5DGCA

Reaction of phosphorylated chey with imidazole 2 of 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
molecule keywords Chemotaxis protein CheY
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dgcA00
3TD9A 3LOPA 4YS6A 2IPLA 3H1EA 5B3JC 4JP1A 4EYOA 3QELB 2FSPA 2FMIA 3RVMA 1J56A 4F8JA 5IUJC 2RJNA 2HSGA 3KHTA 1ZESA 2FEWB 4H60A 3LUFA 3DLHA 1FFSA 4KV7A 4RY9A 4JAVC 4DN6A 3HXMA 3SG0A 3N8IA 3F7NA 4WZZA 4KMRA 3LFTA 1YVUA 2FMFA 3LMKA 5BRAA 4O1HA 1CHNA 4YRZA 2QW1A 4ML3A 1NXTA 4UHKA 3H5OA 4TLLB 2IPNA 3K9CA 4YGXB 2PLNA 1R8JA 3LUGA 1S8NA 2FXIA 9ABPA 4WWHA 1PNTA 4W5OA 4EGSA 5E3JA 1W9HA 2MSKA 4Z4EA 3QLTA 5EWMA 4D6XA 3QLVC 2N9UA 2LIVA 4RK4A 5DTEA 1PNRA 1L5ZA 2FLWA 1XHFA 4Z9AA 3I42A 3IP9A 3OO1A 2MYPA 3HZHA 3O75A 1JFSA 4HNRA 3Q7SA 1UDRA 1JBEA 1D1PA 2FLKA 3DZDA 4G86A 1KMIY 1DCKA 3KLNA 4FB4A 3HK2A 4OTZA 1TM2A 2LUOA 4JA2A 3QX9A 2L2QA 2WMYA 4G0XA 3IP6A 1TMYA 4OBBA 1USGA 3A0RB 5KQGA 4FE7A 4Z0NA 5JNVA 1Z17A 1JFVA 1CYEA 4ETNA 1Z13A 1DZ3A 1GUBA 2WWVD 4H3KB 5F64A 2QZJA 4RDCA 1A2OA 2GBPA 3IPCA 3I45A 4G0PA 3EQ2A 3F6PA 2FKAA 3IP7A 4F3TA 3OLZA 4LE2A 3CZ5A 3N0XA 3Q41A 4YP9A 1LK0A 1SD5A 5GOTA 5FWXB 2FEPA 3HDVA 3OO0A 4OATA 4MQFB 1RNLA 3E61A 1ZITA 3G1WA 3MA0A 3JTEA 3O21A 1NXOA 2WJAA 3HS3A 3DGFC 1JYEA 3CLKA 3KS9A 2FMHA 4H3HB 5TQ0B 2E4VA 2O20A 2AYXA 3MMNA 4YV7A 3T38A 4HYEA 4NV3A 4KQ9A 3KG2A 1DCFA 4KK4A 3NNSA 4G0QA 4E7OA 4RY0A 5HKOA 4L4UA 3HJFA 4P1ZA 3CU5A 4JASB 4DQDA 3RVKA 2HJ9A 1P6QA 2WY2D 4RK0A 4O5AA 3JVDA 5KWSA 2A9QA 1SRRA 3M9WA 1YIOA 1H9CA 4YR7A 1WETA 3KYJB 4ZYLA 4MQEA 1Z18A 1ABEA 3L6UA 2FMKA 3LUDA 1U2PA 5CNMA 1VRVA 4RS3A 1APBA 2LP4Y 4YCSA 3HM9A 1RPJA 4D74A 4CBVA 4NICA 2HQBA 3KSMA 3I5AA 5TQ0A 2QXYA 3SM9A 4MS1B 3HUUA 4IILA 2RJOA 4KZKA 3QELA 1FSPA 3HEBA 2WB4A 2E4YA 3QEKA 5JS2A 4EVQA 2A9OA 4RKQA 4XASA 1M5TA 1TLFA 3HCWA 1KRWA 1NTRA 1ZY2A 1A0OA 4E7PA 1QPZA 1W25A 2W42A 2JB9A 1DCMA 3ILHA 3OLWA 1XHEA 4ZMSA 3CS3A 4RV5A 2F8TA 2ZAYA 3UUGA 3UK0A 4RK6A 4Z4CA 3TB6A 4Q7EA 3HUTA 3SQNA 2P4UA 3TX6A 4MR7A 5C5CA 2B1JA 4IGAA 4W5NA 4TLMB 5FBHA 4W5QA 1Z2DA 3BBLA 4N76A 4Z99A 2PUDA 3H1FA 1LBIA 3H5WA 4LE1A 5IUNC 1JFTA 1RXEA 2R4QA 2FEKA 5CHYA 4MR8A 4LX8A 3O2JA 3JPYA 1MVOA 3CFYA 3HSYA 4RXUA 5CNIA 4EVRA 2TMYA 1KGSA 1VKRA 3QLUA 3UKJA 4RXTA 1DBWA 3NNDA 4GPAA 2QU7A 3RVOA 3FDFA 1EWKA 3RVJA 1A04A 4XFKA 3T8YA 3URMA 1JH9A 3RVPA 4QYMA 1ABFA 3KCNA 3M6MD 1LBHA 3OM0A 1QP7A 3CKMA 3CRNA 1FQWA 5JS1A 3MYYA 3QK7A 1PEAA 1VPWA 2ID7A 2A9RA 1BVHA 1D4ZA 3O2SB 3DLBA 1QO0A 2PE5A 2H3HA 2QV0A 3N75A 4LRQA 3ROTA 4N0PA 5BR1A 3LKBA 2MSWA 3A0UA 4G0OA 4D6YA 1P8AA 1OXKB 4MS3B 5I4CA 3G85A 1DBQA 3TMYA 1D5WA 2NZVG 2VUIB 1YTUA 3H6HA 1PUXA 2MYNA 5T3YA 4PZ0A 2M1ZA 4EUKA 1RZRD 4KFCA 3JVIA 1JDPA 4MQEB 1U04A 4WXMA 2L19A 3LUCA 4ETMA 4ETIA 5HQJA 5TQ2B 5CNKA 3CG4A 3P9YA 6CHYA 1JF8A 3HVRA 3IP5A 3O1IC 5B3JA 4N41A 2RGYA 3LUKA 3OLXA 2PUBA 3C6QA 3NNNA 2FQYA 3OMXA 2MYTA 1PEYA 4XAQA 1YK1A 1QNLA 2YHBA 2NUBA 1QO0D 3Q9SA 4XLTA 4ZPJA 3OMWA 1ZDMA 4KNYA 1HEYA 1FFGA 4W5TA 4QICA 4QPJC 4YLEA 3LUJA 5IUKC 3TO5A 4KRFA 3QEMB 3K4HA 5EWLB 1JWLA 1AB5A 3SY8A 3EULA 1FFWA 1QMPA 3RH0A 2Q5CA 1E2BA 4MR9A 4RK7A 1BAPA 3R0JA 2FN8A 1P2FA 2VUHB 4LDAA 3KJXA 2PUFA 4ZJPA 4O1IA 4RU1A 3DBIA 1K68A 5PNTA 1GLGA 2PL1A 3S99A 1EWTA 5FWXA 3VNBA 2FW0A 3CHYA 2IKSA 3RVLA 1I3CA 5JNTA 4HNQA 4MR7B 5IULC 1RZRA 2JBAA 4OG2A 3EODA 1DP4A 3OM1A 1BDHA 3KYIB 3LUAA 2LPMA 1C0EA 1TVMA 3N0RA 4RZSA 3SNKA 3BILA 5BRJA 2PL9A 2PJUA 3GYBA 3KTOA 3FGZA 3FFXA 3H5IA 5DGCA 5JNWA 1JL3A 2E4WA 2J48A 3H5LA 2PUEA 1ZGZA 1NATA 3CTPA 4NCBA 4Q6BA 1ISRA 5EWJA 1TJYA 1F4VA 4MS1A 3O74A 4ZMRA 4HNSA 3L49A 2H0AA 2MYUA 4RXMA 1QP4A 4EYKA 1U2QA 3IDOA 3NHMA 2IOYA 3DGEC 3H1GA 4IRXA 1QKKA 1D1QA 3C97A 5JNRA 2NT4A 2A9PA 3FFTA 3GT7A 3Q7RA 1ZGGA 4G0MA 2NT3A 2JK1A 1NXVA 4TN5A 3GWGA 4LZLA 5C5EA 2YHAA 2NZUG 5KI6A 3IPAA 1QQBA 1GUDA 3O2QB 5IEBA 2CHFA 2CD7A 2PAFA 2VYCA 3MM4A 4MLDA 1NXWA 3C3WA 2QR3A 2B4AA 7ABPA 3OLVA 3JY6A 2WRZA 1MIHA 2VK2A 4MS4A 1YMUA 2OENG 5FWYA 4G97A 1NXXA 1Z25A 2MSLA 4MRMB 1ZN2A 4QYWA 5ABPA 5ED4A 4S05A 3MQ4A 4B09A 3BREA 2PUAA 4P98A 4MR9B 4G0ZA 3H6GA 3NBMA 4PE5B 2HPHA 2R48A 4YO7A 5TPZA 3M9XA 1L5YA 3NHZA 3EQZA 1MAVA 3CG0A 2R47A 4PICA 3RVNA 5T7BA 3SAJA 1SXGA 3RVQA 3Q15C 1ZH4A 5IBQA 1YK0A 1USKA 3HDGA 4IF4A 5IX8A 3JPWA 5BQ3A 3GA5A 1U0SY 3H5TA 5HM6A 1U8TA 1Z12A 3C3MA 6ABPA 3OQNA 1JLKA 3I09A 4JB0A 3B2NA 4OLAA 1BDJA 1QQAA 1BA2A 3A10A 2KYRA 4N47A 4MGEA 3QLVA 4RWEA 2RDMA 4EY3A 4Z4HA 1USIA 1YS7A 3EAFA 4EYQA 2PUGA 3CNBA 5DLEA 2GI4A 5CNJA 1F51E 4FE4A 1M2FA 3A3KA 5KC9A 1MB0A 4Z4IA 4MPTA 3FFWA 1EFAA 2GKGA 2JCGA 3Q7TA 2HQOA 1RXIA 2IPMA 4KQCA 4RSMA 4OLBA 5TPWB 1QP0A 2CWDA 4N0QA 5EWJB 4WXEA 4XARA 1CEYA 1MB3A 2E4UA 4JOQA 4MYRA 2X7XA 1ISSA 3C3KA 2FQXA 3F73A 3GBPA 1K66A 3D8UA 4MQFA 1YS6A 2PKXA 4F11A 3QX8A 2QSJA 4UHJA 5KC8A 1VLZA 3FMVA 3O1HB 2GX6A 1AB6A 2E4ZA 5D2CA 2P9HA 3OQOA 4GNRA 4M88A 2R25B 1JHZA 1C4WA 4PEVA 4G0YA 3T6KA 5KQPA 3MIZA 4KVFA 1DG9A 1DC7A 1SXIA 2E4XA 2HQRA 3N53A 4MAAA 4KK3A 2OQRA 4N03A 4WUTA 2F8SA 4EYGA 4W5RA 4LDZA 4S04A 4NCAA 1DRKA 3GV0A 3N0WA 1PHRA 2ZWMA 4JB2A 1ZH2A 