5DFWH

Crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment k13
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
222
Chain Sequence
VRLHQSAAQLVQPGASVRLSCTTSGFNFKDSYLHWVKQRPAQGLEWIGRIDTGNGNVKFDPKFQDKATITTDIPSMTAYLHLSNLTSEDTAVYYCVPYGYGFHSWGDGTTLTVSSDIQMTQSPASLSVSVGETVTITCRASENIYRTLAWYLQKQGKSPQLLVYGATTLADGVPSRFSGSGSGTQYYLKINSLQSEDFGTYHCQHFWGTPWTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title VH-VL orientation prediction for antibody humanization candidate selection: A case study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords CD81 antigen
total genus 52
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH02
2NMSA 5MEQB 2CLZA 3QXTA 2FBOJ 4LPXA 4YHMH 3T77B 5FCUH 1NBVH 1T03L 1TQBB 3MOBL 5BW7C 4F7MB 1GC1H 5DYOB 3AREA 3D18A 3UXFA 1IQDA 1J1PL 5MP6H 4D3CL 1A64A 5KSBA 3R1GL 3BSZH 4N5EC 1NEUA 4Z7VF 3DI2B 3VFGL 5IESH 3GSVA 4JO4H 1P7KB 2J3SA 4CU8A 1R5IA 4UUJA 1ORSB 2DLTA 5EZOH 3OKLB 3SDAA 1D5BB 1V05A 3RHWF 5E5MB 4LLMB 1YQVH 3BIKA 3OJDB 3L7FB 1QR1B 1KJ2L 5BRZB 5C07B 4ZS7L 5F7DA 3BD5A 1KCKA 2NY2C 2H1PL 2V9TA 1RJLA 1DE4B 5IBTH 3MUJA 1BQLL 2P5EA 1TVHB 2OQJB 4XPFH 1CBVL 2AI0H 3D85B 3GSUB 3VDAA 5BMFL 4X80H 4FP8L 1FNLA 4X6CE 5HPOA 1BQHG 3EGSA 5DK2B 2R0ZL 4R7NB 4PP2A 3WMSA 1Z0MA 4ODTL 5CILH 3LV3B 5E4EC 4A6YB 1CTNA 5GGTH 4AG4H 2DS4A 4EDXA 4KDTC 5J1SC 5B39B 1LO2L 3FRUB 1BAFH 4KPHH 4OM1H 2ERJC 3ZKXB 1DQJB 4LK4A 4FXKA 1GHFH 2C3VA 1OW0C 3KPNB 3LS5L 3QUZC 5IVOA 5CJOH 1FYTB 3BMVA 4NN7B 1YYLH 5EBMB 4FTVB 4JZNB 4KTDH 4OIAA 2W91A 2X44D 4X6FB 4F7CA 3FZUC 2CK2A 4ZFZA 4OQ1A 3BD4A 1U8PB 1J1XH 3OPZH 4JANA 1BQHB 5HPMA 1WK0A 2DAVA 3ZHKA 3LD8B 1DLHA 4LKXA 3INUL 4HGMA 4LPYA 4DOHB 1TTFA 4PY8I 4PLOB 5GZOC 4PJDF 1N0LA 1RUML 4G8FA 3QG7H 5DZOA 1JZ5A 5GGQH 5B39G 4YFLF 2FGZA 3HCVB 3DXAE 1QR4A 2OYPA 5DC4B 4Y88A 5INDA 1U8IB 3K1KC 3QDJB 3IGAB 3TA3B 1Q38A 1NAKH 3SKMA 5FO8A 2FHCA 1ZHKA 5J11C 3GSOA 1SVCP 4YDLB 4NNYA 4OD1L 3MNZA 3VXSD 1WCBA 3FQXB 1B90A 4PYHA 4LVOB 4NUJA 1UT9A 3MLWH 3OKOB 3RVUC 2BNRE 5FV2A 1N5AA 3CXDH 1X6LA 4JFFA 1AI1H 2BOBA 2EIEA 4I77L 1HN1A 4K9EL 3NFSL 3SJVD 5GGRY 3SE9H 4LEXL 4ONHB 1DBJH 5T3ZL 4F58L 3QEGL 4LSVH 4IEFB 4NO2B 4LCWB 2DICA 3MYJB 2PTVA 2YD3A 3F58L 4HWBH 2VWEC 3GSXB 5FAAA 2DKMA 1IEHA 2FZ3B 3OKYA 3ZDYE 3IAGC 3BN9D 5EBLA 5DI8A 1FP5A 1GZPA 4RX4D 3SOBH 5DD6A 2C4FU 4L9DA 1P84J 2OR7A 2HFFB 2J8UE 4YXHH 5BRZE 4NHCL 1WAAE 1EZVX 5CWSA 1LEGA 3QEHA 2A83A 2EH8L 1LEIB 1UZ6E 1A3LL 3I6LE 1OT2A 1GAFH 2EDYA 1IILE 3G5ZA 4NBXB 4ZUUB 2DQIL 2ICWI 3U6RA 5D6CB 3DGCR 1KN2L 2GW5A 1MF2H 2XWJA 5HY9A 4GLRH 4QRUA 4XMLH 5F7KC 4K9EC 1OSZB 1OD9A 4OF7A 4Y1AA 2B4CL 2A6DA 4G9FD 1KPVB 5F9OL 4PJ7E 1WZKA 3WS3A 4YXKL 4P2OD 4JKMA 4Q9QL 1AQDA 1UZ8A 1WCQA 1YMHB 2GHWB 4QCIB 1IC1A 5FUOL 3D39E 5JORB 4MDJB 1A4JA 4YDKL 4KQ3L 5EZLA 2RIKA 1GGCH 4OLVH 3C6SB 5F96L 5DJCB 4PPTA 1DANT 3L5WA 1AQKH 1SHMA 1NGYB 4L3EA 1IZJA 2XXCB 4PJ8C 4ZUVA 2WUBH 4OCNC 2J6EH 4PBXA 5GS0L 4F15C 1M71B 3EYFB 4XBGB 1RZFL 2EYTA 2IG2L 3JXAA 4YDJB 4Y16B 4MCYB 2KZ1B 4KRNA 4FNLH 4R4FL 3O41A 4HF5H 3VDBA 1UH4A 4WUUA 3B9DA 2YC1B 4KKLD 2ADGB 4CN6A 1NBZB 1AD0A 5FYKE 1BD2B 3OBAA 1R3IH 3TH2T 2LAAA 2DQGL 5J6HA 3QNXA 4Y1AD 2XT1B 3ARGD 5E4IA 2K9UA 1A6UH 4OTXH 5JOFA 3FT3B 3ZLQC 5KN5B 4JFQB 3VFUA 4HBCL 4ISVA 4QWWD 3D6GA 3T09A 4AIZA 4X80L 1AKJB 4LHUA 4PGCA 3CUPA 1YMMD 4PJBA 2QSCL 5GS3A 3STBA 1E4XH 2FX7L 3B9KC 4HUVA 3EFFB 4QO1A 4KH2A 4WHYH 1CL7H 1EHLH 4GW4A 3LMJL 1TJIL 32C2A 3JV5A 4LCUA 2AK4A 1F6AB 5D9SB 4BZ1H 2EO9A 4RFOL 2ID5A 2XQBL 3VGHA 1NAML 4J12A 2M8XA 1DQMH 2MCPL 4Q97A 4P2RA 5FHAH 1D5ZB 4XC1L 1NCBL 3QUKB 4FQLL 4PUBH 4WFFD 4NP4H 2YPKA 2L7JA 1K5NB 2ORBL 3QCVH 4GKZB 2E6JA 1FNGB 5EOCJ 4ELMA 2Y1VA 4Z0BH 2JK5A 4IRJA 4DW2H 1WIUA 4ZNEA 1YNLH 1NLDL 2AJSL 4LASL 4XT1C 4EI6B 5J3HD 3FHAA 4KMQA 4BFEA 4O58H 3BZFA 2XWBB 1W2KT 3CD4A 2WMPA 5JW4M 2A73A 3P9MA 1O5DT 5CEZD 1BFSA 3W11D 5F71A 4AJ0A 1RZIB 3H7BA 4EN3B 1CI5A 5LXGL 4F8QA 4OV5B 1YNTA 1Q9KA 4ZFOL 4ODXA 1IARB 5LBSL 1JZ3A 4PJXA 3VH8G 4BSWB 1ZHLA 1P6AB 1OW0A 3SKJH 2G60H 1D6EB 4G8GA 1FO0L 1MQKH 1JL8A 5ANME 1XIWC 4JGUA 3FO2A 4CMMB 2A6IA 2G5BB 3ARVA 1KIRB 2JIXD 1X3DA 5DXWA 4TUOB 3S5LA 5J0BA 3I75A 1QLFA 4QRRE 1HHGA 1MREH 1T1WB 2AJZB 7FABL 4Z76A 3HI5H 5LGHL 4OT1H 4NKDB 2Z31C 5J12B 1H3UA 3SE3C 4C4KT 5DA0B 1MRCH 3G6JE 3P30L 4Z7UA 4PRPE 1GXEA 3BW9B 5EZJB 3U0WH 5EC2A 4KRLB 3KGRA 4LNRB 3VWKB 3VA6A 3SDCC 3MNVA 4RAVB 4X98B 1RSFA 5E2WL 1MFBH 1FC2D 1T5WB 2EC9U 4E42B 25C8H 4R8WL 4MLSA 1AIFA 3H9SE 5KSAD 4I8DA 3JWDC 5F1IB 4AEHH 4JFHE 4KWUA 3V6OC 5BXFB 1URLA 4CW1A 3RL2A 4I0CC 4U1SB 1MHHA 5D7LB 1A1MB 1YEFH 5C0CA 5IG7A 3ULVD 4KV5F 4HGWA 4P57B 1U2CA 1NFDA 4HKJA 1RUAL 1CZ8H 2VXTL 2HH0H 2CRZA 3DUSB 5EOCL 3L7EA 4U1GB 1RUAH 3ULUD 2NY6C 3HAEB 4WW1A 5A2LH 1U41A 3OMZA 4W6WB 1XGYL 1I3RB 1X5GA 4KRMB 4TVPD 3WFDH 5E94A 4LHJB 2ZKHH 5FCUL 5AUMB 3HA0A 2YN3A 3PIQB 5D1QD 1I1YA 4PRBA 2GTWB 1T0MA 2BOCA 4WWKD 1IAIL 1KEML 2NY3B 4G9FB 1JNHA 4D3CH 5MP6L 5BQ7B 1MFDL 2DYPB 2O5XH 1IKFL 3KAAA 1G7JB 2X09A 4P2RE 4JO4L 4HULB 4FQJH 3ECBA 4YHYB 2YPLA 4UQ3B 1JPSH 4XVSH 3HNSH 2VZVA 2XFXA 3MXVH 1OAYL 2FWOA 4H8WC 4JANB 4LKCA 2YMXL 1IZKA 4BA8A 