5DFWH

Crystal structure of human cd81 large extracellular loop in complex with single chain fv fragment k13
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
222
Chain Sequence
VRLHQSAAQLVQPGASVRLSCTTSGFNFKDSYLHWVKQRPAQGLEWIGRIDTGNGNVKFDPKFQDKATITTDIPSMTAYLHLSNLTSEDTAVYYCVPYGYGFHSWGDGTTLTVSSDIQMTQSPASLSVSVGETVTITCRASENIYRTLAWYLQKQGKSPQLLVYGATTLADGVPSRFSGSGSGTQYYLKINSLQSEDFGTYHCQHFWGTPWTFGGGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title VH-VL orientation prediction for antibody humanization candidate selection: A case study.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords CD81 antigen
total genus 52
structure length 222
sequence length 242
ec nomenclature
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dfwH02
4QRRB 2FGZA 3JTSA 2X09A 2NW2A 2DB8A 2IALB 3CLEH 3WHXA 4M7ZB 3TBYA 2IH3A 1VGEL 1SY6L 5DHXB 1GC1L 4K3HA 2WLZA 3WD5L 3O9WB 3FB5B 3CSPA 1MFDH 1MFEL 4WENB 1B0GB 5AEAA 4NFDA 4LRNL 4KDTC 4LCYA 1UJTA 4XVTL 3WN5A 4M6ML 3VG9B 4JFHE 4PGJA 2YD5A 3EFFB 4MAYD 1RJLB 2DBLL 1KCSH 4DGVL 3QRFM 1OD9A 3BX7C 4XBPB 3HR6A 1VFBB 5I1IH 4JFDE 2JIXA 5JOPD 3PGDB 2Q8BL 3JWOL 2MTPA 4RRPA 2P7TA 1GGCH 1IE5A 1N2RA 2IALA 1T5WA 3UMTA 1KIRA 3J8F7 4OQTL 1NBQA 2IH3B 3B83A 3REWA 5D5MF 3SKNB 4JFYB 3D87B 5ESQA 1U6AL 4U0RC 4X4MA 4WW2A 5DS8B 4FQXC 5T1DH 3V0WH 4HX1A 1A3LL 4HPYL 4RQQB 3OGCA 1TZIA 1T5XB 2R2EA 5EA0H 1JMZA 2KZ1B 3LY6A 5GS1A 4Z95L 2W92A 2XY2A 4AEIL 3VMNA 5EU3A 4LMQE 3X12A 5IEKB 4LOUD 1IKFH 1PSKL 3WIFA 1T1XB 5E7FA 2EDXA 4ZUVA 3PL6C 4KC3B 4PP1D 1NGZA 5JQHC 1MHHB 2FL5A 4IOIA 3RNQB 5J11C 2VOTA 2A6JA 3ABZA 3NCBB 3SHSA 2YPLA 4N8CL 4DOHB 4PLJD 3OZ9L 1L9NA 4X8XA 1ZGLM 2ZCLH 3FOLA 2EDBA 2Z35B 1AH1A 1O7VA 3HRZB 2AJZA 4TUJA 5DD3H 1P1ZB 4MJ6B 1I9JL 1A6AB 3OJDA 2AEQH 4X5LA 5DD5L 4Z9KB 3MJ8A 5D5MB 1ZS8B 1I1AC 3V6OE 5A40E 1MCRA 5MERB 5HHPA 3LMJH 5E9DD 5TDNA 3V0WL 2BOCB 2E6PA 3MRGB 2FJGA 4Z7VA 3WN5C 2DD8H 3K1DA 3X12B 5IEKA 3GI9H 1CG9B 1NDGB 4M61A 4AEIH 1T3FA 1T1XA 3K2MC 1HNGA 3X3GL 4FFWC 3ULUE 1MLBA 2UZXB 5D7SH 3GZKA 1JP5A 2PNDA 2MQ0A 4YXLH 3OF6D 4BZ2L 5E95B 1Z0NA 5CINL 5E6IB 3P9WB 4RBPK 4Q97A 5I1KH 3BZEB 2YUWA 5I8CA 1ES0B 2ID5A 5JQ6H 4PGBA 1GOHA 1W72L 1QNZH 4NSKB 3LQMA 1FNLA 4M1GL 5I1GH 4LKXA 4PRIE 1MFBL 2Y72A 5SWSD 3GKWH 4LPXA 3QCUH 5I8EA 1CF8H 3ARBD 4IJ3C 4DGIL 4EI5C 1A6TA 5HGGS 3SE3C 3H9ZA 5ACLA 5HHPB 5CLTA 2X4NB 3L5WA 4TSBH 4PD4J 2WUBL 5IBTH 3LN4A 5KG9B 1HE7A 4FQ1L 3AB0B 4HGWB 3AM8A 4MSWB 2VZSA 2DMCA 4QWWC 5TQ0H 3RHWF 5SV4A 8FABA 3MSPA 1NFIB 5I9QB 3TP4A 1OSZB 43C9A 4AY0A 4G8EA 4KQ3L 4ZDHB 3CXHJ 4PJGE 2EYTB 4Q9QH 4PB0L 5CINH 3ZDZE 4MD4A 3CFDB 1OGTB 2GKIA 2WZPD 1HKLH 1ZWIA 5ANMB 3KJ4B 1CDIA 4PTUA 5EOCJ 3DMMA 3OB0H 4L8CA 4AEEA 1M71A 2XWTB 5I1GL 2YKLH 1I85C 5J6GB 4LCUB 1AI1H 1QFUL 3QQ9C 3S35X 5I19H 3CXHK 3MC0A 4FG6C 3I6KB 1K8IA 3ES6A 3CPLB 3RWDA 3LZFH 2A6IB 1T22B 4D0CB 1YEKH 3DV4B 1P4LA 2KDGA 1D5BB 1W0YT 5EU5A 1LEIB 1XF4B 1GZPB 4HKJA 4N1HB 2ZSWB 4WW1A 2HTLD 2MOVA 4RWHA 3REVB 3NA9L 2BNUB 5DT1L 3B9KA 1CLZH 4LQ1A 1S9KC 4Z78A 4P5TC 4YZFE 4NFBA 3ZYJA 1NCWH 3GB7A 1UVQB 3FQNA 1NC2D 1FNEA 1QSFA 3MGAA 1TPXB 5HVHC 3PQYA 4G6KL 5D8JL 4JCLA 3S37H 4C56D 3KPSE 5I0ZA 3MRCB 1FYTB 1CXIA 5IOPB 4ZPVA 2I9TB 4NQXA 1LO3L 4JY4A 1SYSA 5F6HI 4MAYA 2AXFA 1JWMB 1K4CB 3VE0B 1YY8B 4U1KB 1WICA 2X9XA 1KUMA 4M6NL 3VI3F 3O3UN 5BW7C 1RK0A 3UBXA 1AIFA 5EZLA 1YEKL 3PWNA 4BSVB 5E8EB 5T1KD 3T8XB 3VXTB 3CU1A 3UO1L 4GKZA 3EYUL 1OM3H 5HTSA 5CJQL 4MXVF 2VDOL 2JF1A 5L2JA 3RVXC 4YXHL 2VQ1A 1BZ9B 1IT9L 5TE7L 1UKQA 3ULVF 3QEHB 4MA1C 1RZFL 2HLFC 3QIBD 5FYLL 3X13A 2AJSL 4PJDE 4AIZB 5IJVA 3MRCA 3RL1A 2X4PB 5IROA 1CFTB 4L29A 4OCYH 1GOFA 3SKNA 3T65A 5AG9A 4OIIL 5E70A 3HZKB 3SDCB 4I2XA 4HT1L 5D93B 4XMKL 4NZDA 2CLZA 5HHNA 5C0FA 3BDYL 2VWEC 4U1GC 1L7IL 1YA5A 5FYKL 4OI8A 1DR9A 3BFOA 5D96B 4LCWD 1NFDE 4YHKL 4BQ8A 3IDYB 4NNXA 1R24A 4CJ1A 5FYJE 1NAKH 1AY1H 4G9FD 1J0KA 3TPUA 4FFYL 1FGNH 5IMOA 2HTLC 4NRXA 1TJGL 4ZFFB 2JJWA 2CKBH 3GMMA 1EIBA 3GUTA 1JGUL 5EIIA 4NJ9L 1G7LA 1G7IB 4Q9BA 1AQDA 4LK4A 3QG7L 3HS0A 4HQQL 4LDEB 1J5OH 3QWOA 2EDRA 2I9TA 3OPZL 4PRHE 2DDQL 5BV7B 5C0JB 5F9OH 1GZQB 1PG7L 1J1XL 4PJAE 3BDYH 1IGTA 4N90E 4U05A 1HH9A 5CP3A 3I3EA 5DUMH 1ACYH 1IGJB 1EEZA 1JGDB 5KBNC 1LGVA 5F72S 5SWZD 5E1AA 3TIEB 2CRYA 2R56L 4JFFA 1H3UA 4S0SD 4YHKH 3ARQA 3AAZB 3D0VB 1K5NB 1WJ3A 1D6VH 3VI4E 4QXWA 1F11A 3WHE1 2YPVH 4MZ2A 3G6JB 1TJGH 5FGCB 2QEJA 5GRYA 4R7DA 3MRFB 3S36H 3HS0B 2IPTH 4XNUH 5DMYA 2R1WA 2ICCA 4CADB 3CC5A 3O0RL 3BZEA 1FZMB 3QO1B 1CDYA 4EDXA 5M95B 3T0EE 3ULVE 3IVKB 2PW2A 4DKDC 1FC2D 3HTLX 1MNUH 4HS8L 4X6CB 2CLVA 2AAVA 3T8XA 1RIHH 1MRCH 5DQJA 2QSVA 3GEWB 5IB2A 1EVTC 2AXGA 1MUJB 3U7YL 4JHBA 3V0AC 4M5YL 1OHQA 1T03H 4KK8C 1YPZB 5E8OA 4Y19B 5EC1B 4BK5A 5LCVH 1ACYL 3DGCR 4NKOA 2HJFA 3BPCA 5D1QA 1YY8A 4DJMA 5EU6D 3RX7A 1SEQH 3WKML 1LO4L 3N85H 2DTSA 2IBZX 4UV7L 3VFTA 3RVUD 2ORBH 2Y5TB 1D6VL 3HFMH 1VGKA 4D0BA 4RISL 4LRIA 2F54B 3STZA 1CICC 2BY3A 2VUYA 2BNQA 1G7IA 2HTKD 5JW5A 4EN3C 4TVPE 4YLQT 4WY7L 1XGQA 4PJHE 4HJ0D 1G0XA 3AY4A 5ACZB 1R3HB 2I07A 4ODHH 1RIHL 1W72B 5L2KD 4NQDB 2X2YA 4HKJB 2GY7B 2ILLA 4HBCH 4P9HC 3UTPD 1FAIH 4GG6B 4ZFGL 