5DFWH

Crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment k13
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
222
Chain Sequence
VRLHQSAAQLVQPGASVRLSCTTSGFNFKDSYLHWVKQRPAQGLEWIGRIDTGNGNVKFDPKFQDKATITTDIPSMTAYLHLSNLTSEDTAVYYCVPYGYGFHSWGDGTTLTVSSDIQMTQSPASLSVSVGETVTITCRASENIYRTLAWYLQKQGKSPQLLVYGATTLADGVPSRFSGSGSGTQYYLKINSLQSEDFGTYHCQHFWGTPWTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD81 antigen
publication title VH-VL orientation prediction for antibody humanization candidate selection: A case study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 52
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH02
3O2DA 1FZKA 3A6CH 3GM8A 2PW2B 4X5XB 4L9LA 1IAKA 4ZXBD 1IKNA 4NKMA 4OM1L 2V7HA 4Y5XC 5E8NA 1PG7X 1J5OH 3C5SB 1F6LL 1OW0A 4Y4HA 1A3QA 3BFOA 3IU4L 3MLXL 4XVSH 3L3OB 4MS8D 1HQ4A 5ESAA 2FJHB 1MAJA 2GSIB 1UM5L 2BRRH 1WK0A 4HJJL 1J1XH 4L4TD 4JJ5B 2R0KH 3U0WL 1I3UA 4PJBF 4XPBH 4P9HL 4DGVH 4XPAL 2BNQA 2X4SA 4R9HA 3VXUE 1A47A 3VXQB 4YFLF 1XCTA 5D1ZB 3DYOA 5EZOH 3LZFH 1PZ5B 2BMKA 3RI5F 3CFCL 3WEXA 4ZOEA 1RULH 1W0YT 1EFXA 4L9LC 1IKNC 1MCLA 4QXTB 2NZ9C 1C1EL 4QTHB 5EOQL 4Q6IC 2ENYA 3P2TA 4GQ9H 4ONFH 2X1WL 3F7YA 1SBSL 3QXAB 1OW0C 5J12C 3B5TA 4KK8D 2FYYB 3ARZA 4M6ML 4EI5A 1GZPA 5CINL 3G6AB 3VG9C 4N1HB 3SHSA 2VDOL 2FIKB 3N06B 1RMFL 3V8CA 3UBXB 4WUUB 1KELH 4UTBH 2C7UA 2HKHH 1EGJA 2OI9B 2BNRB 2GK2A 4L1HA 3RKDD 3H3KA 2KZWA 4TUJA 5E95B 4BZYA 3H9SB 1IRAY 1Y6NR 4YHNB 5IQ7L 2W9LA 3ZO0A 3E2HB 4MA3A 3X13B 4DFHA 1NFIA 1KXVC 1ONQA 2NY6D 3DRQA 1OTSC 3Q1SL 4JM4H 2CRMA 1KEMH 3TBWB 2AEPH 5KAQF 2VISA 1AGFB 1MELA 4NQXB 1BX2A 5AZ2H 4KWUA 2BCKA 4LASL 2PKDA 4HX1B 4MB4A 4C56E 2ZKHL 4ZODA 1FG2B 1PD6A 1CFBA 5DQDL 3MRQA 3O2WH 4F3FB 1A6AA 2IMNA 1IM3B 2EO9A 4XCCH 3UTZB 3GSNL 4BSJA 2ESVE 1A7NH 2IPKA 4KKBC 3AU1B 2ICWJ 2X4RA 2NX5B 2HWZL 2VQUA 5FYJE 2DIBA 5HYJB 3QHTC 4KTEH 1II4E 2A1WL 3FB8A 2K7QA 4EIZC 1G9NC 4P2YA 3CH1A 1FFNA 3WL9A 1U3HA 2NW2A 4PRHD 1SJHB 2AJUH 5JW3H 1R3HB 2EDBA 5C09A 2KQNA 2Z9TA 4M1DH 1F4WH 1ZANH 2C3WA 4YR6B 5EBWB 2BDNH 3ULSA 2ILLA 3MRHA 1FLTX 3CXDL 1BVLB 4S1SH 4AM0B 5I1HH 5ESQB 4KUZH 1BLNA 1W72H 4JY5H 2Z31D 4PG9B 1DE4B 4AEHH 1RFDL 4JFDE 1L4IA 4NNXB 1CD1B 5ITFB 4M7LH 4ZFOB 2AI0L 1B6DA 4ZSOB 2Y9RT 2LAAA 4QHMA 1MFNA 1KIUA 5J89A 1E4WL 2ENSA 2YPLD 4NPYB 1AHWB 2CRZA 3PHOA 4NP4H 5LCVL 1S7VA 1CK0H 2FL5A 3WJLC 1FYTB 3QDJE 1FZJB 2EYTA 4ODSH 1R5IB 4E5XB 2ERJB 2AKRA 3GJFA 1OHQA 3MOAH 4ONHA 4MVBD 1U3HC 3EOBA 3X3FH 2ATPA 3L3KB 1IZKA 4JZNB 1FV1B 4WENB 5JOEA 3ARBB 3PWPB 3QCTL 3MLZH 4FQQA 2VKWA 1RZJL 1U8PA 1LE9A 1F4YH 4HLZH 4PGZA 2MCG1 4MDJB 2BHYA 4MJIB 2DLGA 1BZ9B 1S7XA 1W8NA 3UZQA 1P9MA 4MNQB 4LLQA 5EULV 5FYLD 5DZOA 2DICA 3HPLA 2ADGA 1I7UA 4YK4C 2P8PB 3CMOL 4NC1E 5I16A 3QUZB 2W92A 4Y4FB 4O58L 3KYAA 3LRSA 2VXSL 1AXSA 5E03A 5L2KA 4ZNEE 1ACZA 3PWJA 2FO4B 5J6HA 4DKAA 4CU7A 4OZIA 1N64H 1UZ8B 1BWMA 2KPNA 5E99L 1MJJB 1ZV5A 4U6HB 4OD3H 4XBPA 3I6GA 4Y4HD 1BJ8A 4YXKL 1T5WA 2YD4A 3RWDB 1MCFA 4HCRL 1CXFA 4K8RH 4LSRL 2CUIA 1JBJA 2V5SA 3T8XB 3HG1A 1OF2B 2Q7NA 3C8HA 1QLRA 4KMTL 3JTSA 1QFHA 2MOVA 5C0RH 1MLCB 3BKJH 4R2GC 4ERSL 3WNLA 4J12A 4LRNH 4N8CL 2DWEB 2V9RA 1JHLL 5DJ2B 3AMLA 1NCNA 5F7DB 2DQEH 2YEZB 5BZDB 5A2JH 4K3EH 4LSSH 3VI4E 3H9HA 4PRBA 3MRGA 4OCLC 2H26A 4G9FD 3MYJA 1EFXD 2OK0L 2R4RH 4QGTA 1K8IA 4JRYB 1U8IA 2NY2C 1CFNA 3VFGH 5A40E 1UKQA 1NSNH 1P7KB 3EO1B 4XX1G 1UH4A 4EI5D 1Q9OA 4PJDA 3Q6FB 2FX8H 4G9DA 2H6PA 5I30L 1FLRH 4IOFC 4KKAC 4Q0XL 2GSGA 3NCJH 4HUWB 1D5XA 2F74B 1KIQB 3OKLA 1SVCP 3QIBA 5ADOL 2VDKL 5FYKL 1JGDA 4M5YL 1UVQB 5GIRB 5D9SA 3DX8A 4UNUA 1SHMA 3S36X 5GS0C 2D7PA 3FONB 2MMXA 4LP5A 4JFFD 1QFUL 2CKBL 2FB4H 3IXAB 1LP9E 5IT2L 2FH6A 1NLDL 4RGMC 5EC1A 1F2QA 4LSVH 1MRDH 2Q6WA 2JIXB 2R0ZH 1XF2B 1CE6B 4J1UA 1RZGA 3ZE0F 4FP8H 3SKUD 3QT2A 1BZ7B 1TXKA 2FEEL 3ILQD 4ZUSB 2WBWB 4TOYL 3QNYA 4UIKL 5T33H 3I6KA 2GW5A 2I07A 2B1HL 3FQTB 4PGEA 2CK0H 4K9EL 3I3DA 2ICCA 5T3XL 2CUHA 4X6BA 1MRFH 2AV7B 4X8XA 5EU4A 4N9GB 1I3GH 1TJGH 1UM4L 2FNBA 1IGIH 2BVTA 1NBYB 3STZB 2A77H 2JK5B 4NZUL 1FFPA 1LEGB 4DZ8A 4RNRA 3MRCA 3EFFA 3D2UA 1CGUA 3D0VB 3FO1B 5IMKB 3EYVB 4TSCH 1LO5B 5BQ7A 3ETBF 5EZLB 3DRTB 2H32A 3O6FA 4FQXB 5H2BB 3VXRA 4KAQH 3D5OF 1BFVH 3IDYB 2HVJA 3RA7H 2ZOKB 2VLLB 4L8SA 4JZOB 4W6WB 5I8OL 1FRGL 3SPVA 3WS3B 4Z78B 5I75C 5KJRL 4E0RA 2PCPB 5F9WB 4NC2B 5GGSA 2OTPA 5FCUL 4HT1H 4ODXB 4OBSA 4O9HL 4ACPA 3HAEH 2P8LB 4OLEA 2DIJA 2I27N 1YYLH 4JFYB 3O3AA 4UOW1 3VGEA 1JYVA 1F13A 3RHWK 1TQBC 2WIIA 5GS2H 5L9DH 1G7QB 3VXMB 5DMIH 1CG9A 3EGSB 3T0XA 3D18B 4H1LH 4JZJB 3BAEL 2PW2A 4X5XA 5SV4A 3GRWH 15C8H 4R96B 3O6FC 4NRYB 2F19H 3C5SA 4IM8A 1Z3GH 4IRJA 5MI0C 3F58H 4L8SC 1FORH 1YECL 4R2GD 1D5IL 5BJTB 2FBJL 4QY8B 1N26A 2FJHA 2GSIA 4NC0B 4RGNC 3QEQA 2HKFL 4MJ6B 4EUPH 3L3DB 1L0YA 5DD6B 4JJ5A 1H3GA 3E6FB 2EEAA 1UWGL 3JWDH 4Z5RA 2NQCA 5HDBE 4PJHE 5IMMB 3BWAB 1X6LA 4WEBL 2HLFC 1TJHH 4L5FL 3VFSB 4WI7A 3VXQA 1HKLL 3P0GB 4CL7A 5D1ZA 3BIAX 5C0EB 3NN8B 3ULUH 5KVEL 1NC2A 5DFVC 3UYRH 3SDCA 2ID5A 3K4ZA 4QXTA 2QHLA 3U1SL 4LLWB 2Y36L 4BA8A 1QZ1A 5DC4B 5DS8A 1KN2H 4MNHA 3TH2T 4CDGC 2D31A 2FECI 1Z9LA 2WWKT 4IRJC 1P1ZB 