5DFWH

Crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment k13
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
222
Chain Sequence
VRLHQSAAQLVQPGASVRLSCTTSGFNFKDSYLHWVKQRPAQGLEWIGRIDTGNGNVKFDPKFQDKATITTDIPSMTAYLHLSNLTSEDTAVYYCVPYGYGFHSWGDGTTLTVSSDIQMTQSPASLSVSVGETVTITCRASENIYRTLAWYLQKQGKSPQLLVYGATTLADGVPSRFSGSGSGTQYYLKINSLQSEDFGTYHCQHFWGTPWTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CD81 antigen
publication title VH-VL orientation prediction for antibody humanization candidate selection: A case study.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH02
5TJWK 4CVXA 4LDEB 3U79A 2JJSC 3V52H 4PJIE 4G8GE 3WJJC 1V3MA 1XFPA 1JPTL 4PRHE 1UACL 4CVZB 2GJ6D 3GM8A 3HZKA 4F2MA 5E2VH 5FF6A 2DLFH 1DQJB 3O9WD 5KS9A 1LE5A 4FQXA 2R8SL 2EKSA 3BE1H 1C1EL 4YBLC 3TVMA 3Q2CA 1A7OH 3GSVB 2EXWD 4PJXB 1KJ2H 4QHNA 3QNZA 3SJVA 4EI5A 4HUUA 1HI6A 1RZKC 3O2DL 2A77H 2PTVA 5EBGA 4N68A 4LSPL 4JFXB 4LPVA 2EKJA 4WUUB 4OCSL 5C3LD 2H2PD 3TIDB 3KPQA 4OTXL 5CGTA 2KQMA 4NKMA 4NO3A 5I18H 4XWOC 4MS8D 3BSZH 5IB5A 2A74A 3X3FH 1IM3B 1IAKB 2NTFA 4X6CE 4YDKH 1IFHL 4APQD 5IW1A 1DBJL 1F6FB 3O8XD 3MJ9A 4RX4A 2DQTL 1NJ9B 5CHNA 3RVTC 3O6FC 2G75B 2B4CH 3QP3A 3LQZB 5IP4A 2ATPA 5C07B 1YY9D 1DEEB 5EPMA 2Q1EA 3VWJD 4K7PL 4X6DF 4N8CH 4LBEB 4HJJH 4O9HH 3L5IA 4GMSH 5AZEH 3IDMA 1I7ZB 2BY0A 2X1QA 3QRGH 1DTUA 4NO2A 4PV9A 4YC2C 4Y5YB 1I8KA 5IOPB 4Z7VA 5FM5O 1T1WB 2MTPA 5I1KL 4JO2L 1E6JL 2YD9A 3RWIA 1G6RH 2EDHA 5F7MC 3PQYA 4OIAA 3SDXB 3GMRB 1JV5B 3U9UA 3BGFC 4O4YL 1R5IB 4WFGE 1SJXA 3VMOA 3PL6B 1RV6X 4YDIH 1SEBB 2YD7A 4JJHA 2X4QB 2BMKB 4CADA 1MJJA 3P9LB 1JGDA 2ZOLB 2YR3A 3QPQD 3TT1L 3E3QE 4U49A 2PTTA 4YBQD 1X5IA 5BXFA 2BSTB 3TJHD 3BQUD 3BIBX 5EU7E 2QQLL 5J11B 3VGAB 2MKWA 1PKQB 5ELIA 2P47B 2Q20A 5HXMA 3OXRA 5ADPH 1J0JA 1Z2KA 4IIQB 3IYLW 1FSKB 4MNGA 3KYNB 5CP7B 2UZIL 4P5TA 2EO1A 4HLZH 3C2AL 3WE6A 5JUEH 4ZUVB 3V6OC 1RVFL 4AT6B 5BZDB 4UNUA 3R8BB 3QJHA 1YJDH 1GC1L 4G6AC 4JFDA 1UCBL 4CUCA 1XF4B 1BFOA 2BVQA 4GAYB 1WICA 3TN0C 4TULL 2IH3A 5DD0L 5H37H 5HPMB 2P5WB 3D3VA 4PUBL 5GGQL 3RJDA 4YXKL 1OGAD 4LLUB 3UJIH 4XPAH 3S36L 1YEHL 2EE6A 3TH2T 3I6LD 4ETQB 3VCLB 1CLCA 1IGFL 3AAZA 1GAFL 4JB9H 5C0FB 4KY1H 3HZMA 5TE6H 3U0WH 2DL9A 3MLZH 3QEQE 4X8JA 5HYJD 1RUQH 3ZKQD 2X42A 2HTLD 1KXQE 1FYHB 4J2XA 4F7PA 5B39G 3JWOH 3HAEB 2AV1A 3F7VA 3TWCL 3B43A 3GMLA 4BZ2L 5JW3L 3RVUD 1TQBC 2YPVL 1FG2B 1UWGL 3FCTA 5ALBL 3GRWH 2X4SA 3CSBA 1YNKL 4P9ML 1KTDA 3FO0H 5FM4A 1KEGL 1NMCB 3L5WB 4U3HA 1J0HA 1RZGB 3REVB 1A3QA 2AVGA 3QI9D 4I0CC 1G9ML 2N7BA 3DUSA 4LCIH 4Y5XA 3VW3H 1X7QB 4ELMA 3P0GB 4L3EB 1EFQA 3MV01 1FORL 2I07B 3MYZA 4NBZB 3VMNA 3CIQA 3ROLA 4XP4L 4E0RA 4Z7VF 1IGTA 1KIUA 3UTSD 5LKNA 1LQSR 4JG0L 5BCAA 3DTXB 4JQIL 5HHPA 3RAJH 1N4XH 3GKZA 5HYEA 2IADB 4U1KB 5AG8A 4U3CA 1MUJB 1NCDH 1HQRB 1BVLB 1PG7X 4S1RH 4ZFZB 2CRMA 5GSRA 4J4PD 3BWAB 1S7SB 5HHNA 5CD5D 5D72L 1JNHB 4Y4FA 3X13A 1P2CA 1RZ7H 5E9DB 2XZQL 4JHZA 3NZHH 3MV11 4JN1L 3WSQL 5CZVL 3ZYJA 3CXDH 1I3RB 3EFFB 5L0QC 2ZUQC 4RRPA 4G8FB 5IMKB 4NQDD 3C5ZD 1R24B 3PP4H 5FGSA 1NAML 1T03L 3TCXA 5CSBA 2WWMC 4N5EC 1EEZB 3STZB 1JCKA 3VXRD 3D2UB 3OAUH 4QTHB 1Q0XH 4NM4L 4HWNA 1MF2H 1VEPA 5T1DL 5BW7A 1WISA 4YIQB 1QEWB 3QXAB 2C7UB 4WO4D 5F70A 2OP4L 1J18A 2CIIA 1HDMB 4TQEH 3DX6A 3FAXA 4KKCC 4PJDF 5GHWL 3RUGA 2HFFA 3HG1B 4XVJH 2GT9A 4OD2B 4P99A 1NFDA 5DJDB 1MWAA 2PYEA 3CFCH 3QHTC 4J23A 2VXSH 4PV8B 3RY6A 3UP1A 2Q6WA 1W8OA 5I19H 1IEAB 3MLPA 2R1XA 4Q7DA 4LLVB 4OCXH 3RWJB 4Q74A 1GIGL 4KK8C 3CX2A 3DVNB 4PJEB 3MCKB 1IKFL 3BEVB 3RVVC 4F7CA 3HNVL 4K7PY 1YY8A 4XMKL 3EYVA 5INCA 4ZOBA 3R0MA 5JOPD 4C59B 2FGWL 3DYPA 2AABH 4TUOB 5HGAB 1F3JA 4LKCB 3SQBA 1OAKH 4RCAA 1JGVH 3BKYL 5CBAA 1L9MA 1TCRA 5BZWB 1WEJH 5I30L 5FUCC 4YWGL 5TE4H 1OP3K 1RMFH 3S37H 2Z31C 3OB0K 3TO2B 4RQQA 3ARFD 3QZWB 3VXMD 2DYPD 4KUCD 3EYSH 4WWKA 1NUGA 3NTCH 5DVNA 4XNXH 3U6RA 4BM7A 2RQ8A 1RUML 2JELH 3A6OA 4TYUA 5EOTB 4OD3H 1UVQB 5EBLB 4LHUB 3T3PE 1S9YA 3RTQC 3QNYA 2FJGA 1A6UH 1CN4A 1WIOA 25C8H 1DR9A 3V79C 3T4YB 5ICYB 2XIDA 4QRTA 1R5VB 4NC0B 3PWPD 5I0DA 3B9KC 1BP3B 1WVZA 2BOCB 3VFSA 5FB8B 1J86A 3CZJA 3DURB 4MD4A 2NLJA 2VDMH 5J9PB 3ULVE 3O6ML 1JHTA 5D2NE 1MRDH 2G5BB 3SEPA 4QRRD 2PCPA 5CAYB 3KGRA 4M1GL 4YUEL 3FB7A 4U33A 4QHKI 1LO5A 3QFJB 2GCYA 4EBQL 1B0GB 3RVTD 5J56B 2L7JA 5HYIA 5E2UL 1P7KA 2W0LA 2F8XC 2F5BL 1F5WA 5DRXA 1OP3H 4EDXA 3HCVA 5EOQL 1KT2A 1DQMH 2ADGB 1MHPL 5FFLA 5D1QA 4RBPH 4P9HC 4TOYL 3C8DA 3RUGF 1CL7L 4OCNC 5D70H 2BSSB 4K07A 3MLTB 5DF0A 4J6RL 2DTML 4KJYB 4AIZB 1YEFH 3BXNB 5C0JB 5GGRA 4OAWB 3PXHA 5BO1H 3O3UN 4DZ8B 4HKZA 4MA8H 2CSPA 4U7MA 2XNAA 1T20A 4LCCC 3TBVB 2XI9A 5HGHB 5D7SL 2GTWB 3MV7A 4XGZA 4CJ0A 5B8CA 1LWRA 4OQ1A 5EB9A 1EHLL 4Y4KD 1QR1A 4ZUUB 4F7TA 5FV1L 3QDGE 3CFDA 3G08A 4XPGL 2R23B 3VDAA 2QSQA 1A7NL 1U3HB 5FGRA 4PGJA 9CGTA 5DJ2B 4HLZG 1S5IH 3N0PB 1MHEA 1IEHA 2Z92B 1EHAA 5CEYA 5F7HA 2OYPA 3T8XA 3X14B 2CLZA 1CGWA 3OWEA 5M94B 1CXEA 3MLUH 1MVUA 1LK3L 4YNYB 2E6QA 2OBGA 3RWEA 5D7LB 5JHDB 3C8KA 3S35L 1VFUA 1CQYA 4UTAH 1NGZB 4LF3A 2APTA 3Q5YA 4ORGA 3RY5A 3QIWA 3W9DA 5ACZA 1SJVA 4P23C 5H37G 3ZSSA 1YUHB 3UEZA 3VFGL 4X80L 