4LFUA 3E5QA 4WXDA 5KVRA 5JFRA 2O5WA 1IRGA 3MCFA 3ERED 1R58A 3CUQC 3F8BA 2QVOA 5LGNA 3GRNA 3U1DA 1NFSA 1BI3A 3I71A 3G73A 3P7NA 2K27A 2FNPA 2VODA 3IHUA 3I5UA 3X0LA 3F8CA 4CO8A 4R79A 3CDHA 1TQIA 3P9IA 4KG3A 4M9ZA 3O61A 2VE9A 3LA3A 3MZYA 4JZUA 5D8KB 1NQZA 3HRSA 1MZBA 2OZ6A 2XKOA 4PCQA 2P5VA 4JZSA 4F7ZA 3L2CA 1YTYA 1T2KA 4RGXA 4K2EA 2DTRA 2FXAA 1X3UA 2V1DA 3SQNA 3F8NA 1D8JA 3EDPA 2A6TA 1VRLA 2YX7A 2OAZA 3WTUC 2K7LA 2FU4A 2FA5A 3NQOA 1ZGJA 1Q27A 1V8UA 1RZ4A 2GA1A 1ZG3A 5C7TA 5LLQA 1JHFA 4A12A 1IN6A 1V8VA 3JW4A 1XGOA 4WXCA 4C9WA 2CW0F 2OU2A 3O6BB 3L9FA 1LVAA 2JT1A 3CNGA 1R1TA 3X0JA 1IUYA 3LFKA 5LEJA 4S2VA 2PEXA 3T8TA 3H92A 1H0MA 2STTA 1R22A 2XHKA 1QVJA 1I9AA 4DQ2A 3KP4A 1SJYA 1U5TA 3EQLF 1L3LA 4HDUA 2H94A 5ILVA 4RGRA 2Z33A 3MFKA 5FO5A 1PUQA 2A07F 1WSUA 1MKMA 2O6GE 2RN7A 4PDKA 3EYYA 3ROUA 2RKHA 1PUNA 2DHOA 3HSRA 1MR2A 2BYVE 4ESJA 2KIUA 2YVOA 1KQ9A 4ZYEA 4ENKA 1G3WA 3IL2A 3RTRA 2HWVA 2NS0A 3WHWA 4YFXF 2E1NA 4IJXA 4KYXA 5HLIA 1O3SA 3KVHA 1HW1A 5GHQA 1SD5A 2YYHA 3RPQA 4HVYA 2VOPA 1R67A 2ESHA 5FSMA 3HTUA 2VBWA 3ABTA 3TOBA 1WKMA 5CVVA 4ZZDA 4EJVA 2E7XA 2XASA 3RH7A 4LK0F 1MP2A 2OZUA 2L4AA 3Q4IA 1J59A 1FYKA 3ZPLA 4KICA 3HHHA 1W5TA 1VTNC 4LLGF 2YX4A 1HX3A 3BPXA 4HAMA 2RNJA 2W85A 3KEQA 4HF2A 2QQBA 4KFCA 1V8YA 4M9SA 2QM3A 2OA4A 1U3EM 4OU0A 3HYQA 2FOKA 4EJTA 1TW2A 3N97A 5DD8A 3GLXA 4A0XA 4AWXB 1ZREA 4HF1A 3K9TA 4RGUA 3O52A 1PVFA 1MJ9A 2XSQA 2LF7A 1WWXA 5CVUA 3KFWX 3T5XA 2FBIA 5JR3A 4MEXF 3DV8A 2XAHA 2HGCA 2MLKA 1BOAA 5FB2A 4EMSA 5K5RA 3V4GA 4FT8A 1Z05A 4FX4A 3HRTA 2KJBA 4MTDA 1FOKA 3ZN0A 5A2QZ 5AIPA 1V8WA 3X0MA 3BWGA 2PN6A 2Q8KA 1Q33A 3LA2A 1MQWA 4HOBA 3KP6A 5ANVA 1TUMA 3NRVA 1YW9A 5HS9A 1G3SA 3W6KB 2L01A 1BJAA 2ETHA 3KEOA 1Z7UA 2UZKA 3ML6A 4WK8F 3ZMZA 1SZ3A 3MGMA 1QZYA 2A8RA 1J2XA 3REOA 4C9XA 3J81Z 4I2OA 2HR3A 4M74A 2J5OA 1Z91A 3WE2A 1LNWA 1YS6A 3F21A 1A04A 1O3QA 3L7WA 3FHZA 3C7JA 3COAC 1B9MA 2LDUA 4BH9A 3KLOA 3JTHA 4P5OA 5HZXA 1YIOA 3H95A 4AVPA 2QENA 1Z6RA 2IA0A 3A6VA 1WRJA 2CYYA 2L54A 5AIQA 2CG4A 2GXGA 3IKTA 3R60A 4BYYA 2QJTA 3RKWA 4S04A 4YPRA 5C7QA 1FNNA 2STWA 3GZ6A 5E8IA 5IT9Z 2ISZA 1P4WA 3HOSA 2E1CA 3IRQA 3G0QA 5JVTA 4HDVA 4KT5C 4HF0A 5LBQA 1F1ZA 2M45A 1G3TA 3QPHA 4AIHA 2P8TA 2VT2A 2EK5A 4YFKF 3WODF 4N9IA 2GT4A 4KMFA 4JZVA 3BJ6A 3FK9A 2JZYA 1V4RA 3ZQ7A 4LGWA 5KK1A 4P96A 1REPC 3MDGA 5DYMA 3F23A 4U88A 3CLOA 1TBXA 1DPUA 1J75A 3U2RA 1OKRA 2J5PA 1PP8F 4MTEA 5FD5A 3CUOA 5H6RA 3BHOA 5F6FA 4OIQF 2P4WA 4PGHA 1BN5A 4HV5A 1O3RA 1V8RA 3HRMA 2PMUA 4HFQA 2XGXA 4Q48A 4IHSA 4LJZF 3O2PE 4DNCA 1RNLA 1FLIA 2A5YB 1KU9A 2A3SA 3BPVA 4OIRF 4ZYHA 3E97A 1XSVA 1TQMA 1FSEA 3HHGA 4U0VA 3ZMDA 5IT9K 1O3TA 1VHZA 2V1UA 1XGNA 1ZGAA 1IZ1A 2VC0A 3GXOA 4IRIA 3LA7A 3MZHA 4M6XA 2QBYB 2F5CA 1SD6A 4JK1X 3E6DA 2IW5A 2O0YA 2QBYA 1L0OC 3J7AO 2HKXA 1V8MA 1I1GA 2Q0OA 4Y13A 3MQ0A 4KMUX 4KIFA 1FSHA 2RV8A 2QJOA 3FZVA 1W7PA 3MDIA 2IA2A 5E18F 2DUKA 4L5IA 3A6SA 4LK1F 3F6AA 2K86A 1P6RA 1GXPA 3E6BA 3F22A 3FJYA 2MH9A 5FSLA 2R7DA 1B59A 2C6YA 2DSCA 3RIRA 4EM1A 4BHPA 2DU9A 4CYDA 4JBAA 4WF2A 3Q5FA 1V8IA 2XAFA 2PNYA 3IWFA 1F4KA 2PLYA 4RAZA 1X84A 4AIKA 2VOOA 4RB1A 3R03A 2ZXJA 2EV5A 5A2QK 4Y17A 4HX8A 3C18A 5CFIA 5D4RA 1V8NA 1G3YA 2MD5A 2P6TA 1ZRCA 2CSOA 4UVAA 3KCCA 2VNPA 1HZTA 2FBHA 3COUA 2QQ9A 2PMHA 2ZJ2A 2Q9PA 1DPRA 3DUPA 5JI6A 2QWWA 2XIGA 3BJAA 5EEHA 2GWRA 3RPUA 5ANUA 3HSEA 1IXSB 3FM3A 1YFHA 1MD0A 1OR7A 1LQ1A 5LEKA 2A8TA 5ILSA 4KN7X 3ZMVA 3Q1PA 4QLCU 3A6TA 2DT5A 4U0WA 3WG9A 3JSPA 5E17F 4YPHA 2XAQA 4EQQA 3KP3A 2MH2A 3B02A 3X0PA 2X4HA 3KETA 4GYGA 2EA4A 1T98A 1F3YA 1FWZA 2WWYA 4RB0A 4IJAA 2EA2A 2ISYA 2F2EA 1R36A 4ZG0A 3PFIA 1YS7A 3QU6A 3GO5A 2DSBA 2NNNA 5AONA 4XLNF 3PQKA 1XSDA 1XGMA 3I9XA 1QQIA 1BI0A 5D5WB 2VNQA 4A5NA 2GZWA 1HQCA 2EJRA 4OMYA 2NAZA 4G94A 3HSFA 5HS8A 4MQ9F 2HDCA 4OOIA 3I7VA 5D4SA 1J5YA 4HLXA 2ZMEB 4OINF 3F13A 3K1PA 4UV9A 4OIPF 3JTGA 5LGUA 4CZZA 1EH6A 5BONA 3RYPA 4IXAA 3ECOA 1I1SA 4M9XA 3FXUA 4UHTA 3B73A 1IN5A 1XDSA 3G3ZA 3R6SA 2VC1A 3L09A 2ZKZA 3GVAA 3ZR0A 4N1TA 1HKTA 4A0YA 4L9NA 3K1NA 3RJPA 2XRNA 1AOYA 3LQRA 2XAJA 5K5OA 1NHAA 2P6SA 1OYYA 4I09A 2YU3A 2DQRA 3HRUA 4MEYF 4EGZA 2ZNZA 4HW0A 1ZRFA 3P5TA 5L3EA 1BBYA 3GW2A 4KYWA 2VBZA 4GCVA 2HYGD 1S8NA 4ZH4F 2W57A 5BMZA 3PQJA 1F9NA 2NNYA 2HKOA 1DDNA 5HLHA 1IRYA 5IW5A 2VE8A 1O57A 5GHNA 1R5HA 5CLSA 3V7SA 1JHHA 2R5WA 5ILUA 1YG2A 2COMA 2DW4A 1QO0D 3EF5A 3DPLC 2O3FA 3GEZA 3OOPA 1YO5C 2A69F 3K1MA 3TOAA 5DEQA 2X0LA 2K02A 4ESBA 4AIJA 2M87A 2IRFG 5DDGA 1IN4A 3FFUA 5HLGA 2NYXA 2A61A 4RB2C 4ICKA 2ZMEA 1G0SA 3X0QA 2EWNA 2FBKA 1I5ZA 3QAHA 2UXXA 5DV5A 1HSJA 4O6JA 4RGSA 4L9JA 4N9HA 1FP2A 2YSRA 1XSBA 4L9VA 2W4EA 3J7Ye 2TDXA 3K69A 2OBPA 3GX4X 3S2WA 3BY6A 1XGSA 5ED4A 4BHBA 3ABUA 