5DG6A

2.35a resolution structure of norovirus 3cl protease in complex an oxadiazole-based, cell permeable macrocyclic (21-mer) inhibitor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
165
Chain Sequence
HAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxadiazole-Based Cell Permeable Macrocyclic Transition State Inhibitors of Norovirus 3CL Protease.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-LIKE PROTEASE
total genus 34
structure length 165
sequence length 174
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dg6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dg6A01
1P2IA 5L2YH 4A92A 3SI4H 4AORA 4BXSA 2PSYA 2SGQE 1RTLA 1JXPA 1GBLA 5E0HA 1RTFB 1SGTA 1CT4E 2BLQA 1IOEA 5DK1A 4DW2U 3BTTE 1A1RA 1PFXC 1SG8B 2J95A 1ZGVA 1HLTH 1P2OA 2ZF0H 3RLYH 5DP9A 1GMDF 1EZXC 3PB1E 3SJ9A 1A0JA 1EJNA 2ZIQH 1F5RA 4X1QU 2ZGXH 3PROA 2GT8A 1WTGH 1WU1A 1J15A 4D9RA 2P8OB 2RDLA 5T6DA 1P8VC 2P95A 4K1EA 1C5LH 1FAKH 4ZHLU 2C8YB 3QN7A 1C1RA 2ANKH 2A5KA 4GVUA 4NIWA 1BCUH 4Y7AA 5DG6A 1V2KT 1S82A 3BEFB 3BIVH 2J94A 1PPBH 1FN8A 4Y0ZE 1DS2E 1EAIA 4TYDA 1C2IA 4CRDA 4GLYA 1N8OB 1Z1IA 6CHAB 2VWMA 1V2QT 3SGBE 3NPSA 4ABIA 3M3TA 1TBQH 2PFEA 1SLVB 5FBIA 3SUGA 5E0JA 1CT2E 5E2OA 2PW8H 3RXHA 1MKXK 3KNXA 1IQNA 2R0LA 1O3FA 4X1NU 4ZKRU 4K3JA 3HKJB 1GI9B 1DM4B 3ZZ7A 5C1UA 4ESTE 1MTVA 2BQ7B 3E3TA 3BG8A 3GY8A 3PWCA 4FXGH 1O2UA 4CBOA 1SPJA 1QRXA 2CXVA 2RA3A 1C1UH 3F9EA 1RFNA 3SNCA 2C8XB 4OS4A 3U69H 1D3PB 2IOTA 3ODDA 1QB9A 1HJAB 4A1TA 4BAHB 2Z7FE 4KELA 1DT2A 1TBZH 4INKA 3QLPH 4B2CA 5C5OA 1V2NT 1C5SA 2ANYA 4UDWH 1PPHE 1G9IE 1TA6A 3LIWA 2AGIX 5A0AE 5C1XA 4I8GA 1QL8A 3I77A 2BQWB 1HAHH 2QF0A 2XXLA 1W0ZU 2YOLA 3NCLA 3KQBA 1FPCH 4BTIB 4KKDA 1L4DA 2ZPQA 1O2QA 1W3CA 3Q3YA 1ELDE 4TPYA 1THSH 2UUFB 3PLBA 2PKAA 1NU7B 4ZKSU 1C5RA 1A5GH 3U9AH 3ZVEA 4KGAA 5EW1H 4JZ1A 3M7UA 2Z9IA 1GL1A 3M7TA 1BBRK 1KSNA 3AW0A 4Y0YE 3RXAA 1V2OT 3PV4A 3SUDA 1HJ8A 2WV4A 3RXUA 1FN6A 2Y82A 1EAWA 1SGYE 3DUXH 5H4IB 3SHCH 1YLCA 1YYY1 1NZQH 3RXFA 2THFB 3QWCH 1H9HE 1NFUA 2A32A 1SBWA 8ESTE 2PSXA 2Y7ZA 4D8NA 2XTTB 3OU0A 1C5NH 2ZDVH 1ZRKA 3ZZDA 2GVFA 2YNAA 1QQ4A 1NRRH 2A31A 1OWIA 3BTEE 4RKOB 1WQSA 3RXIA 1YPHE 2Z9GA 1BDAA 3MNCA 1C1MA 1RJXB 2H5CA 3A8DA 2Y6TA 3AAVA 3RXDA 5GWZA 1TPSA 2I6SA 3Q76A 3E8LA 3C27B 1XUHA 5EQQA 3BIUH 2HGTH 1FZZA 1CGIE 1O34A 4NWLA 3DHKH 3HK6B 2F9UA 1QNJA 4XDEA 2BVRH 4SGBE 1GBFA 3GDUA 1EZUC 2ZQ2A 1T8NA 5PTPA 1ELGA 2C90B 2H9HA 2FOHA 3H7TA 2BX4A 1AD8H 3TH4H 2FIRH 2F9PA 2TGDA 4MLFB 3LH3A 1X7AC 3GY4A 3PYHA 2Z6BD 2W7SA 5FBEA 4U2WA 5LGOA 1EXFA 3DA9B 9LPRA 1RD3B 2A4GA 2PGBB 3HPTB 1O2KA 3QGJA 1UCYE 4R0IA 1ELCA 3VGCB 1UTJA 4JZDH 1K1LA 2JETB 3VGCC 1KYNA 1ZMNA 3EA7A 5C1YA 2FI5E 2P16A 1VCWA 1S0RA 1S6FA 4RN6A 1OS8A 2UWOA 1UCYK 2SNWA 4X2YA 5EU8A 5JBTA 3PLKA 1ETRH 3BTFE 3SUFA 2AMPA 2R2WU 3CS7A 3GCTG 1P09A 2ZDKA 2VIPA 8LPRA 4BAQB 3QZQA 2VJ1A 1CSOE 1P02A 4X6MA 2ZPSA 1AIXH 1N6XA 4MVNA 4CR5A 3Q00A 4X2VA 4GCHF 1GI5A 4BAOB 1DUEA 1EB2A 1V2JT 4IN1A 1DANH 1CT0E 4JZEH 3GCNA 1GJCB 4TY6A 3A89A 3KIDU 2WUCA 1XUFA 5DKMA 3BN9A 3PMJA 1EP6A 5J4QA 4NIYA 6GCHF 1BZXE 2A45B 2WPJS 4K60A 3K9XB 1GI7B 1G3EA 1GHYH 1QA7A 1DX5M 2FYRA 1DXWA 4GHQA 1JIMA 1HAPH 1LHFH 2IPHA 1O2WA 2CHAC 1AMHA 1XKBC 3E90B 5DP3A 3DFJA 4UFGH 5ABWA 5IYTA 1DY9A 3IG6B 1W13U 3NUMA 1SGPE 1A46H 5EODA 2CGAA 2R0KA 2BZ6H 3BTHE 1QJ6B 3ELAH 4H6TA 3OY5U 5GDSH 1G32B 1T8LA 3PMAB 1JRSA 1BTYA 2O8WA 2A2QH 1AFQB 3BEIB 3MMGA 4ABJA 2VIWA 3RXCA 1SI5H 1AE8H 2FMJA 1FXYA 5JB9S 1GBKA 1K1PA 2BOKA 2ZU4A 3MU8A 3P6ZB 3CS0A 3BTME 1C5UA 4FU9A 1BRCE 2FO9A 1F5KU 1MKWH 4AFUA 3SBKA 1PPCE 3D62A 3SU3A 3OYPA 1NROH 4WXIA 2EI8A 3RU4T 1DFPA 2OC8A 4X1PU 4NFEA 1GHBF 3T62A 3A7WA 3TK5A 3ATKA 4UFEH 1MCTA 4MNYA 3S9AA 3RU4E 2JKHA 1PPZA 1ID5H 3R3GB 1TRNA 4TPIZ 1IHTH 1GI2A 2GMTB 2P59A 4ISIH 7LPRA 1MMJN 1P2JA 2BX3A 1H8IH 2A1DB 3RC6A 3GISB 1KY9A 2GCHG 4THNH 2ZHWH 3SNDA 3ZZ4A 4OGYA 1EZQA 2FS9A 1ZHRA 3VB4A 2O8TA 4GSOA 1P3EA 1H9IE 1Z8GA 1HIAB 4FUFA 1YPEH 2QXGA 3LJOA 4JK6A 3SV6A 5AF9H 1BTWA 1D3QB 5EG4A 1K2I1 4FU7A 2BYAX 1T8MA 1P05A 3KCGH 1A5IA 2ZWLH 3FVFB 2PUQH 1O3MA 3KHVA 2ZU2A 3STIA 1ESBA 2R3YA 1TGTA 1DICA 1H9LB 2HRVA 1FAXA 2B5TB 3LU9B 3ZVFA 2FTLE 1ZPZA 1OX1A 2FM2A 2Q1JA 1LTOA 3N7OA 1QGFA 4DCDA 4E7RG 3O8DA 4ZUHA 1F5LA 1J14A 3VB6A 3RMMH 1OP2A 4WH6A 3A87A 3UQVA 1SLXB 3ATLA 1C5XB 4YOIA 1G36A 1O0DH 1O31A 3EYDA 1C9PA 3M3SA 1CQQA 1IQHA 2O8MA 1VCPA 5JB8S 4B2AA 1RS0A 2DUCA 4K1TA 4K2YA 1DDJA 2VGCC 2FOFA 1HUTH 2GDEH 4AX9H 1DVAH 3VFEA 1OOKB 2OP9A 2WV5A 2ZQ1A 3HATH 5DP8A 1SGIB 1S0QA 1CU1A 4H6SB 2GT7A 4H4FA 1BA8B 3JZ2B 5FPTA 4UFDH 4NZQA 4WMDA 3QTOH 2UWLA 1EKBB 2J2UA 1ZZZA 1BIOA 2EI6A 2FI4E 1EPTB 3W94A 5A8ZA 1O3IA 4PROA 1HFDA 1O3LA 4Y8ZA 1G3BA 2QY0B 4JZFH 2EI7A 2TGPZ 2XNIA 1AE5A 1EJAA 2GP9B 4B2BA 3FZZA 4X2XA 5GJ4B 4YT7H 8GCHG 1P0SH 1AUJA 3M5NA 1CGJE 2FX6A 1YGCH 3V7TA 3S69A 4X1RU 1NM6A 3P8GA 4Y71A 1BBRE 4X2WA 1J17T 4AZ2B 1O5AB 2A4QA 2B0FA 2C93B 1FQ3A 1O2XA 1BHXF 3TIUA 2GTBA 1GJ9B 2TPIZ 2G8TA 4YTAA 4Y7BA 1WTHD 3I29A 1GI8B 5C67A 5G4BA 3TJOA 2QV1A 1OWHA 2ZGJA 5LPFA 3SI3H 3LGIA 1GGDC 3K2UA 3RXEA 1UVPA 2G55A 4MNVA 1EAUA 3TH3H 2OC0A 2GD4B 