1GCGA 2AYZA 3T95A 5TPWA 1NXPA 5DKFA 4RY8A 1ZVVA 4IMJB 2FVYA 1Z2EA 1M2EA 3H75A 1JYFA 4F12A 1JDNA 3JS5A 4XXHA 3EJWA 4EVSA 2BGGA 4KREA 4YWHA 2GWRA 3D02A 5TQ2A 2JRLA 5IEJA 1ZAYA 5FBKA 4RK1A 5GQSA 1XWWA 1DJMA 2LBPA 3EDCA 3RVRA 4DADA 2I6FA 1NY5A 4MRMA 5HSGA 5JNSA 3H5VA 2CHEA 2PMCA 2IPAB 3N6VA 3BRQA 4MS3A 2JVJA 1NXSA 2IYNA 8ABPA 1YMVA 3RQIA 2QVCA 4MLCA 3MF4A 4L85A 3VNAA 2FQWA 5TPZD 3GL9A 3HO1A 5IC5A 3EGCA 1BDIA 2M98A 2XDYA 5EWLA 4F06A 4RKRA 4KPYA 1D2AA 2FTKE 3ROFA 1URPA 1EHCA 4LE0A 3KLOA 1E6LA 1EAYA 4WT7A 1Y1LA 1EWVA 5EWMB 1T34A 3LUHA 1SXHA 3HV2A 2ID9A 3RVSA 3KKEA 4Q6WA 4MR8B 2PUCA 4MS4B 5FWYB 4Y9TA 2V0NA 3O1JC 3ILYA 1E6KA 2QVGA 1E6MA 1P6UA 5KQLA 2JBAB 1GCAA 4IMIB 4Z4FA 2L17A 3LTEA 3F6CA 3OLYA 4Z9BA 1Z26A 1Z15A 1IIBA 3BRSA 2FN9A 1OXBB 3QLUC 5KQMA 2DRIA 1ZHHA 1DBPA 5TE9A 2L18A 3GBVA 1KRXA 2IDMA 3GRCA 4TMYA 1M5UA 4Z4GA 1JX6A 1DC8A 5TQJA 3W9SA 3CZCA 4NQRA 2WJWA 1DRJA 1B00A 1Z16A 3QEMA 4PYRA 3E3MA 1LJUA 1LJLA 4RK5A 5JNUA 3LKVA 2JVKA 5DCLA 2JVIA 3OQMA
chains in the Genus database with same CATH superfamily
2AUMA 3L6EA 4PYIA 1KO4A 3EMDA 3R7DA 3DONA 3ZZMA 2Z98A 4HNUA 5IH7A 2JIMA 4JP1A 5LBUA 2I78A 2Z2KA 2BI7A 1RCTE 3JAWB 1RXVA 3CLUD 4G89A 2HJWA 3OPVA 2PV7A 2FR1A 5GJBA 4ME6A 2YDXA 1YR1A 3JARA 3I2HA 4JEUA 3AZQA 1CHNA 2YYYA 1L9KA 3CH5A 4IDQA 1OFUA 3GT4A 1OLXB 3ZI0A 5KCZA 2A8YA 3WWDA 2OVBA 4Y98A 4UHEA 3LA6A 5C8VA 2ZJ5A 3JWJA 4B5LA 3K5IA 4LBZA 1E66A 2RC6A 3H1PA 2MWMA 3TXYA 1SKYE 1IONA 2Z5VA 3BE6A 4J0KA 1YO6A 1EFTA 1KY4A 3VV2A 1U02A 4DV0B 2I4RA 1JPNA 3AHJA 2IJGX 3G6KA 2W00A 2C82A 2BRUA 2FSHA 3MGBA 4O4IB 4F6RA 1JIVA 1KVTA 5JISA 1IXKA 1DIBA 2C7VA 3H13A 3FETA 3H2KA 1WXDA 1IN7A 2ZAMA 1IJFA 2LIPA 3B1FA 3ZU4A 2NTVA 4LKOA 1N6PA 2VPYA 3DZFA 1B6RA 2HJVA 2FLKA 1D1PA 2Q62A 1T0UA 2Q9BA 1XTIA 1CP3A 2XW6A 2VH2A 3LCUA 4G86A 2XLCA 5IS2A 4QOSA 1L5RA 2YJGA 3LLSA 4ZVMA 3OQBA 3WMGA 5U4QA 1XHLA 3CB4A 5CCBA 3IUMA 1P7YA 1KZ1A 2VO1A 4AL4A 4ATNA 3W7BA 2BSAA 4ZOLF 3V42A 3ANSA 1II8A 8GPBA 1RRMA 4J1TC 4ETNA 2WAAA 1GUBA 4KQWA 5A4KA 3PQ5A 4JI4B 2QG6A 5C7OO 1MB9A 2WMNB 4U1RA 1PTJA 4A92A 5ERGB 4D9JA 4MW4A 5L8VA 2IYFA 4JUDX 2JW5A 1OW3B 4R6XA 5EJAA 4DTCA 1E5LA 2O23A 5G1OA 3L8YA 4P7BA 3N0XA 1EGMB 5EP2A 3V7FA 1IHDA 1U2RA 1Z62A 4D0SA 3RUIA 4ZQCB 4UE2A 3MAGA 2CYBA 1I01A 3BGOS 3LLUA 3LWDA 4RJKA 4E4RA 5JLJA 5KNDH 4DPKA 3U7EB 3FCOA 5BN4A 4BO3A 2XB2A 1GDTA 2ZDHA 1NBMD 2G76A 3OKPA 3KZXA 2IE8A 4GD3Q 3O5AA 3D4NA 3EGVA 1Y7PA 2E2WA 3JQAD 7GPBA 2OPBA 4EW2A 5JCXA 1T5LA 5IAEA 4UKDA 5CW2A 3PFKA 2ZE8A 1RJFA 2F3RA 2GEBA 1P18A 3HBLA 1QGYA 4GP6A 4J2HA 4KOAA 2X8JA 3SQLA 2ZIUB 2HJ9A 3TLAA 4RK0A 3C4QA 3KLPX 2I7XA 4B3BA 3BE8A 3GB9A 1UM8A 1LFDB 2XYGA 3ILXA 3C3BA 4EO4A 1LLDA 3NGXA 4CIBA 3ZJ4A 3WRWA 1UQTA 5TMPA 2OFOA 3NETA 2JGMA 5H02A 2PMEA 1NPDA 5HIAA 5ALMA 2QUAA 1N5DA 3U4IA 3TIGA 1RQLA 1EMDA 4ODIA 3L6UA 3UA3A 4GZ3A 5C1DA 1CIVA 4AUKA 2PZJA 3ESYA 2P9EA 1T4CA 4W82A 5GV7A 4IS3A 3ZZ1A 1VGRA 1OJ7A 1X8KA 4EPWA 4KXQA 1CQIB 2R87A 1K8RA 2BN4A 1C4KA 1TVKA 2D5IA 1YUMA 2QRVB 3JCZA 1ISFA 3VPXA 3VR3A 3SM9A 1XVTA 4DCPA 1U2GA 2WU4A 3COVA 3H05A 3FVWA 4MS1B 4DJTA 3DO5A 2OXEA 4H08A 1SB9A 5DRTA 3W6ZA 1NQXA 4WUVA 2WA2A 3QELA 3BJEA 3O8DA 3P20A 4MCHA 4X6UA 1N2HA 1Q7TA 5JS2A 1KJ9A 1MC5A 1R6BX 1Y3IA 2HIAA 2QZZA 5K5EA 5MN4A 4LXIA 1RADA 3O91A 3TM4A 2GLTA 1DVRA 1C4OA 4YONB 1P2VA 2HDHA 1GLVA 2BDTA 4MUFA 4EG8A 3O8OA 3L79A 1JMKC 3OLWA 1LEHA 1NOJA 3K8ZA 3UXMA 4LMPA 3RREA 3VC2A 4YV0A 2AL7A 3N7AA 2BFEB 2C4KA 4MV0A 5MFZA 3TSOA 1ISHA 4NCHA 1KDVA 3B9RA 3CEHA 2VAPA 2OFFA 1LA2A 1M0EA 4WKNA 2YVLA 3ZCPA 1WB9A 1GGKA 1GQ2A 2XODA 1RKBA 3SEAA 3ZBQA 1R6UA 4L3VA 3LFUA 1TTPB 2DPGA 3ORSA 1G5TA 4KQ2A 4PG4A 4QU0A 4FWIB 2FUKA 2ZGVA 3ITDA 1U3FA 2CLSA 2J9RA 1TEXA 2OK7A 3OHSX 2R1UA 3TRIA 1VKOA 5JJ5A 3MBIA 1W4BA 2NQ2C 3OJ0A 3FF4A 1OHHD 1NBAA 3VNQA 4AKTA 1M6YA 2C7OA 3L1UA 4NEHB 3FOBA 1LKZA 1UF9A 1LBHA 4NDNE 4RAQA 3OX3A 2ZWOA 3RSZA 2BGTA 3QK7A 3MCVA 2CNWD 1K9SA 1E98A 4ND1A 4WZAA 1E2NA 1X7YB 4OL9A 5JCOA 1RC0A 4ZCIA 2JGNA 3ZV5A 4QE3A 5JO0A 5EMMA 4EB6A 2MSWA 2ABWA 1QFZA 1H0HA 2BMEA 3ESAA 2B0CA 5IDYA 1ADJA 1FUUA 1TJNA 3EYAA 3MHPA 1AS3A 3MNFA 2P2LA 1ZQ1A 2WYUA 3H6HA 2V1UA 4EUKA 2M1ZA 1P3DA 3OMLA 4ZU1X 1NN3A 3DDUA 3MOSA 3V1YA 2IH5A 1PEKE 5M04A 2A5GA 3UT5B 4B4KA 4C0BA 1O95D 3CRVA 3DEKA 4Y9UA 1ZK1A 2VKQA 2B7LA 3AUAA 3VO1A 5HIKA 4G1UC 1RE1A 1WDWB 3W8FA 1BHSA 1E7SA 1UOOA 4YBZA 2J07A 4KJXA 5B3JA 4B3JA 2DE0X 2IHBA 3IERA 4GOKA 2XY4A 1FX0A 1HUQA 1SOUA 3LRTA 1TM3E 2HMTA 5HOQA 1ZWKA 2RKWA 4OQQA 1AC5A 2MYTA 2WZDA 1IHYA 1ZHFA 2LDXA 4MVYA 1E9SA 4I99A 3ESRA 3N2IA 1NKVA 1OWPA 1E9FA 1JDSA 2ST1A 1NY6A 2YS7A 5C3MA 1FFWA 1JWLA 3TZKA 2G5GX 1IEWA 1QIKA 1VIVA 1RYMA 2VSNA 3P0HA 4G24A 5I6DA 4AXBA 3T41A 4YMWA 1LSSA 2WJ6A 1K2VN 4XRGA 2I8LA 4O1IA 3CNNA 3DBIA 2Q4BA 1K68A 1GRVA 4JLNA 2C97A 4G65A 4RVDA 5FT9A 1OBCA 1RVDA 5E9WA 3RIEA 2DQSA 2QTBA 4CKCA 3DMGA 3AILA 4RDHA 3B53X 1SWVA 1JHPA 2GFHA 3DAGA 1I3CA 4IDOA 4HNQA 4K6CA 4FXPA 1G2PA 1Z2PX 5LMZA 1X9GA 2OUKA 3WSVA 4C76A 3AL0C 4RHEA 3UAYA 3V4OA 3FY4A 4N5DA 3DZKA 4HDOB 1NP3A 5ESRA 3S7ZA 5A5FA 2XUQA 3NGMA 1LLCA 2AKEA 