1QLFA 2MSPA 1AE6H 3D0LA 3DXAA 2OJZH 2YXFA 1A1MB 1T2JA 4Q6IC 4KQ3H 4G6AD 1QFWH 1OAQH 5C0NC 4G43B 5CMAA 4PY8J 3NACL 3TN0D 4IS6B 1G7PA 3PABA 5T1KA 4OZHB 3WIHH 3P73B 2WUBL 4PGDA 3BZFA 2LV4A 3LEYH 4HBCH 5IHZA 1HEZA 1A6WL 3OKYA 2EDTA 3GIZL 3MLWH 3CJJA 1XMWA 3T2NL 2YD1A 1BOGB 2HKFL 4LEXH 3QAZC 2XWTB 3MRHB 1QSFB 1OCWL 5E94B 3GBLA 3T0EA 3T2QA 2HLFD 1CGYA 5JTWA 3MZTA 3BRGC 3AMLA 1YEEH 3ILQD 1L7IH 4LSUL 5TQ2H 2IPUK 4FG6D 2AJYH 2EIDA 2AEIT 1PKOA 3AREC 3MA7A 4FRWA 1D9KD 2X70B 4CRPA 3T4AA 2AK4D 3Q6FA 2BZDA 4I9WD 5MP6H 5AD0B 3LRHA 3S3PA 4PRHA 5ALCL 3LMJH 3DVGA 2VUYA 4DUVA 4H88H 1NCUA 1BZ9B 2EE9A 1WBYB 4Y1AA 5MEQA 4ZTPL 1FIEA 3QG7L 5HD8D 2P8PB 3JUZA 3QNXB 4OKVA 4P2RD 2J8UE 3DMMD 3S34L 5L2KE 3CX5K 1A4KB 3I2CH 1IQDA 4QYOA 4WU5A 4GBXD 4U1GC 1FNFA 4JR9L 3RA7H 1AO7E 2IBZX 3UZQA 1RZKH 4JY5H 5A40E 5ABDE 1AH1A 2XQYK 1GCFA 1NBZB 2CPCA 3MNZA 3I3BA 4HWBL 4KRPB 1C16A 3ARVA 1HHJA 1MCJA 1YDPA 1T3FB 2H32A 5GGTA 15C8H 5DT1L 4Y5VA 1P9MA 1AXSA 1SYVB 2FJFB 3V5HB 4HIHB 3V6OE 3WL9B 4HS3A 5C0BE 1N5AB 1XF3A 2X40A 2B8OT 4I4WB 3G9VA 3QUYB 5HJ3B 3STLA 5DC9B 1CU4H 4NUJB 2UVFA 3FO9A 4QNPE 3RZCD 2YBRB 2EIEA 5HYQB 1AHWC 2DWEA 5TH2A 5EO9B 2VC2L 1TVBB 2EDWA 4GG6A 1MAML 12E8H 5I1EL 5KSAB 4JHWL 3VFTB 1RUPL 5IB2B 3KG5A 1MPAL 4Q9RL 1J5OH 4Y2DA 4TPRH 3MGTB 4HW6A 4MAUL 4XP6L 5KSBF 1BM3L 4H1LH 2YPKA 3UC0L 2E3VA 5MHSE 4XX1E 1XZ0B 2KUTA 5EC2A 4NKDA 2Z35A 4JRYE 4WFFD 4G6MH 3T2PA 3FO2B 2AXHA 5E6ID 1NCNA 3GSNH 5EU6B 3SGJC 4NJ9L 3GRWA 5E2TL 1WBXA 1FIGL 1GHFH 5K59E 4NQVB 3ROOA 1UM6L 1A6PA 5F44A 5C6TL 3GJFK 3HFMH 5E8NB 1DEDA 2VZ1A 1JGLH 4XPBH 1RU9H 4KMTL 3ZKNC 2ORBL 1AIFA 3D9AH 4XZUA 1ADQL 4LIQE 5T3XH 3CCHA 4ZXBC 4JKLA 1AFVH 1BLNA 1FV1B 5ISZE 5I1AA 3BKML 4K3GA 5FCUH 4E41B 5AYUL 2EYTB 2YPLD 4PJIF 3IJYA 1YPZA 4XNYH 2ZWLT 3W0WD 3W5MA 4GLRH 1R3JB 5CINH 2YS4A 5IK3B 4ESKA 1EERB 1SM3L 1HQ4A 2HJKA 2Z93B 1GGCL 3CVIH 4UV7H 1NGPH 4L9LA 4MX7B 1S9WB 2A1WL 5E95B 3MJGX 4OF3A 3S37X 1UA6L 3MV8B 3WXVL 1IGJA 4HGKC 5IFJA 5T33H 2ZCHL 1IM9B 3VWJA 2Y1VA 1FZKB 3LS4L 5F7EH 3PWJA 4OV5B 4TTDC 3OKLB 3HR5A 2AXGB 4DVBB 1NANH 1OTSD 1PLGL 1R3LB 1FLTX 2AW2A 4X6CF 2AXJA 2H2SD 3MCLH 4I2XE 4CJ1A 3EYQC 3MRFB 1SJHA 1JZ8A 3RPIB 1I3VA 3HI6L 2JJTA 3GFUA 2FCBA 2WINA 2VDPH 2P7TA 1YEDB 2JE8A 2H1PL 1D5IL 2ADIB 3MODL 5CWSB 3KAAA 3BGMA 4HGWB 2FSEA 4CDHA 1L0XA 3CK0L 2DMKA 1CXKA 5F3HA 3WNOA 5JDSA 4JO3L 3O8XB 5E4IA 4JG1L 2R1WB 1KLFA 5DMYA 4XCFH 3ARXA 3IS1X 4Q9CA 4MYWB 4JEGB 3BQUA 5GGUB 3EYUL 5HGBA 2R56H 1QFUL 5F72S 2B1HL 2XQBL 3MOAL 5HHOE 3BP7B 4MWFA 4XNUL 2BNUA 4GRLC 3G5ZA 4N0CD 3WDHA 2D03L 3OB8A 3KPRD 1YEKL 5DJCA 5J1AA 1HHIA 3UXFA 4GSDL 3CXHJ 1K8DA 1TLKA 5DC4B 2P43B 2A73B 3L7FB 1DBAH 1GC1C 2F8OA 5JOEA 2I5YH 4LVOC 5FYJL 1FNEB 1ZXQA 3PGFH 2R1YB 1MCCA 4PGZA 4U7KA 4U1HA 3DLQR 4L3CA 5F6IB 4NZTL 3WFZA 3CPLB 4NQEB 2P46B 4DKEH 3TJEL 1OGAA 1YC8A 1Z9MA 5EC1A 5IQ7H 4L8SB 5SWZD 3MBXL 3CVHL 1K4CA 3JV6A 3KPSD 1FJ1A 1T6VN 1ZLVK 1VESA 1CFVL 2FYYA 3THML 3V6FA 1D5MB 1M7DA 4N8VG 3K7UA 2R2BB 2HWZH 5JHLH 4YHOH 4LSRL 1KTKE 3U48A 5C0ND 1BF8A 1NLDH 4AEIL 3VXUE 1JWUA 4QHUA 5JQ6L 4M1DL 5D1ZA 1CZ8H 4YDLC 5I8CA 4B7LA 1MI5A 2DI8A 3UO1H 5CJOH 2XA8L 3LRGA 4RDQG 1BREA 2XTJC 3LEXB 4S1QH 4FQHB 1KPUA 4DGVH 1S7QB 3MUZ1 4V1DE 4DN4L 2WBJC 3QEHA 1A3LH 2HJFA 3A6BL 2Z8VC 2OR8A 2R2HB 3R8QA 5H35A 1J11A 2HT4C 3UTSA 2BHUA 5EZOL 1BQUA 3MRIA 1RIVH 4IRSA 3MC0A 4JFPA 1Z0MA 2FATL 1MCPL 2X4RA 2RFXA 2F54D 1WZLA 3IFOB 2E7HA 4N9OB 3WHE0 5HHMB 3QUXD 2CMRH 4BFIB 3M8OL 3LSOA 3PHSA 5D1XB 1XF2B 3SE9L 1FO0H 1XAUA 3QIBD 5I16A 4FTVE 4JJ5A 4U6HB 1A3RH 4J8RA 3N9GH 4MJ5B 1NCWL 3U9PH 3RWDA 3HI5H 1GGBH 3TIEA 4HPOH 2E8YA 1QYGL 3ZL4H 1ZLVH 1V7MH 2NZ9C 2DLGA 4GW1B 4LRNL 5DZOA 2VKWA 1S7RA 4X7CC 4U0RB 3UPRA 2DLTA 4FQ2H 4EI6A 1J05B 2AQ2A 5CBEA 3ARGB 4WI3A 2UY6A 1NDGB 4TSAH 4WI6A 4X99A 2XKNB 1NUFA 4Q6YA 3WKNA 3QUML 4XH2B 4AG4H 4N1HB 5CKAA 1Z3GL 5D2NA 5EH1A 2IPUG 4Q97A 2NXYB 4KJQC 3B6SA 4UDTA 1OAYL 3HC0A 4FQCL 1QG3A 2A9MH 4JCLA 4NBYB 4OF0A 3ISWA 2JKXA 4DN3L 1CFTA 4H1LG 4ZNEE 5CEZE 4TVPD 3RX8A 1MCLA 2IPTL 5BRZB 2YKLH 3MRRA 5DS8B 1YNTB 2NW2A 1H3WM 1SY6H 4H5SB 1HIMH 5I76A 1KCSH 1FBIL 4PGEA 3QDMB 4YHPA 1ZA6B 4ZFFB 2VLKE 3VXRB 3C6LC 3TH4T 1MEXL 5GS1C 1INEL 3S5LG 1FAKT 3VD4A 4L4VE 3QPXL 1DVFC 3BH8A 3WUWA 4ZAKC 4HXBH 1MQKL 1OGTB 2FBJH 1LHZA 2JJSA 4CU8A 5F9JA 1JF1A 3MXWH 5E8PA 4J12A 4OZ4A 3WJJA 1OTUD 2NY1C 2WANA 4UB0L 3QDGA 5I1HL 2OJEA 3VXMA 3DV6A 3BP6A 3NZ8A 5I73B 1CD0A 2ESVB 3VI4E 5L9DL 5IBTL 1RK1B 3NCEB 5C9JB 1BIHA 4QHKJ 1TZIB 2B39A 4KRMB 1KN4H 4GH7B 4JDZA 5IGXH 4KJPC 3FQUB 1MY5A 5FUZL 2VXQL 4NHUB 1KB5B 2VH5L 1KC5H 1P84J 1GPOH 1NC4D 1Q9WA 3N1GC 2VZTA 3OX8A 5JXAH 3NOIA 4IBLT 4JVWA 5J13C 3I84A 1NEUA 4ZOEA 4LPWA 3NA9L 4J3VA 5EN2A 1ORSB 2G2RB 1G7LA 1RUAL 5HHVL 4QRRA 5CEZH 2BCKB 3T3PF 1MLBB 1ETZA 4YFDB 3LCYA 1F58H 2VDKL 5IHBA 4LCYA 4X7DC 3P4OA 5MEOB 2BHZA 5EWIL 3U0PB 1W0YT 4HZLA 2EZ0C 1NBQA 2F53D 3IDYB 2A83A 3ARBB 3O6FA 2V7NB 4PY7B 4WJ5B 2EECA 4I0PD 4HC1H 1P5VA 4HUKB 5DYOB 3BZEA 1I85C 1KIQB 3IETB 3ULVF 2IG2L 4BELD 4R4ND 3DGCR 1U8LB 4PRPE 2F58L 4HCRA 1EK3A 1T7VA 3PDGA 3PWPB 3EYQD 3MRDB 4WHDA 5IVZB 2XKUA 1BAFL 3WFEH 4H1LA 