1T03L 1V7MH 1HH9B 5GIRA 2VZ1A 1MLCA 2P8PB 4YFLF 1T22A 3ARSA 5D1QB 3L3GB 1ORSA 2D7PA 1T1YB 1ZT1B 3IKCA 3VG0L 4LIQL 3MNWB 5K9KB 3U9UB 5FDWB 5TPWL 4GXUN 3N85L 4RFOL 2H8PA 5E8DL 4JM2A 5IBLD 5IROC 4YBQC 3LQZA 3W9DA 2QKIB 4RZCB 5I76A 1FFQA 3O2VH 2Y7QA 4WHTB 5JOFA 5MEPB 1FL3A 4L5FH 3QNXB 4TUKL 3EYSH 3GMQA 5GS2H 4NDMB 4Z7WB 1JZ8A 3QI9A 1D5XB 4MXQD 5B38G 1T2XA 4YBLB 1U8QB 1TVBA 4NT6A 3TO4A 2PTUA 2OBGA 1SYSB 4NO5B 4U0QB 3I50L 3AFLA 4U2YA 4MJ4A 3RGHA 3DRQB 3UDWA 1A7QL 1KBGH 4K3DH 4JRYE 2C3VA 4JFXA 3TNMB 4MJIA 5E94B 2D3VA 1V7ML 5JW3H 4G42B 3KLAB 4MNGA 4M8QA 3MYJB 1NSNL 4NOBA 3Q6FA 1VFMA 5I74B 4BH8A 1S7SA 4E9LA 4KRNA 3C2AL 1A7NL 4QEGA 3KR3H 2YEZA 5CUSH 4C4KO 5DJ8A 1CR9L 1IM9A 5KJRH 1IM9D 2CLRB 5I8CB 1FZKA 3O2VL 3K2UL 1CDUA 1S7UA 4X8JB 4ZUSA 3TVMA 2LQRA 3VFSB 4C83A 1AC6A 2X9WA 1KCKA 4EN3B 3O4LA 1XCTA 1P9MA 3S5LG 4U2ZA 4LASL 3C5JB 1HN1A 3JWNC 2FBJL 1MRFL 1J86A 2QR0B 3LCYA 1UG9A 3DYMA 4OLUL 4WHYG 4E0RB 4IEFB 3GSUA 4PTUB 2FIRT 3BQUD 3B3IA 2Y06L 1CLYH 2FECL 5EWIL 1IC5L 1LE5B 4Y4HB 1A9BB 1TETL 2NXZC 4YFLI 3K4DA 3QXDB 4G80A 4MA7L 2Y36H 2CKBA 4QHKJ 4WO4B 4OKDA 5FCUH 4BQ6A 3DWTA 1NCAL 3GO1H 4U1IB 8FABB 3F7YA 1R5VB 4W6WB 4X5WB 5FV1L 3MLXL 3MRPA 2JTDA 2VLJE 4OJFL 3MRHA 1FFNB 1CXKA 3W5MA 4NZJA 5E5MB 2X4OA 2P7TB 1Z0MA 4NCDA 3WIFB 2FDBP 5DVMA 4PJ8C 1D5IH 4RCAA 15C8H 1R3JA 2AEWA 4X4XB 2FBJH 2HVJA 4UNVA 5HHOA 5BW7A 3CFEB 1BFVL 1MVFA 2M2DA 1A6PA 4DKEL 4HBQA 5A16A 1CWVA 2MJWA 4KUCF 2OR9H 1W0WB 4JFYA 3SDYH 1EHAA 3E1F1 2R2EB 2H26A 5IW3A 2FSEA 4U6VH 5CHNB 3ET9F 3FN9A 1YEHL 4B0MM 4UT7L 5E8EA 5EPMB 5T5NG 5BQ7A 2OK0H 4XCFL 2VAJA 5JW4R 4R90L 1HI6B 2NY3B 5ISZE 2XZQL 4U1LB 4NBZB 1Q9WB 2M26A 1FFNA 5F7MC 4QHUA 4QT5B 4NT6B 2AV1B 1FG9C 5IW1A 4KFZC 4IOIB 4OCXL 1OWRM 2BC4A 1UWGL 5FGRA 4DQOH 1DBJL 4RRPG 5CSZB 3LHPH 1I1AB 5TDOA 4AMKL 5DD6A 5KSAA 1WGOA 1TZHB 4C59B 1JYNA 3SBWA 1MIML 4ZTPL 4JQVA 4OM1L 3PNWA 3KDMA 1ZANH 4F58H 3ARGC 4XNMB 3DOSA 1N4XL 1P84K 1ZLSL 1L7TL 1EUTA 5ENWB 4U33A 3HE6B 2QBWA 4ZSOA 2EIZB 4K9EC 5DA0B 3O2DL 1QA9B 4G9DB 3T2QA 3ZLQC 4PJIE 4OD1H 4DVRH 4P3CL 4QHKI 5DJ0A 4XP6H 1RUMH 4N8CH 5HYJB 1SQ2N 3WIIL 4L3ED 5BRZE 3QSKB 3JV4A 4LVOB 4N0UA 1WTLA 2D7QA 1ZA6B 2VAAA 5KSBA 4B7LA 1F6AB 1R3HA 3LPGA 4I18A 3OGOE 4ODXB 2VH5L 5KVFH 3DVGB 5I30L 1EH9A 3MRRB 4OZFG 3OAZH 3LMJL 2AEIT 4LHUD 1RUPH 2NY5H 4XBPA 4XCYA 5F8RC 3GMPB 1PVHA 1HHGB 2OJZH 2GK2A 2OX5A 3BWAA 3H9SB 2Q3ZA 4OQTA 3IXAA 2ESVB 2K7PA 4Y4FA 1SBBA 3AB0C 3LEXB 4DK6A 4Q74A 3D3VE 4OGAC 5JORB 3FO9B 3FB5A 3RP1A 3PL6B 2IFFH 1EV2E 4JKLA 4NWTL 1A1MB 1K4DB 4FA8A 1UFUA 2X4TA 4DGYH 1YZZA 2ZWLT 2KH2B 1P9MC 5IMOB 1XF5A 3BUTA 4YWGL 1J12A 4U1LA 4KGJA 1F4YL 1YNLH 1QLRA 4CKVX 1UM6H 4D8PB 3O3EB 2QADC 4HUUA 3HC3H 1NGXB 2P5WB 3LS5L 5F1IB 3HMWH 1X5JA 4QXGL 5HPMA 1P4IH 2NCMA 4HS6B 3QA3A 3KPMA 3GMNB 3BISA 3LB6C 1CF8L 1A7RH 4WVRA 4HC1A 2IG2H 1OW0A 2ICWB 5DC4B 4O00A 3QXAA 5I30H 4JG0L 2P5EE 2H2SD 2PTTB 2OQJA 3B2UD 2WUBH 4X6DA 3L3KB 3VXUA 5FHAH 3UC0H 3UP1A 3UTSB 2XRAL 2X4QB 5GZOC 4ISVA 4O51A 2EE6A 2ZOKB 4PLOB 2A1WL 3TZVA 4MQXC 4D94A 3REWB 5JXAH 3TJEL 5ICXA 3O3AA 3CH8A 3VGEA 1OCWH 3OSKA 1CXHA 1MWAB 4XGZA 4XMLH 4U1IA 2EICA 3V2AR 4BUGA 3T0WA 5L2KE 3DI3B 1UJ3A 5EOTA 3O6ML 3S35H 1JPFA 4MNHA 1UM6L 3MRDA 4APQD 2BCKA 3X3FH 4HWZA 4FS0A 1LK2A 3MRLB 1I85A 3L3DB 3QRGH 1NBYB 3W0WD 1KJ2H 2NTFA 4X7TB 2FRGP 4PP1C 2FL5B 5E4EB 1HCFX 1EO7A 1DBMH 3CFCL 4Y4HA 5KS9F 1RK0B 3C60A 4HUWA 3WO3B 1IQDB 1MUJA 1LE9A 4OM0H 4BQ9A 3P4NA 4WHCA 1X5LA 2XRAH 1I1YB 5T1MA 3V95A 1ORQB 5LJYH 2FJFA 3SDXB 1UACH 4KK5D 4PRAB 1TCRA 4UT9H 3BP6A 2VLRA 1YEDB 2VXTL 3QG6B 3WXWH 5F9AC 3D0LA 3MA9L 4JY6A 3CSYA 1H15A 4HXAL 1OCWL 1BP3B 1P7QB 3DO7B 3DXAD 1F90L 1IAMA 1KLUA 1S5HB 4G6MH 1YYML 4MJ2A 2OI9B 3S35L 4N0YL 5E5RB 1TJHH 2XFXB 4ODVH 1JYVA 3V52L 1JPTL 2DQJL 2NTFB 4X7TA 4GAYB 1UCTA 1WCQA 1SYVB 1T0NA 1QLFB 1B90A 3C5SB 1J8HB 3KYNB 4AEFA 5GJSL 2FLBT 2OLDA 4MLSA 2XZAL 1QRNE 2VLRE 5HHXH 1T2QL 5JW4N 4M1DH 5T1MB 1RULH 4LHQB 1GJIA 5CKAA 2QQKL 1H0DB 3FHQA 1A6WH 5CP7A 5HDBE 2FYYA 4JVWA 3TF7C 5F7EH 5EIQA 4NQEA 1OLZA 4JGUA 1S7QB 3F12B 4PJ5A 5FCSH 3UDWC 4PJDF 2VXTH 1QRND 3GMLA 3IAQA 5EU6B 3TYFA 4YC2C 3BKJH 4DK3A 5C0RL 2YD2A 3RTQC 3SCMB 3HMXH 3FRUA 3RTQD 2L0DA 4GG8B 4Z7UB 1RU9H 4FQLH 5F1SA 1OGAB 3GSNH 2DKMA 2JE8A 2FZ3B 4LVNB 1YPZF 3RL2A 2BP3A 3QHZL 4NN7B 4P57B 1J8HA 2NPLX 2RR3A 3KYNA 4ENED 3RAJL 1INQB 4LPTA 3RVTC 2EDOA 4DKFL 5EFIA 2AABH 5I71B 3UEZA 4GQ9L 5EN2A 3TCLB 1CXLA 5C6PB 3U0TA 4PJGF 3SDDD 1MFCH 1H9VA 4ZS7L 3MRKB 1KJVB 2OQJB 4Z6AT 5L7XH 3IJHA 1QBBA 4J2XA 5DJCA 2QHRL 1NGQL 5D2NA 5F9WC 3B9VA 3U46A 3MRMA 5IVNA 5TFSH 1FL6A 5DTFA 5C0RH 4M3JA 3QG7H 3BW9B 3RWGA 3T09A 2Q8BH 3BQUC 3T0ED 4JFZL 1WAAA 3LRSA 4OZHF 5HXMA 4XBEL 3TT1L 3SPVA 2NMSA 1F00I 5I2IA 1DE4A 3RZCD 1Z9LA 5FYLE 5GGQH 3MNZA 1BZ9A 1BD2B 4LNVA 1IQDA 2DL2A 4YDIL 3MLZH 1N7MH 5T1DL 4XB7A 2R9HC 2AXFB 4C57C 4K3JH 5D2LA 5T1KA 3ZE2E 2F15A 4K8RH 3BXNA 4WHYH 4XP1L 2W1NA 4Z95H 1BOGB 3HZYB 1G7QB 4OI7A 3V4UL 2HFEA 4WO4C 4JFEE 5E08H 3FCTA 3FT2B 3LDBB 2C4FT 2WBJC 1EFXD 1Y6KR 5MHSD 1UQSA 3LKSA 1AGCB 3OAUL 1DVFC 2RFXA 5L2JB 4JRXE 2IQ9L 3BI9X 1A1OB 3I6LE 1LD9B 3OZ9H 5HDBF 4HG4K 2P24A 5DJ6B 2F54D 