4DDWA 1WP9A 1C0EA 4WHMA 4C7OA 5DOVA 1B1AA 5TV2A 1Y8AA 3CZAA 2YXLA 1Q20A 4ER3A 1E20A 5JV5A 5GIOE 1JHRA 3RIHA 1B7GO 3CZRA 2XUJA 1GKIA 4LQCA 4EP1A 4Y2SA 3CUYA 1XJ0A 1KH2A 2A0UA 2ASVA 3A7DA 3PHJA 3GXBA 4IIDA 4WCFC 4W9RA 5KAPA 4ASUD 1T0PA 3U80A 4OP2A 3BFXA 1BHO1 4KQEA 7REQA 1YJCA 3SF8A 5A6VA 5ESDA 1YONA 4F97A 2GLUA 4L6CA 3RG8A 4CIWA 4C20A 3X1XA 2AQ8A 2FPKA 1V2GA 5DTJA 1UQUA 2FPPA 3PI7A 3NHYA 5HKKD 3I5XA 3CZMA 4CKYA 3PGXA 1NXVA 3JQ9C 2I7TA 3ZY6A 3D6MA 4HXGA 1DXOA 1U9ZA 3KDAA 4JJAA 4WN3A 5E1MA 5G3YA 4KH0A 2Q3BA 5BV7A 4NU8X 1EZ4A 1L7NA 5CH5A 4MEBA 4O5OA 121PA 1ETUA 1ENOA 4E32A 3U4MA 1R12A 3C3WA 4BBZA 1XZNA 5F33A 1P81A 1E2KA 1FNSA 2UYYA 4OA8A 1A9QA 5I4BA 1YV9A 4R71A 4G97A 5IDVA 3E1GA 2E82A 3I4LA 1ZN2A 2JAUA 3D7RA 1NWCA 4OB6A 4X92A 2C4TA 5CVJA 1E5TA 2ZTHA 5IPFA 5BWNA 5GY7A 2O59A 2R00C 4UUMA 4HFJA 3SJZA 3AH8A 3SQMA 2I91A 2UZIR 1PJ3A 4CU2A 3JD0A 3MFYA 3GGPA 3PGJA 1GQFA 3M1IA 1O6FA 2VQ3A 2AA3A 3ZWQA 2F7SA 3NH9A 4AIIA 5T7BA 3P2EA 1FA9A 1DWQA 4HNAA 4HGOA 2Y0EA 1D2EA 4GQBA 2GHQA 3HEAA 5IAJA 2FFRA 3LBNA 5IBQA 1TPYA 1UAGA 3CNQS 3JQFA 2W70A 3ZUGA 2HHHB 1TECE 1UBLS 1TUBA 2XRMA 3DYIA 4LRSB 1QHIA 3HY4A 4M1SA 4X1YB 1OH7A 5EJ7A 4FOSA 4YJ2B 4NNJA 5H81A 3COZA 4LA4A 3K94A 4MQ4A 3AVQA 2JJ8A 1LSOA 1OROA 2Z43A 4FGJA 4IW3B 3UXEA 3W7AA 4E11A 4WZ6A 1AV7A 4AICA 1M2NA 4WBNA 1MA0A 4KN5A 3B3JA 2NNLD 2HWWA 3QLVA 4RWEA 1NMZA 3ZWXA 2HLDD 2EHJA 3GRZA 2QP3A 2IEYA 4HLUC 3GELA 1QC5A 1S6YA 2MIIA 3M3PA 5M7EA 3EIXA 4GLBA 2WA1A 3LL7A 4BVBA 4K0KB 4PRLA 4CQMA 3H9GA 3RRBA 4MUKA 3HXOA 2XMQA 3HA3A 3M9LA 1NIPA 3PQ4A 3MCZA 3RTDA 1HYBA 1PT5A 2I2BA 5DH9A 2CWDA 1UKCA 2C5FA 1QP0A 4BC0A 4QOJA 5C46F 1CEYA 1MB3A 1JSRA 1WDTA 1MMFB 4JOQA 1QQ7A 2BEUB 4IOKA 4PHCA 2X7XA 2JLVA 1G8JA 1TA4A 3CWCA 1N2CB 3WYFA 4G4GA 1EZZA 4W1SA 5DT9A 1F2DA 2QG4A 1ZJJA 5EXXA 3ER9A 4M7WA 3UN1A 4OX9B 3FPHA 4JQOA 3ABOB 4ZJUA 3N8KA 4OM8A 1EFPA 4QARA 4WZBA 4RSRA 4CHTA 1HURA 3PI6A 5ETJA 1SCUA 3AEQB 4CLHA 1LUAA 1ZUNA 2BV3A 3T1YB 3AHEA 2FETA 4X65B 3SC2B 3M0EA 2RGBA 4QYSA 4HB4A 1KO7A 2V54A 3CUTA 4LF7B 3GGOA 2SKDA 5CK4A 4P4GA 2BONA 4QSMA 4RTNA 1ISMA 1T0JB 3LY9A 4XE5A 2C84A 4O4LB 1UUFA 4UMEA 4RACA 2O7NA 1Z9BA 3JQBC 1JGTA 2CXRA 1C9MA 1SCIA 2L69A 1MDBA 1XVUA 2OMKA 3C5HA 3OZEA 4IL5A 5ALDA 5HCNA 3ZE9A 4CIXA 4J7AA 1M8PA 3L7NA 5HFAA 3ANNA 1VPLA 2CNWA 1HH4A 2RHRA 2ZBUA 3DO8A 3RSCA 3TTUA 3UHJA 1U4OA 1YZGA 3GGCA 3TLMA 4RTJA 4OYLA 4BV3A 2K7FA 2PSEA 4QNRA 1FSZA 4FKBA 4OHBA 1LBSA 1JZQA 3IEXA 2AOVA 2FSSA 2H29A 3F9RA 3HH8A 1XP8A 4JZKA 4LY3A 3OCVA 1RWMA 4LJ9A 4QD3A 5K51A 3RE1A 2W2OA 1KOGA 3RDPA 1E9RA 3CLVA 3IV7A 2ZKLA 1WXXA 2QSUA 1NHWA 4MWGA 4FGUA 4YO8A 3U9LA 2BM1A 5KNCD 1AJEA 3WL7A 2PH7A 3EQ9A 1M0SA 4L75A 3RVRA 4S1PA 2L42A 2FK8A 2DTDA 2I54A 3PT9A 1FYDA 2RGNC 4FYXA 4MYTA 1Y9AA 3W5HA 3WLJA 2GN8A 1KMHB 1M75A 3LPMA 4UDNA 4JT2A 4MS3A 3H2YA 4X71A 2VHJA 3GZNA 5WRFA 1NR7A 2GUWA 3PXGA 4E22A 4YAKA 3L8ZA 3MWGA 2J0SA 3PFBA 4MLPA 1VA5A 3N2ZB 3NZEA 1ES9A 3TQSA 3EPLA 4TYYA 1X0VA 1ULZA 1DBRA 2G1JA 3FRJA 4B45A 2NLOA 3O94A 4KDRA 2B6HA 1OFTA 4LE0A 2PS0A 4KFUA 2GF2A 4I6GA 2VQDA 2VDWB 4LW8A 5LOVF 1LB1B 1UXIA 5SY6A 1E0DA 5KDOA 4KZPA 3R3XA 2IXDA 2OWEA 2Q2QA 1Y6JA 2W2QA 1ECPA 4RESA 4TPKA 3NORA 1ECFA 3AWDA 3TAHA 4YRKA 3NHFA 2J67A 5MN6A 5J2UA 1R0RE 4C6TA 1E1RA 1WR8A 3DPIA 5K3FA 2I80A 1CY4A 4LSZA 5LB4A 2QVGA 4N49A 4XR4A 4E51A 2RBGA 3IQGX 3ZCXA 4M2LA 4P3KA 5C8YA 3WO1A 5F7JA 3U60B 4BNGA 4H9GA 1T2AA 3GR6A 2YYAA 4DLZA 1G20B 1XXHE 1LBQA 4JEMA 2RK3A 2QYHA 1YHNA 4LG1A 1DX9A 4TWJA 2JGJA 4HX2A 1CF2O 1BXRB 2VSQA 4EY7A 5JCJD 1ZSNA 4ENRA 3HFRA 1FRVA 1EYZA 4DT1A 4TN1A 2DFDA 1AF7A 5KHAA 4D3XA 1XMVA 4JU9A 3AM3A 3UMMA 2WJWA 1FXWA 3COYA 3H65A 3BG5A 3QVTA 4GLJA 3R4CA 2ZR0A 4PYRA 4PX9A 3VH3A 2CJWB 1F2TB 4RK5A 1C7JA 2BR5A 2Q2WA 4XVRA 3REGA 4D2IA 1C0LA 1WZUA 5MGBA 4QDTA 3U4GA 4BWYA 3IS3A 1GA6A 3HN2A 3KSDO 3OHMA 4YS6A 5EMHA 4F96A 1MQAA 4JOSA 3PS9A 2FMIA 3DKIA 3RVMA 1X77A 3USCS 3NKLA 4PFJA 4WESB 3EFBA 4FHZA 3K15A 2FUEA 1ZU5A 4CKWA 8OHMA 3OOEA 2O8FB 3H18A 4FMDB 4DS3A 3GYGA 3NIFB 1TQ6A 1VM6A 1XRPA 1U6JA 2UZAA 3AEUA 4DNQA 1FBNA 1NRJB 3LMKA 3NYIA 2ZBVA 4PW0A 4G5HA 2GEKA 4R81A 4R9VA 5EP4A 4R8KA 2H5EA 4YUAA 1NC1A 2P68A 2NZYA 3HWSA 1H2FA 3I83A 2X7JA 4LYDA 4PC6A 3U0BA 3B51X 2EKBA 4CDGA 5BNWA 2P7HA 4IIUA 5EQJB 4QU8A 9ABPA 3R9XB 3R6GA 3RWMB 2ETVA 2VT7A 2XB6A 5E3JA 4J0GA 1XTSA 3IMKA 1KP2A 3ABSB 4QO8A 2FMTA 4F45A 5KOIA 2QQEA 4RK4A 4JYAB 3STXA 1EX6A 2FOIA 1X8JA 3NAGA 1GKLA 1Y80A 2ZBEA 3I6BA 1T1SA 2FPSA 2PS3A 4W1PA 3D31A 4MHOA 1G9XA 3PVCA 3QPBA 2V65A 1W49A 3HVUA 2V97A 4LAFA 3U3KA 2C58A 2NYRA 4UMVA 3WYGA 5LVAA 1TM2A 3K6JA 2LUOA 3WLAA 3P52A 4ACBA 4ESHA 2AKYA 3CC8A 1XTPA 3QU5A 4X20A 1SCBA 2QROA 5FR1A 1ZIDA 3DEYX 1SIOA 1D1TA 1OY1A 4OGWA 5JJBA 2CLOB 1EWQA 4RSGA 4ZOQI 3R7BA 1H85A 4LSGA 3V5NA 1V6AA 1HZJA 1GZSA 1B41A 1EAMA 5TXGA 2GARA 5CB0A 3EEBA 2QZJA 3FJYA 3SFZA 2BGWA 2NVOA 3GU3A 2FPIA 1OVMA 2EV9A 2ZYHA 3H2IA 4YMVA 2AXPA 1U0BB 1LK0A 2ODNA 4WW0A 3D4IA 4F93B 2VOJA 4YRFA 5K4HA 1QG4A 2IDJA 4J4BA 1EZ1A 3KYDB 1LBEA 3G5UA 2Q0HA 4Z1MA 5CVTA 1Z3CA 3SYTA 2YBEA 1Y8QB 4TTSA 2IEDA 4BEVA 