5DFTA

Structure of the eleventh type iii domain from human fibronectin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
89
Chain Sequence
QMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTTIPAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Structure of the Eleventh Type III Domain from Human Fibronectin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 10
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dftA00
3HUJF 4F7EB 3FT2B 5GSRB 1P5UA 3HLAB 1SEQL 5I75B 1VGEL 4K8RD 1AGDA 1OF2B 1QR4A 4YUEL 1H3XA 4A6YB 1HI6A 3OX8A 1B6UA 2Z93B 1OP3H 1OB1B 2CK0H 5K9KA 4X6BB 4EJ1C 2HVJA 2GK0B 2I25N 3WFDL 1MI5E 4OUOA 1A5FH 4NZUL 5IF0B 3FN0H 2XYCA 4F57H 5HHOB 4Q97A 2AERT 1EAPB 3CC5B 3AXLB 4MXQC 3CLEH 5C0ND 3F7RA 3P9LB 2WWKT 1CGYA 4QTHB 2VDMH 3HNVH 2IJ0C 4QOKE 1A47A 2NXZB 3BPLB 5J6HB 1QBML 3HPLA 3RHWF 4ELKA 1UB5B 5I1GL 1RZKL 4OUUB 1MQKH 2Z92B 4XXCA 1C7SA 3GGWA 3RX7A 1UVQB 2IAND 3SKMB 2OTUA 2CRYA 3N1MC 3QHFL 1Z2KA 3FO1A 2ADFL 1PG7X 1KXTB 3MLWH 3OAYK 5GRJL 1L0YA 2BVQA 3G5YB 5D2NA 4HH9B 4AL8H 3FZUC 3NPZB 4APQB 2P5EE 2V7NB 4O51B 4PJEE 1E6OH 1OCWH 4YX2H 5T3XH 4BSVB 2W0FA 3G08B 3EJZD 1Q72L 3EIFA 5J3HD 2YPKA 4PV9A 4EVNA 1EGJA 2B4CL 1SBSH 2P8PB 2V17H 1S5HA 5D7IF 1T1YA 2JIXA 2W9LA 4KHXH 3P73B 5HVWA 1MCHA 3ZYJA 2XN9A 3ARBA 4CDGC 1YMME 2VB5A 3BW9B 5BXFA 4UTBL 3VRIA 4HCRL 2DYPB 3KJ6H 1FNFA 4X9BA 2DD8H 2BSTA 2W9EH 2D9CA 3L3DB 4M3KB 5IHBA 5ICZB 1I1YA 2D7MA 4BKLB 5SX5H 4OFDA 4KZDL 4OZHE 2ZCLL 1WWBX 1O0VA 3ZT7A 1DUZB 3SE3A 5E2UH 1HILA 3FB8B 1KIPA 5DJYA 2ICES 5IT2L 1DBAH 3C5ZC 3KS0J 4GJTB 1TJGL 3HI5L 5C0CB 1NL0H 4BELD 2JJTC 1OAYL 1WUNT 3QO0A 2PCPB 4OJFL 1TJHL 4JRXD 3FQXB 3VFPB 4HUVB 4IS6B 3U7AA 2OMBA 5MERB 3GSRA 3OKYA 2NY2C 3G6AA 4RFNC 1AI1L 1CVSC 3OAUH 1Q94A 2YBRB 1BLNA 1ZWIB 4ZAKA 1IQWL 3NABL 1OM3L 1WIUA 3MZGB 2N7AA 3HUJA 3DOSA 3B3IA 3PXHA 4MNHB 1MCBA 1OSPL 1H15B 1S9XB 3BT2H 3C9NB 4ZTOH 1OOAA 4OLZL 4G7VL 2YRPA 2P48B 2AW2A 3QUKB 3BN9D 5ICXB 4LLUB 3RWGA 4UNVA 1TXKA 1BWMA 3KPMA 1CGXA 1KACB 1MJ8L 4B5EA 4P46B 5KSAC 1MNUH 1N6QH 5LXGH 2P24A 1TZHA 1YEFH 4ZO7A 43CAA 1W72L 4JEGB 5D7JB 3AFLA 5GGVY 2DAVA 3S36H 1JGLL 3RIAF 4UIKL 3GSOA 3A67H 3MLVH 3VWJA 2QKIA 5JDSA 3N9GH 3LIZL 4YH6A 1MHEA 1DUYA 4XC1L 3W5MA 2J8OA 1N59B 3B5HA 1ZT4B 4MDIA 3MLSL 4YDVB 4KKLD 1RK0A 5GGVL 5C09D 5F9OL 2J7LA 4LDEB 2NZ9C 3TA3D 1V7NH 1TVDA 5GSVA 5FYLH 5GS1A 1FG9C 4LEXL 4J1UB 2O61A 4J3WA 2LTQC 3IDJB 3O4LA 4IRZL 2ICEA 4E41B 1IGTA 4ZQKA 4XWGH 3ABZA 2H32B 4K7FB 4OZ4A 2FR4A 1FVCB 1NPUA 1OAZL 5IW3A 1EVTC 3BE1H 2Z31B 3IFOA 4HUUB 4MX7A 4ZPTA 4M8QA 4ZTPH 2GFBA 4MZ2A 4P5MB 4NQDE 5KW9L 3I50L 1S7TB 1J05B 5HYQA 2EXYD 1H5BA 4JQIL 3VGEA 3OSKA 4JPKH 4M1GL 1ZANH 4Z7WF 1U8LB 2YD2A 1E4WH 3CVHA 5EBGA 5CJBA 5GRUL 5BRZB 1WTLA 5IB5A 5F3BA 3MJ8A 5D1QB 1MWAL 1HIMH 5KSVB 5D2LA 5HHOD 4NQSB 2VDOH 4R8WL 4HZAA 1NGYB 5IJKC 1NBQA 4KKAD 5BCAA 1I7RA 2L0DA 3RWDB 2NXZD 3IAQA 4PRBB 5AYQA 5T1LA 2NR6D 1M71B 2DLEA 4L4VB 4NGHL 2BJMH 3VXUB 4WY7H 2BXYA 5FDWB 5IB1A 4P2QB 1GC1L 3EZJB 2F53A 4ZFZB 2DBLL 4OZHF 5ANME 5LGKA 2R0WL 2IFGA 1T5XB 2GITB 4KKCD 3QDJE 3MODH 3CVHH 3VI3E 1KJVA 3FO0L 1I8IA 1KJ2B 4JO1L 4V1DE 5DWUL 5GJSL 3V79C 3GIZL 3EOTH 4JN2B 4DEPB 1F13A 3H9HA 1JNLL 5FHAL 3SOBL 4R0LC 5ETUA 5FCSH 3REVA 4HBQA 5JW3H 4FXGB 3G5ZA 2OQJA 4ZYKA 3WHXB 1XIWA 3M8OH 5AZ2H 5IG7B 4JGJA 1JTTA 3QQNA 1PFCA 2FSEB 3D18A 4K3DH 2ICWI 3REWA 4I3SH 5D1ZC 4CN4A 2DYPD 1RURL 3D6GA 4OF0A 3PWNA 3V5KA 4D94A 5LGHH 1ZLUH 1B0GB 5DRZB 4NKOA 3QJFA 1PSKH 1QP1A 1NCTA 5JQ6L 2HT2D 2R15A 1B0WA 4JLRB 4WTZA 3IDMA 1Z9MA 1N8ZB 1L0QA 5JIIA 4GH7B 1LO4H 3AB0B 2V2XB 1QD0A 5CJOH 3DECA 1RFDH 3OKMA 1P4IH 5E99H 1MY7A 1MI5A 4Z8FH 1NUGA 3GSVA 1B0RA 1C5DA 4UNTA 5DI8A 3QA3A 3QIBC 4NPYB 5E8DL 4YDLB 4I18A 2VABB 1AR1C 2ZKHH 4J6RH 5T1DL 1QSEE 3NN8A 4QOKA 3S3SA 4Z78B 5C0DA 3VI4F 2XA8L 2XWTA 4ZPVB 2Q6WB 3NZHL 3O3UN 4QXUL 4HK0A 2H2PC 1NGPH 3VFGL 2KKQA 1LK2B 4H1LA 1ZE3C 4F7MB 5C0FA 2Q8BL 5DT1L 1HHJA 1NGXA 2NNAB 5EU4A 1OT1A 4PGEA 4M03A 4WUKH 1NC2B 4XP9H 4DN3L 4KRPD 2PYFA 3K8MA 1DQTA 1HYRC 5BOZG 1YDPA 2B7DT 3BPOC 5EN2A 1CLYL 1E4JA 4XHJD 1KTKE 5DQJA 5I76B 5TFSL 2P5EA 1NLBH 4P46D 5JHDB 1PYWA 1GGTA 4PJEA 4WUUE 2FZ3A 5E94A 1GCFA 5D7JD 5FECA 2V9TA 1GHFH 3UO1H 1S9KC 1LNUA 2H41A 5DK0A 2Q86B 4XWOC 4K07A 4G9FE 3MGTB 2AJYL 3QWOB 4G42A 3LD8B 3BD5A 1ED3A 1YMMA 5D8JL 5HHVH 1I9IL 5JR1H 1P6FA 2ZUWA 4KK8D 2NY0C 3E6HB 5KS9E 4U6XB 4JN1H 3BGMB 3EUUA 4RMQA 4S2SA 5MP6H 4OZHA 3U0TA 4E41D 1IEAA 4NN7C 3BN3B 4L9LB 3E8UH 2G9HB 3BPNB 1R3LB 5F8QC 5B21A 1KPUB 4H26B 4R7DA 4PRHB 5MENB 1CTNA 5DRXB 1OGAE 5F7EL 5I1AA 3MRJB 4O9HL 2M2DA 2CDGB 1INEH 3KPLB 4PJXE 5ESAA 4PYGA 3VI3F 5KANI 5L2JB 4PFEA 3U1SL 4JM2A 3VFTA 4OM1L 3SO3B 5IW1B 5IR1B 1D5IL 1G6VK 4URTB 1IILE 5IM7B 5BRZD 4ODWA 4RQQA 4RGOH 5D1QD 2ZSVB 4KQ3H 2YPLE 1W0YT 4ZO8A 2EDHA 1W0VA 5EU5A 4LCUB 1FO0L 5D7LD 4WTZG 1IAIM 1JGDB 1T7YA 4ODXB 4H5SA 2FYYA 1BIIA 4UV4L 1OVZA 1YNKL 3D39B 4FQXA 4O00A 5EFIA 4E0RB 1G7QA 2AGJL 2E27L 3BH8B 2X2YA 3VXUD 1B9ZA 2FX9L 2GK2A 1KC5L 4XNQA 3KPRE 4JDVB 4L8DB 4XBPB 1UA6L 3NZ8B 1P9MA 2PO6B 4J3OC 4LGRB 5E6YA 4M48H 4OLYH 2R23B 5EO9B 