5DEQA

Crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
218
structure length
214
Chain Sequence
b'MKNYYSSNPTFYLGIDCIIFGFNEGEISLLLLKRNFEPAMGEWSLMGGFVQKDESVDDAAKRVLAELTGLENVYMEQVGAFGAIDRDPGERVVSIAYYALININEYDRELVQKHNAYWVNINELPALIFDHPEMVDKAREMMKQKASVEPIGFNLLPKLFTLSQLQSLYEAIYGEPMDKRNFRKRVAEMDFIEKTDKIDKRGAALYKFNGKAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR AraR
publication title A novel transcriptional regulator of L-arabinose utilization in human gut bacteria.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron (strain atcc 29148 / dsm 2079 / nctc 10582 / e50 /
molecule tags Transcription regulator
total genus 45
structure length 214
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5deqA02
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5deqA01
3BJ6A 5ILVA 1ZGJA 2W57A 1XGNA 4EJWA 1FBQA 3F6VA 4UHTA 2HTJA 3V7SA 2QJOA 1P2FA 4RGSA 3QSJA 1O7LA 4N1UA 5FLXK 3IKVA 1KQ0A 1D8JA 3GFLA 2HEOA 4M71A 2YVNA 4WCGA 4Y15A 1VHGA 3OOPA 2JT1A 2FNPA 2ISZA 1I6XA 2ADUA 4S2WA 4L9JA 2P6SA 1GXQA 1UB9A 4YIFA 2HYFA 3TOAA 2EJRA 3CUQB 3ECOA 4IHSA 1H0MA 2HZTA 4FX0A 2CYYA 5HS7A 1Y0UA 5E18F 2KDVA 3R03A 3MEXA 2Z9OA 2EWNA 4LLGF 3SHDA 3U9GA 3H95A 4P9UA 3VB2A 5HVQC 3ZN1A 5CVIA 3DPTA 3R0AA 3M1EA 3AC9A 3EQLF 2B0LA 4UVBA 2AXLA 2LNBA 3KP4A 4MTEA 4UV8A 4KICA 1JHFA 3DXJF 3GZ6A 1JRKA 1K7AA 5ISYA 2H6CA 4WX9A 1W7PB 1JHHA 4BHCA 2GXGA 3V8KA 1SJYA 2VBZA 1R1VA 2RDPA 2O1CA 2F2EA 2UZKA 4ESBA 2GWRA 3F23A 1IN7A 3V8LA 2FOKA 2D1VA 3BPVA 2H09A 3L2CA 3PFIA 4EGZA 2BV6A 3KEOA 3N9UA 3I53A 1G3YA 4HF0A 2JSCA 4GYIA 4CDGA 3WTYC 1FWZA 1X3UA 4HBLA 2O5FA 3O2PE 4HV6A 2YPRA 4XBFA 3R60A 4ZYEA 1EH6A 2ZMEB 3I59A 3GWYA 3GVAA 1PPXA 2EFQA 1R23A 2A69F 1P92A 1BIBA 2RN7A 2ZBKA 3HOTA 4CGZA 3EDPA 3Q9VA 2XHKA 3ZMDA 5CVJA 1GA7A 5D5WB 3WTTC 3F8NA 4HFQA 1FSEA 4HVYA 1IN6A 3BM4A 3L7WA 5K1YA 2DK5A 4EMSA 1R36A 5JFRA 1VK6A 2XGXA 3REOA 4ESFA 5DEQA 1K78B 1LVAA 4MNUA 2E7XA 2ETHA 5LGNA 4A5MA 2ZO4A 5CYVA 4IVNA 3BY6A 3JTGA 1MQEA 3E57A 4KA4A 4L5JA 4YFNF 5L3FA 2XKPA 3CNGA 3KE2A 4GGGA 3BHOA 4A12A 5L3GA 3VODA 5GHIA 2XASA 4YPRA 5ILUA 1S7OA 1UCRA 2XAFA 1WWXA 2QYOA 1FZPB 3FCMA 1BC7C 5D6EA 4U0YA 4IRIA 1LDDA 4I7HA 2ZFWA 1ZLJA 2O0YA 3PQKA 5GHMA 5HZXA 3CO7C 1LEBA 5ICEA 5DD4A 4G9YA 5F6FA 2P4WA 2V1XA 3FMQA 1HSJA 2B06A 3Q5FA 3K1MA 1HQCA 2J5PA 2GA1A 2OU2A 3RYPA 3VFZA 1KGSA 2ZNZA 3MZHA 1XSXA 5E1WA 1BI1A 3QPTA 2ICJA 5GHQA 1VRLA 3RH7A 1QGPA 3CTAA 4KG3A 2OZ6A 2QZ8A 1ZYRF 4PZJA 4AIKA 4MEXF 4QLCU 1J75A 1SD6A 2IP2A 4UXNA 1HXDA 2A6TA 1FSHA 2O6GE 2GIVA 2VE9A 3J7AO 3OV8A 3BROA 3W6JB 2W25A 4ZZDA 1XSVA 3M8EA 3TKYA 3P9CA 4BHPA 2A68F 4AIHA 3FMSA 3EYYA 4V14A 3RDIA 1ZLKA 3A6SA 2VBWA 3F6OA 3F22A 5D4RA 2QVOA 2W85A 2BEOA 2QBYA 1MUTA 3EF5A 1TW3A 4HW0A 2XV4S 1X84A 1LNWA 3BJOA 4UVCA 5GHPA 3WU0A 4KFCA 1SMTA 4Q48A 2O5WA 3E6CC 3QP5A 2DSCA 5DV5A 4S2VA 2A5YB 2CSOA 2K4BA 3KP2A 1V8LA 1Q27A 2YVPA 2M5WA 2D45A 2A61A 1DDNA 3RKWA 3N4MA 1KQ9A 5JHUA 2DAOA 3WTSC 4EGYA 4BNCA 3I59B 3HUGA 4RS8A 3BDDA 3A6VA 3EETA 3GZ5A 3F72A 4RB3C 1IXSB 2OZUA 4C9WA 1ULYA 5D8LB 3HYIA 2A6EF 4A0XA 3HRTA 4IRHA 1L3LA 2YSRA 3KETA 1NHAA 5K5RA 2FEZA 2G7UA 2RNJA 2HWVA 2P6TA 4HDUA 5FSMA 4JZTA 4N9IA 2IA2A 5ED4A 1TQPA 4HV5A 1WRJA 5CVVA 4L0YB 2Q8KA 3J7Ye 5LGUA 4A6EA 3BJAA 4LD5A 2CL3A 2QQBA 3TO9A 1SD4A 3MCFA 1I1GA 2NYXA 1YW9A 1LJ9A 3FXUA 4U0VA 3M8FA 4ZH4F 4IF4A 4FT8A 3QOPA 1KU7A 3ZMUA 2STWA 3BAPA 4JZVA 4XSXF 5EEGA 2P5KA 4OIRF 2TDXA 4BHBA 2VOPA 1USTA 1KYWA 3K0LA 1FYMA 5HDNA 5LPGA 3K9TA 5D5UB 3E5UA 2EFNA 1U2WA 3GXOA 2BE5F 4G7OF 1SAXA 4KNYA 2ZXJA 3L85A 3D0SA 5ICFA 2HKXA 2G73A 5FSOA 2R5WA 1B9MA 3X0JA 3KZYA 2NS0A 1QBJA 3ECHA 1REPC 1FX7A 3RTRA 2CWEA 3FZVA 1PP8F 4EJUA 5TJJA 2XUBA 2PMUA 3H3ZA 2LKPA 5ANTA 3U53A 2QKMB 1KU9A 5DCMA 3ACAA 5AIQA 1RUNA 2JPCA 5LHIA 3EUHA 2NAZA 2M45A 2GB5A 4MHGA 4XLNF 3ISPA 1E2XA 4B8XA 2YVMA 1ZARA 5E20A 1ZRDA 5DYMA 3RI4A 1PUEE 2O3FA 2PN6A 4LK0F 2QBYB 5F1RA 2DW4A 4HA8A 2R7FA 1YYVA 3GO5A 1XMAA 1BN5A 3IRRA 2Z99A 3FJYA 5GHOA 3KCCA 4YFKF 3IWFA 1MDMA 4A0ZA 2YVOA 4ZYHA 4I0AA 2XROA 4AVPA 2V1UA 4U7DA 5D6FA 1LDKB 5D8KB 4R79A 3ZQ7A 1BOAA 3JSOA 2HQNA 4HF2A 3J80K 3KP6A 1UHWA 5HDKA 2PEXA 4I09A 1KYZA 3EXQA 1R22A 1T0FA 2IVMA 2VE8A 2G74A 1QQIA 2DTRA 4P5OA 2QQAA 3E6DA 1R1TA 4KIGA 1YFHA 1W5SA 1BI2A 2EV5A 1NQYA 2QJTA 1LDJA 1T2KA 2FMYA 1B6AA 3VEPA 3EEUA 3O3KA 1E17A 3X0LA 5FGMA 2OAZA 5DD8A 3HRMA 1MD0A 2LSOA 3WTUC 2HFHA 3GFIA 4FX4A 3TGNA 2VT3A 5ICCA 4EJVA 4L5IA 4WXDA 3WHWA 3MDIA 3IWZA 3L00A 4JK1X 4RB1A 5H6QA 2J5OA 2Q2EA 2BGCA 4N9HA 2FBIA 4I98B 2KRFA 2I8TA 4ILQA 1BIAA 3I7UA 1Q1HA 3HHJA 1XB4A 1R1UA 2L4AA 4KIBA 3G3ZA 3T1BA 1HZTA 3EESA 1MJBA 2FQ3A 4BYYA 1KT9A 2ISYA 2F5EA 4ESJA 1KHZA 1KQ8A 1FPQA 3GF2A 4LK1F 2OQGA 1IRYA 5H6RA 2HOEA 2LF7A 4LJZF 1MGTA 2D2WA 1Z1DA 3FF5A 5JVTA 4ZZLA 1V8NA 1U20A 3L9FA 4Y13A 3I71A 1XMKA 4ETSA 1PUSA 4N0BA 2PBIA 1G0SA 2EK5A 5KVRA 1U6GA 3ROUA 4WK8F 1Q54A 3SHFA 3L09A 4KN4X 3H92A 2CO5A 1MJAA 1ZGAA 5FSKA 2K7LA 1U3EM 2VBXA 1HKQA 2VC0A 4LGWA 1FT9A 2L54A 4GXOA 4GO1A 5DCMB 3DQVC 3WGHA 1I1SA 1F1ZA 1TW2A 3LFKA 3JTHA 2ESNA 4JZUA 3K2ZA 3SFZA 2V79A 4A0YA 2KIMA 5AONA 3R0JA 5LHGA 1IF1A 5BQTA 5FFXA 4M9ZA 2QWWA 2L01A 