1KT2A 2FYYA 2R23B 4DKEL 3KPPB 4AG4H 5L88H 2VLKB 5E2VH 1N0XH 4MAYB 3OZ9L 3WUZA 4YUEH 5D5MB 5JA8B 3UBXA 4GW4B 4KK6C 4WUUA 1CWVA 5IVXF 4HMEA 4M4PA 2VAAB 4Y4KB 1HCFX 2BNRA 3DVNB 4Y5VB 4OM1H 2Q76B 4YHNA 3LV3B 2ZUXA 4JO2L 1WIOA 3QUYA 3GBML 1MCWW 5D1ZC 5BXFA 3JUYA 3MLXH 3IU4H 5DD1L 1HHIB 3SDCC 3TBWA 5I9QC 1UM5H 4HJJH 4NQXA 1AGFA 3O3DB 3U0WH 1CLOL 4HGKC 3T3MF 4HX1A 2YKLL 4N90D 2F5BL 4P9HH 2ICWB 3BZ4B 4OZFH 2HT2D 4XPAH 1ITCA 1N5AB 1GOHA 2DS4A 1NUNB 1WZMA 1IM3A 3QIBD 2ZSWB 2BXYA 4HZLB 4J6RL 4YHPB 3A67L 3UTZA 3AU1A 3MUY1 5EBMB 2NX5A 1D7FA 1HILB 4NO5B 5DJZB 4C55A 5DGRA 5HYJA 1RUPL 4UAOC 5D5MF 1CGYA 2GCYA 3HHRB 1C1EH 5EOQH 3HR6A 4OV5A 3IDUA 4XI5D 5ID1B 3QUYC 1HH9B 1SBSH 5FUCC 2R2EA 3MZTA 4JPKL 4J3WA 4WW1A 3RIFK 4NQCA 1SJHA 4BYHA 2CXKA 4M6MH 3RIAK 5CINH 3LQAL 3BD5A 4XVTL 3MV11 4PRDB 4K3JL 2VDOH 3QPQC 1RMFH 1A3RL 4YR6A 4DCQB 5EBWA 4NJAL 4EKXA 4RFOL 1BVLA 3RVXC 4AM0A 4P4KD 2PTVA 4HH9B 1SY6A 2HJLB 1EHLL 5HHMB 3UBXG 5ESQA 5KSAB 2ED8A 2J6EA 1KTLB 1HYSD 5ICYB 1DE4A 4NNXA 1TZHB 2QBWA 5ITFA 4ZFOA 2O61B 1KOAA 4F37K 2DWDB 3AB0B 5IQ7H 4ZSOA 3B5GA 2XA8L 1YYML 3RDTA 4NPYA 1AHWA 3Q1SH 3BHBB 4PRID 1FYTA 1FZJA 4W4OC 1R5IA 4P5TB 3VXRD 4HWBL 5FOBB 1DEEB 3LN4B 2WWMC 2BSTB 4LASH 3PGFL 2DIAA 4FTVE 3OKKB 5HHPB 1HYRC 2ZKHH 2Z93A 5D7JB 3VXSE 4JZNA 5ITBL 5DQDH 1B2WH 3ARBA 4UQ2B 3PWPA 2XN9D 3FFCE 3P4NB 2RAMA 5JORB 1JTPA 5C0FB 3GSNH 1CI5A 1BZ9A 4J3XA 2HWZH 4MNQA 1R6VA 3RUGE 3RL1B 1G7IB 5BVPL 3HI1B 3AY4C 2A1WH 1NLBL 3TBTB 2CH8A 3D25B 4CU8A 2P8PA 4F9LA 1DDHB 1H3XA 4Y4FA 1EERB 1S9YB 4JHWL 3RDTC 2OMNA 3M1BB 2FO4A 2VL5B 4O2CA 2A6KA 1UZ8A 2ERJC 1MJJA 4U6HA 4OLXL 1INDL 1K6QL 3CXDH 1PGRB 5JHLL 1K5NA 2CDEB 3ARBC 1RFDH 3QEUB 2V7NA 4NCC1 5L8KB 2J4WL 2AI0H 2FATL 2V2WB 2DDQL 3KPTA 1MLCA 1MQ8A 3SKOB 1E4WH 4KJPC 3DIFB 5IOPB 5LCVH 1CICA 2DWEA 3SQBA 5DJ2A 2ZJSH 4F15B 5GSRB 3NIFF 2BVQB 2JB6B 5D1ZD 4F9LC 4Z0XB 2NNAB 4Y4FC 2XRAH 3O2DL 1C16B 2AXHA 5DA0B 3QCTH 4PY8I 1A9BB 5HTSA 5IKCB 5MEOA 2D7NA 3RX7A 1RZJH 3QO1B 4EQ3A 5MHSE 1P7KA 2EDLA 4X7TA 5J9PB 2QEJA 4EZMA 4LSQL 4J4PA 1EJ6A 4G43B 3CCHB 4FFWD 4KJQD 2D7TL 1YEDB 1HWHB 4Z7UF 3V5KB 2JCCE 4WUUD 3LKNB 1LEIB 1DFBL 4HUWA 1MCBA 4O58H 2F74A 1KIQA 2BNRD 2VXSH 4WEMB 3ZTNL 5JXEC 3H9SD 4ZUVA 1CICC 5E6IB 4Z7OF 5KVGL 4JDZA 3RTQC 1U8HA 4JY4A 1CF8L 2DL9A 1FN4B 1XGYL 5GIRA 2H2SD 3B2VL 3F65A 4OCMC 5E99H 2VDPL 3BGFC 4YXKH 3FONA 4OFDA 5AG9A 4HCRH 2XKSA 3IXAA 4S2SB 4LSRH 5SWZE 4U1GB 4NZJA 2JIXA 1XF2A 5E94B 3ZLQC 4GG8B 4BUGA 3RVXD 4RBPH 1BZ7A 2HJFB 12E8L 4ERSH 4ZUSA 1WWWX 4GBXC 3PGDA 4J4PC 4N8CH 1I8KB 1JHLH 3U7YL 4HJ0C 2LU3A 1JRHI 3FB6B 4HS8L 1BIIB 3FQWA 4YH6A 2NX5D 3UEZA 4NZTL 1EO7A 1NBYA 5DJ6B 3STZA 1EGJL 5HYJD 2JK5A 3TF7C 4WI5A 2OK0H 1PYWB 1ACYH 1LEGA 5GS3A 4MAUL 4I18B 4Q9RL 2BX5A 3HE7C 1QSFE 3D0VA 3FO1A 1F5WA 1G9NL 5DHVB 5IMKA 4OUUB 3ULVC 3EYVA 1K4CB 4CMHC 3U4BL 4NM4L 3DRTA 4FQXA 2V5RA 5FM5O 4R8WL 4G42B 2OTUB 5I30H 2IH3B 2ZOKA 4Q0XH 1KNOB 2VZ1A 3WS3A 2WW8A 4Z78A 1WT5A 1AY1L 2PCPA 4OGAC 5JIKA 2OM5A 4W4NA 1TIUA 4OCWL 2WUBL 2VDKH 1BFSA 1NQBA 3IS0X 3KXFB 4ODXA 4OGYL 5FYKH 2P24B 4M5YH 2P8LA 2I25N 3MGOB 1YY8A 4HD9A 3WHXB 5DQ9B 1HSBB 1ZAGA 1PAMA 4JFYA 2JJUA 1QFUH 2CKBH 2QL1A 5IT2H 1DVFA 1CU4L 1FYTD 1NLDH 5CP3H 4G6KL 4PJIA 3VXMA 3ZDXF 4BH8B 5CLTA 5EOCJ 3EGSA 3ARDC 1JK8B 3D18A 1DUYB 1SJXA 3HRPA 3LIZL 5J1AA 5L6YL 4TOYH 4UIKH 5DJ0B 5FYKU 3ARBD 3PWPD 2CLZA 4CUCA 4U1JB 2B1HH 1JZ3A 3I6LD 4FQXC 4NRYA 4K9EH 2PTUA 1UENA 3IDYC 5FHBL 5K33A 5T3XH 3MRRB 4DN4H 4MJID 4OFIA 1UM4H 2EO1A 4KJPD 3O3EB 4MNQD 3QPXL 2Q7YB 2XPGA 4MJ6A 2Q3ZA 4NZUH 3L3DA 5DD6A 5BRZB 2VXQL 4LHUA 2A0LC 3E6FA 4IHOB 3EYUL 3RFZC 3QUZD 5F8QC 4PY7B 4Y4FD 4JGUA 5IMMA 3VA6A 3BWAA 3TEUA 3Q0HA 3VFSA 1DVFC 1INEL 5C0EA 5FDYA 5HSFA 3GFUA 4M43L 3F8UB 5I8OH 1FRGH 2GUOB 1R3LA 5KJRH 1KLUB 5E0QA 1JVKA 4LLWA 1S9XB 3LN5B 4NRXB 2B2XL 5FCUH 1UJ3B 4O9HH 1KCSH 4HIXL 1P1ZA 5C92A 2CD0A 2R23A 2IBGA 4GRWB 1M7DA 3MFFB 3KPPA 1A9EB 2VLKA 3LDBC 3O2VH 3KPRE 5IVOA 5D5MA 4J2XA 1A64A 4GW4A 2A6JA 2JB5L 4YEEA 5JQ6L 1QFWM 2VAAA 4Y4KA 3CX5K 1A21A 3DVNA 3V6FB 3BAEH 3C5ZB 4OLWL 4HS3A 2R8SL 2Q76A 1F02I 1J0JA 1RUAL 4KGLA 3LV3A 4JRYD 4N0UB 2N1KA 2HG5B 1JI2A 3CUPA 1YECH 4X6DE 2HAZA 3IDNB 2FBJH 4IMLB 4UT6L 3QAZC 1HHIA 2J1KA 5F3HA 4J4PD 5GGTA 2HKFH 3O3DA 1U93B 3BZFB 1YN7B 1UWGH 1WISA 4O02L 3BZ4A 1OSZB 3CFBB 1MFBL 4MQXD 4LHUG 5CZXC 1TZGL 4HQQL 1ZK9A 4WEBH 2Y06L 3VXTB 4YHPA 2E8YA 1HKLH 3G6JE 1XZ0B 4XNUL 4GRWF 5KVEH 3ULVD 5E5UB 1HILA 4L29A 5DJZA 4AH2B 1GVIA 1TETL 5HI3C 1NBZA 2ARJB 4K23H 3WIIL 4D0BB 5GS0L 3U1SH 2Y36H 3EFDL 5ID1A 4QGYA 2JIXD 3D3VD 5C1MB 4MQ7B 1HH9A 5D2LE 3SY0B 4DZBB 2XT1B 3BW9B 4RBPK 1UG9A 4OGAD 4DKEH 1J05B 4PRDA 2W59A 2GT9A 3OZ9H 4KJWC 4DCQA 5E6ZA 4M62L 3VFMB 2H8PB 3S35L 1R24B 2FH8A 4HH9A 5D7IB 3QB7C 4W6XB 5KSAA 5ICYA 3RKPA 1MNUL 3WO3B 4EEEA 1TZHA 4S1DD 2YK1L 2O61A 5ANME 1ZKAA 3HNTL 2DWDA 4FQPA 4JO2H 1QFWL 4K07A 1L6ZA 2ZUQB 3EJJX 3GBMH 3SGEH 4UDUB 4WW2B 1Q38A 2IFGA 5DD1H 3JWOL 3BHBA 1CXHA 5HGDB 3CFJB 5I0DA 3QZWB 1J10A 2J8UF 4M7LT 5FOBA 1CLOH 3RNKA 4IDLA 2BSTA 3OKKA 3EYQC 2YKLH 4Y19E 2F5BH 5D7JA 4UQ2A 1MH5A 1MCDA 1T2XA 3LB6D 4J6RH 1VEMA 5JORA 1IGMH 