4N0YL 1B6DA 3ARSA 2AI0L 3VGDA 1GIGH 2AJYH 3O81A 2ICEA 3QIWC 5KVEL 1MCBA 2EE9A 5DZNA 1HDMA 5BV7B 4M7JL 2VDQH 1MFCH 3X13B 3EO0A 5HDQH 1D5IL 2Y6SC 5HYFA 3NIGF 2VXQL 3OQ3B 3KR3L 1JGDA 5HDBF 3K8LA 2KBGA 1KACB 1R3KB 1S7RB 1I1AD 1KPRB 1FRGH 2E8YA 5I1IH 1T0PB 3D3VE 3CH1A 5HYEA 1AO7B 2PUQT 4OZHA 4LQFH 1CT8A 3MGTA 2BOBB 2JB6A 3QA3A 3C60D 3OKDA 1H3VA 2KH2B 4JFPB 3K1DA 1FQ9C 1ED3A 2XKSA 3O4OB 3BGMB 4JY5H 1XFPA 4Z7NE 5TQ0L 2ZWLT 4UU9A 1RK1A 4G6MH 2OK0L 1FFNB 2XZAL 1ZS8B 5JXEA 4Z78A 5MENE 4YHKH 2UY7A 1PKQB 3MCG1 3RZCA 4GS7C 4MB3A 3DRTB 4LBEA 1NC4B 5DHXB 1H15B 2QHLA 4XMPL 1KNOB 1G6RB 2WUCL 2E8ZA 5DJ8B 5IGXL 2Q76B 4DGVH 5ILTH 2WUCH 4NFCA 4IRSA 5F7EH 3REVB 4J2XA 4OZFH 1AGFA 4PJ8D 2VRAA 1FFOB 4GG8B 4H26B 2CIKA 4H0HB 5D2NE 5EU4B 4NOFA 1G7LB 1TNNA 3QHFH 3MCKB 3T3MF 2GK0B 3HC0A 4K3JL 4NPYB 4WHYG 2NX5D 4L4VB 3ARYA 3BP6A 5EIQA 4PS4L 1U3HD 1LO5A 5GS1B 4KKLC 1R3LA 4XP6L 1JNLL 1KCUL 1KJ3H 4H1LH 1XAUA 4G3YL 1IGML 4HH9B 4L3CB 2ERJB 3QWRA 4NZDA 4MDJA 4EI5D 2VMFA 5EOQL 2I27N 3DMMA 3FMGH 1T1YB 4HUUA 3GJFB 1XH3A 3KPLA 3PGCB 4YHIA 1CG9A 5FECA 1NGPH 2FEEL 2ICCA 4UNVA 3ALWA 3PWNA 2H32B 2NXZB 5H37G 1QNZH 5DZLA 4OLZL 4EIZC 4BFBD 5IV2B 3D5OF 5EU3B 2EYTB 5AZ2H 5E2WH 4PRIA 1E0OB 5F1SA 2UWEE 4F2MB 2XPGA 5C0RL 4HXAL 2R56L 1WICA 3C5ZA 1B3JA 3KPOB 2ADFL 3RX8A 1XF2A 4W6YB 4A2MA 5DUBA 4PP1C 5T3ZE 3OXRB 1AC0A 1N7MH 2F15A 4ERSH 3G6DH 1CDGA 1FGVL 4OD2A 4QXUL 4U1JB 4XPTH 1DQDH 4XXCA 3SDDD 4EJ1C 4JFDD 5JHLL 4L4JA 1IAOA 3RUGB 3V0VA 2A77H 1N4XL 3VFRA 2EECA 2VLJB 2HT2C 3KYAA 2R2EA 15C8H 4M9OA 2XA8H 2OJEA 2HKFH 5C0GB 3FKUS 4JPKH 2BERA 4X6BB 5D1ZB 1T1ZA 5C0AD 3G5XA 3CSYB 5B38G 1V8HA 3B6SA 3QULA 5H2BA 5IB5B 3U0PA 1SYSA 3HMWH 2BVUA 2R8SH 1C8PA 2WZPD 3RWIA 3O4LA 1TLKA 3VA2C 1QD0A 4JGJA 1N8ZB 2AVGA 4KGJA 3V4VH 5KVGL 1R24A 1KJ2B 5EOTB 2WUBL 4RAHA 2X1XR 3LZFL 5FDWB 1K8DA 3S97C 2DM4A 2NY0D 5E6ID 1BWMA 4EEEA 1P2CB 1FL6B 1N5YH 1U3ZA 5BV7L 4OTXL 2XN9E 5L0QB 1WVZA 3BISA 4NRXA 5IHUL 2D4FA 1MHCA 1S7SA 2ZCHH 1ZHNA 3A6OA 3MJ7B 1I85A 4YBQD 1BEYH 1NUDA 1QRKA 1UXWB 2ZCHL 1JV5A 4ENED 1AGDB 1TZGL 5I15H 3FT2B 4GUPB 3T0EA 5C07A 1S8DB 3LV3A 1K85A 4FQ2L 4CKVX 1T3FA 4NQSB 1KT2A 2Z0BA 2UVFA 3VI3E 2VLKD 3DHMA 3STZB 2F8VA 3VW3H 1S7XB 1J0YA 2EDJA 3GIVA 4PJ7B 4YIQB 3MQIA 3VD7A 5KSAC 3HZKA 4RISL 3P4NA 3IJSB 5LQBL 2B7DT 2HWZH 3CDCA 3FL7A 1QSFE 2XQBH 5F1OB 2PCPB 5LQBH 4OI8A 2VLKB 3LVEA 3V79C 1CYGA 1QQDB 4MJ6B 2EDNA 3B43A 1IM9D 1GPOL 2J6EL 2P24B 1YYMH 3TFKC 1MRDL 2P5WE 3ARFD 4XNXH 1HI6B 5E2VH 1AE6H 1FVCB 3PF2A 5CZXC 3NFPB 3L3DA 1KULA 2XNAB 4NDMA 1N6QL 1ADQH 1RAMA 1NANH 1ZWIB 3QO1A 1FL5A 5I1AA 5GS0C 4DAGH 2Z31A 2H1PH 5C0EB 3Q6GL 3DX9A 3EYVA 4PRDA 3ARFB 5K59E 1C1EH 3KYKL 1IT9L 4WUKL 4QYOA 5HHPB 1FFRA 1OM3H 4NZRL 3RX7A 2VZTA 5GSVA 4YFLI 3UYPA 1LD9B 2YEZA 4KI5D 4KI5F 4OIBA 4GBXA 2BVYA 4BH7A 4LLYB 3VFSB 1NLBL 1Q1JL 1LDSA 5E5UB 3T2NH 3I3BA 1KN4H 4IMKC 3DURB 2PXYC 3VGBA 1DUZB 1C7TA 3PL6C 2JF1A 2H41A 2UZYB 3K46A 4POZC 5B8CA 2VDOL 2R29L 1UJ3C 5C0JA 5MEOA 1N2RA 1JYXA 4HIIA 1YEGL 4JKLA 4BK5A 3MFFB 1DN0B 4WW2B 2V7HA 3MUY1 3VRJA 2PYEE 3O3EA 4JM4L 4UBDC 2FJGA 3MA7A 1QLEL 3H3KA 3MYJA 4Z7QE 5KSVB 1JFQH 4M48H 4MD4B 1RK0A 4XRCA 5DK0A 2XTJB 5FYLE 3IDNB 5IM7A 2D7TL 3UMTA 5D7JC 5IVZB 3MREB 1QVOB 4GAJL 1PKOA 5DI8B 3QDHA 2ZCLL 3OKMB 2UWEB 2NLJA 4NSKB 3UP1A 1FAIL 2B0SL 5L88L 3G6DL 4MDIA 4TTDC 3QR2A 5KVDL 3FFCA 3L3GA 4QY8B 2FLBT 4JB9H 1CDUA 5DQDH 3NZ8B 3D3VA 2NY3D 1D7FA 3W9DB 1JHLL 2X4PA 3MRNB 2HH0L 1NC2B 3E2HB 2BSTA 4JB9L 3K8KA 4D9RD 1WZLA 4HK0A 5I1JH 2YZ8A 2E9BA 2PNDA 4JKWA 5T3XH 1YJDL 4OI7A 4X6DF 1P1ZB 1YY8A 5DEFB 3SE9L 1BF2A 2JB6B 4JFXB 5JZ7D 3T1WA 3WFBL 4Y4HD 1LE5A 3IFNL 4JFPA 1J8HE 4DGIH 2BHZA 1Q9WB 4JO2H 1IAIH 3IB4A 4PY8J 4GRLA 4OCLC 1U91B 3ZSSA 4ELKA 5HGDA 3TT1L 1AD0B 1NBZA 3SGKA 4IIQB 1S7QA 3O3BA 4PJ9D 2X5PA 4LCYB 2VUOA 4ZFOB 4JFDE 3L6FA 4F7TA 4AEFA 3AUVA 2IWGA 1NEZB 3VXRE 3UTZA 1CL7I 1XR8A 4IOSD 5HHMD 4OF3A 4PJCF 5D93C 1OAZL 3T2OA 1IGCH 4L1DA 3W2DH 1YEFL 3WNKA 3R8QA 4JDTL 4LSTL 1YEDA 4HLZG 5SWSD 5KVEH 2IPTL 4DN4L 4G5ZL 4JQVA 1YEJH 2AEIT 3ZKMD 1BD2A 3VCLA 5DGRA 2FJFA 4OZGF 1A47A 4QHNB 4PTUB 4PJ8B 3ARQA 3N1QC 1NH6A 2BK8A 2IPUG 1KGCE 5TQ2H 5MEQA 3BP7A 3CPLA 4NZUH 2GAZB 5AWNH 1MJJB 2NY7L 4HZLB 1I3VA 3RKDC 4ZUWA 3WFDL 3PQYA 1QRNE 3I6GA 5DMKA 3C8KA 3BN3B 4RGNC 3UPRB 3KDMB 3DV6B 2P8LA 5CCKL 4NQCA 3ALXA 1Z9OA 5DRWA 1AC6A 4LFHG 2EH7L 3MV7B 2XKUA 3B9KA 1NBYB 5DHYB 3X3GL 4EI6A 4Z7WF 3L3JA 4X6DB 5C9JB 3E8UL 4MCZB 2DOCA 5F6IB 3IETA 3IU4L 5JDSB 1ZA3B 3MRDB 1YNLL 2AJSH 4LASH 4GMTL 1RUKL 2BX5A 3EHBD 2NTFB 3QUXA 2AXFB 2DLFL 3TGXA 3MRIA 4AIOA 4JPIB 4X7TB 4NQED 4LLUA 4K7PY 5L8JB 5FYJH 1IAII 4Z7UE 3N1FC 5IGXH 1JHKH 4DKFL 5EU6E 3FTGA 2GSIB 1I9EA 3UYRL 3I2CH 1INQB 3R8BB 2JCCE 3MOAH 1IBGL 4YHYC 2FNBA 1AXTH 3PWPE 1WWCA 3IVKB 2VB5A 3V4UH 5DRNB 4M93B 1G9MC 1L9MA 4TNVK 4X5XB 3RDTD 4L8CA 4GG6E 2VWEE 1NGQH 3C5ZC 5DQ9B 4KPHL 4ZFFA 1NQBA 3GSRA 3PHQB 4YBQC 1VKXA 2N7AA 2HN7B 4PJXE 4JFEA 5ADOL 1CF8L 2OJEB 3EO9H 4ENEC 3WHE1 4OZIE 2ADJA 3QWOA 2GIYA 4JGMA 2Q86A 4LVOC 3SBWA 3UTQA 1A1OB 4JFFD 3GSNB 1INEH 4TUOA 4PJCB 3S5LB 3U0PB 4PRHA 4L1HA 3S98A 4RAVA 5J11B 5E99H 2YPVL 4NC1C 1YUHB 