5DFTA

Structure of the eleventh type iii domain from human fibronectin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
89
structure length
89
Chain Sequence
b'QMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTTIPAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin
publication title Structure of the Eleventh Type III Domain from Human Fibronectin
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 10
structure length 89
sequence length 89
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dftA00
2OTPA 4KGJA 4GS7B 5BQ7B 3SBWA 3DBXB 2W60A 2Z8WC 2FEDD 1OPGH 4FFVD 3ULUD 3MNWA 2JELH 1I8IA 4LF3A 2EEDA 3U4AA 4M61B 4NQEB 4DGYH 4XPBL 3EOTH 3RZCC 4GG6F 3SOBL 1OGAA 3E3QC 3IDIB 1T4KB 5F8QC 3S98A 2V5SA 1RVFH 4ZXBB 2WWKT 4NC1C 5DUBB 4WFEE 1FP5A 3RA7L 2PYEE 1FNGA 5E99H 3NCCB 3S88H 2BSTB 1J8KA 1OL0A 3CFCH 1KEGH 3UXFA 2NXYD 4KROB 1RZJL 3ZTNL 1YMMB 1FPTH 2WANA 2R2CA 2I9TB 3EIFA 3VA2C 1JL8A 2W1NA 4Z7UE 1DDHB 1ZVYA 2NY6B 1YQVH 1NSNH 2APVA 3TWCL 1QRNB 4AEEA 3DLQR 4YIQB 3M8OL 1MFAH 3DETC 2Q8AH 4NNXB 2AJXL 4L29A 4CADB 4E9LA 1NBYA 4K94C 4FQXD 4QXUL 4M9PA 2P43B 1FZKA 4OT1L 3LQZB 4P2QA 3NFPA 2Q7YA 2V2WA 4NSKA 4PUBH 3RWDA 4NJ9L 1S7TB 3GB7B 3RVVD 2J8UB 3BGAA 4Z0XB 4HKBA 3KJ4B 1HSAB 3EJYC 1YC7A 1R3KA 1EEUA 4JQIH 4KC3B 1N6QL 5EORH 3EJJX 2Q86B 4MXWL 4HH9B 3MV01 1XGQA 3AY4A 1FN4A 4CMHB 5HD8C 5FUOL 3SPVA 3QFJD 4LVOB 4HF5H 5I1HL 1SJHB 4X8XA 5EO1B 2P5WA 3IVKA 4KVCH 1J1OH 4ETYA 2CRIA 5E6ZA 2JJWA 3QAZB 5DJ6B 3LV3A 1LE9A 4CVUA 2ORBH 3RNKB 4XZUB 3T4YB 3OSKA 1CGTA 4M6NH 1XF5B 5IVZA 4EN3A 3RX8A 1BJ8A 4GLRI 2HT4D 3B3IA 4L3CB 5DF0A 4RFOH 5GGRB 1A1OB 1FL3B 1XGRB 5FA3A 5L88H 1I1CA 3T8XB 3VG9C 4Y4FD 4OIAA 1AH1A 5HYFA 3WXVL 2F58H 5C1MB 2X7LA 4G9FA 3QQ9C 3LB6C 1FBIH 2D0HA 2ED8A 1OM3L 5HI5C 1I1FB 1GGCH 5C0AB 5F9WB 5SX5H 2F74A 2ZOLB 3MCLH 4EBQL 4LLVA 4AQ1B 2IGFL 4C54A 3QG7H 5HYEA 4MJ5B 5HPMB 4K3DH 2XKSA 4JVUA 1MRDL 1KF9B 4XCCH 1K8DB 4E41D 4QTIL 4O9HH 4JZJA 4B53A 2B1AL 3BRGC 3BWAA 4KZDH 1AC0A 3G9VA 3BHBB 1U92B 1QOKA 3GSXB 4NHCL 3SEPA 5B3JF 5FM5M 4YC2B 1TJGL 4DEPB 2B4CL 5C0RL 3D69A 4XBEH 4PB0L 1FL5B 4C55A 3ULVF 43CAB 5DUML 4X83A 5ESAA 1NKRA 3CX5J 1RJZB 3VH8G 4AMKL 4LHUA 2EXYC 3L3IB 2DQCH 4I0KA 3EKCA 4PRPD 3UJIL 1BBJB 1KLGB 1F3DJ 1UWEL 2AJVL 3V2AR 1Q0XH 3TYFB 3QULA 1HQ4B 1WQVT 2K7QA 3ESVF 5CCKL 1G1CA 5C70A 3DARA 1I85A 4OCYL 3LEXB 4ZNEA 4UV7L 1K4DB 5HHPB 1CDBA 4KTEH 4PYHA 4FTVB 3K7UA 3RNQB 3HC3L 1DVFC 5CIPB 4R0LA 4C83B 4Z7OE 5C2BH 1KCLA 5F88B 3MV9D 1B9ZA 2XNAA 5FOBA 5KW9L 2VERN 3AB0C 3NZHH 4BSJA 1EAPB 1CFSB 3TP4A 5MHSE 4DKEL 2IH1B 1Q0YL 2YPLE 4OZFH 4PRIB 4MB3A 4OD1L 3MA9H 3EW3B 3QUYB 3E3QE 3R06B 2HJKB 4B41A 1LO5B 2DM7A 4LLUB 3PGFL 5TE4L 3DV4B 4JKLA 4CJ1A 4WNQB 3V5KA 3MBEB 5CGYC 2V5RA 1Z9SA 5DJXB 1CFQB 3KWWA 5TH2A 2NY3B 5I8CB 1TJIL 4O2EB 1BQUA 1KCKA 1CXIA 1JPGB 4OZIF 3TIDA 5J3HC 3QWRD 3B9AA 5F7YC 3TO2A 3DXAA 1MEXH 4DUWA 4OCRH 2PKDA 5ISZA 3NA4A 2VIRB 2AGJL 4TSBL 2X9WA 4MAYB 5A1AA 4JAMB 2UWEB 4PJBA 2W91A 2P8LA 3TO4A 2OSLA 3GHBH 2V2XB 3BKJH 4IIQA 3KXFD 4YH6A 1VADA 3T0AA 4KKLD 3F62A 1PKQA 3O45B 4Y89A 5D2LE 4N1HB 5BZDB 2X1XR 2BSSA 2EYRA 3EOBB 2E3VA 4PP2A 3MUGA 2ZUYA 1KFAH 5JORA 2DQUH 3B9VA 1ZHKA 1A47A 4IDJH 5D1QD 2ZUQC 5LBSH 4NNPL 1EX0A 4D3CL 4P57B 1ZOXA 4PGEA 4NM4L 1I1AC 1T6VN 5KN5A 3ULVH 3IKCA 5HTSA 4TOYL 2Y9RT 2CD0A 3F12B 3WIIH 3GJFH 4BH7A 4S10A 2AJUL 3TBWA 1IGCH 5CJQL 1RK0A 3RUGB 4FFZL 1HXYB 2D0FA 1T80A 4XPGL 4YK4B 4K55A 3OKLB 5CWSA 3L3GB 1CIDA 2E7CA 3GMRA 3H3KA 1M7DA 3WKML 3MFGB 1L9MA 3KLHC 2GITA 3NACH 4G80A 4KHXH 3RL1B 1WV7T 2HLAB 2YC1A 2W92A 3AGVA 3VFRB 1NCBH 1Q9WB 3HFMH 3OKMB 4TUOA 5GGTH 1W8OA 4D9LH 1VCAA 1NAMH 3FO0H 1HIML 1AI1L 3BMVA 3BIAX 4H1LH 3G6JA 1FC1A 2VH5H 2AV1B 4KVNH 4JFED 1SJEB 1OY3B 3GSUB 3L5XL 4TVPE 3LCYA 5IFJA 4U7KA 2X4QB 3MRHB 2VDPH 5LG1A 2AI0L 4DTGL 3GJFK 4KPHH 4Y19A 3MNVB 4UOW1 2NCMA 4WW1A 2ITDA 4IRZH 1NGQH 2Y06L 3UBXA 4Z7UB 3S36H 4MSWA 5JXEC 3V6OA 3TZVB 4D0DA 2C1OA 2WBJB 1BZ7A 5CJXC 3JUZA 3MXVH 3SQOH 1NDMA 3IRPX 4U1MB 3UTQB 4I8DA 4X5XB 3CSBA 4L3EB 5BS0D 2ZCLH 1UZ6F 2DKUA 3HNTH 5AD0B 3QIUD 3VXNB 2ARJB 1AQDA 3D85D 3I3EA 4G8EA 1PEWA 2OR9H 5JNYB 5B8CA 4U6XA 3FQRB 3ULVD 1J0ZA 2XZQL 2P7TB 3MO1A 5GGUB 3FB5A 3K4AA 3FO1B 2R15A 4XHQA 2F8OA 2R1WB 3HUJE 1I8KB 4N0CC 3PGDB 4X6BB 4HC1A 5J11B 2GSIB 1JWUA 5KSAA 2FLRT 3C6SB 3SKJH 4HJ0C 2FDBP 2L7UA 2D31B 4HS8H 1CVRA 3LMJL 5C08E 1VFBB 3LH2L 1U3JA 3NCEB 5ETUA 4Y1AE 3UTOA 3FTGA 2VZ1A 3WUWA 1J10A 5D8JL 3ZKXC 4LQFL 3P0YL 1IEAA 2ICWI 1FSKB 1J0IA 1ZGLA 4QRRA 5F7UA 4O2FA 1LEIA 4Y2DD 4FZ8H 1PDKA 3V8CA 4M1DL 5JIIA 2HLFC 5C6TL 5I18L 1NMBL 2O5YH 3KDMB 4MZ3A 3H7BB 1IQDA 2XZZA 3MLSL 3QDJA 3FB7B 4ZPVA 4P23D 2GK0A 4JHWH 4RMQA 2H41A 3CVHA 4MWFB 3GI8L 3MGTB 1QFHA 1ZMYA 4U1LA 4M48H 1P6FA 4I3SL 3BESR 1SM3L 1TETH 3VWJD 4NZTH 3RZWA 5IT2L 2DJSA 1CDUA 1OSZB 4ALAH 4XP6H 4F7TB 3MRDB 3D25B 3B9KA 5D6DA 3MODH 4BFIB 3SCMB 4XVTL 2XRAL 1PX3A 3MQIA 1FL6A 4F7EA 3KPSE 4W4OA 12E8L 2JJVA 1KPVB 2V9QA 1UWGH 3MXWL 1H8OA 5GRVL 1A6UH 4J4PD 1X44A 2OJEB 3Q0HA 2APTA 1UM5H 1X5GA 1MIML 3QT2A 2GSGB 3WNKA 2HVKB 1WEJL 4OLZL 2J4WH 3RIFF 3IT8D 5HXMA 3I3BA 