1YRHA 5JECA 3INRA 1B0ZA 5G53C 4YV7A 4BNZA 1E2UA 3KL4A 4TYQA 1NDQA 1Y3DE 1BEZA 4M1EA 3D2BA 3CXRA 4G0QA 4YQZA 1M2HA 2GHTA 2XQGA 2HUNA 3HA7A 1JTEA 3WDLA 1VG8A 2AYYA 1QFJA 2E18A 3A4VA 3OZVA 2WY2D 1BX0A 5DM70 2CLFB 3AR9A 4PZCA 4HQKA 5EC8A 4DMLA 5A0VA 4LCBA 2QQ0A 1EVYA 4J0HA 2PSHA 1Y37A 2Q3JA 1ZRNA 3TQHA 5TF4A 1MVLA 1II9A 3ID6C 1RAEA 2BPOA 5ALGA 4C3VA 2R8PA 3T0IA 4N9QA 3BERA 2FY8A 3FHCB 2EP5A 1QQTA 3CY6A 1G8HA 1SRQA 2PMFA 2Z2ZA 4JC5A 4TKUA 5EN4A 4CLOB 4RS3A 4BRUA 3F6SA 2JLYA 3DWFA 1KFBB 1MG5A 3DE3X 4D80A 2KX7A 3HKEA 1NULA 1HORA 1OFIA 3W7VA 2XOKD 1DKNA 4A2WA 2V6GA 5EJMA 1N0VC 1DQRA 3TDMA 7ADHA 4GYYA 1GTL1 1M7BA 2H52A 4F4HA 5F7OA 2G77B 3HLTA 3HUUA 3P7MA 3K7EA 2Q6KA 4JHLA 4TL9A 3OF5A 2NZWA 3ANMA 3NPAA 1QO9A 3AX6A 2IUFA 4MKXA 1GTMA 4ZJYA 1GTSA 4EVQA 5AM4A 4WQMA 3IBYA 4YJGB 2DPXA 2ZYAA 1HDYA 1ZA2A 1FS4A 3HCWA 3HNPA 3BWYA 3PXAA 4Q15A 3RTCA 3A14A 3EUWA 3EZLA 4E0BA 3B9BA 4L0QA 2VOEA 4UOQA 4FYMA 3GLFE 5E6RB 4Y2GA 2RIRA 3M4YA 4O4HA 3AVVA 1DEOA 3DCYA 3LYAA 2JI9A 4RW0A 5JBNA 4Q93A 3EXHC 1GU1A 3UAWA 2XMCA 5J2TA 2H63A 3GGJA 2XJ4A 3C7AA 1XMIA 3K3PA 4IZOA 4Q1EA 4UU0A 2BMDA 1P1CA 2GA9A 3B6MA 5E8RA 3OIUA 2D0OB 1GARA 4IIJF 4QU9A 2O7SA 3SKYA 2HZ7A 5D86A 5CDYA 1X80A 2FEKA 1FTWA 2YX1A 1CQWA 2G8LA 4Y2XA 5KOJA 2XXAA 4WOPA 1JR4A 2B7BA 2C4NA 3A8TA 4J4TA 3E8SA 2J3EA 3K92A 4AAYA 4KLNA 4QZVA 2Y93A 4GKBA 1RHQA 5KS2A 2Y9PB 4ZO8A 3GN1A 2V74B 2W2LD 1N9GA 3EIOA 5ED0A 3URMA 4B7UA 3QMVA 3AEKB 4QYMA 3FB4A 1MQ8B 3SYLA 2C4VA 3CW2A 2BFCA 5F1PA 3SJ7A 1U0TA 2OLEA 5JS1A 1FQWA 3LC2O 2WTUA 5ES4B 1VPWA 2A9RA 1UJ5A 2XKJE 3O2SB 4XWAA 3RFFA 1Y4UA 1C9YA 5HYVA 1Z0JA 4XM1A 3HGQA 2A92A 5ADUS 1SBYA 4XDZA 1DHTA 5J5CA 5JAQA 3SIXA 3GX1A 4PIPA 4K5QA 1PZMA 3DMYA 1G3QA 3SVLA 4MS3B 4R3NA 1QCZA 2PU7A 2PT7A 2QTVB 4TTJA 1CULC 1IRXA 3EH2A 1CDDA 3E15A 1OPRA 1CERA 1E1DA 2CJFA 2JGDA 3LC7O 2L19A 4MB0A 4R2KA 4Y1RA 1BMFD 3KAKA 5HQJA 3H5NA 5DXAA 1FX1A 3I5MA 1A82A 4S35A 4ZEOA 4EJSA 5I3CA 2J31A 4NE9A 5H4GA 1FZQA 3LUKA 4PQFA 4WCFA 5D1HA 5EKSA 2O2CA 4YUYA 1KEVA 3H9QA 4US1R 3T0GA 2I55A 3H7AA 1Z5PA 5A62A 1X14A 4KXFB 3DZHA 1V9SA 2J7PA 3MG9A 3T4UA 2J3DA 4CI0B 3TRFA 2GYWA 2R8RA 1T6XA 3MXOA 2XGSA 2AWNA 5EZSA 2Y4OA 3V32A 3SY8A 1JHVA 1O6ZA 1YBVA 1H6AA 2OZEA 3RH0A 3ZV3A 3KYBA 3UGJA 3ZGLA 3H9JA 2P2GA 1N9ZA 3KZCA 3AHGA 1Y82A 2CCJA 4M1ZA 4BFWA 3CH4B 1MNQA 2RGGA 2QF7A 2H1LA 2VBIA 3ORYA 3GUCA 3FIUA 5PNTA 1O5TA 3VDXA 3FFAA 2I4OA 1YIDA 4BMCA 1JS1X 1AHHA 3QKTA 1PBTA 2FW0A 1PJAA 2NSDA 1LC3A 1EFHA 3CHYA 1X94A 1X7DA 4O4JA 1N57A 4IDFA 4X60A 4P0QB 4RH0A 3ZHVA 1L5OA 1N1DA 2Y2UA 1D9XA 2GO7A 4YIKA 4TTPA 2NU6B 3DE5X 4DCGA 3AV3A 1TM5E 1BDBA 2R1VB 3G8AA 5TMBA 3HSKA 2XSZA 5BRJA 3BMCB 2D2XA 4W9MC 1PK7A 1NIJA 2FWPA 1VKZA 4JLJA 1PJSA 2BR3A 5F35A 2W2KB 2AJ8A 3H0CA 1P1KA 4H7JA 1GTRA 2H7YA 5CYGA 4KH1A 2AXEA 3SX4A 1UBFA 5TMDA 5KNBA 2CFCA 5LP1A 4HNSA 4LNUA 4FC6A 5BR8B 3ZD6A 4UUQA 4POOA 5LZ7A 2XZTA 3D6FA 1GGJA 1YTLA 3DGEC 1QKKA 3LC1O 2JEZA 2VZ0A 2YZNA 1VJCA 3IT2A 4YDSA 4L1KA 4UREA 2PQ6A 5HGXA 4AJHA 3OTHA 1L1FA 1BE0A 1WHSB 1L5HA 2H08A 2DFVA 3EUEA 4O63O 1UZMA 5AOCA 5AI0A 2C54A 3E9YA 3ICPA 1DTEA 4HNVA 4CMJA 3PJEA 5KJFA 1M0TA 5KI6A 2CZGA 3IPAA 2XUGA 3PNMA 3P8ZA 3VVBA 2R84A 4DLTA 1QQBA 3BPSA 3MM4A 4RJJA 4P5EA 4YCBA 3IAUA 3CLTC 4O2BA 3TPCA 4KPGA 1E1MA 1UWVA 2CLLB 4B83A 2AB0A 2OENG 5CX4A 1XMOB 1O94A 2BKEA 2IZ0A 3ZIDA 2VTVA 3AUYA 3FNFA 4YAFA 4H1TA 2PUAA 2W6IA 3ZUPA 2M2IA 1JA0A 1JG1A 1E9DA 1WRBA 2PCJA 3ND7A 1NONA 4LRWA 2HD4A 1HZZA 2CUKA 2JFOA 4HX5A 1T5OA 5J9FA 1YVPA 1JIKA 3D5EA 5TPZA 3SXPA 2IHKA 3ZWCA 4I66A 3BGDA 4KUEA 3QOYA 1ZAKA 5JY1A 1P1BA 4MW5A 4P80A 5JMTA 3L7YA 4BIIA 1G4UR 1USKA 1FMCA 3HDGA 1P9NA 3EIHA 3M2PA 4NYIQ 3FTQA 5KTOA 1OLUA 1JV2B 1H2YA 2ZIFA 3C3MA 3UHPA 1AHPA 1UODA 1C4XA 1JIQA 1CTQA 2NXJA 3WBFA 3E7FA 3C1OA 1C1DA 1VRCA 1RKUA 2ILTA 5KYYA 5E9JA 3HC7A 4B7CA 2JFGA 2EAUA 1G21E 5U1PA 3ZHSA 2IOHA 3C0KA 1GR0A 4NATA 4QOHA 1RYFA 3IC5A 1NDUA 3H86A 4TKZA 3DE2X 4Z4IA 1M8JA 2OP1A 4EFMA 5CDFA 4KIUA 1OXTA 2HXSA 5DLPA 1QIEA 3D64A 2I1LA 1N6RA 2HIGA 2PZGA 3EZNA 1J22A 1FUEA 2WAMA 4HZUA 1ORHA 1LTKA 2VZ8A 1CF9A 3CLHA 3DQZA 3HLYA 3OE7A 2FQ1A 3LBHA 3PYMA 2IWHA 1E3MA 4Q02A 1YA8A 2H51A 4TS9A 1N3IA 5C32A 2RGNA 5GADl 1PSDA 2BIFA 1XVAA 2I4TA 3VDRA 1FU7A 1SUCA 4YX9A 1VP9A 1XCJA 2WHEA 5ALSA 1WXGA 4YY3B 2V6FA 3MINA 5DBOA 5LXTA 2P9JA 3GLGA 1Y9ZA 4JI0B 5B7PA 2AEFA 3ST7A 1WCYA 2I6GA 1E2EA 3KLMX 4JYPA 1XOIA 3IX7A 4JV5B 1K06A 2HJSA 2AJCA 1XFDA 4WJKB 2IHTA 4L2IA 4RS4A 4NMHA 3X0DA 4LHXA 3ZZ0A 5KWIA 2Z30A 3AHHA 3NHSA 4PEVA 1YL7A 4IIFA 1S9DA 2G4CA 2HX1A 1TZ2A 3CF6R 4OUDA 1N34B 1Z56C 4MAAA 2O8VA 1DC7A 2IWRA 5ERXA 1T36A 2X0EA 5M3BA 1I13A 4KK3A 4QUGA 1SEPA 4JJIA 2V6IA 4OBXA 5IARA 2H06A 4ZQHA 4G23A 5LZ5A 2EEPA 3P26A 4PYKA 2Q1XA 4UNQA 3K8YA 4GI2A 4E31A 1ZUWA 3AUKA 1NVGA 4MX8A 2XQKA 1M66A 3D4LA 2P9BA 2CLDX 3RFXA 4X3CA 3F8SA 2WAXA 1AGNA 5AXBA 3NJ8A 1KI8A 1X7ZA 4MUGA 1JYFA 1U8XX 5DTRA 5KU1A 4CMBA 3JS5A 4XXHA 4CMKA 4A6PA 4I55B 2JRLA 3MWEB 3W5AA 3ZWNA 1AKTA 3WGZA 1I0LA 3MT7A 2O2GA 1E4EA 4PNPA 4L5YA 4L57A 3EHEA 2ZYWX 2LBPA 4JCOA 3NAMA 2IT1A 3EC7A 5FDFA 