5ANSA 3CUQC 3BP8A 2VODA 2FNAA 1UHMA 3CJNA 1V8VA 2XIGA 4RB0A 2VN2A 2VC1A 4EM2A 1V8YA 2CGPA 3ZN0A 2DQLA 1Z6TA 1MDMB 1P6RA 1G3TA 4A5NA 1V3FA 1O3TA 5ICGA 4U7BA 4WXCA 2WWYA 3T8TA 1U5TA 2BBYA 3HIFA 4L9VA 3I54A 1G6NA 2EA4A 3W6KB 5IW5A 2L4MA 4MGRA 3DUPA 1PVFA 3O52A 1XGSA 1V8SA 4HQEA 3D5LA 3Q91A 1XSAA 3R61A 3FSPA 4OIQF 2FXAA 2RGVA 3HSEA 4YFXF 3HSRA 4CXFA 5BMZA 4KIFA 3FMRA 5C7QA 3J81Z 1MR2A 4JBAA 3A6UA 1QVJA 2FU4A 1J5YA 1VC9A 2H27A 3MWMA 1F3YA 3I7VA 1SU2A 1D3YA 1IN4A 2FE3A 3E6MA 2X0LA 5E8IA 5CLSA 2HS5A 1B1BA 4TV7A 3CDHA 4NFXA 1TQIA 2DSBA 3WTVC 2MLGA 4O6JA 5HOOA 3U2RA 5GHNA 2K86A 3X0MA 2EFWA 2A8SA 3MGMA 2HR3A 3HYQA 1FBSA 3GEZA 5C7TA 3KEQA 3X0IA 1GHCA 3FXQA 1ZG3A 4G6QA 1OR7A 2P8TA 4LLLA 3WGIA 2KKOA 3BWGA 1IZ1A 4C9XA 3F21A 1K79A 2Y75A 4Z2YA 3WE3A 1IAWA 1V8UA 1MP2A 2IA0A 3X0OA 2Q0OA 3MFKA 3LQRA 5L3EA 1OYYA 5LEJA 2JTVA 2RVCA 1FP1D 3GLXA 3LA3A 5HDGA 3X0QA 3JAMK 4EJTA 3CLOA 1YO5C 6PAXA 2OBPA 3HHHA 1RI7A 1V8WA 3DEUA 4PGHA 3F8CA 1Q33A 1G3SA 4S05A 3HHGA 4NB5A 2V1DA 4M9SA 2PNYA 4ENMA 3ABUA 4WXHA 1OPCA 2EFOA 5H20A 2EV6A 2AS5F 3O6BB 1G3WA 4DNCA 1QPMA 4K2EA 1GVJA 2YX4A 4CYDA 2V6CA 2MH9A 1O3SA 3DPLC 5ERIA 1EH7A 3WU1B 4AIJA 1H9GA 1U5TB 3E5XA 3E97A 2K27A 2IRFG 5CVUA 1ZH5A 3IHUA 2RC4A 2P5LC 3V8JA 2KIUA 3ZPLA 3Q4IA 1R5GA 5FB2A 3GG6A 4HOBA 4CO8A 3TO6A 2L02A 3HRUA 1ZRFA 1HW2A 3C18A 1HBXG 3MDGA 4ENNA 2K02A 1SZ3A 3J80Z 4WF2A 2DUKA 4LB6B 1IW7F 3RKXA 4P96A 4RAYA 2VT2A 5FSLA 1T6SA 2P7CB 3COAC 1EV7A 1OYWA 4PDKA 3WE2A 3F3XA 4IRGA 5I8UA 2QM3A 2WV0A 2OQRA 1LQ1A 1YQAA 3ULQB 3TDUC 2STTA 1FC3A 4G94A 5ANWA 2RQPA 4M72A 4DQ2A 4MTDA 3ZMZA 1STZA 4EQQA 3QU3A 4IJXA 3F8FA 1K6OA 4BAYA 1OYIA 3GZ8A 2DO7A 2M30A 1IXCA 2QQ9A 3GWZA 3K1NA 4H0EA 3ZMVA 1IRFA 1BJAA 2UXXA 5FD6A 3LWFA 3GFJA 1U5TC 5IT3A 4B09A 1FNNA 4HX4A 1ZG5A 3QPHA 3SXYA 5FSIA 4I0BA 1J9IA 1IXRC 1X51A 4EV0A 3NEUA 3MAJA 4MQVA 5FLXZ 2FKBA 2VBYA 2MC3A 5A2QK 4GCVA 1W5TA 2VONA 2ICKA 1V8IA 4UVAA 4YPHA 2AZWA 1GXPA 3ID9A 2PQVA 2W84A 5HS8A 1ZG1A 5E1ZB 4I01A 4KDPA 4AD9A 2IT0A 3C3WA 1OKRA 4I02A 1SD5A 3KFWX 1YG2A 2VNPA 2NRAC 1LEAA 1XDUA 4N1TA 4NFWA 5LBQA 1YLFA 1K26A 2QENA 1FP2A 1O3QA 2KJCA 5E17F 4KYXA 2Z5UA 1QZYA 2DK8A 4HF1A 1OW2A 3KVHA 1OMIA 2A07F 2P7VB 4KUMA 2YR2A 3Q9SA 1RZ4A 3T8RA 4EJOA 1ZHFA 1W7PD 2EB7A 2QLZA 4PCQA 2MLKA 1CF7A 2XAQA 1BI3A 3X0RA 5J8FA 4R1HA 1S6LA 4NQWA 3ELKA 2V9VA 4G7HF 3WODF 3R4KA 2E1CA 3BPXA 3WTXC 5IT9K 1NFSA 1ZN2A 2CFXA 1G4DA 4RGUA 2FRHA 3MQ0A 3KLNA 2D1HA 1KU2A 3ERED 4ICKA 4DYWA 1TQMA 2HTSA 1F9NA 5DDGA 4G7ZF 5J8CA 3P7NA 5L3DA 1V8RA 1TBXA 4WWCA 3C1DA 2YX7A 5IW4A 3MZYA 3FM5A 5ILSA 1KA8A 2MBFA 1D8KA 4I2OA 2DI3A 1PUNA 1XD7A 2F5FA 1B4AA 2MD5A 2COMA 4AWXB 2K4JA 4LFUA 2RV8A 1T98A 4NHJA 1SFEA 4RGXA 1PP7U 1YW8A 2JRTA 3A6TA 4RAZA 1BI0A 2W4EA 1J2XA 4HZFA 1JE8A 4UUVA 1SFXA 2X4HA 3TO7A 2FSWA 3FWEA 4HDVA 4OMYA 1T38A 2PFBA 3QAHA 4LLNA 1FY7A 4HX7A 1RUOA 2RRKA 3Q93A 1DPUA 4Y17A 3SONA 3DKWA 1ZAOA 2O61A 3I4PA 3DP7A 3P5TA 2VXZA 1DP7P 1VCDA 2XKOA 1U78A 1Z7UA 3JSPA 3BOQA 5EEHA 2UWMA 4XRFA 5JR3A 3ZP5A 2L3DA 5KK1A 4ZYGA 2OA4A 4A2UA 5JI6A 1Z6RA 1WSUA 4ENKA 1PPWA 2A8RA 2MA3A 1JGSA 5C8LA 5AIPA 3WG9A 1I27A 2A8QA 1L0OC 2PQ8A 2QUFA 4KTBA 3RPQA 1B59A 1Z05A 2F5CA 1TUMA 5K5QA 1XCBA 2G9WA 4BXUA 2PG4A 5L3CA 3I5UA 1HW1A 2XAGA 1R7JA 1XSBA 3TDZC 5LRRA 3GYHX 1TNSA 2GXBA 4LB5A 4QWQA 4JZSA 1USSA 4EM1A 3X0PA 2XRNA 4IHTA 5BONA 1DPRA 1RIOH 5BS6A 2A3SA 5TRDA 3NRVA 2KIFA 3JAMZ 4L18B 2IPQX 2DHOA 1CF7B 2LDUA 3ZMTA 3HTSB 4U88A 1ZREA 1FYKA 2DFIA 2XSQA 4L0ZB 5F64A 3B02A 5J6XA 3RJPA 4JQFA 2DSDA 1P4WA 3IC7A 2FBKA 1S3JA 2FBHA 1HW5A 3RPUA 2I6KA 1F4KA 4M9XA 3GRNA 1XN7A 5FSNA 1YS7A 3CUOA 1EH8A 5BPDA 3T5XA 1XGOA 2YU3A 3F8BA 1FYLA 1Z9CA 5K5OA 2Y48A 4U0WA 1XSDA 4RB2C 2G7HA 3VOEA 4G6DA 2XAHA 2R7DA 2YYHA 1ODDA 2PMHA 4P9FA 1B9NA 3FHZA 4A6DA 2WTEA 1R5HA 2RKHA 5DUKA 2Q9PA 5BPIA 2H6BA 2FVVA 1HSTA 2XAJA 2W24A 1J59A 2IW5A 2A6HF 1VIQA 1BM9A 5GHJA 1MZBA 2M87A 2A8PA 1XSCA 2M8EA 3LQQA 3ABTA 1V8MA 1X83A 2GZWA 4ASNA 4IJAA 4M73A 4R8HA 3Q2SA 1NFZA 4BH9A 1MK1A 1TTYA 2ESHA 3P6YA 4YG2F 3LA7A 4OU0A 3FK9A 1IN8A 4MPOA 3O69A 3COUA 3TOBA 3FXRA 3SZPA 2DPUA 3SQNA 1VIUA 3KZZA 1YS6A 5D5VB 1HKTA 2IA1A 5CFIA 3O8SA 1SFUA 1G9QA 4S2YA 4OMZA 3QP6A 1RNLA 4M74A 1H9TA 1DUXC 4LG0A 2GT4A 2M1BA 1U8RA 5HLHA 1SOIA 3DV8A 4O3MA 1FLIA 1I9AA 1YW7A 2FMLA 4KMFA 4HQMA 4P55A 3F13A 3WGGA 5CFJA 1S29A 1JKNA 3LAJA 4HYEA 1V8TA 1MQWA 4S2XA 1XCVA 1CGPA 4UNOA 4IPAA 5A2QZ 2GA2A 1RRQA 3QRFF 3WTWC 1ONVA 2NNNA 1S8NA 2P5VA 3E6BA 5HLIA 4M6YA 2KJBA 4EVIA 1RRSA 2HQRA 1VHZA 2EA2A 2GAUA 1MKMA 5HS9A 4LMYA 1V4RA 5CVRA 1TNTA 2DBBA 2IJLA 3QU6A 3GW2A 3U1DA 3P9IA 4G8XA 4ZYDA 1R67A 4OIPF 2JPBA 3Q1PA 3RYRA 3KP5A 4E70A 4ZG0A 5DCFA 2KDWA 4KMUX 4L9TA 5LGTA 2VOOA 2C6YA 4GYGA 1PPVA 1RYAA 1VTNC 3FFUA 4YIIA 3IRQA 3IL2A 2B2KA 5ANVA 3KP3A 4FHTA 3M9AA 3NQOA 4O5VA 3ZR0A 3F6AA 2ELHA 1O57A 5ANUA 2CQKA 1WQ2A 4CICA 1F5TA 5D4SA 2DLLA 3J81K 1IUYA 3T0YA 2FF4A 5E8GA 1O7FA 3LA2A 2E7WA 3HOSA 1O3RA 3N77A 1I5ZA 3I0TA 1AWCA 1PDNC 4YOQA 3SZTA 5IT9Z 2GQQA 3DFGA 1BC8C 2VNQA 3CO6C 3M7GA 3MCZA 3DF8A 3X0KA 2NNYA 3G73A 1QZZA 2J8QA 3H3UA 1J0RA 4HLYA 2Z33A 3FM3A 2UXNA 3E5QA 1PUQA 2CG4A 1NQZA 1HX3A 3IKTA 4XLPF 