4OF6A 5ENWB 4FTVE 4LLMB 2NQCA 2EIZB 5GZNC 2GJZB 2ATPB 3NCBB 5ACZA 1J1XL 3MCKA 5E56A 4PJAF 3PV6A 3VG9C 1AXSA 3HNSH 4QRRD 3WL9B 1DBBL 4GAJH 1WEJH 1ES0B 4U6HB 2JCCB 2Q8AL 4PJ9B 1I1RA 2G5BA 4QO1A 2D03L 1LEIA 1HHKA 1QRNE 2E8ZA 3OPZH 1MFDH 5J13C 2G2RB 2VOTA 3SDAC 2X1QA 2AK1L 2AV7A 2X4NA 3GHEL 3TJHC 5CD5D 1KPVB 1RUKL 1LP9E 1OWRM 1K3IA 1JPST 4PJ7B 4NQDA 2J5LB 4O58L 1I9JH 2VQUA 4NC1C 2K3TA 4QCIB 2IADB 4QRQB 3TN0A 1LILA 2ZG3A 1FL5A 2CLZB 15C8L 4XPBL 3PGDB 2DM2A 3FRPA 1WBXA 4RWYL 1PDKA 3BQUD 3MRIB 4YHOH 4PJIF 5EZIL 2R9HC 5GS0H 5ESQB 3T0WA 1FAIL 3MACH 1NBZA 4UUJA 2O5YL 2BMKA 3GSUB 3JV4B 1R3JA 1ONQB 2EDTA 5JOFA 2CKBB 3LZFH 3BPCB 3U48A 4JVWA 2XOTA 3GZKA 1E28B 5ADPH 1KOAA 4HKZB 4QXGL 5KN5B 1J12A 4MJ4A 3FOLB 4FFYL 4RGMC 2V2WA 2QSCH 2NMSA 5KS9F 4M6MH 4H25A 1UT9A 5D6CB 4CU6A 4WGWB 5HDOA 1CTOA 2MCPH 5ANMA 3QNZB 3MJ9A 3QDJA 3BFOA 1FG2A 2A1WL 3PP3H 3F5WA 4LHUB 4OI7A 3WSQH 4V1DA 4NKDB 4O5LH 4P2YA 2D0GA 2X1PA 4E5XB 3ALPA 5JOEA 5FHBL 3BDBA 4KUZH 4PJXF 2F54D 1YEIH 5JHDD 1CR9H 5EC1B 3MLPA 1UADC 3QUMB 1IC4L 3LS4L 3C87A 3K81A 4P9HC 3TJEL 3W39B 3C6LC 1HDMB 4IJ3B 1A6TB 4LGSB 3CFCH 4LARL 4P2OA 2VXQH 1Q0XH 4TPRH 3E2HC 3LMJL 3QXTA 1E0OB 5FCUL 4OV6F 3BKJH 4LF3A 4YBQC 5EBMB 1V8HA 1CZ8H 3EO0B 1OP5H 3ZDXF 1DQLH 3C2SA 3EYOB 2AV1A 5K9JH 4MQ7A 5EBLA 3RVXD 1L4IA 3BZFB 3NTCL 2NY3D 2BDNL 3GBML 1B6DA 1KB5H 4U6VH 4JO3H 2XIDA 3UMTA 2WWMC 1EJOH 2VLKE 3FFCE 1RQ5A 4J8RB 4GW1A 3OKDA 1RUQH 7CGTA 1CXIA 5MEND 4JFOA 4PLKD 1EHNA 3S37X 4HC1L 4H88H 3DVNB 5FXCH 3QIUB 5IBUB 5CWSB 3T2PA 4NDMB 4NBZB 1A6AA 1TJIH 5B3JE 4KJWC 4PJAA 2AJXH 3SDXB 1NFIA 2DLFH 2P43B 1PY4A 1T0NA 1I3RB 4Y5VB 2FO4A 5E08H 1URLA 2GJ6B 2LFGA 4RISH 1QSEA 2HH0H 3GMQA 2YWZA 4YE4H 4RFOH 4HWUA 1DANT 3RGHA 4LDLB 1JRHL 3U83A 5I1DB 4LLDA 1BGXL 1ADQH 1L7IH 1D3CA 3ARFA 2UWEF 4DFHA 3FQRA 1H8SA 1XGPA 2DI7A 3I02A 3FOMA 3MRPB 3CZFA 4Q58C 4ZD3L 3D25A 1CD1A 4UV7L 1ETZA 1VFMA 3IXTB 3MLYH 1CF8H 3I6GB 4G9DB 4IIQA 3ZKNC 5L2KE 3Q48A 5F7HA 4JCLA 4NZTL 4X6CE 4Q9QL 1MY5A 4MXQD 2WW8A 3MRCA 4L8SB 3UTPD 3WJLC 1Z0MA 1HZHH 3DJ9A 4KGLA 4G8GE 1FFPA 4F7CA 3O6KL 4X5WA 2Z8RA 1VKXA 5EU7C 4JPIA 4LHJB 2PO6D 1PZ5B 3HC0A 2AXGB 2ZWLT 5CBAB 4WUUA 3TIEA 1ZT1B 4XCFL 1J1PH 5EO0A 3BIKB 4JDTH 1L9NA 3WV0A 4FFZH 4EOWL 5JW4Q 2K9UA 4I13B 3MYJA 2AJSH 4MNGE 4ONGH 5TPWH 3ZKSD 4G9FA 3DX9A 1FV1A 5IGXH 3WLBB 4Q9RL 1QPPA 5HYEA 4OCXL 1IM3B 2KBGA 4FQCL 2DDQH 5CBEA 1A9EA 1KF9B 3FZUD 1CFTA 3NCJH 4XCNA 4F15C 4MQXC 5KS9A 1C08A 4RFEA 4OFKA 1GVIA 4NO2A 3EHBD 1CDYA 5I1CH 4KVCL 4EXKA 4MZ3A 3LKNB 4DFIA 2YSSA 4QHKJ 1OGAA 2X4RA 3F62A 1MREL 1CK0L 2ZG1A 3SE8H 2AABH 1KB9K 5FK9B 2DKSA 4I0PB 4PJXA 2W65B 1CWVA 2R29L 2V9QA 4PJHB 5GS3A 3TBVB 4PY8J 3E3QC 5DZOA 3OXSB 2DICA 2CJUL 2W38A 4MJ6B 4WWKB 3L3HB 4NN6B 2OL3H 3ULVE 1A6UH 4XAWL 4CMHC 4Q2ZB 3TO4B 3PWLA 3RI5F 1IGFH 1NGQH 1N6UA 1TZGL 5D7SH 2YPLA 2IG2L 4MA1C 1F2XK 4X4YA 2NLJA 4OTXL 4YK4B 5EZLA 4PRIE 5DZNA 5B38A 4HS3B 5I17B 3ROLA 1JTOA 1YN6A 1JRHI 2Y36H 5F88A 2O5ZH 4FG6D 1EMTL 2G75A 5FF6A 4HGWA 3L5HA 5F1NA 4Z6AT 3KPRA 1IGJB 3WDHA 2NPLX 1CDIA 2NY2D 4W4OA 1HINH 5L9DL 3DVIA 3V0VA 5BV7L 4M93B 4O2CA 1EUTA 1H3GA 4PD4K 4XNZB 4OCRH 4FTVA 4LASH 5SWQA 4ZXBA 4DTGL 2F19H 3HR6A 5DTFA 5C0RH 5B3JF 5CILL 1ZHKB 1GIGL 4Z7UE 1SHMA 1G7MA 3BUTA 2UWEA 1YUHB 4QNPE 5KSUA 1OTUD 3NPSB 4OV5B 4D0BB 3MO1A 1MRDH 2WINA 1MFNA 4E42B 4HJJL 2RFXA 2YC1B 4P3WA 3IFNH 4TOYL 1PGRB 5CKAA 1JGUL 1NCBH 1A1OA 1NMBL 1TENA 3VA6A 3MRHB 3HTLX 4NO5B 3ZKMD 5DMIH 3WFBH 3VE0A 5D2NC 1QRNA 1JP5A 3CMOL 5T3ZD 5CHNB 1BEYH 4KJQC 2A83B 3BEVA 4PLJD 4KI5C 2X4PB 4JKKA 3MRRA 3G6JB 1T4KB 1MRFL 4JFDE 3RY6A 4D3CL 2A74B 1H3VA 1LP9A 4W6YB 1RVFL 5EB9A 4HBCH 3QB7C 2XRAH 5SWZE 3RNQB 1EDQA 4YWGL 3ULUH 1B2WL 4Z76B 3MNWA 3JWDC 1FNEA 3ZKXC 5KVEH 1Q38A 5MEQA 2XTJE 3ARBC 3QQ3B 2YD1A 4BFIA 1JPSL 3S5LA 4M7JH 1F00I 1MCQA 1M7DB 4HPOL 5HY9B 5BS0D 4D9QD 4QHMA 3ARDA 5D1XA 1LK3H 3MXVL 1K2DB 2JJVA 5J1AA 3CCHA 5EOTB 3SKNB 5J1TC 4YNYA 2EDNA 1B4JL 3LDBC 1K4CA 4QF1B 1LGVA 2GJ6D 4ODSH 1FHGA 3HC4L 5CJ5A 3MMEA 3SE3C 4XPHL 3FFDB 1MUJB 5HGDA 1FNAA 3K2UH 4XPFL 3Q3GA 3K4ZA 3CGTA 4KY1H 3OF6A 1KXQE 2X70A 1RY7B 3STZA 1M7IB 2AJZA 4CMMA 3LB6D 5EU3B 4RIRB 4OM0H 1N3NB 1HE7A 2JB6B 1AIFA 4NQUA 1WIPA 4NHCH 4NNXA 5IBTL 4MYWB 1G6RB 5DRWA 1KEGH 3WS6C 4YDJB 1SYVB 3HE7D 4FQQA 1T5WB 4K9EL 3CLFL 4FFWD 5KJRL 3G04B 3QDMB 5B38G 3SGKA 3VCLB 4PUBL 4EBQH 3KLHD 3MNZA 2X89A 1N7ML 4XPGL 5DMKA 1DBKL 3DXAB 3IS0X 4EN3D 5TH2A 1Y6NR 5FKAA 5F72S 1F97A 1FSKC 3C2AH 1ZGLB 1QSZA 4OLXH 3PHSA 5DK3A 5A3IC 3H9SD 4P4KA 3U9UA 5BOPA 1AD0B 2DQUL 5B39A 1YECH 4KROC 3EYVA 4MWFA 3VD7A 4NQTA 1CFNA 4TSBH 1PKQE 1EO5A 4PGZA 1EZVX 2VXVL 4JPVL 3IT8D 3Q5TA 4JZNA 3MR9B 4LPTA 5TF0A 4S1SH 4LPVA 1EUUA 1JWSA 2VLKA 2HG5A 1Q1JH 3FFCA 2ARJQ 5E2VL 2FEEL 3PABB 1N64L 3K46A 2ZOKA 2FECL 4PJBB 5I1JH 1QUNA 3NAAL 4TYUA 4G7YL 5DVKA 3VWKA 1W2KT 5D1ZD 1U41A 4OCMC 5J11B 4P5TA 3HKFA 2FBJL 1MJJB 3B4NA 3U0WH 4UT6H 1DSFL 5C0GB 2IALA 3MV7E 4BK4A 4FQLH 2VMFA 1OAXL 4JKPH 5INDB 4HG4J 4OSUH 4MGXA 1M7XA 5SWSE 1UZ8A 3UTOA 4Z7UF 1EEQA 2M1KA 1BOGA 1BD2D 4TSAH 4QNPF 4JRYB 1RK1A 4CW1A 3MXWL 3N06B 4DVRL 4KK6C 4ODVL 1T3FB 