1FPTH 1XGQB 2NY6B 3CZFB 3BH9A 4FFZH 3EJZC 2X2YA 3LKSA 1U58B 1XIWB 1QBLH 4H20H 4TSBH 2LE9A 5ICXA 2VLJD 4Q9QH 3KXFE 4MGXA 3GSNA 4RMVA 4OZIB 3VWKC 3V4UL 4HIIA 2DKMA 3BRFA 4MJID 4HKJA 3LH2L 4LCWE 2WK2A 4Q0XL 3LEVL 3IVKB 3WHXB 3S5LA 5CGYC 5L2KA 5I8OL 1FL6A 3G9AB 3SPVB 3QEUA 3MBEB 3GSXA 4PTUA 4PGCB 4B7IA 1FNSH 2FX7L 3LKNB 4EUPH 1A9BA 4UT6L 4EQ2A 4UNVA 3P4MB 1MFAL 1H8OA 1ULVA 4I48B 3CAFA 4M7ZC 3SDAC 3AUVA 2DWDA 1A6AB 4F33B 5J4MA 3BD4A 5KN5B 1HHKA 2MNUA 3V6OA 4KUZH 2CLVA 2EDOA 4JPIB 1PJ9A 5C0BA 3D0VB 4C56B 4KAQL 4WW1B 3BT2L 5C86A 5DDHB 3HNSL 5ANME 2ICEA 1S3KL 2BFVH 4TVPH 1FNLA 3TN0A 2FLBT 2R4SH 1KULA 2OL3L 2JLLA 5LGHL 4F3FA 1CK0H 4X6DB 3F58L 4Z7WE 1KUMA 4ZOCA 4AQOA 1IL1A 1MIEL 3SKMA 3N85H 2FHCA 3ZDYE 2XZZA 4XBEL 3GSOB 5CEXA 4NNYA 2VABA 1R3IL 4ODSH 2Y4SA 2V5SA 4K71C 5EZLA 4AEHH 1MHCA 4X9FA 2J2ZA 4ONHA 2HAZA 3BEWB 2BDNL 3CSPA 3LD8B 3X17A 2HVJA 1VADB 5K9QG 4KRLB 4JGMA 1UACH 2VQ1A 1UJ3C 5D6CB 2XTJD 4R97C 5D5ME 2BNRB 3VD3A 2AK4A 1QPPA 1BZQK 5CSZA 3VGEA 3GSWA 3VA2C 5CFHA 4JRWA 5CJ8A 4O2CA 4QKXB 2F74A 1AD9B 2DQGL 3MR9B 3REWA 4I18B 1C1EH 5FV2A 4U1SA 4CVXB 3T0WA 4K94L 4U1MA 3O2DH 2QADB 1XF5B 4Y19E 3C9NA 4I8DA 4LSPH 4OCSH 2GSGA 3L5JA 4OTXH 3TP4A 4BSWA 2OXHA 4JY6B 3HZKB 4HK0A 4MVBC 4F2MB 5ENWA 4U05A 2AAVA 4LVNB 1LE5B 2NY3B 2IANB 3QEQD 1EEYA 1WFNA 4NRYB 1IFHH 4FQXB 4KHTH 1DBJH 1FE8L 3ZMRA 2J8UF 1MCKA 3TVMB 2DQTH 2NZ9D 3F7YA 5C0DA 3QUZC 3QNZB 3SJVB 3WFHA 1IT9L 4PJ8D 1QBAA 4K7PH 5F9DC 1ZGLM 4JFHD 3S88H 4KMLB 3KPQB 1S78D 5E00A 2C4FU 4X9HA 3DMMB 4XAKE 3VFMB 3I6KB 5BV7B 5DJ6B 5I1KH 4JO2H 1E6JH 2XICA 2NTFB 4G8EA 1T1XA 3I75A 3DETC 1U8IB 4I2XA 4J1UB 3MCG1 5DJXB 5FYJU 4BH8A 3SKNB 4QNPF 1X5YA 4J3SA 5EPMB 3A6CL 1IKNC 2V2TB 4KROC 1JHLL 2D0HA 1DUYA 2W38A 4XPFL 4W81A 4NO2B 3UTTB 3QCVL 1VB9A 1I8KB 4Z7VB 5C0RL 2IC2A 3HNTL 3SKOA 2FEEI 2OTWA 4ZDHA 5F96L 3PQYB 3LN9A 3HPJB 1MELA 5A2KH 3C6LD 3KLSA 3U0TA 2Z8SA 4GLRI 4XNQA 3HMWL 5BVPL 2O61A 3Q5OA 2VXUL 1HSAA 4XTRC 1DVFD 2P8MB 4WNQA 3LQAL 2J5LB 2YA2A 4MJ6B 4LSQL 4ZAKD 1SQ2N 2UZIH 4I3RH 3C2AH 4CADB 1WFUA 2YPLA 5K59F 1JGDB 1RVFH 3GBNL 1NCBL 5F7KC 4ODBD 2E9IA 2Z31A 2E6JA 3FL7A 1CDIA 2PTTB 1GC1H 1UCBH 5BXFB 1BQHG 2NY1D 4P5MB 1T66C 1FO0A 3O4OC 1ZVSA 3U83A 1K8IA 1KGCE 4TULH 4UAOB 1KN2L 5DD0H 3HC3L 1F3DH 4PUBH 3DJ9A 5KVMC 3RDTC 4YXKH 5LBSL 3S36H 3UBXG 3TO4C 1YEHH 4HIJA 3KLHC 4Z7UE 4H26B 5EIVA 2W65B 5BJTA 4JZNA 3MZGB 4PJ9C 3RTQA 1IGFH 1Y18A 3TFKC 4MNGB 5ESVB 4YHZL 1GAFH 4WGVB 1NANI 2CRYA 1U3JA 5J89A 4OLXL 1T22A 5K9OB 1OWRM 4P5TB 5I71C 1AY1L 3WE6B 1P53A 1BFTA 1U8QA 4N1CA 3B9KA 4WW2F 4D8PA 3QJHB 3CU7A 3BWUC 3TWCH 4JFDB 4BZ2H 5JW3H 3S7GA 1Q9LA 2BVQB 1WZKA 2YPVH 2P5ED 5ALBH 4YXLH 1MCNA 2IH3B 1QBML 3RP1A 3D3VB 4X7SL 1RJYA 1KEGH 1Q9OA 3W0WB 2A38A 5IW6A 3U7WL 1TTUA 1BJ8A 3OR7A 3AAZB 5GXBB 3BIAX 4ERSL 3HZMB 1FORH 2ITDA 4U2YA 4M6AA 5E03A 3P9WB 4XP4H 3VXSE 4F7PB 4OCYL 4DJMA 2PYFA 4JG0H 4M7LT 2AV1B 3MOBH 3O3DB 4ZS6C 2GITA 3VXPB 2BHYA 2CKNA 1SY6A 2X4SB 1XCQB 2A0LC 1I7UA 2AI0L 5JW5B 2K9UA 1KTDB 4LSVL 2X89A 3SO3C 5GSVB 3DUSB 4Y5XB 3FZUD 2GY7B 4ELMB 5D72H 4OJFL 3NCJL 4OUUA 1CVRA 3K4ZA 5F7FA 2XZQH 2DQHL 3ROLB 4FTVA 4JN1H 4OF7A 5CZVH 4LCCA 3WSQH 3V8OA 1IGTB 4IDLA 3VWKD 4EUPG 2A6JA 3MNVA 4G9FD 3W39A 1NAMH 1T03H 4F15C 3CFEA 4EJ1C 1UWXK 3WDIA 1TETL 5GRUL 2A6DA 5GSRB 2Q7YA 1MCOL 4NM4H 4PP1C 5J12B 3O4LE 3X13B 5T1DH 1P2CB 2DJSA 5D8JL 4XP1L 5HI3C 2E7CA 2AQ3A 2OP4H 5IUSA 5A2LH 2VIRB 4P23A 5F1IA 5SWZA 5GHWH 4RGMC 1T7YA 3BDBA 2R2EB 2WQRA 3VRIA 5ID1A 2OLDA 3M17A 1I8IA 2BSRA 1XCTB 2LABA 4H0GA 5I0ZA 1GGUA 4I77L 1GYAA 4Q6IA 3BDXA 3GEWB 4YH6A 1GIGH 3GK8L 4OKDA 4XCCL 5IB4A 1MNUL 1U95A 2OTUA 2W0KA 4PRID 3HNVH 5JIIA 3ZE1E 4XMKH 1JGUH 1CGSL 3H7BB 1RY7B 2DI9A 2FGWH 4L4TA 3T0AA 4IOSD 4JFEB 3DX6B 2XZAL 3WXWL 4OD1L 3RUGB 2HFFB 3OSKA 4KI5C 2GT9B 1FG9C 1MWAB 2PYEB 1UH2A 3BKYH 3BYTA 3ZKXC 1JIBA 1KPVA 2VLKA 2Y6SC 4CMHC 4MSWA 1D6EB 2F19H 5GZNC 2R1XB 3H9SE 5I30H 5D4QA 2D7TL 5FYLL 4ZMAT 1ES0B 4JLRA 2L4OA 2Q8BL 4PJCA 4JPWH 4F7CB 1VKXB 1OSZA 1CLZL 2Z4QB 1VFAA 2F54A 4H25B 1LP9A 3QRFM 4KZEL 3AREA 3EYVB 5GS2D 5INCB 2ZPKL 4AENB 6CGTA 4PRNA 3WIIL 1RUMH 4Y4HD 1F3JB 5TPWL 3TYFB 1G7QA 2P24B 5DURB 1W72L 1T80A 4HXAL 5E1HB 5CBAB 1TCRB 5KTEL 4G6KL 5GIRA 5L6YL 1MFCL 4NYLA 3BGAA 4RQQB 1JZ7A 4OLWL 4N90E 2NXZC 1RURL 5E8DL 1WBZA 3JTSA 4F7MA 1QSEE 3NAAL 1OD7A 3R06A 5HHXL 4UQ2A 4BZYA 3T77A 1JTOA 3ARTA 3RGVB 4FNLL 4EXPX 1CTOA 4PRDB 4M1GH 4YUEH 5GRJL 3QHFL 3F12A 1X5JA 5C92A 4L5FL 3IT8D 5KG9B 4EBQH 3QNYB 5KANG 3QUXB 3VGFA 4BQ6A 1SMOA 2EICA 5DK3A 3DWTA 4JFQA 4QRTB 4XCYA 5E2UH 3P4NA 1IEBA 1I7TA 2VR5A 4JFYA 2F5BH 5FIEA 4PS4L 5MEND 5D7IE 4MD4B 5EOQH 5IKCA 1AHWA 1MHPH 4MA7L 5C9KA 2X4NB 1TMCB 2E7LC 4TOYH 3WD5H 3RVWC 5DI8A 2G5RA 3RPKA 2PCPB 1JBJA 4PJ7E 4J6RH 2DTMH 3FB7B 1P1ZB 4PTTA 1LO5B 1T04A 5C0CB 3PUCA 1RQ5A 3CH8A 4R90L 5FOBB 1ZVHA 1P7KB 3QDHA 5D7SH 2FO4A 1EPFA 4XP5L 4U1IA 4P2QD 3LB6D 5ESQB 1EXUA 2DQIL 4LLMB 3HCVB 3SGJA 5T3ZL 2IQAA 3BFOA 3QSKB 5D1QB 3HLAA 4F9LC 5TQ0L 4NCC2 2MCPL 1A7NH 4KVCL 2DLIA 3OXSA 4LCWA 5CGMA 3UYOD 4HUNB 1XGUA 4L8DA 4PYHA 1B2WL 2BVTA 2ENYA 2H45A 3TGXA 4BKLA 4NRZA 4OLZL 4ZXBA 5M7QA 3PV6B 