5DGCA

Reaction of phosphorylated chey with imidazole 2 of 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dgcA00
5JNTA 1YTUA 1T34A 2CHEA 2PAFA 3A0UA 2MYNA 1P8AA 3EULA 5BQ3A 3N0XA 3JPWA 4IGAA 3VNAA 3HXMA 4DADA 4ZJPA 4EYOA 2BGGA 1JYFA 2GBPA 3CHYA 3QEMA 3OQOA 4KPYA 1TMYA 3IP5A 2E4YA 4JOQA 5FWYB 1Z16A 2FEPA 5TQ0B 3RVMA 3HK2A 4ZYLA 4O1IA 4FB4A 1QP0A 1IIBA 1QP7A 3EAFA 3CS3A 3N53A 1USKA 5JNSA 4LE2A 2PJUA 3CNBA 4H60A 1F51E 4MR9A 2AYXA 3OMWA 4N76A 2FW0A 1C0EA 3RVSA 4MQEB 1CHNA 3FGZA 3Q15C 5FWXA 4MGEA 4MPTA 1DZ3A 4G0ZA 3KYIB 3A3KA 3LFTA 5PNTA 2A9OA 5KC9A 4LX8A 3B2NA 4H3KB 4F06A 4NCAA 2RGYA 1KGSA 3KG2A 1NATA 1VRVA 2OENG 2WJAA 1TJYA 3HZHA 4JB0A 5TPZD 3H5VA 5BRAA 3F73A 3Q9SA 3H5LA 2PE5A 4Z4EA 4RK5A 3IP7A 4OTZA 4MS3B 4PE5B 3MM4A 3H6GA 1RZRA 4MS4A 3P9YA 3TO5A 2L18A 1ABEA 1M5UA 1VLZA 4Q6BA 2MSWA 2PL1A 2WY2D 2QU7A 2MSLA 5KQMA 2IPMA 2LP4Y 3G1WA 5DKFA 4WZZA 5CNKA 5JNVA 4WUTA 2JCGA 1NTRA 2J48A 2NT4A 2R47A 2WMYA 2VK2A 4W5QA 4PEVA 1FFSA 2DRIA 1RNLA 3QK7A 4RV5A 4YWHA 4ETMA 5T7BA 4ETNA 1D1PA 2FSPA 2QVGA 4YP9A 2CD7A 4Z9AA 3RQIA 3GL9A 4TN5A 2IOYA 2ID7A 2JVIA 4F8JA 5CNJA 2FMKA 4GPAA 3LUGA 2IPNA 2L19A 1EWTA 3BILA 4G0XA 3ILHA 3OLVA 3N75A 1EHCA 4EVQA 1QQAA 5T3YA 4FE4A 4IRXA 4EVSA 3M9WA 4FE7A 2ZWMA 4HNSA 3BRQA 3C3WA 4QYWA 4RK0A 2PMCA 5FWYA 1UDRA 5TQ0A 1VKRA 4F3TA 4G0MA 4PICA 1A04A 4LDAA 4ZMRA 2RJNA 2RDMA 2FKAA 4MYRA 3H1GA 1USIA 4YR7A 3EGCA 1APBA 1NXSA 1Z15A 1Z2DA 3LUDA 4MQEA 5DTEA 3N8IA 1W25A 1JYEA 3T8YA 4EYKA 1PEAA 3HEBA 3LUKA 3NNNA 1M2EA 4MAAA 1ZVVA 2HJ9A 3HM9A 4ML3A 4RXUA 2M1ZA 2MYTA 3E3MA 1JL3A 1MVOA 1NXWA 2GKGA 1ZH2A 3F6PA 1LBIA 3OLYA 1JFTA 4JASB 2FTKE 4UHJA 5IULC 2V0NA 1DP4A 2QVCA 3HVRA 3OQNA 4RZSA 5JS2A 3L6UA 2QXYA 4EGSA 3QLVA 3MQ4A 4RXTA 2FMIA 4XARA 3RH0A 3MMNA 4RU1A 3LKBA 4Q6WA 5EWMB 3O1JC 3W9SA 4MS3A 1FFGA 4W5NA 3Q7TA 4HNRA 5ED4A 1ISSA 1D1QA 1RXEA 2LIVA 2NT3A 2WWVD 5GQSA 2JB9A 1YIOA 4IF4A 2F8SA 2IPAB 3O75A 2VUHB 5DCLA 4MR7B 5KWSA 3JTEA 3T6KA 3EJWA 4MLDA 4YV7A 3CTPA 4G0YA 3OO0A 3TD9A 1QO0D 4LRQA 