4BQAA 1QNTA 1ZRCA 5LLQA 3JW4A 1FBUA 1HKSA 3PQJA 1T39A 3HRSA 4M6XA 1XDSA 2LF8A 1ON2A 2Y0MA 3Q2TA 1BBYA 4HAMA 3BZ6A 2O03A 3LSTA 2I8UA 2HGCA 5CJ9A 4PGGA 4XSZF 2HKOA 2A8TA 4ON0A 3F8MA 2GT2A 4F7ZA 1ON1A 5D5XB 5BOXA 1KTGA 1J7KA 2PJPA 4L9NA 4CHUA 3CUQA 3I9XA 4MQ9F 2F5DA 2JZYA 3I58A 1UFMA 1R58A 1W4MA 2HDCA 2PLYA 4LG0B 4K6EA 3KLOA 5DPKA 2DU9A 2DQRA 3K69A 3N97A 4EM0B 4Q47A 3RKYA 4KN7X 2ACJA 4KYWA 4UV9A 4HX8A 3O61A 1WI9A 1MJ9A 1SMYF 1VC8A 2OD5A 4S04A 5E1XA 3C7JA 3B73A 1A04A 3GFMA 2H94A 2HYGD 1TLHB 4OIOF 1YTYA 1XGMA 4Q4ZF 4CZZA 1K2EA 1YIOA 2MH2A 1W7PA 1Z91A 3FX3A 4ENJA 3O6ZA 2ZJ2A 2ZCWA 4KG4A 3OGAA 1JXSA 5HLGA 1FOKA 1LB2A 1R00A 3WTZA 3X0SA 1QO0D 2FA5A 3S2WA 3ZMSA 2E1NA 2BYVE 2XVCA 3E3VA 5DUIA 1AOYA 2ZKZA 4KT5C 2Z3YA 1P4XA 3GX4X 2CW0F 3ZR1A 4D0PA 3AAFA 3V7CA 3GUDA 5L3BA 2ZMEA 5LEKA 3X0NA 4MEYF 5FO5A 1P4AA 2PI0A 1C0WA 3I64A 2O8XA 1KU3A 2B0VA 3KP7A 3ML6A 2WC2A 1IRGA 3P9KA 1WKMA 2ZNYA 1D5VA 3V7RA 4HLXA 3K1PA 5LHHA 4RGRA 3HTUA 3TQNA 3DKUA 4OINF 4IXAA 2DT5A 5FFZA 2EFPA 3G0QA 3V4GA 2JVBA 1K78A 3R6SA 3LAPA 5LRSA 1SD7A 2DPDA 3HSFA 4OOIA 5FD5A 2EV0A 3SMDA 1IN5A 3EYIA 3RIRA 4Q5SF 2R3SA 1S7AA
chains in the Genus database with same CATH superfamily
3BJ6A 5FKLA 5FROA 5ILVA 1ZGJA 2W57A 1XGNA 4X0GA 4EJWA 1FBQA 3CMMA 5FKKA 3Q0WA 3F6VA 4Y7NJ 1POGA 1QVUA 3QOEA 3CCSI 4UHTA 2V9KA 3BT9A 2HTJA 3V7SA 1IG7A 2QJOA 1P2FA 4RGSA 1W0UA 1OCRH 3QSJA 2ZXIA 1O7LA 2MSYA 3GCMA 4N1UA 3MKWB 5FLXK 3IKVA 4GDFA 2MFZA 1KQ0A 1D8JA 3H35A 1PPXA 5B5EC 3GFLA 2HEOA 3A0HC 1D1AA 4M71A 3OYMA 3M4OJ 3ONQA 2YVNA 4WCGA 3BLYA 4Y15A 5EJCA 4MFEA 2TRTA 4C3JJ 1VHGA 2R5ZA 3OOPA 2JT1A 2FNPA 9ANTA 3LL7A 2ISZA 1I6XA 2ADUA 2L9VA 4S2WA 3HL2A 4L9JA 2P6SA 2L9NA 2CV0A 3PSFA 3C2HA 2WADA 1GXQA 1UB9A 3QYEA 4YIFA 3DTIA 2HYFA 3TOAA 2EJRA 3CUQB 2MG4A 3ECOA 1ZGWA 2E2JJ 4IHSA 4V19K 1PJRA 1H0MA 2VL8A 2HZTA 5C44J 2OUMA 1JKQC 3K10A 5F1JA 2DN0A 4FX0A 1BA5A 2CYYA 5HS7A 1Y0UA 4LITA 5E18F 2KDVA 3R03A 3MEXA 2Z9OA 1RKWA 2EWNA 4LLGF 2Y0SN 3SHDA 3D5RC 5F04A 1N77A 3U9GA 3UKGA 3OYGA 3H95A 2NVQJ 4P9UA 1N25A 2EZHA 3OMYA 4DBQA 3VB2A 5HVQC 2MW8A 3FIWA 3PL8A 3ZN1A 1ENHA 3S32A 5CVIA 3DPTA 3FXJA 1U9OA 2M4GA 3R0AA 3M1EA 3AC9A 2R7QA 3EQLF 4ZC3A 1SANA 1X1AA 2B0LA 4UVBA 2AXLA 1RETA 2LNBA 3CCRI 3BG9A 2H8WA 3S1MJ 3KP4A 2P0WA 2GOXB 2HVRA 1I3QJ 5B66C 4MTEA 1YI2I 2PJRA 4UV8A 4KICA 1JHFA 5GAHJ 3DXJF 4MO7A 3GZ6A 1JRKA 1K7AA 2QSHX 2IS2A 5ISYA 2H6CA 4HNUA 4WX9A 3KIOA 1W7PB 4E4HA 3PO2J 1JHHA 3TL4X 2UUZA 4BHCA 2GXGA 2A05A 3V8KA 2VPLA 3BR6A 3CC7I 2FUG2 1SJYA 4XK4A 2VBZA 1ETWA 3MMYB 1R1VA 5HNHA 2RDPA 1KONA 3CCYA 2LR8A 3OYJA 2O1CA 2F2EA 4NQWB 4X1EA 3VSLA 4ESBA 2QEXI 2GWRA 3F23A 2UZKA 1IN7A 2E1MB 3V8LA 3MKYB 3RQIA 2Q1ZB 3G2BA 5GPAA 3N05A 4A3EJ 2FOKA 2D1VA 3BPVA 2H09A 2WBMA 3L2CA 2VIXA 3PFIA 4EGZA 2BV6A 3KEOA 4XLEA 3U21A 4B47A 2FQ4A 3N9UA 3I53A 2KPMA 1G3YA 4HF0A 2JSCA 4AYBA 3GTKJ 4GYIA 4CDGA 2TCTA 3WTYC 4ZDPA 3QYFA 1FWZA 1X3UA 4HBLA 2PMZA 2O5FA 3LSMA 3O2PE 2X6YA 4XLHA 4HV6A 2YPRA 4XBFA 2ZXHA 2IS4A 2ELJA 2P81A 3BR3A 3MZ8A 3R60A 4ZJZA 1EH6A 2ZMEB 3I59A 3EPZA 4XN0A 4ZYEA 3GWYA 3GVAA 2BXZA 3K6GA 1A6QA 2EFQA 1R23A 2A69F 1P92A 1V54H 3GZNB 1BIBA 2JRMA 3OS0A 2RN7A 2LKXA 2ZBKA 3HOTA 2EZIA 3A02A 3EDPA 2G0EA 4CGZA 3Q9VA 3RZOJ 2XHKA 3ZMDA 2L7ZA 2R7OA 5CVJA 1GA7A 5D5WB 3WTTC 3F8NA 2KP6A 4HFQA 1FSEA 4HVYA 3DBHB 4C3HJ 1IN6A 2QQ8A 2OC6A 2DMNA 2GOMA 3BM4A 3GTGJ 3L7WA 3C2BA 1Y0NA 3FBNB 5K1YA 2DK5A 3SFIA 4EMSA 3ZQFA 1R36A 5LFAA 2K3FA 4GFBA 5JFRA 1VK6A 2XGXA 3REOA 4ESFA 5DEQA 4D9JA 1K78B 1LVAA 4MNUA 2E7XA 2ETHA 1UMQA 3S3NA 1K4TA 4ITVA 5LGNA 1E0EA 4A5MA 2M0MA 1VQ9I 2ZO4A 5CYVA 4IVNA 3BY6A 3JTGA 1MQEA 3E57A 4KA4A 4L5JA 1QPIA 4XIDA 2E1MC 2OV7A 4YFNF 2I8DA 4G12A 5E79C 5L3FA 4N4OB 3O8HA 4BBRJ 4IOCF 2XKPA 1Z77A 2OF7A 3CNGA 3KE2A 4GGGA 3BHOA 4A12A 5L3GA 3VODA 5GHIA 1U8BA 2DDAA 2XASA 2ZB9A 2O7OA 3MN2A 4YPRA 5ILUA 3DEEA 1S7OA 4QPQA 1F36A 1UCRA 3PFYA 2XAFA 3BC8A 4JX4A 2M0CA 5KNLA 4A3LJ 1WWXA 4PJMA 1WVRA 2VJIA 2NVYJ 4EATA 1DGWY 2K9MA 2QYOA 1FZPB 3FCMA 3JRIA 1BC7C 5D6EA 4U0YA 2R7SA 4IRIA 1LDDA 4I7HA 1EKEA 2ZFWA 2V7FA 2IGMA 1ZLJA 2O0YA 2VJ4A 3PQKA 5GHMA 3PUBA 5HZXA 2M4KA 3CO7C 1LEBA 5ICEA 5DD4A 4G9YA 5F6FA 1WJ5A 4II2A 2P4WA 3JR9A 4NNJA 1VQ4I 2V1XA 3FMQA 2WAFA 1HSJA 3IH2A 2B06A 2BW3A 2W4SA 3Q5FA 3K1MA 3ZQLA 1HQCA 2J5PA 5M3FJ 2GA1A 2CUFA 2XGEA 5BNGA 2OU2A 3RYPA 3VFZA 1KGSA 2ZNZA 3MZHA 1XSXA 2DYRH 5E1WA 1BI1A 3QPTA 2ICJA 5GHQA 1VRLA 3PM1A 3RH7A 1QGPA 1BJZA 2XF6A 3CTAA 4KG3A 2OZ6A 2QZ8A 5FKNA 3H3VK 4B3XA 1ZYRF 4PZJA 3HG9A 1OJLA 4AIKA 4MEXF 4QLCU 4C30A 2OJED 1J75A 1SD6A 2IP2A 2WA0A 4UXNA 1IRXA 4AUXA 1HXDA 2NVXJ 2A6TA 1FSHA 2O6GE 4IEJA 2GIVA 2LK2A 2VE9A 3J7AO 2KFDA 4IHYA 3OV8A 3BROA 4BQOA 1Z67A 1X1PA 1QVTA 2W25A 3W6JB 4ZZDA 1XSVA 3BG6A 3M8EA 3TKYA 3P9CA 4BHPA 2A68F 1YX5A 4AIHA 2PJRB 3FMSA 1Y1WJ 3EYYA 3GTQJ 4J7HA 4V14A 1AA7A 3DTKA 4E7HA 2L0KA 3RDIA 1ZLKA 3DEWA 3A6SA 3CDIA 2VBWA 3F6OA 2ZJQF 2F5VA 2B9SA 4XKWA 3F22A 1GV2A 5D4RA 2QVOA 2W85A 2B7EA 2BEOA 2CV2A 2QBYA 1MUTA 2JVGA 1T56A 3EF5A 3M07A 1TW3A 1ETQA 4HW0A 1ERDA 2XV4S 1X84A 2DA4A 1X1CA 2OCEA 2NVUB 3SEQA 2WAEA 1LNWA 3BJOA 1N78A 3E7LA 4UVCA 5GAEJ 1F43A 3BQZA 3H5AA 3JRGA 2QA4I 