3BRFA 1VB9A 2VSDA 1AHWA 4QNPF 1KTLA 2D7MA 4NC0B 4Y5YA 5GJTL 2W9EL 3KPQB 1D3CA 4C56A 3HZMB 3JTSA 1SMAA 3DMMB 4DVRH 1FIEA 2H3NA 2XY2A 4WU7A 4JM2C 4OKDA 5E7FA 3OKEA 5BJTB 4IRSC 3ROLA 4XPAH 3O6ML 1Z6JT 2JIXB 3NPSB 4NZDA 3OB8A 3DTXA 2FX9H 3KPPB 4O51A 3ARBC 2QR0B 4ZS6D 3L6FA 3OKDA 4QHKJ 4Z6AT 1CFVL 1YEHH 1ZHBA 1RIUH 4G6MH 5HYSB 5CBEB 2DB8A 3TNNA 4PGCA 2YPLB 5D1ZD 1WICA 3HCVB 4XP4L 4UUJB 2FCBA 1NLBH 3EO0B 1IGYB 3RZCB 5T5NG 2RAMA 4F9PC 2SEBA 4UINH 2P5ED 2CR3A 4P4KC 1JUFA 2VL5A 5MERB 3QISA 1E6OH 1YNLL 1C5DB 4HX1A 4F33A 3L5HA 3FFCA 5C2UB 4HK0B 1BJ1J 2PCPA 2VLRD 3P0VH 4IOIA 4DGVL 2DOCA 1YEKH 2PW2A 2YKLH 1MHPL 4PPTA 3ZDYE 1FRGL 2FH6A 3JVGA 3VXTB 1N59B 3QUKB 2ADJB 5D1XA 3MLZH 1FO0L 3JWDC 2Z4QB 4XNZC 4IMKC 2PO6D 2A9ML 4OZGF 1AKJA 1JMXA 3O9WC 1FGVL 1HWHB 4OM0H 4WCYL 2CPCA 3E1F1 3K1DA 3BH9A 4NOFA 4PD4J 1F42A 3QNXA 4ZUSB 1T66D 1TPXB 2AXGA 3RQ3A 1J8HD 2CDEB 3WLBA 2OBGA 5D2LB 4DQOL 2Q1EA 4OBRA 2DL9A 4CKVX 1MCFA 5JMOC 1HEZB 1Q94B 1KN2L 4TUKH 5DQ9A 5ELIA 5F6HJ 1MFDH 4N0YH 5JHDD 3VFOA 1A7RL 3FO9B 1CDHA 1MCBA 4JFDA 3BPNB 1PLGL 4W4NA 2OK0L 3DIFA 3O4OC 3HA0A 2R39A 5DUPH 1W72H 4LASL 3VU2A 1BEYL 3P30L 4WEMB 3O6LL 1M71B 1RUAL 4JQXC 2X4RB 5C0DB 4JDTL 5C8JA 3WS3B 3TVMC 3QQ3B 1K9TA 4HAGA 3QJHB 5E00A 5GJSH 1RAMA 3RDTA 2R0WL 4XXDB 4R2GC 3CSPA 2YA2A 1I7RA 1KB5B 4ODSL 2MHAB 4OGXL 1RHHA 4S1RH 5C92A 4X4YB 5D7KD 3ABZA 5L7XL 2AV7B 4PR5B 3U0WL 2JLLA 2I5YL 4L3AA 5JHLL 5EU3B 3VG9B 3E8UH 1L0XA 4CNIA 2DM4A 4OF3A 43C9A 2NX5E 4JZOB 4NKDB 3BAEH 3ARGC 1IGMH 4YAQB 5A3ID 3MRPA 1K3ZA 4OIIL 5DD0L 5KSBA 3RIFK 3OKNB 1HZHH 3ZHDA 1KCRL 4MXVF 3SE4C 4WEUD 4QRQB 1DQMH 2WQRA 4Q9BA 2MSPA 2XN9A 3BUYB 3KVQA 5CMAB 5JXAL 5TDOA 3OHXA 1LO4L 4P49A 4N8VA 4MQ7A 5JDSB 1WFTA 1EPFA 3PUCA 4F8TA 5HY9A 4YHKL 4R7DA 3GBNL 2BP3A 2I26N 4PRHA 5IHUL 5KSVB 1CICD 4ZAKA 4BSWB 3SDCA 2AXJA 4S0SD 5DSCB 1VGKB 4EEEA 1A4JA 4N1CA 2E7HA 3KG5A 3I50H 1YEJH 5GPRA 2X4TA 4A2MA 4NQDE 5TPWH 3BKYH 2DM2A 4Q9QH 5LKNA 1HXMA 1QR1A 3FQUA 1LEGB 1MLCB 1VGEH 4WWID 2A0LD 5SWZD 3JSSA 3WO4C 2NY4C 3HUJB 3W0WB 1FYHB 1VACA 5ITFB 4LSPL 3VGBA 1DZBA 4ZOBA 5E2VH 3IS0X 1PQZB 4M4PA 2C3VB 1Q9KA 5D7JC 1VESA 2YOCA 1MCRA 4LSTH 3MRIB 1FFNB 4NFBA 3ET9F 1U8HA 3UTSA 1F4AA 1T21A 5DD5H 5T3XD 2V5MA 4F80A 2W59A 2PTVA 5C08B 3Q5YA 4JRYA 4Y1AB 3AB0B 3MRCA 4PGJA 3D3VA 5CILH 3CLFL 2C4XA 5B38G 4JRXE 5TJWK 1FIGH 5T1MA 5J8OA 2CIKA 4PJ9D 2ATKA 1C5CL 1T1XB 3PP4L 4XNYH 1BFSA 3U4EA 5FO9A 3A0OA 2X09A 4ELME 3SBWC 3LSOB 4I5BA 4OD2B 5D9SB 3SGDH 5L2JA 1NJ9B 4DUXA 2E6PA 1VPOH 4G8GE 3PDGA 3Q1SH 1ONQA 5ID0A 3AROA 1KELH 1CU4L 3CUPB 2VLJE 5J6HB 3DYOA 4X9IA 5GRJH 5I73C 3FCTB 4J3VA 3OXRA 4P48A 3ULSB 2VN7A 1OT2A 2NXZD 5E8PA 5E8EA 4Z7QF 1Z2KA 3G6DL 5ICYA 3D18A 1NGXA 5AYQA 3KPSB 4M7JH 1U8LB 4PREB 5MI0C 2UYLB 1UWXH 2KUTA 4OFKA 2B7DT 4PS4H 5T1KB 2R69L 1MIEL 1CGXA 5FHBH 1NBZA 2XYCA 5FGCE 4LARH 3FHAA 4WTWA 2B2XL 1SQ2N 3BP5A 4QYOA 1INEH 1I1AB 4Z7VE 1RZKH 4BQ6A 1OCWL 1C7TA 3CFKA 4HKZA 3MRRA 3QQNA 5F3BB 1NCDL 2GK2A 4ODXA 4BM7A 1GGIH 2HN7B 1R0AH 1NFDE 4JY6B 4B5EA 2Q8BL 3X3GL 1U36A 4GKOA 1QYGL 1NFIB 1KT2B 3RTQD 3SGDI 1S7UB 5FUCC 1G7MA 3M1BA 3AXLA 1JI1A 4K23H 1PGRB 4NO0A 5TQ2L 2BOCB 5H2BA 5C86A 1UCBH 3GSRA 1UWXK 1Q9LA 3QIWA 2NY2D 2NY5H 3D0VB 1JF6A 4LKXA 4M6MH 2VDOL 4XH2A 4ZDHA 2RCSH 1CGWA 3QEHB 4F58H 1N3NB 3HPJB 4EN3C 4A2LA 3DUHA 1IGFH 1WTLA 3WNNA 4OZFB 5I2IB 4U3CA 1JPSH 3BJ91 5DJ8A 2KPNA 1EUTA 2W0PA 3BT2L 2MKWA 1LO2L 1MELA 4MHHG 1CDJA 1HDMA 4KUZL 4HMCA 1KIUA 2GKIA 1E4KA 1GAFL 1OAQH 1XGPA 1AFVH 4H25B 1I8MA 5C7XL 1DFBH 1D5MA 1MI5E 1MVUB 3JXAA 5IIEB 1JHLH 3KPLB 1N0LA 4KQ4H 3S5LA 1M1SA 2YD5A 4JZJC 4X6FB 1CZ8H 1EBPA 1N4XH 5DZLA 5CD5D 5EU4A 3G5XB 4PG2A 1D9KC 1LE5B 2Z31B 3O11B 3NCYS 2HAZA 1ZHLA 5C0FA 4YHOL 1QSFA 2DN7A 1A6TA 2FBOJ 3CXDL 1QPXA 1S9WB 3BEVB 3DUSB 3UTTA 4HUXB 2H9GA 1ZV5A 1IQWL 2Z8SA 2BVUA 4J8RA 4NO2B 2DLEA 1OP3K 3KR3L 1KG0A 2APXA 1TNNA 2NLJB 3C6LA 1YMHB 2XQYG 4PGBA 1ZHNB 2I24N 5CZKA 3L7FA 3U7WL 4MA8H 3D9AH 3H42L 4PB9H 5DMIH 1C08A 1ZT7B 2H2PC 1TDQA 3EZ8A 2P46B 3ZKXB 2ENSA 1I85C 2LVEA 2DLHA 1ZVSA 1XAUA 4QRPE 5CHNB 1E4XL 5EBMA 1UZ8A 1JFQL 2MQ3A 4R0LC 1RZJC 4YFLF 1A6WH 1XH3B 4UT6L 4OQTA 4QXTB 1C8PA 2NX5B 4GSDL 1AP2A 4ZUTA 3Q3GB 5ERWA 2OL3H 3VJ6B 4QWWD 4MNQD 1OQOA 2ADGA 5IW1A 3IDJA 4WV1C 2B1HL 5DRWA 3PWUA 2IG2H 4QHLA 5EO9A 4EKXA 1BPVA 4EI6B 1X5ZA 4L4VD 5EUOF 5CSZB 3STLA 3ZT5A 3O6KH 3LQAC 3KLSA 4BZ1H 2LV4A 4IMLA 4TSAL 2K7PA 5JLZB 1NEZG 1OTUD 1Z3GL 1D5IL 2J88H 3GSNB 4G6AC 4Y5VB 1FVEA 3NIGE 3OL2A 4LMQI 2DQFA 2WIIA 3EYFB 5EC1B 5M95B 1L0YA 2DWEA 1CF8H 5D7SL 4ZPTA 4YPGB 3D5OF 1W0VB 3O3DA 1MCSA 5FDWA 1JRHL 3DWTA 4NQVA 3IU4H 1A3LH 4KK9D 3D0LA 5H37G 4UMGA 4NCDA 1MPAL 4OZIB 1PJ9A 4NQDB 4PJGF 3FONB 3TO4C 3H9SD 1IC4L 3GMMB 4IIQC 5DQJA 4Z76B 4GRLD 8FABB 5HGBA 3EFFA 3EGSA 5INDA 1NH6A 2VDLL 3FN9A 4NQCA 1J05B 3IXTA 4P2QE 2ZOKA 3GIVB 4IM8A 4XCYB 1ES0B 1IKNA 1CQKA 1AIFB 4HT1H 4IRSB 2BXYA 3C5ZD 5D72L 3EO1B 1NAKL 3V9FA 4JM4H 4QO1A 1LDPL 4M62L 4E42B 3ARBB 4XGZB 5IEKA 2ZCHL 5BXFB 3TJEH 5T5NF 5I30L 4ZODA 3T2NH 3P4MB 5DWUH 2AKRB 5D7LA 3H3PH 3QWQB 3LPWA 1XCTB 3VE0B 3PHOA 5DEFA 1UJ3A 5JO5B 4JRXB 2P5WE 4KV5E 3ROOB 