5KI6A 2ID9A 3I45A 4QYMA 1ZGZA 4YRZA 3S99A 3R0JA 6CHYA 1DBWA 3VNBA 2PUFA 4D6XA 3OLZA 1FQWA 3LUCA 4MR8B 4LE1A 4E7PA 3SY8A 2GI4A 3CFYA 5KQGA 4N0PA 1Z25A 4KFCA 3GWGA 3O2QB 1Z26A 3HV2A 1Z2EA 1ZGGA 1KRWA 1FFWA 3H6HA 1SD5A 2IPLA 3FFWA 5IC5A 3QX8A 1EFAA 4RS3A 3LUFA 5HKOA 4Z9BA 1D5WA 4MRMA 1Z17A 1Z18A 1Y1LA 4TMYA 2FXIA 2VUIB 3KHTA 3C97A 3H5IA 4QICA 3O1IC 4Z0NA 2QZJA 1P2FA 2FEWB 4Z4IA 1NXPA 3GRCA 3UKJA 4HNQA 3BREA 4RSMA 3T95A 4NQRA 1BDIA 2E4VA 3KYJB 5IX8A 5FBHA 3HS3A 4XAQA 2L2QA 2HSGA 5TE9A 4DN6A 2YHBA 4KZKA 3HCWA 3C3MA 2P9HA 2FMFA 5JS1A 3QLVC 1PNTA 5BR1A 1U04A 4OLAA 3SQNA 4Z4CA 1QQBA 3OM0A 3KKEA 2E4XA 2E4ZA 1DRKA 3FFXA 3CLKA 1SRRA 3NBMA 4MQFB 1EAYA 1P6UA 3LUAA 4UHKA 2WB4A 1QPZA 1H9CA 2QR3A 4ZPJA 3H5OA 2IYNA 5C5CA 2R25B 3DLHA 1NXXA 5JNUA 5KQPA 3RVNA 1FSPA 5EWMA 3RVKA 5TPWB 4D6YA 1JFSA 3NNDA 1DCKA 1XWWA 4WWHA 2MYUA 3H5WA 1YK1A 2B4AA 2FQWA 1U2PA 3Q7SA 4LDZA 1ZN2A 3RVOA 1JHZA 2I6FA 2WRZA 1PEYA 5F64A 6ABPA 1DCFA 3QEKA 1AB5A 1LBHA 3C3KA 4MR7A 3OQMA 3G85A 2NZVG 5C5EA 1ZDMA 3KS9A 1GUDA 3M9XA 3N0RA 4ZMSA 4EY3A 4Z4GA 1DC8A 3TB6A 3CZCA 1DJMA 1URPA 4HYEA 4WXEA 4O1HA 2PKXA 5CHYA 2GX6A 4YO7A 3URMA 4MR8A 1RZRD 3OLXA 4YS6A 4XLTA 3TX6A 5B3JA 4EYGA 1MIHA 3H1EA 4EUKA 1USGA 4E7OA 1K68A 3NHMA 5HSGA 3I42A 3O2SB 4KQ9A 4P1ZA 3UK0A 1ZY2A 2YHAA 4KREA 3IPAA 4OATA 2HQOA 3I5AA 4KK3A 3RVLA 5BRJA 2QW1A 1F4VA 2B1JA 1JBEA 5TQJA 4NCBA 3LMKA 1U2QA 2VYCA 2CHFA 5IEBA 4N0QA 3GV0A 4XFKA 9ABPA 1CEYA 4PYRA 3DBIA 1A2OA 4OG2A 1KRXA 2H0AA 3EQZA 5EWJB 1L5YA 4P98A 1JDPA 1DBQA 3IP9A 1DRJA 3JVIA 1R8JA 4NV3A 3GYBA 2E4UA 3Q7RA 2WJWA 4MLCA 3LUHA 3HJFA 3LOPA 4WT7A 3SG0A 1JH9A 4YGXB 1D4ZA 1DBPA 1QO0A 2P4UA 5E3JA 2A9QA 1RPJA 4RKRA 3F6CA 4F11A 2PUBA 1J56A 3HSYA 3QLUA 4XXHA 3MF4A 2PUEA 4IILA 4KRFA 4KVFA 4F12A 1SXGA 5I4CA 4Y9TA 4G0QA 2TMYA 1BDHA 4G97A 4MQFA 1M5TA 2HQBA 3QLTA 1TM2A 3RVRA 1P6QA 1BAPA 2FQYA 3CRNA 3MA0A 4RY8A 2R4QA 1JWLA 2LUOA 2FEKA 2AYZA 4IMIB 2PUAA 3FMVA 4G0PA 2FQXA 2M98A 5TQ2B 1VPWA 3M6MD 4W5RA 2JRLA 5JNRA 5TPWA 4Z99A 3T38A 2X7XA 