5HDGA 1MK1A 3M8EA 3ISPA 1ZYRF 5CVRA 3DP7A 3EYIA 4RS8A 3KP7A 3FM5A 3P9KA 3BROA 5D8LB 1ZLJA 3DXJF 2FE3A 1PPXA 2CL3A 1SFUA 4KG4A 3GUDA 1X51A 1FBUA 1I6XA 4HX4A 5L3CA 4GGGA 2IJLA 3TO6A 4A6DA 4Q47A 1OYWA 1SFXA 3HYIA 2KDWA 2FRHA 4BXUA 2VONA 4U0YA 4P55A 4I02A 3MAJA 1XCBA 4MHGA 3KE2A 5L3BA 4HQMA 3J80K 1BI1A 1ONVA 2BBYA 3LAJA 4Q4ZF 1ZAOA 4DYWA 2P7VB 1KT9A 1XMAA 2FKBA 4L0ZB 3MEXA 2P5LC 3KLNA 2ACJA 2IT0A 4I0BA 3O69A 1HKQA 3V7RA 5E1WA 4E70A 5FGMA 3VODA 1I27A 1P4XA 3VOEA 3P6YA 1KU7A 1U5TB 2I8TA 3R4KA 1QPMA 3DPTA 2VBYA 1YW7A 3QRFF 1XB4A 3VFZA 1O7LA 4M72A 2HZTA 2A8SA 4BQAA 4GO1A 3AC9A 1HSTA 1FX7A 1VIUA 3I64A 4PZJA 1KU2A 2RQPA 4RB3C 5K5QA 1QZZA 3QP5A 2AS5F 2PI0A 3N9UA 1KQ0A 2QKMB 5DUKA 3KZZA 1VC9A 4YIIA 3T8RA 3WTYC 1STZA 2DSDA 3VB2A 2ICJA 3F3XA 1TTYA 1KTGA 1WI9A 4FHTA 2GAUA 3L85A 1HW5A 5ICFA 4CGZA 1XDUA 3E3VA 4HYEA 4S05A 1FY7A 5C8LA 2ZNYA 5TJJA 3AAFA 2PQ8A 3WGIA 1S6LA 1IW7F 2F5DA 3DF8A 2A8QA 4H0EA 2RRKA 2YR2A 2GXBA 3SMDA 3M7GA 1U6GA 3RI4A 4GXOA 2ZFWA 1V8TA 4ASNA 4HBLA 1R7JA 1LJ9A 3SHFA 4KA4A 2A8PA 2OD5A 1OPCA 5IT3A 3HUGA 3NEUA 4ILQA 2EFQA 1RRQA 1IRFA 1IAWA 1KYWA 3E6MA 4P9UA 3X0IA 4EVIA 2MBFA 3EETA 2QQAA 1KQ8A 1BI2A 4ENMA 1RUNA 4HLYA 1E17A 4EGYA 1W7PD 4A6EA 5BS6A 4UUVA 1SD7A 1B9NA 3T1BA 3ZP5A 1LEBA 1PUSA 3Q91A 5ICGA 5LRRA 4XLPF 2H6CA 4ENNA 2HTJA 1T38A 3WTWC 1K79A 2EV6A 2HEOA 1MUTA 5LPGA 2H6BA 3I59B 3I0TA 4YFNF 2WC2A 1AWCA 5HDKA 3E57A 2IVMA 2HFHA 1U8RA 3ZR1A 1OMIA 3I4PA 3RYRA 1RIOH 1VC8A 1SD4A 4N0BA 1Q1HA 2W24A 4LMYA 3P9CA 3DKUA 1NFZA 3KZYA 1SU2A 2G73A 1IXRC 1SMYF 3V8JA 3ECHA 1BM9A 5ANWA 3MCZA 5DPKA 3JAMK 3FXQA 4G7ZF 5FSOA 5CJ9A 2RC4A 4BHCA 1V3FA 2A68F 4UVBA 1HBXG 3F8FA 1OW2A 1S3JA 3CO7C 5E1XA 1S29A 3WTZA 3Q93A 5HDNA 1TW3A 1GHCA 4CHUA 5TRDA 3C1DA 3U53A 1EV7A 2YVNA 2CQKA 1PUEE 2BE5F 1LEAA 3DKWA 4G6DA 4XSZF 4HV6A 2HQRA 2JRTA 4A5MA 3TDUC 1UCRA 2GB5A 2DLLA 2YVMA 2DPDA 1QNTA 3SZTA 5BOXA 4EJUA 3M1EA 2ZO4A 3M8FA 1UB9A 2D2WA 2FEZA 2JVBA 1YYVA 5CVIA 1KA8A 1FP1D 2V1XA 2O5FA 1G6NA 3O3KA 1R23A 4S2WA 3Q9VA 1K78A 2L3DA 3H3ZA 5HOOA 1ZG5A 4LD5A 1ON2A 2VBXA 3EXQA 1J7KA 2Z99A 1UHWA 2LNBA 4NFXA 1R1UA 1FYLA 2PG4A 2KIFA 2G74A 2UXNA 3KP2A 1OYIA 5ANTA 1LDDA 3SZPA 5GHPA 4ESFA 1TNSA 2BEOA 4UXNA 1W5SA 1K6OA 2V79A 2M5WA 1D8KA 4ZZLA 3ZMTA 1J9IA 4G7HF 3ACAA 2L4MA 2J8QA 3WTVC 1SOIA 3X0KA 4S2XA 4B8XA 3FSPA 3HIFA 1SAXA 1USSA 2RDPA 1ULYA 5BPDA 1KGSA 2GA2A 3T0YA 3I54A 3CO6C 3F8MA 2I6KA 2ESNA 1V8LA 3FCMA 3F72A 3MWMA 2L02A 2Y0MA 4UNOA 1IXCA 2ELHA 4KDPA 2O8XA 2A6HF 2IP2A 5H20A 2FVVA 2HYFA 3E6CC 4YOQA 3Q9SA 3ULQB 2XAGA 2G9WA 5DCMA 1ODDA 3GFJA 3ZMSA 2CGPA 3F6OA 2V9VA 5ICCA 2EFOA 5DUIA 1CF7A 1H9TA 1EH7A 2V6CA 2DI3A 2HTSA 3BOQA 2KJCA 2P7CB 2QUFA 2DAOA 4FX0A 1IF1A 4ENJA 3X0SA 5E8GA 5EEGA 1B6AA 2YPRA 3FWEA 4LLNA 2EB7A 2M8EA 3J80Z 4CXFA 4EM0B 5K1YA 2WTEA 4MGRA 1B1BA 4JQFA 1XSXA 1G4DA 1RUOA 2DQLA 1K2EA 1WQ2A 4IPAA 4S2YA 2K4JA 1ZHFA 5D6EA 2JTVA 2QZ8A 3TO7A 1Y0UA 4ZYDA 4WXHA 1U2WA 3QU3A 3LWFA 5D5XB 1HXDA 4R1HA 4UVCA 4XRFA 1KYZA 4Z2YA 4LG0B 5I8UA 3BP8A 4I98B 3FMQA 2HS5A 3V7CA 3CJNA 1FT9A 2HQNA 4IVNA 5D5VB 3J81K 4GYIA 4OIOF 2FSWA 5ERIA 1GA7A 1LB2A 4EM2A 1XSCA 3N77A 1BIBA 3OV8A 5D6FA 2B2KA 3IC7A 3WTSC 1ON1A 5F64A 4B09A
chains in the Genus database with same CATH superfamily
5ANSA 2R7FA 4ZYAA 1JKNA 2LP0A 1ZELA 2FJ1A 3X0RA 1JGSA 5L3FA 2BV6A 1BC8C 4U7BA 1RRSA 3NWSA 3K2ZA 1YITI 2IGMA 2ICKA 5K7ZA 2OQRA 1LFBA 2KKOA 2YVPA 1TWFJ 1RYAA 5FSNA 1ENHA 1ZARA 1MJBA 2DA7A 4V2GA 2EBIA 3CMEI 2DMQA 2H8WA 3W2AA 2CH0A 3ZQLA 2E1MC 3FXRA 3I53A 1GV2A 1MIJA 1VIQA 1PUFA 3D0SA 4HG2A 2PFBA 2F5FA 4DIQA 3AFHA 2CWEA 4F52A 5FLMJ 3WGHA 1N78A 4G12A 2DO7A 2LY1A 3IKVA 2W48A 3PJRA 2XROA 3E5XA 1V5GA 1APLC 1OCRH 3SJMA 2W84A 3C2HA 3WTTC 1VK6A 2G0EA 3ZN1A 5M3MJ 4G9YA 1FOYA 2YU9J 3Q2TA 3K6GA 2GM4A 1GXQA 2JPBA 5TISC 1YRNB 2CQ7A 3S1RJ 4AU7A 1V8SA 5JVGF 1P92A 3V8LA 2IA1A 3ZQCA 2FMLA 4M3BA 1UFMA 2ADUA 3I7UA 4IHXA 3NWTA 3TQNA 3BZ6A 1VQKI 4IRHA 4IOAF 4IHTA 1W7PB 2LRDA 1ZH5A 1UHMA 3GYHX 1TNTA 1S7AA 1ZLKA 1CGPA 3FKJA 3SDGA 2E7WA 2DPUA 4A3GJ 4JZTA 1GVJA 1UMQA 4CUGA 5FLXZ 2L5QA 2DXIA 4BBSJ 4XLFA 4LG0A 2B0VA 1UG2A 3IWZA 4L9TA 1XD7A 4Q5SF 4KTBA 4LB6B 2ZFUA 3ZQFA 4K6EA 3LSKA 1MMDA 4NQWA 1QBJA 4HNVA 2CV2A 2M34A 5D5UB 1ZRDA 2JSPA 2QSHX 2NS8A 5LRSA 1PJRA 1ZK8A 2I10A 2Q2EA 1MJAA 4AD9A 5F1RA 2MG4A 3S3OA 1X1AA 1JRKA 3TKYA 1DGRM 2Y48A 2XDVA 4RAGA 2EIMH 5EYRA 3S3NA 1JKRC 2JA2A 2KRFA 2FMYA 3L2RA 5LHGA 3PSFA 2EZLA 3N4MA 2ZXWH 1X1DA 4DOZA 2M0CA 3J7AY 1XCVA 4CCNA 1DUXC 4QPOA 3TW7A 3BM4A 4PGGA 2ECBA 5HVQC 2M4GA 1I50J 5CFJA 4I76A 3WU0A 4ETSA 3HGYA 2LSOA 3RDIA 3WE3A 4MNUA 2LF8A 1Z3YA 2GIVA 4JX6A 2PJPA 5LFAA 5LGTA 3BDDA 2GQQA 1ZG1A 4KN4X 3DEUA 2W82A 3GF2A 3EUHC 2LKPA 3Q0WA 2QYOA 4UUTA 3RQ4A 