5C0FA 1RZIB 3A67H 1B9ZA 1F58L 3OR7B 1QSVA 3BSZL 1EHNA 4M4RA 2WV3A 4JQVA 4KKLC 3QDGB 1RUPH 1G7IA 3BN9C 5E4EC 3RL1A 5KSAC 2R1WB 3HI1A 4L3EB 2HTKD 2W0FB 4DW2L 3ULUE 3E6HB 5C08D 3TBTA 3VXMD 3V6OA 3D25A 3AB0C 3DXAB 1S9YA 5F71A 1NMAL 4JPKH 4HW6A 3EDFA 3FO0L 1X4ZA 3LQAH 4XVTH 4D0DB 4Y2DB 4Y2OA 1H8SA 1HCVA 4K3JH 4U2ZA 1A3RH 5IMOB 4WW2F 4NJAH 2R2BA 4RFOH 2V6HA 4F7EA 4ODWA 3GMLB 1IEAB 1EHLH 5BS0E 1FVEB 3QEUA 1OGTB 4TSBL 5E8OB 1RVFL 4JEGB 2XWTB 3DUUB 4GUPA 2P5WB 4F9PA 3TYGL 2BSED 1EO8L 2V2WA 4ZUWB 5HY9B 2Y5EA 4A2LA 2XA8H 3SKOA 1YYMH 5I1CL 4JFZL 1T7XA 1BQUA 3DIFA 4OF3A 5AG8A 4LP4A 5IOPA 2GKIA 1UEMA 4OTXL 4LKCA 3EKCA 4HWBH 2BVQA 2K1MA 3V6OC 4MWFA 4OLZL 3PGFH 4Z0XA 3WSQL 1Y18A 5CP7A 2NNAA 4JFHD 3KJ4B 2DLFL 43CAB 5ITBH 1C16A 5HHOB 3DV6B 2R4SL 1A9BA 5IKCA 3KPMA 1FL6B 3QO1A 5I8KL 4P2QB 5GHWL 4X9FA 3UAJC 2UV3A 4WRLA 5J9PA 3BZDA 1PVHA 3NZ8B 4PJFB 1QBLL 3CCHA 3G04B 5BVPH 2VLKD 4YFLI 1YEDA 4MAYD 2APFA 1JZ2A 3V5KA 1NLBH 3WMSA 2EE6A 2WINB 4F80A 5HD8D 3R0MA 3LKNA 4PPTA 1LEIA 4F9PC 2FEDC 4Y4KD 3TIEB 2MQ3A 4JHWH 3P0VL 5HI3D 4WO4C 1W0VB 4PJCE 5E6IA 2ATKA 1DANT 2J8OA 3MBEB 1F4XL 4TYUA 1FN4A 4XP4L 4FFVD 1Q72L 5GRUH 4OLXH 4LPWA 1INDH 1K6QH 5JHLH 3V7AG 5DRZB 2VC2L 3RY4A 1IC5L 4HK3J 5E1AB 4QXWA 4KJWD 1DUZB 1OLLA 3VDCA 4BFGA 3D1MC 3OR6B 2J4WH 1NCCL 3DTXB 3O8XA 2FATH 3HZKA 2DDQH 2QQKL 2DMKA 3DMMB 5DSCB 2HJFA 2DKSA 1HHJB 2MQCA 3ZT7A 5EUOB 3HPJA 2YD5A 4YJZL 3IDXH 3ARGB 4YGVB 2EDTA 3FB6A 4HFWB 5CD5C 4PJFF 3PABB 2VQ1B 5KSUB 4QHLA 3TC9A 1E27B 3O2DH 2QKIB 4OFPA 3FOLA 5DVNA 5E6IC 5F88B 4Q2ZA 5DEFB 2IAMB 4I18A 4LNVA 4Z7WE 4JQXA 4OUUA 4HZAA 3W11C 1P84K 1K4CA 4LSQH 4PJAF 5KOMC 4J8RB 2NY1C 2D7TH 1VGKB 2DKUA 5D6CB 4U1GC 4B53A 4DKFL 1DFBH 1KNOA 3NCCB 2MNUA 3O8XC 3DGGB 5HHMD 2FR4B 5M7QA 3BN9D 3V4UL 1GGBL 3ZTNH 4XNYL 4Y1AB 5KVGH 3KXFA 3D39B 1X9QA 1CF8H 1KYOJ 1T1WA 1XGYH 2P24A 4WFHE 5GPRA 4KHTL 3TGXA 2VDPH 4HJGB 5DQ9A 1HSBA 4HWNA 5I73C 2OQJB 2XTLA 2DL2A 5EUOF 1WFTA 4JKKA 4D0CB 5LGKA 1R5WB 4OF6A 5D1XC 3KLHD 4L4VD 4XGZA 4BH8A 5EFIA 1AGEB 1MI5B 4P5TD 4V2BA 1JV5A 4I18C 1AGDB 4JM2B 4JQXC 1QRNB 5D7JD 3X3GL 3I3EA 12E8H 4NQEB 5DJ0A 4I48B 5C6TL 4U1JA 3U7YH 5T1MB 3BKYL 3FB7B 2AJSL 3MRRA 4AIXA 2NMSA 4HS8H 5FHAL 3AC0A 4NZTH 3O3EA 1EGJH 2C1OB 3GMOA 5C0IB 4HAFA 5JLZB 5BRZA 1QO3A 4JFEE 2BK8A 2J6EL 2F58L 4IHOA 4MAUH 2Y7QB 4L8CB 1G9NH 3L7EB 3ZE2F 2X4TB 3QWOB 5T1KB 5KSVB 4GKZB 1N59B 3U4BH 4NM4H 1UGNA 2OZ4L 1P7HL 2E7CA 5EU7E 2J88L 1EZVX 4JKMA 4LLDB 4R8WH 4XWGL 3BXNB 3TV3L 2NY4C 3MLUL 1CL7I 1OT2A 3RWFB 2GUOA 1KLUA 1AY1H 5EO9B 3DX9A 1S9XA 5CJXA 3LN5A 4NRXA 4U3XA 2WUBH 4OGYH 4KRPB 1MCPL 1TMCB 3OB0H 1T2QL 4RDQG 3MFFA 4PJ7B 1A9EA 5C0DB 2EZ0C 1NBVL 1JP5A 5C9JB 4G6KH 1N6VA 2OXHA 3TJEL 3RVWC 1QR4A 3HB3C 1HNFA 4CAGA 1Q9LB 3V6FA 5IIEB 3C5ZA 3LIZH 1JGLL 4POUB 5L6YH 3ZKMD 1EFQA 2VIRB 4PJEB 5JHDA 1LO0L 1YPZB 4N0UA 4MLIA 3UJIL 4O5LL 2HG5A 5FHBH 4LVHC 4U4BA 2NTFB 1AKJB 3F12A 2ITDA 5CBEB 3IDNA 3LPWA 2VMFA 4BSVB 3KGRA 1SM3L 3L5WB 3QPXH 3U9UB 1EBPA 1L9MA 5CJXC 3PL6A 1T83A 2VXQH 4JREC 3IDJA 1U93A 2VWEC 3HI6L 5EA0L 1U8OB 2ADJA 1YMMB 3BZFA 3ZKNC 3EYUH 3CFBA 3QUXB 5DMJB 5T5NF 3MRLA 4CBPA 1JE6A 2DQDL 2OR7A 3VXTA 3DVIA 4P2RA 1CD9B 1INEH 4NOFA 5JW4R 2IQAB 4M43H 5FK9B 3C5ZC 1T7WA 4D0BA 4M48L 4D3CL 1VKXB 2B2XH 4HG4K 3KDMA 4B7IA 1Y6MR 4MQ7A 3SY0A 4HIXH 1OGAE 1T7ZA 2NY0C 4OQ1A 4TPRL 5ALCL 5FYKE 4PJEF 3LMJL 2NYYD 2FJGB 1FAIL 4X5WB 3PL6C 3DNKA 1T83C 3VFMA 4MNGA 1EO5A 3CAFA 2JB5H 5HHNB 4HWZB 5JQ6H 4KI5E 5D7IA 4OLWH 1AO7E 1AJ7L 1ZWIB 2R8SH 2L7JA 3NFSL 1RUAH 4FHBD 4H8WC 5AAMA 4BFIA 3CSYA 1BBDL 2AXFB 3MV8B 1GGUA 2IPUG 4UT6H 1QQDB 3ULVL 5T3XE 2FLBT 4PJGB 3CFJA 5HGDA 3HMWL 2AEWA 4XMKL 2MTPA 3HUJE 1FQ9C 3SDXE 4MQTB 1T4KB 4O02H 4XVUC 1MFBH 4X5LA 1GOGA 1TZGH 5F1KC 3GIVA 4HUUB 4HQQH 1ZT7B 4GS7C 2Y06H 3SO3B 3KXFD 3ZKXB 2XKUA 3EIFA 4O2EB 1BOGB 1BZQK 1CIUA 3CDFA 3OR7A 3QDMA 4MJ4A 2OS7A 1F97A 1NCTA 3UROR 1TETH 2R1WA 3WIIH 8CGTA 3INUL 5GS0H 4L3EA 2W0FA 4Z6AT 3EFDH 2GJJA 4X6EB 4YHOL 1M7IA 1TLKA 1FDLL 3IVKB 3DXAA 3REWB 4GLRH 1BQHB 3C60B 3QH3A 5TE7H 4WI8A 4HUMB 1TVBB 3U7WL 4D0DA 3WDHA 2D9CA 4KV5F 7FABL 2Y72A 5FGCE 4YX2L 4M1CC 4M00A 4WI9A 5MENB 4M62H 4ELMB 3V6BR 3U2SB 1KULA 3N0PB 1NKRA 3GMLA 3S35H 1IEAA 2GJ6B 5IVXE 4RFEB 1MNUH 1FVEA 3LKPB 5I2IA 2QADC 2YK1H 2XWTA 3HNTH 1BJMA 1QFWH 1S7QB 4FG6C 4ZUWA 3T65B 2FEEI 1ZA6B 1U6AL 1X5IA 5SWQB 5FXCH 1NGYA 3ARUA 1KLGB 5J7CC 3FN3A 1BEYL 1NMBL 2GY7B 43CAA 4YPGA 3BYTA 1J8HB 3T3ME 4WTXA 4BQ6A 2EICA 5HHOA 4GG6A 2NXZC 1FL6A 1YUHA 4ETYA 3LEVL 5D7SH 4PREB 3ZSSA 4G8GA 3NZ8A 3BSZH 3FQUB 3OB0K 4QRPE 1KGCD 3G04A 3TJHC 3WO4B 4DW2H 4ZS6D 3IDMA 2WINA 1UT9A 4JFPB 5H94B 3RWEB 3T3PF 3VE0B 1KJ3L 4DOHE 3ME0A 4D94A 1QPXA 1ZT4A 1NMAH 4PB9L 3C5ZD 3FO0H 4PP2B 4J3TA 2X70B 2CJUL 1W0VA 4NQDE 5E5RB 4XWOC 3MBEA 1I9EA 3ZL4L 1FSKC 3W9EA 4CGTA 3JV0A 4IRSA 3HN3A 5DRZA 2FDBP 4U1NB 2BRQA 4NQVA 5E1AA 5I1AB 2YZ1A 1RZ7L 1V3LA 1NEZG 4OLVL 4QNPF 4TSBH 4B7LA 5L7XL 3DTXA 1H5BB 2IANE 2QJDA 3TYGH 1EO8H 3DMMA 5DSCA 2E9IA 5I1CH 1HHJA 4JFZH 3GSRB 3VRLF 4KRMB 5EUOA 3FHAA 4YC2C 4OTXH 1FNLA 3ARGA 1VEPA 4YGVA 4NDMB 1X5YA 4IIQB 4HFWA 4OLZH 1FO0B 3PABA 2VQ1A 4WDIB 3WSQH 