3SKNB 5LXGH 2PTTA 4YDVA 4IRJA 4EOWL 3T0BA 3V6ZA 4EUPB 4YUEL 1UYWL 4E0RA 5JA9A 3ZT7A 1QFWH 2F54D 4ELMB 1BX2A 4M5YH 3BW9A 2DQIH 3DETD 1EV2E 1YDPA 3FT3B 4NT6A 1KIQA 4G8GB 3L3HA 4NN6C 4AEFA 1EHNA 3AM8A 3KPRA 1JNHB 4OCLC 1L7IH 2VLJB 4KY1H 3W2DH 4WFFD 3MLRL 4K71C 4POZD 4UOW0 2CRYA 3O9WB 4G6JL 4G9FE 1MCIA 3QUZA 4XMPL 4YHIB 4N5UA 1UG9A 2VABB 1ETZB 3FN0H 3QNZB 2H8PA 4JKKA 5I19L 1KJVA 1IMHC 2FYYB 1B2WL 1JGEB 1MAML 4ONFL 1HKFA 3VRLF 4W6XB 1I7UA 5ALCH 4D0BB 1OSPH 2IEPA 3LKRB 2FWOA 4N8CL 2DQGL 2PO6B 3V6OC 2BJMH 5BOZG 2HKFH 3UAJD 3FT4A 3TIEB 2BVQA 4GG8B 4UT7H 2CLVB 5BV7C 4LLYB 4JFQA 1I4FB 5FGCB 4PRAB 2ERJB 1FVCB 1N6UA 2EE3A 1QUNA 4Z7VB 3DUUA 32C2B 4KMTL 3SO3B 1K3IA 4NRXA 1OAUH 3WEXA 1ORQA 4WTZA 2CMRL 1DBJL 3PABB 2FIKA 3ARDD 1U8QB 1FC2D 5HYJA 4ODBD 3H0TA 2BDNL 5K9QG 2P8PB 4XPHH 4R2GB 5TDPA 1L7TL 2AJSL 3LB6D 4YFLI 5C0NC 5EOCL 4TVPD 5CEXB 1H0DA 1MCPH 1RMFL 1SY6L 4ZNEE 5CEZH 5HI5D 5KSAC 2F9BT 4MJ6B 3U9PH 3QRGL 5EBWB 1MCJA 2JCCA 3U9UA 4MX7A 1UKTA 4NQUA 5DJYB 5F89B 3HI1B 3QHZH 1CE1H 3NZ8B 1QBAA 3GBLA 3ARGB 4RGNC 4YHZL 5IQ7L 4GRWF 5IJKC 2VDNL 4ODWA 4WI7A 1PX4A 1CLOH 1AGEA 4LSUL 3OTTA 4YO0B 1GOFA 3BN3B 3O6FA 3VXRB 4Y4HA 4YNYA 1NC4B 3W9EA 1RI8A 4LEXH 1TMCB 2C3XA 4OGZA 3JTTB 4CW1A 5C3TA 3B2VH 1G7LB 5H35B 1CLZL 3EOAB 3FQWA 2EXYD 1RZIA 1K4CA 3ZMRA 2VLLB 1N0XL 1A2YA 1F8TH 4JG1L 4X6CA 1H15A 1IAOA 4F3FB 1MHEB 3DXAE 4D9RE 1KENL 3F7YA 2A6JA 5CBAB 5ISZE 5D6DC 3B9KC 3H6JA 3PV7A 3STBA 1YY9C 3THML 3BGMA 1LP9F 2H26B 1NBVH 4PJBE 4N9GA 2ED7A 4F7PA 3OR7B 3ME0A 4YFDB 2MQCA 4W4OC 1IEHA 1SYSB 1R3LA 4XT1C 1D5BA 3VFNA 3QPQC 5E8OA 1PKQE 5ADPH 3L3KA 3RVWD 5DJDA 3WO4B 1CICB 2NY4B 1QA9A 1T3FB 2WZPD 4DFHA 4XNXH 4PJXF 1KLFA 1R24A 3QUMB 1F3JB 5I15H 2J8HA 1AHWC 1X4ZA 3HI5H 1YZZA 4Y8DC 5D7JB 3DVGA 4Y5YC 1T1WB 5E5MB 2ENYA 3MV8D 4NUJA 2WWKO 2CDFB 3ZE0F 1RJYA 2CDGB 4YGVB 1QNZH 1AJ7H 5F6IC 3GI9H 3KJ6L 4QCIB 3U82B 3HAEA 3X11B 4C4KT 4H0HB 2GUOA 5CEZD 1RUKL 5FYLE 1T03L 1BFOA 2AJ3B 4HS6B 5I1DB 3HZYB 2HJLA 1A9BB 5KVFH 1WCBA 4PJ8D 4QRPB 1YPZA 5KVDL 4CVWA 3L5WA 4JO3H 2DD8H 1HKLH 1VSCA 4TRPL 3KYNA 1PZUB 2X1OA 4HJGA 4EDXA 5F7LB 5AUMB 1NGPL 2W60B 2VQUA 3TN0A 3MNWB 1I8IB 4LF3B 2EDTA 2V6HA 5JW4R 2BCKA 5E8DH 2GI7A 5FO8A 5E08H 3V95A 3KS0H 3G08A 4IJ3B 5T5FH 3FQNA 1UXSA 2PR4L 1V7NL 3FO2B 3G6JE 5I73B 2NNAA 3NFNA 3TT1H 5BO1H 1P4LA 3BSZL 4BZYA 1A7OL 1OLZA 4HLZH 1FNGB 2CIIB 4XC3H 1EO7A 5GZOC 1PSKH 4ISVA 3VFPA 4UILL 3E2HC 1UM4L 5D1XC 4TSCH 3IU3B 4JVWA 4MQSB 1EA9C 4Y19E 1NCTA 3BQUA 3ZE1E 2VDML 3ALXA 3HZKA 1XR8A 4JLRA 3UO1L 3D2UD 3V6OE 4LEOA 1IM9D 2VUOA 4URTB 2W38A 2CUMA 2P8MA 1AQKL 2F53D 5TQ0H 3TH3T 1QEWA 1MWAA 3LEYL 3NABL 4L29B 3QDGA 1NBYB 5F44A 4Q97A 3VXSD 1QLEH 1AXTL 4GW5A 3CGTA 4L9LA 5CJOH 1JZ5A 1ACYH 1RZGA 1FDLH 5J57B 3BPCB 3CMOL 4NO3B 4P2QB 1IVLA 3NFPB 4FQ1H 2Q7YB 4PJIF 2V2WB 3MACL 3T1FA 3SKMA 4NSKB 3RWDB 2DYPD 3DX8A 1EDQA 3QG6A 1JPTL 1NCAH 5GSVA 5TGBA 3FRPA 4JREC 5ID1A 1FGNL 4X6DA 1EMTH 1DJSA 1IFHL 1R3KB 2EKJA 4LDEB 4HUWA 2FJGA 4X5WA 4J3UA 1XGQB 2CJUH 4Q6IC 3T0ED 1FN4B 1R3IL 4R8WH 3SPVB 3N1GC 3LKSA 2AK1L 5EU6A 1AR2A 4OD3H 4K2UH 1FH5H 1BREA 4BFBD 2P5WB 3O8XD 3IVKB 2Z91A 1ZLSH 3LDBC 4XAWH 3OZ9H 5FKPA 3OKOB 1O0VA 1K2DB 1JBJA 1TLKA 2P42B 4L5FH 3RDTC 1T22A 5JXED 1LE9B 4EI5D 4ZSOA 3REWA 4KRPC 3F7QA 5IVZB 4EN3B 5FF6A 4DN3H 2QADC 4QRRE 4YHLL 1CDGA 4PIRF 4JGJA 4L1HA 3WD5L 1QFWM 4M61A 2JE8A 5HVFB 5DRZA 5FA3B 2CRZA 2NY2B 2BK8A 3FB8A 2KH2B 4ESKA 4X80H 3QDJE 4G9FB 2CR6A 5C0BD 4ZXBA 3UBXG 1VEOA 2D3VA 5E2WH 2ARJQ 1YY8A 4HUNB 4HUMB 3O4LA 2F74B 2RB8A 4DCQA 1JNLL 1EFQA 3MRNA 5FO7A 5AG9A 1A1MA 2R4SH 4H26A 4PTTA 4AT6A 3MOAL 5CGMA 1QLRA 4Q74A 1DDHA 4F8QA 3BWAB 3NFSL 3WN5C 3C2AL 3U7YL 2IF7A 1QRNA 4ZAKC 2HH0H 4Y7MA 2HMIC 2HFEB 3D69B 3EO9H 3OB0H 5IHBA 2YD6A 4PLNC 5BZWA 3RGVA 1KJ2A 5ESAB 3U36A 4LCIL 4C56E 2OZ4L 4LHUB 1DUZA 1KGCE 1IGTA 4LNRA 4P2RA 1ZS8A 3GB7A 2GFBA 2GTZB 2YD8A 3CXHK 3S34H 3V6BR 2Z8VC 1KXVC 3QULB 4ZUWB 4XTRC 2ZUVA 5FYKL 2AP2A 2Y6SD 2DIAA 2IAMD 1F90L 1EAJA 2BY1A 1RZFL 1SJHA 1VHPA 4MCYA 4RGOL 4R0LB 3B5TA 3TYGH 3A67H 2XNAB 1EHAA 1ZXQA 5FOBB 1I3RA 2OS7A 2VXVH 5IVXA 4RIRA 2RGSA 2DQJL 5LAXA 1VDGA 4XZUA 1JHKH 4I0PA 4KK6C 2CH8A 4X4XA 1IM3A 3CVIL 2X4SA 4UB0H 3T2PA 5GGRA 5D71L 1FFPA 3IDXH 3FFCE 4XMKL 3V5KB 1OP9A 1JHTB 4QOKA 3MLPA 4RSVA 3KWWB 3R1GL 5TH2B 2WQ8A 4RA3A 3VG0L 2R23A 1GGBH 1JCKA 4ZTPL 3PWLB 4JM2D 5C0AA 3DXAB 3VWKA 5I8OH 5ISZB 2C4FU 3UC0H 5HPMA 4L8CA 3PQYA 4PJBB 1K8DA 1PW3A 3PWVA 2P8LB 3TO4B 5L2KA 4OLYL 4UNVA 1F4HA 4IIQB 5ECJE 1VADB 3WIHL 1CR9L 3BHBA 3OAUH 1PKQB 2ZSWA 4RCAA 1T2XA 2BSSB 1T04A 2EYRB 3DHJA 4RWYL 4PJ5D 5JORB 1FL5A 4ZOEA 1V5JA 4J23A 1ZHKB 5L8LB 2V17H 4UT9L 1EHLL 43CAA 2RJMA 1KTKE 4JFDE 5D6CA 4JFZH 4P4KD 4ERSL 1WFUA 1RJZA 5KN5B 3IKCB 2B0SL 2VDQL 3MMEB 5JR1L 1WZ1H 1Z9LA 1KPUA 1GC1L 2P45B 1UA6L 5BMFH 1RK0B 2IPTH 3UJTL 3E0GA 2A83A 1CIUA 1UB5A 4RX4A 4HPYL 1HQ4A 3VD5A 4ONGL 5CWSB 4HFUH 1BLNA 1G6RH 1M7DB 2H1PL 2H45A 2GITB 4LCUB 4G80B 4FTVA 1KEML 3BH8A 1AO7A 3TCLA 3FKUS 3N9GL 2BVTA 2YC1B 2AEQL 1F3RB 2GJ6D 3PE9A 3WL9A 2IWGA 3PGCA 1KIRA 3WFCH 4YHML 4MNGA 4NN6B 3BP6A 1DN2A 4PRIA 3RU8H 3GJEB 3G6JB 2E8ZA 