1GGBH 4APQC 2P43B 1ND0A 5AZEH 3ZDXE 5AG9A 5SWSA 4NGHH 4P4RB 5D72L 4GAYB 2RCSH 3FQTB 4PJ5D 4P46B 5KZCD 2NY4C 5D93B 2D7PA 1EXUA 4M7KL 4LKXB 3WNLA 3WFZA 3LD8C 4TOYL 3SDCB 1QFUL 2OMNA 1M6OB 2VITB 1FNEA 4UNTA 1BGXH 2F54D 2X1WL 3PL6A 5IT2L 2GFBA 4I0PD 1P9MA 2G75A 4YHPA 5EWIH 3UPCA 4FFZL 4DVBB 1XMWA 3VRIA 1I7ZA 4ZS6D 3KHQA 3VFTB 1Q72L 5T5NF 4PJIF 5I1EL 1U95B 1WCBB 1YEHH 3FQXA 1XGRB 5FUCC 3QUZB 1IC4L 4N8CH 5I8EB 3MJGX 4L5FL 4X7EC 3IS1X 3VXMD 1U8QA 3OJMB 3HZKB 4G9FA 1BVKB 5DJ2A 5T1LB 4MS8D 2CR3A 1S5IL 3MRPA 3QWQB 4D0CB 3X14B 5CBEB 3ULSB 5TGBA 4FNLL 5F88A 1PX4A 1RHHA 5E6IA 2FO1A 4GRWH 2M1KA 4DKAA 4XXDB 4K8RH 5HVGB 3VXMB 3U2SB 2APVA 2PW1B 4K23H 4GMSH 1KPUA 2PXYD 1TPXB 1EK3A 2XN9B 3MRQB 1QBBA 1NCAH 4C58B 2XG5A 3OR7A 2I9TA 4MVBC 2P5ED 2I07B 5CWSB 3FFDA 3GMNA 3UTTB 5J6GA 4D0DA 5I1CL 3RNKB 4KJYB 2BNUA 1UWGL 1G9NL 3I9GL 4MQXD 4X4XA 2FHBA 5I1CH 2F5AH 4ERSL 2EE6A 1DJSA 3U7WL 3SGEH 4H25A 4UBDD 5GSVB 5EC1B 3K4DA 3QIWB 1H3PL 1KPVA 3GSWB 4HXBH 3GUTA 2ED8A 4YDKH 5B38A 4ETYA 3U9UA 3D85A 2CGRL 5DLMH 1NGZA 4MA7H 2N4IA 4BQBA 2J8HA 5I18L 5CCKH 1JGVH 4M43H 4R7NA 1JJUA 2PTTB 3LN5A 3NOIA 5L8KB 1H8OA 5HHME 1K4CB 1JI2A 4XB8A 3F6IA 5E2VL 4ZAKC 3MLTA 2AK4D 4XPHL 4Y19D 1XGUB 4GBXC 2H6PB 3HUJB 3S35L 1TIUA 1KNOA 1G1YA 2NY3C 2X4QA 5DRZA 5DQJB 3F7RA 1DN0A 1BFVH 2IGFH 2JELL 3ZHDA 4L3ED 3VG0H 4EN3D 1OAKH 1CD0A 1CXHA 4P2QA 3IFLH 3MRMA 4QOKD 5D7IF 4UU9B 1RK1B 2P8MA 5JIHA 4ODVH 4DKFH 1FE8H 2NY6B 4PJEA 4MXWH 3QDMD 3HLAB 4OGXL 1I1RA 4Q0XL 5IVZA 3UYRH 2YD9A 4RMRA 2OSLA 2AP2A 4U1IB 5JXEC 1NGXA 1E6JH 3CIQA 4FG6D 2DWDB 3F7YB 1JNJA 2HVKB 5BMFH 5E1AB 1SJVA 3R0NA 1BOGA 5DMGD 1UM5H 3NZHH 4P3CH 3FB8A 4TSBH 1Z3GL 4HH9A 1KG0A 4Y2DA 4YLQT 4LCCC 4NO0D 2XY2A 3REWB 3EBAA 4K3GA 1DBJL 4GRMA 2AK1H 4LFHD 1F6AA 1XGTB 2QADD 3X11B 1FH5H 2E3VA 4UINH 3G5VA 3FMGL 3S96B 5ITFA 4KMTL 3TWCL 5I6XC 4JHAH 4HWBL 1I3GH 5ELIA 1MEXH 2DQUL 3DX8B 3PP4L 1U9KA 4BQ6A 4JFXA 1N5AB 2YN5A 4ZNEE 1BZQK 1NCWL 1Y0LB 4WV1B 1GC1C 4XGZB 3V0WH 3FB5B 1LO0H 4P5TA 1FJ1A 1M7DA 4HPYL 4J3VA 1IGFL 4MZ3A 1IJ9A 5C0RH 3H0TB 4WHTB 4ZYKB 4NWTH 3MRLA 4LEOB 5BZDA 2OTUA 1ZA6B 4PD4K 3WCYA 2P47B 3S8WA 3G6AB 3B83A 1XCQA 4AENB 2EDDA 3DETC 3GRWA 4PJ5A 1TJGH 4MJIB 1WBZB 3UZVB 3L3HB 3QH3B 3DO7A 1T89C 3B9EA 4DZBA 4F2MA 2AJVL 1MQKL 1FGNH 1A7PL 1RIHL 3E3QE 3U83A 3JV0A 5CLTA 2YUZA 2A9ML 3FCTA 3G5XB 1HOCB 5D1ZC 2R0WH 2I5YH 2OZ4A 5FA3A 1G7IA 4XCEB 3U1SL 1QLFB 4K55A 1CICC 4KRPB 5D7IA 5DSCA 3C8KB 3T2PA 1X5IA 2ZJSH 4JO2L 3W0WA 4BZYA 1EEYA 4JFZL 1F90H 1FBIH 4XNUL 3DV6A 1F3DJ 4NZJA 4QTHA 3WIIH 3MRHA 4KKBD 3WFBH 4K07A 4XNUH 5CGTA 1HHJB 4TVPL 1LK3L 2QEJA 3SY0B 1CDHA 3RDTC 1S3KL 1HQRB 4W4OA 3ZE2F 5ETUA 4CBPA 5EIIA 4OKVB 2ZG1A 5BW7A 3DECA 4UAOC 4YHNA 2OS7A 1M7IB 5LWYH 2DF3A 3TZVB 4QT5B 3CMOH 1B9ZA 1BJMA 3QP3A 5LGKA 1Y6KR 4KKCC 5C08A 3RTQC 4X4YA 3NIFE 4PJXF 3QEQE 4PJ7A 3MFGB 4APQD 1B0WA 4HUMB 1A6AA 2ZG2A 1H3PH 1I7RB 4V2CB 3NIDF 4TNVF 3MODH 1QRNB 2JJSC 3QXDB 1UKQA 1OAXH 3UTTD 1I85C 2CUMA 5CJQL 3MV01 1LMKA 3QEUA 2QBWA 1TTGA 1KB5H 2ESVB 5E4EB 3PNWB 4NWUL 5GGTA 4FQIH 3SDAD 3MLUL 3K2MC 4LAQL 2IPKA 3VXQA 1JNHB 4ZS6C 1V5JA 3QIBC 1T6WA 5IMMA 4L9LC 3QPQD 1CCZA 1PG7X 1F58L 1IKNC 1F3JB 4Y19A 2EDBA 3IKCA 5GJSL 3O0RH 4P9HL 4F7EA 3WSQL 4OIIL 2GSGB 4PD4J 1P4LB 4GKZA 1QYGL 5GGVH 3U36A 5FOBA 2YEZB 3WUWG 4QF1B 1J05B 2GCYA 3E6FB 4FTVD 1IQWL 3NFNA 4LOUD 1CBVH 1JGDB 2VAAA 3EJYD 1QSFB 4NIKB 1S7RA 3ARED 1OSPH 1DDHB 5GGSY 4EUPG 3WHE0 4OFYA 5FM5O 2CDEB 1QBLH 1QZ1A 5MEOB 1P53A 5I8EA 5IFHH 1MAKA 1MCNA 2L7UA 4GRWE 4MQXC 4NCC1 4KZEL 3V4PL 3P9LB 2YUXA 1HSBB 4PB0L 3O3EB 2AEPH 4O51A 4EKXA 4MB4A 4Z77A 4LU5H 4PG9A 1FZJA 1GPOH 1EJ6A 3RPKA 5D8JH 5J13C 3V0WL 2AV1B 2FO4B 3ZE1E 1QEWA 2E7CA 5C86A 3UBXI 2H9GA 2YPVH 4PJGE 3KPQB 4KGLA 3U2SA 2ZNXA 3KS0H 5I8CA 3QQ9C 3IDMB 1UQSB 3T0VA 4Q2ZA 1GYAA 4P5KA 2D7TH 5FM8A 2YHGA 2XA3A 4Z7UB 1FZMB 2BP3A 4P23C 2A9NH 3OR7B 3VRJB 2I9TB 3GSQB 4ZAKD 1LE9B 3UTTA 5D2LB 1A9EA 3D69A 3O6KH 2MTPA 1AGFB 2E7HA 1GOHA 3BUYB 1EGJL 3SO3C 1ZKAA 5DK0B 3BT2H 3EIFA 1KLUA 4KRPD 1B4JH 3TH4T 5CGMA 3I6LD 3S88L 5ANMA 3NPSC 1CFQA 5EC1A 3VFPB 1NEZG 4M6AA 1A1MA 5I1EH 2IQAA 3D39B 5JW3L 1AHWC 4U6YA 4Y2DD 3U30C 5IG7B 3HG1D 3RJDA 5I75B 5KG9B 1J1OL 2UYLB 3QCUH 3MLPA 1W72L 4OLUL 3K4AA 1QOKA 2JTDA 3QXAA 5DHVH 5EUOF 4C56A 5IW1B 2EXYD 4H0IA 3CCHA 1XH3B 3V7AE 2MSPA 4ZFOA 1R3HB 4U4BA 2WW8A 3BP5A 3TBTA 4JY4B 2D0FA 3KXFE 4HSQA 4Q9CA 1CGVA 3GRWL 1CIUA 2JB5L 3RKPA 4J3XA 1UWGH 1KBGH 3DIFB 3V6OE 5LGJA 1S9VB 3MRRB 5GGRA 1R0AL 3JWOC 2Z8SA 3VWKC 4NHCH 3WFEH 4IIQA 1EERB 5IHZB 4Z7OF 3HI1A 1A14H 4PJ8A 5E8NA 3QHZH 3CFKA 1IFHH 3PABB 4RCAA 4MXQC 3BP7B 4HW6A 4PJAE 1P4IH 1NGXB 1WISA 4HWEL 5J12C 4G80B 2Y7QB 4AEEA 2BFVH 5SX5K 1UYWH 5I76A 1Z2KA 2NW2B 3MX0A 4M4PA 5EA0H 5FUZL 2F54E 2EEBA 3X17A 2OXGA 4NQDA 1AQKL 4X6BA 3PGFH 2QQKL 3NA9L 5EA0L 3HMWL 4FQHA 5F21B 4U7SA 2XKNA 4GLRI 1L0XA 3NCJH 4K2UL 5KJRL 4YEFA 2WM0A 4LSSL 4RGMC 3S96A 1HQ4A 1WZMA 3F7VA 1OAKL 4N68A 1CLZH 2Q1EA 5F7MC 2OZ4H 5J1AA 1LVEA 1Y6MR 2HFGL 4LCWD 4POYA 5CFHA 5L2KD 5ID0B 5T33H 4JCMA 5KAQF 2R1WB 3QQ3A 2DMCA 1M7DB 3FTGB 5D7KE 1ZK9A 3IAQA 3I6KA 3LKSA 5JXAH 1N26A 3L3JB 4Q0XH 