1FJLA 5GHPA 5F08A 1GDTA 2R92J 1Y8RB 4FE7A 3WU0A 4KFCA 4C2MJ 2EZKA 1SMTA 3O8GA 1Y8QB 4Q48A 4XLCA 3K7AJ 2F6CA 2H8RA 2O5WA 3IUOA 5EG0A 3E6CC 3QP5A 2DSCA 5DV5A 4S2VA 2A5YB 2CSOA 2K4BA 3KP2A 1V8LA 5IPAA 3V42A 4FCYA 2Y9YA 1EA3A 2M5WA 2A61A 3PNVA 2D45A 1Q27A 2YVPA 2MYSA 3SEZA 1DDNA 3VWBA 3J7AY 3RKWA 1QA6A 1BR1A 3N4MA 2GLOA 1KQ9A 4CCNA 5JHUA 2DAOA 3WTSC 4EGYA 4BNCA 1JUMA 3I59B 3HUGA 3A1YA 4IHXA 1JTXA 4RS8A 3BDDA 4B3AA 2E35A 4OWRB 2L9SA 3A6VA 3DKYA 3HDDA 1PYVA 2AHQA 2NOJB 2DT6A 3EETA 4M3DA 4DYRA 1VF9A 3GZ5A 4CUGA 3F72A 4RB3C 1IXSB 2OZUA 4Y3OA 1R6RA 3PSIA 4C9WA 1TWAJ 2OCCH 1ULYA 5D8LB 3HYIA 4AYBN 1SVLA 2A6EF 4A0XA 3HRTA 4IRHA 1R5ID 5C3EJ 1L3LA 2YSRA 2PMZN 3KETA 1NHAA 5K5RA 4FISA 2FEZA 2G7UA 2RNJA 2LY2A 3DKXA 1SC7A 1I3AA 2HWVA 2P6TA 3QPLA 4HDUA 5FSMA 2X1CA 4JZTA 2VJ5A 4N9IA 2DMPA 2IA2A 5ED4A 5J4VA 2X6XA 1TQPA 4HV5A 1R71A 1WRJA 5CVVA 4L0YB 2HQ5A 2BY2A 1OCPA 2ECBA 2Q8KA 3J7Ye 2BY0A 4HEA2 4XORA 2CW8A 5LGUA 5EDNA 4A6EA 3BJAA 4LD5A 5M3MJ 3OIPA 2CL3A 2FJ1A 2QQBA 3TO9A 2LREA 1S7EA 1SD4A 4DJAA 2LVSA 1VQ8I 3MCFA 1OISA 2E60A 4XLAA 4RA2A 1AU7A 1I1GA 2EILH 2NYXA 4CCLA 1YW9A 1JKOC 1LJ9A 3MKLA 2XF5A 1VQMI 3FXUA 1FOWA 2VASA 3M8FA 4U0VA 4ZH4F 4IF4A 2DT7B 4FT8A 3QOPA 1KU7A 3ZMUA 2STWA 3BAPA 4JZVA 3GTJJ 4XSXF 5EEGA 2P5KA 4IKFA 3W2WA 4OIRF 2TDXA 4BHBA 2VOPA 1USTA 2VUMJ 4D7MA 1KYWA 3K0LA 1FYMA 1JJ8C 5HDNA 5LPGA 3K9TA 5D5UB 3E5UA 2KZGA 2EFNA 1U2WA 3GXOA 2BE5F 2CQXA 4G7OF 1SAXA 4KNYA 3L2UA 2ZXJA 3Q0VA 3L85A 3D0SA 5ICFA 2HKXA 2G73A 1TWCJ 5FSOA 2CQNA 2R5WA 1B9MA 2BW3B 3OWTA 3X0JA 3KZYA 2NS0A 1QBJA 2VKHA 3BR5A 1XS9A 1MMAA 2KRHA 3ECHA 2XSDC 1REPC 5DM7F 1FX7A 3RTRA 2LY9A 5CQGA 2CWEA 2N8GA 2B63J 2IGNA 3DBLB 3AL0B 3FZVA 1PP8F 1XG1A 5TJJA 4EJUA 2R5YB 2QSGX 1VQNI 2XUBA 2PMUA 3H3ZA 3MVPA 2LKPA 2Y2ZA 5ANTA 4HNTA 4E7LA 4M6VA 1EF4A 4PSXA 3U53A 2QKMB 1KU9A 4Y4RA 4BXXJ 5DCMA 2HOAA 1H88C 3ACAA 3ZOBA 1W0TA 3ZQCA 5AIQA 2DMQA 3K4CA 2JPCA 3SYTA 1RUNA 3ZRGA 5LHIA 4P1WA 3EUHA 1P7IA 3HXLA 1JKPC 2NAZA 3CC2I 2M45A 2GB5A 4MHGA 4XLNF 3ISPA 2ME6A 1E2XA 3K4LA 4B8XA 2YVMA 1OCTC 3I56I 1VQOI 2WY7Q 1ZARA 5J1RA 5E20A 1ZRDA 2JQ7A 5DYMA 5GAGJ 3RI4A 1PUEE 2O3FA 1HF0A 2PN6A 3A0BC 4LK0F 2QBYB 5F1RA 2DW4A 4HA8A 2R7FA 1YYVA 3GO5A 1XMAA 1BN5A 3IRRA 2LG4A 3S93A 2Z99A 3FJYA 5GHOA 1WJEA 3KCCA 5LD2C 2E2HJ 4YFKF 2JUGA 5FRNA 3IWFA 1W5CC 1MDMA 4A0ZA 3TP3A 4B44A 1HC8A 3JREA 1Z21A 3SJMA 2YVOA 4ZYHA 4I0AA 3OR2C 4AVPA 2XROA 2V1UA 4U7DA 5D6FA 4IQJA 1LDKB 5D8KB 4R79A 3ZQ7A 5EG0B 1BOAA 2BVMA 4MLOA 3PIPF 1DU0A 3JSOA 2HQNA 4HF2A 3J80K 2Z16A 5GPCA 3KP6A 3RSNA 1UHWA 5HDKA 2PEXA 4I09A 4JOMA 1EJ9A 1KYZA 3EXQA 2ZC2A 1JGGA 2HYJA 1R22A 1T0FA 2IVMA 2VE8A 2G74A 2LH9A 2M3AA 2R7TA 4XM3A 1QQIA 2D5VA 2DTRA 3HUGB 4P5OA 2QQAA 3E6DA 1R1TA 4KIGA 1YFHA 1W5SA 1BI2A 2EV5A 4HNVA 1NQYA 2QJTA 1LDJA 1T2KA 1QHHD 2FMYA 4JP0A 4C2TA 1JUPA 4E6KG 3CMEI 1B6AA 3E0JB 1T95A 3VEPA 3EEUA 3O3KA 1MSEC 1E17A 3X0LA 4J19A 2XF7A 4DW6A 3KYCB 5FGMA 2OAZA 5DD8A 1X4OA 3BZCA 2IAIA 3HRMA 2NOGA 1MD0A 2LSOA 3WTUC 2HFHA 3GFIA 5FRMA 4BDYA 4FX4A 4YRVA 1VQ7I 2LTPA 4BKXA 3TGNA 5IOZA 1T8IA 2VT3A 5ICCA 5DTDA 5M5YJ 4EJVA 4L5IA 3UNGC 4WXDA 3WHWA 3W2VA 3MDIA 4PSWA 2M8GX 3IWZA 3L00A 1YX3A 4JK1X 4RB1A 1BL0A 3QPSA 5H6QA 2M9HA 4JYKA 2J5OA 2RNGA 2Q2EA 3FKIJ 5EYRA 2BGCA 4N9HA 2FBIA 4I98B 2XB0X 4BEHA 2KRFA 4Z6YA 3LSRA 3FXMA 3IP4B 2I8TA 2VJJA 4ILQA 1BIAA 2HPMA 3I7UA 3CCMI 1Q1HA 3VYRB 3HHJA 1XB4A 3DWLE 1R1UA 2HVSA 2L4AA 1GLNA 4KIBA 4FTHA 3H1CA 3GTMJ 1MBGA 1H8AC 3G3ZA 3T1BA 5E3MA 5J40A 1IRZA 4XQFA 1HZTA 3EESA 5E3LA 1MJBA 1TWHJ 2FQ3A 4BYYA 1KT9A 2ISYA 2F5EA 2DOAA 3IH3A 4ESJA 3DLAA 3KYDB 2YS9A 2KLOA 3GMEA 1KHZA 1B72A 3S8PA 1KQ8A 1FPQA 4RLFA 3GF2A 4LK1F 2LFBA 3CF5F 2OQGA 1IRYA 5H6RA 4BXFA 1MSFC 5F27A 4E7SA 3M8JA 1YIJI 1E3PA 2HOEA 2LF7A 3CLQA 3OIQA 4F92B 4LJZF 2R7RA 1MGTA 1LE8A 3G71I 2D2WA 1Z1DA 4UY8I 3QWLA 2BZTA 2Z1DA 4NC7A 3FF5A 5JVTA 4ZZLA 1V8NA 3ZCOA 1U20A 5IYBJ 3L9FA 4Y13A 5KAFC 3I71A 1MMSA 1XMKA 2DA7A 2DDBA 2JVHA 3H9QA 4ETSA 3PO3J 1PUSA 4N0BA 3NARA 3CJRB 2PBIA 1G0SA 3L1PA 5B3SH 1MNEA 2EK5A 1U6GA 5KVRA 3BTLA 2XSJC 3ROUA 4WK8F 4RAGA 1IV6A 1Q54A 3SHFA 3L09A 4KN4X 3H92A 2CO5A 1MJAA 1ZGAA 5FSKA 4MFDA 2F4MB 2K7LA 1U3EM 2VBXA 2EH3A 1HKQA 1IDZA 3K4NA 2VC0A 1OCZH 4LGWA 1FT9A 2L54A 4GXOA 1I6HJ 4A3JJ 4GO1A 5DCMB 3DQVC 5IYDJ 3WGHA 4OAZA 1I1SA 3I55I 1K83J 2R7XA 1F1ZA 1TW2A 3LFKA 2AXTC 2ESNA 3JTHA 4XKCA 2H1KA 4JZUA 3K2ZA 3SFZA 3CP8A 3NWSA 2V79A 3W3CA 3CDLA 4A0YA 3ZQGA 2KIMA 3HEFA 5AONA 3R0JA 5LHGA 2O8KA 1FIPA 3I4NJ 1IF1A 2JK3A 2X1DA 5BQTA 5FFXA 4M9ZA 1MBJA 2QWWA 2DCEA 2L01A 1NTCA 5F0HA 3OYKA 3CUQC 3BP8A 1RESA 2VODA 2FNAA 1ITYA 1UHMA 4A3DJ 2DTZA 3CJNA 1V8VA 4V2FA 2XIGA 2FD5A 4FQGA 4RB0A 2VN2A 1VQKI 2OTJI 2VC1A 3G6EI 4EM2A 1V8YA 2CGPA 3ZN0A 2DQLA 1Z6TA 3FDYA 1MDMB 3FBIB 1P6RA 2BY1A 5IOYA 1JJ6C 1G3TA 4A5NA 2K9QA 2KRCA 1V3FA 1K6YA 1O3TA 1TZLA 5ICGA 4LIUA 4U7BA 1YOVB 4PJJA 1HCRA 1G59A 4WXCA 3T8TA 1U5TA 2WWYA 2BBYA 3HIFA 4L9VA 2GXAA 3I54A 1ETYA 1G6NA 2EA4A 3W6KB 5IW5A 2L4MA 4MGRA 1ZR4A 3DUPA 1PVFA 3RPUD 3O52A 1WJDA 1XGSA 2QCOA 2X6WA 1V8SA 4HQEA 3D5LA 3K70C 2DXIA 3Q91A 3JRHA 3CCJI 1M1EB 1XSAA 3R61A 1NK3P 1ACIA 3FSPA 4OIQF 2FXAA 2CMPA 