3DX7A 1WFOA 3R06A 4M03A 2HJKA 4TULH 1X7QA 2R4RL 3MOBL 4HWBL 3T2QA 2DMCA 2EIEA 3DV4A 4N0FA 5DMJB 3ALPA 3WXWH 5KSBE 4JDZA 2O5XH 1DBMH 4JQVC 4KU1A 2F54B 2VR9A 5IFJB 1MNUL 2A73B 3BP4A 1YEIL 3C60D 4KAQL 5JIHA 2OZ4A 4PJDA 3AC0A 3JV4B 4JKMA 4GRWE 4OBSA 4X7CC 4OCWH 4JPKL 3U48A 4Y19B 2XN9E 2F15A 4RFNC 3MLTB 2BNRD 4WW1B 1NCWH 2ITDB 3UBXB 4HUVA 3P0GB 4MSWB 2J5LC 4D0DB 2C1OB 1FNFA 1G0YR 1BZ7B 3VXOA 2YWYA 1E4KC 1QSED 1NDMB 5A16A 4PRHE 5BV7B 5F9JA 2EH8L 2UZIH 4H0IA 1A7QH 3VA6A 2BNQA 1AQDB 4G8EB 1IAIH 2N4IA 2E9BA 4O58L 5B8CB 4MA7L 4PG2C 4M1GH 3CZFA 4WWKB 1DEEA 3VMPA 3MO1B 3I75A 3FB5B 2WMPA 1P6AB 4PP1C 3INUL 3O41A 4G3YH 1WBYB 5MEND 5LQBL 1DBKH 4XVUC 1A22B 3B83A 5KSAB 4Z8FH 4I9WD 5DGQA 4G7YL 4U1KB 5FM8A 3C6LC 1YNKH 2DRUA 4X98B 1FFOA 3UTSE 1T2QL 4BUHA 4HGWA 1G7JA 3MRFA 1J86A 1X3DA 3OKLA 3RAJL 3CSGA 2EICA 4NKIL 5ETUB 4JRYE 3FTGB 3OAYH 6FABH 3D3VE 1A14L 4WO4A 2AAVA 3WUWB 2B39A 2VC2L 5AYUL 3DOSA 2HLAA 3I6GA 3LQMA 2NY1C 3T0VA 3EJZD 1IEAB 1ZGLB 1DSFL 1LEIB 4O2FB 5KS9A 3Q6GL 1A6ZA 2B5IC 4YDKL 3SGJC 5IVNA 4YBQD 1U6AH 1UJTA 2A6IB 3ZT6A 4OV5A 4J1UB 2HTKC 1FE8H 4K3JH 4KQ3H 3V7AE 2YD1A 1OAKL 3F5WB 1AXSA 2FSEA 3QDJB 1GHFH 4ZPVB 2GK0B 2R2EB 1I8LA 3G5VB 4N8VG 3CVHB 4U1LB 3QO0B 3DRTA 4GMTL 2YUVA 2X4QA 4ZNCD 1Y6KR 2RQ8A 4HWEH 5HGHA 5EU7C 4LLMA 1WBXA 4KHTL 1CGUA 1FL6B 4F7EB 3SJVD 2A77H 5D5MA 3BJLA 3MV7D 4JKPH 4RNRA 1ULVA 1QBLH 5EUOB 1JZ8A 3QDMA 2F5AL 4S2SB 1BBDH 3OAYK 4HCRH 5CGTA 4MJID 2JB5H 2QSTA 4G6KL 1WITA 4L3EA 4KKNA 4ZFOB 1AHWB 1KTLB 2ARJA 1S8DB 5DHYA 2QJDA 4OCXH 4U0QB 1WWWX 3W11D 5FK9A 3ULUL 1M05B 2FJHA 3JTSB 4X5LA 5F6IB 2OQJA 3J7HA 3VXMD 5E0QA 2WNGA 2H3NB 5GGUA 1N6VA 4PLJC 4WU7B 3FO1A 1RFDL 6CGTA 1IKNC 5EH1A 1GVIA 5C0IA 1OAYH 3MFFA 1I8KA 3ROLB 2PXYA 5CKAA 4HBCL 1TJHL 4JHZA 3PGDA 1OGAD 4X6BA 1G9NH 2YD7A 2A1WH 3WS6A 4JPVL 1N7MH 4YFEA 1S5HA 1YJDC 4O51B 3MV8B 1WFNA 4K94L 1U95A 1DEDA 3OKDB 3L6FB 2QQNH 4KK8C 3WV0A 2BVPA 1ZHBB 4WEBH 2R0LH 4WHYG 3SDXF 4PGCB 5HYIA 1UJ3C 4O02L 3PP3H 2VWEC 5B22A 4PJEA 5HDBE 3EOYG 4IRJC 1G7QA 4QLRA 3MCKA 3JV6A 2FO1A 2HP4A 3B5HA 1JUFB 5KANI 2VL5B 5DA0B 4KZEH 1EJOL 1H3TA 2X41A 4R7NA 4HX1B 4F33B 2OMBA 3ZE2F 2N1KA 5CEYA 3CIQA 4M5ZH 2YUWA 3LVEA 4IOIB 3SKUD 2KZ1B 2PW2B 3QDHA 4BQBA 1S3KH 1DLFL 3AM8C 1OARH 2HWZL 3E2HB 5D1XB 3VFSA 1U3HD 4F37F 1JNNL 4RGMC 3O0RL 4OI8A 3QHFL 1AKJB 4YE4L 3QUZC 5ESQA 3GIZL 1FVDA 1KB5L 3IETB 4Z18A 3BH9B 4H20L 1DL7L 1V3KA 2BY3A 4K8RH 5K9QI 2R2HB 2XTJC 2AJZA 4YHNA 4D8PA 3F7PC 2AXGB 4XI5C 2EDFA 2Z35A 3D39E 4NZJA 4XPBH 5GS3A 4MS8D 1CDCA 3WLBB 1M7IB 3SOBH 2H32A 4KDWA 3AS2A 5KSUA 2FX8L 5DQ9B 2VE6A 4KJWC 4P5TA 1MFNA 4FG6C 4EVNB 4JHBA 3GO1L 3VFOB 4OLUL 5IFHL 1PYWA 1FCCA 3BUTA 2OR8A 3T4AA 4JFDB 1FAKT 1T0NA 3DI2B 3EOTL 1Z5LA 4UAOC 1GIGH 1QSFE 3DIFB 1M6OA 4P59L 1UH3A 3UTTE 4OB5L 4AZ8A 3ZTNH 4L4TD 4NFCA 2ZSVA 1EH9A 3AFLA 4YZFF 4I48A 2W0KA 3VFVB 3RVUC 5E99L 5K93A 5FOJA 5BJTA 3TWCH 2CLRA 5C8JB 1MRCH 5KZCD 1NUGA 3M8OH 3OWEA 5E00B 2ESVD 2AS5M 2AJXH 1J0JA 4XAKD 2H2SC 4XX1E 1UACL 4KRPB 1I7RB 5E4EC 4P3DA 4MNHB 1MFEH 4DK3A 3Q2CA 4X7SH 2QADB 3BZDA 3O3BA 4OT1H 4J3SA 1ITBB 5ACMA 4HWUA 1GXEA 4N0RA 4UNTA 1AGFB 4JEGB 4NJ9H 4UUJA 1J7VR 5FM5O 1U2HA 1IGYA 1KTRL 2O5ZL 43C9B 4KGLA 3QXUA 4OGAC 4PGDB 4PJHA 5HJ3A 5GISH 1D9KD 3MRPB 1C5DA 4NN7C 4JPWH 2Y36L 5KSBB 4AIZB 2NMSA 3P77A 3S7GA 2HT2D 1FORH 4MXWH 4PUBL 5CP3A 1QO3B 3WSQL 4FZEL 1YYLH 5FUOH 5E2UL 2PNDA 5ACLA 3O6FC 4Y4HC 4GRWB 3IDMB 5EU7E 2XN9B 4DKDC 3I9GH 4K8RD 1WIOA 5TDOB 1F02I 5LGHH 4N8VB 4MD0A 4MQ7B 3S5LG 5HY9B 4OF5A 3IDGA 3BN9C 4HF5L 5DA4A 4OLEA 4PRHB 4ZAKB 1JZ6A 2F5BL 3SDCB 2D03L 1KJ3L 3MRMA 3WIFA 2LE9A 4XHJC 1A4JB 4CGTA 4BELD 2R1YB 1ED3B 2X4TB 2CDEA 4A6YA 3VRJA 3WXVH 4K9EC 3T04D 2IQAA 2OJZH 1Y0LB 1HXMB 2C5DC 1QR1B 1FYTD 3OF6D 5H8DA 3FQUB 5E56A 4RFOL 3CH8A 1U58A 1IAIM 4NBZB 2BHZA 5DJAA 1OM3H 5HHQA 3FO9A 3ES6A 4FQ2H 4HIXL 4NQCE 4CDHA 1VACB 1DQLH 4EBQH 2IGFH 3MLVH 1MAJA 1I9JL 1MQKL 2F58L 1T83A 3O3AA 3QEQD 2KQNA 4XX1G 1CD1A 1MRDH 1Q9KB 2DICA 3PV6A 1CL7I 1I3UA 3S3PA 1LD9A 2GT9A 5DJ0B 4KDVA 2YPVH 3SO5A 2DTML 3JBG7 2B1AH 1U8HB 3DVIA 2X4RA 3LHPL 3UTSB 4CU6A 3WNMA 2Q87A 5DC0A 4LIQL 2WSKA 2IPUG 5D7LE 4PJAF 2B4CH 2QQQA 3HNSH 5C0RH 1GJIA 2VLKD 3MRCB 3D3VB 4PB0H 4G6AD 5F7EL 2VWEE 2XIDA 2J8OA 4JZNA 1MREH 3P11L 1B0RB 2MWCA 5IB2A 4UTAL 5DUMH 1UENA 2CIKB 4FQPA 2ATKB 2AV7A 3VI4E 5ICXB 1CDIA 3U4EB 3MLXL 3UTPD 2XV6B 3MLWH 3QFJA 5FO9B 5EU3A 5GZNC 4I5BB 2AQ1A 5SV4A 3TN0C 5L2JB 1SJVA 4HWZA 1KCSL 4ZG1A 1S7QA 3CFDA 4OLXL 2FEEI 3KPRE 3CAFA 1ONQB 5CCKH 1EXUA 5I1GL 4OCYH 3OKNA 4UV7H 1RULL 4D0CA 3OXRB 2QLVB 2FIRT 1BQLL 3HC3H 4TNVF 2J1KA 4QRQA 5E8PB 5E8EB 3QZWG 1IKFL 4PJ7F 5ICYB 2XTJE 3D18B 5F9AC 4HMDA 4Y4FA 1NGZB 4DKEH 2VJXA 4XRCA 1T1ZB 2DQEL 1WCQA 3BQUC 3UJJH 1OQXA 3PWPD 4AEIH 4FP8L 5DSCA 1A3RL 1VGKA 4KJQC 3PGFH 3BDXA 4RRPA 4M1CC 5TE4H 3K8MA 1NBZB 1RZ7L 4DZBA 5CZXD 3HR5A 5B4MC 3BP5B 5DJZA 4E41A 1FJ1A 2JTDA 1TJIH 3CFKB 4HKZB 3MRRB 4JN1L 3ARZA 4GQPH 1LEGA 1MLCA 3WJJA 4L9LC 3CH1A 1DQDL 3EFDL 4ODXB 3W0WA 5ITFA 2AGJH 4TUJB 5DC9B 4TSBH 5HYJE 1D6VL 1PQZA 1I9RH 5BRZD 4UZGA 2CGRL 1MRFL 1HYSC 1QFUH 4FXGA 3RPKA 3NAAL 5E6IB 