1URLA 3KR3L 4MA7L 2DLFH 5IFJB 3WN5A 1TPXB 1E27A 2QKIA 3O81A 1YDPB 3QP3A 2R4SH 4JQIL 1LEKB 2VLRD 3MBEC 2IAMA 4U6YA 2YA1A 5GHWH 5IGXL 2CK2A 5FUZL 4XVUD 4HIJB 1L7TL 3QFJA 4OZGF 4IRSC 3WNMA 1CLCA 3UTPE 1QBLH 4J8RA 1I9IL 4LPXA 3QSKB 1VGKA 3C6LB 4KTDL 5GGTL 4XCEB 1VDGA 1EV2E 3S34L 1GIGL 3DGGA 1JF5A 3HLAB 2OCFD 5FGSA 2FR4A 3P0VH 1WWCA 4FQ2L 5CGTA 3DURA 1H3WM 4OZHE 4C58B 2VABB 4V1DE 2MHAB 1WZKA 5JIIA 1F4XH 3ARGC 4N68A 4XP4H 1Q72H 3PG2A 1PLGL 2OQJA 3MV9E 1G7PA 3MX0A 2VC2H 3WN5C 1R5WA 1IC5H 5I74C 1UWEL 4B50A 2Y6SC 4A6YL 3QO0B 4XBGA 4LCYB 4JAMB 1AGEA 1MI5A 2GJZA 3FO2B 2IAMC 4JM2A 1AGDA 1NCCH 2PYEE 4NKQB 3P77B 1QRNA 2QQKH 3MYZA 2XZZA 3OHXB 3KPOB 3MRIA 4I48A 3UXFA 3AM8C 5T1MA 2X09A 3FB7A 2IBBA 3SGEI 2BSRB 4U7SA 4FG6D 1CGSL 5EN2B 5JUEL 1MAML 1RIUL 4G8IA 3EJZC 4M93C 1X5HA 4Y5YB 2C1OA 3QDGD 5JLZA 3OPZL 4LAQL 4L3ED 4YIQA 4AK1A 5J8OA 2DD8L 2YR3A 5E2WL 3IKKA 2Y7QA 4NKOA 4L8CA 3DXAD 2X4TA 5T1KA 4C54A 4GKZA 1N59A 4BK5A 1E4KA 4Y2DD 5DZNA 4FZEL 1N3NB 1ZGLM 3E0GA 3JTTB 4LLDA 4MX7B 3GMRA 5H37G 3VJ6B 3RWFA 4JM2C 4DKFH 1GGYA 3K4AA 4HULB 3QEGL 3V4UH 5EO9A 1GGBH 5ADPL 1MCHA 4XNYH 4P23A 3OKDA 3K80A 4HKBB 3SE9L 5EU6B 2P5WD 1WFOA 3S7GA 5SWSB 4KHTH 2DMCA 3UZEA 4NQUA 1G0DA 4FFYL 4PJ7A 5C0DA 3N9GL 5HXMA 4XWOD 1IVLA 5C9JA 3GJEB 5E6YA 5EC2A 2CMRL 1BOYA 1C7TA 1Q9LA 5F1NB 5IIEA 5KSBB 3SOBL 3X3GH 3I3BA 1YMHB 5HHOD 2VIRA 5C6TH 3N85H 4PJEA 3I85A 3IJHB 1E4KC 1QLFA 1YPZA 1EHXA 5K9OA 1S78C 3BKYH 4P2QD 4RISL 4YHIB 4GMSL 2AJSH 1T89A 5HDOA 1AKJA 4R97C 4R4FL 5CBEA 4BSVA 1MEXL 4PGDB 3U9UA 4P23C 2HVKB 2GK0B 3RVUD 1JNLL 2J6EH 3SKNB 2F58H 1U8OA 1YMMA 4KRPC 1DN0B 5CCKL 3BIBX 1A22B 1T1XB 3NCYS 3QUXA 4GO6B 4I13B 3A0OA 2F53B 2VE6B 2OZ4H 4HC1A 3HCVB 2J88H 3MBED 4XWGH 3TV3H 3MLUH 2IQAA 3MNWB 5IB5B 4JRXE 4NFBA 4ZOBA 5FK9A 4XNQA 4RX4A 4ZNCD 1XGUB 3OGCB 1RZKC 1H8NA 1VKXA 4YFEA 4OIIL 4PBVC 1MCPH 4PUBL 5KSBF 1T89C 3BESR 2O5ZL 3V9FA 2AGJL 3DMMD 1T2QH 4P3CL 3BMVA 3TA3B 2BNQE 2PR4L 1LO3H 3NTCL 2YWYA 2FJGA 1NBVH 1NAML 5IJVA 3T4YB 3WFZA 1XCQB 2YPKB 3TJEH 3KPSE 5HHNA 4HWZA 1IBGL 1VESA 1WQVT 1UA6L 3MRPB 4U1MB 3WXVL 3VI3E 1I4FB 1JGLH 3ECBB 2DYPB 3OKEB 2D2OA 4XAKD 1AD9B 5DTFB 3TN0A 1HXYB 1LO0H 2JJTA 2AXFA 3UCRA 3MV8A 5GGVY 4O5LH 2DQUL 3UJIH 3NBNA 3RX8A 1QR1B 4YDLB 2CR6A 1V05A 1QQDA 2Y07L 5F3BB 4HS6B 4N5ED 4PJGA 1JUFA 1A4JA 4ZDHA 3HI6H 5EA0H 3RBSA 3DX7B 4R26L 4Y89A 2GTWB 1RIHH 1U92B 1N6UA 1GH7A 4WVRA 3LEYL 4Y1AD 1JNHA 1ZT7A 1T3FB 2DQDH 4FFZL 2R0WL 3LOWA 3D39D 4XBEL 2ZG2A 1J1PL 4O2EA 1BOGA 3W39A 4G6JL 3GMPB 3MRBA 3KWWB 1WTGT 2DKMA 4Q7DA 4D3CH 1GXEA 2UUDH 1MI5D 3TN0C 3MV7E 2JJTC 1L7IL 5K93A 1BQHA 1QRND 2Z0BA 3C60A 4XHJD 4LGPB 5ALCH 3BN3B 4NQED 1TVBA 3LMJH 5IBLD 2EDKA 1FAIH 3OB8A 3F7VB 1LO2L 4XCYB 4ELMA 5CEXA 1WUNT 5ERWA 2GJ6A 1KN4L 4OQTA 1V3MA 1WCQA 1AJ7H 3VFWB 2EC9T 3LKPA 2OXGA 3NFSH 2ZUVA 5FO8B 3QIUC 1A14L 1BVZA 1XF4B 1HOCA 1BBDH 3KYKL 3NZHH 4CMMA 6CGTA 4NO0B 1DQML 3K2MC 1S7QA 4UIMB 3T65A 1U3YA 2UZXB 1ZA6A 5EZJB 5T1KD 4BZ1L 3IS1X 3ULVH 5C09E 3U0PB 1IL1B 1CXKA 3V5HB 1KB5B 3HMWH 4XMKH 1KLGA 2APVA 3VA2C 1IFHL 1PX4A 1MY7A 4B5EA 2E5EA 2ESVB 3C60C 3DBXA 1UADC 1J8HA 2YN5A 4P46B 1QP1A 4PYGA 3WLBB 4ONGL 4NCC2 1IQWL 5EPMB 2CDFB 2EDRA 1H15B 3DI3B 1A6WL 3IU3A 3FQUA 5C3LD 4MLSA 3TPUA 3LY6A 1K4DB 4U1HB 3INUH 5F7EL 1WLHA 4JG0L 4MQSB 2ICEB 3PWVB 4JFPA 5H94A 3HA0A 3VE0A 4YHOH 1FDLH 3SQOL 1C5CL 4WU5B 2XA3A 5CSZB 1EJOL 4PP2A 2FHCA 3U7WH 4XX1E 5F9JA 3CFKB 1BQHG 7FABH 4JFDB 5IW3A 3VMOA 4YX2H 5GRYA 4HV8B 3PV6B 4APQB 1F3RB 3I50L 1N2RB 5D93C 1CT8B 4U1NA 5I1AA 4XMLL 3WD5H 3PIQB 5E5MB 3RY6A 3MOBL 3QDJB 1JWMA 2B1AL 4X6CB 1YMMD 2BNUA 3FTGA 3SDYL 4NUGL 1RY7B 3QUXD 3GSRA 1U6AH 5L2KE 2AK1L 4HWEL 1AQDB 2MSPA 3ARTA 4OZIE 3RU8L 4EN3C 3VD9A 3DJ9A 1BEYH 1FO0A 4BQCA 1UZ6E 4HDIB 1QBAA 1NMBH 2J8UE 1CE1L 5IFJA 3ESVF 4HH8A 4FABL 4WGWB 2J3SA 5KANI 4PY8J 1MCQA 5TDPB 1YDPA 4OI7A 2DQGL 3HG1E 1LEKA 3LEVH 5ESVA 4HBCL 1LK2B 3GIZL 3CJJA 4KROB 3QNXB 3TZVA 5I19L 4Y88A 3ZDYE 4PV8A 5HGBB 3RY6C 3CVHL 1KJ3H 5LXGL 1GC1C 1HQRB 4PB9H 3CFEB 5IF0B 3U36A 1MVFA 2CJUH 4XTRD 2VABA 2EIEA 2MHAA 3P9MB 2D7QA 3G5VB 3RWHA 3ZL4H 1FBIL 3MV8D 3BE1L 4H8WL 5M95B 5JOFB 3VFPA 1K8DB 2NXYC 3GSOB 4FXGB 3QNZB 3MACL 4EI6B 3MODL 3MLPA 3QBTB 4PJDE 5FO9B 3QO0A 4JLRB 2VL4A 4LCYA 3W0WA 1RZ7H 3ZT5A 4OLVH 1U95A 2E6QA 5L7XH 1MF2H 2NY7L 4JDVA 4U49A 3SJVB 3OHXA 3KPOA 3TZVC 4ZFFB 4XPTL 1B88A 1L6XA 4NBYB 4MCZA 1MHCA 5GS1B 2BSRA 4A2MA 2BVPB 3MO1B 3WKNA 4MA7H 4Y5YA 4JFOB 3CC5B 3FFDB 4JQIH 1CDGA 3ES6B 4NKIL 1N7ML 2UUDK 5IGXH 5DD3L 5FUZH 1ED3B 1DTUA 1L7TH 3C60D 2FHFA 2OR9H 2RIKA 3TIDA 2Q20A 4WV1C 1N3NA 2XQBL 5JQHC 4MX7A 4KTDH 1M71B 5GGTH 5MEND 5D7LB 3VJ6A 3S34H 1HH6A 2X10A 3BPCA 2Q8BL 1GIGH 1RIVL 2GJ6D 4TVSa 4FQ2H 2ZUUA 3MQIA 2DBJA 1HHGB 1LP9B 5F1OB 1U0QA 3QJHA 4HKBA 4GLRI 5EU6A 3VI4F 5SWSA 1PLGH 4NZDA 1OWWA 4X4XB 5DUBA 3RWGB 1KFAH 2A2QT 4FQLL 5I1JL 4Y5YC 4JG1L 1UWEH 4A6YH 3VXRE 3RJQB 2W60A 1CFSA 4AT6B 1KCVL 5F1NA 1DLFL 4GFTB 1GAFL 4RGNE 1MUJA 3L6FB 1J8HD 5BCAA 3IAQA 5E9DA 5CZVL 4ZUTB 1CGWA 3IJHA 4GXVL 5CLWA 1QFWI 3U46B 1DLHB 3T0EA 4YHIA 5DHXB 1CGSH 2HFEB 3FT2B 4WWKC 5JUEH 1MAMH 1RIUH 3U4EB 4E41A 1A6TB 