1H5BC 4FP8H 3V6BR 1HSBB 3RWIB 5L2KA 1T7VA 3QHZH 3TVMB 4OD1H 4FFVC 4X6CA 2N1KA 4KQ4H 3KYMA 4JVPA 3H9YA 1S9VB 5ID1A 2Q1EA 2Y25A 4JQXA 2IANE 4G8GA 1A4JA 1FBIH 3ZSTA 5EBWB 5JLZA 3VGDA 4XXDB 3AROA 4XVSH 2ZCHL 5DHVB 3MGAA 1UKSA 4FXLA 2R4SL 4L5FH 1QFUL 5F1SA 2PYED 3QAZC 5GIRA 1UWGH 5T1MB 4MA7L 2HRPL 5CSZA 2R1XB 3BGAA 2BRRL 4OZGF 3CPLB 3HZVA 4ZS7L 4MNGA 3HNTL 1UYWH 3T4YB 2E7MA 1JWUA 4OCYL 3CX2A 1XR9B 2APBA 3GJEA 1CDHA 2HJKA 1FZJB 4JO2L 4M7KH 5FGRA 2IWGA 5CP3A 4LSUL 12E8L 3DHJA 2B5IC 5ITFB 1R3KA 1XF2B 3WNOA 4Q74A 2H6PB 3B9KB 1FZOB 1I7UB 2JB5L 3KLAA 4FQ1L 4WDIB 1M6OB 4XRCB 1NDMA 4L8CB 3H7BB 5CSGA 3UJIL 3WXVL 43C9A 3U6RB 4DGVH 4K7PH 2SEBB 4HS8L 2VZTA 1GGBH 5B39G 2KPNA 3O3EB 1FH5L 1UQSB 1XIWC 1C1EL 3AREA 5FUZL 3MBEA 4GXVL 3SDCA 5DQ9B 3SN6N 1XT5A 4U3CA 3W9EB 3LRGA 1NGZB 2FEEI 1INQB 3GRWA 1LWRA 1FJ1B 1YEKL 1JE6A 3RIFF 1X3DA 2FECI 2HJFB 4LCWE 4NQVB 1MRCH 1PZUB 3I84A 4PJFE 5F7DA 1ZHLA 2ORBH 4PY7A 3NGBB 3TNNB 4YBLB 2FDBP 3BX7C 1E4KC 4XMLL 5FO7A 2QADC 4YHPA 4PRIA 4XZUA 3TIDB 3WBDA 4NWTL 4NT6A 1P1ZB 2ICWB 1T1XA 1D5BB 4OFYA 4XTRC 2D0FA 1PLGH 3WKML 1HH6B 1S9YB 4LKCA 4ZFGL 3RWFB 4JFHE 4B41A 3VXNB 1HKLH 2EDXA 4XP1H 3P4MB 3SPVB 3ULVH 5D5MF 4U1MA 1A7OH 4OZIB 2UZIL 4F37K 4H20L 4PB9H 4PS4H 1JYWA 2A9ML 4D0CA 1D5MA 1DFBL 2F15A 3KHOA 2B1HH 4IRJB 3DXAD 3SKOB 1MFEL 2YK1L 3C6SB 2CLRA 3EFDH 4Z7UA 4HAFA 3CVIH 4HV8A 3B83A 2R8SL 4ZNEE 3QEHB 3TT3H 3QIWC 1FFOA 3CSYB 3QQ4A 4XNXL 3V6ZB 5T33H 1XGRB 4F7TA 1JPFA 3BSZH 4JG1H 1KTDB 1NC4B 3WIHL 3FAWA 5HHPA 5HVHB 3QUXB 1S9WA 4Z0BH 4ORZC 4L4TE 1VGKA 2VE6A 1TCRA 4RNRA 5C09E 2OR8A 4YR6A 4QRPB 2VDKL 2QQKL 1X44A 2IAMC 1S7QA 3EJYD 4JFDA 1CFSA 2EDRA 2XY1A 1TTUA 1A6ZA 3GK8L 1NH6A 5I1LA 4NHUB 4DN4H 5D96C 3G6DH 4H8WH 5SWZA 5E9DB 3WKNA 5AYUH 3P77B 3FAXA 4WFFD 1MVUA 1YMHA 5FV2A 3M45A 4JHWH 3ARXA 2FL5B 2HTKD 4PIRF 1SY6L 4UU9B 3IRZA 3D87B 4OFVA 4F3FA 1ZAGA 1CFVH 3B6SA 4TULL 3ZDZF 1Q9LA 3FQWA 6CGTA 2GKIA 1JHKH 4NIKB 3HR5A 1X5AA 4X98A 3TO2A 3FB7A 3JWNC 4AIOA 4N8CL 3FQUB 1JNNL 4DKFL 3BP5B 1IKNA 5ITBH 3QCVH 4U1GB 5H37H 4JY5L 2W9DH 2AXHA 5DF0A 1IAMA 5I66B 2C3GA 3CSBA 3NACH 2PXYB 4JRYD 3CXDL 1J1OL 2X4OB 3U4EA 2X4QA 1K5NB 3U0PB 2WV3A 2OI9B 5H35B 3VDBA 3PWPD 3UPRB 3KDMA 3OJ2C 3RPIA 2R69L 2BNQB 1MCEA 4HEPG 4QRTA 4QRUA 1ACYL 2OSLA 1AGDB 4N90D 2NTFA 1FYTB 2AXFA 1S7XA 3EYFB 1BFOA 1YPZB 3TBSB 1BVZA 5I8EA 5C2BH 3SO5A 4WU5A 5MHSD 2IGFH 35C8L 1IC7H 3LKSB 4G6KH 1R24A 3DBXB 1WBYA 3X14A 2XTLA 3H6JA 4TVPL 3H2WA 4KK5D 1YEDA 1IGIH 5JA8B 1DQDL 5CZKA 1T80A 2XG5A 1P9MC 1PKQA 2Y7QA 4ELKB 3MOBL 2WBJA 3T3PF 3HI1B 3S3PA 1KCSL 4WENB 3BWAA 1BFVH 2R2EA 3LRSA 2O26U 1AQDB 1XCQB 1X5ZA 4LLWA 3V7AE 1XF3B 4HJGA 1ZMYA 4MD0B 5IEKB 1EO7A 1NAMH 1FIGH 3RGVC 3T0VA 4Z7OE 5H37G 5JA9A 2I24N 2W0FB 5ILTH 3MV7A 2YPKB 3BH9B 3VJ6A 3O9WB 5GJTH 5SWSA 1ZTXL 2VLJD 4GFTB 2WWMD 3IJHB 5C0CE 1ZA3A 3QRGH 3QFJB 4C55A 1QA9B 4JM4L 1PY9A 1CFQB 2CDFA 1HQ4B 2CDEA 4O02H 3GMNA 4WW1B 4XNMA 5H94A 1ZGLM 3RP1A 4MHHI 3ES6A 2M8XA 5E2TL 5C6PB 1QR1A 4KJWD 5M94B 2V2TA 4XCYA 3O2DL 3EBAA 4HUNB 4AH2B 4UINH 4GRMA 5DJAA 3SKJH 3ZSSA 4QEGA 3QZWG 2AEPL 2E6PA 3LKRB 5EWIL 1A64A 2IANA 4F33A 1F4XH 3BIAX 5DC0A 4AEEA 3VH8A 1HILB 1IZKA 3VXMD 3QRFM 5DJYB 3A6BH 4NRYA 3QNXB 5JXED 4Y19B 3U36A 2P7TB 3EOBB 5I1KL 2V5YA 3GO1H 3B8SA 3DMMB 5IVXE 1S5IH 5C3TA 4KPHH 5TE4H 3VXRB 4RMSA 2C7UA 4IRJD 3GSQB 4AJ0A 3BKYL 4KKBC 4LLQB 3V4VH 4LSDA 3VGAB 2B1AH 3P11L 3WYRA 2VDML 5DLMH 1J9CT 1BIHA 3HNVL 5GZOC 4EI5A 1HKFA 4ZAKB 1Z9LA 3BO8A 3SBWA 5TQ2H 1S7SA 4XBGB 4M6OL 5TGBA 4EQ2A 5IQ7H 4C4KT 2BK8A 3QUXD 3R4DA 2E7HA 1G1YA 2NCMA 3O45A 1P84K 4U7SA 1MQKL 4QRPD 3O2VH 5FYKE 5C0JA 4WFEE 4X7FC 3P4OA 4ZFOB 2VXSH 2YZ8A 3K0WA 1KULA 3QI9C 1TQCC 4NM4H 4LVHB 4LIQE 5E9DD 5JO5A 3S88H 3MLWL 4YO0A 3RWHA 5D9SB 1WWCA 1I9RH 3JTTA 2P24B 1TZHB 2BOBA 3RVWD 4LCWA 4NFDA 1DVFB 4AL8L 1XGTB 3TBTA 3MLUH 3PUCA 3FQNA 4PJFA 5I1IL 3VWJB 5JDSB 5HHME 1CQKA 1DQQB 1U58A 1SBSL 4LPXA 3CFKB 2APFA 2V17L 3GI8L 4WHCA 4M3JA 1T2QH 5EORH 1RK0B 2IMNA 5F7FA 5GSVB 5GS1B 2VR9A 3L3IA 4U6YA 4R9HA 1WGOA 3KJ6L 5KSBB 2FJFA 3O4LB 2NY7H 5F21B 2R2BA 2KQMA 2GYSA 3QJHA 1IGTB 2ZSWA 4ZQKB 1VFAA 4WWID 1T22A 5ALBL 3T1FB 4KK9C 4LCYB 4M5YL 4OZ4B 3X3FH 3RZCB 5EH1A 3PE9A 3IFOB 2BNQD 1XAUA 1H3TA 4L4VE 3VXOA 3MLXH 4MX7B 3OZ9L 4IOSD 4M8QB 5E70A 2GFBB 1AR2A 5EIQA 2FJGB 4P2QE 1ZXQA 1T1ZA 2ADJA 3ARFC 5KG9A 1EGJL 4XPAH 1A7PL 4M02A 3CVHB 1NANH 3JWDL 5IB5B 3MJ8B 4IIQC 4HIEA 5I73C 4ZNEA 4PGCB 4GRLA 5D2LB 1I1AA 5DQDL 3QWRD 3VH8G 1RAMA 5T3XD 4YDKH 2UVFA 4OGZA 2MHAB 5TDNB 2NZIA 1V05A 5E6IA 4L4TA 4XP4H 5C09A 3LKPB 1P5VA 4FS0A 5F7MC 3V8OA 1U8JA 3T1WA 3RWEA 3UDWA 1NMCC 3BT2L 1T6VN 1BZ7A 4AIZA 4JFYA 4ZTOL 2DWDA 3DETC 3EJJX 3KPQA 2F53B 4F58H 4JREC 4WJ5B 1JV5A 4G8IA 3L5WB 3RUGB 1QEWB 2A6KB 3FT2A 5CZXC 5JW4R 1KJVB 3HLAA 4X9HA 2HJLB 3L3OB 2AVGA 1MNUL 1N6QL 4MXVE 1FL6B 4WV1B 1YEFL 2GTWB 1QRKA 5D71H 1FRGH 4FA8A 2DB8A 1EJ6A 3H9HB 3S36L 4A6YA 5ETUB 3BKCH 2WUBH 4KTEH 2DKUA 2Z93A 3N9GL 5GGQH 1OB1A 3O2WH 2ESVE 2OR7A 4WU7B 4AEIL 4HXAL 4DK3A 2GK0A 4EEEA 2D0HA 2J88H 1P4BL 1ODAA 2RIKA 2XNAB 4PG9A 4K3JL 5IF0A 2XN9D 5JOPE 3UBXI 3AXLA 3ARBD 