4IOFD 2JK5A 5JDJA 4PJIB 4WIQA 5GGRY 4MB5A 1F6AA 4WRLA 1G7MB 4OCRL 1CDYA 4M93B 1SVCP 1JGLL 3O3EA 5I8KL 4G6FD 4NO0B 5CUSH 5CZVL 2Z93A 4PRPA 3MYJA 5H2BB 3VI3F 2WLZA 3GSRB 5JTWA 2JCCE 4R3SA 2IFFL 1Q9LB 3QIWB 3GHBL 5T1LD 2VXUL 4LKXB 5J6GA 4D3CH 3T0XA 3NIDF 4XMLL 1KIPB 4KJPD 4XH2B 4ZDHB 3JWOC 1HOCA 5EPMB 4TOYH 5DVMA 3U6RA 1CK0L 1V3JA 2XY1A 4UDTA 2GJ6B 3T0DA 2AJUH 3MV9A 4LSSL 5CJQH 4DKFH 3OJDA 3VDCA 5LBSL 2D7QA 5DEZA 1U3YA 2H6PA 5JW3L 1TFHA 3ULVL 4MCZA 4X7FC 4RFNB 3SY0A 2ARWA 4GFTB 1HDMB 2NTFB 2ZKHH 3WIIL 4ZXBC 1IGCL 4KI5F 3VD4A 1X5XA 4YDLC 4X6CE 4GG6A 5IROC 1I8MB 4WDIA 2WK2A 5E1HB 2E9WA 1D5MB 1XF1A 4HHAA 3T1WA 1W2KT 1HIMH 3D39B 4GBXD 1AI1H 2MPAL 3NACL 3KPTA 4PREA 2L0DA 5HI3C 4KHXL 1XFPA 3CFBA 3CLEH 4D9QE 3ARVA 5T1KA 4U7SA 4LNVA 1U8IA 1NCBL 5EU4B 5GGTL 4H0GA 2NY6C 4OZHF 4WTZG 4DW2L 3FO0L 3L5XH 5DT1H 1ZHLB 5C0FB 2EDBA 1A6TB 5EUKA 3QH3A 2G5BA 4RGND 3WFDH 4ZO8A 1F3DH 3UTTB 2FJFA 4BK4A 2H9GB 4BYHA 4DTGH 2V5YA 3WFHA 1RUML 5E95B 2XQBH 3QIBD 3RGVC 5K9OA 4BFGA 4QRRD 1KG0B 2BY2A 3C6LB 1VA9A 1OD9A 5L8KB 3BMWA 2Z0BA 3RHWF 3VCLA 2A6DA 3L7FB 4JY6A 1C08B 1ZKAA 1JN6A 4JO2L 5D1QA 5J9PB 1KCVH 3A6BH 3W39A 1IL1A 1S7UA 5IFAL 1ZWIA 4TNVK 5DVNA 2NY1B 2O61A 4DAGL 3LEVL 2VRAA 4BH8A 3OMZA 1ZVSB 2YWZA 4JDVA 1C7SA 1YPZE 2B5IB 4KFZC 2DIJA 3FZUC 3GSQA 3D0VA 2XZQH 5IHLB 3HNTL 2AQ3A 3MUJA 3QAZC 2J6EH 1AP2B 1HCVA 1NCCH 4ZUTB 4KUCF 3CX5K 2UUDH 5ERWB 3S3SA 2OR9L 1A5FH 1AE6H 1DQQA 3QNYA 3P73A 1I75A 2ADGB 4Y16B 5IW1B 3IDJB 2K3TA 4Z95L 5DRWB 4PLKC 3PWUB 4OZFA 5TF0A 2XWJA 2YRLA 4QHLB 5EO9B 3ZKMD 3NCJL 5D7IA 1ZE3C 1MOEA 4AENB 3STLB 4XCNB 4XP1H 3PNWB 3ZL4L 4JO1H 4IMLB 1CGYA 4C56D 2VUYA 2OXGA 1R5VB 3TJHD 1FVEB 2C4FT 2DQFB 4O2CB 4LL9A 4LP5A 1ROWA 3P0YH 4JFEA 4XP9L 1ZLVK 4ZMAT 4ZPTB 4OIBA 4HS8L 4H25A 2G9HA 3MROB 5F9WC 3VWKC 2FD6L 5LVEA 2YK1L 5FDWB 4NQVB 1Z9MA 4KKCC 3HG1D 4M1DH 3D0LB 3TT3L 2NPLX 1GZPA 1NMBH 2ZUTA 1EGJL 2LU4A 3OAZK 4X6FA 5E70A 3QDGE 5DTFA 3GNMH 3JWDL 4NYLA 3GI8H 5HGBB 5DURD 1T0MA 2IAND 4Z7WF 3EFFB 3EGSB 5INDB 1E0OB 1SM3H 2UUDK 4DEPC 2V2TA 4NQCB 3IXTB 4FQJH 2ZOKB 3CX2A 2VXSL 1R5WA 2LTQC 2XG5A 5C07D 4XVTH 5BS0A 1I9IH 1JGUH 4NO2A 3QIUA 4KKBD 3D85A 4X6DE 4I1NB 5IEKB 1P5UA 1WC7A 3OR6A 1SYVB 3MXWH 5F7NC 4I0CC 2QHRL 3FFCD 1WAAF 2ID5A 3MODL 1MIMH 5D7LB 4GQ9L 3PHOB 5EU6E 4XCFH 5DEFB 1UJ3B 1NMCC 2R0ZH 3GJFA 1AGDA 2PTTB 4YDVB 1HNGA 4IRJB 1FNSL 4YZFE 3RX7A 5GJTH 1FLRL 2W9EH 3SKOA 3V6ZB 2C1PA 2DL2A 2BC4B 4E0RB 1HHIA 4JJ5A 3UDWA 1NGYA 1BX2B 2WM0A 1XH3A 2D4DA 5GS0H 4J2XA 3UPCA 1NC2D 4QXTA 3WNPA 3BW9B 3G6AA 3QDAA 4AYFA 1YDPB 4JFXA 1KIQB 3U7AA 3N1FC 3Q3GA 3KPRB 5IW6A 5GGTA 3O6MH 4GW1A 1NAMA 4LCYA 4RGMB 3QUYC 3IJHA 2OCFD 4KK5D 5FIEA 4CVZA 4I77H 2L7JA 4C57C 3QQ4A 4Y2DA 4H1LA 1GOHA 1CFVH 1S7WA 1MJ7H 2XTJB 5FYJH 3G5YA 3O4LE 1KJVB 4KI5D 3W82A 4Y5VA 4XP4H 5IBTH 1I7UB 4F7MB 5KG9A 3VXPB 4P23A 3RHWK 2ICWA 3MC0A 1L0QA 2FWOB 2YZ8A 5GHWL 2X9YA 1YNLH 1BIHA 3FT4B 3V5DA 4KMQA 2BVQB 3VWJA 2YR3A 1QRNE 4JFQB 4OZIA 1WLHA 4ODUA 5ITBL 1MHPH 4UAOB 1OP5K 4BJLA 5FECB 4UINL 2X4PA 1ZLWH 1FO0H 3DUUB 3AS1A 4AJ0A 5F9DC 1E6OL 5JMRA 2IPKA 2QEJA 2CO6B 2A9MH 4NRXB 4J4PA 5HI4C 3VXUD 3WEXB 3ZKQD 1ORQB 1FGVH 4L8BA 1YEKL 4XCYA 1ES0A 2FIKB 3NPZB 1AIFA 3SDAD 1ADQL 3H0TB 4P2RE 4OSUL 3ARED 3V4VL 4O5LH 4R96A 5TDPB 5A2IH 5E4EB 4XGZA 4WHYH 2X44D 1KCUL 1H0DB 2WAHA 5SWSD 4DQOH 4ORZC 3VE0A 4HK3N 4LPTA 1KN2H 3HB3D 2JCCB 4ZTOL 1T89A 1XZ0A 3QCUH 1A7RH 1IT9L 3QEUA 4I2XA 5GS0D 5IVXE 3IDUA 1PLGH 4LCWD 4WO4C 1P84J 3QUML 3GK8L 4NN7B 4TUKL 1NANI 4ODWB 4LASH 4JFHE 1AGEB 4KUCD 1BEYH 3P30H 4N0YL 1TTFA 1ZLWK 4J6RH 3O6LH 1BGXL 2MMXA 4Y4HB 4YNYB 3DPBA 3IF1A 5HHVH 3W9EB 5D1ZA 1P7KB 1UH2A 3TNMA 4QOKE 4Y4KD 4CW1B 2R0WH 5FYJD 1UC6A 5DO2C 2P5EA 4ODSH 1K4CB 1CBVL 5ANMB 1ETZA 5F8RC 4X6CB 1H15B 1IAOB 4NHUB 4C4KO 5L7XH 5C0AE 2VLRA 3U0WH 3F7YB 2I5YH 5JHLH 4NFDA 3PQYE 1Z0NA 4NCC2 4POUB 4N9GB 2YXFA 3V52H 1GC1C 4S1RL 3FAWA 4QTHA 5E9DD 3IJYA 4F7PB 5L2KE 2PO6A 4O4YH 1R3LB 4OIIH 5DD0H 1D5BB 4GG8A 3EDJA 3VFNB 1LGVA 5E8OB 4K7PY 3QA3B 3L3KB 3K2UH 1NPUA 4ZD3L 2NZ9D 3L5IA 5DJDB 3O2WL 4JRYD 1KCRH 1QA9B 1FVCA 4QRUA 4ZOAA 3KGRA 1N64L 3OG4B 4GW4A 4S1SL 2XXCB 1IC5H 1MHHA 1R24B 4WFGE 4ZO6A 5FV2A 1IGML 4P5KB 1ZLUH 1J8HA 3DVGB 4X9FA 4CDGC 5JXAH 1LO4H 2QL1A 1HZHL 2E6JA 4NUJB 3L7EA 4ZUVA 1RJYB 1ZSDA 5DHVH 3GBNH 4RMSA 5IHUH 2HT3C 4ACPA 4BKLA 4V1DD 3HAEB 5FAAA 2GUOB 3SGEH 5JHDA 1BFOB 4WW2F 1OAZL 2PXYC 4G7VH 3WS6C 4KDTA 1RY7B 1YPZB 5AAMA 4MJ6A 3L5WB 1JWSB 2CKBH 4FTVE 1AO7E 2BRRH 4P46D 5J1AA 1BD2D 1A6VH 3KYNB 1KTDA 4HJGB 1U8PA 2FGWH 1X6LA 1OAXH 4LHJB 3TN0B 3I50L 1YEJL 4MNGE 4LSPH 4N90D 1BJ1H 5F96L 2BCKB 5TPWL 2VLKB 5FO8B 1MY5A 4PRIE 3G08B 4GAGH 3FQNB 1UXSB 1TZGL 1FSKC 2CUIA 1BP3B 4JKWA 3NFNB 3ZTJG 4X99B 3VXRA 1ZLUK 3L3JA 5IGXL 3KHQA 4ISVB 4DN4L 1OF2A 3VFPB 5ESVB 4LSTL 4P9HH 4PJDE 3L1OL 1OOAA 2VLLA 1K8IA 3BQUB 2DI9A 3HZKB 4HEME 1XR8B 4F3FA 2NYYC 5F1OB 1MHEA 2D7TH 3PP4H 4LEOB 4LBEA 2DBLH 3SCMC 4D2NA 3TPUA 5CILL 5FYKE 3OPZH 1QEWB 1MWAB 1NUFA 1FIGL 1N2RA 5C09D 5F9OH 4LOUC 1G9MC 1RURL 3QDGB 2V9RA 3EYUL 3SE9H 3SGEI 1QP1A 2BZDA 1CU4H 1TVHA 4QHKI 4GW5B 1T5WA 1ZVHA 2BNQE 4X0KA 