1U41A 1EMTH 2PYED 4XAKD 2V2XB 4YDLB 5BV7C 1XF1A 4XBEH 3TT1H 1VFAB 3CDFA 3SDDB 3IF1A 4F7CA 3C5ZD 4ZOAA 1E4XI 5JUEL 3UYPA 1GC1H 3E6FA 4YHZL 4OFIA 1EGJL 2OR8A 2DQCH 4KJPC 3HZVB 3QDJA 4LKCB 2G60H 1C08A 5DVKA 4XP1H 2X7LA 4TULH 1CDHA 5IFJA 4R9HA 3QEQD 1G7LB 1F58H 4PGDB 5KVEH 2ORBL 4MQSB 5FO7A 5BS0D 3QAZB 2YK1H 2XKUA 4FFZL 4QHMB 2I27N 1RFDH 3RWCB 4U1NA 1TTGA 3V8OA 2O61A 5IB3A 4DGVH 4BSJA 2Z91A 4FABL 4Q58C 1E6OL 2NR6D 4JPWH 1FAKT 1W8NA 3RWIA 4K07A 3ZT5A 4AH2A 5MEOA 2YD7A 5IW1B 3UAJC 3AU1B 3WNOA 4Y5XB 4TN9A 1G7MB 1CE6A 3KYKH 1S7WB 1QKZL 4OCLC 1J7VR 3MCLL 4RFNC 1MWAH 5F3BA 1AR1C 4F7PA 4YPGA 1OGAE 5AAWA 1QSVA 1P4BH 3QFDA 1HXMB 4FFVC 4OV6F 3MOAL 4LIQH 1CS6A 5C09A 3ZSTA 4P2QE 4LQFH 3QDGB 1YY9D 3QJHA 1OTSC 1GHFL 1JWUB 4QOKA 2WWKO 2R2BA 1ZT4B 1CT8B 2YK1L 2EH7H 1T83A 3WDJA 1ZHKB 4WEBL 1Z9MA 2VC2H 2V9RA 1I3GH 1IAKA 4KQ4H 5DS8A 3FO2A 1IGMH 1UCBH 4OD3L 5EULV 4KMTL 4FNLH 4LSVL 4PUBL 5ITBH 3UTPE 4FZ8L 3VDBA 1Y18B 4YXKL 2V5SA 3OKMB 4G9FB 3FQUB 3C6LC 2W9LA 4HIXH 3O4LB 5KVMC 1AXTL 4TVPL 4GBXC 4M9OA 1F2QA 4P46B 3IDXL 1HXMA 3PWPB 4OCMC 2NY6D 3PWUA 3C5ZC 3ULUD 4C55A 1VADB 2D7OA 4R2GB 1K4CA 4QCIB 4WRLA 1QSEB 2B1AH 1FNFA 3BPOC 5EOCH 1BEYH 2Z35A 4D2NA 1NCWL 4KKBC 1JN6A 2W65B 2YMXH 4FZEH 1FJ1A 3NFPA 4Y4KA 5HD8D 5LWYH 3F7PC 4G8GE 4JKWA 4G8GA 4YBHA 5EU4A 3DSNA 1CD8A 2V2XA 4N9GA 5D8JH 1K2DB 1MAMH 1P7KB 2VLME 3RHWK 4LNRB 4BJLA 1MJUL 4X6CE 4KI5C 5I1LB 1KXVC 1A6TB 2LTQB 4XCEA 1MRFH 5I18L 5HVGB 4B50A 1TNNA 4O5LL 3QCUL 1OGAD 1YDPB 1II4E 4X4XA 3T2PA 2R23B 1PLGH 4KY1H 5GRXG 1ZT7B 4ZUTB 1IC4H 4PFEA 4U1JB 1BIHA 1H8OA 1ZLUH 3UO1H 5JDSB 3DVNB 3MLWL 4X7CC 1VKXA 5ID0B 5DMKA 5T1KB 3HI1A 1D9KD 4UDTA 4PJ8D 4YXHH 4JO2H 3QUYB 5IVZB 3CFDA 1TJIL 3TO4B 1QFWI 4PJIB 4JDZB 3O6KL 1Z5LA 3MLXH 3IYLW 4KJWC 4TPRH 4XNYL 1DVFB 3WIHL 3DRQA 5HDQH 3ZTJG 2H9GB 3FB8B 4G8GD 4JM4L 4L3CA 5I66A 4OCYL 4G7YL 4RZCA 5I76B 15C8L 5ESAB 1CD9B 5ESVB 3D69A 3K8LA 1FL3B 3KS0J 4KZEH 1XGUB 4PRHD 5L88L 1CYGA 1XZ0A 1OPGH 4LEOA 1U93A 1FPTH 1UC6A 2YWZA 4OGYH 2OR9L 5FECB 1IC4L 3SKJH 3DX7B 2NXYB 3PWPE 5B38A 4FTVE 4KUZL 2HRPH 5A2KH 2GT9B 1I3VA 2AJ3B 2YD8A 3OKOA 5J0BA 5EG6C 3BKML 2J6EL 5DO2C 4YQXL 1CIUA 2IPKA 1ADQH 4U1NB 4QRTB 5HDQL 4ZPTA 5B4MC 5BXFB 1Q9LB 3Q3GB 3ARZA 5EUOB 5B22A 2VSCA 3VFUA 2DWDA 4TTDD 2XOTA 2OP4L 1RURH 32C2A 4Z76A 4EIGB 4NGHH 3QUXD 1OPGL 5BJTB 1QTYT 4X5WA 1WF5A 1J87A 4LCWE 4RX4A 5BRZB 4TVSa 4O02L 4D0BB 5MENA 1EERB 3QFJD 4KUZH 2HRPL 4WTWA 3ARDD 3O8XA 4Z0XB 1LE5A 5IQ9A 1R3KB 1A14L 3GSUB 2GI7A 2YPVL 2OL3L 1TVHB 4KI1A 2D7MA 3KG5A 5GZNC 2J6EH 4DTGH 4YQXH 5GS1B 5F3HB 3LRGA 1KGCE 2Y23A 1ZLVH 2H1PL 3I02B 4IM8A 1HXYB 4I3RL 3R0MA 3QH3B 2XPGB 3LS4H 3FOMB 1I7ZB 4DUXA 2XV6B 3DX8A 5FA4A 1DN2A 1DUZB 5FHBL 4N68A 2VDNH 4FHBD 4M00A 2NY2B 4IDJL 1WEJL 1RZGA 2H32B 3HI6L 4MCYA 2XQBL 3BP7A 3KPRA 1NAMA 1T0PB 4H0GA 4UT6L 1SBSL 4HIIA 3VWKD 5I9QC 3EYFA 2YXFA 1U3ZA 4FFYH 1FGNL 5HGHA 1RY7B 1Q72L 4NIKB 2IADA 3B6SA 1Q1JL 3RVVD 3PP4L 2DM7A 1N6UA 3C09C 4QXGH 1RUQH 1CIDA 4EOWH 3Q48A 1DUYB 5J3HC 2ZPKH 1MOEA 1D5ZB 4JPVH 2A6KA 5IMLB 3ARFC 4JQVC 3SGEH 4WTZG 1EZVY 1YEDA 4RGNE 3U7AA 5KOVC 4BZ1L 1R5WB 1VHPA 2V5TA 3VFOA 4XCCL 2CO7B 4JO4L 2Y7QB 4WHTA 5JOFB 4HKBB 3IJYB 2OCFD 3L3DA 4U1GB 4ZFFA 3IRPX 3JBG7 1T21A 4HEPG 1B0WA 3CK0H 3WNPA 3WFHA 5BV7H 3I9GL 1AR2A 2A77L 4GRWH 3VGAB 3W39A 2ADJB 3V5DA 3E2HB 3O4OB 4H5SA 2NZIA 3M1BA 4O2CB 3C5SA 3RNKB 3MJGX 1U8JB 1TVHA 2HMID 4RMQA 1F8TL 1RHHA 4XPAL 3FZUC 1QFWL 4ERSL 4YNYA 3ARFD 4W70A 5ICYA 1I1AD 3WXVL 5TE6H 3P73B 2HJLA 4AIOA 3ZDZF 2EXWC 3IETA 3EJZD 4HDIB 3VD3A 3MODL 3QQ4A 1CFQB 1I1FA 1ZHBB 2W9DH 4P2QD 2YPLE 3VXPB 1MFAL 5F88A 2MCG1 3SGKC 5FK9B 4HHAB 4DCQA 4PJHB 5HI4C 4K3DL 2XN9A 5J4MA 3U7YH 1QEWA 3ULUH 1N8ZA 3MCG1 5DWUL 3QEHA 4PJ5D 5JW3L 4MCZA 2HAZA 5F6IC 4JZJB 2Q1EA 1R3LB 1DDHA 4HXAH 4NN5C 4V1DD 3FRPA 4UV7H 1AHWB 1YEJH 1KLFA 2BNRD 5EU6A 1FZJB 5DQJB 5DHYB 3CDGB 1F8TH 1IILE 4XPAH 5L6YL 5J8OA 2CXKA 3P9LA 1TJHL 5ITFA 2B8OT 1V7NH 5EUKB 5C7XL 3UBXB 3PHQA 5TE6L 2X42A 2AK4B 1VEPA 3FQWB 4QTIL 5DUBA 1KPRB 3RVWD 1YEIH 4KPHH 3IJHB 1A21A 4X9BA 4RDQF 4KRLB 4OLUH 4J3WA 1JFQH 4U7SA 4PJ7A 3C6LA 4IRJD 4DAGH 1P7HL 1W0VA 25C8L 2DIAA 6FABL 5ESVA 1BJ8A 1FAIL 5HYIA 5DWUH 2ESVE 2IAND 4NO3A 3IFPB 3K80A 3X11A 1RZ8B 3QUKA 3LAFA 5F7EL 4LGPB 1MHPL 4XWGH 4TTDC 4PJFE 4RDQG 5D9SA 1N5YL 3UTSA 3CH1A 1F4XL 2A38A 4IHOA 1C8PA 5D7LD 4XNZB 5E8DH 2YZ8A 4YE4L 1S7XA 3DRTA 3FN0H 4XHJD 2OM5A 2NQCA 5HDLA 4EI5A 2JK5A 3BQUB 4UQ3A 4ALAL 2CIKA 1ORQA 2BNRA 1WV7T 2CSPA 2FH6A 3QHZH 3BYYA 3FB6A 2PXYD 3HE6A 4ZD3L 2W0FA 3QI9D 1FE8H 4UUJA 1NAMH 5CWSB 4DZ8B 4ZSOE 1UB6A 2HLAB 3PQYE 4DKAA 1HCVA 9CGTA 1NMCC 5IVXF 3WV0A 4PGEB 2F54E 5DVNA 5D6CA 5CD3A 1NSNH 5FYLD 3EDEA 1YN7B 3EUUA 4NRYA 1NGQH 1JPSL 4R90H 5C0CB 1PKQE 1G6RL 1MCSA 2HT4D 4L4TB 3GGWA 5E2TH 4NKMA 3RWEB 3WLWD 4NPYB 3WLWC 5BMFH 5J57B 3U83A 1I9IL 1VDGA 4J8RA 4DUVA 4YDLC 1QSED 1N6QH 5IB4A 4NP4L 1S7RB 3G08A 3MJ8B 2HLFD 1CL7I 1E4WH 4GUPA 3N50A 5FA4B 1ND0B 4X6FA 1N7ML 3QG6A 4PJBB 3HA0A 3B5HA 2WWKT 5IFAL 2F9BT 2M8XA 5DEGB 3ELAT 2X05A 3T0AA 3QCTH 3QDME 4I18C 4X0KA 4P3DA 4TTGA 3ARXA 4FQPA 5AUMA 3IKKA 4GRMB 5DD0L 4NQEE 4MA7H 3W81A 1UADC 1DQDL 