1C2KA 1O5BB 2TBSA 2FWWA 2G5NA 1O3EA 1PQ5A 2ALVA 1LPKB 4ABAA 3QTVH 2FDAA 4IMZA 3RC4A 1YKTA 1EQ9A 1QHRB 4KTCA 5EW2H 4FUJA 2BB4A 1O2JA 2BD2A 4NCYA 1SGFA 2Z3DA 4RSPA 2GDDA 3Q3KA 3BTWE 2FOEA 1NRSH 2D8WA 1HAOH 4I31A 1ZR0A 1SGFG 1AGJA 1MU6B 5FCKA 1QB1A 1TNLA 2BDIA 1HRTH 3STJA 2FESH 4AFQA 2AYWA 5BRRE 1GJ7B 2BMGB 1Z8JB 2PKSB 5DP7A 5E8EH 4NA9H 3L6PA 4YZUA 1FV9A 3W95A 3NXPA 2HNTE 1TA2A 1JOUB 2GZ7A 1Z8RA 1UO6A 3FP6E 5I46H 4AYVB 1IQLA 3MU5A 3AW1A 1SFIA 1ELBA 1TYNA 4NFFA 2FXRA 3SN8A 3MO3A 1HV7A 5E0GA 4JK5A 1WBGB 1B7XB 2F9BH 4AOQA 1TMTH 4B75A 1TGBA 3BSQA 2KAIA 3V3MA 2WPHS 2VINA 3ZVDA 1Y3XA 4K8BA 2OINA 2BM2A 4BTUB 2A7CA 4I7YH 1O3DA 3MNXA 1GDNA 1SGRE 1MQ5A 2NU1E 5EPNA 3UREA 3RU4D 2ZCHP 3F1SB 2F83A 3S7HB 1GI4A 2HWLB 1O2OA 4I8LA 1G37A 2BY9X 2HALA 2TGAA 3MH4A 1O2HA 1BMNH 3DFLA 2WUBA 4JYUH 3SV8A 2TGTA 3A82A 1KXBA 1LDTT 1F92A 3HKIB 5E2PA 3SU6A 2WYJA 1DUAA 1C5ZB 2C3SA 3ATMA 1XUGA 3P70B 4XBDA 2IN2A 3P95A 3O8RA 3HGNA 4SGAE 5JYIA 1UK3A 3RMLH 1DLEA 1FI8A 1SFQB 2PTCE 2ZFTA 4NSVA 1F0RA 4R8TB 3SO3A 2XBVA 3VB7A 1ZOMA 1AZ8A 1THPB 1Z8IB 1ANBA 2W3KA 3O8CA 3U8OH 4ABGA 1LKBA 1JIRA 1ABIH 4BTTB 2AH4X 3A81A 5DPAA 4AFSA 7KMEH 2XBYA 3A8BA 3F9HA 1HB0B 1LCYA 3UNQA 1LVBA 1BTPA 1O3GA 1KTSB 1GMCG 1O2NA 1PPFE 3GYMA 3TGIE 2FEQH 1GL0E 5EGMA 1MTSA 4NA7A 4D7GA 5HYOA 4Q80A 2Q6GA 5TCAA 1T8OA 1KTTB 2CF8H 3GY6A 5FCRA 2ZGHA 1OXGA 1MKWK 3EGKH 2BDGA 1O2RA 3ZZAA 1YCPM 2XWBI 3LGUA 5GXPA 2I6QA 4WXVA 2ZU5A 3D23A 3SQHE 3EA8A 5FX6A 1BUIA 1D6RA 3M5LA 1FJSA 1MZDA 2PWXA 1HAVA 4FUBA 4Q7XA 1TALA 1O5CB 4I33A 2BLVA 2FZZA 5HXFA 4ZHMU 1EOJA 3GY7A 1C2JA 2HNTC 3RXBA 5EXLA 3TH2H 1ZHMA 1UTQA 1GCTC 4K69A 2STBE 5F8XA 1VR1H 1VGCB 3I78A 3KL6A 4J1YA 1C5QA 4UEHH 1Y5BT 1C5TA 5GCHG 4X8UH 1TGSZ 1MTNC 2G00A 3ZZ9A 1FLEE 3T2NA 1ZMLA 3FAOA 3SQEE 5LPRA 1TOMH 2GZ8A 1VJ9U 1K1MA 1O2PA 1E36B 4O03A 5I25A 1V2WT 2GKVE 4OS5A 5CHAB 2GGVB 1EP5A 4CRFA 1YF4A 1EASA 3ZVCA 2UUKB 4MPXA 3A7XA 1O5DH 2ZZUH 1IQKA 4TWYA 4DVAU 4ZH8A 1OKXA 3GY2A 3A84A 1ABJH 2FYQA 2K1QA 4D9QA 1O2MA 2ZCLP 1O36A 4D76A 1SMFE 1J9CH 3A7VA 2XBWA 1O2LA 1GDUA 1TX6A 4AB8A 5L2ZH 1SQTA 1ELFA 1QJ1B 2Y80A 1GI6A 3K65B 1K1JA 1CBWC 1W10U 3V13A 4X8TH 1WOFA 3SNBA 4HI3A 1SC8U 1LVMA 1DITH 5HM2A 3DT0H 1YP9A 2ZEBA 2BD9A 3SU5A 5DO4H 2R3UA 4JZIA 3M5OA 2WPMS 4GCHG 2G4TA 2QXHA 4WWYA 1E34B 1FY1A 1THRH 2ZCKP 3MYWA 1GJ6A 1TGNA 3A7YA 3U1JB 1O5EH 1E35B 2QC2A 1RIWB 4UE7H 5HGGA 2FX4A 1ACBE 1W0YH 1GHBG 1VGCC 4VGCB 1MAYA 5FAHA 2P93A 4X8SH 2AMDA 4MQAA 4FVBA 3TJUA 3SV7A 2FOCA 3RMNH 3T26A 5EQSA 1GJ8B 1BOQA 3BEUA 5F8TA 1Y3WA 4CBNA 2ZFPH 3KEEA 8GCHF 2BY8X 4U01A 1QFKH 1TNKA 1S6HA 1HAZB 1S83A 3GCOA 4CRGA 2FP7B 5T3HA 5C3NA 1B0FA 1MTWA 1GVKB 2Z9JA 1UK4A 2CF9H 2A5AA 1Q3XA 4O9VA 4X8VH 3K6YA 2AIQA 1VCQA 1C5YB 3QO6A 4TY7A 3LT3A 2P3TB 1NU9A 3RXPA 1GVZA 2ZTXA 1TONA 2QXJA 2EC9H 2VIOA 4KTUA 2Y5GA 2V6NA 1Z7KA 1ZYOA 3GCTF 3PLPA 1LHDH 3CENA 4I8KA 3NWUA 4E06H 2Y81A 2WPKS 4YO9A 1EZSC 1T4VH 3LKWA 1GMHF 1VITF 2ZHDA 4DY7B 1UHBA 3TLOA 2Y5HA 1HJ9A 1O39A 3MFJA 2BLWA 1P2MA 3V12A 1ZHPA 1SGCA 1Y3VA 3F9GA 4U32A 3FZDA 2OUAA 4YOJA 2SGFE 1V2UT 1YC0A 1IHSH 3S0NA 4UFFH 3WY8A 3B23B 3TPIZ 3C1KA 1KLJH 2SNVA 2H6MA 4AN7A 1O3KA 1BRUP 1A7SA 2ZDNA 2GV6A 1O2ZA 1UVSH 2C8WB 1LHGH 1O38A 1FONA 1W2KH 2QF3A 3UWJH 1FY4A 1GBIA 5T6FA 3SNEA 1ARBA 4MPWA 2H9EH 1WV7H 1XUKA 3SJ8A 4H42U 1V2LT 1GVLA 2VIQA 2RA0A 7ESTE 3TK6A 2A4RA 1Q2WA 2SGEE 4FUEA 4J2YB 1C5VA 1XUIA 1CE5A 1OWDA 4Z6AH 1INCA 1UVOA 4NZLA 2Z9KA 3ZVAA 1ESTA 2PUXB 9ESTA 4D7FA 2BY7X 1GJ5H 1GG6B 2D26C 2AERH 1UHBB 2ODQA 2F9NA 2J9NA 2VWLA 2Z9LA 4YESB 5FX5A 2ULLA 4Z0KA 1VITH 2XRCA 4IMQA 1CGHA 3K6ZA 4UD9H 1GHZA 2O8UA 5C2ZA 3Q77A 1TE0A 1AB9C 1ZMJA 5A8YA 3RUOA 1F0UA 3TVJB 1SOTA 2CJIA 1NT1A 1BRBE 1OPHB 1FY8E 4I8JA 1ZLRA 3VPKA 3MH5A 4YLQH 1P9UA 3HK3B 2RG3A 1TAWA 1WUNH 1BBRH 2TRMA 1UCYH 3RP2A 1YPGH 1K28D 2SGPE 1AVXA 1QTFA 4NIXA 1AN1E 1W8BH 3VEQB 1O2SA 2ZNKH 1PJPA 2ZU1A 2A2XH 3IITA 1NRPH 1H1BA 3VXFH 3ZYDA 2C4FH 3M36A 1EPTA 3RXMA 1SLWB 3UQOA 3KQEA 4INLA 4DT7B 1DWDH 3ZZ6A 3LOXA 1FNIA 3Q3XA 2EA3A 1O3JA 1GMDG 1V2MT 1KIGH 3SV9A 1XKAC 1C2GA 2G5VA 1CHOG 1Y3YA 1KDQB 1D3DB 2XC0A 3E0PB 1LPGB 1QRZA 4AFZA 1XM1A 2XC5A 2BTCE 4B71A 2XYAA 4WY3A 2DE9A 3RXSA 2J34A 4CH8B 2QIQA 3ZZBA 3PMHB 1TB6H 3H7OA 2FODA 5LPEA 4WF8A 3RXRA 1O3CA 5F6MA 2BD8A 2OBOA 5DP6A 4GAWA 3D49H 3IWMA 1K1IA 1IQMA 1MUEB 4AG2A 1IQGA 3FFGA 4I8HA 3KF2A 4CHAC 1GWAA 3JZ1B 3LONA 4BANB 2JETC 5T6GA 2JH6D 2ZC9H 2FLRH 7GCHG 3SOSA 1ZTKA 1XMNB 2Y5FA 1AWFH 5EXMA 1HAVB 2WYGA 1JWTA 4GPGA 1W11U 4ABDA 3SJOA 1E0FD 1LPZB 4KP0A 3MI4A 3TGJE 5AHGH 3SNAA 3QZRA 2EEKA 1DY8A 1HAGE 3PO1B 2HPPH 3UPEA 1IQJA 1NPMA 2FLBH 2Y7XA 3ODFA 4MPUA 2WPLS 3D65E 2VWOA 3SV2H 1ZPCA 1V2RT 2B9LA 3ZYEA 6CHAC 1A5HA 1EB1H 1RXPA 1GBBA 3BTKE 4IGDA 2ZTZA 4VGCC 2W3IA 3GCHB 4DURA 3RDZA 2ANMH 2ESTE 5EOKA 1TMBH 1TGCA 1ZPBA 3AASA 7GCHF 2TIOA 5GIBA 1RRKA 1WCZA 2GCHF 3UTUH 2A7JA 2A5IA 1GGDB 1TPAE 1UTPA 1QQUA 1XVMA 2OXSA 5DP5A 4ISOA 1GI3A 1K21H 1ANDA 1BHXB 2H9TH 1CA0B 6GCHG 3F9FA 4X6OA 4YT6H 4K8YA 3UOUA 3LJJA 5SGAE 1MTNB 2HNTF 1C5WB 1GBAA 1LO6A 1G2LA 1YCPH 4B74A 3PTNA 1AI8H 1AUTC 1QURH 5GCHF 4ZXXH 4FUHA 1BTHH 1C1OA 1PPGE 4MTBA 