4X6DA 4HWNA 5C9JA 1JWUA 4Y4FA 1OF2A 4ONFL 5GPRA 2I9LB 4AEIH 2HFEB 4O02L 3VXNA 3I9GH 1GIGL 2AJYL 2CLRB 5HD8C 4LHUD 4XWGH 3LPWA 1XGQB 4KVCL 4HV8B 5BCAA 1MRFL 4F57L 1CDYA 2FR4B 3I50L 4AT6B 5JW4Q 3MLWL 1P7HL 3WIFA 4MXVF 4PV9B 4JVWA 3LKNB 5CILL 5JOPE 5I1IL 1YY9C 4QXTA 2F53A 4K71B 1ZTXH 4LSVL 1FG2A 4Z95L 5GRVL 3OG4B 1LQSR 4S1SH 5HYSA 2VKWA 1MNUH 1RZKH 1ZT1A 4OM1L 1I1AB 3WE6B 4WFHD 5FA4A 1FDLH 4MD5A 4PRID 1BIIA 1MCCA 1R3LB 3TCLA 1XIWD 4Y5YC 3WLWC 1TJHL 2VC2H 3HZYA 1X5LA 3RWCB 4JJHA 4NQEA 5TE6L 4PV8A 1XIWA 3TO2A 3QNYB 4FXGB 2DD8H 5E00B 1OGAB 3KXFB 4NRYA 1EHNA 3O2WH 3SY0A 5CINL 5IQ9A 4WDIA 2EH8H 4PJIA 3B9VA 3HZVB 3OKLA 1ZSDA 3KPLB 4QRSA 3QIUC 1FAIH 2B0SH 3VXPB 4HX1A 2AGJH 3CFEA 1YUHA 4MJ5A 3LSOA 2H26B 1GOFA 1I7ZB 4Z9KB 2X1PA 4YO0B 2Y23A 4ZSOE 3MGOA 3QPQC 4X4YB 1ZT7B 4JO1L 3S34H 5K9KA 1IRAY 1JYWA 3UX9B 5CZVH 3FZUD 3GIZH 4GXVH 4JO1H 3S34L 3JV4B 4JN1H 4U0QB 1I8LC 5AD0A 1A7NH 2W0PA 4FN0A 3EYSL 3NACH 3SE8H 2XWTA 3TT3H 1I75A 3ARDC 1KCUH 1CK0H 1JPFB 2KQNA 4X99B 1AP2A 1NGWA 3O4LE 4OCXH 5TGBB 4XPGH 1MWAH 5I66B 1CDCA 2C7UA 3VFTA 5I30L 1KIQA 1WFOA 5SWQA 4TVPH 3SOBL 3C09B 3HI5L 1OLLA 4NZTL 3HPLA 1MWAL 2OMBA 2V2TB 3BKCL 5FHBL 1EUUA 4LOUC 1SEQL 5GRZA 4F8TA 3EJYC 2FYYB 4LNVA 1K4DB 3AREC 2MPAH 4NJAL 1OVZA 2OI9C 5TF0A 5T1KD 4BZ2H 4LCIL 2KKQA 3RVUD 1BZ7B 4LPTA 3RNKA 4JHZA 5DJZA 2WBJA 1HILB 5GXBB 2GT9A 4HHAB 1FN4B 3MZTA 5IM7B 1JF1B 3VD9A 4WCYL 5GGUA 3C08L 3DO3A 3OAYH 3MCLH 2JCCF 4U6VH 5JNYA 4TVSa 1QLRA 5GIRB 2DL2A 2B5IC 3AY4A 5INDB 3D3VB 3EDDA 3MBEC 3NZ8A 2E6QA 4UT9H 5E2JA 4PJ9B 4J3SA 3SKMB 1NC2A 1U92A 5SV4A 2B2XH 3BMWA 5D1QA 2BY3A 4XP9L 1E27B 3BKYL 3C8DA 3HPJA 4U2YA 4CADB 3FQWA 1X4YA 3HR5B 4HS8H 1CLYL 2ED9A 4RFNB 2P5EE 4QHMA 5DEFA 3WN5C 1MLCA 3ULUH 1BLNA 1FFPB 4LF3B 3SDXA 3F12A 2FL5B 1IKFH 1KB5L 1RMFH 4EUPH 4HFUH 4KTYA 1CLYH 5KAQG 3FQNB 1TCRA 3IRPX 4B7LA 1BBDL 2EDHA 1LP9B 3VFVA 3KYOB 5TFSL 4MNQA 1H0DA 3AXLB 3EYUL 3G08B 1JZ2A 2ATPA 3NGBB 4XXCC 1G7HA 5HYSG 1DQLH 4RIRA 5IR1B 4FQXD 3GJEB 5DDHB 2AKRA 3S3SA 1EVTC 1DBAH 4HK3N 4PTTB 3EDEA 4P2QB 4N0YH 1YC7A 1KYOK 4LSPL 3L3DB 2FX9L 1LEGB 2EYRB 2Y72A 5D2LA 2VLLA 3LKRB 4P9MH 4KVNH 5TE7H 2WIIB 4YHZL 4Y19E 3FHQA 1N6VA 5HDQL 2HRPH 3FT4A 3C87A 5K9QG 4R26H 3AC0A 3CVHL 4E41A 5IMKB 1CWVA 3TBSA 4LMQE 2RBLA 1DEEB 4MNQE 5SWZB 1GHFL 2A6DB 4PRNB 1QP1A 3TNMB 4ONGL 2JE8A 2XV6B 4N0UB 3H42H 2HLAB 1S9KC 3KDMA 1HNGA 3TEUA 1FPTL 1HEZB 3BDYH 5I18H 4WU7A 4WV1A 1SYVB 1NCBH 2YWZA 2J12B 4UIMA 2V2WA 4JN2B 4Y4KD 1FJ1B 3OKNA 2GI7A 2O61B 1G9MH 4HIHA 2DB8A 4NKIL 1YPZF 3SGEI 4HIJA 4LVNC 4X0KA 5DVMA 3DLQR 1OCWL 5ITFB 2X4OA 2NTFA 1HH6A 1WWWX 2FEDC 1TVBB 2PO6B 2C4XA 1EBAA 4HUXB 1OGAE 1HNFA 2YA0A 1U3HB 4WW2A 3LKQA 4MQ7B 5EG6C 1ZT4A 1LO4L 1I8IB 2NX5A 4YJZL 1INDH 3UROR 1WFUA 1M05A 4H88H 2OX5A 3KLHC 3P73B 4KUZH 2IAMC 4M8QB 3VFNA 4ZYKA 5ADPL 4I18C 4EI5B 5DUML 2Z35A 2YXMA 1OSPL 1A02N 1J1OH 4H5SB 5TDOA 3DUUB 3VE0A 3SGDI 4GXUN 4L9LA 5D2NA 2W9EH 4WGVB 3O6FB 1PY4A 4U0RC 8FABA 4FZ8L 4J6RH 5HYJA 4F7MA 2KPNA 2F74B 4JFZH 3BIAX 5ALCH 3W11C 4NC2B 1UB5A 2R29H 5F9DC 3S37H 3THML 4BM7A 1RHFA 3RZCD 2RHEA 5CLWA 4LLQB 1I1FA 2P44B 1TVDA 2Q86B 1CQKA 4LSRL 3GRWH 5HGAA 1QNZL 1ORSA 5SWSE 1SY6A 4G6FB 2VR9A 1AGCA 2D31B 2EC8A 1ETZB 4GFTB 4NNXA 4PRHE 1TNMA 1DBKH 2ZUTA 4JG0L 2OL3B 1GGIH 4KI1A 1S9YB 4D8PB 1OWRM 4S1RH 5FYLL 1CE1L 5FK9A 1VEPA 2ZG3A 3HS0B 3IFOA 1F4WL 1PD6A 4DK3A 3RRQA 5C0CE 1EO5A 3O2VH 1MF2L 5DFTA 1AXSB 1T6VN 4HXAH 3WLWD 3KPRE 3O3BB 1LGVA 2B1AL 4KAQH 4YX2H 3OGCA 1T1XB 1Y18A 4U1LB 1QA9A 2R0KL 4Q9QH 3OJDA 5LCVL 1IC7L 4ZUTA 1KB5A 2DYPD 2A6KA 4I0PA 4N1CA 5F7DB 3LIZH 1EX0A 4GAGH 3N85H 1RZGA 2VDKH 4NQDD 1MFNA 4N90E 2W9LA 4ALAH 4JDVB 4KHTL 1JGVL 2BCKA 2EEAA 5B39A 2OR9L 3MLVH 3BPLC 1AFVL 1MI5B 1PG7L 1MCJA 5FGSA 2QKIA 3C2AL 1UH2A 2EH7H 2KDGA 3O11A 4ODWB 1XF5B 3Q3GB 1DUYA 3BVNB 4HIXL 5DK2A 1HHGB 1KJ2H 1D3CA 4R2GC 5F7HA 4E0RA 4LPUA 3M8OL 5FM4A 5IOPA 1UEMA 1YQVL 5I1GH 1KB9K 3QEQD 4FHBD 4U1KB 4EUPB 2QV2A 3BPNB 3LKPB 3KPRB 3ZDZF 1JPGB 4TUKH 3PNWA 1OB1B 3CLEL 4PGBA 3L3IB 3VRLE 1G0XA 3GHBH 5FOBB 5I8KH 5B3NA 3TYFA 4ZOEA 1OTUD 2ICWJ 1E4JA 3SDDA 2R4SL 4M6NL 1TZGH 4LNRA 3FFDB 3GMNB 5FYKU 3NFNB 1ZA3A 3MRDA 1EMTL 3TFKD 1BOYA 3Q2CA 5D1QC 1PZ5A 4AEIL 3V0AC 4M02A 4X6FA 4WWKC 2VTFA 3RU8H 1I8MB 2OL3L 1OWWA 4U1SA 1DSFH 3EYQD 1F00I 3BZ4A 4LLWA 5D71L 4OCWH 3CAFA 1JIBA 3WL9A 2ESVE 2H8PB 4X7SL 4S2SB 1B0GA 2YBRB 4B5EA 5FHAL 1INQA 1V3KA 5JDJA 3ULVL 3DUHA 3SGKC 1YN6B 1IEBB 4O9HH 3LB6D 5MI0B 1MCEA 4P4KC 4YR6A 4K2UH 5EO0A 5KJRH 4HT1L 4IHOB 1YYLL 5BZWB 1T80A 3QDMB 4R2GB 2DQTH 1KIQB 1K4CA 3TPKA 2JCCB 1XGUA 4GH7B 2PYFB 2ICES 5AAMA 1U0QA 1IGYB 1R5WB 1J1XL 2CRIA 5D7LE 2BC4A 2JIXB 2PR4L 1PDKA 4MA1C 4G6KL 2DDQH 4XMKH 1DN2A 1OAQH 4N0CD 1SEBB 3GBNL 3ARTA 1UZ6F 3RGVD 2G5RA 3RIAF 2BNQA 5C0AE 4MXVE 3TO4C 4PS4H 3S5LG 3LS4H 4Y4HB 3P0VL 4QRRA 4LCWE 3FQTA 1JNLH 3QHFL 5KTEH 1UACL 3V6OA 1WT5C 4KC3B 4NT6B 4OD1H 3PDGA 5E1AA 1W8NA 4CU6A 3GSQA 4RRPG 1HE7A 1MJ7L 3QEHB 1KCSH 4QCIA 2DBLH 3FB6A 5C2BH 3ARPA 1QHOA 3U46A 3P40A 3G5ZB 3BPCA 4WY7L 2APBA 4KQ4L 3HB3D 1SEQH 1FFQA 5HY9B 3B5GA 4A6YA 1WF5A 5I30H 4OZHB 5HI3D 2X4UA 2VE6B 2R1XB 4U6YB 3Q6FB 