1MDMB 4E7SA 2XSDC 2D45A 2RREA 2IPQX 4A0ZA 1HOMA 3O6ZA 1E2XA 2CV1A 2MC3A 1IRXA 4HNUA 2Y75A 2M3AA 3TL4X 2LC2A 2M30A 3GFMA 4XBFA 1FYMA 2H27A 5H6QA 2CFXA 2AZWA 4XKWA 3SFIA 3FDYA 3BTJA 5IW4A 2D1VA 2JJ7A 2UWMA 2JPCA 4BY7J 5CYVA 1OFCX 2H09A 5F1JA 1MGTA 1JJ6C 2E5ZA 2KDVA 3HGGA 2OC6A 1EH8A 1B72B 5DCMB 4G7OF 2WAEA 4BBRJ 2VUMJ 5LHIA 2L7ZA 2HOEA 1YLFA 1LVKA 3GFLA 3HZJA 2NOGA 1DU6A 3M1CA 4HA8A 3X0NA 2KISA 4LB5A 1IN7A 3JRAA 1NQYA 3BR3A 4XSXF 1X19A 1TZLA 4ZDPA 2DBBA 4YG2F 4G6QA 2DFIA 4PJNA 3CCRI 2X6WA 2FF4A 5HS7A 1P4AA 2A6EF 2DMTA 1XN7A 3U9GA 2E2HJ 2OQGA 2MLGA 4WX9A 3ZR8X 5IOZA 3GZ8A 4JX5A 2L9NA 3SONA 4U7DA 1R00A 4W1UA 3W6JB 4ZTFA 4N1UA 3LSTA 3GZ5A 4QWQA 2QLZA 1SFKA 2R7XA 4KUMA 1QHGA 3L2QA 2R3SA 1Z0XA 1TLHB 2NRAC 1OJLA 2G7UA 2TRTA 1KU3A 4XR6A 4EJWA 9ANTA 3QSJA 4KIBA 3S1NJ 1OLTA 3KEYA 3FF5A 5C3EJ 3BR5A 3SXYA 4HQEA 4G6TB 1R5GA 3DTIA 3JSOA 4YIFA 1KHZA 1T6SA 5GTHC 1BJZA 3R0JA 2HXOA 5GPCA 4DW6A 1FZPB 3HBLA 1U20A 3GG6A 5IYCJ 4BY1J 1S5LC 1BW5A 1Y56A 4BAYA 2VQLA 5FFXA 1D3YA 3GWZA 4I01A 3R61A 2I5UA 1YX3A 3BJOA 2VB6A 2EFPA 4HZFA 6PAXA 4A3MJ 3HB9A 2AXLA 5J1RA 1U5TC 4ON0A 4YELA 1LE8A 3A2KA 3ID9A 3R0AA 3G71I 1X3ZB 1PPVA 3EUAA 1WI3A 3ELKA 1MH3A 2JSCA 1R1VA 3LSHA 3DU5A 3KYCB 1G59A 4D0PA 4NB5A 4DYRA 2O03A 1VHGA 1HKSA 3EESA 2R7QA 1YX5A 1S7OA 2MABA 1Z6TA 2DA4A 4KIGA 3RPUD 4HRIA 1SFEA 4L0YB 2OTJI 5GAGJ 1LPQA 2PMZN 3O8SA 4ZDLA 3VYRB 1F5TA 1CF7B 2XF5A 1YW8A 1A36A 2K9LA 1BIAA 4IRGA 3A02A 2BY1A 3PO3J 2Z3YA 4EATA 1PP7U 3AG1H 3F6VA 5CVJA 3TDZC 5IYDJ 4OMZA 3D5RC 2OUMA 1Z77A 2IGOA 3M9AA 4I0AA 5DCFA 2W7NA 5IP6A 4E7JA 3SHDA 1LDJA 3I4MJ 1R4NB 2MA3A 1ZN2A 3CUQA 3TGNA 1R71A 2FNAA 3FX3A 2WBMA 4I7HA 1N25A 1FPQA 5L3DA 2G7HA 4P9FA 2P5KA 2HVSA 1TWAJ 4D9JA 4WCGA 2EFWA 4XRMA 3E5UA 2L9RA 4MQVA 2E2IJ 2RGVA 4IOCF 1A35A 3GCMA 1Z9CA 3HDDA 2O1CA 5L3GA 3L00A 4A3JJ 5KAIC 2GT2A 2K3FA 2F6CA 3OIOA 1H9GA 3I4NJ 1FBSA 3BR1A 2RQQA 3HHJA 1IN8A 2BW3A 2XPUA 3IV5A 4NHJA 4C9YA 4L5JA 4PFPA 3EUHA 3BG9A 3ZMUA 1XSAA 1XMKA 2CUJA 2EV0A 3IRRA 2KT0A 1USTA 1ZKGA 3NARA 2MGQA 4YIRX 3D5SC 1MBEA 1Z1DA 2B06A 1ETQA 3I9V2 3GTOJ 2Z5UA 2HXIA 2ZCWA 3I59A 1Z3XA 2M1BA 2ZBKA 5BQTA 2I8UA 2XVCA 3KP5A 2VT3A 1VCDA 3I58A 3M4OJ 4DZJA 4ZYGA 1VFCA 2CO5A 5GADJ 4UV8A 3RKXA 2VN2A 2FQ3A 1JE8A 2W25A 4Y15A 2K5CA 2WA0A 4DJAA 3J7YJ 2NVUB 2D1HA 5J6XA 1C0WA 4NFWA 1YIJI 2O7OA 1K78B 4L18B 4XRSA 3GWYA 3OS1A 4M6YA 4FQGA 3DQVC 3CCVI 3TP0A 1E3OC 4O5VA 3BR0A 2DK8A 2B0LA 1MQEA 1RI7A 5J8CA 3FMRA 1BW6A 1LE8B 5IPAA 1DP7P 3A1YA 3CUQB 3FMSA 3H36A 4UY8I 5KHDA 3Q2SA 5GHJA 2L2OA 1O7FA 1B4AA 3D5LA 3JRHA 2JVHA 3A6UA 2HYJA 1MNEA 1VQ5I 1X83A 3BAPA 3H9JA 3LAPA 4CCKA 2Z9OA 1VQ4I 2K4BA 3U1KA 4MPOA 5FSKA 2IS4A 1T08B 1HLVA 1Q54A 3TO9A 4A2UA 3VEPA 1P2FA 1JUPA 1W4MA 1YQAA 5FFZA 3V8KA 3WTXC 4O3MA 2VLAA 1OCPA 2Q2EB 2GXAA 3KZIC 2EFNA 1QGPA 4H4KC 3GMEA 4DBQA 3LQQA 4OWRB 4M71A 3OGAA 4FE4A 5CPRB 1LDKB 3IUOA 5BPIA 2OV7A 3VYSB 4WWCA 1JXSA 5ISYA 3X0OA 3QPSA 2O61A 2E35A 3WU1B 3QPTA 2HOTA 4JOMA 3H3UA 1K26A 2PBIA 3RZDJ 3DBRB 4M6VA 2KZVA 4LLLA 3HPGA 2LTPA 2DA2A 3JAMZ 3C3WA 1TQPA 4EEFG 2F5EA 1SMTA 3GTLJ 3RKYA 5J8FA 3CTAA 3JCUC 1G8XA 4XLCA 3HXLA 2XV4S 2XRLA 5FLXK 5FSIA 2KIMA 3WGGA 2X6OA 1Y0NA 1T39A 3QP6A 5E20A 1WCMJ 3TW6A 1FC3A 4KNYA 2R7UA 5IP7J 2BGCA 4J19A 1FBQA 3DCFA 5FD6A 3HOTA 3BG5A 4TV7A 2LY9A 4RAYA 4DGWB 5ICEA 4BNCA 4CICA 3S1QJ 5GHOA 5GHMA 4EV0A 1T33A 2ZXIA 3K0LA 4Y3OA 4V14A 4OAZA 3LMMA 5JHUA 1XMXA 3BG7A 5J1UA 2XKPA 2LVSA 2W1OA 1U78A 5E1ZB 4XQFA 1PPWA 3SEZA 1WPKA 1I3QJ 3EEUA 3KYLA 4HX7A 4XIDA 3RQIA 5LHHA 4XN0A 2LKSA 1BC7C 5DD4A 3DFGA 3PL8A 3OYAA 1HW2A 4CDGA 2Y9YA 1MDMA 3M8JA 1K7AA 3ONQA 1J0RA 2OPTA 2ME6A 2KPMA 1R6RA 1T0FA 1JUSA 2WV0A 1Y39A 4G8XA 1D5VA 1G9QA 3LSIA 2R4GA 1H89C 2ECCA 3HTSB 1R4MB 5GHIA 4EJOA 3PUBA 2BHYA 4R8HA 4IF4A 2VXZA 2EQRA 2PQVA 3SFZA 5GPAA 3QOPA 1PDNC 2DK5A 4M73A 3GFIA 2RVCA 2V9PA 2XUBA 4LFUA 3E5QA 4WXDA 5KVRA 5JFRA 1W36C 1IRGA 2O5WA 3MCFA 3ERED 1R58A 3G1MA 4UUSA 3CUQC 3F8BA 1XPXA 3E7LA 2QVOA 5LGNA 3GRNA 1VQPI 3U1DA 1T56A 3FKIJ 1NFSA 2BY0A 4J01A 1BI3A 3I71A 3G73A 1A31A 3P7NA 4F3QA 2K27A 2FNPA 2VODA 4V19K 1DGWY 3IHUA 3I5UA 4E6KG 1MMGA 4IZZA 1MSFC 5F04A 3X0LA 3F8CA 4CO8A 4R79A 1R49A 2B9SA 3CDHA 3GLLA 2OJED 1TQIA 3P9IA 5C44J 4KG3A 4M9ZA 4E7KA 3O61A 3FK6A 2VE9A 2XPVA 1AU7A 2M9HA 2X1CA 3LA3A 3MZYA 3GTPJ 3OYNA 5M3FJ 4JZUA 5D8KB 3W3CA 1XS9A 3CJRB 4BQQA 4XN3A 1VI0A 5FJ8J 4E4HA 1A5JA 1NQZA 1PYVA 3HRSA 1NH3A 1MZBA 3K4CA 2OZ6A 2XKOA 3L2WA 4PCQA 2P5VA 4BE2A 4JZSA 3E1SA 2KQRA 4F7ZA 3L2CA 1YTYA 1T2KA 2LK2A 1SANA 2XB5A 1ZQ3P 4RGXA 2CU7A 4K2EA 3K4KA 3TBIA 3A01A 2DTRA 2FXAA 3CC2I 2IS2A 1X3UA 2V1DA 3SQNA 3F8NA 1D8JA 1GV5A 3MZ8A 1HCRA 3BZCA 3DBLB 1BR4A 3EDPA 2IXSA 2A6TA 5EZGA 1TT5B 2FUG2 2YX7A 