4DJZB 1Z71A 2CHAB 1BMLA 1MTUA 4ZHAA 1YPJH 3QGNB 1G2MA 4NWKA 4BNRA 1GHXH 1HJAC 3A80A 2ZDMA 4ISNA 1F7ZA 3T27A 1SHHB 2SFAA 2BVSH 1KXEA 1D3TB 4ABBA 4AGJA 4ABEA 1SL3A 1HNEE 2H5DA 1OP0A 1MBMA 1VITG 2DE8A 2WPIS 1RGQA 1E38B 4WMEA 3NKKA 1TX8A 1TNJA 3S9BA 3GOVB 3ZV8A 1DWCH 4X6NA 3RXJA 1O3OA 1BQYA 2FOMB 5B6OA 2KAIB 3LDXH 1QJ7B 2GCTB 2GMTC 2J92A 1AKSB 3M61U 1ETTH 2PGQB 1O3NA 3MO9A 3OY6U 3SJIA 1NY22 4TWWA 1V2ST 4X6PA 2ODPA 4BXWA 1SQOA 3TK9A 1ESAA 4OGXA 3ZZ5A 1Z6JH 2OD3B 2ANWA 3KQCA 1JBUH 4NSYA 1LHEH 1YPMH 1Y3UA 3A8AA 4XBCA 4O97A 1AVGH 5JPMH 2ZHFH 1P57B 1H4WA 1BRAA 4DIHH 1KXDA 3LGTA 5GPIB 1A3BH 3MO6A 2H2ZA 4X1SU 1CVWH 1YLDA 4WVPE 3MNBA 3A88A 1F2SE 1YPKH 3MOCA 4WMFA 2D1JA 1P06A 1QCPA 1YCPK 1BJUA 1SGEE 2V0BA 1T4UH 3P8FA 4NIVA 1MCVA 2ZGBH 1C1TA 1VZQH 2AIPA 2BDHA 1NFWA 3GICB 1T7CA 3RM2H 2AGGX 1O5GH 3BF6H 1N8OC 1NESE 1TMUH 2UUYA 5CMXH 1GI0A 1GJDB 3UWIA 2BDAA 3OX7U 3S9CA 2VGCB 2XWAA 2Z94A 4B1TA 2ZFQH 1LQEA 4FUDA 1OWJA 3GY5A 1TWXB 3ITIA 1P2QA 4MNXA 1K9OE 3L33A 1SLUB 3P8OA 4M7GA 3TGKE 5C20A 3ZVGA 4Q2KA 1GHVH 1TNIA 5EPYA 3GDSA 1DPOA 4AG1A 1C2LA 1ANCA 3MU4A 3SORA 1S85A 1SQAA 3G01A 1GMHG 2QN5T 1V2PT 4WJG2 1W7XH 1DSTA 2B7DH 1BB0B 3GDVA 1FUJA 1OWEA 1KXAA 2G51A 3RXVA 3SU2A 3QK1A 5JDUB 4Y11E 3F68H 3VB3A 1IQEA 1F0TA 4JCNA 1BMAA 1Z1JA 2ZDAH 1BMMH 2ZFRH 3OTJE 2ZO3H 3NK8A 4Y8YA 3E0NB 3LH1A 4NGAH 1QL7A 2YNBA 1UJ1A 1H8DH 1PYTD 4IN2A 2FPZA 1LVYA 4ZKOU 3BTGE 3EAJA 2BLOA 3PMBB 3QDZB 1P9SA 1L1GA 1MD8A 1W7GH 2BDBA 1V2TT 1PYTC 1GHAF 3LC3A 2QGRA 1HXFH 1B5GH 4BOHA 3A8CA 4FUCA 1ZGIA 2V35A 1A4WH 1TIOA 2BHGA 3PTBA 5BPEA 1GJAB 5L6NH 4ISLA 1A0HB 1SSXA 3SU0A 3KQDA 4UONA 1AQ7A 1L2EA 3BG4C 5AFYH 4DIIH 1O2GH 2LNCA 2IJOB 3O8BA 3RM0H 3PM3A 1O35A 4HGCA 3UFAA 2CV3A 1ETSH 1TOCB 1LQDB 3BTDE 4IW4E 1QBVH 1FMGA 1O5FH 3ZZCA 3MHWU 2VWNA 1AKSA 1UTOA 1GHWH 4IBLH 1CA0C 3HGPA 3M7QA 4Y10E 3KGPA 1IQIA 1G30B 3T28A 1AZZA 1ZJKA 2QAAA 5DP4A 5HMAA 2HOBA 2HVXA 1CO7E 1HIAA 2A7HA 3T29A 3DD2H 2BD4A 3URCA 2G81E 1TRMA 3T5FH 2GCTC 4NG9H 3UOPA 4AGKA 1GBDA 2BY5X 3GY3A 1UTLM 1KLIH 3TJNA 4FU8A 1D4PB 2VVUA 5J4SA 3A7ZA 3P8NA 5F8ZA 1C9TA 1ELVA 1DWBH 2BDCA 1MD7A 1HAXB 2QA9E 4QT8C 3P17H 1HXEH 1NO9H 2VNTA 5DGJA 1UMAH 2D2DA 1P11E 2FOGA 3E16B 1QL9A 1QR3E 1C4V2 1SGDE 3TNTA 4OS2A 1ELEE 1HDTH 1B0EA 4CREA 1TPOA 4CRAA 1D6WA 2P8OC 2W5EA 2ZG0H 1ZTLA 3GCHC 1DSUA 1JMOH 2XCFA 3EE0B 3UR9A 1UTMA 3FANA 4KTSA 5JBBS 3PWBA 4ZKNU 2ZGCA 1ORFA 1O3HA 2UWPA 2AEIH 1J8AA 1QRWA 5EQRA 3UNRA 4LZ1H 1XVOA 5EXNA 2R9PA 3ENSB 4X0WU 1MH0A 3U8RH 3LPRA 5L30H 4ZMAH 3P92A 1S5SA 1M9UA 1GJ4H 4XBBA 4A1XA 4I32A 1ELTA 1KDQA 1C1SA 4DGJA 1V3XA 5FPSA 3ZVBA 3FP8E 1NS3A 3VXEH 1C1WH 3ZZ3A 1Y59T 1CHOF 2PKSC 2ALPA 2UUJB 1AFEH 1TX7A 4ISHH 4GHTA 1O30A 1P03A 2PV9B 2JH0D 1EPTC 1UTNA 3NZIA 2H1UA 3ATWA 2OC7A 1D9IA 2BVXH 3U1IB 3ZV9A 1A0LA 1C5MD 4LK4A 1P12E 1P2KA 2ZFSA 3SGAE 2W7UA 2FI3E 3LGVA 5ESTE 1EATA 2P3UB 1DOJA 1AHTH 1TBRH 2W26A 4FVDA 2M5TA 4XSKU 4Q7ZA 1ELAA 1SHYA 4CRCA 1XUJA 3UR6A 1WQVH 4A1VA 4DOQA 4MG3A 2VH0A 3RXQA 2ZHEH 1AB9B 1HCGA 2XCNA 3MH7A 3VB5A 4NA8A 4ZROA 3MH6A 3UUZA 1KLTA 3R0FA 2ZI2H 1GBTA 4WH8A 1YPHC 2A0QB 1C2HA 1P04A 2QYIA 1T31A 5FXLA 1NFXA 1OWKA 1TPPA 3MU1A 1GBMA 2PHBA 1NTPA 1AU8A 3E6PH 4LZ4B 1V6DA 4HTCH 1Y8TA 1UK2A 1SVPA 3OSYA 3AAUA 1TNGA 1O3BA 1BT7A 2BXUH 1ZRBA 2AS9A 2VIDA 3A85A 3UY9A 5JBAS 6ESTA 2G4UA 4JYVH 1HAYB 2PTNA 2V3OH 1ZSKA 3A83A 3SHAH 3SJKA 2HLCA 3SZNA 4CR9A 1GBEA 2FTMA 2LPRA 5DJ7A 2VVVA 1XX9A 3TNSA 1U6QA 4B73A 1MU8B 1RTKA 5FHTA 4Y76A 1G3DA 4LXBH 1QA0A 4RKJB 3V0XA 3GYLB 4IS5A 4JMYA 2R2MB 1WAYB 2AFQB 1MQ6A 1FIWA 2ZTYA 1YBWA 4OS1A 5LH8A 2NU0E 2OBQA 4FUIA 1S81A 2GX4A 3EA9A 2ZHQH 1O33A 2G52A 1T32A 3MWIU 1C2EA 3BV9B 2Q6FA 2SGAA 1SB1H 3A7TA 2RCEA 1C2MA 5CE1A 2OCVB 3AVZA 4F4OC 4LOYH 4O3UA 1G3CA 1L1NA 3RLWH 5K7RA 1J16A 2V3HH 4F49A 4ZAEA 1DE7H 1HPGA 3U8TH 2ZKSA 1CA8B 4BAKB 1EUFA 3SUEA 1QY6A 2NU3E 4HFPB 1O3PB 2PR3A 1HAIH 2AGEX 2XBXA 4JYTA 1LHCH 3U98H 1WYKA 4GUXA 3F6UH 3KN2A 1O32A 3B9FH 3E91A 2O9QA 4A7IB 1SGQE 3TITA 1KXCA 2BZAA 1L4ZA 4IC5A 3M35A 4K5ZA 4YOGA 3MTYA 4CH2B 5AVDA 1O37A 1P10A 3RXGA 1F0SA 4AB9A 1P3CA 2F91A 1GMCF 2FOAA 2GV7A 1HBTH 2FS8A 3E1XB 1GBHA 1QIXB 1ZTJA 2BY6X 4E05H 2CN0H 2J38A 1C4U2 5HM9A 2A4OA 2C8ZB 2ODYB 3PO1C 3ZZ8A 2P3FH 1RIWC 3RXLA 3URDA 4Y79A 3M5MA 2JH5D 1NRQH 2BDYA 3M3VA 3BTQE 2XC4A 2Z3EA 3M37A 2O8LA 4O3TA 3H5CB 1Y5UT 2WINI 1EJMA 1W12U 4BAMB 1LMWB 1K1NA 1PQ8A 2OC1A 3LGWA 4K1SA 1TNHA 5TCCA 1EX3A 1XXFA 2F9VA 3MNSA 4Y6DA 5F03A 1ARCA 1P01A 1K22H 4MDSA 1WSSH 1S84A 1C5PA 5A2MH 2PKAB 1GBCA 2BD5A 2F3CE 1GCDA 2ZPRA 1AY6H 1QBOA 4IC6A 1AVWA 3RMOH 2BD3A 3MU0A 5A09A 4XE4A 5IDKA 1TQ7B 3A86A 1UTKA 3LC5A 4ASHA 1NRNH 3SGQE 1C1NA 5A8XA 5AFZH 1C2FA 2OQ5A 3RXKA 1MBQA 4AYYB 2F9OA 1GBJA 1MKXH 1BJVA 1OP8A 3QX5H 2J4IA 1ZJDA 4MPVA 3EQ0H 1AWHB 1CHGA 1EOLA 1GDQA 1OYQA 1Q31A 5TJXA 1A61H 3FP7E 1OYTH 3T25A 1O2TA 1ZSJA 1UVUH 2GZ9A 2ZFFH 3ESTA 1HGTH 2OTVA 1FY3A 1Y5AT 3RC5A 5A0BA 1O2YA 2B8OH 1NC6A 2VIVA 1A3EH 2AMQA 2HPQH 5A0CA 8KME2 1FDPA 1W14U 1NN6A 1O3AA 2VB0A 4A6LA 1TABE 4FUGA 4Y8XA 1V2VT 1DWEH 1AO5A 3SU1A 1PQAA 1C1PA 1NFYA 2Q6DA 4XFQA 3S7KB 1Z6EA 3SU4A 3TJVA 3RXOA 1DLKB 3RXTA 