1KCSL 4ZUVB 3CMGA 4NQCD 2VL4A 5C08D 4P3CH 3VXRD 4U6XA 1U3HB 4XH2A 3UTTA 1T4KA 2FHBA 2BSTB 1GYAA 2A9ML 1N3NB 3FO9A 1T80A 4DN3L 5IWLA 4WW2B 4D0DB 4RNRA 4MQ7A 2YEZB 3ALWA 1J05A 3CCHB 1BWMA 2R39A 4LCWB 3NCJL 4D3CL 2YA2A 2ZP0T 1K3IA 1UVQA 2IWGA 1EGJH 2NY6C 2D0HA 1S7WA 2WQRA 1IC7L 5JHLH 1FG2B 1I9RH 2VQTA 2ATPA 2G60L 3BO8A 3AU1A 4KJYB 4LLDA 5DHVB 2GIYA 2HG5A 1U58A 5D2LE 3PGCA 4E41E 5CEZL 1ZLWH 3ZDYF 5D6CB 5CD3B 5C2UB 5HVFB 3QXAB 3FFCB 1YEHH 1YJDC 1NDMB 1WIPA 2N7BA 4Y2DC 4MB5A 1PFCA 1VENA 1YMHB 4JFOA 4YBQD 4XXCA 5C0EA 3DURB 5LXGL 1M6OA 4JB9H 5F93C 5FA3B 1EJ6A 3HR5A 1QBAA 5IK3B 3VWJC 4KK9C 2AEQL 3CUPA 3HCVA 2GJ6B 3ARDB 3EYQC 2JB5L 2MSPA 1INDH 1N26A 4I3SH 5DD5H 2H26B 4GXUM 1QR1B 3MRPB 3DRTB 3DPBA 4EZMA 1X44A 1WZ1H 4RGMB 4XNMA 4PJ9A 3SOBL 1U8OB 4GOSA 4MCZB 4QGYA 1I9RL 1PKQB 3RIFK 4HCRL 3GI9L 2H32H 4D9QD 1UH4A 1UH2A 4M93C 4S2SA 2C9AA 1B0GA 3RVVC 4QT5A 4MNQB 5JXAL 3ME0A 3L7EA 2QKIA 1ED3A 2AV1A 4LCYB 2LV4A 3RIFF 1N59A 5IR1B 2GJJA 3LD8C 4DZBB 4KI5E 3P0YH 2VC2L 2VLMD 4HULB 1CI5A 4DVRL 4ESKA 3WCYA 3X14A 1IGML 1UCBL 2N7AA 3BP5B 1CQYA 1WWCA 1IGIL 2AK4A 4JB9L 3X3FL 1Z2KA 4YXKH 5AZEL 1HHIA 3RWJB 4CVZA 4LHUG 4YHYB 5D1ZB 3CCHA 2R1YB 5KVFL 1RZKH 2XWBB 5DZNA 4G9DA 1QA9A 3SGJC 5H35B 4TSBL 4I9WD 5C0BD 2QADD 2Z91B 1I8MB 2X1QA 3L3JB 4GRWE 3D2UA 3VRJB 1XGPB 4LCCC 2W0FB 4AM0A 2FGWH 4GW5B 3KNBB 4JZOB 4GG6E 3EJYD 1F4WH 3QIUA 1OB1A 3ECBA 2CD0A 5E2VL 4G6FB 5E5MA 2YUZA 3ILPB 4GW1B 4PB0H 1MRDL 3MRJA 2WM0A 3BQUA 1MAML 5JXED 4D0DA 3PV6A 2CRZA 2JCCA 4JFPB 5EZOH 3T3MF 2NY7L 3C8KA 1DVFD 1YNLL 3HPJB 1A64A 3VWKC 2YKLL 2Q76A 4WWKA 5I8OL 3Q6FB 3VGBA 3HNTL 4HF5L 1KCRH 1U9KA 4OLVL 1UENA 4POUB 4U6TA 3G08B 1YNTA 1WCBA 3S34L 3ZT6A 2FHFA 3BPCB 5E9DA 1I8IA 5IF0A 4UB0L 2GAZA 4Z7OF 4ZYKB 4C54A 5HGAB 3VXNB 4JZJC 4OF5A 4U3HA 4GAFB 4FQXD 1RZIB 1PZ5B 3BGMA 3M17B 1QEWB 4LL9A 3AS0A 1EBAA 2NZ9D 4PJDA 3BZFA 2ZSVA 3T4YB 2BVPB 2O93L 4OB5H 4CL7A 4P9HH 4L4VE 3IFNH 3IU4H 3GSNL 4KTDH 2NY4C 4CVWA 2H41A 3FO1A 5T3XE 4ODUB 4NPYA 3KPOA 4FTVA 4UILL 4WTXA 1WSST 5J12C 4MB4A 5FYJD 2ZUVA 3TJHC 5SV3A 3UTTE 3QJFB 2J6EA 1OY3B 4ETYA 3QUXC 4XX1E 3MJ9H 4DKFH 4GG6A 4NQDE 3IFLL 4PJHA 4LVHB 4MDIB 3OKKA 3EYUH 1E6JH 1QYGH 4CW1A 4GXVH 3WN5B 4ZUWB 4X98B 1HWHB 3B9AA 2FJHA 3TV3H 2VXUH 1RJLA 3KLHD 3CD4A 4ORZC 2HWZH 4I13B 5CEXA 4OZIA 4PJAB 3TBSA 3W82A 3PWLB 5CMAB 3STLA 5LAXB 3BYTA 2XNAA 4UU9A 3RPIA 3T4YA 5CBEB 1GAFH 5TFSL 3X11B 3TBTB 3AREA 3IGAB 1BLNB 2VITB 2X44D 3D18A 5FDYA 2MCPH 4LHJB 5H37G 1BZQK 4PRHA 4PP2A 4N5EC 5EBLB 5AAMA 3N1FC 3P77A 5GGQL 1I1YA 2F53D 3MREB 1YNKH 4NGHL 2MWCA 5IUSA 4P23A 1NLDL 1JPTH 5F9JB 3EFDL 1EVUA 1AGBA 4U0RB 5FYKH 1J0ZA 3GBNL 4PRIA 4K3GA 2GEEA 3EDDA 1AGEB 3UTQB 2MMXA 4HGKC 5IIEB 3WFBH 2ICES 4M1DL 3O6LL 2ICEA 4MCYB 3X17A 4ZFOB 2UUDH 4NKDB 3IXTA 4OLYH 3TLRA 1R0AL 1WBXA 5B8CC 4QOKE 1OP5K 3FL7A 2E5EA 1OWWA 3ORJA 4ZQKA 2PYFB 4N8VB 4R4FH 4WI5A 2B5IB 2EYRB 4JY4B 2HYMA 1AO7B 2CDFB 4D9RE 1RK1A 1S9WA 3HUJB 1FO0H 3CSBA 2I60L 4X5XA 1RUAH 3RVWC 1JK8B 2VZOA 3QIWB 2BRQA 2H1PH 1SJXA 1EXUB 2NZ9C 4JFDA 4P59H 4NHUA 2IJ0C 4LLWA 1N5AB 5SWSB 2EEBA 4PJIA 2AKRA 4WU5B 4RX4D 3DUUB 1XMWA 3TN0D 1NLDH 2D2OA 1NPUA 2DQIH 2X4RB 2VDNL 1RJZA 2VLJB 4YHZH 5E8OB 3N1GC 1ORSB 3JWDC 4NC2B 1FCCA 5D6DC 2GTZB 4TULL 3F5WB 4MAUL 4YX2L 3WFBL 3PHSA 1IEAA 3KXFD 5DD1H 4L9DA 5DA4A 3HE7A 1HYSD 1F6LL 4JG1L 1UXSA 3WEXB 5ALCL 1QLRB 5I1EH 1OT1A 1EO8L 5F88B 4R97B 4NKIH 1SJEA 2I5YH 2OMNA 4P4RB 1CU4H 1NMBH 2W60A 3LKOA 3F58L 4C56B 5ILTH 1ZLWK 4EOWL 2A74B 4K23L 4YNYB 4M62L 4OSUL 5EFIB 1EFXB 1L6ZA 3KHQA 4W4OC 4B41A 4HWEL 2X4PA 1U95A 3MLTA 4NC1E 2IPKB 2LVEA 2Q76B 1WK0A 3A6BH 1QSEA 5GS2D 4P9ML 3BE1H 1U3HD 2DM3A 2DQIL 4M7JL 2DN7A 3ROOB 2ENSA 5C0FB 3PWVA 4OAWA 3LEVL 3ZKMC 2L7JA 1TQCC 4JN1H 1H8SA 5EU7E 3IDIA 3S3JA 3V8CA 4F7MA 4H0HB 4P2OB 2DWDB 4XWOD 2ADGB 5JW4M 1SM3L 5ID1A 3KNBA 4JZOA 5BVJB 2YBRB 1SJHB 3ARGA 4XCNB 3FAWA 5MI0B 3RDTB 3KXFA 1MIEL 5BVPH 3KXFE 3AC0A 5FYJU 3BKYH 4X6DB 4X98A 1Y6NR 4BA8A 5KSAC 3F58H 5ILTL 5ITBL 4WY7H 5KVDL 5FOBA 2JLLA 5AYUH 3MODH 1IMHC 2XYCA 1BMGA 4FQXA 1WBZB 3LKRB 5IKCB 3TIDB 3N0PB 1RIUH 4LPWA 2I9LA 3SKUD 5INDA 2F8VA 2H3NB 2J8UA 4RMTA 3IDMB 3T1FA 1OF2A 4J6RL 4JVUA 4TVPH 4KHTL 3PXHA 1QSEE 3A6BL 3D9AL 1G7JA 1QD0A 3VFRB 1OVZA 3WO4C 4HKZB 1FG2A 1HIMH 2BRRL 4PR5A 2IC2A 4HUNB 5CZVL 4UMGA 2DQCL 1JNNL 4H1LG 4HWBH 5CZXC 2PW1A 5JIPA 3D25B 2X41A 3EYQD 1DSFH 3OWEA 3BJ91 2VXVH 3BESR 2EYSB 5E6ZA 2IBGA 4BK4A 2WBJD 1X5AA 1PKOA 2XZCL 4ACPA 4YHNB 3VXSB 1RFDL 1MREL 5DRWB 4FABH 5F96L 1A02N 1MI5A 2DBJA 3M45A 4GRLC 4D9QE 1QRNB 4K7FB 4F33A 3G9VA 3NOIA 4JHWH 3V7MA 1OL0A 3BRFA 3WFDL 1YEIL 5AYUL 5DQ9B 2OXGA 3A67H 5TDPB 2AJUL 4GS7C 3TBVA 3WJLC 3B9KC 1KBGL 2DTML 5TGBB 3QHFH 1HSAB 1DBAL 4NJAH 5C08E 4OFPA 2OMBA 5TF1H 3T0EC 5C3LD 1D7FA 2E7BA 2UWEB 3MFFA 3MV9D 1YC8A 2OTUB 5D1QD 3VRLE 1RAMA 3FT3B 4B53A 4NUGH 3WLBB 1U8MB 5CUSL 2X4NA 1RZKC 1ULVA 5L2KB 4WI8A 1GRWA 4G6AD 4BZ2H 4S11A 1G7MA 1C7TA 2Z0BA 1AGFB 1E27A 3DXAB 3K2UH 4LDLB 3WJJC 3RI5K 4L8DB 4QNPE 2UYLA 5JR1H 4JM4H 1FVCB 3WYRA 3WS6A 1NFIA 5DURD 4ZTOL 4WO4D 3S5LB 1MY7A 2H6PB 2DRUA 2IQAA 2VXQL 2Q87A 3BEWA 1JF1A 4XI5C 3GKWL 1MH5A 1PBYA 