1VRLA 2OAZA 3WTUC 1GVDA 2DOEA 2K7LA 2RNGA 4PSXA 3UNGC 2CFOA 2FU4A 2FA5A 4IKFA 3FK7A 5DM6F 3NQOA 1ZGJA 1JT6A 1MW7A 2E60A 4NUBA 2WV1A 1Q27A 1V8UA 2OCEA 3A4CA 2XF6A 4B48A 1IDZA 1RZ4A 2GA1A 3C2BA 2NVXJ 1ZG3A 5C7TA 5LLQA 4E7HA 1JHFA 3QYEA 4A12A 1IN6A 1V8VA 3JW4A 1XGOA 4WXCA 4C9WA 1JKOC 4D1QA 3CC4I 2CW0F 4XONA 2OU2A 4UUSB 3O6BB 4MFEA 2HDWA 3L9FA 4HNTA 4U87A 1X3WB 1LVAA 5H2FC 4KITB 2DOAA 2JT1A 3K7AJ 3MD2A 3J7ZI 1R1TA 4GRIA 1OCOH 3CNGA 1BA5A 3X0JA 1IUYA 3MKZA 3LFKA 3CESA 5LEJA 2HU9A 1TL8A 3Q0UA 2MW8A 4S2VA 2PEXA 1SVOA 3T8TA 3H92A 2HI3A 1H0MA 2STTA 1R22A 5F0FA 3DBHB 2XHKA 4CCLA 1QVJA 4HPQA 1I9AA 3S32A 4PJ0C 4DQ2A 3KP4A 1SJYA 1U5TA 3EQLF 1L3LA 5KCMA 3IAS2 4BL0B 2IBDA 3OYLA 2BXZA 4ABZA 3CP8A 2H94A 5ILVA 5K7HA 4HDUA 2LFBA 2ZSIB 4RGRA 1MBKA 3MFKA 2Z33A 5FO5A 1PUQA 1A6IA 3JR9A 2A07F 3FXOA 5EG0A 1WSUA 1MKMA 1LFUP 2O6GE 2RN7A 4PDKA 3EYYA 3ROUA 1NK3P 2RKHA 1PUNA 2DHOA 3HSRA 5IYBJ 3W2VA 1MR2A 2BYVE 4MO7A 4ESJA 2KIUA 3SYTA 2YVOA 1KQ9A 4A93J 2DDAA 4FISA 4ZYEA 2W00A 4D5FA 1V55H 4M3EA 2HVQA 4ENKA 1G3WA 1VQ8I 1MNMC 4IX7A 3RCOA 3IL2A 1OCCH 3RTRA 2HWVA 2NS0A 3WHWA 2BY2A 2WAQN 4YFXF 2E1NA 4IJXA 4KYXA 5HLIA 1O3SA 3KVHA 4B44A 1HW1A 3K4BA 5GHQA 4YRVA 1SD5A 4CYCA 2HVRA 5TGTA 2E34A 3CCEI 2YYHA 3F0CA 1LFPA 3RPQA 2R0QC 4HVYA 2VOPA 1R67A 2ESHA 2JN6A 5DM7F 3DLAA 4OAYA 3HTUA 5FSMA 3MMYB 2VBWA 4XRSG 3ABTA 3CJQB 3ASNH 3TOBA 1WKMA 3PNYA 5CVVA 1ZTRA 1K61A 4AVZA 4ZZDA 4EJVA 2E7XA 5M5YJ 2XASA 2VKEA 2F5VA 3RH7A 4LK0F 3VYUB 1MP2A 2OZUA 3CQZJ 2L4AA 3Q4IA 4X0GA 1J59A 1AKHB 3DWLE 1FYKA 3ZPLA 4KICA 3HHHA 1IRZA 1W5TA 2Y31A 1VNDA 1VTNC 4KJZA 4LLGF 3W6VA 3GTGJ 1M1EB 2HQAA 2YX4A 2QGUA 1HX3A 3HKZN 1QPIA 3BPXA 4HAMA 2RNJA 2JVGA 2W85A 3FHNA 4GFBA 3CP2A 4BUPA 3KEQA 1GDTA 4HF2A 3SDBA 2QQBA 4KFCA 4ZDOA 1V5FA 1OISA 2V1NA 3CF2A 1V8YA 5J4YA 4M9SA 2QM3A 4M3FA 2OA4A 2L9VA 1U3EM 1X1CA 2L7KA 4OU0A 3HYQA 2FOKA 4EJTA 1WZ2A 3OYEA 1TT0A 1TW2A 3N97A 5DD8A 3GLXA 4A0XA 4AWXB 1FEXA 2DA6A 2VJ4A 4FETA 5B5EC 1ZREA 4HEA2 4HF1A 3K9TA 4RGUA 3O52A 1WH5A 1PVFA 3A03A 1MJ9A 1UZCA 4XKCA 2XSQA 2LF7A 1WWXA 5CVUA 3BTIA 3KFWX 4ZTJA 2R7TA 3T5XA 1ETXA 2FBIA 5JR3A 3K70D 4BDZA 3DV8A 4MEXF 3OIQA 2XAHA 2NXNB 2HGCA 2MLKA 1BOAA 4NC8A 5FB2A 1SEUA 4EMSA 4KT6A 1UELB 5K5RA 3V4GA 2X51A 4FT8A 1Z05A 4IQ4A 3DEWA 1D1CA 4FX4A 3RKQA 3HRTA 1ORKA 2CUFA 2HQ5A 4II2A 3UKGA 1D1BA 2KJBA 3DTEA 4MTDA 3ZN0A 1FOKA 5A2QZ 5AIPA 2O5RA 1V8WA 3WG7H 2DA1A 3X2QH 3X0MA 3BWGA 2PN6A 2Q8KA 1Q33A 3LA2A 1MQWA 4HOBA 3KP6A 4IHVA 3OS0A 4LIVA 5ANVA 1R9TJ 3S1MJ 2R5YB 3NRVA 1TUMA 4J7HA 2KDZA 1YW9A 5HS9A 1G3SA 1MMAA 2L01A 3W6KB 1BJAA 2ETHA 3KEOA 3OYJA 1Z7UA 2UZKA 3DKYA 3ZOBA 3ML6A 4WK8F 3ZMZA 1BR1A 1SZ3A 1CQTA 3QYFA 4M3GA 1DP3A 1Y1VJ 2QF7A 3MGMA 1QZYA 2A8RA 1J2XA 3REOA 4LG3A 2CMPA 2V6EA 4C9XA 3J81Z 4I2OA 4PJJA 3A0HC 2HR3A 4M74A 2J5OA 3S14J 3H35A 1Z91A 5IOYA 3WE2A 1LNWA 1YS6A 4FE7A 1A04A 3F21A 1O3QA 3L7WA 3FHZA 2CRGA 3ABKH 3C7JA 3COAC 1B9MA 1TWGJ 2LDUA 4BQNA 4BH9A 3DLLF 3KLOA 3JTHA 4P5OA 3K4MA 3ZRGA 2CZRA 5HZXA 1YIOA 1MSEC 2K3PA 3H95A 4AVPA 2QENA 1Z6RA 2IA0A 3WHBA 3A6VA 1I3AA 2DFHA 1WRJA 2DMNA 3QQAA 4AUXA 2O9LA 4YEJA 2CYYA 2EZIA 2L54A 2LMDA 3BTCA 2LYCA 5AIQA 4AM3A 2CG4A 2GXGA 3BLYA 3HUGB 3R60A 4BYYA 1Y8RB 3IKTA 2QJTA 2IS1A 3RKWA 3C2GA 4S04A 4YPRA 1WJAA 5C7QA 1FNNA 3FISA 2STWA 1F43A 4CH7A 3GZ6A 5E8IA 5IT9Z 5LD2C 2ISZA 4RLFA 1J09A 2FQ4A 1P4WA 4CSWA 5FLVA 2AQFA 3HOSA 2E1CA 3IRQA 3G0QA 5JVTA 2XGCA 1IGNA 5J1YA 4HDVA 1X4OA 4KT5C 4HF0A 4RMNA 5LBQA 2WAQA 2P81A 1D5YA 4B47A 3HOVJ 2NVQJ 1F1ZA 2M45A 1JKQC 4CCJA 4RA2A 1G3TA 5FRNA 1VQMI 2R5ZB 2F4IA 3QPHA 2VPRA 4AIHA 2P8TA 2L7FP 4DYQA 2VT2A 1U8BA 2EK5A 1ZR4A 4X6AJ 4YFKF 2LREA 3K4NA 4JP0A 3WODF 2MD0A 4N9IA 3JRGA 3E0JB 1SVMA 4JX4A 2GT4A 1W1WE 4KMFA 4JZVA 4Y4RA 3BJ6A 3FK9A 4KISA 1X1BA 2JZYA 1V4RA 1YJWI 3ZQ7A 4LGWA 1E3HA 5KK1A 4P96A 1REPC 3BZKA 3MDGA 5DYMA 3F23A 3MVPA 3BCBA 4U88A 2JUCA 3CLOA 4IHYA 1TBXA 2DDBA 4BU2A 1DPUA 3EUKL 5B1AH 5EGOA 2Q1ZB 1J75A 1VQLI 2NS7A 3U2RA 3JRDA 1EF4A 1OKRA 2J5PA 1PP8F 4MTEA 5FD5A 3CUOA 5H6RA 3K70C 4A3IJ 3LSJA 3BHOA 2DJNA 5F6FA 4E7IA 3S17J 3AL0C 1YOVB 4OIQF 3TEDA 1WJCA 2P4WA 4DYCA 4PGHA 1BN5A 4HV5A 5C4XJ 1O3RA 3OR1C 1T95A 2M8GX 3HRMA 2D5VA 1V8RA 2PMUA 2HOSA 4HFQA 2LR8A 2XGXA 4Q48A 4IHSA 4LJZF 3O2PE 4DNCA 3H9QA 1RRJA 1RNLA 1FLIA 4A3FJ 3L2UA 3HL2A 4IHWA 2A5YB 3HEFA 1KU9A 2A3SA 1WFXA 3BPVA 4NNJA 4OIRF 4ZYHA 2L7MP 2ELJA 2R7OA 3E97A 1Q1VA 3JRIA 1XSVA 1TQMA 2LH9A 1SVLA 1JUMA 3ESWB 1FSEA 3HHGA 4U0VA 3ZMDA 1S72I 4F92B 1XC5A 5IT9K 4B1RA 1O3TA 1YHQI 2V1UA 1XGNA 1VHZA 1ZGAA 1VZ0A 1IZ1A 2DT6A 2VC0A 3WHCA 3GXOA 4IRIA 2R7SA 3LA7A 3MZHA 4M6XA 2QBYB 2M7BA 2F5CA 2CS3A 1SD6A 4JK1X 3S15J 3E6DA 4LIUA 1WJ5A 2IW5A 2O0YA 3PNTA 1YJNI 2QBYA 1L0OC 3ERMA 