4F9PA 1F4HA 3JUYA 1D5XA 1ZANL 3BGFC 4YDJA 1P6FA 1AKJD 1W72B 3UBXA 2EEDA 1F42A 1AHWA 5D8JL 4ELME 1FYTA 1MJUL 3WD5H 3SO5A 4ZXBB 1KYOJ 4ZSOA 3BKJL 4S1QH 1J8HD 4WFHE 1JGEB 1FYTD 4NCC2 1MJUH 4M7LH 2HT4C 1OD7A 3MR9B 1RQ5A 2Y5EA 3DVNA 4M4RA 1G7HB 2DTMH 2YRZA 4XXDA 3UJTH 4EI5C 3Q5YA 5DDHA 1MCQA 1I7UA 3C6LC 4JM2B 2H2SC 3KJ6H 1WBZA 4AIZB 2AJVH 3MV8A 4OM0H 4Z5RB 5KVFL 5I76B 1WAAA 1MLBB 5ICYA 1G9EA 4P59L 5D1XC 3UTOA 2XZQL 1U6AH 1TETH 1MHEA 2WIIA 2IEPA 1EGJA 1UB6A 4G43B 4X8JA 4KHTH 1P84K 5MENA 4X4XB 3D0VA 1MJ8H 2JKXA 3GEWB 2BMKB 4FQXB 1A3QA 2YPLD 2GITB 5J9PB 3S35X 4NKOB 4Q9BA 5IJVA 1L4IA 1S9WB 3VFGH 1LO5B 35C8H 1YMMB 1NFIA 2NZIA 4N9GA 2LU3A 2AQ3A 4H20L 1KCVH 4KUCD 1LK3H 2C26A 1U8LA 5C92A 4P2QD 3LEXA 1TZHB 1V3MA 4AL8L 4QOKA 4DZ8A 3MLXL 4GMSL 1HHHB 3JTSB 2PTTA 3LN5B 1UH3A 4KJPC 1M7XA 3CFBA 1VHPA 3T4AB 1JZ7A 3VFWB 4FXLA 1T2JA 4XPFL 4WO4B 4FQ2H 4WCYH 4XNZB 3RZCC 2VLME 3MRJA 5ESQB 1CXKA 1A6UL 3SKNB 1KXVC 3WIFB 3WNOA 3RY6A 4XZUB 3UDWC 4M62L 2CMRH 1FRGL 3U4BH 3WXWL 3HUJE 1G7MA 3HN3A 3ZYZA 4P3CL 3AFLA 1KXQE 3OGOE 3VD4A 2XWBA 2I9LA 5DURD 5HYSB 5SWZE 4WU5A 1T7XA 3S6CA 4UILH 2NY0C 5E6IC 1UVQA 1GCFA 3TPUA 2WINB 5C7XL 4V1DD 1SVZA 4TNWF 3RVWC 1YC8A 2VDPH 5IIEB 5AEAA 4JHAL 1QFPA 4NQCE 1FYHB 4Z7VE 3L9RA 1OTSD 1RU9H 1P5VA 2JJUA 4BSWA 2WBJC 2RGSA 3RWCA 3QFJE 4FQQB 4OUUB 5KSUA 3P11L 2VC2L 1L7IH 3EOAA 1I1CA 3V5HB 3VXUD 3TN0B 1DQJA 5IROA 4F7PB 3IYLW 2BNRB 3WHXA 1A1NB 4IOIA 2A6IB 2G5BA 4V1DB 2E6PA 1JFQL 3C5ZD 1G9NC 4ZODA 3TBWB 4XI5D 2DQHL 3NH7H 4AK1A 2DQFB 3GZKA 2AABH 3JWDL 4C56E 4DUWA 4UOW0 4D9RE 5JOPD 3S37X 4NFBA 3B5TA 1KJ2A 4NO0A 3QXUA 2X70B 1BQHA 5HPMB 4CL7A 1A7RH 1FE8L 3QUMB 3DV4A 5IQ9B 1RURH 5ACZA 1Q9OB 1J5OL 4H8WH 3OGCB 2B20A 1KLGB 5IF0B 4O2FA 4JG1L 5JPNB 4ZAKA 1FCGA 1YECL 2W0FB 3ES6B 2LABA 1EAPA 1Z6JT 1ZVSB 3ESUF 3WUZA 3WDIA 4YK4B 3EZJB 3CUPB 4HPOL 4XCCH 5D7LD 4YXLL 4CDGC 4PGDB 4QNPE 2Q6WB 3RIFF 4WFEE 5GS0D 2BJML 1C12A 1RZKL 3A6CH 5DTFA 3ME0A 3SDXE 5KSBE 1PQZB 2ITCA 5JPMB 2AEPL 2XRAL 1BFOA 3M45A 3W0WE 5IKCB 4MNGA 3ZE2E 5C0DB 4NO2A 5CSGA 3FONB 2ADIA 3IJYB 4I9WD 4G8EA 4IDJH 4JRYA 1YZZA 4KKNA 4R4BA 3VGFA 4CVXA 3ECBB 3VXME 1WTLA 4JRWA 2W38A 4BELD 3HFMH 2PXYA 1JF1A 3ARDB 1EEYB 1I9JH 3C5SB 4I3GA 3OL2A 3KPRA 3OAUH 3L3KB 4P3DB 1T0MB 2DL9A 4LVNB 2DQIH 1UKTA 4NHUB 4WJ5B 3LRHA 3UTTE 4ELMB 4NO5B 5JNYB 3QIBB 2NTSP 2O5ZL 3QUXC 2BDNH 2Z91B 5LCVH 3U0TA 3QUYD 3ULUE 3KPSB 2YPLB 2R39A 4PJHB 4O00A 3B5HA 1RZJH 3ISWA 2IQ9L 4J4PD 4DQOH 4FFVD 1JGLL 4JO3H 4MVBD 4OV5A 1G7QA 3VWJD 3MV7E 3HPJB 2RFXA 1JGUH 1AO7A 5BRZD 4U6HB 4J7RA 1MY5A 4OSUL 3U82B 4ZPTB 4JJ5B 2P5EB 1HHIA 4FA8A 3OAYK 4HMCA 2UYLA 4ETQA 3X3GH 5CD5D 4BYHA 9CGTA 5EU6D 1WFTA 1ZGLB 2DWEA 4OJFL 1EEZA 5H94A 1T7VA 5T1KA 1W0VB 5IMOA 4G9DA 1SBSL 3VH8A 3CX5J 3C5JA 3DX6A 3OG6B 4MA1B 4U05A 5K9OA 1DQLL 1PSKL 1BEYL 3RFZC 5I1DA 2Y36L 3FQNA 5EB9A 5EZJA 2R23A 5TJWK 2EYRA 1FLRL 4GBXD 1VACA 1JZ6A 2R2HA 4XAWH 2BSRA 2APXA 4LSTH 4AG4L 4KAQL 3F5WA 4YX2L 4Y4HC 1EMTH 4E42A 2VSDA 4HEME 4NPYA 5DT1L 4YHZH 5MI0C 4CRPA 3MREA 3TBSB 3QO0B 1G6RL 3MUGB 5F9OH 2VDKL 5C2UB 4HK3J 4RQQB 2Q76A 4NSKA 4G80A 4WI8A 1C5DA 4JPWH 4PJ9C 5M94B 1BX2B 1P7QD 3RY5A 1OAXL 4JKPL 3VMNA 5I0ZA 1KELL 1CN4A 5IESL 4GG8A 3A6BL 2B5IB 5HVFB 2QR0B 4LSSH 3QWRD 4HIHB 3QDJA 1QSFA 4HIXH 4IMKA 2BVPA 4XMPH 4MA8L 5DMYA 2DLFH 3BP6B 4E41E 1U93A 4D9LH 2IANB 4UOW1 3QFDB 5IBLD 4HWBA 4Y5XB 4JZJB 1PEWA 3ARBA 3PWNB 4DGVL 3ZKMC 2DQHH 3BXNA 4N0UA 1TVBA 4JR9L 1UXSB 1JRHL 1TZIA 5CHNA 4U31A 3AM8A 3I2CL 1DBMH 4IRJB 3QXWA 4OCRL 4CVZB 3QG7L 3IFPB 2BVOB 1M05B 4WV1C 1H3TA 2DKUA 3VGAB 2Y4SA 3LQAL 3EYOB 1DBAL 4H88L 3MXWL 1J5OH 1I7UB 4JM2A 4LHQB 1UQSA 1K9TA 3OKKB 3P0VH 1KCLA 5IV2A 4I5BB 1U3HA 3ROLA 5C2BL 1O0VA 2V5TA 4PJXB 1ZTXL 2GTZB 4XPGL 1J8HB 3C60A 3RNQB 4P2OB 4R26L 3G5YA 1C5CH 2FECL 2FJFB 1Z0NA 2YWYA 3S36H 1NGPL 3H8NA 5L7XH 4EI5A 3FO2B 4CMMA 4P48A 2BSSB 3QNZA 2IF7A 1FNAA 5D7IE 4NKOA 5GSRA 3PGDA 4YDVA 3MMEB 2YZ1A 4X7FC 4NJAH 4P5MB 5GISH 2K1MA 5SX4I 1HWHB 1IGTB 4PJFA 2V5RA 1DL7H 4DFHA 4HPYH 5JIKA 3NIGE 1U58B 4H0GA 4OGAD 1CICD 2O5YL 5D1ZA 5GGQL 4N0FA 1S7TB 5A1AA 1YEIH 3BKJH 5CD3B 3C6SA 2UV3A 1X44A 3DYMA 2Z93B 5KVFH 4NN6B 1OP5H 1AGCB 1UXWA 3QQNA 4HX1B 4TOYH 3QHTC 3MRCA 1CZ8L 4KK6C 5EPMB 5C08D 1N8ZA 3BQUA 1LO4H 1T22B 5CEZL 3SE3A 3C9NA 4JFOB 4JDVA 1QO3B 3GIZL 3RQ3A 1ZT7A 2GUOB 4WUUB 1MJ7H 2R0WL 2P4AB 3EUUA 3O3UN 1ZLWK 4ZPVA 5L9DL 1QPXA 3VXTA 1BVLB 1RFDH 3GMLB 3M17B 3RWFB 1VCAA 1HXMB 3HRZB 5JTWA 2G9HB 35C8L 1UADC 1P69B 4LVEA 4WI7A 5I1KH 1MOEA 5DR5L 5FYJU 4XNQA 1KCVL 1S7XA 2FSEB 3ARGA 1V7NL 1ODAA 3GM8A 2IJ0C 2DI7A 3QFJA 3UTQB 4M5ZH 3JTTA 1MCSA 3S3PA 3IF1B 2MQ3A 5C0IA 5F1NA 4Y8DC 5B8CC 1TQCB 1J0JA 4XTRD 4P4RA 1AD9B 5EN2A 1I8MA 4L8DA 1MRFH 5CMAB 3VI4E 3W39B 4LKCB 5HGGS 3T0BA 1SJXA 4N1EA 3VXOB 4M6OH 4C55A 4PJIE 5FO7B 3BESR 1RY7B 3QQ3B 2AV7A 1DSFL 3KS0J 1Q94B 3T08A 3VWJB 4P2RD 3LKSB 1IC5L 3NN8A 1GH7A 2FLRT 2O93L 4MA7L 3QO1B 2YRPA 1FVDB 3EO0B 5CGYD 1EH9A 3WS6A 1JTOA 5DUBB 4YHPB 5L2KA 2VN4A 2W0FA 1F02I 4XCFL 5GZOD 4KK5C 1AO7D 5B8CB 5DEGA 5ESAA 4NKQB 1J12A 1YNTB 5CP7A 2VABA 4KHXH 4FQIL 1N2RB 4YGVA 3VG0L 1IGYA 3MACL 4Z0XA 3QA3B 4PJFE 