5L88H 4JFHD 4PJCB 3H7LA 4FXGA 4XBGA 1AE6L 2HFEB 3QUYD 3DETC 4DGIH 2VISB 4L3EB 2V9TA 4HC1L 3UTTB 4Y8AA 2A73A 1UZ6F 4R3SA 4K55A 5L8JB 3IDXH 3PHOA 2PETA 1RUKL 4UTAH 3VXMA 1RZ7H 2R29L 2ZUWA 1FO0A 1FL5B 3MFGB 3O4OC 2W0PA 1VERA 1NKOA 3KLSA 5F7HA 4P5MB 3SQBA 3PABB 4ZDHA 1JZ4A 4Y1AB 1CXFA 4NUJA 3PWVB 4OAWB 4L3EE 3RJDA 4KQ3H 1I9IH 4Q9QL 1ITCA 4Q2ZA 5BS0A 1N6QL 2KUTA 1JHLH 2HG5B 5GISH 1GOGA 5F8QC 4D9LL 5HYSG 1JWUA 1E4WL 3BD5A 1S5IH 4HZLB 1X6LA 4NYLB 3FRPG 2E9IA 3FFCA 2OP4H 3LKNB 4I0PB 2AJXH 1RZ8A 2CGRL 1AI1L 3NAAH 3GSVA 3O9WC 4O5LH 1ZHNB 2OJEA 2OSLA 1OAUL 4HD9A 3RWHA 5C07B 1X9QA 3KPQB 2ATPB 4P5TA 4ELMA 5KW9H 3E0GA 2NY4D 2P47B 3CU7A 5DK2A 5SWZB 2UWEA 3MFFB 4JAMA 2UWEE 1KPRA 3V4PH 3V5HA 1LO5B 2B4CC 3BPOB 1TTFA 4JO2L 3OB0K 1TNMA 2F53E 2OL3H 4X9GA 1VFOA 5IMKB 3JSSA 3VH8G 1P6FA 3FB7B 2G2RA 2HFFA 4JQIH 3QUMB 3IF1B 3VXOB 1G0YR 2ZG1A 1YEEH 4Q6IC 3NPSC 5DI8B 1YECL 3NCYS 1NCBL 2YD3A 4D9LH 4E5XB 3RGVB 2O5XL 3HLAA 4EN3A 4Y5XC 1ZTXH 3DBXB 2BOBA 2CIKB 4FQXB 4OKVB 2VIRB 3OKEA 1PYWA 1QPPA 3B4NA 4PJFF 3CLFH 4FN0A 2BHUA 3LKQB 1ZLSH 4CBPA 3ARBA 3V4VH 1MQKH 3F7YB 2ATKA 3SDAC 1BOYA 3V5HB 1A3RH 1J10A 4JFQA 5HJ3A 2VZUA 5MEQB 4QO1A 1ZXQA 2Z8RA 5IGXL 3ULUC 4XAWH 1AGFA 1E27B 1QBLH 4WTZA 4DN4L 4GBXD 3T0XA 3WIIH 1MHCA 2EDKA 3O11A 2V2TB 4ZS6C 1CICB 5HYQB 4NRYB 3RRQA 2LU4A 4PGEA 2AJSH 4LBEA 3MLRL 3C6SB 2YSSB 4P57A 4PPTA 5JO5A 2H3NA 3T1FB 1YECH 5D2NC 4BZ1H 4HUVB 3V6OC 3QXUA 3SOBH 4XCCH 4X6DE 4OCSH 2ARJB 1RV6X 4IDLA 4MWFA 4UTBL 1WAAE 3SE8L 3VXUE 4AEHH 4EUPA 3TBVB 3QO0B 3NPZB 3CK0L 1P5VA 3L1OH 1AXSA 4P23D 4GRWB 3QIWD 5KN5A 3V4VL 1JMXA 3T2NH 3KPRD 3KYAA 3TBYB 4O2EB 4NNYB 5DF0A 4MQTB 4NWTH 4X9FA 2AK1H 3ZKXB 2R4RL 1IJ9A 3LPFA 3KLAA 4MNGB 1KXTB 3VXRA 3QFJE 1SEBA 1DEEB 3VFVB 3MR9B 1BQHG 1YMMB 4W81A 2GYSA 4QHNB 4V1DE 4OCRL 3MBED 3LQAH 2XICA 1T1WA 3VWJB 4DTGL 3VFMA 4MD0B 1GGIH 3GBML 4NO3B 2VDKH 1RZKL 4UDUA 4G6FD 2R0ZL 1B88A 5C0GA 4WWID 3H3KA 2RCSH 3BZFB 3EW3B 1RZGB 2H32A 3TZVB 4LSTH 5I15L 4GKSB 3HG1B 4K7PH 4KK8D 1FYTE 1JPST 2BSSA 1KTKE 4FMFA 4MLIA 3P9LB 5AD0B 1BOGA 4XPBL 4F37K 2GTZA 3QB7C 5CLWA 3LKSB 2R1XA 5J7CC 3VXNA 4J12A 1J0YA 5FF6B 4LAJH 4W6XB 1MCEA 4HLZG 1FLRL 1ZAGA 2MFNA 3HE7B 4HCRA 4EBQH 5HGAA 2R4SH 4XMLL 4XNZC 4L4VD 4U4BA 3CVHA 1U3HC 4OZHA 1BVLB 3O6MH 4QRPA 3OL2A 2WINB 1GC1C 1PJ9A 3MV8B 4LLVA 3IDJA 1V7NL 2JIXB 3S36L 2C5DC 5ELIA 3QRGL 1S9XB 4AZ8A 4LPUA 4QTIH 4G8FA 2YPKB 1LP9F 4JRXA 2AVGA 3QDMB 4Q6IA 2IAMB 4X6CF 1TVBB 3DNKA 2X1WL 4UB0H 4PJ9D 4F57L 25C8H 2BX5A 3H0TA 1FH5L 4R6UA 5IFHL 5C71A 3TH4T 2A83A 5DRZA 3RUGA 1IRAY 3GSXB 3R1GH 1QUNA 4HUMB 4Z7WE 1CGXA 5DJCB 5D1XA 3I9GH 1SEQL 4NKOB 2HRLA 3MA9H 5BXFA 4JO1H 4YHOH 4LSUH 2GW5A 1K6QL 2J5LB 1O0VA 2R4SL 3MV8A 5IHZB 1J1OH 3QR2A 1OGAA 5CGYC 5DO2D 4N0YH 4MDJA 4S1RH 1TZGH 1MCHA 2H2PD 3O3EA 5EU6E 4WNQA 1Z9OA 5FB8B 1LO0L 2XA3A 4KAQL 5I1AA 1D9KA 1S9YB 2DI9A 4ODHL 5F9DC 1OP9A 3MROB 2YOCA 3KPQA 3C5ZB 2AI0H 4Y8DC 3MA7A 1E6JL 1QYGL 2D31B 5JPMB 5IFHH 5FOJA 4GJTB 3OXSA 3TV3L 4F9PA 5DMIH 3TESA 3LKQA 1KXQE 1T04B 3MR9A 1ETZA 3AMLA 1AD9B 1KEGL 4NZTH 4MAYC 4I77L 4NQVB 2RQ8A 2LFGA 4ZQKB 5HHME 5DVOA 4HGWA 4ENEC 3P4OA 4ZUUA 1QACA 4OIBA 3IXTB 1NCDL 5E2UH 5HI5C 1MWAA 1TPXC 3PXJA 2FD6L 3H9YA 4JRYA 4S1RL 2NNAB 3FT4B 4TUKH 3QEQA 2ZSWA 4XPFH 1OP5H 1ZLUK 1BFSA 4LF3B 3RVXD 3JV4B 1U8LB 2VDLL 2E27L 5HGBB 5KAQG 1U91A 4AJ0A 5JPNA 1MCDA 1NAMB 3QEUB 4WHDA 5GGRY 4YR6A 5DJXB 5T3XL 5T1LD 4X7SH 1BECA 1HHHB 4GQ9H 2ERJC 2FJFB 3QCTL 3SDXA 4KRMB 5EBMB 4Y1AD 4ELKA 2XWJA 3KJ6H 4LFHG 1L0YA 3DXAE 4LSQH 5FYKE 3T0EB 4AL8L 1KB9K 1PYWB 3QUYC 4ZS7H 4XMPH 5IOPA 2NXYC 3BJLA 4IRSD 1CFNA 3L95A 1UYWH 2KBGA 4IRSA 4L8BB 4H1LB 7CGTA 1D6EB 3VRIB 5GSRA 4GKSA 1MAKA 2DMBA 1I8IB 5FYJL 1CBVH 1DFBH 4Y2OA 1V8HA 1F4XH 2I60H 3EOTL 4MNQD 4R8WL 5DR5H 5EZLB 4P4KD 3MLUL 4JN2A 2X4TB 5FUCC 4DN3H 4EUPH 3TT3L 5KSBB 1PKQA 2G75A 1T1WB 4LAQL 3MLZL 4MD0A 3UZEA 1VGEH 4G9FE 4Z0XA 4U3CA 1XIWB 4QF1B 4K3JL 4Y5VA 3RY6A 4QRUB 2ZUQB 1MELA 3FMGL 1NAML 2YPLB 3UCRA 4YX2H 2BNQE 4ODBD 1HKFA 2C1PA 1WFUA 2R0LH 4JRXB 5CEZH 1KB5H 1TXKA 4PRPD 4XMPL 1KNOA 1QO3A 1FZOA 2BNUA 1BBJB 5I74C 1VACB 2V2WA 4L9LB 5EOQL 2UWEF 2AK4E 5MI0C 2IQ9H 5JHDE 1G6RH 1RJCA 5A16B 5EU3B 2FECI 3G9AB 4XPHL 1XF3B 3MO1A 4JAMB 3IAGC 3B5TA 4I3GA 3OR7A 1JF5A 4HUUB 3SY0B 3QBTB 1PQZA 1WWAX 1TCMA 4PJBA 3KPTA 1A1NB 1HWGB 4P4KA 5E2WL 3KLDA 4PJ9C 1WZ1L 5JUEH 1IAOB 4CGTA 1OAXH 2VABB 1ZVSA 3U0WL 5FM5O 4X7EC 3U79A 1NFDA 3BIAX 4E42A 5CBAA 3EOYG 1UWXK 4NKMB 5IV2A 3W5NA 2CDGA 3IXAB 3C6LD 1S9VA 4JFEB 3NTCH 1PSKH 4HK3J 5CJBA 3SDYL 4HS3A 5IMLA 3QCVH 3QQ3A 4U6VL 5CCKH 3SKMA 1UB6B 2HLAA 4XCFH 2JELH 4O9HL 4CVXA 3B2UC 1V3MA 3ARBC 1R3IL 5D7LE 4BKLB 3L5WB 3PV7A 3D3VD 1IGIH 1MLBB 3VCLB 3QISA 1S8DB 3RY6C 4X0KB 4G43B 4OZHB 3C09B 1P6AB 4P49A 3ESVF 1HOCA 1BREA 4BFEA 1URLA 3KYKL 3WLBA 4PB9L 4FXKB 1NCCL 3DX9B 4YO0B 2CDEA 3P9MB 5LGJA 5D7JA 1HIML 2BRRH 3FAXA 1OTSD 2CK2A 2X10A 5GGUA 3B5GA 3MUY1 3HG1E 5C07D 4TUOB 4U1SA 1Q0XH 1XF2A 4LLAA 4YK4C 3S96B 2VR9A 4G8IB 3SDCD 2VXVL 5E2VH 3BD4A 1BBJA 1EFXA 2XZCH 2HH0H 5FKAB 2FR4B 5DJ6A 5C0CD 2Z9TA 3SJVA 1C5CL 1HH6B 4HWNA 3K81A 3CXDH 4KQ4L 1FIGL 5EZOL 1HQRA 5EIVA 4KHXL 4ORGA 