1N75A 2RGVA 3HB9A 3OYEA 1U9NA 3HSEA 4YFXF 3HSRA 4CCOA 4CXFA 3D1NI 4KIFA 2ID6A 5BMZA 2X1EA 2GM4A 1WJAA 3FMRA 2XGDA 3C2GA 5C7QA 3J81Z 1MR2A 4JBAA 3AKZA 3A6UA 1XC5A 1QVJA 2FU4A 2QF7A 3OYAA 1J5YA 1VC9A 2H27A 2CQQA 3MWMA 2ICWG 4M3EA 1F3YA 3I7VA 5GADJ 1Y39A 1LFBA 1SU2A 1D3YA 1IN4A 2FE3A 3HOXJ 1J09A 3E6MA 3ABMH 3HOZJ 1I50J 1W36C 4NDLA 2X0LA 3H0GJ 4IHVA 3HOYJ 2VQLA 5E8IA 5CLSA 2HS5A 1OQYA 1V55H 2WAQA 1B1BA 2Q2EB 4TV7A 2OTLI 3CDHA 4NFXA 3BG7A 1TQIA 2DSBA 1BW6A 2VQHA 2IGOA 2KISA 3WTVC 2MLGA 2ZMEC 4O6JA 2MABA 1R4MB 1MBFA 5HOOA 2KDZA 3U2RA 5GHNA 2K86A 3X0MA 2JA7J 2EFWA 3NWTA 1JTYA 4DGWB 2YU9J 1YE9A 1QRYA 2A8SA 3MGMA 2HR3A 2R5ZB 3HYQA 3S15J 1FBSA 3GEZA 5C7TA 3KEQA 1RR8C 2CRGA 3X0IA 4HRIA 2LKSA 1GHCA 3CF2A 2M7BA 3FXQA 1ZG3A 2VQGA 4G6QA 4XRSA 4B48A 1OR7A 2DJNA 5K7FA 2P8TA 4LLLA 2HOTA 3WGIA 4A93J 4V2GA 1OCOH 1B72B 5C4XJ 2KKOA 2LYCA 3BWGA 2JA5J 1IZ1A 1A5JA 4C9XA 3F21A 2RREA 3CCEI 1K79A 4BU2A 3J7ZI 2Y75A 4Z2YA 3WE3A 1IAWA 1V8UA 1MP2A 2IA0A 2CUJA 1LE8B 2HDWA 2L5QA 3OY9A 1YRNA 3H9JA 3X0OA 2Q0OA 1DQUA 3MFKA 1DGRM 3LQRA 5L3EA 4QTRA 1OYYA 3BR0A 5LEJA 1DU6A 2RQQA 3FXLA 2JTVA 2QGUA 3S17J 2RVCA 1FP1D 3GLXA 3LA3A 1X58A 2LP0A 5HDGA 3QYBA 3X0QA 1BW5A 4D5FA 1FMVA 3JAMK 3S2HJ 4UB8C 1XPXA 3CLOA 1E3HA 1P7JA 1Z0XA 4EJTA 4CSWA 1YO5C 1YJ9I 4DYQA 2IXSA 6PAXA 2OBPA 3HHHA 3PUFA 1MW7A 1RI7A 1V8WA 2Y69H 2L2OA 3DEUA 3F8CA 4PGHA 4DIQA 1Q33A 3B6AA 1G3SA 4S05A 3HHGA 5JHFA 2DODA 2XB5A 4NB5A 4B1RA 2V1DA 3E1SA 4M9SA 3HOVJ 2PNYA 4ENMA 3ABUA 3OIOA 4F55A 1OLTA 2V1NA 4WXHA 1UJ8A 2GBYA 4U87A 3L2RA 4IHWA 2V6EA 1OPCA 2EFOA 3K2AA 2BHZA 2BXYA 2FX0A 2V9PA 4DZJA 3FHNA 5H20A 3L2WA 2DJIA 2EV6A 3TW7A 4IOAF 2AS5F 3K4BA 3O6BB 5EGOA 2R7UA 1WZ2A 1G3WA 3H5RA 4DNCA 3CCUI 1QPMA 4K2EA 1GVJA 2YX4A 2VPRA 4CYDA 2V6CA 2MH9A 4PUSA 2DA6A 5FJ8J 1O3SA 2DMUA 4BUPA 3DPLC 5ERIA 1EH7A 4M3GA 3WU1B 2E36A 3WU2C 3K4JA 4AIJA 2ME0A 1H9GA 3S1RJ 1U5TB 3AG3H 3W2AA 3E5XA 3E97A 4YEJA 1LFUP 2K27A 2IRFG 2JSPA 5CVUA 1ZK8A 4XR6A 1ZH5A 2JA6J 3HOWJ 3S14J 3IHUA 4B4CA 2RC4A 2P5LC 1SFOJ 3V8JA 2KIUA 3ZPLA 3OYBA 2F4IA 3Q4IA 1R5GA 5FB2A 2XDVA 3GG6A 4BJTA 4HOBA 4CO8A 2W00A 3TO6A 2L02A 1XX5A 3HRUA 3JRAA 1LVKA 4A3KJ 1WJCA 1ZRFA 1HW2A 4BACA 3C18A 1HBXG 3ZXSA 4ZDOA 3MDGA 4BY1J 4ENNA 5E3OA 2K02A 3G1MA 3M3YJ 1SZ3A 4CCJA 3J80Z 4WF2A 3X2QH 2HXOA 2DUKA 4LB6B 5HLTA 4ZTFA 1I39A 4E7KA 1UG2A 1IW7F 3RKXA 4P96A 2DFFA 4RAYA 5IYCJ 4XRMA 3OSGA 3LFUA 2VT2A 2O9LA 1T6SA 5FSLA 2P7CB 3COAC 3HC7A 1EV7A 1OYWA 4PDKA 4GRIA 1ZTRA 3WE2A 1Z3XA 3WG7H 5K7HA 3Q0UA 5TGTA 3F3XA 4IRGA 5I8UA 5CQEA 1G8XA 2QM3A 2WV0A 2OQRA 1LQ1A 1YQAA 3ULQB 3TDUC 4I6ZA 2STTA 1FC3A 1BOBA 4G94A 5ANWA 2RQPA 4M72A 5KAIC 3BR2A 4DQ2A 4ANJA 3BCAA 4MTDA 3ZMZA 1STZA 4EQQA 3QU3A 5J4YA 4IJXA 4PJNA 2FOWA 3H9GA 3F8FA 4D7NA 1K6OA 4BAYA 2XPWA 1OYIA 3GZ8A 2DO7A 2M30A 4UUTA 1IXCA 3S1QJ 2QQ9A 3GWZA 3K1NA 4H0EA 3ZMVA 1IRFA 1BJAA 3DBRB 2UXXA 5FD6A 3LWFA 3GFJA 2UV1A 1U5TC 3NAUA 3DTEA 5IT3A 4B09A 3ZQQA 3UR3C 2LRDA 1FNNA 2XC7A 4HX4A 3AG4H 3LSGA 2ZSIB 4IX7A 1ZG5A 3QPHA 3SXYA 3F0CA 5FSIA 1Z7LA 2JUCA 3HJEA 4I0BA 4M3BA 1J9IA 1IXRC 1X51A 4EV0A 3NEUA 3L2VA 1S72I 4BBSJ 3MAJA 4MQVA 2VB6A 5FLXZ 2FKBA 1LUJB 2MC3A 2VBYA 3OYDA 3Q3SA 3TW6A 2WAQN 2JN6A 5A2QK 4GCVA 1W5TA 2VONA 5FKOA 3OYIA 2ICKA 1V8IA 4UVAA 4YPHA 1VQLI 2AZWA 1GXPA 3ID9A 3A01A 4A3BJ 2PQVA 4CYCA 2W84A 5JLXA 5HS8A 1ZG1A 2M2EA 5E1ZB 4I01A 4KDPA 2BOLA 3HPHA 4AD9A 2IT0A 3C3WA 1OKRA 1YRNB 1MBHA 4I02A 4PJLA 1SD5A 3QQAA 3KFWX 1YG2A 2VNPA 2NRAC 1LEAA 1XDUA 3DU5A 3I3LA 4A69C 2LLKA 4N1TA 4DOZA 4NFWA 5LBQA 3ABKH 1IJWC 2GIZA 1B8IA 3CC4I 1YLFA 1WJBA 3FK6A 2HI3A 1K26A 2QENA 1NK2P 1FP2A 1O3QA 2KJCA 4PJ0C 5E17F 4KYXA 2Z5UA 3BQYA 1QZYA 2DK8A 4HF1A 1X3WB 1OW2A 1RC9A 1T08B 3HPGA 3KVHA 1OMIA 2A07F 2P7VB 1RKTA 2YR2A 3Q9SA 1RZ4A 4KUMA 3T8RA 4EJOA 2NS7A 3F9KA 1ZHFA 5M5XJ 1W7PD 3QODA 2EB7A 2E19A 3MD2A 2QLZA 3OS1A 1O4XA 2W48A 4J00A 4XN3A 4PCQA 2DA3A 3HKZA 3TBIA 2WB1N 2MLKA 3ASNH 1CF7A 2XAQA 1WI3A 2CW7A 1APLC 1BI3A 3X0RA 5J8FA 1VZ0A 4R1HA 1S6LA 4NQWA 3ELKA 2V9VA 3GTLJ 2DFHA 5EGOB 4G7HF 2EZLA 3OL3A 3WODF 2O5RA 2Z2SB 3R4KA 1A6IA 4S0HB 2KL4A 2E1CA 3BPXA 3WTXC 1RR7A 3AL0C 5IT9K 1NFSA 4OAYA 1ZN2A 2CFXA 1G4DA 1XMXA 4RGUA 4D1QA 2FRHA 4HG2A 3MQ0A 1VQPI 1K61A 2KHMA 3KLNA 3OYLA 2D1HA 1ETXA 1MBEA 3OR1C 1KU2A 3ERED 4ICKA 4DYWA 1OFCX 1TQMA 2CV1A 3S16J 1X2NA 1TT0A 3PNTA 3CMYA 2HTSA 1VQ5I 1F9NA 5DDGA 5J8CA 4G7ZF 3P7NA 5L3DA 1V8RA 1TBXA 4NC6A 4UUSA 1WHUA 4WWCA 3C1DA 2DYSH 2YX7A 5IW4A 3MZYA 3VYTB 3FM5A 1GV5A 5FLVA 3KZIC 5ILSA 4BQQA 1KA8A 2MBFA 1D8KA 5EF6A 4I2OA 1PVEA 2DI3A 2K40A 1YITI 3H5NA 1PUNA 1XD7A 2VKEA 3HBLA 2F5FA 4NUBA 1B4AA 2COBA 3VYSB 1JKRC 2MD5A 2COMA 3JRCA 5IP7J 4AWXB 2K4JA 4LFUA 2RV8A 1T98A 4NHJA 5J1UA 1SFEA 3K4MA 4RGXA 1YJNI 4AVZA 1PP7U 1YW8A 1D5YA 2EPFA 2JRTA 2ELKA 3S2DJ 3A6TA 4RAZA 2BY3A 1BI0A 2W4EA 1J2XA 4HZFA 1ZELA 1JE8A 4UUVA 1TT5B 4LOCA 1UHSA 1SFXA 2X4HA 1V5GA 2F48A 3TO7A 2FSWA 3A03A 3FWEA 4HDVA 4OMYA 1JT6A 1T38A 2PFBA 4DBRA 3QAHA 5C4JJ 4LLNA 1FY7A 4HX7A 1RUOA 2RRKA 3Q93A 1DPUA 4Y17A 3SONA 3DKWA 1ZAOA 2O61A 3I4PA 2JMWA 3DP7A 3P5TA 2VXZA 3P5JA 1DP7P 1VFCA 1GT0C 3PNYA 2RAEA 2XKOA 1VCDA 2ZXWH 2A5WA 1Z7UA 1U78A 3JSPA 3BOQA 