4PGDA 3OPZH 3KLAB 4CVZB 4LAQH 4QOKE 1CXIA 2D03L 2HVKA 2DD8H 3O4LE 5E2WH 3SKNA 2BY3A 1DN0A 5F44A 5DD0L 3FCTA 5F7UA 1J11A 2F53A 3OX8A 1LP9F 5CGYC 1P4LB 2VE6A 3QIWB 1FVDB 1M6OB 3HCVA 4FZEH 2P7TB 1JPFB 1FFQA 2PYFA 2CO7B 2PF6A 2AW2A 5CJ8A 3MNWA 1XGRA 4X7SL 4QCIB 4DKDC 4LSUL 2AJVL 3ZE1F 5HYSB 3QEGH 3QEQE 5ADPH 3REVB 4GRLC 2BY1A 3S35X 1NGQL 3T0EC 3SE9H 3U4AA 3V0VB 3MUGB 2JE8A 1MOEA 3TA3A 4FFYH 3O45B 5BMFL 3GUTB 1KIPB 1KJ2L 3N9GH 3SBWC 3T4YA 1OTTD 2YPKA 3Q3GB 3OL2A 1Z5LB 2CMRH 1WC7B 5B8CB 1LK3L 3MRPA 5DFTA 4U1MA 3BP6B 1I4FA 2H3NB 1D6EB 1K3ZA 2HTLC 2QQLL 4XXCA 3SOBH 3SDDB 2DYPA 3OKEA 2W0KA 5AUMB 3RZWA 1IC7H 5I8CB 5DTFA 1TTUA 1WIPA 4HKXB 4RISH 3P4OB 1QR1A 5K59F 1MEXH 3QQ4B 4HS6A 1A6UL 1T66C 1J0KA 4PJHB 2FX7L 4D8PB 5I1IL 3C6LD 5DJDB 1JNLH 1YNKL 3QI9B 3DX7A 4TVPL 1WBYB 5CCKH 3TFKC 4XMPL 3MUJA 3VW3L 2BNRE 1WZ1L 3DI2B 4FMFA 2GTWA 1G7LB 5CSBA 5D7KE 2DQIL 4I2XB 2JF1A 3F7PC 1I7RB 1T3FA 1F3DH 1MFEL 2DM4A 5FUCE 4YDKH 4WNQB 5IW6A 2D4DA 3ZT6A 1NMCC 3GMPA 1QHPA 5E8EB 2X89A 1JGUL 1UB6B 4PD4K 1C5BL 3LN9A 5I15L 5ALBL 4OIIH 3FZUC 4PUBH 3NFPA 2C3XA 5E7FA 1F6FB 2O5ZH 4BKLB 2AGJH 3OAZH 4P3CH 2PR4H 4YDVB 3NTCH 2LQRA 1NAMH 4FQCL 2DAVA 4MD4B 2YA2A 2Q86B 1TENA 5JIHA 2EXWD 1CFTA 1IBGH 1UA6H 3VG0L 5J6GB 3WXVH 1MCRA 3RWJB 5HYJE 5HDBF 3RL2B 4YBQD 3VFWA 1F8TL 3GSWB 5FO8A 5MERB 1IKFL 1XF4A 2NTSP 2XTJC 4NO0A 3U30C 2WQ8A 2DQUH 3SGKA 4UIMA 4NQCE 5EH1A 1WSST 4WFGE 5EOCL 5EZJA 1OVZA 5DR5L 2LFGA 2Y07H 3HC4L 2KQMA 3U0PA 3V5HA 3MRFB 1KB5A 1R3KB 2VLMD 2BVUA 4LLVA 2EH7L 4TTDC 3ZTJG 3CZJA 3PP4L 4X9IA 1ZHBB 4R26H 9CGTA 5TQ2L 4P46A 4PRAB 5DK3A 3WLBA 3LEYH 5A16B 5EPMA 5GZOC 3TT3L 4P2OB 2E9JA 4FFZH 5FA4A 1NFDA 3R0NA 1F45A 2Z8RA 4ZSOE 3VFVB 4XBEH 1J1PH 3PQYE 4QLRA 4K7FB 1OCWL 4G6JH 5SWSD 3BH8B 3CD4A 4R0LB 4XXDB 1T1ZB 5CHNB 4XT1C 3VFUB 1K4DA 4HEME 4U1HA 5CGYD 3O0RL 1MWAB 2ICEA 3T4AB 3PWVA 2CRIA 3VXPB 1U8JB 4WU5A 3QRGH 3QXVA 3NIDE 3SGKC 5F1IB 5CSZA 2KZ1B 3P3YA 5DK2A 1JTTA 5FCSH 3B5HA 4NN5C 2EDXA 4WU7A 2CRYA 3CFKA 5DK0B 3RVTC 2UVEA 4HV8A 1LO2H 3U83A 1CTOA 1A7PH 1N2RA 3D69B 1EX0A 5E2JA 5IQ9B 1PKQB 1CT8A 1KN4H 1IAOB 4P46C 1ND0B 2E6PA 1DQJA 1A14H 3PIQA 3T0VA 2HT3D 3BPOB 3QDJA 2BP3A 3KYKH 4Z9KB 5ACZB 2F9BT 1DQMH 4X6CA 1TCMA 1IM9B 4FTVB 4CVXA 4X7FC 3EYFB 4BZ1H 3VXSB 5KVDH 1EVTC 5D96B 2N7BA 1EVUA 4W81A 3UDWC 3MMEB 3NVQA 5C2BL 1RULL 1U2HA 1IFHH 3UTSE 5IHUL 4HDIA 4NT6B 4GQ9L 3ZHKA 5TDPA 4EIGB 2VO5A 4ONGH 5IR1A 1A6WH 1RZKL 4X4YB 1P6FA 3AAZA 3IAPA 1LK2A 2HLAB 3TFKD 4M02A 2R2HB 4Y7MA 5DUPL 4P5MA 3TH4T 3O4OB 1A7QL 3UYOD 2X2YA 4XH2B 3TA3D 5F7EH 4ZNEA 5F70A 4JG0H 5HGBA 1JGEB 4WCYL 4NQSB 1D5ZB 2QQQA 5DQJB 5FECB 3WS6C 1PDKA 4YDJA 3SQOH 5DXWA 1C5CH 4OI8A 3HRZB 1A4KA 3L3IA 3CFEA 5IF0A 1EJOH 1KC5L 2DYPD 2AJ3B 3P9MA 3CGTA 4C59B 5CEZL 1N6QL 3G5VA 3FZUD 4YE4L 5JOFA 3SEPA 1K8DA 4FXGA 3QNZA 3I50H 5KN5B 4EI6A 2DQHL 5FO9A 3BKML 4XMLH 4JLRA 3MOBH 3VXUD 5F6IB 3SDYH 4LHQB 2NY3C 3SJVA 4NUGH 3RUGF 2AK1H 1CQYA 3IJYB 1F11A 5GS1A 3RU8H 2HYMA 4MD5A 3ULVE 2G5RA 1MFAL 2BVPA 3MO1A 3ARFB 1UFUA 1CE1H 3T2PA 4FABH 2X89D 3FFDA 4NNPL 4R4NC 2DQGH 4UMGA 4KRLB 2DI8A 4KZDL 5JDSB 1ZA3B 4HBCH 2JCCB 3GIZH 1J1OL 1FJ1B 4AIOA 1I8MA 4UNVA 1IC4L 5I19H 5JZ7C 1BFOB 3OAZK 5GZOD 1M71A 5IMLA 1IJ9A 3H42L 4ORGB 5D7LA 1W72L 4GOSA 2VDNH 4HKZA 2R2CA 5LXGH 4X4ZA 3UTOA 1FGVL 5GJSL 3WIHA 3H8NA 4EOWL 1HHGA 5SWZB 2EECA 5GS1C 3VCLA 1FBIH 4H8WH 4NO0D 4HKJB 1HEZA 3SDAB 2ZSVB 3CDYA 1FVCB 4X4XA 3RWGA 4C56D 3MACH 2R69L 3MODH 3STLA 3HTLX 3VGBA 1UYWL 3U9PL 3X3FL 1G7JB 2AAVA 4GMTL 4CVWA 4WTWA 4AT6A 2NY7H 5JNYB 2ESVD 4OD1L 4QNPE 3L6FA 1BJ1H 2V2TB 3EOTL 4P46D 1VEOA 5FYJD 4ZUTA 4XPTH 1DBJL 2W38A 1DQQB 5HI5D 3FHQA 4PGBA 2JCCF 1DLHA 3U46A 5E1HB 2HFEA 1QSFB 2FLRT 1RUML 2X1OA 1A6TA 5F7FA 1D9KC 1TJIL 3RZCD 3GEWB 1JPSL 4PJIE 1ORQB 4NKIH 3KHOA 5TGBB 1N7MH 2JELL 5DD3H 4F2MB 2VDRL 3TO4A 3K1KC 2ZUSA 4Z77B 3F7RA 2P48B 5IB4B 1U3ZA 1P4LA 5DRNA 1FVDA 2XQBH 4JFDD 4ORZC 4APQD 4NFCA 2BOBA 4I4WA 5FOJA 4QCIA 2Q8BH 4K71C 3RP1A 5HYSA 1RIVH 3FJTA 3S37H 1PG7W 4H88L 4RWYL 5GGUB 1EMTL 2E7LA 4AEFA 3QDJD 3RHWF 4HUXB 1DBAL 1FNFA 3FB5B 4LLYB 3V0VA 3DOSA 3CIQA 3MUGA 2DQEL 3NCBB 3O45A 4FQLH 4UT9L 5I1JH 3GUTA 4JG1H 4J3OC 5L0QB 1JWSB 2G9HB 3CU1A 3TESA 3DETC 3G5XB 3FO9B 1ZS8B 3Q3GA 1F90H 5B8CA 1KCVH 2B5IB 2B8OT 4MXQC 5DVOA 5IG7B 1DLFH 3BP6A 5LAXA 2H3NA 1D6EA 1GAFH 3TO4C 1K85A 3SDDA 4TNVK 3HE6C 5CZVH 4XC3L 4GXVH 3VFOA 3ALWA 4HKXA 4I9WE 1BD2E 3V4VL 2VR9A 5BOZG 4DEPB 3WIFA 1RZFL 4JGJA 4KROD 4WFFE 1A2YB 1KUMA 1L0XA 2VLKE 4PJHA 5HVGB 5DJDA 2D03H 5DVKA 3IFOA 3N1PC 3QI9A 1TQCB 2E7LC 2LTQB 2P5EE 5D2NB 1WBYA 4R90L 5DD0H 1Z0MA 4LOUC 1G7LA 2EDYA 1WVZA 3TCLB 1GC1L 1YEIH 4I2XA 1EAJA 1I7RA 4KQ3L 4KRNA 3T08A 1NGPL 3ALPA 4ZXBC 5ICZB 3MRDB 4WNQA 5IVNA 4X7SH 5E8EA 1KG0B 2RBLA 1UB6A 1FO0L 5JZ7D 3BIKB 4JPIA 5IP4A 5DYOB 2ZG1A 2APWA 1NGQH 4FXKA 1PQZB 1F6AB 5HYSG 4MCYA 1X7QB 4NRZB 1NANH 2A73A 4BKLA 5L8LB 3QHZL 3MR9B 1MJ8L 3SJVD 4YDVA 5I17B 5BMFH 3NGBB 1KJ2H 4OM0L 1VADB 4LRIA 2YOCA 3K46A 4MD4A 4XPHL 3O3BA 4H0IA 5TE6L 2RHEA 4YHYC 1LK3H 5J6GA 3LPFA 4FQHB 2FIRT 3RWJA 3RL2A 2QQLH 3S98A 4X6DB 5D71L 3GSWA 4U1IB 2EYRB 2XQYG 4YBHA 4L8BB 5B4MC 