5C5NA 2ASUB 1KXFA 6LPRA 1PPEE 1A2CH 1K1OA 1C2DA 4CHAB 1SOZA 2BOHB 1HYLA 3TU7H 1GPZA 1ZSLA 1GCTB 2ZA5A 4MNWA 2ILNA 5CHAC 1ANEA 1BTZA 1BTXA 1UVTH 4INHA 2NWNA 4B76A 2CMYA 2NU2E 1GG6C 4ABFA 4ZXYH 1SGNE 3L3TA 1SR5C 3UNSA 1YPLH 1GJBB 3LGYA 1LKAA 2VVCA 2Z3CA 1OSSA 2P94A 1XXDA 2BXTH 1TQ0B 1YM0A 1BTUA 5ESBA 4YM9A 5FPYA 4ABHA 2QXIA 4YLUA 4DG4A 5K0HA 4OS6A 1FIZA 2VH6A 1FY5A 2BD7A 3BG4B 2OQUA 1L0ZA 2PLXA 1JRTA 1P2NA 2SGDE 2XW9A 1C4Y2 1AFQC 4HZHA 1GHAG 1QBNA 2ZECA 3B8JA 4U30A 1IAUA 1N6YA 1TLDA 2VU8E 2QCYA 3ATIA 1GI1A 4A5TS 2BQ6B 2OLGA 3UIRA 5ETXA 1VJAU 2STAE 1LVOA 4Q7YA 1DXPA 1E37B 1O2IA 4E7NA 1TFXA 1O2VA 1C1VH 2ZDLA 3EDXB 1FPHH 1IQFA 4OS7A 1CBWB 1TRYA 5JBCS 1PQ7A 2NU4E 1EAXA 1C1QA 1MZAA 1BITA 2ZU3A 2ZP0H 3QUMP 1N1LA 3CP7A 1QB6A 4XOJA 2FOBA 1MAXA 1C5OH 1L1JA 3SW2B 4CRBA
chains in the Genus database with same CATH superfamily
1P2IA 5L2YH 4A92A 3SI4H 4AORA 4BXSA 2PSYA 2SGQE 1RTLA 1JXPA 1GBLA 5E0HA 1RTFB 3AK5A 1SGTA 1CT4E 2BLQA 1IOEA 5DK1A 4DW2U 3BTTE 1A1RA 1PFXC 1SG8B 2J95A 1ZGVA 1HLTH 1P2OA 2ZF0H 3RLYH 5DP9A 1GMDF 1EZXC 3PB1E 3SJ9A 1A0JA 2KR7A 1EJNA 2ZIQH 1F5RA 4X1QU 2ZGXH 3PROA 2GT8A 1WTGH 1WU1A 1J15A 4D9RA 2P8OB 2RDLA 5T6DA 1P8VC 2P95A 4K1EA 1C5LH 1FAKH 4ZHLU 1K0HA 2C8YB 3QN7A 1C1RA 3ZIAD 2ANKH 2A5KA 4GVUA 4NIWA 1BCUH 4Y7AA 5DG6A 1V2KT 1KMHB 1S82A 3BEFB 3BIVH 2J94A 3EE7A 1PPBH 1FN8A 4Y0ZE 1DS2E 1EAIA 4TYDA 1C2IA 4CRDA 4GLYA 1N8OB 1S6LA 1Z1IA 6CHAB 3DSOA 2VWMA 1V2QT 3SGBE 3NPSA 4ABIA 3M3TA 2LP6A 1TBQH 2PFEA 1SLVB 5FBIA 3SUGA 5E0JA 1CT2E 5E2OA 2PW8H 3RXHA 1MKXK 3KNXA 1IQNA 2R0LA 1O3FA 4X1NU 4ZKRU 4K3JA 3HKJB 1GI9B 1DM4B 3ZZ7A 5C1UA 4ESTE 1MTVA 2BQ7B 3E3TA 3BG8A 3GY8A 3PWCA 4FXGH 4RT1A 1O2UA 4CBOA 1SPJA 1QRXA 2CXVA 2RA3A 1C1UH 3F9EA 1RFNA 3SNCA 3WWBA 2C8XB 4OS4A 3U69H 1D3PB 2IOTA 3ODDA 1QB9A 1HJAB 4A1TA 4BAHB 2Z7FE 4KELA 1DT2A 1TBZH 4INKA 3QLPH 5EJLA 4B2CA 5C5OA 1V2NT 2KCPA 3MQKC 1C5SA 2ANYA 4UDWH 1PPHE 1G9IE 1TA6A 3LIWA 2AGIX 5A0AE 5HKKD 5C1XA 4I8GA 1QL8A 3I77A 2BQWB 1HAHH 2QF0A 2XXLA 1W0ZU 2YOLA 3NCLA 3KQBA 1FPCH 4BTIB 4KKDA 1L4DA 2ZPQA 4ASUD 1O2QA 1W3CA 3Q3YA 1ELDE 4TPYA 1THSH 2UUFB 3PLBA 2PKAA 1NU7B 4ZKSU 1C5RA 1A5GH 3U9AH 3ZVEA 4KGAA 5EW1H 4JZ1A 3M7UA 2Z9IA 1GL1A 3M7TA 1BBRK 1KSNA 3AW0A 4Y0YE 3RXAA 1V2OT 3PV4A 3SUDA 1HJ8A 2WV4A 3RXUA 1FN6A 2Y82A 1EAWA 1SGYE 3DUXH 5H4IB 3SHCH 1YLCA 1YYY1 1NZQH 3RXFA 2THFB 3QWCH 1H9HE 1NFUA 2A32A 2J97A 1SBWA 8ESTE 2PSXA 2Y7ZA 4D8NA 2XTTB 3OU0A 1C5NH 2ZDVH 1ZRKA 3ZZDA 2GVFA 2YNAA 1QQ4A 1NRRH 2A31A 1OWIA 3BTEE 4RKOB 1WQSA 3RXIA 1YPHE 2Z9GA 1BDAA 3MNCA 1C1MA 1RJXB 2H5CA 3A8DA 2Y6TA 3AAVA 3RXDA 5GWZA 1TPSA 2I6SA 3Q76A 3E8LA 3C27B 1XUHA 5EQQA 3BIUH 2HGTH 1FZZA 1CGIE 1O34A 4NWLA 3DHKH 3HK6B 2F9UA 1QNJA 4XDEA 2CK3D 2BVRH 4SGBE 1GBFA 3GDUA 5EJ1A 1EZUC 2ZQ2A 1T8NA 5PTPA 5KECA 1ELGA 2C90B 2H9HA 2LELA 2FOHA 3H7TA 2BX4A 1AD8H 3TH4H 2FIRH 2F9PA 2TGDA 4MLFB 3LH3A 1X7AC 3GY4A 3PYHA 2Z6BD 2W7SA 5FBEA 4U2WA 5LGOA 2J98B 1EXFA 3DA9B 9LPRA 3OTPA 1RD3B 2A4GA 2PGBB 3HPTB 1O2KA 3QGJA 4F48B 1UCYE 4R0IA 1ELCA 3VGCB 1UTJA 4JZDH 1K1LA 2JETB 3VGCC 3OEED 1KYNA 1ZMNA 3EA7A 5C1YA 2FI5E 2P16A 1VCWA 1S0RA 1S6FA 4RN6A 1OS8A 2UWOA 1UCYK 2SNWA 4X2YA 5EU8A 5JBTA 3PLKA 1ETRH 3BTFE 3SUFA 2AMPA 2R2WU 3CS7A 3GCTG 1P09A 2ZDKA 2VIPA 8LPRA 4BAQB 3QZQA 2VJ1A 1CSOE 1P02A 4X6MA 2ZPSA 4YXWD 1AIXH 1N6XA 4MVNA 4CR5A 3Q00A 4X2VA 4GCHF 1GI5A 4BAOB 1DUEA 1EB2A 1V2JT 5KEDA 4IN1A 1DANH 1CT0E 4JZEH 3GCNA 1GJCB 4TY6A 3A89A 3KIDU 2WUCA 1XUFA 5DKMA 3BN9A 3PMJA 1EP6A 5J4QA 4NIYA 6GCHF 1BZXE 2A45B 2WPJS 4K60A 3K9XB 1GI7B 1G3EA 1GHYH 1QA7A 1DX5M 2FYRA 1DXWA 4GHQA 1JIMA 1HAPH 1LHFH 4XRNA 2IPHA 1O2WA 2CHAC 1AMHA 4Q63A 1XKBC 2QF5A 3F2HA 3E90B 5DP3A 3DFJA 4UFGH 5ABWA 5IYTA 1DY9A 3IG6B 1W13U 3NUMA 1SGPE 1A46H 5EODA 2CGAA 2R0KA 2BZ6H 3BTHE 1QJ6B 2W6JD 3FOAA 3ELAH 4H6TA 3OY5U 5GDSH 1G32B 1T8LA 3PMAB 1JRSA 1BTYA 2O8WA 2A2QH 1AFQB 3BEIB 3MMGA 4ABJA 2VIWA 3RXCA 1SI5H 3OE7D 1AE8H 2FMJA 1FXYA 5JB9S 1GBKA 1K1PA 2BOKA 2ZU4A 3MU8A 3P6ZB 3CS0A 3BTME 1C5UA 3OEHD 1BRCE 2FO9A 1F5KU 1MKWH 4FU9A 4AFUA 3SBKA 1PPCE 3D62A 3SU3A 3OYPA 1NROH 4WXIA 2EI8A 3N7DA 3RU4T 1DFPA 2OC8A 2IPQX 4NFEA 4I86A 4X1PU 1GHBF 3T62A 3A7WA 3TK5A 3ATKA 4UFEH 1MCTA 4MNYA 3S9AA 3RU4E 2JKHA 4Z1MD 1PPZA 1ID5H 3R3GB 1TRNA 4TPIZ 1IHTH 1GI2A 2GMTB 2P59A 4ISIH 7LPRA 1MMJN 1P2JA 2BX3A 1H8IH 2A1DB 3RC6A 3GISB 1KY9A 3WW7A 2GCHG 4THNH 2ZHWH 3SNDA 3ZZ4A 4OGYA 1EZQA 2FS9A 1ZHRA 3VB4A 2O8TA 4GSOA 2PP6A 1P3EA 1H9IE 1Z8GA 1HIAB 4FUFA 1YPEH 2QXGA 3LJOA 4JK6A 3SV6A 5AF9H 1BTWA 1D3QB 5EG4A 1K2I1 4FU7A 2BYAX 1T8MA 1COWD 1P05A 1EFRD 3KCGH 2J98A 1A5IA 2ZWLH 3FVFB 2PUQH 1O3MA 3KHVA 2ZU2A 3STIA 1ESBA 2R3YA 1TGTA 1DICA 1H9LB 2HRVA 1FAXA 2B5TB 3LU9B 3ZVFA 2FTLE 1ZPZA 3PV2A 1OX1A 2FM2A 2Q1JA 1LTOA 3N7OA 1QGFA 4DCDA 4E7RG 3O8DA 4ZUHA 1F5LA 1J14A 3VB6A 3RMMH 1OP2A 4WH6A 3A87A 3UQVA 1SLXB 3ATLA 1C5XB 5CHBA 4YOIA 1G36A 1O0DH 1O31A 3EYDA 1C9PA 3M3SA 1CQQA 1IQHA 2O8MA 1VCPA 5JB8S 4B2AA 5DSFA 1RS0A 2DUCA 4K1TA 1SKYE 1DDJA 2VGCC 4K2YA 2FOFA 1HUTH 2GDEH 4AX9H 1DVAH 3VFEA 1OOKB 2OP9A 2WV5A 2ZQ1A 3HATH 5DP8A 4F55A 1SGIB 1S0QA 1QZ8A 1CU1A 4H6SB 2GT7A 4H4FA 1BA8B 