3PFYA 3J7AO 4BXXJ 2L9SA 2HKXA 1V8MA 1I1GA 4NDLA 2Q0OA 2KRCA 4Y13A 3MQ0A 4KMUX 4HSTA 4KIFA 5EGOB 1FSHA 3FBIB 2RV8A 2Y9ZA 2QJOA 2M4KA 1GT0C 2HZDA 3FZVA 2JA7J 5F0HA 1W7PA 1AA7A 3MDIA 2IA2A 5E18F 4A3EJ 2VKVA 1VQ6I 2DUKA 3ZQIA 4L5IA 1WGXA 4NC6A 1U0JA 1ETOA 3A6SA 2Z1DA 4LK1F 3F6AA 2EH3A 2K86A 1K4SA 1P6RA 1GXPA 3E6BA 3F22A 3FJYA 2MH9A 1IJWC 1YRNA 5FSLA 1UAAA 1MBGA 4C2MJ 2R7DA 1B59A 2DFEA 2GBYA 2C6YA 2DSCA 3IH3A 3RIRA 4RBOA 3HC7A 4EM1A 3S16J 4BHPA 5F08A 2PJRB 2VPLA 2DU9A 4CYDA 4JBAA 2Y69H 4WF2A 3Q5FA 1W5CC 1V8IA 2XAFA 1PUFB 2ID6A 2HPMA 1BR2A 1JTYA 2PNYA 1MBFA 2NOJB 1TWCJ 3N05A 4HSRA 3ZXSA 1RC9A 3OYGA 3IWFA 1F4KA 2PLYA 2KIQA 4RAZA 1NG7A 4AIKA 2VOOA 1X84A 5GTIC 4RB1A 1E3PA 3R03A 4AC0A 3LSRA 5JHFA 2ZXJA 2EV5A 5A2QK 4Y17A 4HX8A 2FD5A 1T0FC 5FKOA 3C18A 5CFIA 5D4RA 1V8NA 4NBQA 1G3YA 2MD5A 2AHQA 2P6TA 4GDFA 1ZRCA 2M0MA 4F55A 3P5JA 3CCSI 2CSOA 2GIZA 4UVAA 4PJLA 2ZB9A 3CDIA 3KCCA 3B6AA 2VNPA 1HZTA 5EJCA 2FBHA 3CLQA 3GZNB 3COUA 1BL0A 3PO2J 1BOBA 2R7ZJ 1XTAA 1JGGA 2QQ9A 1HC8A 2PMHA 1UG0A 2VJ5A 3OSGA 2HOAA 1FJLA 1D0XA 3A0BC 4F91B 4A3KJ 2ZJ2A 4PFOA 2Q9PA 2H1LA 1DPRA 3DUPA 5JI6A 5CQGA 2QWWA 2XIGA 3BJAA 3WU2C 5EEHA 2GWRA 1WVRA 3RPUA 2Y0SA 5ANUA 3HSEA 1IXSB 3FM3A 1ITYA 1YFHA 1MD0A 4BEHB 3H5AA 1OR7A 2N8GA 5LEKA 1LQ1A 2A8TA 5ILSA 4KN7X 3ZMVA 3Q1PA 4B4CA 4QLCU 1D0YA 3A6TA 5FRMA 4B3XA 2DT5A 4U0WA 3WG9A 3JSPA 5E17F 4YPHA 1K4TA 2XAQA 2WAFA 2VJIA 4CCMA 2ZXHA 4EQQA 3KP3A 2XC7A 2MH2A 3B02A 3X0PA 4W97A 2X4HA 3OOUA 3KETA 2B63J 2E19A 4GYGA 2EA4A 1H8AC 3CCUI 1T98A 1F3YA 1FWZA 2WWYA 4RB0A 4IJAA 1JJ8C 1X1PA 2EA2A 2UV1A 2ISYA 3W2WA 1JKPC 2OF7A 2F2EA 3M3YJ 3K2AA 3ZCOA 1R36A 4ZG0A 3PFIA 3QODA 1YS7A 3QU6A 4LITA 3GO5A 2DSBA 2NNNA 5AONA 4XLNF 3PQKA 1XSDA 4QPQA 1XGMA 3MN2A 3QWLA 1QQIA 3I9XA 1BI0A 1PVEA 1TP4A 2NVYJ 3GTKJ 5D5WB 4AYBA 2CQNA 4A5NA 2GZWA 2VNQA 2FOWA 1HQCA 5C4JJ 1UJ8A 3CF5F 1W0UA 2EJRA 2NAZA 4G94A 3VPRA 4DBRA 4OMYA 3HSFA 5HS8A 4MQ9F 2HDCA 4OOIA 3I7VA 3QYBA 5D4SA 2EZKA 4Z6YA 1J5YA 2QSFX 2BW3B 3H9GA 4C3IJ 5E3LA 3BQYA 4HLXA 2ZMEB 2JRMA 4OINF 3F13A 3K1PA 4UV9A 3UR3C 3CDLA 3HOXJ 4PJMA 4JYKA 4OIPF 3JTGA 3OSFA 5LGUA 1JT0A 4CZZA 4A3CJ 1EH6A 3PIOF 5BONA 3RYPA 1XX5A 4IXAA 3ECOA 1I1SA 3CCJI 4M9XA 1Y6IA 3OWTA 2DN0A 3FXUA 4XICA 4UHTA 1JTXA 3B73A 1IN5A 1IC8A 3HPHA 2EINH 1XDSA 3G3ZA 3R6SA 2VC1A 3CCLI 3L09A 2ZKZA 3GVAA 1X4PA 3L2VA 1QU3A 3ZR0A 4N1TA 4CZCA 1HKTA 4A0YA 1OR7C 4L9NA 3K1NA 3RJPA 2XRNA 3PNVA 3LQRA 2XAJA 3I55I 1AOYA 1G2HA 2Y30A 5K5OA 1NHAA 3CZ6A 3OYFA 2P6SA 1OYYA 3RZOJ 4I09A 2YU3A 2DQRA 2VL8A 3HRUA 4MEYF 4EGZA 2ZNZA 4HW0A 1ZRFA 4I99C 1FTZA 3P5TA 5L3EA 4J00A 4XKBA 2R7WA 1W36D 1BBYA 3GW2A 4KYWA 2R7VA 2VBZA 4GCVA 2EIKH 2HYGD 1S8NA 1VQ7I 3KIOA 4ZH4F 2W57A 2EZHA 2EPFA 1ZR2A 5BMZA 3MKWB 3PQJA 1F9NA 2NNYA 2HKOA 2V7FA 3OY9A 1QRYA 1DDNA 5HLHA 1IRYA 3HOZJ 5IW5A 2VE8A 1O57A 3VWBA 5GHNA 3H0DA 1R5HA 2XF7A 1Y1WJ 4BEHA 1TC3C 2COBA 5CLSA 3V7SA 1R5ID 1JHHA 2DTZA 2R5WA 5ILUA 1YG2A 2COMA 4XOTA 2ZJPF 2DW4A 1Z7LA 1QO0D 3EF5A 3DPLC 4MLOA 2O3FA 3GEZA 1QZEA 5EG0B 2VQGA 3HOUJ 4UB8C 3OOPA 1YO5C 4PUSA 2A69F 2XSJC 5IP9J 3K1MA 3TOAA 4CYCB 1F36A 2ZJRF 5DEQA 2X0LA 2K02A 4A69C 4ESBA 3OYCA 4BDYA 3OL3A 2EILH 4AIJA 2QA4I 2M87A 1I6HJ 2IRFG 5DDGA 3BG3A 1IN4A 3FFUA 5HLGA 3G4SI 2NYXA 2A61A 4RB2C 4ICKA 1HA8A 2ZMEA 2QCOA 4IO9F 1G0SA 3X0QA 3HOYJ 2EWNA 1FOXA 2FBKA 5DTDA 3OIPA 3H5RA 5GP9A 1I5ZA 3QAHA 2UXXA 4B43A 1ETVA 5DV5A 1HSJA 4O6JA 4RGSA 4L9JA 4N9HA 2AXTC 1H88C 1FP2A 3IP4B 2YSRA 3VDXA 1ETKA 2E5NA 1XSBA 3DEEA 1QVUA 4L9VA 2W4EA 3J7Ye 2TDXA 2F4MB 1U9NA 1ZGWA 1KZHA 3K69A 4B3AA 2CW7A 3SZGA 2OBPA 3GX4X 2DA5A 3S2WA 3BY6A 1XGSA 3EPZA 5ED4A 1QVTA 4I6ZA 4BHBA 3ABUA 5HDGA 5J4VA 1MK1A 3M8EA 1GLNA 1ZYRF 3ISPA 3KYDB 1RR8C 1RR7A 1X2MA 1EA3A 2DODA 2K40A 5CVRA 3DP7A 2GOXB 3CMAI 3V42A 4M3DA 3EYIA 1DQUA 2E1MB 2YUSA 4RS8A 3KP7A 2R92J 3DTKA 3FM5A 3P9KA 1AKHA 2EIJH 3BROA 5D8LB 2LD5A 1ZLJA 2K85A 1QHHD 5J3LA 4ZC3A 5IY5H 3DXJF 2FE3A 3QPLA 1DU0A 2MSYA 1ETWA 5KNLA 3LSGA 2Z16A 1PPXA 2CL3A 2WY8Q 1SFUA 4KG4A 3CCQI 3GUDA 1X51A 1FBUA 2ME0A 5CKTA 2ZSHB 2VKHA 1I6XA 3PSIA 4HX4A 5L3CA 1S9HA 2X48A 2CV0A 4GGGA 2IJLA 3PM1A 3TO6A 4A6DA 2BY3A 2F4OB 4Q47A 2E1OA 1OYWA 1SFXA 3HYIA 2KDWA 1MNDA 2LBFA 2K9QA 4XORA 2FX0A 4PSWA 2E71A 2FRHA 3I56I 4BXUA 2VONA 4U0YA 4D5CA 4P55A 4XOPA 4I02A 3MAJA 1KONA 2DFFA 1IG7A 4RAFA 1XCBA 3BCAA 4RDUA 3A01B 2BZTA 4MHGA 3S3MA 1NTCA 1IO2A 3KE2A 5L3BA 4HQMA 3J80K 3OYDA 1BI1A 1ONVA 3AG2H 2BBYA 4Q4ZF 3LAJA 1ZAOA 4N4NB 2P7VB 3K4LA 1KT9A 3JRBA 4DYWA 1XMAA 2FKBA 4L0ZB 2BVMA 2ELKA 2X1EA 3MEXA 2P5LC 3KLNA 2V4JC 2ACJA 2IT0A 1VQNI 4I0BA 1MH4A 4C3JJ 3O69A 1HKQA 2KRHA 2MYSA 3V7RA 5E1WA 4CA0A 2CJJA 4E70A 5FGMA 3VODA 1I27A 1P4XA 3VOEA 4BJTA 4BXFA 3P6YA 1KU7A 