3MJ9H 4L9LB 1MCWW 4NQXA 1RZGB 1CICA 4AH2A 3T1FB 1R3HB 1X5JA 5F1SA 2FECI 5EZIL 4P5TC 3DX8B 3QG6B 5GSVB 5TGBB 4F9LA 2HFTA 1OTSC 1KELL 4X6EA 3X13A 5ID1B 2HTLC 4X6DB 5F7WC 4DZ8B 2IBZX 5GRUH 5GRJL 4PJCF 3IAPA 3ZYOA 4HUWB 2FJGB 4XVSL 4PD4K 2R69H 1QZ1A 3LKSB 5EU6B 2OTWA 1MIEH 2EZ0D 3OJ2C 4OM1L 5SWZA 1W72A 2XKNA 2Z91B 1UGNA 3CFJA 4HS6A 4NO5B 3HZYA 3TA3D 5FKPB 2VXTL 2B2XH 1A9BA 1DBBH 2E6QA 1HN1A 3REWB 1BIIA 3T3PF 5SWQB 3QWOA 5FF6B 1SBSH 5M94B 5FHBL 2V9TA 3M17B 5AUMA 2IBGA 5KS9E 1SBBA 4P5MA 4ZFFA 4P3CL 3RI5F 2EH7L 5C0GA 5DRZB 4NCC1 2CO7B 1RZKL 5BVJA 3FB8B 2Q8BH 9CGTA 3X3GH 3FO2A 3V5HA 5T3ZE 3HMWH 2X6MA 3LKOA 1MCWM 2NR6D 1KPRA 4PJ9A 5F6HI 5DEGA 3KAAA 1T7XA 4APQD 3EDFA 3FRUB 1XF2A 4YDLB 4GXVH 1WZLA 1YY8B 25C8H 2CIIA 4HUUA 4ENED 1R0AL 3O4LB 4FMKA 1HHKA 4DCQB 5HDQL 2FEDC 3MRNB 4FFVC 3ULUC 4LAQH 2G75A 1KACB 4LKCB 1EFXD 5FO7B 1PZ5A 3ZDZF 1S5IL 3IU3A 1A1MB 1IGIH 4PTTB 4H26B 4AT6B 5GS2H 5CLWA 4FRWA 2VMFA 5IG7A 1QLRB 2HRPL 5D5ME 2HKHL 3LKPA 3QDME 5KJRH 1PAMA 5DLML 4OZGA 3GMLB 5C71A 3VD7A 1TPXC 3GHEH 3CSYA 4L3EE 3BT2H 1CE6A 1LO2H 1OW0A 2RCSL 3LQAL 5HHOD 5BZWB 5FCUL 2YBRA 3RGVB 1FLTX 3VFGL 1KJ2B 4HSQA 3QXDA 2VITA 3U36B 1IGFL 3BPCA 4NO3A 1LK2A 4PBXA 1DUZB 1Q38A 1JPSL 1IGTB 5I76A 1GAFH 4LNRB 4P2RB 3KYKL 1ZS8B 4HKJA 1Y18A 3CDFA 2ZUUA 3GSVA 3V8OA 2GFBB 3P9LA 2R9HC 1KOAA 3WUZA 5C7XH 3BPNC 5B21A 4Z9KB 2Y72A 3P2TA 1NGWB 1T83C 5CINH 3F7RA 3SN6N 3EYOA 2O26U 1N5YH 4M6OL 3I2CL 2AABH 3HC4L 4MCYB 4HZLB 2BVOB 1KJMA 4QY8A 3S37H 3WFEL 4BSVA 3OKOA 1K2DA 1I3RB 5IVXB 4RIRB 3RVVC 3K80A 1JHLL 4YHOH 3HI6L 5D7IF 4U4BA 4ZFGL 5LAXB 3STZA 3AS0A 4PJEE 4I0PB 3RTQA 4HUKB 1IQWH 4X4XB 1IM3B 4PG9A 5JQHC 2X4SB 1C5BL 4YWGL 4I3RL 1FFPB 4RAUA 3U7WH 1TZHA 4QOKB 1ZA3A 1WSST 4S1QH 5EU5A 5FYLL 4WGWB 5EO0B 3GKWL 4XNMB 3RWEA 2R23B 3TBYA 5CKGA 5GS2D 4AQOA 1MQ8A 3VWKB 4MA8L 1E4XH 3GMQA 4PB9L 1JFQH 1B88A 3WLWD 3WFZA 4L8CB 3PQYB 4LRIA 4UT6H 5EIVA 5IUSA 3NIFE 4HV8A 1C1EL 3OGCA 3PWVB 4Y4FC 4TQEL 1P7QD 5L2KB 4F7CA 1U8KA 5GSRB 5J4MA 4ONOA 2ZSWB 4LLWB 2HFEA 4PJ7B 1ZA6A 3DHMA 1T04B 3WCYA 1A7PL 5K59E 3MUZ1 2HA1A 3PL6D 2A2QT 2LTQB 4UTBH 1DLHA 4U1GB 2OL3L 4TSAH 3IXAA 2R29L 5D6CB 3VH8A 1D5IH 2R2BA 3UTZA 5FFLA 3EYQC 4P2OD 5HHME 3RI5K 3WJJC 1KPUB 2VLMD 3P9MA 2IANB 5IV2A 2GTZA 3T3MF 1JRHH 4OF0A 4LGRB 1NMCB 2A83B 5D96C 1UB5B 1WWAX 4ZUWA 2E7MA 4OF6A 4MQTB 3QO1B 5BV7L 1MPAH 2Q6WA 3S37X 1BLNB 5SX5K 4K3HA 1CYGA 1CF8L 1MCDA 3TCLB 3BH8B 1AO7B 1XGUA 2C3GA 2I27N 1TENA 4JY4A 2NY0D 3IU4L 5IM7A 3WL9B 3PGCB 5EZOL 2VDLH 1KIRB 5IF0A 1FHGA 3TF7C 2IMNA 4MNGB 3BFOA 3BP6B 3HS0A 4F2MB 4LVEA 5D72H 2IALA 5HHNB 2NTSP 5LCVH 1XIWD 4HXBL 4M62H 3U0TB 1T6WA 3DX7B 1ERNA 1X7QB 3RY5A 5DK2B 3F58L 3MRLA 4PJHE 5LWYL 2ZCHH 5E7BA 3QHTC 4N0FB 4JDZB 4S11A 4RMRA 3BIKB 4HC1L 1JHTA 2OI9C 3BP4B 4JM4L 3ULUE 4M8QA 4I4WA 2NY7L 4PJDB 2YD4A 4M8VA 4KJYA 2MCPL 1TVBA 3MLYH 5I0DA 4MNQA 2XA8H 2DQHH 4EOWH 3T2NL 4HUVB 3PWLA 1R5IA 4G43B 1BQSA 3H3PL 4YUEH 3VXOB 4BQ9A 5HYJD 5A16B 3NN8A 4L4VA 3ZDXE 2KL6A 4M7KH 5F9JB 2BHUA 1TZIA 4JO4H 2H2SD 4Z0BL 3QI9D 2BNQB 4JCMA 3N85L 1GGUA 3HE7D 2DKMA 4CJ0A 4G6JH 2Z8RA 3BDYL 3CZFB 3CVHL 1DEEB 5C0CB 4Y0GA 3I75B 5I71C 1CT8B 4GH7B 5I19H 5DVLA 3W2DL 3O41B 3GMPA 1MF2L 1B2WH 1MAMH 3H9SA 3MMEA 1WUNT 4ONFH 5CJ8A 1NL0H 5C0EB 1X5LA 2Y23A 4GRLA 3LKQA 4NRYA 3MRQA 3O6FD 1FFOB 1AD0A 3H3BC 5HYSG 4JFFD 4HGWB 1G7JB 3ARFB 3MRFB 1G7IA 3ILQD 3C5ZA 1T1YA 3BRDA 4LGPB 1MUJB 5D1QC 5MEOA 4WO4B 3JUYA 4LCUA 2N56A 3EHBD 3I6GB 4ZFOL 1HHGB 4TYUA 3VFTA 4OFYD 5KS9B 5IQ9A 1A6ZB 5AWNL 1YEDB 1DBJH 4TPRL 7FABL 3QFJE 1SJXA 4OV5B 5IOPB 4NWTH 2BDNH 5A2LH 2ICCA 3GJEA 1AXSB 1BF2A 2FSEB 1L7TH 1OAUL 2AJSH 5C6PB 2FX7L 3NCMA 4WUKL 4OZ4B 1RMFH 1SY6H 1EEYA 2FNBA 2OL3A 1J0HA 3DRTB 2F54A 2A73A 3CU1A 3QRGH 1EZVY 1YUHA 4FOMA 4RZCA 5I1KH 4FA8A 3JV4A 4XPHL 4TVSa 5HGHB 4LLMB 1BVLB 1WBXB 3MLTA 3PF2A 2J8UF 1O5DT 1QLFA 2ED9A 2XXMB 5D5MB 4YHZH 5IQ7H 2EYTA 4RNRB 4WVRA 1GGYA 3PIQA 3QDMB 4UIMB 3QPXH 3M07A 3QHZL 35C8L 1F58H 4R90L 2XZCL 2EE2A 4LSRL 5DHYB 4PV8B 4X4MA 4JGUA 5FK9B 5DR5L 1CLZH 4E41E 2FJHB 4P9ML 5E9DB 4WWKA 2OQJB 4H8WH 1N0XH 3CDYA 4JG1H 2Z31C 2CK0L 2R8SH 2WP3T 3GRWL 1KENH 5C0IB 3W0WE 3MFFB 1OHQA 2PXYB 3THMH 1WBYA 2KZWA 2D2OA 1OD7A 4WUUD 3SQBA 2LFGA 4MB4A 1RUPH 3QIUC 4MGXA 1F8TL 1S5HB 4U1KA 2DLFL 2GY7B 4X98A 1U95B 3RJDA 3ARDA 1T7ZA 2BVPB 3ULVC 5ADOH 4PRPE 1NBVL 4FQHB 3G04B 4PJEB 1IJ9A 5DFVC 1G7QB 4NM8L 3MCKB 3JV6B 4N0UA 3CFIC 2GJJA 2Q3ZA 5FHAL 4IEFB 4OGYH 5IHZA 3K81A 4R7NB 1V3LA 4M1CD 2A6IA 4KKAD 3UDWC 5CEYB 2VISA 3KJ6H 4J1UA 5DQDL 1U91A 3VW3L 3MV9E 5I15L 1SEQL 3BO8A 3F5WA 3CXHJ 1T03H 4ONHA 2R2EA 3VFSB 3G5VA 1XGTA 1QTYT 1X4YA 3LS4L 1WIPA 1QNZL 4K3GA 3LD8C 3QO0A 2P47B 1RIVH 5KVDH 2V7NB 5ESQB 3S36X 1FVDB 4Y2DC 4RQQA 5CS7A 3X12A 1YEGL 4RRPG 1NGPH 4GG6E 5HVWA 1EZVX 2AJZB 5FUZL 4D8PB 1HQRA 4YHNB 4V2CB 5IP4A 2Z35B 4Y5VC 1EBAA 5EUOA 1INDL 4RAHA 4JO3L 5TFSH 4P23C 4N5ED 3DSFL 4S2SA 4HZAA 1V7NH 4LIQE 2H32B 5DK0A 5KSUB 1G0DA 3BSZH 2HFGH 4ODHH 1A7OH 2VE6B 4PLOB 3VWJC 4P5TB 1FV1A 1OWWA 5DJ2A 4M3JA 4WU5A 4GAYA 4LRNL 1PYWB 4ZFOA 3HE6D 5E08L 3T4AB 1H9VA 1S8DA 1T0NB 2ZUSA 1QKZH 1Z5LB 3QUXD 