2FIKB 4RX4A 4U2ZA 4QTHA 3LCYA 3QXVA 4WFHE 1TFHA 3I3DA 1AFVL 3PWNB 5J6HA 3V5KB 1OPGL 2APTA 3ILPB 3BZEA 1OAUL 2E7BA 5HGBA 4OUUA 1LMKA 4R96B 1UVQA 3SKMA 4ZTPL 3QXDA 4MS8D 2UUDH 3IDMB 4N0CC 3CX5K 4TNVF 3V0AC 1ZLVH 2BOCB 4GT7A 2ZUXA 3RVUD 3P0VH 4C83A 4EDWH 2IH1B 4M4RA 4Y5XB 3W5NA 1ZANL 1Q9KB 1U8QB 3JBG7 1OAQL 2ZUSA 3GSVB 3G5YA 4HH9A 2Q76A 1E4WL 3V5DA 4APQA 2V7NA 2VZ1A 4O51A 1OP3K 4CUCA 1NAKH 1FNGA 1SMOA 4BSVA 3G08A 2FEDD 1HIML 5C0DB 2P8PA 2EH7L 1G7JA 3GSNH 2I5YL 3N85L 3P73A 4R4ND 4F2MB 4I3GA 4ZAKD 3VFOB 3ARUA 1DBJH 4ODHH 4ZXBC 2DYPA 4CVXA 5JMOC 3UC0L 1RIUL 4HGKC 1BAFL 5FYLD 5ACLA 1QFWI 3L3DA 2FATH 5ICZA 4JKLA 5DJ6A 1AKJB 4JZJC 3HRZA 5A2JH 5HHQA 4XP5H 2JELH 1DUZA 4XI5C 2P5EB 1QYGH 4M1DH 1QKZH 4PRHE 5IESL 4UQ2A 2DQCL 3FB8A 3V4PH 5FECB 2NY5H 4P9ML 5FO9B 3T0BA 3B9VA 3VWJD 5C0CA 5IVNA 5JW3L 3F58H 3RY6C 1CBVH 4FQHA 4G42B 2PCPA 3VFPA 1QSFE 1BQHB 3FQXA 2EDQA 4RBPK 5C6TL 4IS6A 1MCWM 5MERA 1FN4B 1UB6A 4I3SL 2NYYC 1VHPA 4MJ5A 2W0LA 1WISA 5HPOA 5F44A 2YBRA 3O4LD 2FX7L 4WI8A 1QQDA 5E7BA 4CU7A 4K2UH 1IBGL 2D9QB 2NY4C 2ZUUA 4F8TA 1FZKA 3D39E 4MNHA 1H15A 4MNQE 2HT4D 1S9XA 2IBBA 2WSKA 5I1AB 4N0FB 4MXWH 1X5JA 3MRLB 4AIXA 3M17A 3VFUB 2MPAH 1P6AB 1NCWL 1DANU 2F58L 2HFFA 2Y06H 3ARRA 1U2CA 4YFLF 4MXVF 5IVXA 3D2UB 3H3BC 1RFDL 3DX8B 1P4IL 5E99L 4JM2B 1MLBB 4YGVB 5D7JA 1S78D 4RAHA 4ODWB 2VLME 1MHPH 4LVOC 4M43H 1L0XA 1YEHH 5DVLA 4BSWB 1VA9A 5EZOL 1MCDA 4OFIA 3T65A 1N59A 3EGSB 2OYPA 2FYYB 1KLFA 2XA3A 1ZT4A 3SGKC 1IFHL 4FQXB 4YDVA 2H3NB 4PRPE 2JCCE 1BBDH 1KIRB 3PF2A 5T1LD 4CVZA 1G7QB 4UI2A 1T89C 1K85A 4J1UA 2I9LA 3S98A 4FRWA 2DQJH 2VLLB 4WHDA 5C0EB 4NQCB 2F53D 2DQHL 1WCQA 4ZUSB 3RL1B 2Z31A 3NA9H 3FT3B 4HUUA 4P5MA 4OF7A 4PJ5E 5HI3C 3IYLW 1S7TA 1SJXA 1J05A 3TWCH 5ACZB 1WT5C 25C8H 4HQQH 3RA7L 3NFSH 3HAEB 4KAQL 3SCMC 5K59F 1AXSB 1HHIA 4IOIA 3VXPA 1XIWD 1RHFA 3VG0H 3V7AG 5D1QA 3IU3A 5FYKH 1UACH 1HH9A 1LEIB 4OLVL 5HHVL 2H26A 1XR8B 4GAGL 4UBDC 2D7OA 5FGSA 3VWKC 5DJXA 1NGYA 4LIQH 2AJVH 1J0ZA 4WEBL 3RWDA 3GMRA 4PRBA 2GY5A 4FQ2L 5I1HL 2X4NB 1M71A 1TETH 4PB0H 4L4VA 1F90L 3E8UL 1GZPB 3K3QA 1CD0A 5FDWA 3WFEL 4P2QA 1KENL 1YNLL 4YEEA 3T0EC 2VL4A 4AT6B 4ZFZA 2B8OT 3PWJB 3ULSB 5K9QI 1T5XA 4IDJH 2YXFA 2GITA 5GGUB 5GGTA 3HPJB 1DQJB 2J6EA 2E8YA 4YHNA 4ERSH 1RUMH 4M7ZB 3VFNB 2OBGA 1MI5D 1JK8B 5DRNA 2EECA 4JN2A 1PX3A 1UKTA 2X44D 1NBZB 2CO6B 4MSWB 1QLRB 4UNUA 5JOFB 3IJSA 8CGTA 4QGYA 4QOKD 4NP4L 4FXGA 3WHXA 1U6AL 5IG7A 2VZOA 4FQJL 3WNKA 3ILQC 2NX5B 3VRLF 1RZJH 3LEVH 4KC3B 3NCCB 4I4WB 4R0LB 1JGVH 2E6QA 2EXWC 3B5TA 5JIKA 5TE7L 1MH5B 3B43A 3H3PL 1WIOA 1HYSD 3QDJB 5GGTH 5H8DA 2HKHH 1MCKA 4TUOB 1KB5B 4P49A 1B0GA 2B20A 3SGJA 2J6EH 4V1DB 3I3BA 5DRZA 3W11C 4F7PA 4AEHH 3GFUA 3CK0L 2ZOLB 2P5ED 4JLRA 5KZCB 2HTLC 1AP2B 5CEZE 1BVLB 1GJIA 3GJFH 3HI6H 1AH1A 4P2OB 4QT5B 1BZQK 2ESVA 5F1KC 2V2XA 4R26H 1E4XL 4MCZA 3SDXE 3IB4A 4GAJL 1IEHA 1WEJL 4GMSL 4K94H 1KCVH 2EDKA 1U2HA 2VABA 2GJ6E 2AV1B 4HLJA 1YMMD 4NZRL 5BMFH 5ELIA 3MBEC 5EBLB 3SDCC 3ROOB 4Z78A 4LU5L 1FORH 1RZ7L 1A7QH 3P40A 4GXUM 4ZPVA 5EG6C 1KG0B 4F9PA 2B0SL 4WI9A 3RPKA 2JCCF 2XKSA 1MFDL 5FYJE 3O81A 4F7MA 4PJCE 2XICA 3QIBB 1HSAB 2EDBA 2OXGA 3OKDB 2NNAA 1XGYL 4JFOB 4U7MA 1NC2A 5E5RB 4TUKH 5LAXA 1N5YH 1CL7L 4KZEL 2WANA 4NUGH 3RTQB 4CNIA 2WZPD 4OCLC 5I76A 1T7XA 4PJ7F 4YHOL 1G7IB 1NUFA 2NW3A 4JM2D 2L7JA 2YA2A 1P7QB 3BPOB 3QEGL 3CDYA 5DEGB 1VFOA 3FOMB 3QWQB 2Q86A 3PG2A 2RJMA 3CZFB 1CD1B 4HUWB 3EO1A 3QWOA 4OCSH 3KLDA 4JR9L 4OQ1A 3TFKD 5DJCA 4FQXD 1CCZA 5D93B 4M7LT 1IC5H 1NMAH 1KB9J 3E6HA 2AQ2A 3MRCB 4U6XA 4LEOB 3BGMA 1G9EA 1D5ZB 1FFPB 1FFNA 3D0LB 4F7CB 3J7HA 1VKXB 1LDPL 1R3LA 2E9BA 3S34L 3WSQL 3WFHB 5JHLH 3C5SB 5CJ8A 4H26A 4K55A 4P23B 4PRHA 2MTPA 2ZPKL 3WDIA 5EO0B 3MRJA 4RSVA 4KUZL 2CDGA 1YEIL 1IM9B 1T0PB 4PJHE 3MYJB 3BGFB 4G5ZL 4QWWC 1EEZB 4LL9A 2VXQL 1Q0XL 4TPRL 1MLCB 1WZ1H 5L2JA 2OL3B 4H0IA 3BKJL 5TE6H 5LCVH 4U1KB 1G1CA 5IR1A 1QSFA 2GHWB 4GO6B 5ABDE 1CZ8L 5L7XL 5IM7A 1WQVT 3P30H 1OTTC 1CFTB 1E4XI 2ZSVA 4XCNB 3RVVC 5GS0D 2XTJC 4WVRA 2EEAA 4HPYL 4RFEB 4LCUA 4YXKL 1JGDA 1NCDH 1QLEH 3MJ9L 4IRSA 4NO2B 4KUCD 4ODXA 5J12C 3QUZC 4U6VL 2VL5A 1SM3L 4P2RB 3D39A 4JFQB 3A6OA 4MNQA 4WCYL 4PD4J 4E0RA 2CK2A 3EYQC 2X4RB 5HDQH 1WFNA 3WN5A 3BH8A 2OLDA 1IKNC 1YY9D 4NQDD 2OTPA 4KRMB 1ZOXA 4JDVA 4L8DA 2XFXB 3TN0D 4P99A 4H88L 3NZ8A 1GSMA 5EDXA 1X5IA 2J8HA 4GKZA 3C60C 4Y4HC 1E6JH 1RZFH 3IDGB 1TJIL 2R23A 2AJXL 3PGCB 2DLFL 2X9YA 5J89A 1CL7I 5DJ2A 4LLMA 3S9DB 3MRNA 5F70A 3HFMH 5E08L 5J6GB 3TNMA 3QR2A 1A9BB 2GJZA 2ATPA 4YE4L 1X4YA 4RFOL 5DXWA 3QUYB 5EZLB 5F7NC 2AXJA 3WL9A 5B38B 1J5OH 4ORGB 3UAJD 1YN6B 4GKSB 1ES0A 1ZA6B 1PD6A 4PRPA 4HFWB 4PRAB 2JCCA 5HGGS 4PJ9A 1CF8L 4NCC1 5FF6B 4JGUA 3LQAH 4NO0B 3BKML 5IFHH 3VG9B 3SHSA 2DJUA 2CLVB 3G6JE 5HD8D 5GZOD 2G2RA 1Q0YH 2ADGA 2VDQH 3QDJD 4UILH 2X42A 4OAWA 4FTVB 2VDLH 4V1DD 4P3CH 1BPVA 2WUCL 4PJ5A 4JQVC 4QCIA 4QRQA 5DTFB 5SX4H 3NIGE 2DQGL 2IPUG 4RZCB 4Y4KC 3PGDA 3GI9L 1G7MB 3FRUB 1WC7B 3GSXB 3GKZA 2EO1A 4ONGL 2FD6L 4P2OD 2YWYA 2EDYA 2YRLA 3MRIA 2R0KL 4ISVB 3WIIH 1J8HE 2RFXB 4BZYA 1A1OB 2DDQL 3T09A 3SQOH 3SGDH 1I75A 1ONQA 