3FXLA 1GUUA 1U5TB 3ABMH 3H0GJ 2I8TA 2M2EA 3K4JA 2CQQA 2PMZA 2DYRH 3R4KA 4N4OB 4E7ZA 1QPMA 4J7GA 3JRCA 3DPTA 2VBYA 5BNGA 1YW7A 3FXMA 1OCZH 3PIPF 3QRFF 1XB4A 3G2BA 3VFZA 1I39A 5JLWA 1ERDA 3MKLA 4NC7A 1O7LA 3KPHA 1K83J 4M72A 2HZTA 3AG3H 2A8SA 4BQAA 4GO1A 3AC9A 2V26A 1FMVA 1HSTA 1FX7A 3D1NI 3CCMI 1NK2P 1VIUA 3I64A 4PZJA 1EJ9A 1KU2A 2RQPA 4RB3C 1EKEA 1QZZA 5K5QA 3QP5A 3M07A 2AS5F 2PI0A 5KAFC 3N9UA 2AO9A 2QSGX 1KQ0A 2DMPA 1OQYA 3AG4H 1RETA 2QKMB 5DUKA 3KZZA 4FASD 1VC9A 4YIIA 3T8RA 3WTYC 1MBJA 1STZA 2DSDA 3VB2A 2ICJA 3F3XA 1TTYA 1RPWA 2KHMA 2VQCA 3BR6A 1KTGA 1WI9A 3VSLA 4FHTA 2GAUA 3L85A 2JMWA 1FOWA 1HW5A 5ICFA 3BC8A 4BJ6C 3CMYA 4CGZA 1XDUA 3E3VA 2KFDA 2PJRA 4HYEA 4S05A 1FY7A 1WH7A 2ZNYA 5TJJA 5C8LA 2QKLB 3AAFA 2PQ8A 2DT7B 3GBGA 2H8RA 3WGIA 1S6LA 2R7RA 1IW7F 2F5DA 3DF8A 5E3OA 2A8QA 1V5EA 4H0EA 2RRKA 2YR2A 3SEQA 2GXBA 3SMDA 3M7GA 4D7NA 3OR2C 1HF0A 1U6GA 3RI4A 4BACA 3HG9A 4GXOA 2ZFWA 3FXJA 3VSKA 1V8TA 4ASNA 2CUEA 5GAEJ 3JREA 2XGEA 4HBLA 1R7JA 3S93A 1Z21A 1LJ9A 3SHFA 4KA4A 2BOLA 5FKKA 2A8PA 3NAUA 2OD5A 4E7LA 1OPCA 5IT3A 3HUGA 1IV8A 3NEUA 2A05A 4ILQA 4XNFA 2EFQA 1RRQA 1IRFA 1RESA 1KYWA 1LKXA 3E6MA 3PUFA 2K9SA 1IAWA 4P9UA 2WB1N 5CQEA 3X0IA 1U9OA 4EVIA 2MBFA 2RAEA 3EETA 4MIMA 2QQAA 5FKNA 1KQ8A 1BI2A 2BVLA 4ENMA 1RUNA 4RM2A 4HLYA 5B66C 5J47A 4BE0A 1E17A 4EGYA 5E3NA 3HOWJ 1W7PD 2YS9A 3IH2A 4A6EA 5BS6A 4UUVA 2LBFB 1SD7A 1B9NA 3T1BA 3ZP5A 1LEBA 2KL4A 3GTMJ 1P7IA 1PUSA 2O8KA 2BHZA 3ZQGA 2IAIA 1FMWA 5ICGA 3Q91A 5LRRA 2VIXA 4FTHA 1O4XA 1W0TA 2KLOA 4XLPF 1B8IB 3U21A 4II3A 2H6CA 1N77A 2IGNA 3OS2A 2KP6A 1YE9A 2LLKA 2HTJA 4ENNA 1T38A 3WTWC 1WJFA 3H1CA 1K79A 2EV6A 1Y8QB 2UUZA 2HEOA 1MUTA 1E0EA 5LPGA 2IS6A 1RKWA 2H6BA 2X9DA 3Q0VA 5FKMA 4IQJA 3I59B 3BQZA 1SFOJ 3I0TA 2R93J 4YFNF 4BE1A 2WC2A 1AWCA 2LY2A 5HDKA 3CJTB 3E57A 2VKDA 2IVMA 1MMNA 2M7AA 2ZMEC 5E79C 2OCCH 2HFHA 4L5EA 1U8RA 2XPWA 3ZR1A 2R5ZA 1WHUA 1OMIA 3KX2A 3I4PA 2DMUA 3MKYB 3RYRA 1RIOH 1VC8A 1SD4A 1IUFA 4N0BA 1Q1HA 5HNFA 4CCOA 2W24A 4LMYA 3P9CA 4A3LJ 3DKUA 3AKZA 2JA8J 1VQ9I 4F93B 3KZYA 1NFZA 1D0ZA 1SU2A 2G73A 4RLQA 1IXRC 1SMYF 5F27A 3V8JA 3OYBA 3ECHA 3B6CA 1BM9A 5ANWA 5E3MA 3HKZA 4XKVA 3MCZA 2OTLI 3GTQJ 5DPKA 2JA6J 3JAMK 4IEJA 3FXQA 4G7ZF 2E2JJ 5FSOA 1T8IA 2KDOA 1WJEA 2CUZA 2RC4A 5CJ9A 5HODA 3G1LA 3QOEA 4BHCA 4DZPA 1V3FA 2A68F 4UVBA 4BJ5C 1HBXG 4BKXA 3FIWA 2KZGA 3F8FA 1JI8A 1OW2A 3OYMA 1S3JA 1TWHJ 3CO7C 5E1XA 1S29A 3WTZA 1Z67A 2Y2ZA 3Q93A 2VASA 2K9NA 5HDNA 1TW3A 4UB6C 1GHCA 2XB0X 4CHUA 3H5NA 5TRDA 3C1DA 2Y0SN 2VQHA 2HNHA 2B7EA 2ZJQF 3U53A 1HDPA 1EV7A 2JWTA 2YVNA 3ZQQA 4XLEA 4ITVA 2CQKA 1HDDC 1PUEE 4Y33A 2BE5F 1LEAA 3DKWA 3S2HJ 4G6DA 3LSMA 4XSZF 4HV6A 3CMMA 2HQRA 2JRTA 3O8HA 4A5MA 4XM3A 3TDUC 1A6QA 1UCRA 3BTLA 3TP3A 2GB5A 2DOFA 2DLLA 1RKTA 5B3SH 2YVMA 4AIDA 2DPDA 1QNTA 3SZTA 2GOMA 5FKLA 3G6EI 3S2DJ 2IEKA 5GAHJ 2AQEA 4QIWN 5BOXA 4EJUA 3M1EA 2ZO4A 3M8FA 1UB9A 2D2WA 2FEZA 5DS9A 2JVBA 1POGA 2DYSH 1YYVA 3OYKA 3OL4A 2L0KA 5CVIA 1KA8A 1FP1D 1S7EA 2V1XA 2O5FA 3OYHA 4P1WA 1G6NA 2JUGA 3O3KA 1R23A 2WY7Q 2QQ8A 3VYTB 2DJIA 4S2WA 2F48A 3Q9VA 1K78A 2L3DA 3H3ZA 2R5YA 1VF9A 1XG1A 2JQ7A 5HOOA 3LOCA 5EEAA 1ZG5A 2X6YA 4LD5A 4Y7NJ 1ON2A 1V54H 2VBXA 4X1EA 3EXQA 1J7KA 2Z99A 1UHWA 2LNBA 2X85A 4NFXA 1R1UA 4BS9A 1FYLA 2PG4A 2KIFA 3O8GA 1OCTC 2G74A 2UXNA 3LSPA 2JK3A 1OYIA 3KP2A 5ANTA 2X1DA 3L1PA 1IDYA 1LDDA 2WB1A 3SZPA 5GHPA 4ESFA 5J40A 2GLOA 1TNSA 2BEOA 4UXNA 3ABLH 1W5SA 2LKXA 5JLXA 1K6OA 2V79A 2MFZA 2M5WA 2CQXA 1B72A 3CD6I 2CW8A 1D8KA 4ZZLA 3ZMTA 4MFDA 3OYIA 1J9IA 4G7HF 3ACAA 2L4MA 2J8QA 3WTVC 1FIPA 3LL7A 1SOIA 3X0KA 4S2XA 4B8XA 3FSPA 1MMSA 3HIFA 4BGDA 1SAXA 2DCEA 1USSA 2XAUA 2RDPA 1ULYA 5BPDA 1KGSA 2GA2A 5HNHA 3F9KA 3T0YA 2ID3A 3I54A 3F8MA 3CO6C 3G1OA 2ESNA 2I6KA 4FCYA 1V8LA 3FCMA 3F72A 3MWMA 1AHDP 2L02A 2Y0MA 2QEXI 1FIAA 4UNOA 4D7MA 1IXCA 2VI6A 4QSHA 2ELHA 1QA6A 5FROA 4KDPA 2O8XA 2A6HF 2IP2A 5H20A 2FVVA 3S8PA 2JA5J 2HYFA 2BXYA 3BG6A 2LOOA 3E6CC 3IH4A 3Q9SA 4YOQA 3ULQB 4Y52J 2XAGA 5M5XJ 2G9WA 5DCMA 2V9KA 1ODDA 4IL6C 3GFJA 3ZMSA 1ETYA 2CGPA 2X6XA 4XMYA 3F6OA 3BT9A 5EDNA 1B8IA 2V9VA 3JRFA 5ICCA 2EFOA 5DUIA 1CF7A 1H9TA 4ANJA 5M5WJ 1EH7A 1D1AA 2V6CA 4XL9A 2DI3A 1MBHA 2HTSA 3FBNB 2ICWG 1UHSA 3BOQA 2KJCA 4XLHA 5F0CA 2P7CB 2QUFA 1NG6A 2DAOA 3DU6A 4NQWB 4FX0A 1IF1A 4ENJA 2NVTJ 3X0SA 1IV6A 5E8GA 2TCTA 5EEGA 1ACIA 1B6AA 2YPRA 3FWEA 4AYBN 2EB7A 4C2UA 4LLNA 2M8EA 3TMOA 3OMYA 5HLTA 3J80Z 1SAUA 2PX9A 4RM3A 4CXFA 2WADA 1VQOI 4ZJZA 5K7FA 4EM0B 4V2FA 5K1YA 3DPUA 2WTEA 4MGRA 1B1BA 3DKXA 4XLAA 4PK4A 4JQFA 1XSXA 1G4DA 1RUOA 2DQLA 1K2EA 2KMUA 2VJJA 1WQ2A 4C2TA 4IPAA 4S2YA 3K10A 2A5WA 2K4JA 1ZHFA 1K6YA 1WJBA 2E36A 2HPIA 2VXDA 5D6EA 2JTVA 2QZ8A 1SC7A 3AL0B 3H3VK 1N75A 3TO7A 2H1KA 1Y0UA 4QTRA 3IAM2 4ZYDA 4WXHA 5B1BH 1U2WA 3QU3A 4C3HJ 1X58A 3BR2A 3LWFA 1P9QC 1P7JA 1WJDA 5D5XB 2ZC2A 2MC4A 3LFUA 4A3BJ 4A3DJ 5EZHA 4C30A 3HM5A 3ZGKA 1HXDA 4R1HA 4UVCA 3CC7I 4XRFA 2W4SA 1KYZA 2Z2SB 2I8DA 4Z2YA 2K9MA 3BP8A 4I98B 3I3LA 4LG0B 5I8UA 3FMQA 3HJEA 2HS5A 4BQOA 2LG4A 3V7CA 3CJNA 1FT9A 2HQNA 4IVNA 5D5VB 4LOCA 3J81K 2DA3A 3CCYA 1YJ9I 4GYIA 4OIOF 3FXKA 2FSWA 5ERIA 2IGKA 3ZQHA 3LNQA 3Q3SA 1GA7A 3ASOH 1LB2A 4EM2A 2XGDA 1XSCA 2P0WA 1YI2I 4XK4A 5EF6A 1LUJB 3N77A 2HDDA 1BIBA 3GTJJ 3OV8A 5D6FA 3RSNA 2B2KA 1X2NA 3IC7A 3WTSC 1ON1A 1FTTA 5F64A 4S0HB 4B09A