2BC4B 3BJ91 5IKCA 4FFVC 4XNXL 2IALB 5GS2H 5CBAB 4X5WB 1R3IL 5EO0B 5KSVA 1HZHH 1VADB 5I1GL 3NGBC 2P1YA 5BZWA 3IFLL 1FO0A 2YD4A 4Z76B 1CR9H 2BHYA 2X9XA 1G7PB 2XYCA 4P4KA 3RWJA 3V6BR 3DRTA 5LXGH 4FQ1H 2ED7A 4WJ5A 5MEPB 3ZTNL 5FDWA 1FIEA 5LBSH 4YC2C 2E7MA 4M03A 4UTAL 4M3KB 4QNPF 3TO4B 3PG2A 3WFCL 3KPSA 4ODSH 3IDGA 4BZ1L 4KJYA 2BNUB 3BN9C 4QRSB 4WEBH 3TBVB 1GZQA 1SM3L 1U8IA 1DLFH 3CFEB 1IGIH 4P23D 1P9MC 1YEGH 1ZLUK 2BJMH 5CZKA 3SPVB 4M93C 4NO3A 5IMLB 1N0XH 4DKEH 1ZVYA 1YY8B 4PRNA 1FHGA 4I3SL 4XCCL 3MV9A 4ZPTA 1ORQA 3W9EB 5I1LA 3OZ9L 3BKCH 3RUGE 2Q3AA 1YPZA 4DW2L 4NQVB 4I48B 4HWZA 3P4MB 1SYVA 4XNZC 3OJVC 4FG6C 4ZSOB 1NKOA 2UWEF 2BSTB 1E6OH 3I02B 1B0RB 3G9AB 3QAZB 4Y2DC 5DMGC 1LO0L 4GRLD 4P2OC 5DHVA 3B3IA 1DBBH 4G9DB 4HGKC 4LL9A 1ERNA 2R1YB 2X4UB 1IL1B 4EVNA 2OXHA 5LAXA 5MHSE 1T20B 3ZMRA 5EORL 2ZCLH 1EGJH 2B39A 1TJGL 1KTKE 4PLJC 4WWKB 3GO1H 1WBYB 2X4NB 5IBLC 3H9HB 1L0YA 1N4XH 5BVJB 3BH9A 3IDYB 4E5XB 1UCTA 4CGTA 5C0NC 1RJZA 2R0LL 3MV7D 4K3DH 3DHJA 3GHEL 3MJ8A 4IRJC 1XGPA 4RGNB 5TDNA 1D5MB 4L5FH 1F4AA 2QQLH 4K7FA 2IQ9H 5HHMB 4QYOB 3HG1A 2OJZL 4RA0C 4OD2B 4U1JA 4H5SA 2BRQA 4XNYL 2DQCH 3BPNC 5EU6A 3DXAA 5D1XB 2X4RA 4BQCA 3T3PF 2BXYA 3L3OA 5EU5B 3HNTL 1NJ9B 4BH7B 3O6MH 3TYGH 2BRRH 1K3IA 1QSFD 2IMNA 4JFEE 2CSPA 1KCRL 3DETD 4HQQH 1BBDH 3QCUL 1WC7A 3K0WA 1F11A 4QWWC 4M1CC 2Y06L 1U8HB 3EDJA 4EZMA 2Z4QB 3STLA 3B9KD 2GAZA 2I26N 5IJVB 3BPLB 4B7IA 3HNSL 5KBNC 3S36X 2MKLC 1EEQA 4HIIB 1H5BB 4JE4B 3MRJB 4PJGF 3MGTB 4ZUVB 2J8OA 1R24B 3SGDH 2Z8RA 5TDPB 4QRTA 5M7QA 1CDBA 2QHRH 5EO9A 1J0HA 3MV7A 3G04B 5ITBL 3MLYH 1IQWH 3MA7B 4KK9C 1MFCL 3UO1L 4F33A 1R3JB 2X7LB 2CMRL 4ZO7A 5JDSA 3JTSA 2AJUH 2GJ6E 3BDBA 1ZS8A 1B2WH 2GJ6A 3P9WB 5JHLH 4WU5B 1IM3A 1JPTL 3NA4A 2W60B 1ITCA 4GSDH 1LP9E 3TPUB 4OGAC 1LDPH 3GJEA 1BBJA 1FL3A 5TQ2L 4L8SC 4MJ2A 4TN9A 1CE6B 2LVEA 4UT9L 4Y4KA 5EUKB 3P77A 3RJQB 5KANG 3GSRB 1WV7T 1U8NB 5A16B 1GGCL 1YEEH 4PUBL 1LO3H 2FRGP 1G7MB 3RAJL 4PRAB 4GW1A 3RY6C 4KK6D 1NC4D 4PB0H 4F7PA 2HLFD 2AJ3B 3BO8A 2R8SL 2BSSA 1L7IL 4YQXL 3KWWB 5GSRB 3IJHA 3OX8B 5T1DL 2F8XC 4X8XA 3IXAA 3TVMC 1P1ZA 1YY9D 4GMTH 1HZHL 3BUTA 3OXSA 1T21A 3PHQA 1GJIA 2P24A 3LKPA 4WRLA 4EQ2A 2VDML 4Z6AT 1HHJA 3QZWA 4QTIH 5GGVY 1T0NA 3RDTB 2C3XA 1BF8A 1A1NA 4HFWB 1DZBA 3HG1E 2VDMH 2V5YA 2LTQC 5HYQA 3MBEA 3VG9B 4R0LA 2IAMB 5CJXC 1PZ5B 1IBGH 2HJKA 1K6QL 4OQTH 2ATKA 1UJ3B 4HUWB 4J1UA 4GAYA 5D7SL 1OGTA 4PGDA 5H35B 4A6YL 4XPBL 1U8OA 3GMRA 3QIUD 4AQ1B 5JHDE 1LEKB 3RWEA 3QIUA 1MFAH 2MFNA 1U8JA 3WUWB 4MAYC 4PY7A 3OF6A 1KLGA 1DQTA 3S36L 4RWYH 2XZAH 1PZUB 1MFAL 1ZANH 3QXDA 2E9IA 1QFWI 1MJJA 3ULVC 1HCVA 4MQSB 4IHOA 3OAZH 4RGMB 2AJZA 1JHTB 3X3FH 3B2UD 1ACYL 1BD2D 3D1MC 4LLDB 1ZEAH 2D9CA 2YKLL 1DL7L 4YK4C 3ULUC 3QEQA 2AEQH 4OLWH 1MELA 3UYOD 1N3NA 4OZ4A 1UB5B 4JQXC 4N90D 4XPTL 3N50A 4MCZA 2J88L 3QJHA 5C08E 3B6SB 5H2BB 4DVRL 5L88H 2IC2A 5IHBA 3HE7C 4KK8C 2V17H 5A43C 2FX8H 4OBSA 4CJ1A 3GMQA 1CD1A 5KTEL 1QKZL 3IXTB 3NCYS 2NR6C 2IMMA 4N1HB 2WWKT 2PO6D 1CFBA 2J8UA 1S9YA 3W0WD 4Y4FC 3OKMA 1T66C 3GMPA 4N8VA 2C3HA 3Q1SL 1YJDH 1KCSL 2Y9RT 2VL5A 4NM8L 5FUZH 3NN8B 3UC0H 4OCMC 5I16B 4HGWB 3PHSA 4P57A 1F2XK 4YUEL 3QQ9D 3CDFA 2DLHA 2VAAB 3W9DA 2HKHL 3BP4B 4DGIL 5FM5M 3P3YA 5FO8B 1JUFA 1VB9A 5I1KL 2R2BB 4Z8FL 5DEGB 1J11A 4P99A 1JPSL 4R97B 5GRYA 1C5BH 4Z8FH 5A2KH 1VGEH 4HJGB 3PIQA 4JJ5A 5HHVH 3WS6C 1FNSL 3WYRA 1CFTB 1AHWB 2X6MA 5BS0E 4I18A 4KXZH 3K2UH 1G7JA 2BY1A 2EDFA 3ET9F 4YHLH 3PDOA 3VXSB 2AJXH 4UQ3A 3C60C 3NCCB 4I3RL 1GRWA 1YEJL 3N1GC 2CO6B 3GKWH 4CJ0A 3TJEL 2EKSB 2V7NA 3G6JB 4OCWL 4GRLC 2NY1D 2HKFL 1HHKB 2A83B 2VSCA 1MUJA 5DJDB 2VZSA 3TESA 4GJTB 4RNRA 1WUNT 3LEYL 2ZOKB 4FRWA 3EFDL 4MD0B 5F3BA 3RAJH 1NSNL 4YDIH 4X6CB 4OLXL 4UT6L 4ZQKA 1OP9A 3DXAD 4ZOAA 5JR1L 3QDJD 3VFPA 4QHUA 3ARBB 4R96A 1C5DB 1H3GA 1ORQB 2D3VA 2HT3C 3ZT6A 5TE4H 1AH1A 5TE6H 5FYJD 4MNQD 1CXLA 3U4EB 3O2WL 1KG0B 3OWEA 3IDXL 3M8OH 2IG2H 3MRGB 4CVZA 2HFGH 3W81A 5IEHB 1Q0XH 3D87B 1WAAF 3HE6A 2EDKA 1VFAA 2OP4L 1FV1B 1FZKB 4GAFB 1NGYA 2EZ0D 2BNQD 2F8OA 2HTLC 2JCCA 4XCNB 4EVNB 1NLBH 4Y4KC 3FFCD 2XN9A 4XWGL 5ICXB 3T2NL 1NDMA 1IEAA 1UACH 1J8KA 3O41B 2CRYA 4LMQI 1RZ8B 4PG2A 2GTZA 2YD2A 4K9EH 2V9RA 2OL3H 4P2OA 6FABH 2NW3B 1NAMH 1E4XL 2FEDD 2FX7H 4E41D 3D85D 3ILPA 3UTSA 3EJJX 5JLZA 1A9BB 1TJIH 2LAGB 1A6VH 1DVFA 4MX7A 4OCSL 5KN5A 4M1GL 1ES0A 5HHOD 1AKJA 4FABL 5F9AC 1CGWA 2NLJB 4NT6A 4DKEL 4XH2B 2NNAB 5HHOA 5E1HB 1PG7W 1J0IA 2P7TA 4FQLH 2FDBP 3FOMB 2CJUH 3IAPA 4NWTL 3SDDC 4AY0A 4NFDA 3DWTA 5C3LD 1VFMA 3MRNA 4HMEA 1A3LH 1S7UA 4NQXB 2Q7YA 3BWAA 4PRHB 1HQ4B 3D39D 3KYMB 2ZUVA 5EORH 5B3JE 4G6FD 3UTSE 2PYEB 1EZVY 1D5XB 2CXGA 2X89A 3LDBC 5DD5H 3BT2L 1F4XH 3LRSA 1MPAH 1Q72H 2VN7A 1RZ7H 4X9HA 1EO7A 4F33B 3S88H 2QQLL 1VGKB 1CICB 5CD3A 4JG1H 1YA5A 1VENA 2MHAA 2VZ3A 3EDFA 5EO1B 2G75B 1V3LA 2HJFA 4URTB 5FO9A 4FFYH 1D6VL 4J6RL 3R06A 3K81A 4ZO8A 5E9DB 4QRPE 3QJFA 4NN5C 3NABL 2V2XA 1EFQA 1UENA 4YBLC 3FB7A 3F58H 3FRUA 3ZSTA 3H9YA 4WIQA 1OAUH 4UV7H 4HC1A 5E08H 4K8RL 1TCMA 5TPWL 1RIVL 2D2OA 5INCA 1OAUL 5E99L 5EBMA 3IJHB 5IWLC 2KL6A 5J9PA 2Y06H 3KPMA 2QTEA 3O8XB 4PJAB 4WTWA 1MY7A 4AIXA 