3QIWC 5CJOL 5JNYB 1INEH 1DQMH 4FZ8H 3A67L 1VEOA 5D7IE 4Y0GA 3PUCA 4P46A 2FB4L 4HIEA 1AJ7L 2OXHA 2VH5H 3P30H 1JRHH 3LPWA 4XH2B 3QNXA 4JM2F 1JZ6A 4XRCA 3F7VA 4M3KB 5I17B 5FGSA 5EZJA 4H20H 2YRZA 3GSRB 4LOUC 1QO3B 2WIIA 3BH9B 4J3VA 1TFHA 4QHMA 4BH7A 4PJFB 1LK3L 1ZA3A 3Q1SH 3P0GB 3QIUD 1Q0XL 5FA3A 5IB2B 4KJPD 1U8HB 6CGTA 2I9LB 3SGEI 2V5RA 3IB4A 1IEHA 1BVKB 1HEZB 3QNZA 4JY5L 4GUPB 1N0LA 4XXCC 1IGYA 2MQCA 3CXDL 2YD1A 4UAOC 5INCA 3JZ7A 5D5MA 3BD3A 3BZDA 3R06A 3Q6GL 4R7DB 4OIAA 1FNGB 4PJ7E 3RDTA 3WUWG 1IAOA 1MCLA 5I18H 5I19L 5F3BB 5AZEH 3U7WH 1KN4H 4FQ2H 2F54A 4KXZI 3STZB 1A7RL 4KKCC 5BZWA 1MCCA 1JRHL 1JNJA 4HSQA 1MQ8A 3CSGA 3MJ9L 4JM2B 1CL7L 2C4XA 2X1OA 1XIWA 5BRZD 4UTAL 4WFHE 3TN0C 5BS0E 3L5IA 4PGBB 4L4TA 3OKDA 1FFOA 1LK3H 5CD5D 4H5SB 3QIBC 1RIVH 4G8IA 3KPSB 5HYJD 2BOBB 2DQHL 3N1MC 5I1HH 2F8XC 1AKJB 4TPRL 3PWJB 4LVOC 4WO4A 5FUOH 5IV2B 3QWQB 1JHTB 4JANA 2VLKB 3GSNB 4H1LA 3GMRA 1X6NA 1A4KA 3MRIB 4XC1H 3DGGB 4G7YH 4NQUA 5GGSA 2H8PB 3Q6GH 5I73B 1AKJD 5T3ZL 3KPSD 4K94H 2AJXL 1J18A 2ITDA 1U92A 1WC7B 1I7TB 3U6RA 3AGVA 2PYFA 4QRUA 1MI5B 3VFNA 5FIEA 1KCRL 4OLVH 4UQ2A 2KKQA 1TQBC 4J23A 2IBZY 2D7NA 1ITBB 3ZKSD 4FQQA 4JM2D 2JJVA 1D5MA 2FWOB 3DSFL 5GRJH 5E0QA 3S36X 3V4PL 3AXLB 3QUZD 4WCYL 3L7FB 4XPGL 2NXZD 4R4FL 3BKMH 1JV5A 1EDQA 1KTDB 3TPKA 4IOSD 3U4BH 3KYOB 3N9GL 4QRSB 1QSFE 3QDAA 1OAZH 3LV3A 4G3YH 4AENA 4P9HL 1I4FA 1IGCH 3VJ6A 1NCBH 4KKLD 4RFEA 3PHQB 1BZ7B 2F53A 3NCMA 4DFIA 3O6FA 1A2YA 2VL5A 4A6YB 5CILH 4K94L 1QBMH 4P5MA 4OF3A 4QRRD 5HPOA 4P2OA 1A8JH 12E8L 2IH1B 4P2OD 1L7IH 3S37X 4LLUB 1D9KB 1H3XA 2B7DT 5C9JB 3PJSA 1U36A 2J12B 1S7VA 1A6ZB 5K33A 3VFMB 5D1XC 4UOW0 1YUHB 4BSWA 3M1BB 1XH3A 1E28B 4N0CD 1A14H 1QFOA 4U1KA 1NC2A 1J88A 3MOBH 4FQIH 3HC0A 3VWKB 1N6VA 4LLQB 3U4BL 4MX7A 4PP2B 1I4FB 5AD0A 2UV3A 2C3GA 2B0SL 4M62H 4M02A 4A6YH 2HP4A 1RU9L 1J1XH 3EJJX 5FK9A 1T7ZA 4HKXA 5FO8B 2XTJD 2ZJSL 5F89A 1UEMA 1ZV5A 5CILL 4PJAA 4JN2B 1WITA 2DQUH 4GKNA 2Y9RT 5FO9A 1NEZA 3VFGL 3BZ4A 2VN4A 4PS4H 4HJGB 3HI6H 3AS3A 2NY6B 2PTTA 4LVHC 3BEVB 2WWMD 5HGHB 3LKRA 4EUPG 3QDHA 3WFCH 3ZDXE 1HHJA 1TLKA 3FHAA 3BRGC 4JDTL 2CRMA 4GKZB 5GS3A 4M03A 2HJFB 3QIBA 1FNSL 1XGTA 4PGZA 3LQAL 3D3VB 5CWSA 1G6RA 5J6HB 1QLEL 4XPTL 4KI5F 4JPVL 4NNPL 5FGCE 1Z3GH 2VDKL 4RFEB 4Y16C 5T3XD 3U0PB 4PRPE 4MNQA 3OAYH 4YHIA 4JFED 2ZJSH 3EHBC 4DCQB 2E6JA 1PDKA 4PJEF 3RFZC 2D03H 5CJ5A 4P46C 2O5ZL 3EIFA 3LVEA 2Y07H 4MQXD 4K8RL 4M1CD 3WKMH 3CH1B 3DROB 2X1PA 2VAAB 1MCBA 4MXWL 3HZKA 2JCCE 4NHUB 3LSOA 1KGCD 1VPOH 3GSXA 5ALCH 1J1PH 3KPOB 3IDGA 3LH2L 1NBVH 1QFWH 1NGYA 3B43A 3MTRA 1FNSH 2EZ0C 1MJ7H 1UQSB 1V05A 4NZUH 1QFWM 4FOMA 1QHPA 1BWWA 1RZJL 4PLKC 43CAB 3FQWA 2VLRD 2FBOJ 2AJUH 5IF0B 3RX8A 5CKGA 4Z0BH 3SDCC 1K5NA 4QGTA 4PV9A 5CEYA 1HXYA 2FJHB 4HBCL 1U58B 4FQHB 2CK0L 1S7VB 2EO9A 3AROA 5DD6B 3MCKB 2PKDA 1A0QH 2P42B 1L6XA 3RPIB 3EO0A 4OZFB 3CX5J 2CKNA 3HNSH 3C08H 3DROA 1C16B 2AKRB 1WZLA 2G9HA 4OGAD 4WU5A 3VI4F 1IAIM 3KPSA 2J8UE 2FWOA 2QJDA 3VWKA 2ZNWA 3I84A 2W9EH 1Q9KA 3BUYB 1ZVYA 4QCIA 4RMRA 3WS6C 4P23C 5EBLA 1JGLH 1YC7A 1JZ7A 1EK3A 2WNGA 1WBYA 2ZNXA 4Y4FB 1HSBA 1CFVL 3WJJA 1FNAA 3EO1B 2YN5A 1LDPH 4OZGF 3G6DL 3CUPB 3W0WA 1JGEA 1M7DA 1NBVL 1AD9A 1SHMA 1EGJA 4HPOH 3KYOA 4ONHB 4O2EA 4Y2DD 1WC7A 1FGVH 3CVHL 4ZOCA 3GMRB 4RMVA 3VD5A 1JGVH 1DN0B 5F44A 1JIBA 3G5ZB 1ZHKA 1T0MB 3A6OA 2AI0L 3MBXH 1LDSA 2L7UA 4FQQB 2YD6A 3V6BR 3MCLH 5K9JL 4M7KH 2ZUSA 4TNVF 3RZCC 1MWAL 4MJIE 3P0VL 2BSRA 1DBBL 2DKSA 1RUKH 3HZMB 2AJ3A 3GK8L 3C08L 3HNSL 4N0UE 2Q7YA 4L1HA 4M9PA 4RAVA 3NBNA 4YK4B 4FTVB 3ZE0F 5DFVC 3WFHB 3BP5A 4Z7UE 3FJTA 5DJAB 1GHFH 1C1EL 2RB8A 2ARWA 4HG4J 3LEYL 1JNLL 3SCMC 3FN0L 1N5AA 5SWSA 5SWQA 1WIUA 4QYOB 4F9LA 3HUJE 4ZXBB 4WEBH 1KELL 4I5BB 3SDDC 5C9KA 4LASH 5I66B 2FX9L 4LLYB 3RUGB 2OI9C 3BSZH 1ED3B 5L9DL 5D93C 1CFSA 3T77B 2KQMA 4Y2DA 3R06B 5HY9B 1BZ7A 3U1SL 2ICEB 2A6DB 2VYRE 5SX4H 3VXOA 5K9JH 1TTUA 2ZKHH 4M6OL 1BAFH 2F8OA 1UA6L 3L3HB 3RU8H 1Q8MA 3V79C 1HDMA 4X80H 5DI8A 5H8DA 2CUIA 4CMMA 3A6CL 3H9HA 2OZ4H 4BYHA 4F8QA 3GK8H 4IOFD 1JPSH 4POZC 4L9LC 1HILB 3MJ6A 4P23B 3HPJA 2W0LA 2YMXL 1C1EH 1QG3A 5BMFL 4X83A 3MLUH 2BSTA 4XP4H 1IQWH 4MWFB 4H25A 3GJFK 1DJSA 1KELH 2HT4C 4M8QB 1K2DA 1MJUH 4OZIE 2O26U 1J8KA 4WFFD 1T1ZB 2O5XH 5J1TC 1S7SB 1NC4A 4ZTOH 1RVFL 3TNMA 3SE4A 4PJXB 4IRSC 2EXYC 5DJDB 1F97A 3IFPA 1OAQL 2K1MA 3EZ8A 5ALBH 4NN7C 1KJ3H 4LEXH 4LLDB 1BIIA 1PLGL 4P5TD 2YN3A 5DD0H 1MVUB 2N1KA 4Z7WA 1P84J 4F7EA 2FLRT 3NIFE 4TRPL 4Z8FL 1CQKA 2GJZA 3DJ9A 1RZ7L 1MCWW 4OZ4A 5K9QI 1PY9A 4R0LA 4I4WA 2GJ6D 4Q2ZB 5BS0B 1CDJA 5JMRA 1U8LA 1MI5E 4RWYL 1M6OB 1LEGB 5CD5C 5KN5B 4QHLB 3VRLF 4LPVA 4L4VB 4E0RA 2WBKA 4GS7B 1G7JB 3PE9A 5I1CL 4I0PA 4CVXB 2AS5M 4EI5B 1CGTA 3ARDA 3O8XD 4POYA 1H5BA 2P43B 5E2WH 5IM7B 3JV5A 4WI2A 5SX4I 3VRIA 4AMKH 4OCSL 1OAXL 1K8DA 4UTBH 1G9NH 3MACH 4XXDA 1MIMH 4ZTPH 4OM1H 1MFDL 1T20B 2VLLA 3NAAL 1NLBH 4G6AC 1NC4D 3HG1D 1FL6B 4NUJB 5KS9A 4HHAA 3T2NL 4R4NC 1UXWA 2FHCA 3OKLA 1DN0A 3QCVL 3O2DH 1EFQA 3QA3B 2DWEB 2EDNA 1N2RB 4RAUA 5HI3C 2FATH 2X1XR 4PREA 3DO3A 1R3IH 4MXVE 3LQAC 4I5BA 3TCLA 1YN7A 1KCVH 3MBEB 2WBJB 2AJZB 4OCRH 3E3QC 5LQBH 1HSBB 4CAGA 1MCOH 