3W6PA 1Y8CA 3ESZA 3M5PA 2Q49A 3FUWA 1FRQA 2FRVA 1OA0A 1EE1A 3KFXA 4TRNA 5JWOA 5A0TA 5HIMA 4M8SA 3GVCA 3PNBA 5BSUA 1E1QD 1UFVA 2OD9A 3GFQA 5AK3A 4UJ5A 3KAQA 2VH1A 4S1VA 1VPTA 2ODEA 5DGDA 3RQIA 2XX3A 1Y1KE 3FIJA 3GAAA 1PI3A 3IOCA 2Z6AA 4BLTA 2X0DA 5TPZD 3DEIA 1JQJC 2OCBA 2X8JB 2ZG6A 2M9MA 3IBFA 3NTUA 5FB3A 2VT3A 3R44A 1RZVA 2VSYA 4F06A 4QDZA 1N9GB 1CS0B 4PPFA 3HKBA 2AG6A 3PHHA 5GZ6A 4HXYA 5GGYA 1OI2A 1NJ8A 4S3MA 4R54A 1CR0A 4GMXA 3FMOB 4RGVA 4F3NA 1EAYA 3JX9A 1NSTA 3R7NA 1T34A 2NZ2A 2P0EA 1BH2A 5FFFA 4NZZA 4ZXPA 4QTYA 2PUCA 4FR0A 4W63A 1GL3A 5JASA 3E9RA 3W3ZB 2JJ2D 1W4RA 4GG1A 5CVEA 2HSZA 1SVWA 1ZVMA 2EFGA 5CHEA 4FQ7A 1OYOA 1SCNE 3CUUA 3PQ3A 4KWHA 1JZSA 2V9PA 1DHRA 3PGVA 1V0JA 3H8JA 1PW7A 1UPBA 4J0QA 5K8LA 4PO9A 2Z6UA 3BXZA 5IVDA 2R8EA 1WUHS 5DNVA 1P9RA 4GFDA 1IBRA 3E81A 4HAVA 1YJ5A 4KQHA 1XFAA 4CLDA 5HEKA 3EVZA 1CZUA 1QYXA 4HD8A 1VSVA 3GBVA 4J0IA 1CRQA 4E1VA 6PFKA 3R2JA 3R8CA 3HPQA 1Q0LA 4E6EA 1G6OA 4V0NA 3MCTA 4R68A 1EB8A 1DRJA 3GDOA 1PJLA 3I37X 5C5IA 1KOJA 4FK8A 4ZAVA 1ELOA 5DK4A 3SR4A 1GDDA 4I1IA 1ESDA 3GJ6A 4YA6A 4X62B 3QHQA 1F6DA 2QTCA 4HFRA 5J40A 2CDRA 1OZFA 3N2KB 3OQMA 1L7XA 4IJVA 1DADA 2Q6VA 3COPA 5CEFA 4ZKDA 5B2EA 3CT6A 4TX1A 4LF4B 3P0IA 2IHUA 4HEA1 1PCXA 3IP8A 3EPPA 4MKZA 5IJAA 2RB4A 4KDCA 4F8JA 2OFXA 2RJNA 3M4XA 2G9NA 3LY7A 5JC1A 3AFHA 4BNVA 1E2MA 2I2FA 5D1NA 2YQZA 1ZRHA 3Q6NA 1EFCA 3DYVA 3NUZA 2WNIA 2QX9A 3E0XA 3GMIA 3LFTA 2P8SA 3WNCA 1FDOA 3SVTA 4FD3A 2JLRA 4NHEA 1GFIA 1J9ZA 1L5VA 1UZUA 2ZJ1A 4O1HA 4R1TA 1G5FA 3G0BA 4X6LA 3UWDA 3V2HA 4BECA 2FZ4A 2JAHA 4I9FA 3UWSA 4DV7B 1WEHA 1MB4A 2R8XA 2CVFA 4FQ5A 3GLFB 2BH2A 1DAGA 1B1CA 3MK31 2P1ZA 1UT6A 4HDSB 4MUBA 1IG3A 3G7UA 4NOJA 2GZRA 1E9CA 3EFOA 3U3OA 5AW7A 4ON9A 1L5ZA 2FLWA 3W5JA 3FOEC 2C96A 3I42A 3IP9A 1WL8A 1Q3TA 3GRYA 4YAIA 3NBZC 3R7AA 1UDRA 4EVIA 2OBFA 3LBFA 1M34E 4N3GA 4M1MA 4INPA 4H1WA 1LNSA 4RTOA 3GLIB 1KAQA 3NDIA 4F6RB 1O7JA 1R10A 4X8OA 3JD1A 1COWA 4MI6A 3UJ8A 1TMYA 1UPTA 1SB8A 1R88A 4PSDA 4AD8A 3I61A 3M8KA 3BJIC 2YXPX 1MO6A 1ZUHA 1RI5A 1Q6YA 2WJ4A 2RHMA 1CDZA 1U3GA 3QQ5A 4J1SA 2PKRA 5KTPA 4ZAYA 3GDWA 4OXKA 2P5YA 4GI5A 3GEGA 1X7YA 1E6WA 4PLHA 1EFRD 3L41A 4MIOA 2EF1A 2DWPA 1EPUA 3USZA 3GI1A 3FGNA 4HDMA 3Q41A 4RKFA 1O6BA 2LNDA 1PFUA 5CIQA 4JLBA 5FI1B 4XWKA 3BX1A 4NAVA 4BLPA 1NT2A 1CB7A 3KJNA 2VTBB 5DISB 1OC2A 4PHFA 3ORHA 3QVGA 5K8UA 2FMHA 2G82A 3AC0A 4NEQA 5DI9A 4YRQA 1PN3A 4LHYA 1DAKA 4KG7A 3EVEA 3TEFA 3ZEIA 2QE6A 1G20E 4J76A 1Z6QA 3LP8A 3GP8A 2FUG1 3COSA 3BIJA 3F9IA 1OH5A 3K0SA 2WICA 2QTWB 1HE4A 5EJIA 2NPIA 2O2XA 1U90A 4UUPA 3I52A 4OYRA 3ZQUA 4DQDA 1WQ4A 3RYFB 3C41J 3T9AA 4CV1A 4BUJA 3QFHA 2XCUA 3U13A 3X2EA 3ZD7A 4DNFA 1Z2NX 5BSWA 2UVDA 1E77A 1GNVA 3ZKAA 1ND6A 3HR4A 2R6R1 5CG1A 3IT0A 4XYEA 1DV2A 5ALNA 1DOAA 2B98A 1KNQA 1IDOA 3FWPA 1Z0AA 4IWYA 2XB8A 3RRMA 2AFHA 2HRZA 2OKGA 2LP4Y 2BEVB 4Q3DA 4YCSA 4UMFA 3CW8X 2ID4A 3DP9A 4ZO7A 1ZFNA 3QFTA 4NDAA 4Z51A 4G2TA 4YAGA 1AQNA 5T4EA 1QR2A 3JQ7A 4HQRA 4I1YA 1RM4A 3PWTA 4MSUA 4CUJA 1JA1A 4KQXA 3ZHRA 3TSAA 4H4DA 4Y0VA 5FNVA 3V4VB 2RJOA 3PUVA 4EY5A 5AW0A 2KBFA 4XDYA 2F43B 4YPVA 3E9EA 5IKMA 1FSPA 1JUDA 1ZK2A 2JPDA 3SSNA 1CK4A 1D2HA 1Q0UA 3I28A 4DKJA 2HB6A 1KBQA 1JEQB 4NK5A 1YBAA 4RKQA 4BNLA 5I48A 4L6IA 4RLFA 3B6ZA 3DD1A 3H0EA 1AN9A 1USWA 3H16A 3NW9A 1MR3F 1CY6A 2EQ5A 3AVPA 1W94A 1GNLA 1XP5A 2JB9A 2XVXA 3MGAA 5AW8A 4ZMSA 4RV5A 1NVBA 2I3GA 3U81A 4CETA 1SELA 3UUGA 2GR9A 2X6TA 5JRJA 1UMBB 2Y1FA 3R76A 2HPVA 1T91A 3QKSA 3PQCA 5F2EA 2HHLA 4IGAA 3SCZA 5H9VA 4W5QA 2P3SA 1Z2DA 3OUZA 4Z99A 1SXJC 3CPJB 5DN6D 2YJ6A 5ALFA 4LE1A 3IV9A 5FLEX 3FZEA 5CHYA 2OY0A 5ALKA 4DR3B 2C2HA 3O2JA 5J3JA 4PYOA 4BAGA 5FV4A 4U63A 3BHNA 3WIDA 3ZH2A 3W5DA 2ZRKA 3TUJC 2HPAA 1IAVA 2YASA 3I58A 3OG9A 3OPNA 1JP7A 3PZRA 3SZ3A 1I33A 1A72A 4RD1A 5K0EA 1RLIA 3EG9A 1IBCA 4MP3A 3TD2A 3SHTA 3HDTA 1NLYA 4AZSA 2Y1EA 4RVHA 2X8LA 5F2NA 2EYQA 2NU8B 5A9SB 2XYPA 4DA6A 2C2KA 2SKEA 3T7DA 1G8AA 3FSJX 4Z49A 1MX1A 1O8CA 2CDCA 3FHOA 1ZO8A 4W1QA 5JRDS 4LPKA 4DSUA 2O57A 4P4TA 2JDID 4PYNA 5FI5A 2ZB3A 2Q1YA 4EBFA 1ODCA 3HR7A 3E35A 3N28A 2DJ5A 3G85A 3FBWA 1JFRA 4RE6A 5C5DA 2QUJA 1PBNA 2O4CA 5FXMA 5JU6A 5I8WA 1FJGB 2G9ZA 5BWCA 1CIPA 3QPAA 4G5OA 4MQEB 3K6SA 2IU3A 1T43A 2PD6A 3LUCA 1W5TA 3M1LA 3PT5A 4UNSA 4EITA 4ETIA 5BW4A 2ORED 1JEOA 4GPZA 4I8XA 4RJIA 4QDJA 4LY6A 1L5QA 3L8DA 4X1KA 5ALXA 3GFPA 4BO1A 1L4HA 3BSYA 4OJNA 2PUBA 1I3LA 1RJEA 2Q2VA 3WNZA 2XVMA 2HA0A 2V45A 4K1XA 3I9JA 2X4IA 5B4UA 4O59O 2ATVA 2R2AA 1PLLA 1NP7A 3FYDA 4JK3A 3TO5A 5C7YA 3QWAA 4EHKA 1NF8A 2G4VA 4KL8S 2CLIB 3BSWA 4S0XA 3UK6A 1HLPA 3G0CA 3PGLA 2QDXA 3MWKA 4G25A 5IT0A 4YJHB 2C3MA 2ZRFA 2DECA 3M4JA 1KFCB 4LDAA 5AH0A 5LP6B 1O9BA 4RU1A 1V39A 2PPVA 4YPFA 3W6NA 1UK7A 2EATA 2CKMA 4F4FA 3GQBA 4B80A 3L18A 4BQIA 1DS6A 1MEJA 4KYVA 3MWFA 3OU2A 1B14A 4OHVA 3UXHA 4LTNA 1KMNA 3A6HA 4CM4A 3T3OA 2QM7A 3UT0A 3HZZA 2XUAA 2IITA 4NBUA 2Q1SA 1R9MA 3D6UA 2OAP1 4I2VA 3OEEA 4QPPA 4RA9B 5CB4F 3QIVA 2O54A 4WLFA 4DWWA 5DX8A 2PRJA 2XUHA 1SOAA 4RM3A 3N2KA 3KQTA 4M6WB 4MGIR 3W5CA 3P2MA 2W2TA 2REXB 4YCCA 4XVCA 3NUQA 3O74A 