3EDKA 3GZKA 2XXCB 2IPUK 4YHKL 3MRFA 3QQ3B 1A6UH 4ELKA 2OJEB 1WAAA 4KK8C 2FX7H 2VLJE 1R3KA 5DVMA 5I1IH 4PJ8B 4KKCD 1YNKH 1EAPB 3QUKB 4G8FA 3OJ2C 4TVPH 4XMPH 2NW3B 1M1SA 4U6XB 1WZ1H 3VW3H 5HHME 3ILPB 4BH7B 5HI4C 1S9VA 4PTUB 2DQIH 3I02B 4N8VB 3VWKB 2YD9A 3Q2CA 4G6FB 1MFEH 1GGTA 2Z8VC 2A9ML 4K7FA 3BH8A 2WANA 3L9RB 4R0LA 4KJYB 2OJZL 4XXDA 5EIQA 4ODUB 1HN1A 5CHNA 2FD6L 1JGUH 2X1PA 3IKCB 1C5BH 4PRHA 5B21A 4PYHA 3T4AA 5I15H 2NY6C 5ALBH 3RIAF 3VXPA 1DP0A 1XR9A 1U8JA 2A38A 4HAGA 4X6DF 4X4ME 5F1IA 5HYQB 4S1RH 2M2DA 4TRPL 4P4KB 1FFRA 4FQCH 5H37H 3I75A 3ARYA 1R3IL 2Z31A 2CSPA 4H1LB 2DQJL 5ANMB 1HNGA 2V9TA 3IFNL 3VG0H 4F37F 1ORSB 5M94B 3D69A 4Z18A 3WE6B 2JJVA 5IQ9A 3CDCA 1PKQA 1S7WA 3B9KB 1ND0A 5I1GL 1F8TH 1IKFH 3DETD 3V6OE 2YN3A 5FV2A 3G6JF 35C8L 3NIGE 3RVVD 4PRIB 5D1QB 2IGFL 5EOCH 3MCG1 4EUPB 3EYFA 4N0FB 4NWUL 4YNYA 5DR5H 3HC4H 3ULUL 4AQ1B 2YBRB 4BFBD 3MMEA 3QIWD 3UPAA 3V7AE 2XZCL 4PJBB 5DJAB 2AK4B 2EH7H 3JV6B 4LIQL 2OL3B 5HPMB 5D2LF 3PP4H 3CFDB 4JO1L 4LLMB 4JVUA 5AYQA 2C9AA 5TQ2H 4HIEB 1XF1A 4YHML 2GAZB 3TT3H 3B9EA 1S9WB 5J1SC 1FFOA 2Z31C 2HLAA 2GI7A 2P46B 1OCWH 4LOUD 3LKQB 5TDOB 5IVZA 4XH2A 1J86A 1VACB 3O0RH 3S3JA 1JGEA 2QV2A 4MDIB 5CKAA 1D5ZA 5DQJA 5FECA 3MUZ1 3HRZA 4QF1B 1T0MB 3PV7A 4R7DB 4JANB 4FMKA 3IB4A 1EXUB 3U7AA 2VKXA 4M7JL 3SDDD 2R56L 2AJ3A 3BUYB 1A1MB 5D96C 4MVBC 2ZP0T 3TVMB 2EYSB 3MXVL 5GQBA 5KBNC 4DFIA 1X4XA 5KN5A 4O4YL 1C12B 1KJVB 2IC2A 3LH2L 3H9ZA 1JL8A 3QQNA 4PIRF 5DDHB 3QI9D 4UINL 3VGAC 1D5BA 3A6OA 2GTZA 3UMTA 4S1QL 3ULUF 4KXZH 4G9FA 3LQZB 5C2BH 5B4MD 4OZFB 1OAQL 4P2CG 1HIML 2CR3A 3BDBA 3ARFA 5IHUH 4YHZL 3CH8A 4D9RE 3T04D 3F62A 1AGCB 2NR6C 4Y4HC 2Z35B 4X0KA 5JDSA 1RZKH 3EOYG 3WNNA 2JCCA 4I3RL 1FJ1A 5DUPH 2I9LB 4PLKD 1A7QH 5HI4D 1BFOA 3HZVB 1J0YA 4KY1L 1ZSDB 1QBML 3K81A 4PJCB 4WCYH 5DEGB 4ORGA 3CMGA 2PTTB 5T1LB 4YO0B 5DO2D 3LKRB 4CKVX 5EIVA 2Z92B 1KC5H 2A6DA 5CEZH 1N6QH 5SWZA 4JFFA 4QKXB 4YE4H 3AROA 1BM3L 4U1LA 4LF3B 4HKJA 1U8QB 3SGDH 2ZSVA 1FVCA 3C2SA 2DQHH 4RFNC 3SKMB 3BKMH 1P4IL 1ADQA 4M7ZC 1G7JA 1LD9A 4P4RB 5C07E 3VWJB 1B2WL 4EI5C 4DK6A 3K8LA 1HZHL 5DMGD 1CFVL 5E4IA 1ZEAL 2J5LB 3THML 5EWIL 2V2TA 1WTLA 3S4SB 1CDJA 3QJFB 2YD1A 4F7CB 1DQQA 1OAKL 4HFUL 4P2OD 4I1NB 3ABZA 2C5DC 1G7HB 5I1LB 1QA9B 4AJ0A 4NGHL 1MFAH 1QSFA 3VFNB 2VYRE 3H7BB 3AMKA 4RGOL 4PJCF 4TUKL 4NNPH 4MA1B 4KZDH 1ORQA 3WFHB 4HIHB 3EAKA 2DMBA 1IGCL 3W2DL 3B43A 4F2MA 1JHTB 3Q6GL 1B0GB 1J1OH 4WWID 4QYOB 4MA8L 4U33A 4Z77A 1IC4H 1X5FA 5IB4A 3I84A 4KUCF 5ENWB 1NEUA 5ID0A 1JHKL 2BJML 3ILQC 5J3HD 4FNLL 3IAGC 3H42H 3BEWB 1KB5L 3GMQB 4FQ1L 3C8KB 4XP9L 1KPUB 3BISA 3UZVB 4U1SB 1FGVH 5GJSH 2GITA 3LS4H 5BRZE 3DHJA 3C09B 5GGUA 4EOWH 5J13C 3GB7B 3C2AH 4LMQE 4QRSB 1Z0NA 2ZJSL 4KK5C 1IM9D 4LLYA 5F7HA 3HNVL 4FTVD 2BOCB 3MGAA 3GSQB 3VXSD 2VITA 2MKLC 2R69H 4C4KO 5TDNB 1JWSA 2G9HA 1UYWH 3U9PH 3G5XA 2XRAL 1ZS8A 4GMTH 4Z7WF 4LSDA 4F57L 5IG7A 1MHEB 4OD1H 1WCBB 4Q6YA 4XVJL 5AZEL 3EOTH 5ELIA 1OD9A 1CCZA 1DBJH 1EEYA 2A83B 2VWEE 3IGAB 1AP2B 1WF5A 4CN6A 5EO0B 4QRQB 3F5WB 1FHGA 4F58L 4RZCB 3OJMB 4DVBB 2VR5A 5IROA 1KCUL 3U0TA 5JA9A 1RUMH 3OMZA 1TJIH 2ZG3A 2COQA 3S36L 4MXVE 1RHHB 4POYA 5DMYA 4LCWE 1JPSH 5DZLA 5I76B 3LD8C 2Y5TA 4GKOA 3BEVB 4PLJC 5FFLA 5D2NA 1WBXA 2JELH 2VDRH 1A3LL 2RFXA 2X4OB 1YY9D 3CPLB 3KPLB 3TCLA 5IB2A 2AQ1A 2NR6D 3K2UL 5JHDE 1I1AB 5L0QC 2HMID 2A6IA 3QUMA 3ORJA 1KG0A 2C26A 2HFFB 1KV3A 3BIKA 4DTGL 4H88H 4RWYH 4HK3N 1S7TB 4WY7L 1P9MC 1EMTH 5DYOA 1PQZA 1F6AA 1X7QA 1DBAH 3M17A 4NRZA 4DEPC 1HINL 4LMQI 5IROC 3MR9A 1OARL 4AEIL 4UT9H 4P2RE 2BERA 1ZVSB 1X5KA 5FIEA 3VD7A 3D85B 1TQCC 2DM3A 3MJ9A 1RD6A 5D2NC 2MQ0A 5MHSD 1ACYL 4FQHA 3ARFD 3IDIB 4XZUB 4X6DA 3V5DA 4HG4J 5JW4Q 4X83A 5FM5M 4D9QD 5C0AE 4U1IA 2YD2A 4XC3H 2EYRA 3UJJL 3RPIB 4L8BA 3V4VH 3WDIA 2XKNB 3E1F1 5GRVK 1F3JA 3ET9F 5L2JB 1RZFH 5GZNC 4U0RC 3OKNB 2N4IA 2VXVL 3QQ3A 4DJMA 2OJEA 3UJTL 4KGJA 4PJ8A 1FAKT 4MNGE 1EAPA 5HVHB 2IQ9L 5JPNA 3LS5H 4R90H 1NGWB 4U6XA 2NW3A 3ILPA 4BH7A 1Z6JT 4XPFL 2DM2A 3GMMB 1GC1H 1X6NA 3I02A 4HBQA 1ZTXL 2FRGP 4LHJB 4KQ3H 3VWKA 1NGPH 5SWZD 3AREB 4CJ0A 3U82B 3SDAD 1K9TA 4JO4L 4LCCA 4KJYA 1AXIB 4ODUA 4NYLB 1ZLWH 3D3VB 4PP1D 5EUKB 1FO0H 1OGAB 1TITA 1SEBB 2VZTA 4ONOA 4YHLL 2ZNWA 3ZE1E 3TNMA 4LQ1A 5HYQA 4L8DA 2CKBB 3QHZH 1I85A 1MJ8H 1P5UA 4DN4L 2BFVL 1AO7B 1MHPL 4P4KA 4OM0H 5GGRY 5BV7C 3MRMB 4XPHH 1SMOA 5C8JB 2HT2C 2BHZA 2DN7A 4H1LA 5J06A 5TE6H 5ANMA 1MVUA 4KK5D 4EDXB 3QDME 3QIBC 1QSFD 4F8QA 3DLQR 3WE6A 1YNTB 5FV1L 2ZUYA 3B9KA 4QRTB 5D71H 4CNIB 4K3HA 3M07A 1H9VA 1EPFA 3WIHL 4PRIA 3MTRA 3HUJB 5D1QA 3SDXB 3KLSA 4YHKH 4LCCC 4M8QB 4XI5C 4UDTA 5E2UL 2OTWA 2YBRA 5K59E 4KDTA 4PJBA 2AK4A 2Q1EA 3ROOA 3JV6A 2XN9A 2OL3A 5JO5B 3T2OA 1OP9A 1J18A 4DGYL 1I85C 1KCSL 1DQLL 2GFBB 3RNQA 2EXYD 3FT4A 4P4KC 3GBLA 1T7YA 2GAZA 1FZMB 5EZIL 2X1QA 1S9WA 4PLJD 5LVEA 1HYSC 3O2VL 2A9MH 3LKQA 4KI5F 5C08B 5TDOA 3UPCA 2OJZH 4K8RD 2FD6H 3B9KC 1VACA 3CXHK 4CN4A 5FGCB 1MCIA 1QBBA 2XWJB 1T0MA 1UQSB 1DBML 4OAWB 3LKOB 3BP5B 4R7DA 5J4MA 2CLVB 3AGVA 3BQUB 5LGJB 4WHDA 2Z91B 3OKYA 4TRPH 5C0ND 4GG6E 1EEQA 4F7TB 5IVXB 3L3OA 3TVMA 4KDTC 2EYSA 1LWRA 3HUJF 4G8GE 1R3IH 