1A1MA 3BDBA 4L4TD 4OZGA 5GZOD 1P7QD 4ZO9A 5FKPA 1U8KB 1NCCH 4HFUH 1FBIL 4Y89A 4HIEB 3FTGB 4ZG1A 4K7PX 5DJDA 1HINL 2IFGA 1S78C 3RWIB 5AUMB 4WI3A 5AWNL 2OJZL 5D96C 3ARGB 1NDGA 2V2WB 2A9NL 4M61B 4X4ZA 3BVNB 3SPVB 3IJYA 3RNQA 2BY0A 5CSGA 3GSRA 1IKFL 3OGCB 2CJUH 5FOBB 1GPOL 2FH8A 4O02H 5CZXD 4X4YA 2DS4A 1A3RL 5IB1B 3MV8E 5EZJB 4GRMA 4HJ0C 1YYLH 1YN6B 4O58L 4G7VH 5IGXH 1LQSR 1EHLL 4W4NA 4XAWL 3ILQD 4F7CB 1FIGH 3WS3B 3RDTD 3MV9E 4NOFA 3O81A 5FXCH 5GS0H 1AGDA 2UUDK 5DK2B 3WL9A 4CMMB 2Y6SD 5D7IF 4K8RC 2Y6SC 3KPLA 3WNNA 3JWDH 4HUXA 2E8YA 3UTQA 5DD3L 1NFDB 3GRWH 2HTKC 1AJ7H 4OZGE 1KNOB 2GFBB 5DURB 4LRIC 4MJIB 3ZHDA 3DUUA 3QPQD 2XN9E 4OLWL 5C2BL 1LD9A 2OYPA 1IGTB 3TH3T 3QUML 5DHVA 1OQXA 3L9RB 3P4LA 1H15B 3UC0L 2BVEA 5FHBH 5DGQA 2FGWL 3GMOB 4QOKD 3R1GL 1RK1B 2A6DA 2LAGB 4PJIF 4IIQB 3QI9B 2VDRH 3J7HA 5DVLA 2CLRA 5D7SL 1Y6MR 4OLZL 4FMKA 4QLRA 3HZYA 1KJMA 4S10A 1GPOH 1GVIA 2GUOB 4YXLL 4CVUA 3ZKMD 3LKOB 1KV3A 1MPAL 4JY5H 4KKAD 1YYLL 1OQOA 3R0NA 2CR3A 5I1KL 2R4RH 3P9MA 5E6ID 5LGJB 2X4RA 2D31A 4RAVB 5JPMA 1WWBX 5IK3A 4EI6B 5HGBA 5TGBA 3MXWL 1A4JA 2JK5B 5EU7C 4PBXA 4ZAKB 5GS0L 4PGDA 1G6VK 4YR6B 3PGDA 4ZS6D 2ADIA 4I0CC 2PO6C 2BNRB 2Z92A 3WKNA 5EZIH 4R0LB 3DUHA 4FQ2L 2DLFL 4GW4B 2LU3A 1H3PL 3VW3H 1T89C 3OX8A 3WO4B 3VXME 4XP9H 2DQDH 2RCSL 4XX1G 2IANB 4R4ND 3GSOA 1GGUA 1T21B 3SGDH 5DMIL 3CVIL 4KVNH 1RIVL 2V7NA 4ETQB 3QNYA 3JTTB 3VFPA 2JJTA 2A77H 3JWOC 4I77H 3WE6B 3UJTL 1AO7D 5EORH 4WDIB 2J1KA 2VZVA 5F7NC 4EBQL 1INQA 4LSPH 1H0DA 4H25B 1Z9SA 4PRNB 2BNQB 2EDEA 1NCDH 5E2UL 4GRLB 4G6ML 5GZND 3I75A 5EC2B 3KPRE 3UX9B 4GLRH 2P5EA 3RPKA 2HT2D 2ITCA 1WBYB 1QFUH 4OLXH 1WBZA 5EZIL 3U9PL 1UKSA 1OD7A 1W72A 4KTEL 4UI2A 3VXTA 5H94A 3ULVH 5D7IA 4GSDL 1NGXA 2P5WA 5F1IA 5T3XH 5DJZA 3SDAA 3CDGA 4W4OA 5CS7A 2XZAH 2IH1A 4FQHA 3CFBB 3Q5YA 1A7BA 4AQOA 1J9CT 1RULL 1G7PB 2AXHA 35C8L 3QEGH 5GQBA 3STLB 5D1XB 4NRXB 1F45A 3ZKXC 4LCCA 5DT1H 3U30B 4KK6C 3IDNB 5GSVB 4KJQD 4IIQA 1JHKH 3BIKB 2F5AH 3VXSA 3K8KA 2B4CL 1C7SA 1WBXB 3D18B 3O45A 1XH3B 4G8FB 3TBWB 5MP6H 3O41A 1KPUB 4Y5YC 3NZ8B 5IESL 1OAZL 3HB3D 1T6WA 4U7MA 5DHYA 4HJGA 3MRNA 1FNEB 2X70B 4O51B 2BVTA 3S4SG 4YBLC 4JRYD 5L6YH 3ZE2F 4JKPH 4OLXL 4HUKB 1EEZB 1JGDA 4M7ZC 3L6FB 1P5UA 3V0VB 4PV8A 5EBWA 3UZVB 1GZPA 1A7PH 3BP6B 4JE4B 3SE3A 5T3ZE 1BJ1J 4RAHA 4Z7VE 3ULVD 4HW6A 4LCCB 6FABH 4TYUA 1YJDL 4ZSOB 1C5BL 2P5WD 4N0FA 3BIKA 4U6HA 2Y25A 4M43H 5KOMC 2GTWA 4OLYL 1R5WA 3THMH 3UPRB 1JHKL 3MRIA 1SJHA 3O45B 1IT9H 5TE7H 2XTJE 3GMQB 4DVBA 2R0WL 3MZTA 3AAZA 1A9EA 3SJVE 3D69B 2SEBA 4WV1A 3FQRA 3EYVB 2X4UB 4N5UA 3PGFL 4A6YL 3P4NB 5D5ME 4MGXA 1VEMA 4HUVA 1R3KA 2GHWB 3MA7B 4ONFL 4F2MB 3UJIH 5HHVL 1DBKL 2P5EB 5F1NB 3QZWB 2QQLL 4O2FA 1DVFA 4JKPL 3ARFA 1DUYA 3GBLA 1SY6H 3BH8B 4WUUE 1D9KC 2DOCA 2J8HA 2ZUUA 4G5ZL 1ETZB 4PS4L 1KG0B 2VDMH 1UWEH 2KL6A 5K59F 2QHLA 4TQEH 1MEXL 4ETQA 1A4KB 3O11B 4X7SL 5J1AB 1MI5D 4M6MH 5LAXA 5IVXB 1XF5B 4IIQC 5DD1L 1CFQA 1I1FB 4I48A 3MGOB 5E08L 1AY1L 4MMXC 4JDTH 5DQDH 3THML 2WLYA 1CDGA 3VFUB 1KENL 2CO6B 5C6WH 1FLTX 2R0WH 4MNQE 3H3BC 4YDJA 3O41B 2VL5B 3KWWA 4A6YA 3ISWA 3K0WA 3ALXA 3QQ9D 3PGFH 1EMTL 3GMNA 3H0TB 3BKCL 1YUHA 4ZAKA 2DJSA 1PG7H 5GXBB 4PJHF 3NFNA 3DV6A 3CFBA 2QQLH 2HFGH 3WBDA 4IBLT 3RUGF 3QFJB 2Y07L 3MV7D 5GS0C 1A3LH 3O2WL 4KV5F 2OTPA 1EPFA 1YNTB 2DYPB 4Y4HC 1IKNA 4EDWH 4LLUA 2YC1B 1WQVT 5KVEL 1LO5A 4ZOEA 1I9EA 1FZMA 3QO1A 1SM3H 2HMIC 2A6JB 2CDFA 2W38A 5DRXB 3BPNC 4JR9H 3FQUA 3RVUC 1OSPL 4LHUA 1IEBA 1KENH 2D4DA 3BKYL 4L4JA 4BSWB 4DWHA 3PQYD 2WIMA 2JJSC 3RGVA 4XPHH 5KSAD 1QRNA 1RZJH 4H88H 4K7FA 1DQML 5FM8A 5KZCD 5I1DB 4Z0BL 5A3ID 1RIUL 5TDOB 4E41A 2X4SA 4J6RH 5GGTH 3NMEA 3RKDD 3MRNB 5KANG 5B39A 2ZOLB 5ACMA 1WVZA 1T7YA 3FQXA 5CZVH 4GKOA 3U0WH 5ENWA 3G6AA 3VMOA 3TN0B 2FCBA 4WFGE 1LO4H 4F3FB 1NGWA 1MHCB 2YD4A 4QRQA 4NQSA 4GQPH 4G8EB 3NN8A 4PLKD 4XNQB 2FJGB 2NR6C 3ZYZA 3I6LD 1QNZL 3EDKA 1ZWIB 4MJID 4OD3H 3C6SA 1CCZA 1B2WL 5I16A 1MCNA 3S88H 2YRPA 3CVHH 1HHJB 4N1EA 1JGVL 3FCTB 4Y4FD 5J12B 1FV1A 4WWKB 4FQCL 1X7QB 4ODWB 3WL9B 3MBXL 4R7NA 5GHWL 1AXTH 4PJ9B 3QJFA 2BNRE 4M7KL 1UT9A 3IRZA 4NJAL 1DQJA 5D2NE 4ZFGH 5TE4L 4IMKA 4PG2A 4F8TA 4TOYH 2WW8A 5TQ2L 3HHRB 2V2TA 3TN0A 4BKLA 3QP3A 2O5YL 2DM4A 4LP4A 3EYOB 5EOCL 5EB9A 1FO0B 4CJ0A 5DEZA 5SX5K 4KTYA 5E6YA 3MMEA 1IM9B 3GHEH 4FZEL 4Y5XA 4S2SB 3GJFH 3ARGD 4PY7A 3AUVA 5C07E 3BGMB 3M17A 5D70L 1HILA 1RHFA 4YFEA 1I1CA 4H26B 4NQED 4MSWA 2VE6A 1HKLL 3MLSH 2DI8A 4WUKH 4R4BB 4PJBE 4K94C 3PIQB 5D7JB 1MVUA 4ZNCD 3SE9L 3SKMB 5E00A 5CJOH 2X4OB 3G5XB 2C1OA 3VDAA 1NCUA 4N0CC 5TDNB 2Q3AA 4OF0A 3WUWA 3MUHL 1NCNA 5GHWH 1S8DA 3BP4B 1A6AA 3ZSSA 5TF0A 4RGMC 1JGEB 5MEOB 4QHLA 4RIRA 4X80L 3O8XC 4ELMB 5HJ3B 5TQ2H 5F6IB 3RA7H 1HQRB 4AH2B 4YDKH 2APXA 4KUCD 4ORGB 3C2AH 4P2OC 3Q1SL 4P2RB 3OKMA 2PN5A 3O6KH 3ILPA 1FYTA 4J4PD 1YQVL 2B5IC 4HZLA 1IQWL 4G9FA 4Y5YB 5TDPA 2APBA 4WUKL 3QIWA 4LPCA 5GPRA 3STBA 4K2UH 1JI2A 1RVFH 3IS1X 3ZYOA 2WIIB 4C83B 4HH8A 4OUUB 1B4JL 2F74B 4AQ1B 3C5JA 5ALBL 1NFDF 2MKLC 1JNHA 2GK0B 2J8UF 5IB4B 3QUZC 4PBVC 5ISZA 5DJ2A 3H6JA 3D85D 1CL7H 4I9WE 3RVTD 2Y36L 3EDJA 2P8MA 2VDPH 2YR3A 4P99A 4U1HA 1A1OA 3EO9L 2JB6A 2E7MA 