3NTVA 1KPHA 1SURA 2QRPA 1XEXA 1C41A 1TF2A 2OZLA 4U7DA 4C7OB 1WCV1 1EUDB 1VYTA 5TGTA 1CUSA 1GNQA 3WYCA 4PN7A 1I6MA 4PHHA 2B8TA 5CTJA 4H4EA 3H1GA 1N2OA 2P4QA 2XECA 1N1EA 1U8UA 2PO7A 1V4VA 2RC5A 2ZRIA 3QA9A 1AKWA 2YRXA 4ZGBA 5BW8A 2LDBA 3IJPA 1TB4A 3MWDA 1EXVA 1GR1A 1WMEA 3CJQA 2R62A 3LPCA 3FTEA 1YZYA 1YUBA 1Z07A 3WK7A 5EIAA 4F91B 2PQ2A 3I6MA 4PGMA 1V7CA 4YRCA 3D1VA 3SQDA 4DIFA 2RE8A 1YNOA 2BFPA 4EWLA 4HDRB 3OEHA 4FR2A 5JI3E 1R16A 4M9QA 5HKAA 3VAAA 3OLVA 3TDKA 4BO5A 3DV0A 4KC0A 3GIWA 4WY5A 5TX7A 4CIDA 4G81A 1NXXA 1Z25A 1RXWA 2GOYA 4HNHA 3VKWA 2HLNA 4A6EA 2W83A 4FIDA 3WQSB 1T1GA 3IO5A 3KB2A 2FW8A 3LQRA 3OZUA 4PGAA 4B09A 3R41A 4M8NE 1PR5A 2QZPA 4YYEA 1E0AA 3SYRA 2C9DA 3HCNA 1UBTS 4BVAA 3WLIA 4D6PA 2YS6A 4Z0HO 3CH6A 4IDAA 4AROA 4B0OA 1DTSA 3KKQA 1GSIA 2X14A 1TI7A 3RVQA 2DQYA 2ZBRA 1T0BA 1RT9A 2DZDA 1T35A 3N1UA 2ZRBA 4NYIR 5CU7A 4ZV7A 5IX8A 2D3TA 1F14A 4BEBA 5KZMB 4AULA 3Q4GA 4MVJA 1CRZA 1CQIA 4TMVA 1NLMA 3RBZA 1GPUA 3NHBA 1L7OA 1OWOA 3ACCA 2QY6A 4C7MA 1C0PA 4UCXA 2CD9A 3OZRA 4K3VA 1E3IA 1DJPA 2ZYUX 1UBJS 1EA5A 2ACEA 1E1KA 1QE5A 4OI2A 2PUGA 3F7MA 1JTFA 2BP7A 3ZHXA 4UBOA 2P2SA 2RFLA 2MINA 4G4SP 3N8HA 4RYDA 4YALA 5EE1A 5DTMA 4IHAA 4S2EA 3AUFA 1L0BA 2H92A 3MUEA 3Q7TA 2IU4A 5FUVA 1NUSA 4OLBA 2EWMA 4Q19A 2HEIA 1QFXA 1Z6XA 2QNBA 4Q37A 1BTOA 2DKNA 1G3MA 1LPBB 1EHIA 2ZI3A 4P83A 4OP3A 5KWEA 4GX0A 3TKYA 3BJMA 5D3MA 2HY7A 1T8WA 4P4UA 1SVKA 4AJ4A 1EKXA 3P0EA 3R5FA 2ZRPA 1EK2A 5FQNA 3RW9A 4AQYB 4R9RA 2V7QA 2B25A 2DQZA 1RHMA 2PKXA 2RB5A 4IHQA 3RS4A 2C2XA 4Q3KA 5E2IA 1XJWA 1A98A 5H9WA 4Q0MA 2NU7B 2PBLA 1L5NA 2QSJA 3FVRA 4UHJA 5D7NA 3JZMA 2REOA 3D6HA 2GX6A 3N9IA 4V39A 2A5JA 3V9PA 3DULA 5D2CA 1HLDA 3IRVA 1XRMA 1QGOA 2B4KA 4JP8A 5BNIA 4D9CA 4QM7A 1H0KA 3FAKA 3L7DA 1JG3A 2OP0A 3D6JA 2QU8A 4WUTA 1QYWA 3OY2A 2AH5A 3HV0A 3ZGXA 4YJ2F 1IDN1 2ZUUA 4U6QA 4O1MA 1M2JA 1C3OA 2Y1OA 1ZI6A 1FP4B 3N0WA 4IOJA 4MQLA 3SVZA 2QQGA 3OZBA 1NV8A 4JB2A 5DVZA 3CMMA 3UFXA 1O95C 5KX5F 4OXIA 3K8QA 3KYCA 3GPIA 4MKGA 3VO9A 4CTOA 2GYVA 4NBSA 2YV1A 3MAAC 4LRUA 5CD1A 2H4JA 1QPZA 3DD5A 4IAOA 4PFQA 1T6BY 1WD7A 2PZ8A 4RVCA 3WG9A 1ZR4A 1DAOA 1TGYA 3UENA 5K0ZA 1KJ8A 2ZYSA 2XOKA 2RAFA 3L4KA 5EPOA 1G64A 1RXSA 1Z5NA 3USES 4B9AA 3A58B 1VJ1A 3UMJA 3EXHB 3PNYA 4COKA 3BQNB 2QTNA 5E3IA 1ZK4A 4E5DA 3L0YA 4LVUA 1QSGA 4G41A 3H5VA 5THXA 1H1TA 3AVYA 1F8YA 3EEIA 4ZU6X 4RLQA 4DJDC 4F9GA 2QYSA 3L2OB 2A2ZA 4B3XA 2PSSA 1DUVG 4PAQA 3ETNA 2AFIB 2G5CA 1U11A 2QN2A 1YD7A 3HU3A 4RMIA 3CIFA 1OI4A 2X6QA 1D4AA 3ANTA 4L7QA 2ZIEA 5IMBA 3CZ9A 4OFBA 3UA4A 4EK9A 4YR9A 2IXAA 3HKCB 4KFSA 4DMMA 2AVNA 2HTEA 4ZQBA 1WXQA 3PIIA 1DKOA 3C7KA 2PL3A 4OJYA 2Z09A 1BHJA 4HWKA 4X8LA 3HPRA 1A2QA 4PZLA 4CR7A 4X85A 4EY6A 2NACA 2VJKA 3P9SA 2C5GA 4HRXA 4D98A 4EY4A 4MR8B 3SJAA 5BV0A 3QBVA 3A11A 1DRWA 3QY0A 1F6BA 4J29A 2V0NA 4WEQA 3AJ8A 5TRTA 2XYRA 3ZXXA 1GA1A 3ZY2A 5CBPB 1U8AA 3CVJA 4OLHA 1E5QA 1GPWB 2WYOA 1GEEA 3BMQA 2KQUA 3I8SA 1P5HA 2NTYC 1VDZA 1NP6A 1IN8A 1L4YA 1JEEA 1OLUB 4OK3A 4EYSA 2GVDC 3ETGA 3QHAA 3DUFB 4YWJA 3OLQA 2QUBA 4IH1A 1Z33A 4WE3A 2FX5A 3RABA 3TIVA 1F0PA 2QJTA 4L4UA 1YQ9A 1Z3IX 2JASA 2VA8A 4BLRA 1FMTA 2YV3A 4CZ2A 1NA5A 4QXMA 3GEIA 4Z3KA 2FX3A 1GAXA 3BL6A 5HQTA 5LL6P 4O4IA 3BFVA 1Y5IA 3IR5A 3FHJA 4DM4A 4BB9A 3JZIA 5ITZA 1NRIA 4AKEA 2IS6A 2I3BA 5JYDA 5DM2A 4J3FA 3MWLA 4CEHB 3QFCA 3F8WA 1Y1PA 4C2TA 1N3BA 4PFSA 1MAAA 4GRDA 1JDTA 3FKSA 3H0KA 4XWOA 4A1OA 5BR7A 4PG5A 2I29A 2Z8YA 4DN6A 3TKLA 3F3SA 2ZS8A 1TVKB 2EFDB 3ZJYA 1YQQA 3SG0A 4AF7A 2NSLA 2LCQA 4RETA 4F3CA 1F9EA 1OIWA 1PYOA 2EX4A 1EGVB 4ZCRA 1C3VA 1U8FO 1KBZA 3IV6A 3MAJA 3HXLA 4R0VA 2GZMA 5A7HA 3H5OA 3FNIA 2A7XA 3LX6A 5DIFA 2FN7A 5A7GA 4M8KA 4L3WA 3IUSA 4AJEA 2IYWA 1LW7A 3VAYA 2E87A 3BMNA 1ZD1A 3TZEA 1RXUA 2MSKA 5M29A 1UXGA 1RR6A 3LQKA 4IYJA 4OBWA 1LVGA 3KC2A 1IJKA 3UQZA 2GYUA 5HG0A 5JJCA 4AQ7A 3S2EA 2ODAA 4NC9A 5DTEA 2X8AA 1Y34E 1L4KA 4ID3A 4HNAB 3KEQA 5EZ6B 3OO1A 5C7LO 2GN6A 4QTXA 1F0NA 3HZHA 4NARA 1MAWA 5KOJB 3I23A 4DBLE 3K30A 2QAGB 2VYVA 1GITA 3TH5A 3I2GA 3KKPA 5AOVA 4WOKA 3FTCA 2PR7A 1KDOA 5C81A 1JLRA 3N2EA 5JDCC 2WWTA 1S89A 5KKAA 2WMYA 1XRQA 4DCUA 1A8SA 1KA9H 1R4ZA 5LC1A 5D85A 1FFXA 4X8MA 5TB5A 1D1SA 3W90A 1I9GA 1WS6A 1UAYA 1VGVA 3OD5A 2JAXA 4DSOA 3FDZA 5KVAA 2UXDB 1W48A 2PL5A 4LSMA 2CEAA 1C50A 1GZVA 1PR2A 4MI9A 1UEXC 2I03A 4LXHA 4M0KA 4M37A 2RHDA 1ZSVA 2DG2A 2OV3A 1GU0A 3CZ5A 4X94A 4KITB 1SD5A 5CB8A 2L0XA 1VCOA 4OH1A 4IVPA 2C57A 5AW3A 1RNLA 3MA0A 2Y99A 2ICAA 1JYEA 3KS9A 4ARCA 4PC2A 2WT9A 1JQAA 1UAAA 1JQDA 2VYND 3N87A 3A1TA 4RVNA 3WRVA 2HWKA 1U7DA 3AYXB 2C95A 4HYEA 1BCRA 1OA1A 1U2SA 2GEVA 1UKEA 1GM5A 1GADO 1A69A 2IYVA 3JQ9A 2JAWA 4RY0A 2ZRGA 1B93A 2PBRA 2F55A 1NU8A 3CU5A 3WKEA 4HR7A 1U0OC 2UZ1B 2VHTA 4M9SA 5JSYA 1ZCFA 3CVOA 3CWZA 5F5LA 2VQEB 2ZTUA 3LE8A 4M1TA 2Z2YA 4LJYA 3WK6A 1YC2A 1ZIXA 2I6UA 2YN0A 3CMCO 5E7JA 3RS9A 3SC2A 3IEIA 1U0HC 2PAAA 2F8LA 4NMMA 5HS6A 1Z08A 4K03A 3AT1A 4ZAWA 2DBRA 4DC0A 1ML4A 4MZDA 4B6OA 1UWCA 2CYCA 3QPCA 4QAQA 1RMQA 2OLKA 4WSOA 1YZKA 3LI2A 5CNMA 3TIXB 3VZBA 3ZJ5A 4W8OA 1AK9A 1MKYA 4GI7A 4KWTA 4BDSA 5CAEA 