1LK3H 4DWHA 3CNKA 1J7VR 3S35H 2O5YL 3UBXI 2XNAB 5C09E 1T20B 4XGZB 3VFGH 4X80H 3TT3L 3VH8B 5B8CB 3AM8C 4HF5L 1D5XA 2IMMA 4CDGC 1JN6B 1ZHKB 1NC4A 3OF6D 3C8HA 1TJIH 3FOMA 5HI4D 3WNNA 1T66D 1MHEB 3NACH 5IBUB 2GK0B 5CEYB 3VI4F 3T8XB 3ME0A 1IC1A 5TF0A 4IRJC 1MVUB 5MHSD 2WUBH 5CJBA 5ANMA 3RWEB 2VITA 1HYRC 4WHTB 3U46A 3TBTA 4NGHL 1N6QL 2BVPA 3W9DB 4ORGB 3MRQA 4HIXL 3MX0A 1G7HA 1M1SA 3PE9A 5D7KD 1A6WH 2IAMD 1TTGA 3GIZH 4HUMB 1QLFB 2HKFH 1IRAY 3DXAB 1NH6A 5C08E 6FABL 5KZCB 3R0NA 3MLSL 2MPAL 5KSBB 3L3HB 1OCWH 3HE6D 3HRZA 1U41A 3PIQA 4KKBD 4ZS7L 1JUFA 1MVFA 5CMAB 1NC2D 4IJ3B 1F6AA 1G7PB 4LSUH 2PXYC 3S36X 3HE7C 3PHQB 4CKVX 4QHLB 1OF2A 2O5ZL 3CUPA 2BRQA 2VWEC 1HH6B 4YHNB 3GGWA 4YK4B 3W9EA 1CGUA 2IQ9L 3BZFB 5GS2H 1KXTB 1HEZB 3RWCB 4UOW1 1HH9B 5D5MA 3FMGH 5ALCH 1UCTA 5EUOE 1JI1A 3OPZL 2VLJA 3T0EB 1QQDA 4ZTPH 4RA0C 3QG7H 3SN6N 3GHEL 3S34H 2ZUSA 3ULUL 5DLML 3O81A 4MJIA 4JR9H 1QO3A 2A0LD 5DMGD 2F53B 3MRPA 2RJMA 3GMQA 1JZ5A 3MA7B 1Z9LA 4HWBH 2VLRE 4PJIB 1TXKA 4G8GB 3T4AB 3Q6FB 5EULV 1IARB 4PRHB 5DT1H 1RSFA 4M03A 4JQVC 2DM3A 2RR3A 4GRLA 2ATKA 1D7FA 1QNZL 3DVGB 2LU3A 5MEQB 2K7QA 2DKUA 1PX4A 2GTZA 5CZKA 5A43C 3UTPE 4KJWD 3PJSA 1IQDB 3OKKA 1I3GL 3OR6B 1RFDH 2ZG1A 1CICD 2VC2H 3O3AA 1CDYA 1C5BL 4M7LL 1P5UA 1MAMH 2H32B 4PP1D 5I1EH 4JHWH 3SE3C 3E0GA 2AJVL 2V5MA 3MYJA 3OKDB 3SGDI 3UTQB 3U30B 5E1AA 1JE6A 1AXSB 4M6NH 1MPAH 2CGRL 1EO7A 5JW4Q 4Q9RH 4MAUH 1E4WL 4XP6H 3K80A 1BM3H 4HS3B 5FYKU 2RIKA 3UC0H 5IJVA 3HN3A 1XF3B 4X6CB 3Q1SL 1LK2B 3ZHKA 1WK0A 1I1YB 4LCUA 4ZPVA 3FO9B 4N0UE 1ZSDA 4WY7H 1MCRA 4GW5A 1S7TA 1PX3A 2HJLA 2V6HA 3DHJA 3O6LL 5E2TH 1FIGH 4XWGL 4PLKC 3V4PL 3B2VL 3BPOB 1UM6H 5C6TH 4MXVE 3RWGB 4Z7WF 4LNRB 5IR1A 2NMSA 2FX9L 2NR6C 1OOAA 1J0YA 2ORBH 3ZDYF 1AC6A 2M8XA 1J8HE 1F2QA 1TENA 2YPKB 1BD2D 1N3NA 2WBJA 1EIBA 2DM7A 3VMPA 4ZNCD 2FEDD 5EC2B 1O7VA 2Z35B 1CD9B 3BKMH 3K3QA 4HKXB 5AYUH 4K2UL 4K94C 4LLQB 1WBXB 4LPXA 4F8TA 3MOQA 5JW4R 3ROOB 3BO8B 5D5MF 2I60L 1SM3H 2A6IB 1GGCH 1LO3H 4FABL 5IV2A 2HG5A 2C4XA 4XZUB 3FT4A 3UPAA 4MMZC 1RK0A 1BLNB 3PWVA 2GKIA 1DJSA 1SBSL 2A1WH 1N59B 3KNBA 3MO1B 1J0ZA 1S9VB 3QFDA 5GRVK 2LFGA 5KANI 3WXVH 1FYTD 4CMMA 1NAMA 5J3HC 3IJYB 3DV4A 2ZCHH 3I85A 1S7XB 2XWJB 5DHVH 1AJ7L 5EU3A 2XZCL 1HQ4B 3J7HA 4XHJD 1MCDA 5CJ5A 3NH7L 3GHBH 4L9LB 1M05B 1CLYL 4V1DD 3SDCC 4WRLA 2FD6L 3TBYB 3QDJE 4DEPC 2I9LA 2OXGA 4NFDA 2BP3A 2X6MA 3HI6H 2GI7A 4BK5A 3DGGA 4X7TA 4KKAD 2H1PH 1IGJB 4HMCA 1D5IH 1HZHH 5IFJB 3MODH 3CU1A 3D85D 3CK0H 1U8NB 3QEQB 2IBBA 3I6GA 1AGBA 3QWRD 3PWJB 4PLJC 3VXSA 3HR5B 4JO3H 1PQZA 1AKJD 4JG1H 3RVWD 4OBSA 5BS0E 5K9KB 2VDLL 5FA4A 4PJ8B 4AM0A 2CDFB 2CR6A 1X4XA 4M6ML 3EYUH 1OLZA 2BC4A 1QFUH 4MAYC 2XQBH 1FFRA 3MOAH 2EEAA 3C6LA 4XNUH 2P7TB 1NBVL 1QFPA 1WWCA 5D7JD 3V5DA 5GS1A 3D5OF 4HX1A 1OTTC 5IMMA 1DVFA 3OMZA 1BMGA 2Q3ZA 2D03H 3BGMB 4UUJB 2FSEB 2VZ3A 1MRCL 1YEKH 1H8SA 4ZAKA 4GSDH 5F9OL 5CS7A 5F3HB 1JWMA 5FYJH 3X3GH 2APXA 3UMTA 1S5HA 1IGCL 2D7QA 3TPUA 4NZTH 2M1KA 1GJIA 1FQ9C 4YHML 3TJEH 2G9HB 5ICZA 2BNUB 1MFEL 5F3BA 1QVOA 4PJBE 3MBXH 2C3WA 1OP5H 3CVHH 2P8LA 5J1AB 3IFLL 1CFVH 3K1DA 2AJ3B 3BP4A 3THMH 1K8DB 4G42A 3TZVD 5J6HA 2BVEA 3GSUA 3PP3H 4LSRH 4AEIH 5L8LB 4B5EA 3O0RL 5JQ6H 1JNNL 2P5EA 4M1DH 4C55A 4Z7UF 2XA8H 4BSJA 3DX7A 3MTRA 4PP2A 3NVQA 1K4CB 3ES6A 3JV6B 4XBGA 4DN4H 1FJ1B 4DUWA 3MRLA 3O2VL 3A6BH 4ALAL 1M7DB 1T6WA 3BP5A 3D1MC 2B2XL 1Y0LB 4Z6AT 3K81A 1I85A 3NN8A 5GJSL 2IPKA 5LGJB 5GISH 1DLFL 1JMXA 4GQ9H 4IIQC 3DX9B 4QHUB 1HILB 4X9IA 3WS3A 2FATH 1MCPH 5D1ZB 5I8CB 3IDIA 5IFAL 2E6PA 3M8OH 1X5HA 2HT2D 1FLRL 3SE9H 1KPUB 3QDAA 4PJGE 1FZMA 1FN4A 1NCWH 4JM2D 1YNLL 3MJ8B 3P9MA 4OZGE 5A3IC 5E99L 4BK4A 2BOBB 3OGCB 5EDXA 1EEUA 5H35B 4P57B 5B3JE 1QYGH 3GMMB 4FZEL 2W9EL 3VWKA 4LRNH 4IRSB 4MDIA 3FFCD 1FP5A 4JFPB 2R4RL 2MCG1 2VISB 4N1EA 2X4RB 5JORA 1EO5A 3U4EB 3EJYD 1MJ7L 1NFIA 4XC1L 4CVWA 2DOCA 1BF2A 3LSOB 3NCMA 4GKOA 5I16B 3DI2B 4MA3A 4JJ5B 4IMLA 1IQWL 3KYAA 3QUMH 4J8RB 1IC4L 3TIEB 5T5NG 5EBWA 4P46D 2DJUA 4G3YL 4IM8A 3SDAA 4OV6F 5D71L 1OAYH 5KSUA 2YK1H 3DECA 4FQCH 5ECJE 5T1LD 4JZOA 5F97E 4LAQL 5I1LA 1WFOA 3D25A 1X3DA 4DN3H 2OR9L 4PJFE 3UPRB 1T7ZA 3TM6A 4EI6B 1WZ1L 3OGOE 2Y7QA 3LDBB 4YR6A 2BVOA 3WFDL 3PDDA 3OV6A 3QHZH 4WI8A 3VXNA 3VRJA 4PRIA 1II4E 2NY0D 5GZOC 1AQDA 1FBIH 5CCKH 1CDHA 5D2NB 3LY6A 4RMQA 3VG9C 3WN5C 2BNQD 5C0AE 4PFEA 1OW0C 4UDTB 4X8XA 1ZVYA 1INEH 3HC0B 3M1BA 3QCTL 4D9RD 4NSKA 1CFTB 1MQKH 3FQWA 4NWTL 3L3JA 2VWEE 3D39D 3MRRB 4PLKD 5I9QC 2NW2B 3SY0A 5AZ2H 3ZE1F 5EO0B 2PUQT 5I1HH 4IHOA 4HV8A 4LSTL 1UJ3A 4YHPB 3PGDA 2YEZB 1JWSA 2JIXB 5L9DH 1KG0B 3ARSA 2HRLA 4WTXA 4FXKB 4U6XB 3BH8B 2HT3D 1ZT7A 3ALXA 4QF1B 3WUWB 3AGVA 5FUZH 3U7YL 2VXQH 2VH5H 1B9ZA 1OB1A 1A6TA 3K2MC 1KPRB 3IXTA 2R69L 5F9JB 1JF1B 4DVRL 4HWBA 3QDGB 1N64L 4W6WB 3NA9H 4QRUA 3DV6B 1RUAH 3MACL 2IBZY 3SGKC 4ODUA 5HHVH 1HINH 5IB1A 3QUKB 4OFIA 4FFYL 4RNRA 4N0YL 2VDKH 1D5BB 3IKKA 4MNQE 4OGZA 5I17A 4JDZB 5EWIH 32C2A 5KVEL 5IF0A 3RX7A 4YBLB 3MPCA 3QUZA 1CL7I 1FL3A 4I3SL 3OJDA 4LSSL 1BQLL 4XBPB 1Q9WB 3OX8B 1MCWM 3IDNB 4HH8A 2IG2H 5MENA 1FZOA 4TTGA 3WEXB 5EN2B 5FKPB 5DD3L 4WVRA 2F58H 5I8KL 1U0QA 