3SDXF 4HHAB 2DQJH 1CTNA 3IFNH 5DJXB 1D3CA 4EQ2A 4H1LG 1KJVA 4I0PB 5I1GH 4HXBH 2R9HD 4GKNB 5DDHA 35C8H 2D0GA 1PFCA 2IGFH 3KPNB 3ZHLA 4NN6B 4NWUH 1PZ5A 1MFCL 3FRUB 2XY1A 4ZO9A 3ISWA 3LQZA 2XZCH 4K23L 4OZFA 4LIQH 1RHFA 4QTHA 1IARB 4JO1H 1CGXA 5GZND 3QULB 5C0CB 3QXAA 1H8OA 1AGCA 1JTOA 4QRPB 4YHMH 3EDEA 4TVPE 4RQQB 5LKNA 3G6AA 4RAHA 4JRWA 5GSVB 5DFWH 2FIKA 2I9LA 1DSFL 1OB1B 4MHHI 3VFTB 4NQDB 4PJCA 4LDEB 3H9SA 3KHQA 2PTTA 5T1LA 3C9NB 3K8KA 1U41A 2UVFA 4YO0A 5AEAA 4DQOH 3LKRA 1L0QA 3X13A 4M7JH 1W0WB 2EC8A 1DQTA 1ERNA 2R56H 2VRAA 4G7YL 2FHBA 5LG1A 1BQLL 3ALXA 1ZT1B 4G8EB 1NANI 2WBJB 3MXVH 4P9HC 1I75A 4LF3A 1U8QA 1E4XL 3MREB 3QFJE 5E8PB 2IANB 5E56A 4PBXA 3ZKQD 3RGVB 1CR9L 4O4YH 1FG2A 4P4RA 3LH2H 4N5UA 4PJ8D 2E27L 4Y8AA 3VWJA 1KEGH 1G6RL 3S96B 4F3FA 4UINH 4FFWC 4KJQC 1S5IL 1IGML 1TTFA 2YMXL 4XP6L 4S1QH 3QJFA 4LPYA 4TN9A 4S0SD 3L3JB 2OI9C 3VWKD 1HHHB 2KDGA 2I9TB 2IWGA 1MCCA 1I1CA 4G6FD 3N1FC 5KAQG 3AS0A 5I1LA 1QA9A 1OAQH 1HIMH 4M6OL 3VFNA 1G0XA 4YHZH 4ENED 2MCPL 5H35B 2H2SC 3H7BA 3E2HC 4OZFG 1ZLWK 5GISL 1MI5E 4OFKA 3DYMA 3WFHA 4HIHA 4Z7NE 1R3HA 4I3RH 1JHTA 5CILL 1B0GA 1MCWM 2LAGB 1Q9KB 1U8LB 5AYUL 5GS2D 1J0ZA 4N9OB 2ZCLL 4IS6B 5ENWA 2UWEE 1YEFL 4KY1H 4NOBA 1QBMH 3ZTJH 2VN4A 4V1DB 5D72L 4PG9A 3C8KA 1KPUA 4LVOB 5I6XB 1S9KC 1CD1A 3KYMB 3DV4B 3MRKB 4U1SA 2EDHA 3MV9B 3MA9L 1EK3A 1I1FB 3B9KD 1KYOK 5J11B 1RJYB 1JPTL 3GB7A 3OF6A 4ZAKB 4QRSA 2O5XL 4L4VB 1BM3H 3TBYB 5TH2B 5D1QD 2IF7A 3K8MA 5J1TC 2PYEB 4E5XA 4Y19D 4WJ5B 3GSQA 5TDNA 5A2IH 1P4IH 3L3KA 4MA1C 1FV1A 2AK4D 2BY2A 4OFYA 5CIPH 1A5FL 1HZHH 1CFVH 1ZEAH 3THMH 5EWIH 4PJ5E 4MDJA 4MJIA 4DWHA 1OAKH 4HFUH 1AP2A 3VRJB 5EO0A 4QRQA 3F5WA 1BF8A 4RZCA 4DVBA 4OZ4B 4NGHH 4DAGL 5IK3B 3MOQA 4PJ7E 1U2CA 4RA0C 4MZ3A 5FB8B 4OZHF 3QUZA 4RGOH 1RHHA 2P43B 3C09C 4TUKH 3BT2L 4YAQB 1J8KA 3HR5B 2XOTA 3G08B 5I76A 1AHWC 3BEVA 1ZLSL 5E2TL 1IGCH 3W2DH 4F33B 1TVDA 1I7TB 3Q6GH 3EDJA 4FN0A 2X4OA 4MA8H 3KPLA 3CPLA 3JSSA 5DI8B 5GRUL 4Z7UB 3CZFB 1OD7A 1S3KL 3RWDA 3TVMD 1JHKH 2BJMH 4FNLH 1KB5H 3HC3L 4FQ1H 3TBVB 1IEBB 4XP9H 3T8XA 1OF2A 3UTQB 2HFFA 2UYLB 1LE5B 3SKJL 3DGCR 2CQVA 2VUYA 2AV1B 3PWLB 5FA3B 5AD0B 4M5ZL 5B38B 1YMME 1W8OA 2WWKO 3CK0L 4X8JB 1RK1B 3D87B 5FYLL 1X5LA 1QTYT 3HNVH 5CEZE 4HCRA 3IDXL 1QD0A 5F7DA 3W5MA 2YEZA 5BZDA 4JY6B 4B41A 4KDWA 3DO7B 1RZJC 5HDLA 3QUZC 1AR1D 1ZVSA 3OQ3B 3D85A 5JTWA 4F57H 3BVNB 5C0JB 1PEWA 1AI1L 4JRYA 4QWWD 3IDIA 4XZUA 4XVJH 4ZFGL 1QRKA 1T0NB 5AZEH 3O6KL 3EO1A 4ZUUB 2LU4A 3JXAA 1KCKA 3PGCB 3RPIA 3WNKA 3AXLB 4OUOA 5HHVL 2XKNA 4F58H 3OAYH 1F42A 3Q6FA 3I2CL 5E08L 1KCUH 1FZKB 3R8BB 3VXNB 3OKNA 5CEYB 4K7PL 2G5BB 2MWCA 4L9LB 1IAKB 4KXZI 2VUOA 3S36H 4QHKJ 5C0GB 2V7HB 5ETUB 4D2NA 4Q6IB 1KIRB 2CIKB 2G2RB 4QHUB 5J12B 1NGWA 3JVGA 3KNBB 1OSPL 1A3LH 3GK8L 5F9DC 2IALB 5T1LD 2B7DT 4JRXB 2DBLL 1UVQA 4AQOA 5GRJL 5GJTL 3K2UH 3VG9B 3RQ3A 4TQEL 5GGVL 4KUCD 4H5SB 1MQKL 3B9VA 1XFPA 3DX6B 3HFML 4RMWA 4NYLA 1S7SB 3D3VA 1CE6A 4RMQA 5EUKA 2KUTA 3VDBA 2CKNA 4PJGE 3E8UL 4DTGH 2BNQB 1SEBA 1V3KA 2EIZB 2X4SB 4WFEE 2EH8L 4WY7H 3VWJD 1ZGLP 2AQ3A 1XCTB 2E7BA 3FQTA 3EDDA 1U8KB 3KPSB 1HINH 2CKBA 1CD0A 1OARH 4AEIH 1RUQL 2AV7A 2H1PH 4XAWL 3WEXB 1AO7A 4N9GA 3MRMA 1VB9A 4UQ3B 5IBUB 4MQXC 5C8JA 2DI7A 4KK9D 4XP5L 4EDXA 2FGZA 1INQB 3LPGA 5ICXB 3JVGC 2VZ3A 1YNTA 4GKSB 3EJYC 4QRTA 4CNIA 5K9KB 1LO5A 4X9BA 3UJJH 2RQ8A 5TE4L 5EZLA 3DSFL 5H2BA 3SDXA 4JVWA 2YUZA 3WNOA 4M8QA 2E8ZA 4EXKA 4OT1L 2VLLA 4JZOA 2VXVH 2WK2A 5ISZB 1KPRB 5D8JL 4NBXB 2XY2A 3UJTH 4ELME 1XF3B 2IQ9H 3ZDZF 1ADQL 2VH5H 3OGOE 4WFHD 1NFIB 1TVHB 4XPFH 2GFBA 1ZTXH 2WQRA 3OF6D 2VISB 1T6WA 4G5ZL 3MV7B 3GHEL 5C08A 1G7QA 4S1DC 4JO4H 3VI3F 2F8VA 1I3VA 3B8YA 1QSZA 4JZJA 4YHLH 3L5IA 4XPGL 3MCKB 3JUZA 4R96A 2HT4D 2XWJA 2Y23A 4OFYD 5DVLA 1UQSA 3LKOA 3BP5A 5DUML 2CLVA 2X4RB 1J8HE 3BQUA 2AJYL 4NWTL 2Z91A 1X5GA 2BFVH 5DMKB 3UTTE 1MHPH 4F7TA 5BJTA 5IVXA 1AR2A 4JGMA 4QY8A 1WT5C 4JFED 4HHAA 4U6VL 5F9WC 4LCIL 2FO1A 4J7RA 1N5YL 1A6PA 1ZXQA 2D3VA 1FFNB 3CH1B 3LB6C 3WL9B 1U3HB 4TNWK 3MLTB 5DJ8B 2Q8AL 3OBAA 5C09B 3I9GL 3WIHH 3VU2A 2YHGA 1QFOA 4GJTB 2HTKC 4OCYH 5IW1B 2IBZX 4WUKL 1S8DB 3P9WB 5E2UH 1BQSA 3FRUA 3NN8A 1I1YB 2Z4QB 1I1AD 5D70L 1KTDB 4JZJC 2X9XA 1BFTA 4PG2A 1JGVL 2OP4L 3JV5A 1LNUB 4DGYH 5C0CA 1DQLH 4QRPA 5CSGA 1S7VB 2EDDA 4RQQA 5EZIH 3QXDB 2EYTB 2AKRB 4MAYA 4TSAL 1HI6B 3NAAL 2APTA 3Q5YA 3RY5A 1PBYA 1B3JA 1I8IB 2APBA 5DC0A 1RUKL 3VFTA 4Y5VA 4NQDA 4NO2B 1U8PB 1LE9B 3D85D 4M3JA 3C9NA 1DBMH 1S7XB 4Q97A 1BPVA 3BMWA 1KENL 4YFDB 2VXTL 3AFLA 1ZT1A 4G8EA 5IWLA 4PG2C 3ELAT 2AS5M 3JBG7 1H3UA 5I16B 5KG9B 3OAYK 3QUML 3LRSB 3RGVA 1VERA 4N0CD 5HVFB 5L2KB 2ICWA 1T04B 3NACL 3CLFL 1U9KA 3V8OA 2NY2B 5J6HB 1O7SA 2X40A 1N5AA 2W9EL 3S96A 4OZIB 4CADB 4HZLA 4X98B 5T3ZD 2ZSWA 4MAYC 1Q94B 1MCKA 5HD8C 1T5WB 3EJYD 2J8UB 5HDQH 1MFCH 5DEZA 5EBMA 3L3JA 4Y4KC 4NO5A 2I9TA 4RMTA 3HG1B 4Y5VC 3ARED 1XGQB 1OY3B 1QLRB 1KPVB 2X4PB 3JTSB 2VLRB 4WI2A 3MJ9L 4FFVC 1OGAD 2HN7B 5TFSL 3KYNB 4MYWB 5FYKD 5TE7L 3W0WE 3BYYA 1EIBA 3WFEL 5IWLC 1YEEH 2H2PC 3BDYL 4P0DA 3S3SA 1Q9KA 3MRGB 2B0SL 4KI5D 3RGVC 1DSFH 4IS6A 5DJYB 4AMKL 1AO7D 2HJLA 4RGMB 5CJBA 