3JZ2B 5FPTA 4UFDH 4NZQA 4WMDA 3QTOH 2UWLA 1EKBB 2J2UA 1ZZZA 2JDID 2GJGA 1BIOA 2EI6A 2XNDD 2FI4E 1EPTB 3W94A 5A8ZA 1O3IA 4PROA 1HFDA 1O3LA 4Y8ZA 1G3BA 2QY0B 4JZFH 2EI7A 2TGPZ 2XNIA 1AE5A 1EJAA 2GP9B 4B2BA 3FZZA 4X2XA 5GJ4B 4YT7H 8GCHG 1P0SH 1AUJA 3M5NA 1CGJE 2FX6A 1YGCH 3V7TA 3S69A 4X1RU 1NM6A 3P8GA 4Y71A 1BBRE 4X2WA 1J17T 4AZ2B 1O5AB 2A4QA 2B0FA 2C93B 1FQ3A 1O2XA 1BHXF 4HG6A 3TIUA 2GTBA 1GJ9B 2TPIZ 2G8TA 4YTAA 4Y7BA 1WTHD 3I29A 4FETA 1GI8B 5C67A 5G4BA 3TJOA 2QV1A 1OWHA 2ZGJA 5LPFA 3SI3H 3LGIA 1GGDC 3K2UA 3RXEA 1UVPA 2G55A 4MNVA 1EAUA 3TH3H 2OC0A 2GD4B 1C2KA 1O5BB 2TBSA 2FWWA 2G5NA 1O3EA 1PQ5A 2ALVA 1LPKB 4ABAA 3QTVH 2FDAA 4IMZA 3RC4A 1YKTA 1EQ9A 1QHRB 4KTCA 5EW2H 4FUJA 2BB4A 1O2JA 2BD2A 2EY4C 1SGFA 2Z3DA 4NCYA 4RSPA 2GDDA 3Q3KA 3BTWE 2FOEA 1NRSH 2D8WA 1HAOH 4I31A 1ZR0A 1SGFG 1AGJA 1MU6B 5FCKA 1QB1A 1TNLA 2BDIA 1HRTH 3STJA 2FESH 4AFQA 2AYWA 5BRRE 1GJ7B 2BMGB 1Z8JB 2PKSB 5DP7A 5E8EH 4NA9H 3L6PA 4YZUA 1FV9A 3W95A 3NXPA 2HNTE 1TA2A 1JOUB 2GZ7A 3OAAD 1Z8RA 1UO6A 3FP6E 5I46H 4AYVB 1IQLA 3MU5A 3AW1A 1SFIA 1ELBA 1TYNA 4NFFA 2FXRA 3SN8A 3MO3A 1HV7A 5E0GA 3DCLA 5KGOA 4JK5A 1WBGB 1B7XB 2F9BH 4AOQA 1TMTH 4B75A 1TGBA 4P02A 3BSQA 2KAIA 3V3MA 2WPHS 2VINA 3ZVDA 1Y3XA 4K8BA 2OINA 2BM2A 4BTUB 2A7CA 4I7YH 3UB0A 1O3DA 3MNXA 1GDNA 1SGRE 1MQ5A 2NU1E 5EPNA 3UREA 3RU4D 2ZCHP 3F1SB 2F83A 3S7HB 1GI4A 2HWLB 1UW7A 1O2OA 4I8LA 1G37A 2BY9X 2HALA 2TGAA 3MH4A 1O2HA 1BMNH 3DFLA 2WUBA 4JYUH 3SV8A 2TGTA 3A82A 1KXBA 2WHXA 1LDTT 1F92A 3HKIB 5E2PA 3SU6A 2WYJA 1DUAA 1C5ZB 2C3SA 3ATMA 1XUGA 3P70B 4XBDA 2IN2A 3P95A 3O8RA 3HGNA 4SGAE 5JYIA 1UK3A 3RMLH 1DLEA 1FI8A 1SFQB 2PTCE 2ZFTA 1W0KD 4NSVA 1F0RA 4R8TB 3SO3A 2XBVA 3VB7A 1ZOMA 2EQNA 1AZ8A 1THPB 1Z8IB 1ANBA 2W3KA 3O8CA 3U8OH 4ABGA 2VBCA 1LKBA 1JIRA 1ABIH 4BTTB 2AH4X 3A81A 3PV5A 5DPAA 4AFSA 2XBYA 7KMEH 1E1QD 3A8BA 3F9HA 1HB0B 1LCYA 3UNQA 2RFKC 1LVBA 3DSGA 1BTPA 1O3GA 1KTSB 5HIZA 1GMCG 1O2NA 1PPFE 3GYMA 3TGIE 2FEQH 1GL0E 5EGMA 1MTSA 4NA7A 4D7GA 5HYOA 4Q80A 2Q6GA 5TCAA 1T8OA 1KTTB 2CF8H 3GY6A 5FCRA 2ZGHA 1OXGA 1MKWK 3EGKH 2BDGA 1O2RA 3ZZAA 1YCPM 2XWBI 3LGUA 2HVYB 5GXPA 2I6QA 4WXVA 2ZU5A 3D23A 3SQHE 3EA8A 5FX6A 1BUIA 1D6RA 3M5LA 1FJSA 1MZDA 2PWXA 1HAVA 4FUBA 4Q7XA 1TALA 1O5CB 4I33A 2BLVA 2FZZA 5HXFA 4ZHMU 1EOJA 3GY7A 1C2JA 2HNTC 3RXBA 2F43B 5EXLA 3TH2H 1ZHMA 1UTQA 1GCTC 4K69A 2STBE 5F8XA 1VR1H 1VGCB 3I78A 3KL6A 4J1YA 2YMSD 1C5QA 4UEHH 1Y5BT 1C5TA 5GCHG 4X8UH 1TGSZ 1MTNC 2G00A 3ZZ9A 1FLEE 3T2NA 1ZMLA 3FAOA 3SQEE 2WPDD 3F2GA 5LPRA 1TOMH 2GZ8A 1VJ9U 1K1MA 1O2PA 1E36B 1MABB 4O03A 5I25A 1V2WT 2GKVE 4OS5A 5CHAB 2GGVB 1EP5A 4CRFA 1YF4A 1EASA 3ZVCA 2UUKB 4MPXA 3A7XA 1O5DH 2ZZUH 1IQKA 4TWYA 4DVAU 4ZH8A 1OKXA 3GY2A 3A84A 1ABJH 2FYQA 2K1QA 4D9QA 1O2MA 2ZCLP 1O36A 4D76A 1SMFE 1J9CH 3A7VA 2XBWA 1O2LA 1GDUA 1TX6A 4AB8A 5L2ZH 1SQTA 1ELFA 1QJ1B 4DT4A 2Y80A 1GI6A 3K65B 1K1JA 1CBWC 1W10U 3V13A 4X8TH 1WOFA 3SNBA 4HI3A 1WXRA 1SC8U 1LVMA 1DITH 5HM2A 3DT0H 1YP9A 2ZEBA 2BD9A 3SU5A 5DO4H 2R3UA 2J5UA 4JZIA 3M5OA 2WPMS 4GCHG 3WWFA 2G4TA 2QXHA 4WWYA 1E34B 1FY1A 1THRH 4ACBA 2ZCKP 3MYWA 1GJ6A 1TGNA 3A7YA 3U1JB 1O5EH 1E35B 2QC2A 1RIWB 2KCAA 4UE7H 5HGGA 2FX4A 1ACBE 1W0YH 2L6OA 1GHBG 1VGCC 4VGCB 1MAYA 5FAHA 2P93A 4X8SH 2AMDA 4MQAA 4FVBA 3TJUA 3SV7A 2FOCA 3RMNH 3T26A 5EQSA 1GJ8B 1BOQA 3BEUA 5F8TA 1Y3WA 4CBNA 2ZFPH 3KEEA 8GCHF 2BY8X 4U01A 1QFKH 1TNKA 1S6HA 1HAZB 1S83A 3GCOA 4CRGA 2FP7B 5T3HA 5C3NA 1B0FA 4P00A 1MTWA 1GVKB 2Z9JA 1UK4A 2CF9H 2A5AA 1Q3XA 4O9VA 4X8VH 3K6YA 2AIQA 1VCQA 1C5YB 3QO6A 4TY7A 3LT3A 2P3TB 1NU9A 3RXPA 1GVZA 2ZTXA 1TONA 2JJ2D 2QXJA 2EC9H 2VIOA 4KTUA 2Y5GA 2V6NA 1FX0B 1Z7KA 1ZYOA 3GCTF 3PLPA 1LHDH 3CENA 4I8KA 3NWUA 2V3MA 4E06H 2Y81A 2WPKS 4YO9A 1EZSC 1T4VH 3LKWA 1GMHF 3F2FA 1VITF 2WV9A 2ZHDA 4DY7B 1UHBA 3TLOA 2Y5HA 1HJ9A 1O39A 3MFJA 2BLWA 1P2MA 3V12A 1ZHPA 1SGCA 1Y3VA 3F9GA 4Q4LA 4U32A 3FZDA 2OUAA 4YOJA 2SGFE 1V2UT 1YC0A 1IHSH 3S0NA 2YMSB 4UFFH 3WY8A 3B23B 3TPIZ 3C1KA 1KLJH 2SNVA 2H6MA 4AN7A 1O3KA 1BRUP 1A7SA 2ZDNA 2GV6A 1O2ZA 1UVSH 2C8WB 4XD7D 1LHGH 1O38A 1FONA 1W2KH 2QF3A 3UWJH 1FY4A 3H09A 1GBIA 5T6FA 3SNEA 3U28C 3FKSD 1ARBA 4MPWA 2H9EH 1OHHD 1WV7H 1XUKA 3SJ8A 4H42U 1V2LT 1GVLA 2VIQA 2RA0A 7ESTE 3TK6A 2A4RA 1Q2WA 2SGEE 4FUEA 4J2YB 1C5VA 3FN8A 1XUIA 1CE5A 1OWDA 4Z6AH 1INCA 1UVOA 4NZLA 2Z9KA 3ZVAA 1ESTA 2PUXB 9ESTA 4D7FA 2BY7X 1GJ5H 1GG6B 2D26C 2AERH 1UHBB 2ODQA 2F9NA 2J9NA 2VWLA 2Z9LA 4YESB 5FX5A 2ULLA 4Z0KA 1VITH 2XRCA 4IMQA 1CGHA 3K6ZA 4UD9H 1GHZA 2O8UA 5C2ZA 3Q77A 1TE0A 2IJD1 1AB9C 1ZMJA 5A8YA 3RUOA 1F0UA 3TVJB 1SOTA 2CJIA 1NT1A 4OM9A 1BRBE 1OPHB 1FY8E 4I8JA 1ZLRA 3VPKA 3MH5A 5GNDA 4YLQH 1P9UA 4B6EA 3HK3B 2RG3A 1TAWA 5HIYA 5B6LA 1WUNH 3KQ5A 1BBRH 4AC9A 2TRMA 1UCYH 3RP2A 1YPGH 1K28D 2SGPE 1AVXA 1QTFA 4NIXA 1AN1E 1W8BH 3VEQB 1O2SA 2ZNKH 1PJPA 2ZU1A 2A2XH 3IITA 1NRPH 1H1BA 3VXFH 3ZYDA 2C4FH 3M36A 1EPTA 3RXMA 1SLWB 3UQOA 3KQEA 4INLA 4DT7B 1DWDH 3ZZ6A 3LOXA 1FNIA 3Q3XA 2EA3A 1O3JA 1GMDG 1V2MT 1KIGH 3SV9A 1XKAC 1C2GA 2G5VA 1CHOG 1Y3YA 1KDQB 1D3DB 2XC0A 3E0PB 1LPGB 1QRZA 4AFZA 1XM1A 2XC5A 2BTCE 4B71A 1YY3A 2XYAA 4WY3A 2DE9A 3RXSA 2J34A 4CH8B 2QIQA 3ZZBA 5FL7D 