4JRXA 4OSUL 3ARRA 3CLEL 4WCYL 3T0DA 5IM7A 4LCYB 3P4OB 4WFHE 4PJ5E 3DO7A 3IFPA 2UVEA 3SDYL 2ZG2A 4JY4B 5EZJA 1KFAL 3ILPB 1PG7W 4Y19D 5D7IF 3V4UH 3BZEB 4P2QA 1PBYA 5EUOA 1C12A 1IKNA 3LH2H 4Q0XH 1CE6B 1XGYL 3LEVH 4PJ7F 4YC2B 2FZ3A 4S1DD 4X6FB 2LU4A 4HHAB 5SX5K 5I8OH 1CG9A 1KB5L 4GG8B 3LKOB 4OZIE 2HRPL 3QG6A 4H1LB 4BFGA 4LARL 4WUUD 1ZGLA 1A4JA 1IAIL 3BH9B 3JVGC 2FX7H 1S9KC 3LKSB 2VLRA 4YHIB 4G6JL 2Z9TA 1BGXL 4UQ3B 3FRPG 1QRNE 4POZD 1U8KB 3KPMA 4RFNB 3MV9E 3FT2A 4HKJB 2OZ4A 1CBVL 4S2SA 1RZ8A 2FHBA 4KAQH 3S5LB 3KR3L 1U92B 2J8UB 5L2KB 4JFFE 4HUWB 1I1AC 5A16A 1FL6B 5C07D 5KJRL 3HNSH 3ZZ1A 1S3KH 4CBPA 1CFQB 1AO7B 3QEUB 4QXUL 1MOEA 5LGHH 3H3PL 4LLWB 3WKMH 4HLJA 1AGFB 3RDTA 1OAUL 3TO4A 4B50A 3F58H 3LHPL 3ARPA 5TDOB 3RWFA 2J3SA 1I9RL 3LV3A 4O58L 4PJ9A 5JXEC 1FVCB 1QUNA 2BXZA 5JZ7C 4WWID 3FB6B 1ZHNB 1NGXA 1HHKB 4XBEH 4OFVA 3LN4A 1R3IH 5C0BB 5DHVA 2B0SL 1Q38A 3KYMA 4X6EA 3KJ4C 4G9DA 4ZFOA 2QQNL 2ICEB 3ORJA 3ETBF 2BDNH 1NC2A 1S7WB 3PL6D 1HYSC 1UKQA 5GRWA 4DUXA 5F9AC 3SDDB 5DK2A 4RISL 1T0NA 4NQCE 1IL1B 3BJ91 2D31B 3SKMB 4RMSA 5D9SB 1VFBB 4JKKA 4N9GB 5CEXB 2W91A 1LEGB 5DHYB 2DQGH 2VABB 2HLAA 4BQCA 4MQ7B 2DQCL 3TYGL 5EORL 4KV5E 4BUHA 1PY9A 5EZLB 4JRYB 1MHCB 4K94H 2PO6B 3BPCA 3MROA 2XPGA 3GJFB 1TQBB 3Q3GA 5GGVL 2IAMB 4GRWE 2HVJB 1F4AA 1T21A 3OAYK 1KENL 4FXGA 1U3ZA 4GXVH 3GSWB 5EUOF 1G0XA 4NDMA 1U8HA 3FN9A 3OJMB 1JZ2A 2DIJA 3CH1A 3MRCB 5FYKE 4O5LL 5A3ID 1AR1C 4Z95L 2P5WD 4K9EL 4O2CB 2CR3A 4ONGH 3REWB 1FE8H 4RSVA 2AGJL 4U1SB 3PNWA 5ISZB 1LEKB 4OZFB 4JKWA 3L3KB 3QA3A 3MRMA 5IQ9A 1IT9H 4WDIA 3VGDA 3K4DA 5KS9E 4EIGB 3CXHK 3FRPA 4NFCA 4NJAL 5DJ8A 2ARJA 4D3CL 5FEBA 4HK0B 4POYA 4XRCA 3SJVE 4WW2B 3VXOA 2EEBA 1KJVA 2XY1A 1BFVL 2OQJB 4PGBA 5E5MA 3QDJA 5L0QB 1EZVX 4P2OB 2ZUQB 3ARDC 5C0DB 5EO1B 3WFHB 2Y9RT 4M8QA 4L3ED 1J10A 5INDB 3FJTA 4KDTC 4OM0L 4CNIA 3A6CH 4I0KA 4BQBA 1O5DT 1JHLH 4PLOB 4XPFH 3QCVH 5I1CL 4OLVL 1IC5L 5C0RH 2J8HA 3HNTH 4LAJH 2NY2C 3RNKA 4RGNC 3AC0A 1IAOA 1IGYA 1HHHA 4G8EB 1Z5LA 5F96H 4HEME 2ZZUT 5IVXE 4I2XB 4PJAA 4FFVD 5BVPH 3HMWH 3O6KL 1EAPA 4R0LC 3WLBB 1P7QD 4YXHH 4BH8B 1CDJA 5E9DD 2AK1L 4LSQH 2WMPA 3PHOA 5FYLD 2Q86B 1T83C 4XMPL 4CVUA 1DUYB 3GBNH 4MXVF 1NCBH 2W92A 4JKPL 4X5XA 3O4LD 1PZUB 1U91B 3SKOB 2OTWB 4ZDHB 1KN2H 5L8JB 3HC3H 1EGJA 4WTZA 4KHXL 3D2UD 5LBSH 4XNQB 1T1ZA 2O61B 5DUML 3PV7A 1HSAB 1WAAA 2WSKA 5JNYA 1AP2A 1MRFL 4YHZH 3C5SB 5HHOB 2IH1A 4OLXH 4NUGL 5BV7L 5GS3A 1AY1H 1FYTA 5F7DA 4RAUA 2Z31B 1A5FL 4HUXB 1I4FA 3HG1D 5LWYL 4OCLC 3MJ9L 1VENA 4E5XA 1H3UA 3Q0HA 4MNGE 1SJEB 5C0EA 1ZVSB 1K8IB 4M5YL 2FIKB 1QBMH 4UU9A 3QUMA 4X7SH 1UB6A 2XXCB 1DL7L 3FQTA 3U7WH 1UXSB 4JZNB 3RFZC 4JFDE 3RTQB 1Y18B 3SHSA 3FO1B 1KIPA 1RUKL 1LDPL 4ERSH 1T22B 1P4BL 4HT1L 1HCFX 4MJ2A 3W82A 1FVEA 4UV4L 5JPNA 4GAJL 4U4BA 4OCYH 2NX5E 2CK0L 4D8PB 4ETYA 3FOLA 4WHYH 1X5GA 1EJ6A 2VE6A 1Q9LB 1T7XA 2Q3AA 2E7LA 2AI0H 1RJYB 2J6EA 3HUJE 3VXUB 3CSYA 1XT5A 5DEGA 2APFA 4OLYL 1DANU 5IW6B 1ZAGA 1U8OA 4UILL 3OR7B 3JWOC 4OJFH 3NCJH 1FDLL 2DQHH 2CQVA 2ITDB 1WC7A 4NCC1 2B7DT 5DJZA 5T3ZD 4LHUD 4H0HB 4OZGA 4D9LL 4ELME 1BWWA 3H9YA 2GUOA 4Z77A 4F9LA 1INQA 3QO0A 1J1PL 1HXMA 1MAKA 2YRZA 3H7LA 4NQXA 2KH2B 3ZDZE 1TETH 5GRUH 1RZIB 3RIFK 5HI5D 3F7PC 4C83A 4NHCL 3O9WC 2VDNL 3IAQA 1MCOH 2ADJA 3JZ7A 5GGVY 3HAEH 3ARZA 2NW3A 2CDEA 4NT6B 1QPXA 5D8JH 2XXMB 3B3IA 5EBMA 3UTZA 2LQRA 4FTVB 2EXWC 1UM4L 1X6LA 4LCCB 4WEMB 3C6SB 4V2BA 5FHBL 1SHMA 4YX2L 1UGNA 3MNVB 2A6JB 3QFJD 3AM8A 2VDOH 4NZUL 4ODXA 5DQJB 4I77H 3IDXL 4Q58C 4MS8C 4S1SL 2I9TA 2A6DB 3NBNA 2Z91A 3GK8H 5DZLA 3C09C 2Q7YB 1XGTA 1TVHA 2YRLA 2H26A 3OKEA 1G9EA 4XAWH 4LSDA 4APQC 4IRJA 4PJBF 2ZUXA 3O8XC 1CGSH 1M6OA 5DXWA 4P23B 5F1IB 1A6VL 1YY9C 2XZAH 3WXWH 4OD1H 3QXDB 5JZ7D 5IT2L 2AS5M 2AEPL 3MJ7B 3VRIB 1BJMA 5ID1B 3GMPA 1I8IB 2BSRB 4A6YA 1RI8A 5J0BA 4NN6C 1A1OA 2D7TH 1KELL 1HYSD 5IB4B 2VZOA 1U95B 2PXYA 2Q8BH 3VE0A 2COQA 2OTUB 1NFDE 2V5YA 3TZVB 1FCGA 1I9IH 2ZPKH 5C09D 4L4TB 1U3HD 3WIIH 3TBWA 1T0MA 3G6AA 5TPWH 4UOJA 3K2UH 1W72H 2VLKB 3QAZB 4HXAH 4MSWB 1LILA 4O51B 5D7LD 5JHDD 3ULUD 3QPQC 5C8JA 5KTEH 4G6KH 4L4VB 2ED8A 3FT3A 3GUTB 1LO4L 4YBQC 4ZODA 5F6HJ 3TJHC 1H3GA 4DKDC 4X7EC 1MFCH 5E7BA 5L6YH 4JLRB 5GS0L 5K33A 3EO1A 1OSZB 1UB5B 2P42B 2XKSA 4OLWH 5E8DH 1RURH 1HKLH 2MWCA 1OVZA 3AREB 4PJGF 3BI9X 5TDNB 3NAAH 3L3DA 2SEBA 3F5WA 4NM8L 5HHXH 1YMME 5I15H 4OZGF 4FNLH 3PGCB 3VDBA 1NDMA 4NZRL 4JQVA 5GRJH 4O2FA 1G7QB 2AQ1A 3QHFH 4NNXA 5B3JF 4BYHA 1AD0B 4L5FH 1RIHL 1FL5A 4RAVA 1T2XA 2X41A 2I24N 4DGIL 5GIRB 2XN9E 2QSCL 1J9CT 3AS3A 4U1GB 4NYLB 3O2WH 4EN3D 3MREA 1Q9KB 1RHFA 4PS4H 2K1MA 1QSFD 2IALA 4F7MB 1MWAL 2C9AA 1N7ML 3R06B 4YGAB 3T77B 3SE3A 1GZPB 3GB7A 1CXFA 1NGWB 4EXKA 3S4SA 3F12B 2BNQA 2HTLC 1QR4A 2E7MA 4R90H 1H3PL 4HD9A 4PJFF 1YA5A 4XCYB 1CI5A 3RVUC 1IEBB 4DFIA 4XP5H 1M4KA 2DQIH 2MQCA 1UWEL 2AV7A 5T3ZH 3D69A 1HN1A 3QI9C 5DMKA 1R6VA 5TQ0H 5FK9A 1H9VA 4KVCH 3QJFA 3RBGA 4PRPB 1JNLL 1B2WH 4PTTB 1WIUA 3B8YA 3CDGA 4LU5L 4OLZH 43C9A 1T04B 4KRPD 3RVXD 2ICWI 1TFHA 2NNAA 3ARGC 5HY9A 2O5YH 3UTPD 4YPGB 2FO4B 2ADFL 4U1IB 1EXUB 4PY8I 5DRWB 1MJUL 1DN2A 2IQAB 1KLGA 4HF5H 1QRNA 2NXYC 1J12A 