2EIKH 5EEHA 1IUFA 2UWMA 4XRFA 4X6AJ 3FXOA 4W97A 2IS1A 3KX2A 3VDXA 3ZGKA 5JR3A 1JUSA 2ID3A 4HSTA 3ZP5A 2L3DA 5KK1A 1QU3A 4YELA 4ZYGA 2OA4A 3L2QA 1X19A 1HOMA 4A2UA 5JI6A 4QIWN 1Z6RA 3AG1H 3A01B 1WSUA 1R9TJ 4CYCB 4ENKA 2JA8J 3GTPJ 1PPWA 2A8RA 2MA3A 1JGSA 5TISC 5C8LA 5AIPA 3WG9A 1I27A 3OL4A 2HDDA 4BDZA 1ORKA 4F52A 2HPIA 2LBFA 1S5LC 4XLFA 3TEDA 2A8QA 2AO9A 1L0OC 2PQ8A 3LSHA 4II3A 2QUFA 2R7WA 4KTBA 3RPQA 1B59A 4F3QA 3LSPA 1Z05A 3G1LA 2F5CA 1TUMA 5K5QA 1XCBA 2G9WA 3ZQIA 4BXUA 2PG4A 5L3CA 3I5UA 1B8IB 1HW1A 3BTIA 2XAGA 1R7JA 3BG5A 2LD5A 1XSBA 5CKTA 2BVLA 2HQAA 2ZSHB 1W1WE 3DU6A 5LRRA 3BG3A 3TDZC 2AQEA 4CZCA 3GYHX 4IL6C 2OPTA 1TNSA 2GXBA 4LB5A 2CS3A 5GTHC 4QWQA 4JZSA 1USSA 4EM1A 4XL9A 2Y30A 1MMGA 2NXNB 5CPRB 3X0PA 2XGCA 2XRNA 1R49A 4IHTA 3U1KA 1SFKA 4DYCA 1WH5A 5BONA 1T33A 1DPRA 3FK7A 1RIOH 5BS6A 2VQCA 2A3SA 4NC8A 5TRDA 3NRVA 2KIFA 2Y31A 3JAMZ 1MMNA 1X1BA 3A4CA 4JX5A 4L18B 3FISA 2IPQX 4F93B 2DHOA 1CF7B 2LDUA 3TP0A 4RLQA 4XNFA 3ZMTA 3HTSB 4U88A 1ZREA 3CD6I 1FYKA 2MC4A 1E3OC 3CJQB 2DFIA 2XSQA 1ETVA 4L0ZB 5F64A 3B02A 5J6XA 1UAAA 1NH3A 3RJPA 4JQFA 2DSDA 1P4WA 3IC7A 2FBKA 4DZPA 3CESA 3ESWB 1S3JA 4JX6A 2FBHA 1D0ZA 1HW5A 3RPUA 5M5WJ 2M7AA 1JI8A 2I6KA 4N4NB 1F4KA 4M9XA 4FETA 4A3IJ 3GRNA 1XN7A 1A35A 5FSNA 2IBDA 3ZQHA 3HKZN 2DFEA 4ABZA 1YS7A 3CUOA 4XMYA 1EH8A 5BPDA 3T5XA 4NBQA 1XGOA 2PX9A 2YU3A 4H4KC 5EEAA 5FLMJ 3F8BA 1FYLA 2ZJRF 2K5CA 1Z9CA 5K5OA 1YJWI 2Y48A 4U0WA 3ERMA 1XSDA 3EUHC 4RB2C 2G7HA 3LSKA 3VOEA 1A31A 2LOOA 4G6DA 2R93J 1ZQ3P 2XAHA 4UUSB 2HNHA 2JA2A 2K9SA 4FE4A 2R7DA 2YYHA 2K85A 1ODDA 2KDOA 2PMHA 4P9FA 1B9NA 3FHZA 4A6DA 1IGNA 2W82A 2WTEA 1R5HA 2RKHA 5DUKA 3BCBA 2Q9PA 5BPIA 3M1CA 2H6BA 5F0FA 5JLWA 2FVVA 1HSTA 1PUFA 2XAJA 2VI6A 5B1BH 4D5CA 2W24A 2NS8A 3BTJA 1J59A 2IW5A 2MGQA 2A6HF 2XPUA 3PIOF 3MKZA 1VIQA 4AU7A 3S1NJ 3IV5A 1BM9A 5GHJA 1MZBA 3B6CA 3BR1A 2M87A 1WPKA 2QSFX 2A8PA 1KZHA 1XSCA 2M8EA 3LQQA 3ABTA 4BL0B 1VNDA 3PJRA 1V8MA 4BEHB 1X83A 2GZWA 2L9RA 3I9V2 4IJAA 4M73A 4R8HA 4ASNA 2CH0A 5E3NA 3Q2SA 1NFZA 2EIMH 4BH9A 1MK1A 4CH7A 4C3IJ 1TTYA 2ESHA 1R4NB 3P6YA 1XTAA 3LA7A 4YG2F 2IEKA 3LNQA 2KIQA 4OU0A 3FK9A 1IN8A 1QHGA 1FEXA 4MPOA 3O69A 2M34A 4KITB 3COUA 1T0FC 3TOBA 3FXRA 1U0JA 1UELB 3SZPA 1YHQI 2DPUA 3SQNA 1WJFA 1VIUA 1D0YA 1D1CA 1YS6A 3KZZA 2L7FP 5D5VB 2CJJA 1HKTA 3JRFA 2IA1A 5CFIA 3GLLA 3O8SA 4F91B 1SFUA 1G9QA 4S2YA 2DA2A 2DOFA 4OMZA 3QP6A 1RNLA 4M74A 3HOUJ 1H9TA 2L7KA 1DUXC 4LG0A 3DPUA 2GT4A 5IP9J 4BE0A 2M1BA 1U8RA 5HLHA 1SOIA 3DV8A 4O3MA 1FLIA 1I9AA 1X2MA 1Y56A 1YW7A 2FMLA 4KMFA 2JWTA 4HQMA 4E7ZA 4P55A 5GTIC 3WGGA 5HNFA 3RQ4A 4BE1A 3F13A 5CFJA 2QKLB 1S29A 1JKNA 3LAJA 2WB1A 1MIJA 4HYEA 1V8TA 2LBFB 1SVOA 1MQWA 4S2XA 1Y6IA 1UG0A 1XCVA 1CGPA 4UNOA 2JJ7A 2XAUA 4IPAA 1D1BA 2ECCA 5A2QZ 2GA2A 3CQZJ 2IS6A 2YUSA 5GP9A 2R5YA 1GVDA 1OCCH 1VQ6I 1RRQA 1SVMA 4J7GA 3QRFF 2CZRA 1LFPA 3WTWC 1ONVA 2NNNA 2X6OA 4CCMA 4RM2A 1S8NA 2P5VA 3OOUA 3E6BA 5HLIA 2V4JC 4M6YA 2KJBA 3OYCA 4EVIA 1Q1VA 1RRSA 2I10A 1S9HA 2HQRA 2DMTA 1VHZA 3A2KA 4LIVA 2HU9A 2EA2A 3J7YJ 2GAUA 3CCLI 1MKMA 5HS9A 4LMYA 2HXIA 1IC8A 1V4RA 5CVRA 4RMNA 1TNTA 1MH4A 2DBBA 3WHBA 4HSRA 2IJLA 4KISA 1MNMC 5KHDA 3DLLF 5KCMA 2CUZA 5F0CA 3QU6A 3GW2A 1X1DA 3GBGA 3U1DA 1ETKA 2E5NA 3P9IA 4G8XA 2VLAA 4ZYDA 4E7IA 1R67A 4OIPF 1TWFJ 2JPBA 3Q1PA 3RYRA 1GUUA 3KP5A 4E70A 4ZG0A 5DCFA 5IP6A 2R4GA 2KDWA 3IAS2 4KMUX 4L9TA 5LGTA 3FXKA 2DOEA 2VOOA 2C6YA 4GYGA 4I76A 1PPVA 1VTNC 1K4SA 1RYAA 3FFUA 2R7VA 4YIIA 3IRQA 3IL2A 3WHCA 2B2KA 4BQNA 1FMWA 3KP3A 5ANVA 4FHTA 3M9AA 1LKXA 3NQOA 4O5VA 3ZR0A 3F6AA 1ZR2A 4IZZA 2ELHA 2F4OB 4KT6A 1O57A 5ANUA 2CQKA 1H89C 4IQ4A 3S3OA 1WQ2A 5JVGF 4CICA 1F5TA 5D4SA 2DLLA 3J81K 1IUYA 3T0YA 1TL8A 2FF4A 2X9DA 5E8GA 3SDGA 4Y52J 3G4SI 3RCOA 1O7FA 1AKHA 3LA2A 1MMDA 2CQ7A 2E7WA 3HOSA 1O3RA 2EIJH 3N77A 1I5ZA 3I0TA 4KJZA 1AWCA 1PDNC 4YOQA 3SZTA 3BTCA 3VSKA 2E1OA 2E34A 5IT9Z 1X3ZB 2VKDA 3IH4A 2GQQA 3DFGA 1BC8C 2VNQA 3CO6C 3M7GA 3MCZA 3DF8A 2DA5A 3JCUC 2XRLA 3X0KA 3BZKA 5ANSA 4XOTA 1JT0A 2NNYA 3EUAA 3G73A 1QZZA 2J8QA 3H3UA 3ZR8X 1J0RA 4HLYA 2Z33A 1PUFB 2W1OA 3FM3A 1HDPA 2UXNA 3SZGA 5J3LA 3E5QA 4XKVA 1PUQA 2CG4A 1X4PA 3JRBA 1DP3A 1NQZA 1NG7A 2NVTJ 5FKMA 2E5ZA 1P9QC 1HX3A 3IKTA 2BHYA 4BJ6C 4XLPF 4BQAA 1QNTA 1TP4A 1ZRCA 3K4KA 3JW4A 5LLQA 1FBUA 1HKSA 3PQJA 1T39A 3HRSA 3CP2A 4M6XA 2K9LA 3TMOA 3ASOH 1FTZA 2LY1A 1XDSA 2LF8A 1ON2A 1RRJA 1VI0A 3HGGA 2CU7A 2Y0MA 3Q2TA 1ETOA 4I99C 1BBYA 4HAMA 3BZ6A 2O03A 2EQRA 3LSTA 2I8UA 2K9NA 1MH3A 2HGCA 4ZTJA 1WGXA 2Y0SA 5CJ9A 4PGGA 4XSZF 2HKOA 5IY5H 2A8TA 4ZDLA 1HA8A 4A3GJ 4ON0A 3F8MA 2GT2A 4F7ZA 4BS9A 1ON1A 5D5XB 4EEFG 5H2FC 1J7KA 5BOXA 3CJTB 4L9NA 2PJPA 1KTGA 4A3CJ 4XICA 5K7ZA 2XPVA 4CHUA 3CUQA 4CA0A 1ZKGA 3I9XA 4MQ9F 2F5DA 2JZYA 4C9YA 3I58A 1UFMA 1R58A 1W4MA 3KPHA 2HDCA 2PLYA 2R0QC 1FIAA 3HGYA 5EZHA 3W6VA 4LG0B 4K6EA 1MBKA 3KLOA 5DPKA 2DU9A 4A3MJ 3OSFA 1WH7A 3AFHA 3AG2H 2DQRA 3K69A 3CMAI 3N97A 4EM0B 3LSJA 4Q47A 4PFOA 3RKYA 4BJ5C 1BR4A 2KMUA 1HLVA 1FTTA 4KN7X 2ACJA 4RM3A 4FASD 4KYWA 4UV9A 2CUEA 4HX8A 3O61A 4PFPA 1WI9A 3H0DA 2I5UA 3FKJA 1MJ9A 4PK4A 1SEUA 1QZEA 1SMYF 1VC8A 2OD5A 3CZ6A 2HOSA 4XRSG 4S04A 3K70D 5E1XA 