5T5FL 4BUGA 4UILH 1M6OB 4R6UA 1M05A 5C9JA 1UM4H 4XWGL 4JCLA 2ADFH 5HHMB 2ZSVB 5BOPA 1MHCB 1J1XL 1F00I 4I48B 4J4PC 4EDWL 1U8NA 2ZUWA 4PJGA 3UO1H 3UYPA 3N1PC 4GKSB 2AK4B 4NQED 3BZEA 2CLRB 1PG7W 3LEYH 3NABH 3LRGA 4ZXBD 3VRIA 1I9EA 4P3DB 3MV8A 1FNAA 3P4OA 5E2TL 3O3BB 4LAJH 3ARWA 3CMOH 2R0KH 5TQ0L 3MACH 4KROD 1JPTH 3ZTJH 1YMMD 5DD3H 1GPOL 1GYAA 5GIRA 3DV6A 1I7ZA 1FGNH 3QCVL 4M7LL 2UWEF 1NMAH 5CJOL 4PJ8A 4PJHB 1ACYL 5HJ3B 1IFHH 1DQTA 3P77B 1QRND 5CD3A 5I1AA 3EYVA 4QF1A 5JW5A 2YHGA 2RIKA 1NCAL 3LS5L 2RFXA 2VXQL 1HNFA 4WFHD 5D7IE 1DP0A 3CFEB 1EMTL 5D1ZC 2PW1A 4MD0B 1G6VK 2WWMC 3GRWA 3IDGB 3SDDD 3IETA 4JFEE 5DC4B 2PYFA 1HCFX 3OZ9L 2R2HA 4YHLH 3LPFA 1XGYL 3MRMB 3WIFB 2UY7A 3HNVL 5KBNC 4JRWA 2MNUA 3RUGF 1AGCB 1AD9A 2NXYB 1M7IA 3SDYH 1CLYH 4A6YB 1FZOB 5C9KA 3VRJB 1XF4B 4UIKL 2IQAB 2JJSA 4FQLH 2PO6C 3FZUD 3D2UA 1IM9A 4EVNA 1U58B 4P4RA 5DDHA 5DJAB 5L6YL 5F21B 5HHQB 3ES6B 4M9OA 2ERJC 5I1JH 1T66C 2F53A 5F7DA 3UZVB 2C26A 5CIPH 2R56L 2P48B 4IBLT 5AZ2H 4XPFL 1R3JA 3O3AB 5BS0E 1CD1B 4FQXB 3SO3C 3VXSA 5B3JE 3PV6B 4UBDD 1LD9B 2GT9B 2AJYL 2K1MA 1S9XA 3VFVA 3HPLA 3WFBL 5E94A 3C2AH 3U7YH 1YN7B 1HI6A 3ULVE 2DYPA 4ZUUA 1INQA 4JZNB 1ZEAL 1PD6A 4MNHA 5T3XH 5IB2B 2XA3A 3NCYP 2ZPKL 4LVNB 2F8VA 2YRZA 4R9HA 4KDTC 4LCIH 3K2MC 5D2NA 3T0EA 2WINA 3WNOA 4OZFG 2A74A 4OI7A 4Z7UF 3QFJB 1AGFA 1J12A 1VFOA 5EWIH 5I6XB 3O8XA 1KBGL 2LU7A 5HPOA 1MCOH 4HWZB 1S7QB 4OCMC 3FAXA 5DVOA 3CFDB 4ZO9A 4PGDA 2GTWA 3RWFA 2GY5A 5F1IA 3ZYZA 3U46A 1EXUB 2VTFA 1E6JH 4MQXD 4EI5A 1P69B 4AIZA 3P4LA 4X8JB 1QO3A 4D0CB 1RZFH 4JFPB 4RGOH 4WFGD 3LPGA 3S34L 2FL5A 3IDMA 2XPGA 2Z92B 5IBLD 3JV0A 4HGMA 4Y4FB 2DQJH 5FA4B 4XRCB 1BFTA 3ETBF 1G0XA 5C0BA 3OKKB 5A3IC 1G84A 3TYGL 3RVXD 4W81A 3A67L 4XC1H 4EQ3A 5D71H 3MUHL 2YD2A 2YPKA 1Q72H 3IGAA 3U0PA 2R1YA 1ED3A 4DFIA 4XMKH 4DZBB 1LWRA 4MLIA 4OZIE 3HR5B 5KOVC 2X4NA 3DX6B 3R1GH 4NNYA 5DJZB 4E41B 1Y0LA 1FJ1B 1IGJB 4FTVD 2NW3A 1CS6A 3H9HA 2BERA 3VG0H 4MJ4A 1LP9A 4ZTPH 3B9DA 3CH1B 1K6QL 1CICC 3UYOD 2ZWLT 4XPTH 5TE6L 5D96B 1TQCC 4PRID 3O3UN 5FCSH 4G8FB 4F9LC 4UNUA 1QRKA 1ODAA 1EO8H 3QUYD 4FXGB 4O00A 2EKSB 2EECA 4LSQL 1GGBL 2JK5B 5DJ0A 4OLYH 5EA0L 1Q1JL 1F6AB 4PJXA 1G1YA 2ZUXA 3CJJA 1W0WA 1CR9H 4ZQKA 1QR4A 3WIHH 5I8OL 1F4WL 3O3EB 1QBMH 2Z93B 3MBED 3MYJB 2A0LC 1RIHL 4PRPB 2QHLA 3DURA 5HGDA 4YXKL 4RWYH 1BAFL 4R3SB 5B38A 2NY3D 5I17A 5I1IL 1B0RA 4UT9H 5J6GB 1LO3L 4I2XE 5JUEL 4ERSH 4QXGL 3OAUL 3FOMA 2IAMA 3IFLL 1HOCB 2B0SH 5ICXA 4RISH 5ENWA 4WY7L 5JR1H 3TGXA 4FFYL 3U6RB 4MAYD 4H1LG 4UDTB 5FV1L 1UA6H 2QSVA 3MV9B 3LY6A 2OI9B 3OJDB 3A6OA 1NUDA 1I7TA 3I6LD 2H6PB 4HPYH 5EOQH 4ONGH 4IJ3C 4MCZB 3SY0B 5HI4D 2H1PH 1KEMH 2P5EE 4PJ9C 5HGGS 5BMFL 5FYKU 1DN0A 3HC0B 5DJCB 2AEQH 3NA9L 5AZEH 1CG9B 4GG6B 1S7SB 4NZRH 2VLRE 4WDIB 4HHAB 1NGZA 1AR1D 2IJ0C 1JWMA 1T1ZA 3OKYA 4YXLH 4OQTL 1WT5A 3VGDA 3CFBB 3NTCL 5DS8B 2NW2A 3ZYJA 4RMVA 1U8IB 3PWNA 4JANB 2VZUA 2R4RH 3MOBH 3GBMH 4HWBH 5JZ7D 5I71B 3MRGA 5DD1L 4Z7OF 2NXZC 5FDYA 5A2JH 3H9YA 5EUKB 3QH3B 1YEIH 2G5BB 3RU8L 5DYOA 3U1SH 2DKSA 2FJFB 1V3MA 3RRQA 3AAZA 3DYPA 1OW0C 5F93C 3WFHB 4ZS7L 5J1TC 4BK5A 5K9OB 3SE8H 1J8HE 3KXFB 1TVDA 1S9KC 1A6AA 3ARUA 4DWHA 3MZTA 4KRMB 1MJUH 1UZ6E 4TUJA 1WTGT 3VCLB 1CGSL 4PJ5A 1FAIL 1JJUA 2A6DB 3TH2T 1JN6B 4NRZA 2EH8H 5D1QB 5E6IA 5JHDE 1EERB 1F13A 3W39B 1NCWL 1IL1B 3D6GA 4PJIA 2FZ3A 1ZWIB 4WFED 2O61B 4JFYB 4EUPG 2PYED 1X5IA 4BH8B 1AY1H 4JDVB 3AY4C 1JYXA 4O58H 2IQ9L 5JOPE 3ZKND 4DK6A 2R1XA 2UZIL 3GSQB 1A7QL 4XCEB 3NCFB 4CAGA 3HMXH 3TV3L 4NPYB 3HRPA 3INUH 1KIPA 1A7BA 2QSCH 3TZVD 1MCLA 2VR5A 1BFVL 2WBJD 5EPMA 1DQQB 3QNYB 5GQBA 3P73B 5LQBH 3RTQC 2EIDA 4WI2A 3V0VA 2ADIA 2GJ6A 2XWJB 4G7YH 5D2LF 1YJDL 5D7IB 5D7KE 2YUXA 1X4XA 3VXRE 4MVBC 2RHEA 1IEBB 1J88A 1NKOA 2NY2C 3IYLW 4Z77A 4YX2L 2NTFA 1CXHA 3ZO0A 5AYUH 1JE6A 4JFEB 2W9LA 1DSFH 1IBGL 1CLCA 5TE7H 1JZ3A 3IS1X 4W68A 2G9HB 3Q6GH 4YDKH 4PRDA 1UKSA 3VXQA 3BKCH 1J1PL 2W9DL 3D39A 3C60A 1GZPB 4LRIC 4FQCL 3C87A 1OAKH 3BZFB 3P40A 3VGFA 5INCA 2AXFA 2BNRA 5DTFB 4NYLB 1IAKA 2EC9T 2YEZB 2CLZA 1T0MB 3NH7H 1QSEA 3VGEA 2V2TB 4GMTH 2EDKA 1BVKA 4QT5A 4KQ3L 1R5WB 1BWWA 2BSRA 1GRWA 5BS0B 4BA8A 4HW6A 4OLVL 3QIUB 5ACZA 3D85B 2X9XA 4HJJH 4KI1A 5IB5A 1WC7B 3OR6B 4GKNA 4DGIL 3A6CL 5JOFA 4AK1A 5CD5C 4S1DD 2YMXL 2VZ3A 1RZKC 4OCSL 2G60L 1AC6A 4QNPE 1YECH 1T7WA 4G6KH 2MTPA 5J9PA 5SWZE 4OJFH 1GCFA 4QEGA 3GJFB 4PV9A 1AGDB 3FN3A 5MENA 3VMOA 1U8JA 3SKOB 1BBDL 1I1YA 2C1PB 4PY8J 4MAUL 5ILTL 5EN2A 4NKOA 1HHIB 2JB5L 4JJ5B 3SCMD 1NGYB 1X9QA 5EZJA 3VGAB 3RWIA 4MXQD 2Y25A 2EXWD 1H3VA 3G6AB 4L8DA 3EYSL 3WDIA 4JFXB 1RFDH 4LOUD 5L9DL 5GRZA 4NUGH 5IW6B 4HBCH 1UADC 4GW1B 3C9NA 5GRXG 1NAMB 4LCYB 4Y16A 5EG6C 1OGTA 3LD8B 1H5BA 1WIUA 4JPVH 3IJHB 3F7VA 4CVZB 4K94H 3QQ4B 4Y2DB 4H1LB 4AENA 4XCNA 3PNWA 4POYA 4CN6A 3C08L 1S7WB 1T5XA 3RVTD 2GQHA 1HWGB 3G5YB 4Z5RA 1NEZA 4MA1C 2PUQT 5CJ5A 5EOCJ 1G9NL 1RHFA 4O02H 1R5VA 3O81A 2A1WL 4NJAH 3HUJF 3DMMD 4O2CA 5KG9B 2HVJA 1QBBA 1RSFA 4P23B 4QWWC 1LILA 4M3KB 2ICWB 4K3EL 3MROA 4WEBL 3V5DB 2R0LL 3VWJB 2NZIA 3UMTA 3TFKC 1T2JA 2ZNWA 2JIXD 5T1DH 4ODUB 3BE1L 2JJTA 4OZGE 4C58B 1DLFH 1HH9A 