3HLAB 3KXFB 1C5DA 2VQTA 4J4PC 4FQ1L 3QUYD 5CP3A 5CD5C 3DX8A 4P2CG 4LCWB 1QFWM 3MV7E 4XVUC 4BUGA 5JPMA 3BW9A 5DSCA 4L8DB 4PRAA 4JFFA 4ZXBB 4QO1A 4POUB 4NGHH 1N6QH 1J0IA 4Z9KB 5KSAD 2H3NA 3C5ZC 4Y16B 1ND0B 4HIXH 1RJZA 4H0IA 3W11D 2R29L 4RZCA 4EDWL 2YWZA 1AGCA 1S9XA 4UOW0 1D5XB 6FABH 3MLSH 2MPAH 2JCCA 3FOMB 4XNZB 1AXTL 5DWUL 3NGBC 5D2LA 4WO4C 5EU6D 2O5ZH 5F7YC 2PETA 4OIBA 4HKBB 1W8NA 4K8RL 3SDCA 3DXAE 2UV3A 5ANMB 4YHYC 1N6VA 2VITB 4WHYG 3GM0A 3TBTB 3U46B 2JTDA 1U2CA 2BVPB 4QRPE 1G7HB 4Z7WB 4LHQB 5SWSE 1QZ1A 4MJ4A 3HMXL 2AJSL 3N1FC 2VL5A 3OPZH 3KVQA 4YLQT 3PIQB 4JFOA 3GHEH 3ULUH 5DLMH 1UXWA 3JV0A 4RGNE 4E41D 1F6AB 2HFGL 3H42L 1IGMH 1ZANL 2ED9A 2VLMD 3GSVA 4BQ8A 2OS7A 5HVGB 3ZKSD 4Y7MA 3HA0A 3V52L 3QT2A 3W9EB 5I1IL 4MAYA 4WUUA 4KKLD 4IOIA 5JW4M 1ZLUH 2EYSA 5D5MB 2G60L 3MMEA 1QNZH 5E2VL 3HAEG 1QQDB 1IM3A 1CDGA 1FFPB 3ARFC 5BOPA 2HA1A 1I3GH 1QO3B 3K46A 5CIPA 3MRPB 1NJ9A 3IDYC 3MV8D 4P4RB 2W60A 1G1CA 1XF1A 4NO5B 4OZIF 1JYVA 2FRGP 3LQZA 4Y19B 4Y1AE 1IM9D 4M7LH 3ZT7A 1YN7B 4K3HA 1CT8A 4LBEA 1VGKA 2ZOKA 5I1JL 2LTQC 3LS5L 2CGRH 4L4JA 5IOPA 4GRLB 2ATKB 3OTTA 1E4WH 4PBVC 1NUNB 5C0GB 3Q1SH 1GZQA 2E8ZA 2GTZB 4NZDA 2NY6C 1K4DA 3SDXA 4R7NB 3GMRA 3OKKB 1JV5A 4D9QD 1FFOA 4LVOB 4KU1A 2EDKA 3O6LH 3O3AB 4JZJB 4XWGH 3V4PH 2ERJC 3B2VH 1AXIB 3LKRB 4N8CL 1BBDL 1NSNL 1J1OL 2BMKA 3MYJB 2R15A 5E1AB 3WFBL 1Q72L 1OQXA 1R0AL 3F62A 5JW4N 5FCSH 1YYLL 4S0SD 5J8OA 2OI9B 5IJVB 3L3OB 4GG6E 1MCHA 5IVXA 3QQ3B 1RPQA 3GMNB 3ULSA 5C2UB 5IHLB 1X4YA 4K2UH 2UUDH 3DVFA 4IIQA 3IU4L 4FQQA 4YDLB 4LEOA 5HDOA 5IR1B 1NCTA 2HN7A 2I60H 4AT6A 1GH7A 4FABH 3UZEA 1NMAL 1J0KA 2DIAA 3JUYA 2ZCLL 3U2SB 2WBJB 4K9EC 3QH3B 4X0KA 4NQED 1SBSH 4KV5F 4Y4KC 1ERNA 4FFWD 2VXTL 5GGTL 2GJ6E 4R3SB 4ETQA 2EXYD 3VCLA 4GRWF 1BEYL 1HXYB 4GXUM 5FXCH 4LPUA 5C0FA 3ZKMD 4NC1E 3FQRA 1AJ7H 4M5ZL 1MFDL 5C71A 1CR9L 2XZCH 5CJXC 4DK6A 5IV2B 3NH7H 1CLYH 3FT4B 1YPZE 2B5IC 2FD6H 5TE7L 3LD8C 3PWVB 1FG2A 2L0DA 4F9PC 2EDNA 3QFDB 5CJQL 3L5WA 3WIFB 4Z7UB 1RZGA 2ZUTA 4CMMB 2K7PA 5KS9F 1NAMB 1TJHL 4L3EA 4AIXA 1JYNA 2PR4L 2I07A 3MLZL 4LOUD 3WNLA 2NX5A 3MNWA 3CMGA 1UZ8B 3EW3B 2VDLH 1GOHA 2QADC 1YYML 4NN7C 5E4EC 3GRWL 4U1KA 4M6MH 3WN5A 3HUJA 5HHMD 1MH5A 1OW0A 3BUTA 3DGGB 3CFBA 4HWEL 1ED3B 3TBSB 1NBVH 2VN4A 5D1XD 1LE9B 3BWAA 2HLFC 5AYQA 3E8UL 1MRCH 3ILQC 3I6GB 1AGBB 4FG6C 5F9OH 5L2JA 2ICCA 3P0VL 2WM0A 4GXUN 1ZE3C 1KJ3L 3VU2A 2CJUL 3VXSB 3RKPA 2VQUA 1PQZB 5FHAL 1D9KC 3EFFA 5FAAA 2FECL 1VA9A 2BY2A 4G7VH 4K7FB 4CN1A 1IGCH 1R24A 1F02I 4AM0B 5IVXF 1RD6A 1EDQA 3MUY1 3VXQA 3P11H 2WAHA 2ZP0T 5L88L 3PDOA 4YHMH 4S1RL 3CDFA 4UBDD 1MREL 3ARGD 1MFEH 1T7WA 1W72A 3V5DB 3GKWL 4HX1B 5HD8C 5IMMB 1UYWL 3DMMC 2VOTA 4QTIL 4GBXC 4MCZA 4YIQA 4KTDL 4GS7C 2FDBP 3QXAA 3QO1B 2NXYD 1MCSA 4IDJH 1HE7A 1QA9A 1CD8A 3HG1A 1P7QB 4M48L 1MFNA 1S5HB 1PW3A 1T5XB 2CUIA 4XVUD 1GGYA 4EEEA 4M61B 3O0RH 3D87B 3TPUB 1JNNH 1PZ5B 4Y0GA 3SGKA 5BRZD 1KNOB 2X4OB 4LLVA 2X9YA 5ACLA 1JJUA 1NBYA 1QKZL 4YDVB 3FRUA 5K9JL 3DVNA 5F3BB 1BZ7A 1QVOB 2DDQL 2ARJQ 7FABL 4GKNB 1H3VA 3BEVA 4WV1B 3O4LB 5FKAB 1MF2L 5IIEA 5T5FL 3V0AC 1ZS8A 3QDMD 3O2VH 3RZCC 4ALAH 3A67L 5I6XB 4MD0B 2B2XH 1OGAE 3IDUA 5DGRA 4TUOA 3BPNB 5DEZA 5HGAA 4LKCA 4ODWB 5IVNA 3KPOB 3N1PC 3I6LE 5C0IB 5GJSH 1DLFH 1C8PA 2V7HA 4F8QA 2FBOJ 4OCXL 5E7FA 3VFNA 3QIUB 4JVUA 3DX7B 3NFNA 4PP2B 3TO2A 1FLRH 4DCQA 4MZ3A 4XBGB 1DQDL 4LQFL 1YNLH 3MRLB 5E6IC 1PY4A 5E99H 5HGDA 2ESVD 1MI5E 2JK5B 4YAQA 3FN0L 2AABL 1WV7T 1CWVA 1CF8H 4FZEH 1JYWA 2W9EH 4QT5A 5DJYB 1T2QH 2AKRB 2IPKB 1O7SA 1F8TL 3LIZL 3DYOA 5B39A 3X11B 2EDRA 1ODAA 2R4RH 3N50A 3T4YA 4GO6B 1ZEAL 1PEZA 3H9SB 2CKBB 5ICYA 4MLSA 5TE4L 1MJ7H 4D0CA 8CGTA 4I5BB 4XC1H 5EIIA 3UTSE 2R2CA 2BOCA 2UWEE 3P3YA 1IQWH 1FZMB 1XEDA 3EJJX 3JVGA 1FN4B 5JLZA 1IC4H 1C7TA 1GOGA 1YMMA 2G5BA 4XHQA 3RIFF 4XB7A 4G3YH 4ELMF 4HQQL 5D71H 4YHLL 4RBPK 5I66A 3SQOL 3EDEA 3V2AR 4LAQH 4MDIB 2Y5TB 4N0FA 3QFJA 4AL8L 2DJ4A 2W1NA 1MCBA 3ZDZF 25C8L 2OR9H 1B0GA 1OAXL 3ARBD 4H8WL 4LLDB 4QOKA 2XN9A 2L7UA 1WZ1H 1I1AA 3NFSH 4HJGA 2ZUUA 3WFDH 2HP4A 4P4KB 3RKDD 3WNPA 4NQDE 4IMLB 1ORQA 2ADGA 1QSEB 4U6VL 3L95A 4N5UA 5DVLA 3HS0A 5EBWB 4OQTA 5JXEA 4M7ZB 3SDAB 3MLTA 2QQKL 5KSUB 4AIZA 3BXNA 3EGSB 1F2XK 5C0JA 3QCTH 4R8WL 2NY6D 1X5FA 1D3CA 4L3AA 5I1LB 3ARWA 4R96A 1XIWD 1OTSC 2A2QT 3MQIA 1QSZA 1U6AL 4NWTH 2GTWA 2H2SC 4YR6B 2BVOB 2P49B 5JA9A 2IF7A 1UEMA 5ADOL 5DVKA 1YEIL 4AEEA 5D7IB 5C2BH 3VRJB 5C3TA 2P4AB 4KTYA 1ZWIA 4LSTH 3EHBD 1SVCP 3EDFA 2R23A 3AB0B 4PJ7B 5DJ2A 4DKAA 1JHKL 4MA1B 1YEFL 3MBED 5J12C 1EJOL 5D96C 5KAQG 5D7LA 3U7YH 2LVEA 4K71B 5JOPE 1NGZA 3FQWB 5GS0C 3L3JB 1JMZA 3RL1A 3KDMA 1NFDF 1P4IL 4IMKC 2JJUA 3SY0B 2R69H 1QD0A 5LVEA 4DVRH 3H2WA 4NO0A 2YD3A 1G84A 2A6KB 3BZ4A 1N64H 4C56D 4HV8B 1A1MA 4R97B 3VGGA 4U3XA 1JWSB 2X44D 4N0CC 2Y25A 4LP5A 4FFYH 5SWQA 1T4KA 5F7LB 4IS6A 1LO0L 4N0YH 5CD3A 4GQPH 1JZ6A 2KQNA 5KVEH 4OZHA 2W07A 3EDKA 4OCRL 3VXME 5MERB 5C09B 3ULVL 4XPTL 1OB1B 2DRUA 2X1XR 4I3SH 4LSSH 1BQLH 3IXTB 2DQEL 5I8EA 1A22B 1BOGA 3L6FA 3NPSC 2XWTA 5DD3H 5DUPL 1EFXA 5I8KH 1FVDB 1F11A 3DO3A 4KQ3L 1L4IA 4M7KL 5EFIB 5FGBC 5IEHB 1QFWL 1OAQL 5IB1B 