1KBGH 3NCJL 2DQDH 2CKBA 3P9MA 1J0HA 2XWBA 3BPCA 4OLUH 3MRRB 1AHWB 2DF3A 1E28A 5HPMB 5KN5A 1LP9B 3QDAA 1JZ2A 3ORJA 3QXAB 3VMOA 3ZT6A 1JFQH 2D7QA 3LPWA 3MNWB 5D6CA 4XMKL 2FHCA 3AC0A 5FUOH 1CXKA 3MZTA 4BFIB 3V8CA 5C0NC 1UM4L 4UQ3B 4JHAH 4OQTA 3RDTA 4LHUA 2QL1A 4NKDA 5D1XB 4E5XA 3QDME 3H7LA 3TZVB 4DW2H 1A6UL 3WO4B 2F8OA 4PJHF 4J3SA 1NGQL 1XF4B 2BVPB 3DXAE 4NQXA 5EC1A 3V0WH 3P0GB 3QUMA 3MLRH 2VN7A 1QSED 1YJDC 3W39A 1HDMA 2CKBH 3H42H 5EUKB 2GQHA 5DUMH 5IMKB 3ARFD 3L5XH 4GBXB 4HUXB 5EBMA 4LLYB 2BVOB 3EO0A 4YQXL 4JZOA 2YKLL 5HYSG 3EYOA 4CMMB 1NBVH 1KV3A 4CL7A 2CUIA 3O4OB 1Q9OB 4IOFC 3UYPA 1INDL 4NJAH 5IMOB 1QZ1A 4Z7NE 4OQTH 5J3HC 4JDZB 2P1YA 3X11B 3SDDB 5IFAH 4LSTH 3GHBH 2KZ1B 4TTDC 3QXWA 4J8RA 4EI5C 1KN4H 3S8WA 3WJJA 3NIFF 1HEZB 4LASL 3SBWC 4P23D 4PJBE 3QUMH 4WUUD 2F19L 3QIUA 4YHZH 5CWSA 1IM9D 5IBLC 5F9JB 3GMPA 4NDMA 5KAQF 1Z5LB 2JJSA 5EO1A 1BF2A 4BM7A 4I77H 3U9UB 3PGFL 5T1KB 3SDXA 4YAQB 3LV3A 4G9FD 5J9PB 1I3RA 2H9GB 4Y5VA 5CZXD 2GJ6A 1M4KA 3RY5A 5D70L 3T08A 4QRSB 4MWFB 3JTSA 3RKDC 3U9PH 4DQOH 5JORB 2F5AL 4OBRA 1CFNB 4Y2DB 5H2BA 5I1DA 2X10A 1OP5K 1MAMH 1CXFA 4S1RH 1YYMH 5JDJA 1T2JA 3MRPA 4HIHA 2Z35A 2QQNH 4XNYH 3IXTA 5F9WB 1JWSB 4PJCA 4S10A 1U8PB 1I3UA 2HG5B 1F4WH 2Q3AA 4G9DA 3NH7H 4NKIL 1KLGA 5CEZH 3U30C 5IB4B 5FUCE 4ALAH 1OGAD 3P3YA 1X4ZA 4HWEH 2IQ9H 4U1IB 1GAFL 3G6JF 3MRKB 4L8SA 5KVEL 4P5TB 2BCKB 1TVBB 3I6LE 2B4CC 4X6FB 1RZGA 3A6CL 4XMPL 2IALB 1PZ5A 5DVOA 2AXGA 5CBAA 1ZT1A 5E6ZA 2YPLD 4PY8I 1LO0H 1IAOB 3BJ91 3K2UL 4JY6B 1TLKA 5FYJH 2H1PL 1IM3A 4OF8A 4X6CB 4CKVX 1TTFA 3KYMB 5GXBB 4NHCL 3DX6B 1LE9B 2AEIT 4G8GB 3KJ4C 4GRLC 4M7LL 3SGEH 3KHQA 4D2NA 2I27N 2X6MA 4M6NH 3WMSA 5C2UB 3OJMB 4MA8L 5CZVH 3LKNA 5FA4B 4UT7L 1FGVL 3D5OF 4HLZH 2DIJA 4FTVD 5FK9A 5C6WH 4I0PA 5CSZB 1WLHA 3RVTC 2W65A 4PJHA 4ZXBD 3TA3C 3HZVB 1UXWA 5DURB 1F6FB 3TBVA 1TIUA 4LSRL 4OLXL 2HJKB 2X7LB 1MFAH 4TQEH 3UDWC 3U7YH 4MJ6A 4WWKA 2WM0A 3L3HA 2GUOB 3HHRB 2H45A 3R0NA 3FB5B 2F8XC 1FAKT 4KRLB 3TO4A 1MQ8A 1YECL 3DRTB 3EOYG 3T8XB 1R3KB 3ZE1E 3MCG1 3OKLB 3SJVE 5I75C 1DDHB 1TQBB 1QRND 2PUQT 3KLAB 4HS3A 4LNRB 4CVUA 5I17A 2EXYC 5IBUG 5CLWA 2ERJB 1U3HA 3ZT5A 43C9B 4Q6YA 1Q1JL 3O3DA 5F97E 5E8NB 1PQZB 3ET9F 2F74B 4Z7NF 1KELH 2WLYA 4Y89A 5B8CB 1V7MH 5C0IB 1IGJA 1S3KH 2NYYD 3IGAB 3MRQB 4JO4L 3GMMB 1YEGH 4D0DA 4KKAC 1ZHLB 5I74B 3IKCA 2NXZC 4PJBF 1JPGB 3ARDD 3BPLC 4HDIB 4HS6B 4R4BA 4FQLL 5D1XD 2NR6C 2FX8H 4NNPH 4OSUL 1I8LA 2Y07H 1RZ8B 1RMFH 1AE6H 3TV3H 3T2OA 2CRZA 4QHUA 4YHPB 1ZHKA 2E7LA 1YUHA 1DLFL 4OV5A 4M6AA 3BP7A 4D0BA 5E8EA 4DGIL 2WNGA 3OF6D 2HAZA 3DSNA 3UBXB 4E42A 5I30H 3HG1E 5DEZA 5I9QB 3L6FB 2GEEA 4ZUUA 4NO5A 3UJTH 1OLZA 3QHZL 3JZ7A 5C70A 2EDJA 3CDFA 4HLZG 4G3YH 2A83A 4R3SB 4APQC 4KDTA 3OG4B 1NQBA 3G6JA 1T4KA 2A74A 3G9AB 4U1MB 2J4WH 4OGXL 2VR5A 4Z76A 5BVPH 5M95B 2D7PA 2X89D 4I3RH 4LVEA 1N0LA 4D0CB 2P8MA 3L3GB 1UWGL 5AWNH 1R0AL 1CIDA 2VITA 3QQ3A 2YD4A 2WQRA 4HV8B 4Y0GA 3W81A 1M7DA 5E7FA 2D31B 5HY9A 1UYWL 1MCIA 4QYOB 5FOBA 2LV4A 2LAAA 1F11A 2DQEH 4P4KD 3T2NH 5EOTA 1J8HA 3WLWC 4ONOA 4QF1A 4X80L 4RNRB 4H0HB 3FFDA 1MUJA 2H8PB 5HI3D 5E2WH 3OGOE 4OB5H 1CFSB 2YPVL 1WICA 5JTWA 2ZZUT 1M7IA 4OF3A 3MBXH 1CVRA 4RIRA 5GRWA 2VLKD 3FFCD 4K8RH 1G7PA 2JB6A 5JMRA 1JVKA 1YMHB 4X7SL 1GGBL 3T04D 1A7NH 2BNQE 1G6RA 1JHLL 4ODTH 2XZAL 4U1SB 3D0VB 3K80A 4ZDHB 1HWHB 4YDJA 1SYVA 1FYTE 2E6JA 1T5WA 3VWKD 1YPZE 4P5TD 3O0RL 3G04A 3QISA 3QDMA 3VCLA 1Q9LB 1MRCL 4DJMA 2ORBL 3HR5B 5DYOB 4YXLL 4X98B 3QZWB 3DXAA 3TO2B 3C08H 3AS1A 3UYOD 3HE6B 5BJTB 1ZGLA 4ZSOE 5MEOB 1UZ6E 2OR9L 2VH5H 4J4PD 3EO9H 2NY1B 3D9AL 1AD0A 1I7TA 2AEQH 1O5DT 5T3XE 4HXBL 4XP6H 5DR5H 4XHJC 5KVFH 3R8QA 5KAQG 5IROA 1UFUA 4P46C 3RPIB 5L2KD 4YEFA 4JFEB 1G6RH 1PLGL 4QRUB 5GRVL 3UJJL 5D7JC 5DHXB 1JTPA 3O8XA 1HKLL 1MJ7H 3GRWL 4F9LA 3QPXH 4KROB 4G8GD 1R3HA 3BISA 3PABA 1SEQH 2UYLB 4J3UA 4PB9L 4PJBA 4Y1AB 2CIIB 2EE3A 4NJ9L 5C1MB 4YUEH 1WBYB 4KK8C 1NAMB 5DURD 4OZIF 1YEDB 2OX5A 5C0GA 4BQBA 3BJLA 3WHE0 3L5IA 3LQMA 5C7XH 1X5HA 4NZDA 3WFDH 5T33L 1EHXA 3BSZL 1MIEL 4JG1L 4MAYB 4NZUH 5EOCL 3QFJE 1DZBA 5DD5H 2WBJB 2Z31C 3BP6A 1KT2B 1Q8MA 3ZHLA 4FN0A 4CBPA 1U91B 5HDBF 1T3FA 2BY0A 1QBMH 5JPNA 3EAKA 1MCFA 2DIBA 1HSBA 3ARZA 3RWIA 3FB6A 3G6DL 3KR3L 5I1GH 2BNRE 3TVMA 1GGYA 1U8IB 4GAYA 4U49A 5HI4D 5GRZA 2EZ0D 1MHHB 1NEUA 5TF1H 3ARED 5D1QC 3QHFH 3SDCD 3K8KA 1J88A 3BIBX 2Q7NA 2XPGB 5I8KH 2ADFH 1HOCB 1BJ8A 2O93L 1CFVL 5GRJH 3QFDB 3VJ6B 3ULVD 2ITCA 4Y19E 3ZHKA 5T1MA 2R1XA 5AAWA 3CPLA 1N0XH 2UZYB 4LLAA 5AUMB 3T4YA 5HGAB 3VXRE 1Q72H 1XR9A 5L0QB 2W9DL 4PRID 1FZJA 5F9DC 4HG4K 3V6FB 4W6WB 2V2TB 4XCYB 1EHLH 3MGOA 3N0PB 1XGQB 4OFYD 1OT2A 1XF2A 3NCMA 4UTBH 4HCRH 1XGUB 2H6PA 3B9KA 1FZOA 1I7UA 3P9WB 4XVTL 4F33B 1FE8L 1UXSB 3IF1B 4XX1G 1ZHNA 1M6OA 2CMRL 3VH8B 3QQ9C 4DEPC 3H7BA 4KZDH 3ARVA 1CDCA 4OD3L 1DN0B 1FC2D 2B5IB 3O3EA 3TEUA 4BH8B 1HXYB 1JZ6A 2P5WE 3CU1A 2IGFL 1FNSL 3UTSE 3W9EA 1NGZA 5E4EB 1FJ1A 4LRNL 2VUOA 2C7UB 3TF7C 1T66D 2HJFA 2BZDA 3OKKB 2CIKA 4NQVA 2V9RA 1TJGH 2AK4E 4X9FA 2VAJA 4OI8A 5EUOE 4GRWE 3BD4A 1OAYH 4MCYA 5CD5C 2WLZA 4IMKA 2ENYA 4XT1C 4OJFH 1S7SB 3SJVA 