4KRNA 4NP4H 2X4PB 5LGKA 2HWZH 3SJVA 1OTUC 3MV7A 4KZEL 1JNNH 5C6WH 2IPKB 3O0RH 3QHFH 1UVQA 4NN5B 4M5ZL 4YE4H 5CJBA 1ZT1B 4L8BB 3T65A 2A6KA 3GIZH 1KB5H 5I75B 5MHSD 1KB9J 2V7HA 2ATPA 2YPLD 4H20H 1S3KL 1DL7H 5A43C 4KK9C 4Q9CA 3RZCD 3RIAF 3F65A 1OT1A 2BNUA 1D5XA 4R96B 1BOGB 1LMKA 4XBGA 1SYVA 5EOTB 3UYRL 3MA7A 1QPPA 4GRLC 2FBJL 2JKXA 3VXMA 4K9EL 4K8RL 1E4WL 3MYZA 3LIZL 2FX8H 5FKAA 1NLDL 1PEZA 4F57L 4YDJA 1XZ0B 3DECA 3GO1H 4OLUH 4TVPH 1VFMA 4AEHL 5IFHH 2DMBA 3QEUB 4I2XB 3C5ZC 2GCYA 2C7UA 4XBPA 3V6FA 4P59H 4G42A 1PG7L 4OB5H 4JE4B 2BC4A 3Q5OA 1UXWB 4X7DC 1ND0A 3PWJA 4N68A 1MFBL 1LK3L 4U6VH 4L1DA 3IF1B 1GIGL 1QVOA 5F7FA 5D1ZB 4GLRH 3TNMB 2X89D 2PTUA 3X14A 1UACH 3V4PL 2P5EB 1EVUA 3PXHA 2DJUA 1FNEA 3W5NA 4LDLB 3HLAA 1WISA 2BY0A 2A9NL 5MEPB 3S4SB 1DQJB 1MRCL 1F11A 2R9HD 2VLRB 3MJGX 3EJYD 4F7MA 4PTUA 5I1EH 3VXPA 2O5ZH 1U3HA 1MFEL 4QTHB 3GMOA 3IJYB 4X7SL 5HD8D 4MXVE 3KNBA 3ALWA 4POZC 4GXUN 2Y36H 3SDDB 2BHYA 1CL7L 3VFMA 1UM6L 3CDGA 4FZEH 5GRWA 3WSQH 4CUCA 5E2UH 3TBTA 4QRUB 2X4OA 1P2CA 4GW4B 5FECA 4ODTH 4HCRA 3JWNC 1MHHB 4B50A 3H9ZA 4OAWA 5GISL 1J8HB 4JPWL 4ZUVB 1FORL 3L7EB 1UCTA 5B8CC 3HRZB 2E27L 1YYLL 1ZSDB 5DGRA 3RWGA 3P9WB 4WWKC 3UAJC 3NGBC 5ABDE 4YXHL 4BKLB 4ODVL 2F5BH 3QXAA 2D03H 1F97A 1KJ3H 1RJLA 4FQIH 1QFWI 5JHDB 2YUZA 3I9GL 15C8L 5LGHL 3QCTL 5C0JA 3ZDYF 2WUCH 3QQ9D 4BQ8A 3ARYA 4H5SA 4JY5L 3V0WL 1MWAL 4L4TA 4CU8A 1DUYA 2MOVA 2FEEL 4U1NA 1U8MA 3MNZA 2IBBA 5J1AB 5TDNA 3P4NA 1KTDB 2I60L 4LPWA 1U8PB 3ARDC 2QQKL 2W65A 5JIKA 4HIXH 3MJ7A 1JYWA 2ESVA 1FZJA 1MQKH 1I9JH 3TCXA 4BFEA 2OJZL 4Q0XH 5JW4Q 3BVNA 5AEAA 5DRXB 2DTMH 3BIBX 4FQ2L 2EE9A 3BISA 3LHPH 1EIBA 1DQLL 4HIEB 3MLVL 3Q5TA 3CC5A 4LIQH 2IFGA 3L3JB 4M6AA 1P7KA 3MGOA 1OF2B 2X40A 1GSMA 5F7EH 3EYQD 3MPCA 5IK3A 3P11H 2YPVL 1B0GA 3IKKA 5ANMA 1K8IB 1D9KA 4MNQE 4UTAH 4FNLH 4NHUA 4NWUL 3JWOL 4GUPA 3W0WD 3FL7A 3RIAK 3MLXH 3HNSL 3K1KC 4LBEB 4GT7A 4JG0L 3ARSA 5GGSB 3TPUB 3WDHA 4L4VE 4QGYA 3VMNA 1MREL 1S9YA 1KCSH 1N2RB 4OLXH 3F8UB 1KXQE 2MQ0A 3AMKA 3DVNB 4U2ZA 5I1GH 1DVFD 4M02A 1TVHB 2DTSA 1T5WB 4JFOA 4LHUG 4X0KB 4WHDA 3MLWL 3QA3A 4Z7QE 4NQXB 5C08D 1RULH 1DBAH 4Y1AD 4AH2B 1BQLH 1H3GA 5F1NB 2APBA 4PRNA 1EHXA 2ZZUT 1TQCB 4JHAL 4P5KA 1IKFH 3DJ9A 4X6EB 3X13B 2Y4SA 2CRMA 3LZFL 3H9SE 4LMQE 4CN4A 2DQEH 2UZYB 1FYTA 3OF6A 2CUHA 4J7RA 5CGYD 2MJWA 2OTWB 3RVWC 4FP8H 1A3RH 5SWZB 1W72B 1F45A 2K9UA 2XKNB 5CAYB 1HHHA 1RZ7H 3CFJB 1NDGA 3QEQA 5J3HD 3KLAA 4WV1A 3UJJL 1BIIB 1JWSA 2BXZA 3QWOB 4AEIL 4JN1H 4NQSA 1E27B 4YEFA 2I25N 4XB8A 1KJ2L 4NC1E 1DQDH 3EFDH 1JGVL 5E8NA 4GJTB 3QJFA 4P5MB 4ZFFB 3KPSD 4OF7A 1JTTA 5C0GB 2VLKA 1D6VH 4YDIL 5BVJB 2CGRH 1MRFH 4GO6B 2COQA 1J0KA 3NAAH 3V5HB 1WBZA 5T1KD 4R4BA 1K5NB 4X99A 4PJ8C 3LKOB 3SDXA 1KPRB 4PJ9B 1XF3A 2G2RA 5DEGB 3CMGA 1XF2B 4MD4A 1JGLH 4HFWA 5I8KH 1X5FA 4HUUB 5CZVH 1I9RL 2F54E 1HHKB 3IDNB 1A0QL 1P4BL 2D7OA 4LSVH 1QFUL 3RX5A 3JVGC 1I1AD 4JM2F 2G75B 2IFFH 1JZ7A 3CDCA 5ESVA 3K46A 4NGHL 4BZ2H 1YNTA 1PZ5B 1CGVA 1PBYA 2VXUH 4HS3A 2YD9A 5K9KA 3LN4A 4XMLH 5IG7B 4P2CG 1CCZA 4WFFE 3LKPB 5CUSL 1W8NA 4PJFF 3DROA 4YLQT 1RU9L 1H3PH 1CK0H 1VKXA 3KPOA 4LPUA 2NXZB 5ALBL 4LSSH 4OZGB 2DQTH 3KLHD 3CSYB 4EXPX 1CE6B 1U93A 4QKXB 5JW3H 5MEQA 2YBRB 4U1SB 1JMZA 2WIMA 3BKML 3QXDB 4X4ME 2VITB 3OJMB 2JJSC 1S9VB 3U2SA 1LK2B 5GGQL 1R3HA 1BQHA 3PWPA 4DKFL 5I76B 1DE4A 4HKJB 1Y18B 5IESL 5T33H 4U1JB 3GSVB 4HK3J 3P9LB 4ELMF 1WZKA 1F6FB 4DZ8A 3QEGL 4WHTA 2MPAH 2ZKHL 1OB1A 2WUBL 4X7EC 5JQ6H 5DD6A 3EYOB 3NMEA 1UB6A 1TIUA 4DW2H 4NO5A 1KJMB 4QY8B 4XNQA 3DNKA 4BSVB 2D9CA 1B4JH 5J89A 3B6SA 5BRZA 5GRYA 5TF1L 1V7ML 3CLEL 3STZB 5SWQA 1BOYA 4HG4J 3RTQB 1RUMH 2WW8A 4N0UE 3M17A 1XR9A 5IBUG 4PG9B 2PYEB 5JPMA 5D2NC 4QHMB 5DT1L 3T0EC 3GSNH 1OTTC 2CK2A 4XP5L 1HILB 3I02A 3WFDL 4RAUB 3O8XC 4MLSA 1TZHB 2X05A 5T1LA 1N26A 5EFIA 1ZA3B 4B0MM 3NVQA 4JO2H 5EU5B 1GZQB 2XQBL 4K7FA 4LSDA 4EI5C 3MLUL 3RWEB 5IFAH 4Z7VF 3FRUA 3L9RA 4DAGH 2Z31D 3LEVH 3TBYB 2F19L 2M26A 2JJUA 3GMQB 4X9GA 3IRZA 4LKCA 1KCVL 1J5OH 2YN3A 3A6BL 4N0CD 5F72S 1I3GL 3BP7A 1NFDF 4HV8B 4G5ZL 3OGCB 2EYSA 4F7CB 2UVEA 1Q9OB 4HJ0D 1U8KB 3AMLA 5EUOE 1II4E 4Z95H 1T7YA 2FHCA 5HSFA 5K9JH 3SDCC 1ZA6B 3NCJH 4YBHA 3GMLA 3DSNA 3IJSA 2J6EL 1NCCL 1P9MA 5DFVD 3ZL4H 1DANU 3C5JB 1DLHB 1YEFH 2X70A 2FH8A 1A5FL 2AEIT 3IFNL 1AE6L 4OTXH 4GBXA 3IXAB 3VH8B 2R2BB 3UTZB 2KKQA 2KBGA 5HGAB 2HLFD 5DI8A 1F4YH 1SVZA 4M7ZC 4XP9H 1UFUA 1JP5A 3F6LA 3P9MB 4XP1L 5IV2B 4JO1L 4PJGE 2NX5D 2FD6H 2YK1H 4EUPH 2E9IA 2EDOA 3TT3H 4QRSA 2Y07L 2Q76A 1NGWA 2Q6WB 3WUWG 1EGJH 4G8IA 1RUQH 3O2DH 5IJKA 1Z0MA 5CFHA 3OBAA 3QIBA 2VDKL 5D70L 1XGUB 3NCBB 3MV8E 4JY4B 3JWDH 4HZLA 1JVKA 2IADB 5IM7B 2BVOA 2AEPH 2EIZA 5IF0B 5KVEL 4IDLA 3ZSSA 2VXSH 3HS0B 5CEZE 2IALB 3S35H 3GNML 3OB0K 2Y6SC 4PJAA 3RPIA 2IAMC 3N1MC 4W6WB 2RR3A 5CSGA 3MRLB 2QHRH 4FQJL 5KVMC 4GQ9H 4NQDD 1I9IL 4MA1B 1ZANL 1JGUL 4M8QB 4I4WB 4N8PA 5EO0A 4XNMA 3RWHA 4KJYB 5FGRA 5KTEH 1TVBB 5JIPA 1P4IL 4MNQB 1FNSH 1VFUA 1FLRH 1R5IB 5I1CL 2BVYA 4M43H 4IRSD 4XCFL 3NN8B 4L4VB 2R0ZL 5BVPL 1CXFA 1TZIB 3PHQB 5KOMC 3ARBD 3U4BL 5GSRA 2WBKA 1WT5C 2OP4H 2DBJA 1MFCH 5I74C 4LLWA 4PJ7A