2CR6A 1CE1H 4D94A 12E8H 1N64L 5LG1A 3SE4C 2PXYB 3ARDA 1AD9A 4ZO6A 5EN2B 1NCCH 5GRVK 5I15L 4EDXB 4NQEB 4XPAH 3ILQC 5J06A 2GY5A 4PRPB 4XBEH 4NHUA 3K8MA 4FXKB 3MO1B 2GJ6D 3SCMC 2OLDA 3DSFH 5TE7L 5EC2B 3LPGA 2GCYB 3H0TA 3B2UC 1RZJL 1W0WB 2MOVA 5BZDB 4K3DL 1HCFX 2AJUL 2HJKB 5CJQH 3ARFC 2R2CA 4NYLA 2UZIL 2ATKB 5T3XL 1KTDB 5CZXD 4JPIA 4N8CL 4R90L 5JO5A 4UIKH 5ABDE 3T0EB 4I0KA 1QFWM 4GW5B 1KT2B 4MMZC 2CUHA 2DBJA 4UT6H 3RWEB 4B41A 2GSIA 3TM6A 5FFLA 4OLYL 2UUDK 2ZPKL 5LKNA 1BVZA 3HCVA 1U8KB 3BSZL 4A2LA 4PJDE 1KEMH 3P4NB 3MRBA 4MHHI 4HLZH 5D2NC 5I6XB 5I66A 4KI5C 3CXHK 4JRYD 1T7ZA 3FQUA 4ORZC 2J7LA 3PUCA 5IBTL 1JVKA 3EOBB 1S5HB 5FYJL 4HCRA 4JM2F 3P0YL 4G9FE 2DIBA 1TENA 2F54A 2C1PA 2L4OA 3I3EA 3PL6D 4LIQH 1HI6A 1X5ZA 5T5NG 5BQ7A 2VXQH 4QTIL 4Z18A 3T3ME 1JF6A 1X7QB 3SO3B 1G1CA 3FO0H 1FZJB 2A2QT 3BAEH 4F37F 4JRXB 2Z31B 4WGWB 4UI2A 4Q9RH 1BMGA 2EIZB 2H9GB 2NY7H 1CF8H 2WLZA 6FABL 1MREL 1BAFL 2R0ZH 5F89B 3EW3B 4XHJD 5GGUB 2YPLE 1CGYA 3SPVA 4LSDA 3PV7A 2R9HD 3GMPB 5IB2B 1A7QL 4PRHD 3H9SD 3TV3L 4OCSH 3DV4B 4BFIA 1NAMB 4LU5L 1BX2A 4CU7A 1A6PA 5J13B 3IDGB 5GJTH 3H9SA 3P4MA 5IFJA 4JFYA 3GSUA 5DD3H 2C4FT 3QXAB 4YHKL 4LDEB 1QRNA 1FPTH 4QEGA 4JVUA 1U92B 3RVVD 2R4RL 4ZAKB 3LOWA 1E27A 4TTDD 4KDWA 1Q0YL 4OUOA 4R9HA 2NY5C 2NY1C 1ZVSA 4QXGH 4QRUB 5T3XD 3V52L 1UJTA 5I1LB 2DJ4A 3KG5A 1WJ3A 2FIKA 3FN0H 2IPKB 1BFOB 4XGZA 3LH2L 4FFZH 1A4JB 1F6FB 4I18B 4FTVA 1B0RA 4E5XA 1IVLA 1QFHA 2HJLB 1JHLH 3RX5A 1AJ7L 1INDL 4LBEB 4RIRB 4JFDA 1D5MA 3TJHD 3VXMA 1FYTE 1XCQB 4AENA 1SJEA 2VYRE 2X41A 4F9LC 3LQZB 1MCLA 4YUEH 2IFFL 5DMIL 5EU5A 2VDLH 3REVA 1AFVH 4WWKA 3D9AL 3JWNC 5JHDB 1TPXC 1FFOA 2VL4A 4H26A 1BHGA 3C6LD 3FT4B 1F11B 1KJVA 2D4DA 5E8PB 1HOCA 3QNZB 1JMXA 2Z9TA 2ZUXA 1EFXD 5D1XD 1Z5LA 5IVNA 4NNYB 5EUOA 5EFIA 1WBXB 3PHOA 3QRGH 2BY0A 3UPAA 3DXAB 5D1XA 3KLHD 4JFFB 3B2VL 4YWGH 4OI9A 2VISA 3QCTH 5DYOA 1FNGA 5I8KL 3ROOA 1MH5B 3U9UB 3ARWA 2Y36H 3MRGA 3RKDD 3V5KB 4LCWA 1ZGLA 4L29A 4S1RL 4ELKB 3WBDA 1P7KA 4B53A 1ZV5A 1VERA 1CGTA 4P2RB 5E6ZA 1K2DB 3MLTB 1HYRC 2H32A 3GI9H 3RTQB 3EO1A 4PLNC 2VOTA 2ZOLB 2R0KH 3MOQA 2Q87A 4KJPD 3BZEA 5EO9B 1RZ8A 2B2XL 3UJIH 3C5ZB 3EHBC 4NJ9L 3AS3A 1VFBB 1VACB 3ZT7A 1DVFD 3P73A 4O9HL 1A9BA 4LSQH 2F53D 3ZYIA 3WE6A 4BQ8A 4DCQB 3VFMB 5I1HL 3U6RB 4KZDL 3B4NA 3EGSB 4I9WE 3PWVB 1HH9B 4M1DH 4NBYB 3UJJL 5KVGH 4UT7H 4FZEL 2OSLB 4KROB 1CFQB 2BSED 4CNIB 1CDJA 1ONQB 4RQQA 3PQYB 2IPUK 4LLVB 3BRGC 3SCMA 5C09B 3LKNA 2IGFL 4V1DE 3T1FA 4X83A 3BH8A 2X1OA 4XVSL 2QLVB 2CK0H 4PRAA 4ZOBA 4YHOL 3AGVA 1PY9A 1TMCB 5C6PB 4MQTB 4C56B 2QR0A 4TUKL 3OTTA 5HBBA 3A0OA 4NQXA 3MBEB 3U4AA 1SYSB 3DJ9A 2W9DL 3G5VB 1L7TL 3GK8L 3O4LB 2CD0A 5DURB 1JNNH 1BIIB 2VDQL 5ALBL 1TDQA 4TUJB 4K94C 2W9DH 1U8PA 3LMJH 5F1IA 3S4SA 3TVMA 5HVHC 1G84A 4C56D 2GSGA 4XC3H 1CGSL 2Z8VC 4LAJH 3CSGA 1FL6A 5FO7A 5K9KB 2ICWA 3SJVB 1JE6A 4P5TB 3Q48A 4R2GD 4UINL 1EHLL 1EFXA 5E0QA 3MNWB 5J6HB 3QRFM 3SDYH 4R4ND 2VXVL 1FSKC 4L4TE 3IRZA 3FT2A 4GUPA 4OLXH 1KB5B 3R06B 1NMBH 3SCMD 5DJAB 3TLRA 1QSEA 3OKKA 1EJOL 1MEXL 2CDEA 1MCOH 1AE6L 3MGOB 5AUMA 3HPLB 2ARJB 4HUVB 3O3DB 1F4YL 2GTWA 2JJTA 2HN7A 4LSUH 1D9KC 4OZ4B 1SMOA 3G5YB 4XVJL 4YFEA 3FCTB 3GI8H 1DUYB 3BVNA 5CP3H 2V5MA 3MMEA 4GKNA 2GT9B 4NZRH 1CGUA 2NXZC 1CFVH 3J7HA 5C1MB 3ZO0A 3L5IA 1ND0B 2G60L 5I8CB 1DANU 4HH8A 3IDJA 4MWFA 3O6FD 3TBYB 1P4BL 3GHEH 2BVTA 4AM0B 5DUMH 1RJLB 1U58A 1YEHL 1OM3L 1ROWA 1D6VH 1RZ7L 4OQTL 3CXDL 4J8RA 4J4PA 3BI9X 2BNQE 2YUWA 5C0AA 2YA1A 5CKAA 3BP4A 4LLMA 3JV6B 5EIIB 4HJ0C 2VXSL 1XGQA 1KTDA 1MFEH 4IJ3C 4NKMA 5ADOH 4RWHA 1BREA 1NC2D 1T83A 1A4KB 1KIPA 4QHMB 1DE4A 4Y5YB 5HYJE 4LDOB 1FLTX 4GBXB 4NNPH 4Q6IB 1ZE3C 4IDJL 1N59B 2YBRA 2OQJA 5CSBA 2DRUA 1GAFL 4G8IB 4JG0H 3I75B 5D72H 2WIMA 1I9JL 4OGZA 1A0QH 4PP2B 3UJTL 3AB0B 1KJMB 1RHHB 4F7CB 5JA9A 2NX5E 3RVTC 4WTZA 3PWPD 2F5AL 1IL1A 5GGSB 1R5VA 5CIPB 1XIWB 3TO2B 4HG4J 3IDIB 2JIXA 3RVVC 3ULVF 5EBGA 1OGAA 1ED3B 3HB3C 1F45A 4L8BA 1ZLSH 1K3ZA 4AYFA 2MQ0A 2P5WB 2O5ZH 2YC1A 3GDBA 3TH3T 2DJUA 4RISH 4R0LC 3PDOB 3SQBA 3T0EE 5FUOH 4EN3C 3OSKA 2H26A 4JY6A 1TQBC 1BJ8A 2J6EA 3MLSL 2GQHA 4JFQA 1MJ8L 1HKLL 1NCDL 5B22A 1IM9A 4QHUB 1DLHB 3ZT5A 3ZDXF 2ZSVA 3QB7C 5JR1H 1KEGL 5C0BA 2NW2A 3NTCL 1G0DA 3H9SB 5IFJB 3UCRA 1FG9C 2DQGH 2X10A 5D9SA 4HUUB 1T1YA 3WSQH 5A3IC 2EDLA 4LGRB 4HG4K 4JHWH 1S7VB 1KENL 3DROA 2B4CC 4X6EA 3ARUA 1PGRB 4HS6A 5HDBE 3ARZA 4HUKB 3CH8A 4R96B 1I4FB 4Y5VA 5D2LE 4KU1A 4I2XB 2YMXH 1LP9F 3SN6N 4XCYB 2Q8AH 1NDMB 1LHZA 1JNNL 3WJLA 4Q6IC 4MZ2A 4MJID 1HSBA 3ZYJA 3BEWB 3DBXB 4N0UE 1AGEA 2FX9H 3KPSD 3MODL 4X0KB 1FV1A 4BUHA 3KNBA 1U3YA 2A73B 3S9DB 4G8GD 1DVFB 3GSXA 3V4PH 3LCYA 1RZIA 3H7BB 4HV8A 1EA9C 5E24E 1NUGA 1RU9L 4LCCB 4PYGA 2FR4A 1JP5A 3AMKA 4S1DC 2X9YA 5FYLD 4LGSB 3SJVE 4ZUSB 2NPLX 5D2NB 4U1GC 3A6BH 1JYVA 1TFHA 1QLRB 2AXHA 2VLJA 3DRQA 1U8NA 3EAKA 3X12B 3IS0X 4ZFGL 3FB8B 3E8UH 2NW3A 1LWRA 3FOMA 5DD0L 2X4SB 5DJ6B 2QSTA 5DD3L 4TSCH 5EH1A 1KPRA 3BPOB 3OX8A 4HS3B 3T0EC 3DUUA 4UB0H 3IXAB 3TP4A 5GHWL 4ZD3L 2ENSA 5I74B 1DVFC 4D9LL 1CT8B 3F12B 4DVRH 4WNQA 2P8LB 1BJ1H 2NNAA 2OL3A 1MAML 3PWLA 5D1ZD 2F74A 2YUVA 4NM4L 1FVEB 4OKDA 3QZWB 1V7ML 