3TIDA 3O45B 8FABB 3HZKB 5E5UB 4KMTL 5CKGA 1D9KB 3QDHA 4JFDD 3L7FB 4PJ8B 3QG6B 3NABH 5KSBE 2ICWA 5E95B 5C8JB 4WTWA 3NVQA 5JO5B 5SWZD 4AM0B 1HH6A 1S9YA 1OLLA 3RWHB 4N9GB 1OTTD 3VXNA 3JTTB 1BJ1J 2BOBB 3RVVD 2XTJD 4XBEL 1U8NA 4G6ML 3TBTB 3LH2L 3P4MA 1BJ1H 4LCCA 4PJFB 4CVWA 3HS0A 1MJ8H 3MV8B 3VRJB 2P8LB 4F9PC 3OHXB 4S11A 3THML 1G7HB 3ZHDA 3MRDA 3D85A 3QRGL 3SKOA 2W0KA 3C6SA 4YZFE 4UIKH 3UPCA 2ICWJ 3U79A 3UP1A 3L3IB 3LIZH 4CADB 3CSYA 3L7EB 2NY1D 3V95A 3BZDA 2R2BB 3HG1A 1NLDH 2ZSWB 1KTDA 1NC4A 5GGVH 1RZIB 4P5KB 4UINL 1MWAA 5SV4A 4HF5L 4LEXH 1U95B 4PTUA 3HB3D 4N5ED 3VGHA 4POYA 2ADJB 1T0MB 2D7TH 3DROB 5DUPH 3O6LH 3BP4B 2Y5EA 4Z7WB 2DS4A 1OARH 4KKNA 2IAMB 1VFBB 3I50H 1ZLWK 3RVXC 2V5TA 1I1AB 4M1GH 4FZEL 1I85A 3KPSB 4MQTB 3FCTB 3V4VL 3UYRH 1UJ3A 2OCFD 1LO5B 5GRUH 1FP5A 2PW1A 4LVNB 4L9LC 5GGRY 2LU7A 1MWAH 3I6KA 3BPNC 5TQ2L 3R1GL 4MAYD 2ITDA 3X12B 1ORSA 4PLKC 5IQ7L 1GXEA 5I66A 2WBJD 2PXYA 2MWCA 1JNHB 2V7HB 2X4OA 4PP1D 1BZ7B 1CQYA 2DWDB 3O2VL 1K5NA 3U0PA 4WIQA 1NUDA 2HKFL 3MC0A 3UPRA 3LY6A 4ELME 2DQTH 4NGHH 2RBLA 1DBML 2BNQA 4NM4L 4BZ2L 4S1DD 3SO3C 4J23A 2VDNH 3W82A 3B2VL 1FNLA 1O7SA 1FYTA 4Z95H 4Y5YC 3EYFA 1GC1H 1YPZA 3TBSA 1D6VL 1F6AB 2FGWH 2J12B 1ZKAA 5TDPB 2ATKA 5L6YL 4EZMA 3MV7D 4JO1H 1U92A 5DWUH 4HMCA 4JHBA 5GJSH 1A4KA 1GGIL 3MRGB 1FL3B 5SWSD 1T04A 3GIZH 4ODBD 2QTEA 4ZO9A 4ZSOA 3LKSA 1JNLH 3DBXA 5FHAH 3QWRA 3SOBH 4PG9B 1T2QL 2OJEB 2GSGB 4MDJB 4CDHA 1BP3B 2WIMA 2VIRB 4W68A 2HWZL 4IM8A 2APXA 3GSNB 2PO6C 3ARGB 1IKFL 1VCAA 3S97C 3BZEB 4UAOB 5IWLC 5JIHA 5HGBB 5GS2H 3X3FL 4HWNA 4X8XA 2AJUL 5GGSY 4NYLB 3HI1A 1T20A 1UWXH 1RURH 1EPFA 5KSBF 4KHTL 3QXDB 3L95B 2FLRT 1MIML 3OAZH 4LSQH 4C83B 1I3VA 2C3HA 3GUTA 1ZLSL 1AQDA 1XCQA 2W59A 5DS8B 4XPAL 4ETQB 1XF3A 2Q76B 3V5DB 1QFWM 4MD0A 4IOFD 3BAEL 2CQVA 5A1AA 3OGCA 5IEKA 2C1OA 1AQKL 2C3VB 3J8F7 2OJZL 1FNGB 2XKNB 2R0ZH 4NKMB 3ZYIA 3BH9A 3K1KC 3DO3A 3MUJA 3O9WA 3EHBC 4Y16A 1G7JB 4RBPH 4DOHB 3IJHA 4YZFF 3O11A 5IKCB 4TTDD 3QFJA 1QA9A 4EI5D 5E8DH 5CAYB 1CFQA 1XF1A 1HQ4A 3L3JB 2HFTA 1T83C 4WW1A 5D2LF 2J5LC 3ZE2E 4CVXB 5GRXG 3HCVA 5IBLD 4D9LL 3NZHH 4QXUH 4AY0A 2BNRA 1KIQB 4PJ8D 2DQFB 3MROB 3DNKA 4AH2A 1TPXC 1XH3B 1ZHBB 3GBNL 4Y8DC 5DT1H 1H8NA 5DJ6B 1J8KA 2MKLC 3HRZB 3RKDD 5F8RC 1NKRA 5HHQB 3LKRA 2NY6B 3EYSL 1KCUL 4DN3H 4DKEL 2ZJSH 4UQ2B 5B4MC 4LCWD 1B3JA 2FNBA 5D71L 1FRGL 3RUGF 1CLYH 3OL2A 3QNXA 5C0AB 1JPTL 3F7PC 4Y19A 2P7TA 1NBYA 3EOBA 4FG6C 5IUSA 3BMWA 4KTEL 3DMMA 3O2WL 3KS0H 4FQHB 4XB8A 4U1LB 4LLVA 2LE9A 3F7QA 3VXRA 2VLRB 3GSQA 2YMXH 4LLQA 1UB6B 5CEYA 4MJ5B 5DA4A 4HAGA 2AJYH 4RGNB 1BOYA 1QQDB 4XBGA 1W8OA 5D8JH 1I9IH 1FZKB 4J3VA 4JFHD 1I4FB 1D5XA 1HQRA 1SQ2N 3IFPA 1NKOA 5BZWB 5KANG 4ZFOA 4ZUVB 3M17B 2WIIB 4IJ3C 1OTUC 4NQCE 3VXTA 4A6YL 1NCUA 2HFFB 4YHKL 1KFAL 2P5WA 3P0VL 5IVXB 4ZUTB 5D9SA 1VPOL 3UTSA 3ZKMC 1NSNL 2X5PA 1MCPL 4RMTA 4DK6A 1DVFA 1XGTA 1FDLH 1GPOH 2AK4A 2Z0BA 4PLJC 1NCAL 1NAKL 2VSCA 4GRLD 3DV6B 1I1AD 3KPSD 1DQQA 3CFKA 4OM1H 3LOWA 4HMDA 4RRPG 4RWHA 3T65B 3H0TB 5JW5B 4R90L 1FPTL 4ENED 2BHZA 2F5BL 3GEWB 5E6ID 4L4TD 3RVTD 4WO4B 3VXSB 4CVZB 1FO0H 3RBGA 1DEEB 1NUNB 3BHBA 2BNUB 5D7KE 2I9LB 3W9DB 5KSBA 1JF1B 5I71B 2DRUA 4X7DC 3QO1B 2EDWA 5BV7C 1YNKH 2JJSC 3WUWG 4NFCA 3T1FA 4LCYA 3RZCA 4XPTH 3JWOH 2AGJH 2PW2B 5DMYA 1KIUA 4Y5VC 1KC5H 4M1DL 5IQ9B 1QFOA 2EYSB 2FJGA 3WCYA 1UA6H 5HHMB 4WNQB 4GRWH 4MJ2A 1IAIL 3E6FB 1HHIB 5A2IH 2QEJA 1R5WB 2DMBA 1CGSL 4IOIB 3LB6C 4OF5A 3VXPB 4W70A 4PJEF 1BREA 3Q2CA 2Y1VA 2YOCA 5ECJE 2AJ3B 4NM8H 3MUY1 4NOFA 3IU3B 4PGCA 1J1XH 1HH9B 3DI3B 3ZO0A 2BY1A 2XXMB 4ONFL 3ZE0E 2H26B 1DBBH 1UGNA 3HE7C 3VFMB 4RX4D 5DJXB 4L8SC 5EIVA 4FFWC 1R3IL 5TDNA 2MHAA 3KLHC 2Q8AH 3GMRB 4M9PA 4UIMA 3LKPA 1BX2B 3WNPA 1B90A 2W92A 3ZE2F 4K2UL 3QG7L 2D03H 3S4SG 4EN3C 2JLLA 2J2ZA 4IDLA 2NX5E 3MSPA 5I18H 3PXJA 1VEMA 4KI1A 2PR4L 4WJ5A 3RUGA 4FMFA 3L5WA 2AK1H 1QEWA 3KNBB 2EH8L 4DUVA 2A6KA 4P2CG 1WITA 4YHNB 4GG8B 2HJLA 1MCRA 3BZ4B 3L3OA 4GLRI 4CJ1A 5DRNB 5I19L 1FL6A 4WV1A 2GTWA 4HULB 5HXMA 4APQD 1YN7A 5F3HA 3GJFB 1SJEB 4M43L 1YEHL 3IJSB 3OV6A 4RWYH 1XZ0A 3IXAB 1FVDB 3WS3A 3OBAA 4PV8B 5EZIH 4JM2F 2X4UA 4P59H 4WU7A 4LFHG 1FAIH 4M00A 4CN6A 1YYLL 2PF6A 2VTFA 1JI1A 1N5AA 2O5YH 2XNAA 3TYFA 5I0ZA 1FFRA 2FIKA 1A21A 4YDIL 2ZCKH 4X99B 2COQA 5FFLA 4ZS6D 4K9EC 4QXGH 4ELMA 3WLWD 2O5XL 4FFYH 3PWUB 3ILPA 3V5HB 4WWKC 4NN6C 5I8OL 4F7PB 5HHXH 4U6TA 2Q7YB 4R96A 3NA9L 2NY6D 4HK3J 3B2UD 5F6HI 4YK4C 2BOCA 1QLFB 5JUEH 2ESVB 2IH1A 4Y5XA 5C0AD 4HQQL 25C8L 2Q87A 5CFHA 5FHBH 1Q9KA 1U8QA 2H2SC 2X9XA 4MCZB 5C0CD 1IAII 2OP4H 3LS4H 5JZ7D 3TJEH 4HC1A 2A0LD 5J56B 4Q6IB 3LMJH 1UACL 1V3LA 1PW3A 5FCUH 1JUFB 3OXRB 2LQRA 2I26N 4LIQL 4F2MA 4L29B 4M93C 2AJVL 4RGND 5AG8A 3VFOA 4Q0XL 1U8MB 5IB3B 4NWUH 3NTCH 1MJUL 4FOMA 2RGSA 2BDNH 3GBMH 4JY4B 4KUCF 4GQ9L 1NDGA 4WRLA 2R2HB 5ALCL 4U2YA 5LAXB 5L88L 1Q9WB 1AKJA 3NPSC 4N1HB 4CNIB 2UUDK 1ZLVK 1FVEB 2NW3B 3VW3L 4HC1H 3T2QA 5FO9A 2C26A 4GUPB 3SQBA 4KDTC 2Y72A 3FONB 4JZJB 3EO1B 1BQHA 5DJCB 1BGXH 4YBHA 1FN4A 4WO4D 1RZJL 5FYKD 3C5ZA 4WFED 1S7WB 4ZD3H 3FQTA 4EUPG 4UV7H 1LO3L 2IF7A 4HH8A 3PHOA 4LQ1A 1FFNB 