2RONA 2A3NA 5E6SA 4JXXA 4G9BA 4V24A 821PA 3DV9A 2OOSA 4I6EA 5CPBA 3ZHBA 3GWZA 4S1TA 3T0FA 3A9TA 1V5IA 4B6PA 2RH5A 3YASA 2IYZA 3DMPA 2QXYA 3KTAA 2W2XA 5TC4A 2KPOA 1P2GA 3ZVMA 3NV7A 3BGIA 2W58A 2OAEA 1I6WA 2IQ5A 4I50F 3E5NA 1J8VA 1QGED 1CV2A 3I6ZA 4YBRA 5SZIA 5JG7A 4OQEA 1AGYA 2DY0A 4OFXA 4DAOA 1DDGA 1IEQA 4R3WA 1WCWA 2GKOA 5CYFA 5ALYA 1AUVA 1W25A 2VHUA 3LVQE 4NULA 4JQSA 1RRPA 3ILHA 2B8WA 5KSOA 3L46A 2QTHA 1FMJA 2V6JA 1GD1O 4XX0B 5CLJA 2ZQYA 4PLYA 3PEYA 2IXTA 1FU4A 3T5MA 3UK0A 2WSSD 3HUTA 2FSGA 1YACA 1E63A 3ICWA 3PDIA 4MULA 1I2DA 4S12A 4TLMB 5BUCA 3AVWA 5IG2A 1YT5A 3KX2A 3B6EA 4JJEA 3T54A 3H5WA 4LZZA 1UANA 2H1FA 5B6JA 3TCNA 2B61A 4I55F 3G7SA 6REQB 3ZHZA 4RXUA 1NW7A 1QYVA 4IIHA 1Y5NA 3K5HA 4UAUA 2RK6A 5F76A 4CVNA 4EQ6A 2R60A 4MCJA 4B79A 4C4ZA 4RXTA 4AZ0B 2PUWA 4JC0A 4GZLA 2ZZMA 2DWQA 2A67A 2FR8C 4FSDA 2QZSA 3K9NA 5ES3A 4A26A 4ZVRA 3UGTA 1OKKD 3NAZA 4WNCA 1XZPA 3SIRA 4DJAA 4IKOA 1LW6E 2XE7A 3MYYA 4ID9A 1VL0A 3FYUB 1GT91 3AESB 5CDFE 3B89A 3W8DA 1UJ2A 3A05A 3FPEA 3VTKA 4DPLA 2VYFA 5AP9A 1Q57A 1Z2OX 1SC1A 2R7MA 2ZROA 2OD2A 3L7JA 1K7EB 1LPAB 3ICCA 4X7MA 1YFJA 3WO0A 3SEQA 1HE8B 1PZNA 3GIDA 3WHLA 4KIGA 5I4CA 5GONB 3L0SA 1CJSA 1YJQA 2JFVA 3WRXA 1ZM7A 2GH1A 4X41A 1Q0PA 3STUA 4J7XA 2A0FA 1JAZA 4DC9A 3GJZA 3UJ6A 3WICA 3I01M 4HX9A 5LKRA 4TVOA 1KK0A 1F48A 2A6PA 2R44A 3C6YA 4FMCB 5JD6A 5LWQA 3ZWAA 1XV5A 2XVAA 5CNKA 3V8BA 1H4VB 1XTTA 3EZGA 1TTQB 5AK5A 2B2XA 3HJGA 4CPDA 1E5XA 3TI7A 1OLSB 2DWUA 3KHSA 3NT4A 3UPTA 1QF7A 1QH1A 1SCAA 1FTQA 1JEYA 2PSFA 3EGOA 4WDQA 3K6RA 4E46A 1P1HA 4JXZA 1OTYA 3E5MA 1BMDA 3GT0A 1XEFA 3OF3A 4QPJC 4XJTA 2OO3A 1YKSA 3G2LA 4EHIA 4D26A 5JYCA 3QOXA 4MVJI 4XUGB 2D1SA 2GEFA 1N8TA 3CW9A 3M4NA 1MC4A 3B9QA 1HDGO 3R0JA 4RWZA 1V25A 3QBTA 4UASA 3UB2A 1D2GA 4EG4A 4LDNA 4J0CA 1SEVA 5JFGA 2R97A 4FW8A 1BNCA 4EATA 3GLGE 2WFZA 1M0WA 1R5BA 3N6XA 5AJXA 1IPEA 2HWXA 5E9AA 2HREA 2EX1A 2KHZA 3HEMA 4KPUA 2G70A 4P3XA 4DDKA 3ZNOA 3LNCA 1T4CB 2TRSB 3E9CA 2CC2A 1JSZA 2C42A 4MR7B 3RAGA 5H16A 1DOZA 2FK7A 2ZANA 1J5XA 4AN0A 5IULC 4DLRA 5E1BA 1J33A 2QN9A 2WIDA 4MVCA 2A78A 4M9CA 5LXTB 3ZY4A 2C07A 1ZJ6A 1RWVA 2LPMA 4GDMA 1W0JA 3ZE8A 1QLJA 2JJ2A 2A33A 3BK1A 4HAIA 4A8PA 5F23A 7MHTA 4MDFA 4EPYA 1E0SA 1H4SA 4HYYA 2ZT8A 3KQMA 4FSXA 4X1IA 5EFOA 3WI7A 3FDIA 5BV8A 4CEHA 1KYVA 1WW3A 1F4VA 4ZD6A 4K3UA 2FF5A 4EJ0A 2ZUEA 1PJTA 3E2MA 4YK7A 3VJMA 1M5RA 2O8DA 3ESQA 3L49A 3A1NA 2QUKA 2VK4A 4JC8A 1IZZA 1OV6A 4BJ1A 1BYIA 3HO8A 4C30A 5CYOA 1QU3A 1VKJA 1T8TA 2ZITA 2EW8A 4G4IA 1WM1A 3B1YA 5ALVA 4IHKA 3ZH9B 1R0KA 3FYTA 3MSCA 3B12A 3FFTA 3TM5A 3VOTA 3O4VA 2KSQA 4G0MA 3FA2A 3UWMA 4R2XA 1A1VA 1LPNA 3U61B 2I7DA 1PJCA 1GWNA 4EFLA 3AB8A 2YHAA 4JYCA 4V2UA 1UMBA 2NUAA 4RPGA 1GUDA 2BKXA 3ETHA 4WOJA 4YRRA 1ZA1A 2OSVA 1S7GA 2WM8A 1W2WB 4ZEMA 3VPCA 3JQDA 3VI4B 3GRPA 1J2RA 1E4EB 5DEIA 1A9XA 1KR5A 5H8WA 5ADWA 1TD1A 3GFVA 3VC7A 3U4CA 4IDNA 1XXLA 2EJUA 3K2BA 1OU4A 2D7CA 1D0SA 3ZK7A 1PLKA 5JT1A 3QX7A 5F4ZA 3OX4A 4PHTA 1QS0A 1H3NA 1PT9A 2CHQA 3LKZA 3UBMA 5HUQA 4P3OA 2W2VA 1BCSA 4D0GA 3S44A 3I0MA 5ANRB 2ZJ7A 4OSOA 1L5YA 3LQFA 4Y9SA 2P0YA 4BNHA 1KIAA 4OU4A 2HK8A 1DTWA 1KI4A 2FPMA 3A2NA 3SAJA 4JODA 2UVPB 4UMDA 1FYWA 4URFA 1QVWA 4H6XA 3R0VA 4IO0A 5EKTA 2H48A 3O8NA 4IHJA 1ZH6A 1FXUA 1Z0ZA 2A9VA 2JIOA 4JH0A 5FOXA 4NEGA 1Z6PA 1TA9A 1UP6A 2F3UA 2Z0MA 4WLEA 4LCEA 1XJ5A 3UT5A 2KI5A 1RLUA 3A4MA 4LZNA 4CMCA 2DHEA 2JZCA 2AJLI 3SS7X 3AXTA 4LC1A 2M6SA 4PLGA 1Z6YA 4N47A 2BRUC 3UY4A 4CI9A 4EG0A 3H97A 3D3QA 3DHEA 3JARB 3MTEA 4ZV9A 4B3FX 4OREX 3OTQA 2EKDA 3FOFC 1F51E 1ZLYA 3OECA 4LJRA 2G83A 2Q5JA 3A3KA 3I2IA 4N54A 1J2YA 2FOLA 3IT3A 4UUBA 4E5MA 1CNEA 1XK6A 2IUTA 1K6EA 3DW3X 4TMZA 4D8WA 3OHPA 5B4VA 1PZEA 1OXUA 3L3BA 3IVCA 4F6LA 4IH4A 1N9KA 1XCGB 3BKXA 4KQCA 4RSMA 4M9ZA 4CODB 2HYDA 3RYIA 4XYLA 2IV3A 4K6HA 4CRWB 2V7VA 3A2LA 4JUAA 2Z9BA 4M1QA 9GPBA 1XALA 3DVAB 3KPJA 3H8WA 4WKBA 3O9MA 1FRZA 4OA5A 3HA2A 1NNLA 4YDHB 1EDDA 2FQXA 2V7PA 4NQZA 5F2OA 4RTSA 2VP3A 4L74A 1O97C 1YS6A 1SOMA 2IBMA 2XEDA 5JAOA 3JQ6A 3OSUA 3KSBC 4UOEA 5KO2A 1OIXA 1VJTA 4K6MA 2OXTA 4R83A 3GDFA 4AO8A 4LZOA 3ZWVA 2VCHA 2P2NA 1RKVA 1K7FB 1TYAE 3JD2A 4ZOAA 3O26A 3PK0A 1IZ9A 4Q1FA 3AEYA 2HSWA 2GPBA 4BO7A 1D7OA 2WDPA 3T6KA 3QFFA 1WSWA 4IV0A 1NKSA 2WIAA 3VVCA 2A94A 4MW1A 4R1PA 4OIFA 2JLBA 2Q41A 5CCDA 1FS6A 2BTQA 3EJ6A 2GZHA 5BXQC 1VG9B 1KVUA 3NP9A 4ZZ2A 1Z2CA 4NYMQ 3EOZA 1M1YA 5HRCA 2AYZA 3A1UA 5JE8A 4RFSA 4K86A 5C8YF 2VJMB 4BKQA 5J4HA 3GLFA 1ZVVA 3I0NA 2OK8A 3KLBA 4HEA6 4C01A 2BGIA 3L40A 3ZHTA 5K3AA 4FNOA 5HF5A 4EVSA 1H5QA 3BWVA 4HN4B 4DIMA 4FHEA 3WSTA 5EZ5A 2JLWA 4LRYA 3R9KA 1U5BA 4L9AA 5CXQA 4QFDA 3WLQA 5LA6B 3D3EA 1R4NA 1XWWA 2EZ4A 5JD3A 1ILWA 4BZZA 1SKQA 4KYUA 1PVDA 3CKLA 2B36A 1ZGBA 2DYKA 4YRTA 1HQYE 2CHEA 1ID8A 1DQNA 1RP7A 2IYAA 1NJ2A 3GFGA 4UE6A 4K9DA 2GJ4A 1XZMA 4KE6A 4TSFD 3JALB 5FTKA 8ABPA 1EUYA 1YU6A 1W4ZA 3KE9A 2VYVD 2QD4A 1DMSA 3CX6A 4RYLA 3CLRC 5I7WA 4N3BA 2RG7A 4LCJA 3SIWA 3WGHA 2JLZA 1S2DA 1MT0A 2GXUA 3Q3GE 2F64A 3QU2A 4PQEA 4ONEA 2G5TA 3LHFA 2XR1A 3MUFA 2OXRA 1Y6GA 1H3EA 1A5BB 5FOUA 4CQMB 3TUIC 2ZRDA 2DR2A 