3PMHB 1TB6H 3H7OA 2FODA 5LPEA 5EIYA 4WF8A 3RXRA 1O3CA 5F6MA 2BD8A 2OBOA 5DP6A 4GAWA 3D49H 3IWMA 1K1IA 1IQMA 1MUEB 4AG2A 1IQGA 3FFGA 4I8HA 3KF2A 4CHAC 1GWAA 1W0JD 3JZ1B 3LONA 4BANB 2JETC 5T6GA 2JH6D 2ZC9H 2OK5A 2FLRH 7GCHG 3SOSA 1ZTKA 1XMNB 2Y5FA 1AWFH 5EXMA 1HAVB 2RDEA 2WYGA 1JWTA 4GPGA 1W11U 4ABDA 3SJOA 1E0FD 1LPZB 4KP0A 3MI4A 3TGJE 5AHGH 3SNAA 3QZRA 3KYFA 2EEKA 1DY8A 1HAGE 3PO1B 2HPPH 3UPEA 1IQJA 1NPMA 2FLBH 2Y7XA 3ODFA 4MPUA 2WPLS 3D65E 2VWOA 3SV2H 1ZPCA 1V2RT 2B9LA 3ZYEA 6CHAC 1A5HA 1EB1H 1RXPA 1GBBA 3BTKE 4IGDA 2ZTZA 4VGCC 2W3IA 3GCHB 4DURA 3RDZA 2ANMH 2ESTE 5EOKA 1TMBH 1TGCA 1ZPBA 3AASA 7GCHF 2TIOA 5GIBA 1RRKA 1WCZA 2GCHF 3UTUH 2A7JA 2A5IA 1GGDB 1TPAE 1UTPA 1QQUA 1XVMA 2OXSA 2KFWA 5DP5A 4ISOA 1GI3A 1K21H 1ANDA 1BHXB 2H9TH 1CA0B 6GCHG 3F9FA 4X6OA 4YT6H 4K8YA 3UOUA 3LJJA 5SGAE 1MTNB 2HNTF 1C5WB 1GBAA 1LO6A 1G2LA 1YCPH 4B74A 3PTNA 1AI8H 1AUTC 1QURH 5GCHF 4ZXXH 4FUHA 1BTHH 1C1OA 1PPGE 4MTBA 4DJZB 1Z71A 2CHAB 1BMLA 1MTUA 4ZHAA 1YPJH 3QGNB 3VG8A 1G2MA 3PRDA 4NWKA 1GHXH 1HJAC 3A80A 2ZDMA 4BNRA 5C0UA 2M2AA 4ISNA 1H8ED 1F7ZA 4M9FA 3T27A 1SHHB 2SFAA 2BVSH 1KXEA 1D3TB 4ABBA 4AGJA 4ABEA 1SL3A 1HNEE 2H5DA 1H8HD 1OP0A 1MBMA 1VITG 2DE8A 2WPIS 1RGQA 1E38B 4WMEA 3NKKA 1TX8A 1TNJA 3S9BA 3GOVB 3ZV8A 1DWCH 4X6NA 3RXJA 3N7EA 1O3OA 1BQYA 2FOMB 5B6OA 2KAIB 3LDXH 1QJ7B 2GCTB 2GMTC 2J92A 1AKSB 3M61U 1ETTH 2PGQB 1O3NA 3MO9A 3OY6U 3SJIA 1NY22 4TWWA 1V2ST 4X6PA 2ODPA 4BXWA 1SQOA 3TK9A 1ESAA 4OGXA 3ZZ5A 1Z6JH 1WDIA 2OD3B 2ANWA 3KQCA 1JBUH 4NSYA 1LHEH 1YPMH 1Y3UA 3A8AA 4XBCA 4O97A 1AVGH 5JPMH 2QF4A 2ZHFH 1P57B 1H4WA 1BRAA 4DIHH 1KXDA 3LGTA 5GPIB 1A3BH 3MO6A 2H2ZA 4X1SU 1CVWH 1YLDA 4WVPE 3MNBA 3A88A 1F2SE 1YPKH 3MOCA 4WMFA 2D1JA 1P06A 1QCPA 2L74A 1YCPK 1BJUA 1SGEE 2V0BA 1T4UH 3P8FA 4NIVA 1MCVA 2ZGBH 1C1TA 1VZQH 2AIPA 2HLDD 2BDHA 1NFWA 3GICB 1T7CA 3RM2H 2AGGX 1O5GH 3BF6H 1N8OC 1NESE 1TMUH 2UUYA 5CMXH 1GI0A 1GJDB 3UWIA 2BDAA 3OX7U 3S9CA 1E79D 2VGCB 2XWAA 2Z94A 4B1TA 2ZFQH 1LQEA 4FUDA 1OWJA 3GY5A 1TWXB 3ITIA 1P2QA 4MNXA 1K9OE 3L33A 1SLUB 3P8OA 4M7GA 3TGKE 5C20A 3ZVGA 4Q2KA 1GHVH 1TNIA 5EPYA 1YWUA 3GDSA 1DPOA 4AG1A 1C2LA 1ANCA 3MU4A 3SORA 1S85A 1SQAA 3G01A 1GMHG 2QN5T 1V2PT 4WJG2 1W7XH 1DSTA 2B7DH 1BB0B 3GDVA 1FUJA 1OWEA 1KXAA 2G51A 3RXVA 3SU2A 3QK1A 5JDUB 2KCOA 4Y11E 3F68H 3VB3A 1IQEA 1F0TA 4JCNA 1BMAA 1Z1JA 2ZDAH 1BMMH 2ZFRH 3OTJE 3SYJA 2ZO3H 3NK8A 4Y8YA 3E0NB 3LH1A 4NGAH 1QL7A 2YNBA 1UJ1A 1H8DH 1PYTD 4IN2A 4RT0A 2FPZA 1LVYA 4ZKOU 3BTGE 3EAJA 2BLOA 3PMBB 3QDZB 1P9SA 1L1GA 1MD8A 1W7GH 2BDBA 1V2TT 1PYTC 1GHAF 3LC3A 3SZEA 2KM0A 2QGRA 1HXFH 1B5GH 4BOHA 3A8CA 4FUCA 1ZGIA 3F3BA 2V35A 1A4WH 1TIOA 2BHGA 3PTBA 5BPEA 1GJAB 5L6NH 4ISLA 1A0HB 1SSXA 3SU0A 3KQDA 4UONA 1AQ7A 1L2EA 3BG4C 5AFYH 4DIIH 1O2GH 2LNCA 2IJOB 3O8BA 3RM0H 3PM3A 1O35A 4HGCA 3UFAA 2CV3A 1ETSH 1TOCB 1LQDB 3BTDE 4IW4E 1NBME 1QBVH 1FMGA 1O5FH 3ZZCA 3MHWU 2VWNA 1AKSA 1UTOA 1GHWH 4IBLH 1CA0C 3HGPA 3M7QA 4Y10E 3KGPA 1IQIA 1G30B 3T28A 1AZZA 1ZJKA 2QAAA 5DP4A 5HMAA 2HOBA 2HVXA 1CO7E 1HIAA 2A7HA 3T29A 3DD2H 5C94A 2BD4A 3URCA 2G81E 1TRMA 3T5FH 2GCTC 4NG9H 3UOPA 4AGKA 1GBDA 2BY5X 3GY3A 1UTLM 1VKYA 1KLIH 3TJNA 4FU8A 1D4PB 2VVUA 5J4SA 3A7ZA 3P8NA 5F8ZA 1C9TA 1ELVA 1DWBH 2BDCA 4TSFD 1MD7A 1HAXB 2QA9E 4QT8C 3P17H 1HXEH 1NO9H 2VNTA 5DGJA 1UMAH 2D2DA 1P11E 2FOGA 3E16B 1QL9A 1QR3E 1C4V2 1SGDE 3TNTA 4OS2A 1ELEE 1HDTH 1B0EA 4CREA 1TPOA 4CRAA 1D6WA 3F0OA 2P8OC 2W5EA 2ZG0H 4TT3D 1ZTLA 3GCHC 1DSUA 1JMOH 2XCFA 3EE0B 3UR9A 1UTMA 3FANA 4KTSA 5JBBS 3PWBA 4ZKNU 2ZGCA 1ORFA 1O3HA 2UWPA 2AEIH 1J8AA 1QRWA 5EQRA 3UNRA 4LZ1H 1XVOA 5EXNA 2R9PA 3W1EA 3ENSB 4X0WU 1MH0A 3U8RH 3LPRA 5L30H 3PRBA 4ZMAH 3P92A 1S5SA 1M9UA 1GJ4H 4XBBA 4A1XA 1NBMD 4I32A 1ELTA 1KDQA 1C1SA 4DGJA 1V3XA 5FPSA 3ZVBA 3FP8E 1NS3A 3VXEH 1C1WH 3ZZ3A 1Y59T 1CHOF 2PKSC 2ALPA 2UUJB 3CNRA 1AFEH 1TX7A 4ISHH 4GHTA 2F4LA 1O30A 1P03A 2PV9B 2JH0D 2K0QA 1EPTC 1UTNA 3NZIA 2H1UA 3ATWA 2OC7A 1D9IA 2BVXH 3U1IB 3ZV9A 1A0LA 1C5MD 4LK4A 1P12E 3FO8D 1P2KA 4ACAA 2XOKD 2ZFSA 3SGAE 2W7UA 2FI3E 3LGVA 5ESTE 1EATA 2P3UB 1DOJA 1AHTH 1TBRH 2W26A 4FVDA 2M5TA 4XSKU 4Q7ZA 1ELAA 1SHYA 4CRCA 1XUJA 3UR6A 1WQVH 2JJ1D 4A1VA 4DOQA 4MG3A 2VH0A 3RXQA 2ZHEH 1AB9B 1HCGA 2XCNA 3MH7A 5CDFE 3VB5A 4NA8A 4ZROA 3MH6A 3UUZA 1KLTA 3R0FA 2ZI2H 2KX4A 1GBTA 4WH8A 1YPHC 2A0QB 1C2HA 1SQRA 1P04A 2JIZD 2QYIA 1T31A 5FXLA 1NFXA 1OWKA 5IK2D 3GS9A 1TPPA 4B6FA 3MU1A 1GBMA 2K8IA 2PHBA 1NTPA 1AU8A 5EJZA 3E6PH 4LZ4B 1V6DA 4HTCH 1Y8TA 1UK2A 1SVPA 3OSYA 3AAUA 1TNGA 1O3BA 1BT7A 2BXUH 1ZRBA 2AS9A 2VIDA 3A85A 3UY9A 5JBAS 6ESTA 2G4UA 4JYVH 1HAYB 2PTNA 2V3OH 1ZSKA 3A83A 3SHAH 3SJKA 2HLCA 3SZNA 4CR9A 2KCYA 1GBEA 2FTMA 2LPRA 5DJ7A 2VVVA 1XX9A 2AHME 3TNSA 1U6QA 3N99A 1MU8B 4B73A 1RTKA 5FHTA 3OFND 1G3DA 4LXBH 2WSSD 1QA0A 4RKJB 4Y76A 3V0XA 3GYLB 4IS5A 4JMYA 2R2MB 1WAYB 2AFQB 1MQ6A 1FIWA 2ZTYA 1YBWA 4OS1A 5LH8A 2NU0E 2OBQA 4FUIA 1S81A 2GX4A 3EA9A 5F53A 2ZHQH 1O33A 2G52A 1T32A 3MWIU 1C2EA 3BV9B 2Q6FA 2SGAA 1SB1H 3A7TA 2RCEA 1C2MA 5CE1A 2OCVB 3AVZA 4F4OC 4FOUC 4LOYH 4O3UA 1G3CA 1L1NA 3RLWH 5K7RA 1J16A 2V3HH 4F49A 4ZAEA 2W6ID 1DE7H 1HPGA 3U8TH 2ZKSA 1CA8B 