1V3KA 1QHOA 2P24B 4NM8H 1KACB 2DWEA 3PGCB 5SWSE 3CAFA 1CFSB 3MOBL 4FQIL 3T77A 4RA3A 4RMUA 5CEZD 4RWYH 4FRWA 4Y5YA 1R5VA 5SX5H 4TNWK 3QULA 3E8UL 3S5LA 3TO2A 1DEDA 2VR5A 3BPLC 3QDMD 3F7QA 1FJ1B 3NFPB 3C8DA 4R7NB 3TBWA 1OTUD 3LRHA 5F7LB 3UTZA 1ZVSB 2QQNL 2JIXD 4TNWF 4P0DA 5T3ZH 5JW4Q 4UILH 4ZXBA 3DETD 1I8LC 1XCQB 1P69B 3MROA 3CLFL 3UBXI 1G6RB 5J6HA 4LKCA 2ED9A 3ZE0E 2HN7A 3RGVD 4WU7B 1FL5A 5DDHB 4LVEA 3FB6B 4R3SB 2VDPL 3CGTA 3S6CA 3OXRA 4GXVL 2R23A 4WV1C 5FM5M 5D6DA 2VXUL 3LKPA 3HAEA 4NRZA 1G9EA 3IJSA 2B2XH 4Z7QF 2DLHA 3VI3E 2CKBL 4PLNC 4KKBD 3O3DB 2I26N 1GAFL 3N9GH 1BIIB 1BVZA 5C09E 2HKFH 4Y4KD 5F1KC 5H2BA 3DHMA 4G3YL 1J5OL 4N0RA 5JPNB 4GMSH 5L8KB 1CLCA 3BH9A 4BH7B 1QBML 4J8RB 1EZVX 1RJYA 4YGAB 1GGBH 1S9WB 1U8JA 3NACH 3S3PA 2O5ZH 1PZUB 3TNNB 3JTSB 4X6BB 2XWJB 2C7UA 1PX4A 5IW6B 4OBRA 1NEZG 1MHEB 2HJLB 3IDYC 4Q9RL 1BBDL 4O58H 5IP4A 1AGEA 5IVOA 2C3HA 1VPOL 5E8NB 4M48H 3W9DB 5F97E 1UM5L 2ADGA 2WANA 4HXBH 3CVHB 1VESA 2DQEL 2VR4A 2SEBB 1H5BC 2Y4SA 3HUJA 2IPTL 5HGDA 1N8ZB 3QZWG 4EI6A 3INUL 2HKHH 5D7JC 2YS4A 5I2IB 2HKFL 1J0JA 1IL1A 2ZPKL 3O0RH 4PBWD 5BO1H 1RUAL 1BD2A 2BVQA 4WI9A 4Y5VB 5J1SC 4X5XB 5FFLA 3G6JA 5EUOF 4JFFE 5F7DB 4GKNB 1ZHLA 1U8IB 4PD4K 1CFNB 1WZMA 4LU5L 4WDIA 3V7AG 3T3ME 3WMSA 3EO1A 5TJWK 2FX8L 2AQ1A 1UKTA 3NCCB 2VSDA 3UAJD 4V2BA 3SDXF 3VFGH 1T7WA 5I75B 4CUCA 3U46B 3E3QE 1OTTD 2CIIA 5SWQB 4I8DA 2ED8A 3VD4A 5IHUH 1MCIA 5E1AB 5D7KE 5BZDB 1JL8A 1TDQA 1PEWA 4JG1H 3NA4A 4WW1B 3KPNB 5CZKA 2ICWA 2P5ED 1U42A 3QUZA 1UM5H 4HXBL 4NKIL 4BM7A 3D39A 3O2DA 4U1MB 5GRZA 2K3TA 5E5UB 4OBSA 1GZQA 5DFTA 1CU4L 1NMBL 2HKHL 3LIZL 3ARED 2G5BB 2W9DL 5E7BA 1Z3GL 1XR9A 5EDXA 4CRPA 3VGHA 1NANI 5I1AB 4F57H 1HHHA 3IS0X 3C87A 1X5IA 5H94B 2DQDL 1I7UB 5FHAL 4WIQA 5DJZB 1JWMA 3KDMB 4PIRF 5GGTA 2X89D 3GMLB 3AS2A 1XGTB 5CJ8A 1YMME 5CFHA 1G0DA 3RKDC 3LEVH 2WQ8A 2ENYA 3SDAB 3LV3B 2BCKB 4QRPD 3BGFB 2ZG2A 1P2CA 4N9OB 4ZUWA 1K6QH 1NBYA 2UVEA 2V9QA 3GB7B 3VWJD 4NNYA 3VWJA 2Q86B 5E24E 1F4HA 2R0KL 3BP7B 4S1DC 3BEVA 3D6GA 5BVPL 1OP3H 1SEBB 5IMMA 3HI1B 4X6DF 4YPJA 4P5KA 4WWKC 1QVOA 4AK1A 4UAOB 4PV9B 5C3TA 3X13B 4KTEH 3LIZH 3QXTA 1XGUA 3BSZL 4KPHL 2R9HD 4N8VA 1TCRB 2APFA 5C6TL 3C9NB 3L3KA 1ES0A 3T2OA 3DX6B 4K9EL 4IRZH 2GUOA 4PJGB 2IMMA 1JK8A 2XTJC 2ESVA 2MHAA 3U0PA 5HI3D 5DEFB 5EUOE 3GIZL 4UINH 5T5FL 4RGOL 3EZJB 1G7HB 3GIVB 3P4MA 1JJUA 4QRTA 2ADIB 3L5XH 2VQ1B 2WINA 1F4AA 2W9EL 3D2UB 5IESH 3L3JA 2VKWA 5GGSY 1LILA 5KVGH 1H8NA 2F53B 4XP4L 3B9EA 5DRNA 2XXMB 4YHMH 3K3QA 1RMFH 1MREH 1BVLA 1D5MB 3P2TA 1WZKA 5F96H 5DGRA 2DQJH 3AREB 3IGAA 4Z76B 1NANH 1HHIB 3C9NA 4I1NB 2NYYD 3MXVH 2XT1B 4ELKB 4ZD3H 1T66D 1A7PL 3CFKA 3QNYB 1EBPA 4G80B 5E2JA 5C6TH 1CLYL 3SJVB 5I71C 1KJ3L 4LEXL 3WE6A 2IAMA 3G5XA 1TETH 5B3JF 2EC9U 4N90D 5C70A 1W0WA 2D0FA 3P0VH 3NIGF 3VH8A 3RWFA 3TH2T 2QR0A 3QUXA 3TA3A 3AVEA 3QO0A 3IJSB 5MEQA 4G8GB 1NCAH 3GSOB 3BKJL 3DMMD 4WUUD 3JXAA 1P4LB 3FO0H 2W0KA 1U8KA 2Q86A 1UB5A 1SMAA 3BHBB 4OJFH 4WGWB 2F58L 1M7IB 3T3PF 3OBAA 1GGYA 4U31A 3T0DA 3TT3H 4W6YB 1DBKH 1HOCB 4XCEB 3FRUB 1XFPA 1QPXA 2ZSVB 1D5IL 5IBUG 4G5ZH 5IFAH 3MACL 3RAJH 1I1AA 1ZT7A 1VFBA 3PWLA 5CMAA 4TQEL 2Q8AL 5E94A 3FO1B 2XNAB 3LEXA 1FFOB 2GCYB 4JRXD 3D39E 2GAZB 4M6OH 3RU8L 5JHDD 5E99H 3LKNA 5DQDL 4UBDD 2NY5C 3QQ3B 5F7YC 1XGRA 3FTGA 3BO8B 3V0VA 3DECA 2QLVB 1EEYB 1HQ4B 4OFKA 1KCVL 1F3RB 5FM4A 3VFVA 3FO0L 2FEEL 4OQ1A 5K9OA 1IFHL 3MLVH 4Z7VB 2A9MH 4KXZH 4JFZH 4K71C 1F42A 1U8NA 4ZXBC 1I3UA 1JHLL 2DIBA 3PP3K 4NCC2 5GISL 3L7EB 2E7HA 4YDIH 3E6FB 4KKNA 4EJ1C 1KIUA 4DQOL 3TFKC 4X4ME 3DX9A 4IHOB 4CN6A 4GBXA 4UQ2B 3WD5H 5A2JH 1IC7H 5JHLL 3O2WH 1JTOA 3NH7L 2B39A 1AGDB 2A9NH 3ARRA 4LGSB 3D39D 3GMPA 2ZCHH 2VUOA 3WSQL 3KS0H 1OAUH 1U8IA 2UZIH 1ZA3B 3V6OA 3VXQA 1L7TH 1FFRA 1KEMH 4HK3N 2J7LA 5KW9L 4L8SA 5T1LB 4GMTH 1MY5A 3MRGA 4U49A 4MXQC 4XTRD 1F2XK 3F7RA 5B3JE 3MLYH 5D1ZD 1O7SA 2R2BB 2JCCF 3OTTA 5C92A 1KB9J 3OR6B 2ATKB 1XGPA 3JWOH 2IEPA 1KCUL 4JFQB 2DL9A 1PG7X 5TH2A 5JOPE 1YEEL 3C2SA 5KSBF 3GJFA 3T0VA 5C2BH 3ZKNC 4TSAH 1VADA 3W9EA 3RWEA 4FP8L 4XB8A 3L3IB 4UIKH 3RWCA 5I8EB 3DBXA 1ROWA 4R4BA 3MRQA 3ZTJH 3WSQH 4ISVB 5EU4B 1TENA 2UY6A 1NC4B 3MQIA 3IDMA 4RAUB 1IM3A 4AT6B 1ZT4A 1A3QA 2E3VA 1E4KC 1TQCB 2E7LC 5A43C 1KTRL 5HDOA 2HH0L 4FXGB 1A47A 2F5BL 1H5BB 2XY1A 4DGYL 5I1JL 1C5CH 4KZDL 3FO2B 2JKXA 3EYOA 1FZOB 1LEIA 3CX5K 1K8DB 1H3TA 4BH8B 1MF2H 4KHXH 2C3WA 4H26A 4RIRB 4E41D 3S88L 1OLLA 5IVXA 4Y5VC 4PY7B 3VXMB 4I0PC 5K9QG 4WFHD 1ZGLA 1NMAL 2FB4H 5K59E 3IDIB 4OD2B 3SO5A 3L3HA 4PLJC 3W9EB 1QKZH 2BVUA 4HFUL 5TE4H 2NX5D 3P40A 3W0WE 3IFOA 4RNRB 4BFIB 1MH5B 3MOAH 5E03A 2C3VB 2DD8L 4RGNB 1N3NA 3BRDA 3ARVA 4PJAF 4KVNL 2W65A 3ARTA 3X3GH 4YH6A 3GHEL 4X99B 3ROLB 1SJVA 3HI5H 1T04A 3QAZC 4QYOA 2CDGB 2JJSA 4R26H 5H37H 3VD9A 1Y0LB 3QXDA 3QUYA 4HS3B 4J3OC 2DIJA 1QSFD 3P11L 5FAAA 5IVZA 3F6LA 2UZYB 1EHLH 3UJJH 1Z5LB 3NPSB 3MBEC 2VRAA 5JA9A 1BGXH 3JV6A 1MF2L 4PUBH 1D3CA 3SE9H 3D1MC 4M1GH 3ZKQD 4Q0XL 5B39B 4ODSL 3FQTA 3RZCA 4U1HB 5I8OH 3JWDL 1V3JA 3HZMA 3U7WL 3NZHH 5HYFA 1GGIL 5C0EB 3BN9C 4WUUA 3MLTB 4GSDH 4HIXL 5D7JD 2ICWI 3QXVA 5IB1A 2Z8VC 5CEZE 3ZE1E 3UPCA 4HH9A 4OM0L 4JHZA 4S1SL