1KJ2A 3CLEH 4KK6C 4RNRB 4WCYH 4CW1B 5I17B 3T08A 2ICWJ 7CGTA 4BZ1L 5IF0B 2C1PA 2CIKA 3WBDA 2FWOA 2X70A 2FIRT 3SDYH 2BNRD 3ARDA 3QUZB 5AD0A 4HK3N 4JKMA 3OJDB 5HYSG 4QRPA 4QRRE 1PVHA 1I8MA 2WP3T 4GFTB 5F89B 1EHXA 5SWSA 4KDTA 2R0KL 2XT1B 2GJJA 5E70A 1YQVH 3EAKA 5C08B 5C7XL 4JHBA 1BZ9A 1NGYA 1XGYH 4W6YB 3V7AG 3IKCB 3QNXA 2QADD 3OJ2C 2VAJA 1A4KA 1KB5H 3UDWC 3QB7C 2HRPH 3GNMH 4HSQA 4EN3B 5IM7B 4LARH 3K74B 1IAIH 1NBZA 5K93A 3DO7B 3OBAA 4KZDH 5GGSB 1E4XL 4G6JH 4R0LA 1BGXH 1L0YA 2WUCL 3RGVC 1JZ4A 1GGIL 2NY3D 2IAND 1SYVA 2FJFA 4FQXD 5EUOB 1C12B 1T83A 4HIHA 4U1JA 4KROB 4L29A 3WL9A 2OTPA 1G6RA 2VUOA 2ZSWB 4BQ9A 3DIFA 3QUXC 1L7TL 3TVMD 1CBVH 4KC3B 3O3BA 2V2WB 4V2CB 3KR3H 3SJVD 3QIBC 4EI5D 1ZA3B 4KPHL 4M7JL 1CG9B 5KJRH 2O26U 1Q1JL 1H5BB 3OG6B 4QXUH 4HFUH 4ENEC 2YBRA 1ZGLB 5HYQA 4ZFGL 1OAUH 2FH6A 3LHPH 2VLRB 1I9RH 5CILL 4O58H 1QP1A 1NMBH 3G5YB 3VFTA 3KPMB 5T3XE 1UKSA 3FT2B 4G6FB 4AJ0A 2GSIB 4S2SB 2B0SH 4XVTL 2UZXB 1KCVH 2D0GA 5A16B 4JHAL 2PW2A 5FO7B 2QQNH 3O4OB 4XI5C 3V95A 3FO2A 1IAMA 4MDJB 3VXTA 5EU6A 3PXJA 3RDTB 3UTTD 3TO4B 4RISH 4NQVA 3X12A 3LV3B 5E8NA 4HCRL 5F9WC 1NGXB 4YE4L 3IJHB 4TPRL 3PQYD 2APVA 3LN4B 1NQBA 1N6UA 2DQCH 5DHVB 3TYGH 5EORH 1OQOA 1FNGB 4X6EB 3FN3A 3WYRA 4ZFOB 4E41A 5GGVH 4N0UB 2EYTA 4HS8L 5DJAA 4PJHE 4WI2A 4ZUTB 5HYSA 3NMEA 1T1YB 4M02A 5DK2B 1PDKA 1IZJA 1R3JA 2VRAA 1HOCB 1B4RA 1D5ZA 5IK3A 5C70A 4NN5C 4WEBL 5DTFB 1JTPA 4O5LH 5LG1A 2WP3O 1H8NA 4K9EH 4ISVB 3D9AL 1J8HB 4MX7A 3AROA 5E0QA 2AGJH 2VL4A 3C08L 2AK4E 4I9WE 2HMID 1OTUC 1LEIB 3Q3GB 2YD2A 3DROA 2GJ6A 4P5TD 1C5CL 4WHCA 1T21B 4NJAH 3SO3B 3O9WA 4D3CH 4RFOL 4JFDD 1AGEA 5CINL 4P2RE 5F1KC 1FZKA 3GMOB 4NDMB 3EFDL 3CH1B 4IJ3C 4DVBA 1BFVH 1MSPA 3KYOB 4QXGL 1R3LA 3D3VD 1NGPL 3BISA 1KJMA 1KTLB 4PIRF 4YK4C 1N5YL 3PNWB 3GI9L 3NIFE 3ECBA 1IVLA 3QA3B 3MRMB 3RPIA 4PD4K 3P30L 4WDIB 1M7IA 4OM0H 1GRWA 2VKXA 4BSVB 5DJ8B 3FONA 5I1CH 1B3JA 4OLVH 1IC5H 4XRCB 3VXOB 8FABA 1BBJB 2H8PA 4APQA 2F5AL 2GJZA 3MUGB 1KJVB 3LKPA 5DO2C 3O8XA 3BHBA 3PWUB 3ESUF 1Y6KR 5LCVL 2C1OA 5E5MB 3MCLL 4I0PC 2VR4A 2YWYA 3QDJB 3O6KH 5GGUA 2P44B 4M8QB 1A47A 2AK1H 4P3WA 4R4NC 3BP7A 4MD5B 4CNIB 4XMPH 5E5RB 4DZBA 2DLEA 5KOMC 2B1AL 4LIQL 3BKJL 2RAMA 1KCUH 4JKPH 3RNKB 1BX2A 4WFFE 3L7FA 5BS0B 1WFTA 1CFNA 3DRTB 1FNEA 2ID5A 2WNGA 4GG6F 1BFSA 4KHXH 2CXGA 3ZTNH 5DUMH 2JJWA 1EAPB 5AAMA 5DA4A 1A64A 3ZKXB 4NQEA 1MRFH 3ARQA 4KKNA 1WZMA 1ZHLA 3PHOB 1LGVA 4KI1A 4NUGH 4X4MA 2PTUA 3N1QC 4PREB 5GS0D 43CAA 5E08L 1A5FH 3OZ9L 5LWYH 3MJ9H 4PJDE 4UINL 2XWBA 2R2BA 3LN5A 4HMDA 4M5YH 1XGPB 2GFBB 4U6YA 4X4YA 2YPLE 5FUCE 1MLCB 4E42A 2MOVA 1DL7H 1NEZG 2VJXA 2QR0A 1AP2B 2BY1A 4X9BA 2WIMA 1RUKH 1LDPH 3MLXL 4HPYL 4OFDA 5E8OA 3QEGL 1D6VL 1P4BH 4HT1H 5DFTA 4GKSA 4PJBB 4JFED 4UV4H 3HHRB 1WWWX 4GAJH 5DRZB 3H6JA 2CK0H 1I4FB 2PYED 1MCQA 2CH8A 4E5XB 2NXZB 2R2HA 2HWZL 1P69B 5GRYA 1YPZF 1TQCC 3MUJA 4UU9B 3WS6C 1UB6B 3BPLB 4HDIB 1DBML 4KK6D 1IBGL 3FQTB 1F4XL 5ITFB 4UILH 5HYJA 3SCMB 1FDLH 4BFIA 3E3QC 3ET9F 1XF2A 1FVEB 5JPNB 5EU7C 1FGNL 3IGAA 4MJ5A 4OM1L 5DURD 3FOLB 4D9LH 1AGDA 4D94A 2VE6B 1G9MC 2DMBA 3VGHA 2DQUL 3QI9A 2BK8A 5CZXD 4PR5B 3CSYB 4NHCH 2VDNH 5FECA 3SBWC 1U8OB 1RJCA 5B38G 1A8JH 3NFPB 1DQLL 2PF6A 4U1NB 3ARGA 1WC7B 2M26A 2UWEA 1NDGA 2DQFA 1UM4H 3SOBL 4PJGB 3RGVD 1IJ9A 1VSCA 4LK4A 3UAJD 4FN0A 1GL4B 5IMLA 4YX2H 4OZGB 1WCBA 4P0DA 2Y5EA 3H9HB 1T5WB 5J7CC 1PYWA 4NZUH 2RCSH 4HPOL 3ZL4L 1INQB 4J4PA 5EIQA 3IDXH 3TNNA 4S1SH 5ID0B 3BMVA 4K23L 1TZHB 1V3JA 3KPRE 4X4XA 3JTTB 4ENED 2ADJB 3T65A 1ZT1A 1B88A 4FQ2L 2NW3B 5BRZA 2CDEB 4HAGA 3B3IB 4OCWL 2PKDA 2X4PA 1NPUA 3V7MA 1YNTA 3IDGA 3UTZB 4NQDA 3MRBA 4W6XB 3C5ZA 1A6VH 5HDQL 4PJ8C 5IT2H 2AEPH 1U93B 5I1GL 4ZFFA 1BVZA 5C0CD 3VXRA 1S78C 5IFHL 1NEZA 2I9TB 5FM5M 3EYFB 1E28A 5SWZE 4EQ3A 4XI5D 2NQCA 4K8RD 4PJFB 3KPSE 2MJWA 1XR8B 1TCMA 3NCCB 1TVHB 5F8QC 5KSVB 4WO4A 3OKEB 5LXGL 5D1QD 1OGTA 2H9GB 3HPLA 5TDPB 4G8IB 1M6OB 1SY6L 5ETUB 4P9HL 2X4TA 1HIML 4MLIA 2ZNWA 5C0AB 1CFSA 1FZJB 2ESVA 4GKZA 5F7NC 3BJLA 4K3JL 4A6YB 3PWNB 2MMXA 1TZIA 1GSMA 5J57B 3WIHA 3WMSA 4L4TE 1LO4H 4N8VA 1ZT4A 3FQUA 1P6AB 5GS0H 2PXYB 3HE7B 3VE0B 5B21A 1EH9A 5LAXB 1KB5A 5EZIL 5AG9A 1W0WB 3DHMA 3MLVL 4NM8H 3TBWB 1T0MB 5GJTL 5FDWA 1A7BA 2Y06L 1BIIA 4YO0B 4NZRH 2K3TA 2G2RA 3GBML 4PJCE 3T2OA 2F54E 1LP9E 1RIHH 3FB5B 4O2EA 2BCKA 1I1FA 5C6PB 5C8JB 2KDGA 4DGIH 5MEPB 3ARFA 5MEOA 4QRQB 4X98A 4M1CD 5B38A 3T09A 1EVUA 3EO1B 4M93C 4QXWA 4U1LB 2DYPA 4P3DA 5I75B 1G7JA 2V7NA 3DXAD 1S7UB 2UWEF 3VG0L 4PY7A 4WJ5A 5KZCD 1R5WA 2F15A 1MWAH 3MLRH 4ZUWA 1N7MH 1X4ZA 2SEBB 5DYOA 1KIQA 5IB3B 1A2YB 2ED7A 4YGVA 1QBBA 2NY5L 1G1YA 4W4OC 3WNMA 4LVEA 3U4BL 3VDCA 5CEZL 1FL5B 1MFBL 4RAVB 3PWPA 5TF1L 2XFXB 4MNQB 1H3PH 4XXDA 2MHAB 3CZFA 2XRAL 2D0FA 1ZLWH 4D0BA 3G5VA 3EOTL 3MREB 3N06B 3FQNA 3T0ED 1CE1L 2EE2A 4TRPL 3BMWA 3CFKB 3GB7B 2CO6B 5DO2D 1JNLH 3S4SB 3IVKA 4Z0XA 3BN3B 4TVPE 4LU5H 2XACC 5SV3A 5JO5A 1CDCA 1M71A 4G8GD 3PWLA 3KHQA 2YD6A 4PJ5B 4PRHD 3UZVB 3LKNA 4WTWA 5HHQA 3WV0A 2NY7L 2DQDH 2ITCB 2AV7B 1MJUH 1A7PL 3D69B 4I48A 1MCEA 3NCBB 2QLVB 5HTSA 1A6AA 1VFOA 4F33A 5DMKB 4FQ1H 3SKJH 3FZUC 5FK9B 2NY4B 