1GPH1 1NLUA 5FWAA 1N6LA 1DO8A 1E6LA 2XNJA 3OIVA 1HEUA 2IYEA 3JATB 3MRTA 3OPYB 4YJ3B 5HBGA 4D0LB 1ZL0A 3COWA 2YH2A 4R8MA 1MTZA 1Q16A 3CZQA 3E9ZA 4U7GA 3EF0A 4MP6A 4MIKA 2Q2OA 1LVHA 3MXTA 5EHGA 3B6IA 4XYBA 3SS8A 3T9FA 3GLUA 1CUHA 1XZFA 4UFOA 2GUGA 2VK8A 1HT2E 2NU6A 2EQBA 4WCFB 5JBIA 4TYWA 4BLUA 3U7QA 2ODPA 4IGKA 1UKVY 2V7GA 1C30A 4IF6A 4PRKA 5KYGA 1U4NA 3BRSA 3S1AB 2CL7X 2FN9A 1U3TA 1CZLA 1L4NA 1S0UA 2Q7OE 3WLOA 1P7PA 4TZ6A 3QVJA 4P54A 3UAVA 1NMYA 2YWGA 2F90A 1JFLA 2Z4SA 2P65A 3CINA 4IFBA 3DMNA 1ECBA 2PLWA 3B6KA 1QRDA 1Q95A 4RORA 4GQIA 2Q6IA 2FI1A 4LMBA 4DTIA 3S5JA 2IEAA 2FCRA 3PD1A 3UOAB 4OHUA 1HYGA 4WA7A 5E2AA 4KXVA 2WKPA 1QCYA 3GHHA 3GPDG 3RO7A 2RGRA 2EDCA 1JLHA 4QVIA 1HQKA 3HJCA 3IEPA 1E1LA 5B3JC 1FU8A 1O6GA 1YC5A 4PBSA 3T7SA 1B42A 3EGIA 1NBWB 4C4RA 4XQGA 2VJDA 2ZAGA 1B76A 2H1CA 3TFQA 2HSGA 3QUSA 2XTAA 4NE7A 4D9EA 3HFSA 3LZDA 2A35A 4BX9A 3BHMA 3K1YA 2GDJA 5A2GA 4KV7A 2J3HA 3M81A 3AHFA 5AWFC 1RPTA 4OU5A 3HB4X 3K72B 3GF4A 2IVZA 1QPGA 3GP3A 3WIBA 1DLJA 1GPMA 2XDQB 4CLRB 5CX1B 1KPGA 5EIHA 1KMHA 3TQTA 2VUUA 3IUNA 4YRZA 2EKLA 1NXTA 5CK5A 5AJYA 1OCEA 1XTVA 2BGMA 4I9GA 4WVLA 2DBYA 5IZCA 1DJLA 2IPNA 4FP9A 4KBGA 2D00A 2GMWA 3U7FB 2A59A 1SCDA 2ACKA 2ZXUA 3UF0A 1EXNA 4RL6A 3ZBTA 1UP7A 4BVLA 2Y1GA 4AQDA 3EUAA 1C3XA 1GKYA 5G3ZA 2CXXA 2PX3A 2WKQA 4CUKA 1NQUA 3T3GA 3TNDA 1T9BA 2C61A 5JXHA 1TU3A 4LOHA 2GYYA 3CIOA 2WFMA 1GLNA 2JKYA 1EE9A 1NYQA 1DJNA 2VG8A 4OYYA 1QVVA 2ZI6A 4P81A 4KQGA 4Z9AA 3IMFA 2BGLA 1ZUIA 3OBBA 3P32A 2H65A 4U0JA 3VZPA 5COAA 3WDMA 1Q0ZA 1F4LA 3KLNA 4FB4A 1GV1A 4GWGA 4LOIA 5HZKA 3JYPA 4RNCA 3VR2D 3VOAA 2I6XA 2N47A 3OZXA 3WYDA 1F4PA 2B99A 1L4MA 1VG0B 1GUZA 4IGEA 1VE5A 1CJBA 3H1TA 1DEXA 2OHGA 2QMEA 2JBHA 5BQXA 3UB3A 3HGMA 3UMBA 4M4SA 3TBFA 2V5AA 4GYWA 2WTXA 3J80A 3DDCA 1Z75A 3ED5A 3MMZA 4F2GA 2I2WA 4G0PA 1FK8A 1KEWA 2X1HA 2CV1A 2Q5QA 3D7NA 3BGWA 3N3BC 5FBVB 2BFCB 3THYA 4OOEA 2XGJA 4B3MB 4QOIA 1L5LA 5LP6F 2A5LA 3RBAA 1FQKA 3VX3A 1CCWA 1HSZA 4IDEA 3GCXA 4CCYB 1CETA 2R0QC 3PUYA 4AJIA 4A15A 1Y7LA 2AYXA 4V38A 1AQYA 1V37A 4WK0B 2BTEA 1NW3A 3F3KA 1A4XA 3T38A 1ZCJA 1S2LA 2AMYA 2HHCA 5BUSA 3WC4A 3N07A 1FFYA 1CY2A 2YJZA 2J85A 4F2PA 3BZUA 4FCCA 2WBLC 3GCGA 3GUHA 3OOWA 2V7WA 5I7SA 2C29D 4KO1S 1ZMRA 3NKFA 1T2VA 3OA0A 2C2YA 2FFQA 2PKYX 5D00A 2GPTA 5JLAA 5C1IA 1XMXA 1G20A 3H3XA 3ZWWA 1PZHA 3TR6A 1SRRA 4DYDA 1SKUA 3M9WA 4A0QA 3W5BA 1A96A 3W3AH 1W7AA 1H9CA 3PFFA 4C5BA 1BFKA 1KK3A 3BCUA 3UMRA 2JGKA 4P7GA 4RIEA 4A10A 1PG5A 1V96A 1YL6A 2X4LA 2VDUE 3VUFA 1BE6A 2UAGA 4ER7A 1AX9A 1QZ3A 1UP4A 4EECA 4JVNA 2IUEA 4R8SA 4P9NA 5FUXA 4F4CA 4L5BA 2Y3IA 1B8OA 4YCDA 3FI9A 3Q0IA 1KZHA 3WGTA 1ICEA 1PVOA 1TM4E 3BXXA 3Q7IA 1LCIA 1KDRA 2WF9A 1HL7A 4MA4A 2XLBA 1VPDA 3QP9A 4KMMA 1KOFA 1C1XB 1QHFA 3EW9A 4O29A 1PS0A 3NBUA 3TRKA 5CJPA 1DAEA 1EB9A 2WR8A 4W7HA 3A7EA 3GJ4A 5AVQA 4XGQA 2XNHA 1R9JA 4Q4JB 1RFLA 2B6NA 5DHRA 4UTRA 1Y0BA 4IO1A 3S68A 2QGFA 2OO7A 4U2GA 2FZLA 4RA9A 5DSTA 5KX5A 3FHTA 1N0IA 4BCDA 3CLSC 4D9MA 5FHQA 2XYQA 1RAGA 1JU9A 3IVMA 4LDJA 1WCXA 3EBPA 2G6BA 4EENA 1VLMA 2PNFA 5EP3A 3AY3A 5BWOA 3C7DB 1KAGA 4MVWA 4AK9A 4UTPA 2HGSA 3H99A 1RFGE 5FO0A 1SK9A 3C4JA 5I9BA 5KINB 4C2UA 2ZRJA 5C5CA 4ITUA 3AJRA 4LFAB 1HT0A 1HKUA 1W35A 4KDFA 1NVTA 3I05A 2RKBA 2FSFA 2OHFA 3N2LA 4I3GA 1P44A 1TW3A 2DERA 4FEAA 1BJKA 3ONFA 2EL9A 3ZHOA 1C8KA 4YI3A 1GFSA 2BTOA 2RBEA 3GK3A 3WGQA 5IWCA 1KP3A 3T5PA 3CO5A 3DR3A 4XA8A 3QM1A 4JLSA 2Q1UA 1KGSA 1C2YA 1F5NA 3IR7A 2G71A 3SNHA 3CN9A 1C3EA 4K88A 4GPAA 3T7AA 4DC1A 2JG3A 1X19A 1DBVO 4XFKA 4B6RA 2I65A 5AOAA 1CUDA 3HCRA 3CBGA 3SF0A 1FDRA 1IATA 3KCNA 4B6SA 3TE6A 4F84A 4ZEVA 4NENB 2A4MA 3FG9A 4J2OA 3NTOA 2HW8A 1RPAA 2G9UA 1JAIA 2M1XA 3OETA 3EUFA 2EBUA 4KTTE 1UL1X 2A57A 3WWYA 4I5DA 3ZQKA 3LKBA 4L7VA 3D3JA 2GCEA 3FNGA 3OICA 3OCWA 3Q3EA 1AM4D 1E1QA 1UMDA 2FU5C 2RH4A 4GSLA 5D51S 4DCVA 1WVIA 1Y4DE 3TMYA 1J0XO 3DAPA 4GIBA 4GKKB 1GQOA 2QQFA 2ZKIA 1KWKA 4U3JB 1L5HB 1WHSA 2FFHA 2HA3A 5KYNA 1GRNA 1YRQA 4LV6A 3W04A 3TLBA 4PO8A 1JAXA 3MMSA 2I1WA 4CKCB 1KAMA 5C35A 4ARBA 5BW5A 1JF8A 2GPNA 4FHDA 1O0BA 1EA7A 1UPFA 3CPHA 4NKRA 3SXUB 3KETA 3IUPA 5D01A 2G40A 4TMKA 3OLXA 5K0LA 2O14A 3WGMA 4IEFB 1IWBB 2WUEA 1O08A 3F96A 1DIOB 3VU0A 1MFPA 4YJ3A 1CF4A 3FPKA 1PEYA 2O3SA 4ZTZB 1K27A 1YK1A 1R15A 2W6CX 2YW2A 3EDQA 5AI6A 2EL7A 4XLTA 4Z8XA 2UXCB 4LDRA 3EPHA 2H1IA 3LQQA 5IUKC 3AJDA 3ZZUA 3RC7A 2Z95A 1X1EA 2BH9A 4TM7A 1Y9JA 2VC2B 2WMOB 1UWKA 3KKKA 2WIBA 4I14A 4ZCLA 4ZEXA 2R7KA 4MEJA 5DB4A 3RARA 3SLKA 3VR5D 3ZNPA 4MR9A 1KTIA 4R84A 1U1IA 3QBJA 2HM7A 4YRBA 1ABBA 2ONZA 2Q4RA 1W36D 4ERXA 4WOCA 1A1SA 4CGYA 4NX2A 2MSNA 1C3OB 1JKJA 2PL1A 4HVLA 2GS9A 5FFMA 3W05A 3DKRA 4HB3A 1PT6A 3LUBA 2Q3LA 4HLDA 1U7UA 1XZIA 4H6PA 5LR6A 4BMZA 4V0QA 3N0VA 4F3YA 3ASZA 5LXTF 4YRAA 2QP4A 1QU2A 2OPHA 3D3WA 1IHOA 1B16A 2JFNA 5CG2A 5B6IA 5AVVA 5BWMA 4W6ZA 4EQZA 4F21A 2SBTA 2WHPB 3OFKA 1AZWA 4ZOBA 4F5YA 5CFQA 3BJZA 1ZJYA 3EIUA 5IZ4A 1K86A 1A9PA 4G5FA 1WUKS 4X00A 5K0JA 2I9KA 1CR2A 3CVYA 2Z1NA 1ZGZA 1KI6A 2WKRA 3CTPA 1WD5A 2VLBA 4XD2A 4XGIA 4Y1FA 4AMUA 2Q8QA 5BMVB 4NCBA 2QRMA