5GGTL 5GHWL 1JYNA 5IJVB 2J6EL 4P2RE 1KJ2L 3PDGA 4NZTH 5HI5C 4AEHL 4Q9QH 2Z31D 4N0FA 4S1QL 3MRLA 4D9RD 4KVNH 1S7UB 5CMAB 3VFUA 3Q6GH 3O6KH 5HHMD 1UC6A 1MPAL 3MA7B 3D2UA 3DX8A 1MLBA 3ALWA 1QSFB 4YGVA 4BQ9A 4C56B 4BSWA 1LDSA 1A7QL 4IRSB 5J8OA 5KSAA 1A1NA 1Y18B 4FQCH 3U4BH 3EGSA 2VL5B 5GISL 3MOAH 4MD4B 4MNQB 4XNUH 2H3NA 1KIRA 1MF2L 4L4VD 3QCTH 3WN5B 4LVOB 1BFSA 2VLLA 5C0EA 4P2QD 4NQCA 4JFZL 2X1OA 4TUKL 4GKZB 4ZUSA 5HYSB 1N5YL 3PDOB 1GGCH 3RL1A 1MREH 1CK0H 1BZ9B 3FT3A 5DJ2B 3INUH 4GOSA 5IROC 3MRNB 4XH2B 1OGTB 3ULUE 3TNMB 3EJYC 2KL6A 3QQ9D 3SKUD 4JFFB 2CJUH 1FCCA 3HAEA 4M9OA 3QYCA 4F9LC 1BM3H 1F6LL 1ULVA 2P47B 1TZGH 4B7IA 4GS7C 4RMVA 5I6XB 4PRPB 2C3WA 2IG2H 1AD9B 3GMLA 1QFHA 3PP4H 1MCSA 2HTKC 4OTXH 1A0QL 4NC1E 1XR8A 1T7ZA 3NFNB 1PEWA 1NMAL 1YC7A 3SCMB 5J11C 2VXUL 1EAJA 1EMTH 2UY6A 2ADGB 5BVJA 4OAWB 1GZPA 2R0LL 2VC2H 4PJ5B 3F7YB 5CIPB 1BQHG 3EDJA 4UDUA 4AT6A 3PWJA 5L9DH 4JFXB 2NXYB 5IJKA 3ULSA 2IBZY 3HAEH 5IIEA 4ZOEA 4KGJA 3ARPA 5GGUA 3HPJA 1DQJA 4ETYA 2ESVD 4QKXB 1U8HB 3VFNA 2FH8A 1JK8A 5ERWB 3F7VB 5DMGC 3RZWA 3TVMC 3RNKA 5FUCC 5CILH 1D6EA 1F8TH 1GIGH 2D4DA 5JOPD 1MCOH 3DVFA 4MSWA 3UPAA 1QLRA 3P9MB 2XWBB 5IHUH 5I8CA 4WFHD 2BSSA 2HLFD 5HVFB 5FB8B 4QXTB 1NCDL 1JGUH 1NMBH 2GTZB 6FABH 2WK2A 1I1FA 1S7RB 1F3JA 2NX5A 4DUXA 1JMZA 1YEEL 2VKXA 5E8PB 3I3EA 4I4WA 4R0LA 4E9LA 5HDQL 4O2EB 1MH5A 4LSPL 2ZNXA 4KK5C 4KRNA 4YFLI 4D3CH 4LCIL 2ENSA 1ZEAL 1NC2D 2A2QT 3RDTB 4TUOA 1RVFH 1KB5A 3VFWB 1VENA 3FO9A 3OR6B 4YWGH 1B2WH 1A2YA 1RZFL 4POZD 1DP0A 2ZOLA 1MCNA 5JPMB 1AP2A 1JPSH 4RA3A 1BVLA 4NQXB 4HPOH 1FGNH 4U33A 4QT5A 4N8VB 1VEOA 1X5XA 2VZVA 3ZLQC 1B4JH 5K33A 1J5OL 2HLAA 5T5NG 4JZOB 1RULH 3BEWA 3HC4H 1K3ZA 4XPHH 2VDRH 3HZYB 3ROOA 4XPFH 1IARB 3T0AA 1CXEA 1ADQA 4KDVA 4TVPE 1I8KB 1KG0A 5IFHL 3P2TA 3HAEG 2GAZB 3KYNA 3U46A 5E5MB 4GXUN 4HIIB 3QIBA 1HSAA 5D6DA 3NGBC 4UILL 2IPKA 4YBLC 3LKQB 3SDYL 4IMKC 4P3CL 4UOW0 5EULV 4PRHD 4CJ0A 3CLFH 3V4UL 2YEZB 3GMPB 4OIIL 3B9DA 5EO1B 3EOAB 1ZVSA 1N7MH 1K4DB 3MRBA 4XPGH 3RTQA 3PL6B 3GJFK 5IVZA 3LV3B 4DKDC 1DBKH 3LN4A 3DIFB 1JZ5A 3ULUF 1G7IA 3WNNA 3JTSB 3IDUA 4LGPB 1BFTA 5A16B 32C2B 4BQ6A 1QSFD 2VDPL 3LAFA 5H2BB 1NGWA 3LHPH 2WQ8A 1RPQA 1P7QA 1KBGL 2DQDL 2BFVH 5DEGA 3UZEA 5JXEC 4OLUL 4HIHB 2Z35B 4HUWA 5EU7E 4PJCB 4IRSD 3UZQA 2EC8A 4DZ8B 4NC0B 3D39D 1KLGB 1X5GA 4MNQD 4JPVH 4IRJC 4WI7A 1JFQL 2I60L 5FUOL 4LEOA 3VMPA 2EIBA 4XCCH 2N7BA 5F89A 1LP9F 4JHAL 1D5ZA 2YUXA 2W1NA 3D0LA 3V9FA 5E2VH 2DI9A 1RZGB 2KUTA 1N64H 1K8DB 1LD9B 3WFHA 3C5SA 4Z7VE 3V6OC 3LN5A 4P23A 5BO1H 4HIJB 1OD7A 4G7YH 5HVHC 3QUXC 1IM9A 2VERN 2VLMD 1YA5A 2UV3A 1DSFH 1EEZA 2CKBL 3H42L 1MLCA 1XCTB 2OL3A 4U1KA 3PJSB 5F96H 4PRPD 1NBVL 3RVWC 5IMMB 4PJ9D 3CFJA 2FJHB 5IMLB 1FZMB 3MXWH 1AO7E 4DVRH 4LMQE 5EU6B 4MLSA 1W0WA 4X4ME 4M1CD 4I0CC 4P2RA 2Y9RT 4JFQA 4TRPH 2PTVA 1T2XA 4BUGA 3GHBL 5D4QA 5ADOL 2DQIL 4U0RB 4WW2B 1N4XL 1EIBA 4PJ5D 3QUML 4OZGB 1SBBA 1UXWB 2XFXA 4X7TB 1RUAL 3DRQB 5F7UA 1U42A 2NXYD 2PXYC 3CH8A 3CSGA 4YHZL 5J12B 1MEXH 4JFPB 3IDGA 4HSQA 2R4SH 4TUJB 2YRZA 5KTEL 5DJ0B 3WUZA 3PGCA 4MA7H 2HRPH 2BRRH 5I15L 5J6GA 1A9BA 4OCYH 4U3XA 3M07A 5T3ZL 1AXTH 1TCMA 5B4MD 3QUYA 3GBLA 4DGYH 3C60B 1MAML 4Y4HB 3ZZ1A 3ZKQD 1YYML 2IPUK 4ORGA 1B88A 4PBVC 4GKSA 1ZA6A 2F8VA 1U3HB 4XNYL 4HFWA 4PRAA 4PRDB 4DCQB 3O3DB 1F4WL 3OKOA 2FWOB 4HWBL 3T4AB 2JB5H 4AG4H 5F1IB 4NO0A 5CEZL 4AMKL 1IGCL 2E3VA 4FQ1H 2VZ3A 3RQ3A 4HUKB 5CP7B 2CLVA 3WXVH 2MKWA 3RDTD 4JG0H 4D0DB 2HFEB 1FH5H 4LHUD 1X5KA 3IKCB 3O6FB 4M61A 3NFPB 2EO9A 4GXVH 4R4BB 3TYGL 3NCFB 1CICB 1DE4B 4JANB 1YEKH 4WEUD 4P3DB 4I48B 4RZCA 4QHUB 2GY7B 4KI5E 5EOQL 5ID0B 3TLRA 3GSXA 1IGYB 1WC7A 3FRUA 4NO3A 4XXCC 5BZDB 3SDAA 1UJTA 1CIUA 1H3WM 2GI7A 3BP7B 5E8EB 1MFBL 5FYJL 3IJYB 4ISVA 4QY8B 3EDKA 1RIHL 4PTTB 4R7NA 3OJVC 4U0QB 3BDYH 4XMLH 4ZUUB 1CDBA 2RHEA 4QHLB 4NWTH 3NIDE 3QPQC 1A7RH 3TCLA 3K1DA 1AHWA 3ESUF 1F3DJ 4NRZA 3CMGA 3CFEA 5HPMA 4PRNB 3ZL4H 5D5MB 4GMTH 3O9WC 4M6NL 3WKMH 1A3LH 3CAFA 1F3DH 5CZVL 4YJZL 4ZFGH 4X6CF 3QXAA 3MPCA 5E24E 3MRFA 2P8MB 4OT1L 1I7ZB 5CEZD 2VITB 3WHE1 4WFGD 4UQ3A 1QG3A 2C1PB 3RI5K 5FOBB 1JF6A 3QIUD 1F11B 3IKKA 4LRIA 1P2CB 3UXFA 1J8HB 1A14L 1DFBH 3TZVA 3STBA 3PL6D 2R4RL 3OR7A 1G9MH 5FGBA 1XF4A 2BVPA 2VXTL 4OIAA 4PP2B 3CFBA 1F3RB 3PIQA 4OIBA 3I75B 1A6VL 2I07B 1OW0A 4MS8C 3S35X 5EUKA 5IMKA 5J0BA 4HUXA 4GBXA 3RVUC 1QBLH 4LLYA 2BVOA 3MUGA 4XVJH 3WIHH 5FYJD 5DVMA 1G7PB 4S0TD 1KN2L 1Q9OA 2VDKH 3DMMC 3I2CH 3C6LA 2FB4L 3TESA 4JFEE 1NEZB 5IMOA 3LPFA 4BQCA 4Q9BA 2FEDC 4JDZA 5DFVD 1S3KL 2IPTH 3S96A 3X11A 1QVOB 3AU1B 4LAQL 3SDDA 4Z77B 3HRPA 5GGRB 4R4NC 1M1SA 3VFRB 4ZAKC 1HEZA 4KJYB 5C92A 5ICYB 4OKVB 2FX8L 4L8BB 4NNPL 4Y1AE 3RAJL 2Y07L 1AE6L 3TV3L 4LBEB 4TULH 3ULVF 5F9JA 1Z5LA 5L8LB 5T1KA 1I7TB 3CUPA 2WP3T 4N8PA 4YAQA 5J9PA 2H9GA 2PTTB 2OZ4L 3RU8L 4N8CH 4DKFH 4QRSA 4LVHC 2AKRA 4X6DB 5JORA 1WFOA 2P45B 2Z4QB 4G6JL 4JY5H 3FKUS 4P9HH 4Y2DA 3CXDH 3UTTB 1J1OH 3O8XB 4L3CB 1UCBL 3VWJC 1A3RH 1MSPA 1U8PA 1KSRA 1R3HB 2R69H 1UG9A 2J4WL 1U8OB 4ZUWB 2R1WA 5IB4A 1ZS8B 3SGEI 5BVPL 4I3RL 3SEPA 4U1IA 1CDGA 4X7EC 4G80B 4I0PD 3MRKA 3CZJA 2LABA 