chains in the Genus database with same CATH topology
5ANSA 2R7FA 1JKNA 3X0RA 1JGSA 5L3FA 2BV6A 1BC8C 4U7BA 1RRSA 3K2ZA 2ICKA 2OQRA 2YVPA 2KKOA 1RYAA 5FSNA 1ZARA 1MJBA 3FXRA 3I53A 1VIQA 3D0SA 2PFBA 2F5FA 2CWEA 3WGHA 2DO7A 3IKVA 2XROA 3E5XA 2W84A 3WTTC 1VK6A 3ZN1A 4G9YA 3Q2TA 1GXQA 2JPBA 1V8SA 1P92A 3V8LA 2IA1A 2FMLA 1UFMA 2ADUA 3I7UA 3TQNA 3BZ6A 4IRHA 4IHTA 1W7PB 1ZH5A 1UHMA 3GYHX 1TNTA 1S7AA 1ZLKA 1CGPA 2E7WA 2DPUA 4JZTA 1GVJA 5FLXZ 4LG0A 2B0VA 3IWZA 4L9TA 1XD7A 4Q5SF 4KTBA 4LB6B 4K6EA 4NQWA 1QBJA 5D5UB 1ZRDA 5LRSA 2Q2EA 1MJAA 4AD9A 5F1RA 1JRKA 3TKYA 2Y48A 2KRFA 2FMYA 5LHGA 3N4MA 1XCVA 1DUXC 3BM4A 4PGGA 5HVQC 5CFJA 4ETSA 3WU0A 3WE3A 2LSOA 3RDIA 4MNUA 2LF8A 2GIVA 2PJPA 5LGTA 3BDDA 2GQQA 1ZG1A 4KN4X 3DEUA 3GF2A 2LKPA 2QYOA 1MDMB 2D45A 3O6ZA 2IPQX 4A0ZA 1E2XA 2MC3A 2Y75A 2M30A 3GFMA 4XBFA 1FYMA 2H27A 5H6QA 2CFXA 2AZWA 5IW4A 2D1VA 2UWMA 2JPCA 5CYVA 2H09A 1MGTA 2KDVA 1EH8A 5DCMB 4G7OF 5LHIA 2HOEA 1YLFA 3GFLA 4HA8A 3X0NA 4LB5A 1IN7A 1NQYA 4XSXF 2DBBA 4YG2F 4G6QA 2DFIA 2FF4A 5HS7A 1P4AA 2A6EF 1XN7A 3U9GA 2OQGA 2MLGA 4WX9A 3GZ8A 3SONA 4U7DA 1R00A 3W6JB 4N1UA 3LSTA 3GZ5A 4QWQA 2QLZA 4KUMA 2R3SA 1TLHB 2NRAC 2G7UA 1KU3A 4EJWA 3QSJA 4KIBA 3FF5A 4HQEA 3SXYA 1R5GA 3JSOA 4YIFA 1KHZA 1T6SA 3R0JA 1FZPB 1U20A 3GG6A 4BAYA 5FFXA 1D3YA 3GWZA 4I01A 3R61A 3BJOA 2EFPA 4HZFA 6PAXA 2AXLA 1U5TC 4ON0A 3ID9A 3R0AA 1PPVA 3ELKA 2JSCA 1R1VA 4D0PA 4NB5A 2O03A 1VHGA 1HKSA 3EESA 1S7OA 1Z6TA 4KIGA 3O8SA 4L0YB 1SFEA 1F5TA 1CF7B 1YW8A 1BIAA 4IRGA 2Z3YA 1PP7U 3F6VA 5CVJA 3TDZC 4OMZA 3SHDA 3M9AA 4I0AA 5DCFA 1LDJA 2MA3A 1ZN2A 3CUQA 3TGNA 2FNAA 3FX3A 4I7HA 1FPQA 5L3DA 2G7HA 4P9FA 2P5KA 4WCGA 2EFWA 3E5UA 4MQVA 2RGVA 2O1CA 1Z9CA 5L3GA 3L00A 2GT2A 1H9GA 1FBSA 3HHJA 1IN8A 4NHJA 4L5JA 3EUHA 3ZMUA 1XSAA 1XMKA 2EV0A 3IRRA 1USTA 1Z1DA 2B06A 2Z5UA 2ZCWA 3I59A 2M1BA 2ZBKA 5BQTA 2I8UA 2XVCA 3KP5A 2VT3A 1VCDA 3I58A 4ZYGA 2CO5A 4UV8A 3RKXA 2VN2A 2FQ3A 1JE8A 2W25A 4Y15A 2D1HA 5J6XA 1C0WA 4NFWA 1K78B 4L18B 3GWYA 4M6YA 3DQVC 4O5VA 2DK8A 2B0LA 1MQEA 1RI7A 5J8CA 3FMRA 1DP7P 3CUQB 3FMSA 3Q2SA 5GHJA 1O7FA 1B4AA 3D5LA 3A6UA 1X83A 3BAPA 3LAPA 2Z9OA 2K4BA 4MPOA 5FSKA 1Q54A 3TO9A 4A2UA 3VEPA 1P2FA 5FFZA 1W4MA 1YQAA 3V8KA 3WTXC 4O3MA 2EFNA 1QGPA 3LQQA 3OGAA 4M71A 1LDKB 5BPIA 4WWCA 1JXSA 5ISYA 3X0OA 2O61A 3WU1B 3QPTA 3H3UA 1K26A 2PBIA 4LLLA 3JAMZ 3C3WA 1TQPA 2F5EA 1SMTA 3RKYA 5J8FA 3CTAA 2XV4S 5FLXK 5FSIA 2KIMA 3WGGA 1T39A 3QP6A 5E20A 1FC3A 4KNYA 2BGCA 1FBQA 5FD6A 3HOTA 4TV7A 4RAYA 5GHMA 5ICEA 4BNCA 4CICA 5GHOA 4EV0A 3K0LA 4V14A 5JHUA 2XKPA 1U78A 5E1ZB 1PPWA 3EEUA 4HX7A 5LHHA 1BC7C 5DD4A 3DFGA 1HW2A 4CDGA 1MDMA 1K7AA 1J0RA 1T0FA 1G9QA 2WV0A 4G8XA 1D5VA 3HTSB 5GHIA 4EJOA 4R8HA 4IF4A 2VXZA 2PQVA 3SFZA 3QOPA 1PDNC 2DK5A 4M73A 3GFIA 2RVCA 2XUBA 4LFUA 3E5QA 4WXDA 5KVRA 5JFRA 2O5WA 1IRGA 3MCFA 3ERED 1R58A 3CUQC 3F8BA 2QVOA 5LGNA 3GRNA 3U1DA 1NFSA 1BI3A 3I71A 3G73A 3P7NA 2K27A 2FNPA 2VODA 3IHUA 3I5UA 3X0LA 3F8CA 4CO8A 4R79A 3CDHA 1TQIA 3P9IA 4KG3A 4M9ZA 3O61A 2VE9A 3LA3A 3MZYA 4JZUA 5D8KB 1NQZA 3HRSA 1MZBA 2OZ6A 2XKOA 4PCQA 2P5VA 4JZSA 4F7ZA 3L2CA 1YTYA 1T2KA 4RGXA 4K2EA 2DTRA 2FXAA 1X3UA 2V1DA 3SQNA 3F8NA 1D8JA 3EDPA 2A6TA 1VRLA 2YX7A 2OAZA 3WTUC 2K7LA 2FU4A 2FA5A 3NQOA 1ZGJA 1Q27A 1V8UA 1RZ4A 2GA1A 1ZG3A 5C7TA 5LLQA 1JHFA 4A12A 1IN6A 1V8VA 3JW4A 1XGOA 4WXCA 4C9WA 2CW0F 2OU2A 3O6BB 3L9FA 1LVAA 2JT1A 3CNGA 1R1TA 3X0JA 1IUYA 3LFKA 5LEJA 4S2VA 2PEXA 3T8TA 3H92A 1H0MA 2STTA 1R22A 2XHKA 1QVJA 1I9AA 4DQ2A 3KP4A 1SJYA 1U5TA 3EQLF 1L3LA 4HDUA 2H94A 5ILVA 4RGRA 2Z33A 3MFKA 5FO5A 1PUQA 2A07F 1WSUA 1MKMA 2O6GE 2RN7A 4PDKA 3EYYA 3ROUA 2RKHA 1PUNA 2DHOA 3HSRA 1MR2A 2BYVE 4ESJA 2KIUA 2YVOA 1KQ9A 4ZYEA 4ENKA 1G3WA 3IL2A 3RTRA 2HWVA 2NS0A 3WHWA 4YFXF 2E1NA 4IJXA 4KYXA 5HLIA 1O3SA 3KVHA 1HW1A 5GHQA 1SD5A 2YYHA 3RPQA 4HVYA 2VOPA 1R67A 2ESHA 5FSMA 3HTUA 2VBWA 3ABTA 3TOBA 1WKMA 5CVVA 4ZZDA 4EJVA 2E7XA 2XASA 3RH7A 4LK0F 1MP2A 2OZUA 2L4AA 3Q4IA 1J59A 1FYKA 3ZPLA 4KICA 3HHHA 1W5TA 1VTNC 4LLGF 2YX4A 1HX3A 3BPXA 4HAMA 2RNJA 2W85A 3KEQA 4HF2A 2QQBA 4KFCA 1V8YA 4M9SA 2QM3A 2OA4A 1U3EM 