1K8IB 4LGRB 1U8IB 5BV7L 1CFNB 1KTLA 3MNVB 3SGJA 3FQXB 2LE9A 3KYMA 3BP4B 3DV4A 3MRKA 4GH7B 2WUCL 5KOVC 5HYFA 1A7BA 4JHBA 4G7YH 1RJYA 5T3XD 4OZIF 2WLZA 1F2XK 3O9WB 3EO9L 1BQLH 5GRWA 2NCMA 4L4VA 3WKML 3TBYA 2X05A 5EG6C 1UZ6F 5GGRB 2QTEA 4P5TA 1E4XH 1DEEA 3LN4A 1CR9H 4CN1A 5HHPA 5H8DA 3D48R 3OKLB 1MY5A 4JO3L 2E27H 1JF6A 2MKWA 1IQDB 1G6RH 1OL0A 5D9SB 1S5IH 3P4NA 5D7SL 2YMXH 4XP6H 3LQMA 2CPCA 1YN6B 2F5AL 3ZDYF 4CDHA 4LL9A 5EC1B 5EU6E 2WSKA 5SWSE 4OZ4A 3SGJC 1RZGB 4LVOC 5I6XC 4M6OH 1AIFB 1E4JA 3QXWA 1DEDA 1VSCA 1DDHA 2MCPH 5FB8A 4GSDL 2P49B 4LIQE 4YAQA 3MLVL 1NH6A 3I6KB 5GISH 2W91A 4OLYH 5J11C 3G08A 3M1BA 1KXQE 1SQ2N 4F33A 5KVFL 3KLHC 1LO4L 4X6BB 5CILH 1I7TA 2VL5A 5EU4B 4P5TC 3BQUD 4Z7UA 5AYUH 5E9DE 3VGDA 3CZFA 4PJDF 2ZCLH 4TUOB 4YPJA 1TQBB 3C08L 5D7JC 1YEFH 3T0EE 2JTDA 3DPBA 5D72H 2CDEA 4RNRB 3MRCB 3TBVA 3D2UB 1IEBA 2G60L 4E41E 3UTQA 2OL3L 2UYLA 1LE5A 3LEXB 3MA9H 2VNCA 5BQ7B 4I0PD 3R4DA 5FA3A 3O6FB 1JPTH 4JQVC 4AENB 1RJLB 3A6BL 5B38A 2O5XH 4M3KB 1B0WA 2HVJB 1RK1A 3DROB 3LCYA 1SJEB 4GT7A 1DN2A 5GSRA 4JY6A 2JB6A 3SPVB 5JW4N 2F53E 4RMUA 4B0MM 3DO7A 4RGNB 5FKAB 3U6RB 1QOKA 2P1YA 5GGSB 1QNZL 4JPWL 1NUFA 32C2B 3BVNA 5C0JA 1A5FH 1AC0A 3NCMA 4JVPA 5FGBA 2ZCHL 1QSEB 5C0CD 1YEHL 1FNAA 3O3AB 4QRPD 1MFDL 3BJLA 2D7OA 1H3PL 4ZUUA 3AXLA 4QOKB 4G43A 1XGPB 3O4LB 4Z7QE 4PRPE 2E7HA 3HI5L 1TZIB 2I5YH 3VXNA 4X80L 4DAGH 1O7VA 4M9PA 5CEYA 5IHLB 3GKWL 2G5BA 4L3CB 4RWHA 5C0GA 3GSVB 3BT2H 3OG4B 5ETUA 4Q6IA 1KIRA 2CIKA 4NQDD 2G2RA 4QHUA 1ZLSH 5E2TH 1XIWD 4PJAB 3KNBA 4IRJB 4F15C 2IALA 4JRXA 3LVEA 5JIPA 4UU9B 4I3GA 3QEQB 1S3KH 4H5SA 1O0VA 3ZKMC 2WBJD 2HH0L 4S2SA 2B20A 3HC3H 2H2PD 4R6UA 3DX6A 4C83B 2IAND 2P42B 1S7SA 5E94A 1NCDL 3SO5A 5FGBC 1XT5A 3RGVD 4GG8A 4Z5RB 4M7KL 1QYGL 4OKVB 1N0LA 3SKJH 2EIZA 2OBGA 1NPUA 3NABL 1LGVA 4M5ZH 4NIKB 3CK0H 1I8KA 1U8KA 3KPSA 5FYLH 3AS2A 3GSUB 1NC2B 4JFXB 3SDCB 5B38G 5HVWA 1BIIA 5I9QB 4PV9B 4UQ3A 2XTJE 5DJ6A 4PD4J 1P4BL 3B2UC 3T1WA 5DS8B 4MNHB 1SMAA 1PYWA 1INQA 2D31B 5ICXA 1AI1H 1T1YB 4ZFGH 4GKSA 1KT2B 4O2FB 1GGCL 2YC1B 3O6KH 5DHVA 5K9KA 3KS0H 3UC0L 3UTPD 2BY0A 4DVRL 4BZ2L 2XQYK 3BOVA 4DGIL 1LVEA 3H6JA 5HHVH 2HJKB 2BC4B 2M1KA 3I2CH 1C5DB 3EHBD 5E08H 1X4YA 3IFPB 4G42A 4W68A 2W07A 2ADIB 2OTUA 4K7PH 2IH3A 4UAOB 1GOFA 5ISZA 1KPRA 2PUQT 3IRPX 5BZWB 2X42A 1HKFA 1XF3A 1JZ6A 4V1DD 2VSDA 2NYYC 3QUYB 1GRWA 1JRHH 5BXFB 1OSPH 3GK8H 4EDWL 3OWEA 3N1MC 4UILL 1TVHA 2DBLH 4ZOAA 3MV9D 3V0WL 3MGOA 5GJTH 5GRJH 3WHXA 5C6PB 1W2KT 4TQEH 3S8WA 5GGVH 3N1QC 4W6YB 4ZAKD 2UY6A 5F7KC 3MV7A 2FZ3B 2DJSA 4X9GA 1MQKH 2PYED 3HFMH 2VZSA 1JK8A 2B4CC 1DUYA 3E8UH 1GPOL 3S5LB 5GRZA 1UXWB 2EH8H 3MCKA 5HYEA 4GXUN 3N85L 2AJXL 1CL7L 4EXPX 4P59L 1RUQH 1REIA 4XAWH 4RIRB 4U3HA 5DMKA 1FH5H 5DRWB 1KSRA 1C7SA 3WJLA 4H0HB 2GCYB 1NFDE 1LDPL 4FXLA 5E7BA 1UB5B 2Q7YA 4OV5B 1V7NL 1A1NB 4BM7A 4XP5H 3EO0B 1SY6L 3QWRD 4X99B 5I18L 5IBUG 1BF2A 2R2EB 5CJQL 5JMOC 3MLTA 4WW1B 5DJ8A 4NQCB 1Q1JL 3S88L 1RAMA 4ZFOL 4PY7A 3VRIB 3GBNL 2BVEA 5TE4H 3DSFH 4LNRB 5IW1A 4X9HA 1S8DA 3VD3A 4OT1H 1CLZL 1I1YA 2AVGA 2Z4QA 5D8JH 4LSPL 5HGGS 1KTDA 3GGWB 1T6VN 1ADQH 2LVEA 3PQYB 1UJ3A 1LNUA 3RDTB 4HMCA 3WV0A 3B8SA 4ZS7L 3QXDA 4MB3A 1LO3L 3BPLB 3QQ9C 4WI3A 4X6CE 4G5ZH 2FSEB 1HI6A 3GHEH 4AL8L 1M05B 4U31A 1ZLVH 1HDMB 1EEZB 5K9JL 2Z93B 2ZZUT 1I8IA 3W81A 4XPGH 4NO2A 4RAVB 5DUMH 3P11L 2AJYH 4NWTH 2X6MA 4D9LL 3MXWL 4IMLA 4GAJL 2VXUL 4AZ8A 4U6VH 1SEQL 4LCIH 1N5YH 4WEUD 5KG9A 1UJ3C 5IHZB 5CZKA 5HHXL 1YN7A 2Q8AH 3PXHA 4LU5L 1T04A 1OSZA 4NUJB 2R0LL 4P3WA 1RIHL 2NZ9D 2XG5A 3I9GH 3B2UD 4O2CB 2A6KB 4CADA 4X98A 2DLIA 1Q94A 4WUKH 4ZS6C 3UTSB 1XZ0A 1UKTA 4JRXD 2J8UA 3O3UN 1JZ5A 4LPUA 1K5NB 5JMRA 2GQHA 5D70H 3GJFH 4AH2A 3V79C 5KANG 2V7NB 1XGQA 2ARJA 3STBA 1KPVA 2X4PA 1JGVH 3NIDF 2OP4H 3F6IA 3BGMB 2VLRA 4JCLA 1AD0B 4DZBA 2HN7A 4ZG1A 3KYNA 4UBDC 2BNQD 3BW9A 4YXLL 1CICB 3RTQB 1J05A 1BMGA 2FWOB 5KS9E 3IXTB 4TSAH 3KPSD 3NAAH 3BGFB 3SJVE 2H8PA 1OTSD 4YLQT 1F3DJ 5C3TA 5DJYA 1R24A 1RUKH 1U42A 4MJ5B 5MEOB 3MNVA 3FQXA 3BP4A 2A74B 2VZVA 4X7TB 3NZHL 4WHCA 5T3ZL 4GBXB 4UDUA 4I0KA 2N7AA 4WW2A 4RRPA 1KENH 3O9WA 2VXTH 3MV01 4NQTA 1NAKL 1CBVL 4M61B 3QZWA 5GGRA 4KKBD 2NPLX 4TULL 4PJXE 4Z7VE 1TNMA 4N8PA 3QUMH 5ISZD 5IM7B 3NACH 3CLFH 4ZUVB 2QLVB 5D7LE 4JDZB 1U8HB 5JR1L 1IQDA 2W9EH 4JY4B 3HE7B 5AWNL 1OAUL 1XF5B 1AQKL 1RZIA 2XG4A 3AS1A 4JKWA 4CMHB 1YN6A 1DANU 4N0RA 2R29H 4HPOL 3QDGA 5F96H 1JZ8A 3MV7D 3L1OH 3E6HA 1AIFA 2E9WA 3MJ9H 2ZUQC 3L5XL 5TFSH 3PGDB 4WW2C 3FQRB 2V9QA 3GDBA 1MCSA 4GQPH 3O9WC 5C0BE 4PFEA 4Y2DA 3WFEH 2MJWA 5EU3B 3BDYH 1BIHA 5IMOA 3FQWB 2B0SH 4TUOA 4IOSD 4AMKH 1IZJA 1UJTA 2C1PB 4XP1L 1FP5A 2AP2A 5BV7H 3QQ9D 4NZRL 3WD5L 3ARDB 3MPCA 1OGTA 5E8OA 3DUUA 3JWOC 1U3HD 2WUCH 4PJ9B 2P5WA 3LEXA 2F54E 5HY9A 3J8F7 4MD0B 5C09D 3HKFA 4AENA 1RJLA 3EO9H 1QKZL 3DHMA 3ULVF 3WKMH 2HFGL 3DROA 3VMPA 1SJEA 4RRPG 2O5YL 3O6LL 3DUSB 4G6ML 3HZMB 5FKAA 2DTML 4PS4L 3U6RA 3QZWG 3BD3A 4JO3H 3MUHL 4UUJB 32C2A 3DV6A 4Y2DC 1YY8B 4P2QA 4YEFA 5D6DA 1QSEA 1KCLA 2F5AH 2R15A 3QR2A 4PJFA 3H2WA 4QOKA 1DVFB 4PJIB 1JYNA 1XGPA 3O4LA 1G9MC 1TZIA 1CDIA 4H20L 1IGYB 1ZLVK 5K9QG 2QSCL 2YZ8A 4GSDH