1DZBA 1CGTA 3GDBA 3OQ3B 3AU1A 3D0VA 1EV2E 4ZO7A 4S10A 3CDGB 43C9B 5DDHA 2V17L 2AEQL 2NNAB 5HY9B 1NCCH 1CXHA 3JV4B 4Y4KA 4M62L 2R29H 3G6DH 4EDWH 5DJ0B 1CVSC 2WW8A 4UT9L 1KLGB 1QRNB 1FC2D 2FJHA 3B83A 3D18A 3NABL 4RWYL 1C5DB 3EIFA 5DMJB 2APWA 1A9EB 4Z76B 3MV9B 4QHMA 4DTGL 3GSOA 4HWZA 4RDQF 3CGTA 1DLHB 4TVSa 5JPMB 1AXTH 3BW9B 2A9NL 5DWUH 5CJXA 5DSCB 2H6PA 1L0QA 4JFFB 2CD0A 4K8RH 2NZIA 4L8BA 3L7EA 4F9PA 5ESAA 3P2TA 4RAHA 3EO0B 1VADA 4KUCF 2RGSA 4RZCB 1LO2L 1X6NA 5D6CA 5KVFL 1S9XB 3HMXH 2BNRA 2AJSH 3W81A 5IMOA 4HWUA 3C60B 5J06A 3OJVC 2W0FA 1K2DA 1EZVY 3OKOB 1IAII 4D2NA 4HUVB 1AD9A 3MR9A 3H42H 1ZANH 5D2LB 3S3SA 3INUH 4WFGD 1N2RA 3VFPB 3SDCB 4ZYKA 4KTEH 1ACYL 1XF5A 2V9RA 4DEPB 4D0DA 3QXWA 4PJHA 2NYYD 1YMHB 1JK8A 5I1IH 3SO5A 1BWMA 3SGDH 1P4LA 2CUHA 3IF1B 3H3KA 4JY6A 4NQCB 3RWHB 2G60H 4KQ4L 5IG7B 2VL5B 5HVWA 3V4VL 4MNHA 3DUUB 4X6BA 5SV4A 2IANA 4JFOB 4NRYA 2WZPD 3KWWA 1UXWB 2ZUWA 4NOFA 5JQHC 1JPTH 1PGRB 1EBPA 3TA3B 1E27A 1D9KA 1KBGL 3WDJA 1H15A 3EOBB 3W2DL 4GUPB 2VLJE 4MHHG 4Y4HC 1MQ8A 4GRWB 1UG9A 4MAYB 5AUMA 4IOIB 3EYOB 1TNMA 3B2UC 4MJIE 4M8VA 5I1JH 2R8SH 3LS5H 2EYSB 3MMEB 4P2RA 2KBGA 3KJ6L 3DMMA 3VFMA 3I6KA 5DJ6A 1DE4A 4GBXA 4Z7NE 2VXVL 3G5XA 5FA3A 5FM8A 1CYGA 1U8IA 4KHTL 5CIPB 4J1UA 3RL2A 2W60B 4OF8A 5DJXA 3SKNA 5FF6B 2V5TA 2YD8A 1YECL 2HTKD 5DK0A 5KS9B 2JB6A 3KPTA 1NL0L 1CT8B 4OGYL 1UENA 1VGKB 1BBDH 1NSNH 1J1OH 3S88L 2V2TA 2ZOKB 2DLHA 2EKSB 3WFBH 1Q72H 3ALWA 3UTTA 5IBLC 1R0AH 5C1MB 4QHNB 1YYLH 1GVIA 4KDWA 3LVEA 4EI5B 1QACA 4HUUB 4YHKL 1HI6B 5CLWA 3VFVA 1GZQB 1WQVT 4NQTA 3RZCA 2BSED 3HPJA 1K4DB 1MAJA 3EO9L 1FFOB 1WJ3A 4NKMB 3NCFB 4NO3B 2P8MA 5IB5B 4Z7OE 2A74B 3IU4H 1RHHA 4MJ6A 4RFNC 4S11A 5IW1B 2D7NA 3FTGA 2ZKHL 5CHNB 4O4YH 2FNBA 1NMAH 3HZYA 2DN7A 2R0ZL 2ZCLH 2ATPB 4P5MA 4AMKL 4J3UA 3LB6C 4RRPG 5E6IA 1FAIL 5H2BA 4JCMA 5IVXB 3DUHA 3ULSB 3IDMB 4PV9B 2VXTH 2H32H 3TT1H 4X4ZA 5GGTH 4H26A 2W65A 2XTJE 1KV3A 3GI8L 1VEMA 3ZHDA 4LVHB 3KPNA 4PJHF 1K3ZA 4M4RA 1BEYH 5ESVA 2CO7B 4FQQB 3RWIB 1KYOK 1IZKA 2X1PA 2QQLH 5K9OA 4I3RL 4LEOB 5GRXG 3MA9L 1U8JA 1ACZA 4M5ZH 2HN7B 5E8EA 1MFDH 3U9UB 1CR9H 1JRHI 4FQLL 1KB9J 2AJUL 4PJDA 5TE7H 1E6OL 4X0KB 1K9TA 1G6VK 4TN9A 1MJJB 2VYRE 5TGBA 3ARUA 5CJQH 3SDDC 3IRZA 3W0WA 3R1GL 5DEFA 3AS1A 4PRBA 1TJHH 1YZZA 5HI4C 3DPBA 4NKOA 2PR4H 3FQRB 4B0MM 1JFQL 3R4DA 4MXQD 5GGQH 3V6ZA 5ITBL 4DAGL 3OXRB 4HG4K 1HCVA 4M9PA 3O3DA 3EOAA 2PO6C 3VXPA 1YYMH 3UCRA 4YXLL 2IAMC 5D1ZD 1XCQA 1EUUA 5JW5A 4JFHE 1MI5D 4Z8FL 1QSVA 3NIFF 2GW5A 2BERA 4HWEH 2EDDA 3HE6C 5TFSL 5GSVA 4KKBC 2EH7L 4R2GB 1BFOB 5B4MC 4M3JA 1UWGH 3E8UH 1F90L 1RJLA 4P9MH 1YNKH 3P0VH 1KJ3H 3QXVA 2CJUH 4M00A 2NX5B 5FHAH 3MNWB 1V7NL 3MOBL 1G9MH 4IRSD 3U36A 4LPTA 4X8JB 3KYKL 1JPST 2J7LA 3VG9B 3WN5B 1A0QL 2DM4A 3HUJB 5EU5A 5HBBA 5L88H 1MH5B 3HB3D 1U9KA 3CFBB 1MREH 3E6HA 2BRRL 3MXVL 3F7VB 1DFBL 3GKWH 4JQIH 1UYWH 3GMLB 4WW2C 5IW3A 4QTIH 3FCTB 4KGJA 1A14L 5D93C 1OY3B 4KTDH 1DDHA 5DMGC 5L2JB 5F88A 3STBA 3UJTL 5DD1L 5I9QB 2VIRA 4IMKA 2F9BT 1CXLA 4P2OC 5D6DC 2R2EA 4M48H 4M6OL 4FQIL 4R26L 1EVTC 1RZJL 5DUBA 4NCDA 1XCTA 1UM5L 1DUZA 2QJDA 2X09A 3NA4A 4TUJA 3MRNA 3VXQB 3K4AA 3PDOB 4E0RB 1QKZH 1NGQL 1T0PB 5K9JH 3KPRA 1W72B 4AZ8A 2DDQH 7FABH 5HHPB 4KJWC 3ULVD 4MCZB 1WSST 5T5FH 3S96A 3H7BA 2FB4L 2W0PA 3QQ4A 3A67H 4P5KA 1CICC 1MJ8L 4JFEA 4EVNA 3OL2A 1QA9B 1U36A 5HHNB 3NCYP 1JP5A 4QRSA 5JA8B 4Y4FB 4YBHA 3KS0H 5IROC 3IJSA 4KGLA 1X5ZA 4M4PA 3H8NA 1D6EA 1TITA 2DI7A 5FGBA 4UDUA 1QHOA 2YZ1A 1NBYB 4BH7A 1BQHA 3FRUB 3KPSA 1BZ7B 1ES0A 3HTLX 3K8MA 1VKXA 2Z4QA 4H25A 5IIEB 1DQDH 1JGUL 3UBXA 1ZS8B 4LQFH 2P5EE 3VH8G 3IFNL 4AENA 2JIXD 3FN0H 4B41A 2EIZA 3TYFA 3QYCA 4LHJB 1IKFH 2WV3A 2P24A 1F8TH 3LIZH 4L1DA 1EUTA 5IBUG 2V7HB 4XT1C 2F19L 1CGXA 1ZEAH 2CIIB 4ODHL 3VFNB 2VERN 1KLUA 3UDWA 3WUZA 4KDVA 3NFNB 5DD5L 3UTOA 4AY0A 4DCQB 2FEDC 4MHHI 4JPWL 1NFDB 4OI8A 4HC1A 3P77A 3QDGD 2Q6WB 4NFBA 2MQ0A 4RWHA 2HVKA 3WO4B 5HGDB 1ZLSL 4YWGH 4YAQB 3EDDA 3RGVA 2LAAA 4HQQH 4GW4A 4YHLH 4PRDA 3SQOH 4QT5B 3HR6A 2N1KA 1YY8B 4AL8H 5KG9A 1KACB 5B39B 3QUXA 2EE3A 3O3EA 1OAXH 4YQXL 4H8WH 3WFCL 3QIBA 4D0CB 2GHWB 4LQ1A 5EIIB 1FFQA 3QXTA 3B2UD 4G9FE 3Q6GL 5JLZB 2X4NA 4U6VH 2C4FT 4XWOD 2UY7A 1YMMB 4B53A 4J3OC 2QQKH 5I66B 1P1ZA 4R8WH 4N0FB 3DNKA 4UZGA 1N8ZA 5C0CA 3O6MH 4WWKB 4XHJC 4EUPA 3O6FD 4QOKB 5FOBA 2XN9B 3U6RB 2B20A 1I1AB 1U6AH 4HJGB 1TPXB 5ADOH 1YEIH 2YSSA 5ESQA 4LLMA 4LKXA 1S9YB 3OHXA 1ORQB 2FJGB 3OB0H 5IBLD 1CTNA 2AXFA 4JN2A 3L95B 3WD5L 4KKAC 1A6ZA 3DBXA 3HS0B 3GO1L 1UFUA 1I9JL 1JHKH 2CKBL 2R9HC 3HMXA 1AC0A 3VFSB 3B5TA 1EJOH 4PRIE 2NLJB 5DRNA 4LRIC 3PV6A 1JHTB 4R96B 3NIGE 1L9NA 3KJ4B 1CL7H 1UC6A 2XYCA 1P4IH 3VH8A 1CCZA 1SEQL 2GCYB 4FZ8L 1ZWIB 3ZE0E 5GPRA 1JN6A 1ZHKA 1G7IA 5D7JC 5L2KD 5I74C 3FB8A 5LQBL 1U8PA 3AS0A 1DCLA 4PG2C 2YC1A 1AO7D 2OX5A 5T3XD 1LO0H 2GK0A 5DRXB 4PB9L 4EDXB 2J12B 1EHLH 1KT2B 5HVFB 4U2ZA 1OHQA 1ONQA 4OCRH 4WHTA 4XPGH 3ULVH 1GXEA 4XPTH 3V5KA 3RL1B 3KDMB 2DQEH 5GGRB 4NO0B 3BZ4B 4HKZB 3F6LA 5C0BD 2WWKT 5DUPH 5KSBA 3L3HA 3IXAA 4M7KH 1TJIL 4IRZL 2NY5C 4PJCF 3MV7B 4JE4B 5SWQB 4Z78A 1LP9F 1M7XA 1T4KB 5L8KB 5I2IA 1KXVC 5CD3B 3PHQA