4OU0A 3HYQA 2FOKA 4EJTA 1TW2A 3N97A 5DD8A 3GLXA 4A0XA 4AWXB 1ZREA 4HF1A 3K9TA 4RGUA 3O52A 1PVFA 1MJ9A 2XSQA 2LF7A 1WWXA 5CVUA 3KFWX 3T5XA 2FBIA 5JR3A 4MEXF 3DV8A 2XAHA 2HGCA 2MLKA 1BOAA 5FB2A 4EMSA 5K5RA 3V4GA 4FT8A 1Z05A 4FX4A 3HRTA 2KJBA 4MTDA 1FOKA 3ZN0A 5A2QZ 5AIPA 1V8WA 3X0MA 3BWGA 2PN6A 2Q8KA 1Q33A 3LA2A 1MQWA 4HOBA 3KP6A 5ANVA 1TUMA 3NRVA 4J7HA 1YW9A 5HS9A 1G3SA 3W6KB 2L01A 1BJAA 2ETHA 3KEOA 1Z7UA 2UZKA 3ML6A 4WK8F 3ZMZA 1SZ3A 3MGMA 1QZYA 2A8RA 1J2XA 3REOA 4C9XA 3J81Z 4I2OA 2HR3A 4M74A 2J5OA 1Z91A 3WE2A 1LNWA 1YS6A 3F21A 1A04A 1O3QA 3L7WA 3FHZA 3C7JA 3COAC 1B9MA 2LDUA 4BH9A 3KLOA 3JTHA 4P5OA 2CZRA 5HZXA 1YIOA 3H95A 4AVPA 2QENA 1Z6RA 2IA0A 3A6VA 1WRJA 2CYYA 2L54A 5AIQA 2CG4A 2GXGA 3IKTA 3R60A 4BYYA 2QJTA 3RKWA 4S04A 4YPRA 5C7QA 1FNNA 2STWA 3GZ6A 5E8IA 5IT9Z 2ISZA 1P4WA 3HOSA 2E1CA 3IRQA 3G0QA 5JVTA 4HDVA 4KT5C 4HF0A 5LBQA 1F1ZA 2M45A 1G3TA 3QPHA 4AIHA 2P8TA 2VT2A 2EK5A 4YFKF 3WODF 4N9IA 2GT4A 4KMFA 4JZVA 3BJ6A 3FK9A 2JZYA 1V4RA 3ZQ7A 4LGWA 5KK1A 4P96A 1REPC 3MDGA 5DYMA 3F23A 4U88A 3CLOA 1TBXA 1DPUA 1J75A 3U2RA 1OKRA 2J5PA 1PP8F 4MTEA 5FD5A 3CUOA 5H6RA 3BHOA 5F6FA 4OIQF 2P4WA 4PGHA 1BN5A 4HV5A 1O3RA 1V8RA 3HRMA 2PMUA 4HFQA 2XGXA 4Q48A 4IHSA 4LJZF 3O2PE 4DNCA 1RNLA 1FLIA 2A5YB 1KU9A 2A3SA 3BPVA 4OIRF 4ZYHA 3E97A 1XSVA 1TQMA 1FSEA 3HHGA 4U0VA 3ZMDA 5IT9K 1O3TA 1VHZA 2V1UA 1XGNA 1ZGAA 1IZ1A 2VC0A 3GXOA 4IRIA 3LA7A 3MZHA 4M6XA 2QBYB 2F5CA 1SD6A 4JK1X 3E6DA 2IW5A 2O0YA 2QBYA 1L0OC 3J7AO 2HKXA 1V8MA 1I1GA 2Q0OA 4Y13A 3MQ0A 4KMUX 4KIFA 1FSHA 2RV8A 2QJOA 3FZVA 1W7PA 3MDIA 2IA2A 5E18F 2DUKA 4L5IA 3A6SA 4LK1F 3F6AA 2K86A 1P6RA 1GXPA 3E6BA 3F22A 3FJYA 2MH9A 5FSLA 2R7DA 1B59A 2C6YA 2DSCA 3RIRA 4EM1A 4BHPA 2DU9A 4CYDA 4JBAA 4WF2A 3Q5FA 1V8IA 2XAFA 2PNYA 3IWFA 1F4KA 2PLYA 4RAZA 1X84A 4AIKA 2VOOA 4RB1A 3R03A 2ZXJA 2EV5A 5A2QK 4Y17A 4HX8A 3C18A 5CFIA 5D4RA 1V8NA 1G3YA 2MD5A 2P6TA 1ZRCA 2CSOA 4UVAA 3KCCA 2VNPA 1HZTA 2FBHA 3COUA 2QQ9A 2PMHA 2ZJ2A 2Q9PA 1DPRA 3DUPA 5JI6A 2QWWA 2XIGA 3BJAA 5EEHA 2GWRA 3RPUA 5ANUA 3HSEA 1IXSB 3FM3A 1YFHA 1MD0A 1OR7A 1LQ1A 5LEKA 2A8TA 5ILSA 4KN7X 3ZMVA 3Q1PA 4QLCU 3A6TA 2DT5A 4U0WA 3WG9A 3JSPA 5E17F 4YPHA 2XAQA 4EQQA 3KP3A 2MH2A 3B02A 3X0PA 2X4HA 3KETA 4GYGA 2EA4A 1T98A 1F3YA 1FWZA 2WWYA 4RB0A 4IJAA 2EA2A 2ISYA 2F2EA 1R36A 4ZG0A 3PFIA 1YS7A 3QU6A 3GO5A 2DSBA 2NNNA 5AONA 4XLNF 3PQKA 1XSDA 1XGMA 3I9XA 1QQIA 1BI0A 5D5WB 2VNQA 4A5NA 2GZWA 1HQCA 2EJRA 4OMYA 2NAZA 4G94A 3HSFA 5HS8A 4MQ9F 2HDCA 4OOIA 3I7VA 5D4SA 1J5YA 4HLXA 2ZMEB 4OINF 3F13A 3K1PA 4UV9A 4OIPF 3JTGA 5LGUA 4CZZA 1EH6A 5BONA 3RYPA 4IXAA 3ECOA 1I1SA 4M9XA 3FXUA 4UHTA 3B73A 1IN5A 1XDSA 3G3ZA 3R6SA 2VC1A 3L09A 2ZKZA 3GVAA 3ZR0A 4N1TA 1HKTA 4A0YA 4L9NA 3K1NA 3RJPA 2XRNA 1AOYA 3LQRA 2XAJA 5K5OA 1NHAA 2P6SA 1OYYA 4I09A 2YU3A 2DQRA 3HRUA 4MEYF 4EGZA 2ZNZA 4HW0A 1ZRFA 3P5TA 5L3EA 1BBYA 3GW2A 4KYWA 2VBZA 4GCVA 2HYGD 1S8NA 4ZH4F 2W57A 5BMZA 3PQJA 1F9NA 2NNYA 2HKOA 1DDNA 5HLHA 1IRYA 5IW5A 2VE8A 1O57A 5GHNA 1R5HA 5CLSA 3V7SA 1JHHA 2R5WA 5ILUA 1YG2A 2COMA 2DW4A 1QO0D 3EF5A 3DPLC 2O3FA 3GEZA 3OOPA 1YO5C 2A69F 3K1MA 3TOAA 5DEQA 2X0LA 2K02A 4ESBA 4AIJA 2M87A 2IRFG 5DDGA 1IN4A 3FFUA 5HLGA 2NYXA 2A61A 4RB2C 4ICKA 2ZMEA 1G0SA 3X0QA 2EWNA 2FBKA 1I5ZA 3QAHA 2UXXA 5DV5A 1HSJA 4O6JA 4RGSA 4L9JA 4N9HA 1FP2A 2YSRA 1XSBA 4L9VA 2W4EA 3J7Ye 2TDXA 3K69A 2OBPA 3GX4X 3S2WA 3BY6A 1XGSA 5ED4A 4BHBA 3ABUA 5HDGA 1MK1A 3M8EA 3ISPA 1ZYRF 5CVRA 3DP7A 3EYIA 4RS8A 3KP7A 3FM5A 3P9KA 3BROA 5D8LB 1ZLJA 3DXJF 2FE3A 1PPXA 2CL3A 1SFUA 4KG4A 3GUDA 1X51A 1FBUA 1I6XA 4HX4A 5L3CA 4GGGA 2IJLA 3TO6A 4A6DA 4Q47A 1OYWA 1SFXA 3HYIA 2KDWA 2FRHA 4BXUA 2VONA 4U0YA 4P55A 4I02A 3MAJA 1XCBA 4MHGA 3KE2A 5L3BA 4HQMA 3J80K 1BI1A 1ONVA 2BBYA 3LAJA 4Q4ZF 1ZAOA 4DYWA 2P7VB 1KT9A 1XMAA 2FKBA 4L0ZB 3MEXA 2P5LC 3KLNA 2ACJA 2IT0A 4I0BA 3O69A 1HKQA 3V7RA 5E1WA 4E70A 5FGMA 3VODA 1I27A 1P4XA 3VOEA 3P6YA 1KU7A 1U5TB 2I8TA 4J7GA 3R4KA 1QPMA 3DPTA 2VBYA 1YW7A 3QRFF 1XB4A 3VFZA 1O7LA 4M72A 2HZTA 2A8SA 4BQAA 4GO1A 3AC9A 1HSTA 1FX7A 1VIUA 3I64A 4PZJA 1KU2A 2RQPA 4RB3C 5K5QA 1QZZA 3QP5A 2AS5F 2PI0A 3N9UA 1KQ0A 2QKMB 5DUKA 3KZZA 1VC9A 4YIIA 3T8RA 3WTYC 1STZA 2DSDA 3VB2A 2ICJA 3F3XA 1TTYA 1KTGA 1WI9A 4FHTA 2GAUA 3L85A 1HW5A 5ICFA 4CGZA 1XDUA 3E3VA 4HYEA 4S05A 1FY7A 5C8LA 2ZNYA 5TJJA 3AAFA 2PQ8A 3WGIA 1S6LA 1IW7F 2F5DA 3DF8A 2A8QA 4H0EA 2RRKA 2YR2A 2GXBA 3SMDA 3M7GA 1U6GA 3RI4A 4GXOA 2ZFWA 1V8TA 4ASNA 4HBLA 1R7JA 1LJ9A 3SHFA 4KA4A 2A8PA 2OD5A 1OPCA 5IT3A 3HUGA 3NEUA 4ILQA 2EFQA 1RRQA 1IRFA 1IAWA 1KYWA 3E6MA 4P9UA 3X0IA 4EVIA 2MBFA 3EETA 2QQAA 1KQ8A 1BI2A 4ENMA 1RUNA 4HLYA 1E17A 4EGYA 1W7PD 4A6EA 5BS6A 4UUVA 1SD7A 1B9NA 3T1BA 3ZP5A 1LEBA 1PUSA 3Q91A 5ICGA 5LRRA