3C7JA 3B73A 1A04A 1TC3C 3GFMA 5B1AH 2H94A 4AC0A 4QSHA 2HYGD 3HM5A 3SDBA 1TLHB 1UZCA 3LMMA 4XKBA 4OIOF 1YTYA 1XGMA 2KQRA 4Q4ZF 4CZZA 1K2EA 3OYNA 1YIOA 2MH2A 1W7PA 2EBIA 2L7MP 4YIRX 4IO9F 2IGKA 1Z91A 4RDUA 3FX3A 3KEYA 4J01A 5HODA 4ENJA 1Y1VJ 4ZYAA 2Y9ZA 3O6ZA 1V5FA 3DCFA 1G2HA 2ZJ2A 2ZCWA 3RZDJ 1FOXA 3RKQA 2W7NA 4KG4A 1OR7C 2VKVA 5DM6F 3OGAA 3IAM2 3JRDA 1A36A 1JXSA 5HLGA 2X85A 3G1OA 3H36A 4C2UA 2LMDA 2E71A 1FOKA 4XONA 1LB2A 1R00A 2HVQA 3WTZA 1AHDP 3S3MA 3X0SA 1QO0D 2FA5A 2WY8Q 3S2WA 2X48A 1FOYA 3ZMSA 2E1NA 2BYVE 2LC2A 1NG6A 2XVCA 3E3VA 1W36D 1BR2A 3OYHA 2MD0A 2V26A 5DUIA 1AOYA 2CFOA 1Z3YA 2ZKZA 4KT5C 1IV8A 2Z3YA 4CCKA 1P4XA 3GX4X 2CW0F 2X51A 4L5EA 3ABLH 4W1UA 2E2IJ 3D5SC 3CCVI 3OYFA 3ZR1A 4D0PA 3AAFA 3V7CA 3HZJA 3GUDA 4BY7J 5L3BA 2WV1A 2ZMEA 5LEKA 3X0NA 1IDYA 2HZDA 4MEYF 5FO5A 1P4AA 5J1YA 2PI0A 1C0WA 2EINH 5EZGA 3I64A 2O8XA 1KU3A 3GTOJ 4E7JA 2H1LA 2B0VA 3KP7A 3ML6A 4Y33A 2DA1A 3KYLA 2WC2A 5DS9A 3P9KA 1IRGA 1WKMA 2ZNYA 1D5VA 1V5EA 3V7RA 4HLXA 4RAFA 1D0XA 4RBOA 3I4MJ 2R7ZJ 3K1PA 4M3FA 1MNDA 5LHHA 3LOCA 4LG3A 4G6TB 1HDDC 2KT0A 4RGRA 3HTUA 3LSIA 3TQNA 3OS2A 1AKHB 3DKUA 4OINF 4IXAA 1LPQA 1TWGJ 2DT5A 2VXDA 5J47A 5FFZA 2EFPA 1IO2A 2ZJPF 3CCQI 4AM3A 3G0QA 4QPOA 3V4GA 1SAUA 4BE2A 1CQTA 2JVBA 1K78A 1WFXA 3R6SA 4UB6C 4XOPA 3LAPA 3VYUB 5LRSA 4HPQA 4AIDA 4A3FJ 2AQFA 1SD7A 2DPDA 3HSFA 4OOIA 5FD5A 4BGDA 2EV0A 4B43A 1RPWA 2K3PA 2ZFUA 3SMDA 1IN5A 3EYIA 3RIRA 2KZVA 4Q5SF 1WCMJ 2R3SA 3EUKL 4MIMA 1S7AA 3VPRA
chains in the Genus database with same CATH topology
3BJ6A 5ILVA 1ZGJA 2W57A 1XGNA 4EJWA 1FBQA 3F6VA 4UHTA 2HTJA 3V7SA 2QJOA 1P2FA 4RGSA 3QSJA 1O7LA 4N1UA 5FLXK 3IKVA 1KQ0A 1D8JA 3GFLA 2HEOA 4M71A 2YVNA 4WCGA 4Y15A 1VHGA 3OOPA 2JT1A 2FNPA 2ISZA 1I6XA 2ADUA 4S2WA 4L9JA 2P6SA 1GXQA 1UB9A 4YIFA 2HYFA 3TOAA 2EJRA 3CUQB 3ECOA 4IHSA 1H0MA 2HZTA 4FX0A 2CYYA 5HS7A 1Y0UA 5E18F 2KDVA 3R03A 3MEXA 2Z9OA 2EWNA 4LLGF 3SHDA 3U9GA 3H95A 4P9UA 3VB2A 5HVQC 3ZN1A 5CVIA 3DPTA 3R0AA 3M1EA 3AC9A 3EQLF 2B0LA 4UVBA 2AXLA 2LNBA 3KP4A 4MTEA 4UV8A 4KICA 1JHFA 3DXJF 3GZ6A 1JRKA 1K7AA 5ISYA 2H6CA 4WX9A 1W7PB 1JHHA 4BHCA 2GXGA 3V8KA 1SJYA 2VBZA 1R1VA 2RDPA 2O1CA 2F2EA 2UZKA 4ESBA 2GWRA 3F23A 1IN7A 3V8LA 2FOKA 2D1VA 3BPVA 2H09A 3L2CA 3PFIA 4EGZA 2BV6A 3KEOA 3N9UA 3I53A 1G3YA 4HF0A 2JSCA 4GYIA 4CDGA 3WTYC 1FWZA 1X3UA 4HBLA 2O5FA 3O2PE 4HV6A 2YPRA 4XBFA 3R60A 4ZYEA 1EH6A 2ZMEB 3I59A 3GWYA 3GVAA 1PPXA 2EFQA 1R23A 2A69F 1P92A 1BIBA 2RN7A 2ZBKA 3HOTA 4CGZA 3EDPA 3Q9VA 2XHKA 3ZMDA 5CVJA 1GA7A 5D5WB 3WTTC 3F8NA 4HFQA 1FSEA 4HVYA 1IN6A 3BM4A 3L7WA 5K1YA 2DK5A 4EMSA 1R36A 5JFRA 1VK6A 2XGXA 3REOA 4ESFA 5DEQA 1K78B 1LVAA 4MNUA 2E7XA 2ETHA 5LGNA 4A5MA 2ZO4A 5CYVA 4IVNA 3BY6A 3JTGA 1MQEA 3E57A 4KA4A 4L5JA 4YFNF 5L3FA 2XKPA 3CNGA 3KE2A 4GGGA 3BHOA 4A12A 5L3GA 3VODA 5GHIA 2XASA 4YPRA 5ILUA 1S7OA 1UCRA 2XAFA 1WWXA 2QYOA 1FZPB 3FCMA 1BC7C 5D6EA 4U0YA 4IRIA 1LDDA 4I7HA 2ZFWA 1ZLJA 2O0YA 3PQKA 5GHMA 5HZXA 3CO7C 1LEBA 5ICEA 5DD4A 4G9YA 5F6FA 2P4WA 2V1XA 3FMQA 1HSJA 2B06A 3Q5FA 3K1MA 1HQCA 2J5PA 2GA1A 2OU2A 3RYPA 3VFZA 1KGSA 2ZNZA 3MZHA 1XSXA 5E1WA 1BI1A 3QPTA 2ICJA 5GHQA 1VRLA 3RH7A 1QGPA 3CTAA 4KG3A 2OZ6A 2QZ8A 1ZYRF 4PZJA 4AIKA 4MEXF 4QLCU 1J75A 1SD6A 2IP2A 4UXNA 1HXDA 2A6TA 1FSHA 2O6GE 2GIVA 2VE9A 3J7AO 3OV8A 3BROA 3W6JB 2W25A 4ZZDA 1XSVA 3M8EA 3TKYA 3P9CA 4BHPA 2A68F 4AIHA 3FMSA 3EYYA 4J7HA 4V14A 3RDIA 1ZLKA 3A6SA 2VBWA 3F6OA 3F22A 5D4RA 2QVOA 2W85A 2BEOA 2QBYA 1MUTA 3EF5A 1TW3A 4HW0A 2XV4S 1X84A 1LNWA 3BJOA 4UVCA 5GHPA 3WU0A 4KFCA 1SMTA 4Q48A 2O5WA 3E6CC 3QP5A 2DSCA 5DV5A 4S2VA 2A5YB 2CSOA 2K4BA 3KP2A 1V8LA 1Q27A 2YVPA 2M5WA 2D45A 2A61A 1DDNA 3RKWA 3N4MA 1KQ9A 5JHUA 2DAOA 3WTSC 4EGYA 4BNCA 3I59B 3HUGA 4RS8A 3BDDA 3A6VA 3EETA 3GZ5A 3F72A 4RB3C 1IXSB 2OZUA 4C9WA 1ULYA 5D8LB 3HYIA 2A6EF 4A0XA 3HRTA 4IRHA 1L3LA 2YSRA 3KETA 1NHAA 5K5RA 2FEZA 2G7UA 2RNJA 2HWVA 2P6TA 4HDUA 5FSMA 4JZTA 4N9IA 2IA2A 5ED4A 1TQPA 4HV5A 1WRJA 5CVVA 4L0YB 2Q8KA 3J7Ye 5LGUA 4A6EA 3BJAA 4LD5A 2CL3A 2QQBA 3TO9A 1SD4A 3MCFA 1I1GA 2NYXA 1YW9A 1LJ9A 3FXUA 4U0VA 3M8FA 4ZH4F 4IF4A 4FT8A 3QOPA 1KU7A 3ZMUA 2STWA 3BAPA 4JZVA 4XSXF 5EEGA 2P5KA 4OIRF 2TDXA 4BHBA 2VOPA 1USTA 1KYWA 3K0LA 1FYMA 5HDNA 5LPGA 3K9TA 5D5UB 3E5UA 2EFNA 1U2WA 3GXOA 2BE5F 4G7OF 1SAXA 4KNYA 2ZXJA 3L85A 3D0SA 5ICFA 2HKXA 2G73A 5FSOA 2R5WA 1B9MA 3X0JA 3KZYA 2NS0A 1QBJA 3ECHA 1REPC 1FX7A 3RTRA 2CWEA 3FZVA 1PP8F 4EJUA 5TJJA 2XUBA 2PMUA 3H3ZA 2LKPA 5ANTA 3U53A 2QKMB 1KU9A 5DCMA 3ACAA 5AIQA 1RUNA 2JPCA 5LHIA 3EUHA 2NAZA 2M45A 2GB5A 4MHGA 4XLNF 3ISPA 1E2XA 4B8XA 2YVMA 1ZARA 5E20A 1ZRDA 5DYMA 3RI4A 1PUEE 2O3FA 2PN6A 4LK0F 2QBYB 5F1RA 2DW4A 4HA8A 2R7FA 1YYVA 3GO5A 1XMAA 1BN5A 3IRRA 2Z99A 3FJYA 5GHOA 3KCCA 4YFKF 3IWFA 1MDMA 4A0ZA 2YVOA 4ZYHA 4I0AA 2XROA 4AVPA 2V1UA 4U7DA 5D6FA 1LDKB 5D8KB 4R79A 3ZQ7A 1BOAA 3JSOA 2HQNA 4HF2A 3J80K 3KP6A 1UHWA 5HDKA 2PEXA 4I09A 1KYZA 3EXQA 1R22A 1T0FA 2IVMA 2VE8A 2G74A 1QQIA 2DTRA 4P5OA 2QQAA 3E6DA 1R1TA 4KIGA 1YFHA 1W5SA 1BI2A 2EV5A 1NQYA 2QJTA 1LDJA 1T2KA 2FMYA 1B6AA 3VEPA 3EEUA 3O3KA 1E17A 3X0LA 5FGMA 2OAZA 5DD8A 3HRMA 1MD0A 2LSOA 3WTUC 2HFHA 3GFIA 4FX4A 3TGNA 2VT3A 5ICCA 