3KYOA 2LU4A 3RVWD 4NM4H 4RRPA 4G6JH 1FFNA 4K3EH 4MMXC 4NRXB 5DK3A 3SKJL 1OTSC 1KOAA 3D48R 2VQTA 4KKBC 3WNMA 2VZUA 3BP5B 2AXFA 1VPOL 2HJFB 1P7QA 3GB7A 5JOFB 3SQOL 4PJ5B 2H32H 5ICZB 4PJDA 3L1OL 4XI5C 1KC5L 1MHHB 5IVXB 1WZ1H 4OF8A 4G42A 4K7PX 1C08A 3FRPG 4H1LA 2VDLL 1FH5L 1WBYA 2X4NA 3LKRA 2YK1L 1KF9B 1S7SB 3JV4A 4L3EE 3QI9B 3KPPB 3MCKA 3QNXB 1MFBL 3P30H 4KKCD 3TNNA 1MI5D 3QZWG 4DCQA 1NCTA 3RTQD 1XGPB 4NN5B 2FJHB 4YWGL 5TDNB 3O2DL 3KPMB 3O8XA 5L8LB 2C5DC 3OF6D 3X3FL 4HKZB 4I13B 3HHRB 4MB5A 4ISVB 5F7WC 1VA9A 1D5ZA 4NQSA 2DD8L 4XNMB 3MV11 1A0QL 2BHUA 5LWYL 1T2QH 3RBSA 5E8DL 2HMIC 3BGAA 1FVCA 2QHRL 3LHPH 4LCUB 4Y1AE 3W5MA 1A1OA 4OZFB 4XAWL 5JW4R 3L95B 3UO1H 4RMSA 4IMLA 3BX7C 3DSFL 5FV1L 3ALPA 1JI1A 1QQDA 4G7VH 4TUJA 4JDZA 1D9KD 1E4KC 2XZQH 3PWPA 2EIDA 4NJ9H 1A7PH 2HAZA 1CFNB 2AXGB 4HUXA 4MAUL 4CN1A 3F8UB 4H1LG 4X4ZA 3MOBH 4ODXB 4GXVL 3WL9B 4QHLB 1ZHLB 2ICEB 2BVEA 1YPZE 2I5YL 3MLSH 4NDMB 3SDDB 3CDYA 4XTRC 1X4ZA 1S9XA 4OJFH 2X7LA 2EDXA 3R1GH 4RA3A 4WEMB 5HHQA 1W0WA 5GQBA 2QQKH 3NA9H 1WITA 1HINL 5JPNA 3IFNH 1RZFH 3TIDA 3WIIL 5ACLA 1ZHBA 1YNKH 4OZFG 4NZTH 3TIEB 3SKOB 1BBJB 2DQDH 3OR6A 3Q5OA 5FOJA 3QUXD 1YN7B 5DS8B 1CE6A 4GW5A 5KW9H 4IJ3B 4WHCA 1FNSH 1MWAA 2A6JB 5EBWA 4ZDHB 4WI4A 5A2JH 4I4WA 4O4YL 4G8GB 1KTRL 4P46C 4KK5D 3GKZA 1HKFA 3ZE1F 1T04A 3CLEH 3BO8B 4HMDA 1IEBA 2ADIB 4JRYB 4HIEB 1KIRA 5HGHB 3O45A 3T8XA 4F15B 1A3RH 1JPST 2IBGA 1EHAA 2B4CH 1RVFL 3BJLA 3PDDA 4XP4L 1A3RL 1NC4A 1S5HA 1E4XI 4Q7DA 5EULV 4K7PH 1GSMA 4KDVA 2F58L 3U9PH 4CW1B 4GRWB 5DT1H 4S1SL 5AYUH 3QNYA 4FXGA 5D7LA 3RL1A 4PB9L 5D7JB 4HKBA 3P4OB 4PJ5E 1JTTA 1LDPL 4QF1A 3KJ4B 2RB8A 1X7QA 4W81A 1Q9LA 3H42L 4XBPA 4KHXL 5EU4A 4NKMB 3BD3A 3BHBB 1EAJA 1KELH 3MLRL 3P4LA 5BVPL 1T5XA 4ZFGH 2WAHA 3HKFA 5EZIL 4M1DL 2I60L 1JWSB 5DWUL 5ERWA 4ODUA 2DQTL 3ZKNC 1MCOL 2A38A 2AK4E 1UM4H 4E9LA 1J87A 4WI6A 1ADQL 2NQCA 4Q6IA 3Q6FA 4P2YA 4KRPC 5K9QI 3U4EA 2AGJL 1OP5K 1PFCA 4PY7B 2DYPA 1KIUA 2X4PB 3OKNB 4GRLB 5ESVA 3ZKSD 1N6QH 5CEXA 5K59F 1NKRA 3OKEB 1AP2B 2VLKA 1VFAB 2PKDA 3HZMA 3ZDZE 1H3XA 2C7UB 4KJQD 4MJ6A 4BFGA 2BNRD 4HBCH 4DTGH 1FO0H 3J8F7 4JFDB 3I3DA 5CZVL 5DVKA 4S0SD 2HTKC 2WWMC 3KYKH 1R5VB 5CIPA 2CDGA 1QFWH 43C9B 3MV8B 2GJZB 4QRPB 5DD6B 2EXWC 2FIKB 2P8PB 5MHSD 4RFOH 1J18A 2W9EL 3KLAB 1IAMA 3T65B 3L6FB 2HFTA 4M1GH 2CDFA 4NRZB 3ARFA 3CPLB 1RV6X 5BS0D 4KZEH 4PLJD 4XC1H 4EXKA 2VZ1A 3L5JA 5EFIB 2WBKA 1KFAH 1NFIB 3MROA 3L5XL 2COQA 4XAKD 4RSVA 4NQEE 1WGOA 2HG5B 3PP3K 5GIRA 2MWCA 4MXQD 4OLZH 1G9ML 4GKSA 2E7BA 4Z7UF 1AQDB 4XVJH 3D2UB 3DURA 4EIGB 1H8NA 1OCWH 3QUYA 5IW1A 3X11A 1S7UB 5DRXB 2NCMA 1U93B 3B9AA 4FTVE 2VDRL 1CGXA 3CJJA 4WO4A 1AGBB 3DGGB 1H15A 1OT1A 3U7WH 4LLUB 3MC0A 5ESQA 3CXHJ 5I8OH 4M1CD 2VISB 3EZ8A 3HNVL 3R4DA 4GO6B 4JPKL 5FK9B 4KUZL 1EO8L 5F3HB 1TZHA 1P2CA 4ZTPL 3T0ED 2X4TA 4BSVB 1B4JL 1I7TA 4HS8L 4Q74A 3IDNA 2H2PC 5IK3A 5FB8B 1JV5B 5FO9B 3PWVA 1HH9A 3JVGA 1NCUA 3L3HA 3QH3A 4KK9D 4ZUTB 3DO7B 1F2QA 2EKSA 4M00A 1MCWW 2W07A 3BYTA 3T1FB 3ESVF 2OZ4L 1M1SA 4MAYB 1MI5A 2X4SA 2BNRA 3WHXB 4AH2B 1DQQA 5GRJH 2CK0L 4HS3A 1SJHB 3MLXH 3PGCA 4YHIB 4PJCE 4YPJA 3VI4F 1VDGA 4NQDE 4FQPA 4Z7OE 4P3WA 5E8OB 2IFGA 2XIDA 5ENWB 4FQ1L 2Q8BH 5GRWA 3BAEL 3VW3L 4JRXD 1PBYA 1FVEA 5ALBH 2Y5TB 4OGYL 1GL4B 4PRIB 5KSBB 3KLDA 5SWZD 2VXTH 3UZEA 5HGDB 5AWNL 3WEXA 3MV8E 4DN4H 4TTGA 3U4BL 3FO1A 3MA9H 1D5BA 1ZWIA 2Z93A 3PL6B 2EO1A 2VO5A 1A7QH 1CG9B 3K7UA 5FECB 4HJJH 1T03H 4TULL 1XGYH 4XP9H 3L7FA 1QR1A 5I9QB 1GC1L 1U42A 3UJIL 3TVMB 4BKLA 3ULUL 5I2IA 5H37H 5IVXE 4F9LA 3LEYH 3V0VB 4AT6A 1II4E 2VDPL 5E2TL 4PV9A 2VERN 5ICYB 3SJVA 4WFGD 4YDIL 1PQZA 1YJDC 5IVXF 1YEEL 5J8OA 4LRIC 5F72S 3GMOA 1EDQA 3JWDH 4KFZC 1F58H 5IB4A 5F8RC 2ZCKL 4HD9A 4J3TA 1JRHH 4D9QE 5GJSH 1CU4L 1MAMH 1IT9H 4WUKH 1S9WA 1EAPB 5F88B 4HKXB 5E95B 2J1KA 2HVJA 3EDKA 1JHKL 4N5ED 3IDXH 3UAJC 1HWGB 2JLLA 3VRLF 5GHWH 5K33A 5E2UL 2PYFA 8FABB 4G6JL 3BQUD 4U7MA 4DK6A 3ARDD 1K8DB 5E2UH 5T1LD 2F54B 4F3FB 4L4TD 3OHXB 3B9KB 5E00A 1D5IH 4KVNL 1HK6A 3WN5A 2FJGB 1SEBA 2NY2D 2VLRA 1SM3H 5HGAB 1ZHNB 4MD4A 3G9VA 5DFVD 1DCLA 2BNQB 1IGMH 1XR9A 4QRQA 4NQUA 1AIFB 3SKNA 1NCNA 1D9KB 3V5DA 3WKML 3TV3H 4YO0A 5BOPA 1PYWA 3HE7D 3LRSB 1CD9B 1Q94A 3VWJA 1A6ZA 3CZFA 5ISZE 3NCFB 1QLEH 5TQ0H 4TSAH 4NCDA 4Y89A 5J6GB 2NYYC 3EKCA 3ZZ1A 4PJHA 4U1LA 4ELMF 2M2DA 5HGBA 4LARL 3ZDYF 5DJXB 3O4OC 2PCPA 1PW3A 3PWJA 1S8DA 4I1NB 5EBWB 2X05A 3DYPA 2W92A 2PR4H 1H3WM 2VXUH 3DNKA 2X4QB 3MBED 4KJWD 4Z0XB 1HHIB 3KPRD 1T83C 3GIVB 2BOCB 5EOCH 4ONHA 4WUUD 3TN0A 5F9JA 1QHPA 3GGWA 1J86A 2AEQL 4OLWL 5CBAA 4HIEA 3AS2A 3TN0D 1XF5A 3Q3GA 3RHWK 5H94B 3K3QA 3QI9C 3ZKND 4K3JH 2VLMD 3T0XA 3CU7A 5H8DA 1ZLSL 4RBPH 3ABZA 1Z9LA 2PETA 3KVQA 4NUGL 3D0LB 1L6XA 2AAVA 3D2UD 4PR5A 4RGOL 5C8JA 2C1OB 3PXHA 1FSKB 1FN4A 3EJZD 5D96B 1NEZA 3KLSA 5D70H 3CZJA 5B4MC 1GZPB 4OLVL 3CFJB 1KC5H 2UVEA 3QT2A 5D7JA 5HHOE 2CKBA 4R7DB 5D96C 3QUMA 3MO1A 4OLUH 4P5TC 5ISZA 2R15A 5FYKH 4KJQC 4DKDC 3MRMB 2VITA 4L4VE 3BUYA 3RVXD 1OLZA 5IW6A 4YPGB 3NCEB 2P45B 3BKMH 4M61B 5HJ3A 4NQCD 4M7ZB 3BRDA 4OB5H 5TF1H 2KQMA 2JB5H 5DD1L 2DQEL 3FOLB 5EIVA 3GNMH 5HI5D 1JK8A 1AXIB 1BZ9B 3QCTL