4BAKB 1EUFA 3SUEA 1QY6A 2NU3E 4HFPB 1O3PB 2PR3A 1HAIH 2AGEX 2XBXA 4JYTA 2QE7D 1LHCH 3U98H 1E1RD 1WYKA 4GUXA 3F6UH 3KN2A 1O32A 3B9FH 3E91A 2O9QA 4A7IB 1SGQE 3TITA 1KXCA 2BZAA 1L4ZA 4IC5A 3UAIC 3M35A 4K5ZA 4YOGA 3MTYA 4CH2B 5AVDA 1O37A 1P10A 3RXGA 1F0SA 4AB9A 1P3CA 2F91A 1GMCF 2FOAA 2GV7A 3DSPA 1HBTH 3F0PA 2FS8A 3E1XB 1GBHA 1QIXB 1ZTJA 2BY6X 4E05H 2CN0H 2J38A 1C4U2 5HM9A 2A4OA 2C8ZB 2ODYB 3PO1C 3ZZ8A 2P3FH 1RIWC 3RXLA 3URDA 4ZCNA 4Y79A 3M5MA 2JH5D 1NRQH 2BDYA 3M3VA 3BTQE 2XC4A 2Z3EA 3M37A 2O8LA 1YLNA 4O3TA 3H5CB 1Y5UT 2WINI 1EJMA 1W12U 4BAMB 1LMWB 1K1NA 1PQ8A 2OC1A 3LGWA 4K1SA 1TNHA 5TCCA 1EX3A 1XXFA 2F9VA 3MNSA 4Y6DA 5F03A 1ARCA 1P01A 1K22H 4MDSA 5T1VA 1WSSH 1S84A 1C5PA 5A2MH 2PKAB 1GBCA 2BD5A 2F3CE 1GCDA 2ZPRA 1AY6H 1QBOA 4IC6A 1AVWA 3RMOH 2BD3A 3MU0A 5A09A 4XE4A 5IDKA 1TQ7B 3A86A 1UTKA 3LC5A 4ASHA 1NRNH 2YMSC 3SGQE 1C1NA 5A8XA 5AFZH 4RI0A 1C2FA 2OQ5A 3NRLA 3RXKA 1MBQA 4AYYB 2F9OA 1GBJA 1MKXH 1BJVA 1OP8A 3QX5H 2J4IA 1ZJDA 4MPVA 3EQ0H 1AWHB 1CHGA 1EOLA 1GDQA 1OYQA 1Q31A 5C0TA 5TJXA 1A61H 3FP7E 1OYTH 3T25A 2WZQA 1O2TA 1ZSJA 1UVUH 2GZ9A 2ZFFH 3ESTA 1HGTH 2OTVA 1FY3A 1Y5AT 3RC5A 5A0BA 1O2YA 2B8OH 1NC6A 2VIVA 1A3EH 2AMQA 2HPQH 5A0CA 8KME2 1FDPA 1W14U 1NN6A 1O3AA 2VB0A 4A6LA 1TABE 4FUGA 4Y8XA 1V2VT 1DWEH 1AO5A 3SU1A 1PQAA 1C1PA 1NFYA 2Q6DA 4XFQA 3S7KB 1Z6EA 3SU4A 3TJVA 3RXOA 1DLKB 3RXTA 5C5NA 2ASUB 2KZ4A 1KXFA 6LPRA 1PPEE 1A2CH 1K1OA 1C2DA 4CHAB 1SOZA 5DN6D 2BOHB 1HYLA 3TU7H 1GPZA 1ZSLA 1GCTB 2ZA5A 4MNWA 2ILNA 5CHAC 1ANEA 1BTZA 1BTXA 1UVTH 4INHA 2NWNA 4B76A 2CMYA 2V7QD 2NU2E 1GG6C 4ABFA 4ZXYH 1SGNE 3L3TA 1SR5C 3UNSA 1YPLH 1GJBB 3LGYA 1LKAA 2VVCA 2Z3CA 1OSSA 2P94A 1XXDA 2BXTH 1TQ0B 1YM0A 1BTUA 5C17A 5ESBA 4YM9A 5FPYA 4ABHA 2QXIA 4YLUA 4DG4A 5K0HA 4OS6A 1FIZA 2VH6A 1FY5A 2BD7A 3BG4B 2OQUA 1L0ZA 2PLXA 1JRTA 1P2NA 2SGDE 2XW9A 1C4Y2 1AFQC 4HZHA 1GHAG 1QBNA 2ZECA 3B8JA 4U30A 1IAUA 1N6YA 1TLDA 2VU8E 2QCYA 3ATIA 1GI1A 4A5TS 2BQ6B 2OLGA 3UIRA 5ETXA 1BMFD 1VJAU 2STAE 1LVOA 4Q7YA 1DXPA 1E37B 1O2IA 4E7NA 1TFXA 1O2VA 1C1VH 2ZDLA 3EDXB 1FPHH 1IQFA 4OS7A 1CBWB 1TRYA 5JBCS 1PQ7A 2NU4E 1EAXA 1C1QA 1MZAA 1BITA 2ZU3A 2ZP0H 3QUMP 1N1LA 3KYGA 3CP7A 1QB6A 4XOJA 2FOBA 1MAXA 1C5OH 1L1JA 3SW2B 4CRBA
chains in the Genus database with same CATH topology
1P2IA 5L2YH 4A92A 3SI4H 4AORA 4BXSA 2PSYA 2SGQE 1RTLA 1JXPA 1GBLA 5E0HA 1RTFB 1SGTA 1CT4E 2BLQA 1IOEA 5DK1A 4DW2U 3BTTE 1A1RA 1PFXC 1SG8B 2J95A 1ZGVA 1HLTH 1P2OA 2ZF0H 3RLYH 5DP9A 1GMDF 1EZXC 3PB1E 3SJ9A 1A0JA 1EJNA 2ZIQH 1F5RA 4X1QU 2ZGXH 3PROA 2GT8A 1WTGH 1WU1A 1J15A 4D9RA 2P8OB 2RDLA 5T6DA 1P8VC 2P95A 4K1EA 1C5LH 1FAKH 4ZHLU 2C8YB 3QN7A 1C1RA 2ANKH 2A5KA 4GVUA 4NIWA 1BCUH 4Y7AA 5DG6A 1V2KT 1S82A 3BEFB 3BIVH 2J94A 1PPBH 1FN8A 4Y0ZE 1DS2E 1EAIA 4TYDA 1C2IA 4CRDA 4GLYA 1N8OB 1Z1IA 6CHAB 2VWMA 1V2QT 3SGBE 3NPSA 4ABIA 3M3TA 1TBQH 2PFEA 1SLVB 5FBIA 3SUGA 5E0JA 1CT2E 5E2OA 2PW8H 3RXHA 1MKXK 3KNXA 1IQNA 2R0LA 1O3FA 4X1NU 4ZKRU 4K3JA 3HKJB 1GI9B 1DM4B 3ZZ7A 5C1UA 4ESTE 1MTVA 2BQ7B 3E3TA 3BG8A 3GY8A 3PWCA 4FXGH 1O2UA 4CBOA 1SPJA 1QRXA 2CXVA 2RA3A 1C1UH 3F9EA 1RFNA 3SNCA 2C8XB 4OS4A 3U69H 1D3PB 2IOTA 3ODDA 1QB9A 1HJAB 4A1TA 4BAHB 2Z7FE 4KELA 1DT2A 1TBZH 4INKA 3QLPH 4B2CA 5C5OA 1V2NT 1C5SA 2ANYA 4UDWH 1PPHE 1G9IE 1TA6A 3LIWA 2AGIX 5A0AE 5C1XA 4I8GA 1QL8A 3I77A 2BQWB 1HAHH 2QF0A 2XXLA 1W0ZU 2YOLA 3NCLA 3KQBA 1FPCH 4BTIB 4KKDA 1L4DA 2ZPQA 1O2QA 1W3CA 3Q3YA 1ELDE 4TPYA 1THSH 2UUFB 3PLBA 2PKAA 1NU7B 4ZKSU 1C5RA 1A5GH 3U9AH 3ZVEA 4KGAA 5EW1H 4JZ1A 3M7UA 2Z9IA 1GL1A 3M7TA 1BBRK 1KSNA 3AW0A 4Y0YE 3RXAA 1V2OT 3PV4A 3SUDA 1HJ8A 2WV4A 3RXUA 1FN6A 2Y82A 1EAWA 1SGYE 3DUXH 5H4IB 3SHCH 1YLCA 1YYY1 1NZQH 3RXFA 2THFB 3QWCH 1H9HE 1NFUA 2A32A 1SBWA 8ESTE 2PSXA 2Y7ZA 4D8NA 2XTTB 3OU0A 1C5NH 2ZDVH 1ZRKA 3ZZDA 2GVFA 2YNAA 1QQ4A 1NRRH 2A31A 1OWIA 3BTEE 4RKOB 1WQSA 3RXIA 1YPHE 2Z9GA 1BDAA 3MNCA 1C1MA 1RJXB 2H5CA 3A8DA 2Y6TA 3AAVA 3RXDA 5GWZA 1TPSA 2I6SA 3Q76A 3E8LA 3C27B 1XUHA 5EQQA 3BIUH 2HGTH 1FZZA 1CGIE 1O34A 4NWLA 3DHKH 3HK6B 2F9UA 1QNJA 4XDEA 2BVRH 4SGBE 1GBFA 3GDUA 1EZUC 2ZQ2A 1T8NA 5PTPA 1ELGA 2C90B 2H9HA 2FOHA 3H7TA 2BX4A 1AD8H 3TH4H 2FIRH 2F9PA 2TGDA 4MLFB 3LH3A 1X7AC 3GY4A 3PYHA 2Z6BD 2W7SA 5FBEA 4U2WA 5LGOA 1EXFA 3DA9B 9LPRA 1RD3B 2A4GA 2PGBB 3HPTB 1O2KA 3QGJA 1UCYE 4R0IA 1ELCA 3VGCB 1UTJA 4JZDH 1K1LA 2JETB 3VGCC 1KYNA 1ZMNA 3EA7A 5C1YA 2FI5E 2P16A 1VCWA 1S0RA 1S6FA 4RN6A 1OS8A 2UWOA 1UCYK 2SNWA 4X2YA 5EU8A 5JBTA 3PLKA 1ETRH 3BTFE 3SUFA 2AMPA 2R2WU 3CS7A 3GCTG 1P09A 2ZDKA 2VIPA 8LPRA 4BAQB 3QZQA 2VJ1A 1CSOE 1P02A 4X6MA 2ZPSA 1AIXH 1N6XA 4MVNA 4CR5A 3Q00A 4X2VA 4GCHF 1GI5A 4BAOB 1DUEA 1EB2A 1V2JT 4IN1A 1DANH 1CT0E 4JZEH 3GCNA 1GJCB 4TY6A 3A89A 3KIDU 2WUCA 1XUFA 5DKMA 3BN9A 3PMJA 1EP6A 5J4QA 4NIYA 6GCHF 1BZXE 2A45B 2WPJS 4K60A 3K9XB 1GI7B 1G3EA 1GHYH 1QA7A 1DX5M 2FYRA 1DXWA 4GHQA 1JIMA 1HAPH 1LHFH 2IPHA 1O2WA 2CHAC 1AMHA 1XKBC 3E90B 5DP3A 3DFJA 4UFGH 5ABWA 5IYTA 1DY9A 3IG6B 1W13U 3NUMA 1SGPE 1A46H 5EODA 2CGAA 2R0KA 2BZ6H 3BTHE 1QJ6B 3ELAH 4H6TA 3OY5U 5GDSH 1G32B 1T8LA 3PMAB 1JRSA 1BTYA 2O8WA 2A2QH 1AFQB 3BEIB 3MMGA 4ABJA 2VIWA 3RXCA 1SI5H 1AE8H 