4EJVA 4L5IA 4WXDA 3WHWA 3MDIA 3IWZA 3L00A 4JK1X 4RB1A 5H6QA 2J5OA 2Q2EA 2BGCA 4N9HA 2FBIA 4I98B 2KRFA 2I8TA 4ILQA 1BIAA 3I7UA 1Q1HA 3HHJA 1XB4A 1R1UA 2L4AA 4KIBA 3G3ZA 3T1BA 1HZTA 3EESA 1MJBA 2FQ3A 4BYYA 1KT9A 2ISYA 2F5EA 4ESJA 1KHZA 1KQ8A 1FPQA 3GF2A 4LK1F 2OQGA 1IRYA 5H6RA 2HOEA 2LF7A 4LJZF 1MGTA 2D2WA 1Z1DA 3FF5A 5JVTA 4ZZLA 1V8NA 1U20A 3L9FA 4Y13A 3I71A 1XMKA 4ETSA 1PUSA 4N0BA 2PBIA 1G0SA 2EK5A 5KVRA 1U6GA 3ROUA 4WK8F 1Q54A 3SHFA 3L09A 4KN4X 3H92A 2CO5A 1MJAA 1ZGAA 5FSKA 2K7LA 1U3EM 2VBXA 1HKQA 2VC0A 4LGWA 1FT9A 2L54A 4GXOA 4GO1A 5DCMB 3DQVC 3WGHA 1I1SA 1F1ZA 1TW2A 3LFKA 3JTHA 2ESNA 4JZUA 3K2ZA 3SFZA 2V79A 4A0YA 2KIMA 5AONA 3R0JA 5LHGA 1IF1A 5BQTA 5FFXA 4M9ZA 2QWWA 2L01A 5ANSA 3CUQC 3BP8A 2VODA 2FNAA 1UHMA 3CJNA 1V8VA 2XIGA 4RB0A 2VN2A 2VC1A 4EM2A 1V8YA 2CGPA 3ZN0A 2DQLA 1Z6TA 1MDMB 1P6RA 1G3TA 4A5NA 1V3FA 1O3TA 5ICGA 4U7BA 4WXCA 2WWYA 3T8TA 1U5TA 2BBYA 3HIFA 4L9VA 3I54A 1G6NA 2EA4A 3W6KB 5IW5A 2L4MA 4MGRA 3DUPA 1PVFA 3O52A 1XGSA 1V8SA 4HQEA 3D5LA 3Q91A 1XSAA 3R61A 3FSPA 4OIQF 2FXAA 2RGVA 3HSEA 4YFXF 3HSRA 4CXFA 5BMZA 4KIFA 3FMRA 5C7QA 3J81Z 1MR2A 4JBAA 3A6UA 1QVJA 2FU4A 1J5YA 1VC9A 2H27A 3MWMA 1F3YA 3I7VA 1SU2A 1D3YA 1IN4A 2FE3A 3E6MA 2X0LA 5E8IA 5CLSA 2HS5A 1B1BA 4TV7A 3CDHA 4NFXA 1TQIA 2DSBA 3WTVC 2MLGA 4O6JA 5HOOA 3U2RA 5GHNA 2K86A 3X0MA 2EFWA 2A8SA 3MGMA 2HR3A 3HYQA 1FBSA 3GEZA 5C7TA 3KEQA 3X0IA 1GHCA 3FXQA 1ZG3A 4G6QA 1OR7A 2P8TA 4LLLA 3WGIA 2KKOA 3BWGA 1IZ1A 4C9XA 3F21A 1K79A 2Y75A 4Z2YA 3WE3A 1IAWA 1V8UA 1MP2A 2IA0A 3X0OA 2Q0OA 3MFKA 3LQRA 5L3EA 1OYYA 5LEJA 2JTVA 2RVCA 1FP1D 3GLXA 3LA3A 5HDGA 3X0QA 3JAMK 4EJTA 3CLOA 1YO5C 6PAXA 2OBPA 3HHHA 1RI7A 1V8WA 3DEUA 4PGHA 3F8CA 1Q33A 1G3SA 4S05A 3HHGA 4NB5A 2V1DA 4M9SA 2PNYA 4ENMA 3ABUA 4WXHA 1OPCA 2EFOA 5H20A 2EV6A 2AS5F 3O6BB 1G3WA 4DNCA 1QPMA 4K2EA 1GVJA 2YX4A 4CYDA 2V6CA 2MH9A 1O3SA 3DPLC 5ERIA 1EH7A 3WU1B 4AIJA 1H9GA 1U5TB 3E5XA 3E97A 2K27A 2IRFG 5CVUA 1ZH5A 3IHUA 2RC4A 2P5LC 3V8JA 2KIUA 3ZPLA 3Q4IA 1R5GA 5FB2A 3GG6A 4HOBA 4CO8A 3TO6A 2L02A 3HRUA 1ZRFA 1HW2A 3C18A 1HBXG 3MDGA 4ENNA 2K02A 1SZ3A 3J80Z 4WF2A 2DUKA 4LB6B 1IW7F 3RKXA 4P96A 4RAYA 2VT2A 5FSLA 1T6SA 2P7CB 3COAC 1EV7A 1OYWA 4PDKA 3WE2A 3F3XA 4IRGA 5I8UA 2QM3A 2WV0A 2OQRA 1LQ1A 1YQAA 3ULQB 3TDUC 2STTA 1FC3A 4G94A 5ANWA 2RQPA 4M72A 4DQ2A 4MTDA 3ZMZA 1STZA 4EQQA 3QU3A 4IJXA 3F8FA 1K6OA 4BAYA 1OYIA 3GZ8A 2DO7A 2M30A 1IXCA 2QQ9A 3GWZA 3K1NA 4H0EA 3ZMVA 1IRFA 1BJAA 2UXXA 5FD6A 3LWFA 3GFJA 1U5TC 5IT3A 4B09A 1FNNA 4HX4A 1ZG5A 3QPHA 3SXYA 5FSIA 4I0BA 1J9IA 1IXRC 1X51A 4EV0A 3NEUA 3MAJA 4MQVA 5FLXZ 2FKBA 2VBYA 2MC3A 5A2QK 4GCVA 1W5TA 2VONA 2ICKA 1V8IA 4UVAA 4YPHA 2AZWA 1GXPA 3ID9A 2PQVA 2W84A 5HS8A 1ZG1A 5E1ZB 4I01A 4KDPA 4AD9A 2IT0A 3C3WA 1OKRA 4I02A 1SD5A 3KFWX 1YG2A 2VNPA 2NRAC 1LEAA 1XDUA 4N1TA 4NFWA 5LBQA 1YLFA 1K26A 2QENA 1FP2A 1O3QA 2KJCA 5E17F 4KYXA 2Z5UA 1QZYA 2DK8A 4HF1A 1OW2A 3KVHA 1OMIA 2A07F 2P7VB 4KUMA 2YR2A 3Q9SA 1RZ4A 3T8RA 4EJOA 1ZHFA 1W7PD 2EB7A 2QLZA 4PCQA 2MLKA 1CF7A 2XAQA 1BI3A 3X0RA 5J8FA 4R1HA 1S6LA 4NQWA 3ELKA 2V9VA 4G7HF 3WODF 3R4KA 2E1CA 3BPXA 3WTXC 5IT9K 1NFSA 1ZN2A 2CFXA 1G4DA 4RGUA 2FRHA 3MQ0A 3KLNA 2D1HA 1KU2A 3ERED 4ICKA 4DYWA 1TQMA 2HTSA 1F9NA 5DDGA 4G7ZF 5J8CA 3P7NA 5L3DA 1V8RA 1TBXA 4WWCA 3C1DA 2YX7A 5IW4A 3MZYA 3FM5A 5ILSA 1KA8A 2MBFA 1D8KA 4I2OA 2DI3A 1PUNA 1XD7A 2F5FA 1B4AA 2MD5A 2COMA 4AWXB 2K4JA 4LFUA 2RV8A 1T98A 4NHJA 1SFEA 4RGXA 1PP7U 1YW8A 2JRTA 3A6TA 4RAZA 1BI0A 2W4EA 1J2XA 4HZFA 1JE8A 4UUVA 1SFXA 2X4HA 3TO7A 2FSWA 3FWEA 4HDVA 4OMYA 1T38A 2PFBA 3QAHA 4LLNA 1FY7A 4HX7A 1RUOA 2RRKA 3Q93A 1DPUA 4Y17A 3SONA 3DKWA 1ZAOA 2O61A 3I4PA 3DP7A 3P5TA 2VXZA 1DP7P 1VCDA 2XKOA 1U78A 1Z7UA 3JSPA 3BOQA 5EEHA 2UWMA 4XRFA 5JR3A 3ZP5A 2L3DA 5KK1A 4ZYGA 2OA4A 4A2UA 5JI6A 1Z6RA 1WSUA 4ENKA 1PPWA 2A8RA 2MA3A 1JGSA 5C8LA 5AIPA 3WG9A 1I27A 2A8QA 1L0OC 2PQ8A 2QUFA 4KTBA 3RPQA 1B59A 1Z05A 2F5CA 1TUMA 5K5QA 1XCBA 2G9WA 4BXUA 2PG4A 5L3CA 3I5UA 1HW1A 2XAGA 1R7JA 1XSBA 3TDZC 5LRRA 3GYHX 1TNSA 2GXBA 4LB5A 4QWQA 4JZSA 1USSA 4EM1A 3X0PA 2XRNA 4IHTA 5BONA 1DPRA 1RIOH 5BS6A 2A3SA 5TRDA 3NRVA 2KIFA 3JAMZ 4L18B 2IPQX 2DHOA 1CF7B 2LDUA 3ZMTA 3HTSB 4U88A 1ZREA 1FYKA 2DFIA 2XSQA 4L0ZB 5F64A 3B02A 5J6XA 3RJPA 4JQFA 2DSDA 1P4WA 3IC7A 2FBKA 1S3JA 2FBHA 1HW5A 3RPUA 2I6KA 1F4KA 4M9XA 3GRNA 1XN7A 5FSNA 1YS7A 3CUOA 1EH8A 5BPDA 3T5XA 1XGOA 2YU3A 3F8BA 1FYLA 1Z9CA 5K5OA 2Y48A 4U0WA 1XSDA 4RB2C 2G7HA 3VOEA 4G6DA 2XAHA 2R7DA 2YYHA 1ODDA 2PMHA 4P9FA 1B9NA 3FHZA 4A6DA 2WTEA 1R5HA 2RKHA 5DUKA 2Q9PA 5BPIA 2H6BA 2FVVA 1HSTA 2XAJA 2W24A 1J59A 2IW5A 2A6HF 1VIQA 1BM9A 5GHJA 1MZBA 2M87A 2A8PA 1XSCA 2M8EA 3LQQA 3ABTA 1V8MA 1X83A 2GZWA 4ASNA 4IJAA 4M73A 4R8HA 3Q2SA 1NFZA 4BH9A 1MK1A 1TTYA 2ESHA 3P6YA 4YG2F 3LA7A 4OU0A 3FK9A 1IN8A 4MPOA 3O69A 3COUA 3TOBA 3FXRA 3SZPA 2DPUA 3SQNA 1VIUA 3KZZA 1YS6A 5D5VB 1HKTA 2IA1A 5CFIA 3O8SA 1SFUA 1G9QA 4S2YA 4OMZA 3QP6A 1RNLA 4M74A 1H9TA 1DUXC 4LG0A 2GT4A 2M1BA 1U8RA 5HLHA 1SOIA 3DV8A 4O3MA 1FLIA 1I9AA 1YW7A 2FMLA 4KMFA 4HQMA 4P55A 3F13A 3WGGA 5CFJA 1S29A 1JKNA 3LAJA 4HYEA 1V8TA 1MQWA 4S2XA 1XCVA 1CGPA 4UNOA 4IPAA 5A2QZ 2GA2A 1RRQA 4J7GA