1E27B 4ZODA 5GS1C 4PLNC 2BCKA 4OLWH 5MI0B 1TVBA 4X6FA 3W2DH 3UTQA 1DLHB 2DTMH 35C8H 4WWKD 4U31A 3TGXA 4EKXA 3STLB 4V2CB 5GGSB 5D7IE 3TO4D 4KI5F 4JRXB 3RZCC 4BQ8A 2HT4C 4TVPH 5CJQL 4J4PA 3BP6B 3MLZL 4S0SD 1IAOA 3Q5YA 4JY6A 1DQDH 1Z9OA 4OB5L 5JPNB 1FLRL 4R6UA 2H2SD 1H8OA 2QBWA 3FB6B 1VDGA 1U3HD 3MOBH 1CGVA 1MCLA 3MBXL 3NIDF 4GAYB 4N5UA 4X5XB 4TNWK 1FLTX 1FIEA 4L1HA 1S78C 2YR3A 5F9AC 4UT9L 3DX6A 1LE9A 5FO8B 1U93A 3P0YH 5GRVK 5FYKU 3IFLL 3K4DA 1KNOB 3JVGA 2OK0L 3BVNB 3O2DA 5CUSH 5FA4A 4NSKB 3CFIC 1GH7A 4MVBC 2ITCB 1RJCA 5LBSH 1QOKA 1KYOK 2HN7B 4EDXB 2BHYA 3O6FD 2CUMA 4AEFA 4MHHG 3C8KB 4BUHA 3TBYA 1VADB 1BQSA 4MAUL 5AZEL 2X7LA 4RA0C 2GUOA 1ZTXH 2VH5L 3FB5A 2Y6SC 5BW7A 2YUVA 3DRTA 1KEMH 4JM4H 3MGOB 3T8XA 5KVFL 5F7KC 5FA3B 1CU4L 1JJUA 1AO7A 1KLUB 3OKLA 3CXHJ 1G6RL 1DDHA 5E2TH 4WV1C 5DDHB 3GKWL 1DN2A 4LNRA 2MSPA 1ZHNB 2ICCA 4X4MA 5C9KA 1MJ7L 3O2DH 1CE1L 3KAAA 5HBBA 5E8NA 1PQZA 2AEPH 5EWIH 3LSOB 2F74A 5B8CA 3LEYH 5C0IA 4A2LA 4U7KA 2IEPA 3IGAA 3MRQA 1NFKA 3GMMA 2CIKB 4TN9A 1SYSB 5IV2B 5I1KH 1JPGA 4HDIA 4HS6A 1CXHA 5C7XL 3MV8E 4MCYB 4M62H 1J8HD 1W72B 5HI5D 4U4BA 1AJ7L 1RZ8A 2IC2A 3SJVB 1DTUA 2GIYA 4LSSH 3F8UB 4R2GB 3BKYH 5ISZB 4AYFA 4ACPA 5DD5L 2XQYK 3VGGA 5DD0L 3P11H 2C4FU 1HHHB 4J3TA 5DSCA 3DTXB 1DQMH 1RD6A 3UBXA 4M6OH 4P0DA 4Y5XC 4I2XB 5FKPB 5C08E 3KYOB 3L6FA 3KYKH 4BSJA 2XG4A 4X9GA 3WIFB 1I3GH 4OD2A 3O41B 5GPRA 4R3SA 4I18C 1U8NB 5TF1L 1BBJA 3L9RB 3TH3T 4XVUD 1RUPH 5DD3H 4LCCB 4KV5E 5I8KL 3HS0B 1ZLWH 2PETA 3BDXA 2OTWA 3QDMD 3SY0B 3DVGA 3L5JA 1QNZH 3L3GA 4Z7WE 3MRDB 3D85B 2CXGA 1T03L 5I1IH 1N0XL 2D31A 3DHMA 4QYOA 4NNYB 5DO2D 3V7MA 4PREB 1HCVA 1FNHA 2X4SB 3JV6B 2BVTA 3KPSE 3QEUB 1HYSC 4KMQA 4RMRA 3GI8H 3HG1B 3EYUL 3HC3H 3JXAA 1EHLL 1MWAB 1RJLB 1C12B 2H8PA 1UWEH 3V52L 3VFSB 4PTUB 3X17A 2OS7A 5TQ0L 1NJ9B 3UTTD 2GCYB 3O8XD 1A6WL 5ALBH 5CCKL 4M5YH 4UTAL 3OKNB 3RIFK 1P4LB 3IETB 4FABL 1M05A 3AS0A 3OZ9H 2DM3A 4U1SA 4YXHL 1NCNA 3FJTA 3D0VA 2HFGH 4ZDHA 1UM5L 4RAUB 1EGJH 1YY8B 3L1OL 1YEJL 3SE4A 1A7PH 1UJ3B 1Y0LB 1Z6JT 1DL7L 5E8OA 4K3EL 2B2XL 5DYOA 2PW1B 3R06A 3JWDH 2A9NL 3QZWA 2I9TB 4X8JA 2QSTA 4BFBD 3HE6A 3I6KB 3DO7B 5BJTA 2ITDB 3WS6A 5DQDH 1ORSB 5BQ7B 5MEOA 3O3BB 1CXLA 4WI3A 5A2LH 5C07B 2A6DB 1QFWH 1J10A 4YIQA 5DMGD 3ECBB 4JFEA 5C0BE 3RL2A 3TVMD 4JM2C 4J7RA 4U1HA 2KZWA 3C09B 1GOFA 3WXWL 4KRPB 2A6JA 1Z3GL 4UDTA 5E1AB 2ATKB 4GKNB 3I6LD 1LO2H 2ZUVA 4K71B 1U92B 2UYLA 1A4KB 2WBKA 3MYZA 1T04B 3UBXG 4Y1AA 1AGEB 2PKDA 4JPWL 3TFKC 1OSZB 2CIIA 4ZSOB 4FQXC 4QXWA 2BY3A 1BJMA 4PJFF 5HJ3B 1OAKH 1NAMA 4ZMAT 4CGTA 1C7TA 4RAVB 4HFUL 1A6PA 2Q3ZA 2YN5A 3W0WE 3Q5OA 2DWEB 4AEIH 2MNUA 4HXAH 4MQSB 4OCWL 2XZQL 1C5CL 3OQ3B 1IT9H 2G60H 3VI4E 1EVUA 1VACB 1P4BH 4DOHE 4MAYA 1NLDL 4R4FH 4K3JH 5FEBA 1UM6L 1H3UA 4O2FB 1KT2A 4HKJB 5EA0L 4BH7A 1T20B 3B9KD 5CINL 1CLCA 2M26A 1AFVH 1U91A 3X3GH 4Z18A 1OPGH 5F7WC 1OAUH 5C3LD 1U8IA 2J1KA 3LQZA 4KJPC 2D7TL 5DUPL 1PVHA 3O6LL 4JAMB 1MHHA 1OARL 1RJYB 1CT8A 1JN6B 5GS0C 3OGCB 2NW2B 4KV5F 2C1OB 2XPGA 4YHLL 4LSVL 1NFDB 5F71A 1HOCA 2R56L 4Z5RB 7FABL 3WUWB 3QFDA 1MCWW 5C0AE 3IDNB 4Y16B 1OAQH 3UYRL 5D7IA 3I9GL 4TSCL 3O11B 4HX1B 4KXZI 4XC3L 3AAZB 3MREB 5AUMA 5HGAA 2VLRE 3T3ME 3SJVD 4R2GD 1YY9C 5ISZD 2XWJA 5D7LB 4YHYB 1CI5A 2EH7H 3C5JB 3HCVB 4I5BA 3TN0C 2I5YH 3V6FA 3N85H 2BSED 2BNRB 2HMID 4RGNE 1XGQA 5DJZB 2DQTL 4M7ZC 1XGUA 1R5IB 5IVOA 2Z8WC 3UC0H 3MRMB 1RIUH 1BAFH 2VDNL 1UXSA 3IF1A 4HJ0C 4Z95L 4U1JA 1IE5A 4YC2C 2FGWL 2YA1A 1DN0A 5IB2B 3UAJC 3GB7B 1CG9B 1NBYB 1MAJA 3GUTB 4BH8A 1HXYA 3S4SB 4OZFA 1RHHA 5DJ8B 2CK0L 5HHNB 5IESH 4LLVB 3L3KA 4RDQF 2DQCH 2QHRH 3D85D 4P9MH 1A5FL 3OKKA 3FN0L 4F57L 4QRRB 3KPNB 5CEYB 3CLEL 1JMXA 5HD8C 5MEPA 1XFPA 3VMNA 1SJHB 3HG1D 1KGCE 3S3JA 4N0YH 1NC4D 5C6TH 8FABA 1D5XB 2APVA 3HZKA 3VXSE 1UEMA 3DGCR 1HQRB 1FO0B 3EZ8A 3IFPB 1D9KA 1F5WA 3L7FA 2QSVA 4PJ8A 5J57B 2FX7H 3QG6A 4P2OC 5C8JA 1IBGH 3VXTB 3PWVA 1G0YR 2VRAA 3ZTNH 2P5WB 4AM0A 4LSQL 1E4KA 4OZFH 4OKDA 4N9GA 1G0DA 3DUSB 3UTSB 2ADIB 1L7TH 3AGVA 1HNGA 3Q1SH 1CE6A 4D9RE 2AK4B 3ALXA 4Y4FB 1E6OL 1NCWH 1OCWL 2F58H 4YX2L 5EUOB 5T3XL 5DK2B 4GRWB 4U05A 3BQUB 2R0ZL 3MV8A 5C86A 3OMZA 3VRJA 2P8LA 1F4YH 3DSFH 4D8PA 3OHXA 4PJAE 1G7HA 1WTGT 4KHXL 3PDDA 4KDWA 1RV6X 1Z0NA 2AP2A 1EFXA 5D6DC 4ONHB 2XKUA 1EXUB 1QBAA 2J8UB 1KTRL 5EZOH 3BHBB 3FTGA 1O7VA 4CADA 3L7EA 2PXYD 3NBNA 2DD8L 1ND0B 2W9EL 5C71A 5C08A 1IFHH 1RZIA 4P5KA 3RTQC 2OM5A 5C07D 1U95A 1PG7H 1PEZA 5E2UL 3VD9A 5GS2D 3QIWA 1FYTD 2A38A 2ZJSL 2XT1B 1X6LA 4F80A 2DQHH 3VU2A 1HHGB 3MV9B 4ZOBA 1T0MA 5CS7A 3DROA 1DBAL 3BP4A 3AVEA 4Z7WA 1EX0A 1NL0L 2F54B 2IAMA 3DURA 4Z7OF 1VFBA 4G8FB 4L3AA 3MJGX 4PJIE 3VFVB 3F12A 5D93C 3RA7H 4KAQH 3KPSA 2YMXL 3FCTA 1A3QA 4FZ8H 5DFWH 1LO5A 1V3KA 2YD3A 4H1LH 3OAUL 3T3MF 3MA9H 3KXFE 4UIMB 1IEBA 5EPMB 3X12A 4OLVH 4P23C 4OZFG 3CU7A 4GAGH 5J4MA 5K9QG 2NY3B 3IVKB 1JNHA 2V7HA 2BX5A 3FHAA 3IDYB 4WEBH 3TP4A 3BGFC 3LN9A 5I1HH 4FQ2H 1IJ9A 1F90H 2E7CA 3NCEB 5FYJU 2IFFH 3WFEH 4I9WE 3PQYB 1KENH 1YNLH 2DLGA 5LXGL 4X6EB 5C9JB 1F6AA 3QPQD 4EUPB 1FDLL 1YN7B 5TDPA 5F3HB 1GPOL 4N1EA 3DX7B 3A67L 3MLVL 1IGMH 1XZ0B