2FMJA 1FXYA 5JB9S 1GBKA 1K1PA 2BOKA 2ZU4A 3MU8A 3P6ZB 3CS0A 3BTME 1C5UA 4FU9A 1BRCE 2FO9A 1F5KU 1MKWH 4AFUA 3SBKA 1PPCE 3D62A 3SU3A 3OYPA 1NROH 4WXIA 2EI8A 3RU4T 1DFPA 2OC8A 4X1PU 4NFEA 1GHBF 3T62A 3A7WA 3TK5A 3ATKA 4UFEH 1MCTA 4MNYA 3S9AA 3RU4E 2JKHA 1PPZA 1ID5H 3R3GB 1TRNA 4TPIZ 1IHTH 1GI2A 2GMTB 2P59A 4ISIH 7LPRA 1MMJN 1P2JA 2BX3A 1H8IH 2A1DB 3RC6A 3GISB 1KY9A 2GCHG 4THNH 2ZHWH 3SNDA 3ZZ4A 4OGYA 1EZQA 2FS9A 1ZHRA 3VB4A 2O8TA 4GSOA 1P3EA 1H9IE 1Z8GA 1HIAB 4FUFA 1YPEH 2QXGA 3LJOA 4JK6A 3SV6A 5AF9H 1BTWA 1D3QB 5EG4A 1K2I1 4FU7A 2BYAX 1T8MA 1P05A 3KCGH 1A5IA 2ZWLH 3FVFB 2PUQH 1O3MA 3KHVA 2ZU2A 3STIA 1ESBA 2R3YA 1TGTA 1DICA 1H9LB 2HRVA 1FAXA 2B5TB 3LU9B 3ZVFA 2FTLE 1ZPZA 1OX1A 2FM2A 2Q1JA 1LTOA 3N7OA 1QGFA 4DCDA 4E7RG 3O8DA 4ZUHA 1F5LA 1J14A 3VB6A 3RMMH 1OP2A 4WH6A 3A87A 3UQVA 1SLXB 3ATLA 1C5XB 4YOIA 1G36A 1O0DH 1O31A 3EYDA 1C9PA 3M3SA 1CQQA 1IQHA 2O8MA 1VCPA 5JB8S 4B2AA 1RS0A 2DUCA 4K1TA 4K2YA 1DDJA 2VGCC 2FOFA 1HUTH 2GDEH 4AX9H 1DVAH 3VFEA 1OOKB 2OP9A 2WV5A 2ZQ1A 3HATH 5DP8A 1SGIB 1S0QA 1CU1A 4H6SB 2GT7A 4H4FA 1BA8B 3JZ2B 5FPTA 4UFDH 4NZQA 4WMDA 3QTOH 2UWLA 1EKBB 2J2UA 1ZZZA 1BIOA 2EI6A 2FI4E 1EPTB 3W94A 5A8ZA 1O3IA 4PROA 1HFDA 1O3LA 4Y8ZA 1G3BA 2QY0B 4JZFH 2EI7A 2TGPZ 2XNIA 1AE5A 1EJAA 2GP9B 4B2BA 3FZZA 4X2XA 5GJ4B 4YT7H 8GCHG 1P0SH 1AUJA 3M5NA 1CGJE 2FX6A 1YGCH 3V7TA 3S69A 4X1RU 1NM6A 3P8GA 4Y71A 1BBRE 4X2WA 1J17T 4AZ2B 1O5AB 2A4QA 2B0FA 2C93B 1FQ3A 1O2XA 1BHXF 3TIUA 2GTBA 1GJ9B 2TPIZ 2G8TA 4YTAA 4Y7BA 1WTHD 3I29A 1GI8B 5C67A 5G4BA 3TJOA 2QV1A 1OWHA 2ZGJA 5LPFA 3SI3H 3LGIA 1GGDC 3K2UA 3RXEA 1UVPA 2G55A 4MNVA 1EAUA 3TH3H 2OC0A 2GD4B 1C2KA 1O5BB 2TBSA 2FWWA 2G5NA 1O3EA 1PQ5A 2ALVA 1LPKB 4ABAA 3QTVH 2FDAA 4IMZA 3RC4A 1YKTA 1EQ9A 1QHRB 4KTCA 5EW2H 4FUJA 2BB4A 1O2JA 2BD2A 4NCYA 1SGFA 2Z3DA 4RSPA 2GDDA 3Q3KA 3BTWE 2FOEA 1NRSH 2D8WA 1HAOH 4I31A 1ZR0A 1SGFG 1AGJA 1MU6B 5FCKA 1QB1A 1TNLA 2BDIA 1HRTH 3STJA 2FESH 4AFQA 2AYWA 5BRRE 1GJ7B 2BMGB 1Z8JB 2PKSB 5DP7A 5E8EH 4NA9H 3L6PA 4YZUA 1FV9A 3W95A 3NXPA 2HNTE 1TA2A 1JOUB 2GZ7A 1Z8RA 1UO6A 3FP6E 5I46H 4AYVB 1IQLA 3MU5A 3AW1A 1SFIA 1ELBA 1TYNA 4NFFA 2FXRA 3SN8A 3MO3A 1HV7A 5E0GA 4JK5A 1WBGB 1B7XB 2F9BH 4AOQA 1TMTH 4B75A 1TGBA 3BSQA 2KAIA 3V3MA 2WPHS 2VINA 3ZVDA 1Y3XA 4K8BA 2OINA 2BM2A 4BTUB 2A7CA 4I7YH 1O3DA 3MNXA 1GDNA 1SGRE 1MQ5A 2NU1E 5EPNA 3UREA 3RU4D 2ZCHP 3F1SB 2F83A 3S7HB 1GI4A 2HWLB 1O2OA 4I8LA 1G37A 2BY9X 2HALA 2TGAA 3MH4A 1O2HA 1BMNH 3DFLA 2WUBA 4JYUH 3SV8A 2TGTA 3A82A 1KXBA 1LDTT 1F92A 3HKIB 5E2PA 3SU6A 2WYJA 1DUAA 1C5ZB 2C3SA 3ATMA 1XUGA 3P70B 4XBDA 2IN2A 3P95A 3O8RA 3HGNA 4SGAE 5JYIA 1UK3A 3RMLH 1DLEA 1FI8A 1SFQB 2PTCE 2ZFTA 4NSVA 1F0RA 4R8TB 3SO3A 2XBVA 3VB7A 1ZOMA 1AZ8A 1THPB 1Z8IB 1ANBA 2W3KA 3O8CA 3U8OH 4ABGA 1LKBA 1JIRA 1ABIH 4BTTB 2AH4X 3A81A 5DPAA 4AFSA 7KMEH 2XBYA 3A8BA 3F9HA 1HB0B 1LCYA 3UNQA 1LVBA 1BTPA 1O3GA 1KTSB 1GMCG 1O2NA 1PPFE 3GYMA 3TGIE 2FEQH 1GL0E 5EGMA 1MTSA 4NA7A 4D7GA 5HYOA 4Q80A 2Q6GA 5TCAA 1T8OA 1KTTB 2CF8H 3GY6A 5FCRA 2ZGHA 1OXGA 1MKWK 3EGKH 2BDGA 1O2RA 3ZZAA 1YCPM 2XWBI 3LGUA 5GXPA 2I6QA 4WXVA 2ZU5A 3D23A 3SQHE 3EA8A 5FX6A 1BUIA 1D6RA 3M5LA 1FJSA 1MZDA 2PWXA 1HAVA 4FUBA 4Q7XA 1TALA 1O5CB 4I33A 2BLVA 2FZZA 5HXFA 4ZHMU 1EOJA 3GY7A 1C2JA 2HNTC 3RXBA 5EXLA 3TH2H 1ZHMA 1UTQA 1GCTC 4K69A 2STBE 5F8XA 1VR1H 1VGCB 3I78A 3KL6A 4J1YA 1C5QA 4UEHH 1Y5BT 1C5TA 5GCHG 4X8UH 1TGSZ 1MTNC 2G00A 3ZZ9A 1FLEE 3T2NA 1ZMLA 3FAOA 3SQEE 5LPRA 1TOMH 2GZ8A 1VJ9U 1K1MA 1O2PA 1E36B 4O03A 5I25A 1V2WT 2GKVE 4OS5A 5CHAB 2GGVB 1EP5A 4CRFA 1YF4A 1EASA 3ZVCA 2UUKB 4MPXA 3A7XA 1O5DH 2ZZUH 1IQKA 4TWYA 4DVAU 4ZH8A 1OKXA 3GY2A 3A84A 1ABJH 2FYQA 2K1QA 4D9QA 1O2MA 2ZCLP 1O36A 4D76A 1SMFE 1J9CH 3A7VA 2XBWA 1O2LA 1GDUA 1TX6A 4AB8A 5L2ZH 1SQTA 1ELFA 1QJ1B 2Y80A 1GI6A 3K65B 1K1JA 1CBWC 1W10U 3V13A 4X8TH 1WOFA 3SNBA 4HI3A 1SC8U 1LVMA 1DITH 5HM2A 3DT0H 1YP9A 2ZEBA 2BD9A 3SU5A 5DO4H 2R3UA 4JZIA 3M5OA 2WPMS 4GCHG 2G4TA 2QXHA 4WWYA 1E34B 1FY1A 1THRH 2ZCKP 3MYWA 1GJ6A 1TGNA 3A7YA 3U1JB 1O5EH 1E35B 2QC2A 1RIWB 4UE7H 5HGGA 2FX4A 1ACBE 1W0YH 1GHBG 1VGCC 4VGCB 1MAYA 5FAHA 2P93A 4X8SH 2AMDA 4MQAA 4FVBA 3TJUA 3SV7A 2FOCA 3RMNH 3T26A 5EQSA 1GJ8B 1BOQA 3BEUA 5F8TA 1Y3WA 4CBNA 2ZFPH 3KEEA 8GCHF 2BY8X 4U01A 1QFKH 1TNKA 1S6HA 1HAZB 1S83A 3GCOA 4CRGA 2FP7B 5T3HA 5C3NA 1B0FA 1MTWA 1GVKB 2Z9JA 1UK4A 2CF9H 2A5AA 1Q3XA 4O9VA 4X8VH 3K6YA 2AIQA 1VCQA 1C5YB 3QO6A 4TY7A 3LT3A 2P3TB 1NU9A 3RXPA 1GVZA 2ZTXA 1TONA 2QXJA 2EC9H 2VIOA 4KTUA 2Y5GA 2V6NA 1Z7KA 1ZYOA 3GCTF 3PLPA 1LHDH 3CENA 4I8KA 3NWUA 4E06H 2Y81A 2WPKS 4YO9A 1EZSC 1T4VH 3LKWA 1GMHF 1VITF 2ZHDA 4DY7B 1UHBA 3TLOA 2Y5HA 1HJ9A 1O39A 3MFJA 2BLWA 1P2MA 3V12A 1ZHPA 1SGCA 1Y3VA 3F9GA 4U32A 3FZDA 2OUAA 4YOJA 2SGFE 1V2UT 1YC0A 1IHSH 3S0NA 4UFFH 3WY8A 3B23B 3TPIZ 3C1KA 1KLJH 2SNVA 2H6MA 4AN7A 1O3KA 1BRUP 1A7SA 2ZDNA 2GV6A 1O2ZA 1UVSH 2C8WB 1LHGH 1O38A 1FONA 1W2KH 2QF3A 3UWJH 1FY4A 1GBIA 5T6FA 3SNEA 1ARBA 4MPWA 2H9EH 1WV7H 1XUKA 3SJ8A 4H42U 1V2LT 1GVLA 2VIQA 2RA0A 7ESTE 3TK6A 2A4RA 1Q2WA 2SGEE 4FUEA 4J2YB 1C5VA 1XUIA 1CE5A 1OWDA 4Z6AH 1INCA 1UVOA 4NZLA 2Z9KA 3ZVAA 1ESTA 2PUXB 9ESTA 4D7FA