1D2AA 1S8NA 1SXIA 5IUNC 2PLNA 2R48A 1LJLA 3CG0A 4ETIA 3IDOA 5B3JC 4RKQA 2IKSA 2HQRA 3H1FA 3KSMA 3N0WA 3FFTA 3H5TA 3JS5A 5TPZA 1I3CA 2MYPA 4TLMB 3OLWA 4S04A 4L4UA 1B00A 4RDCA 1AB6A 1L5ZA 2LPMA 4KK4A 3O1HB 2LBPA 4LZLA 2PUCA 1XHEA 1KMIY 3N6VA 3GT7A 4WXMA 1YK0A 4TLLB 1HEYA 4IMJB 5EWLB 3QELB 2NUBA 1PUXA 1MAVA 2FLWA 4S05A 4B09A 3ROFA 3DLBA 4KNYA 1YMUA 1Z12A 2N9UA 3RVPA 1JLKA 1MB3A 2JBAB 1E2BA 3I09A 5D2CA 3HDGA 2JK1A 1SXHA 1YS7A 2F8TA 3CG4A 4JP1A 4M88A 1JX6A 3QLUC 1JFVA 3D02A 3FDFA 3K9CA 4JB2A 5EWJA 4EVRA 2W42A 1WETA 1GLGA 3JVDA 2XDYA 3NHZA 4MS1B 2A9PA 4O5AA 4EYQA 3KJXA 1LK0A 5CNIA 5HM6A 2QSJA 3F7NA 4OLBA 1GCGA 4GNRA 4W5TA 3ILYA 1E6LA 4NICA 2IDMA 3SNKA 1Z13A 4CBVA 1TLFA 3EDCA 4N03A 3BRSA 1OXBB 3QX9A 1LJUA 2QV0A 3DGEC 5FBKA 2JVJA 2E4WA 1MB0A 5IUKC 3TMYA 1U8TA 5HQJA 3OO1A 1JF8A 3EODA 1ZHHA 3A10A 3LUJA 4H3HB 1C4WA 1ZESA 2FN9A 4YLEA 4PZ0A 5KC8A 1BVHA 3JY6A 1NXTA 5IBQA 1NXOA 3KLOA 4RK6A 5IEJA 5JNWA 1CYEA 1ISRA 2A9RA 3GA5A 3K4HA 5DGCA 4YCSA 4N47A 1M2FA 1DG9A 1XHFA 2MSKA 4L85A 4KQCA 5TQ2A 5IUJC 3QEMB 2FVYA 3HDVA 3L49A 1GCAA 5DLEA 2L17A 3E61A 3HUUA 4JA2A 3MYYA 4XASA 3KLNA 4N41A 1BA2A 3O2JA 4RY0A 1ZAYA 2KYRA 4MR9B 3HO1A 3JPYA 4JAVC 1ZITA 3SM9A 3CKMA 1QP4A 1PNRA 1DCMA 4RK1A 5FWXB 4W5OA 1A0OA 3ROTA 3LTEA 4MRMB 2O20A 1E6MA 2HPHA 1W9HA 2CWDA 1QNLA 4D74A 1BDJA 3CU5A 5CNMA 3O21A 3OMXA 4Z4FA 1YS6A 4RK4A 5EWLA 3QELA 3LKVA 7ABPA 1OXKB 3KCNA 1QMPA 2FMHA 5ABPA 3KTOA 2PUGA 2JBAA 1RXIA 2JVKA 4QPJC 5KQLA 4KMRA 3RVQA 3BBLA 3GBPA 4MS4B 4RXMA 3EQ2A 4G0OA 1U0SY 2ZAYA 1EWVA 1PHRA 3NNSA 1ABFA 3GBVA 8ABPA 2PL9A 2RJOA 3IPCA 3D8UA 3UUGA 4OBBA 4RK7A 4DQDA 3DZDA 1QKKA 3CZ5A 2GWRA 4MS1A 4LE0A 2PUDA 1YVUA 3H75A 4KV7A 3DGFC 1NXVA 3O74A 3C6QA 5GOTA 2H3HA 3HUTA 1K66A 1ZH4A 2FN8A 2Q5CA 1NY5A 4Q7EA 1E6KA 2OQRA 4G86A 1EWKA 4Z4HA 2NZUG 3OM1A 3RVJA 1DC7A 4RWEA 4RY9A 3IP6A 1GUBA 1TVMA 3Q41A 1JDNA 1YMVA 3SAJA 2FLKA 3MIZA 3A0RB
chains in the Genus database with same CATH superfamily
4WY8A 1QS0A 4XB1A 4B7ZA 4EG1A 3F3SA 4US1R 2Y6UA 5UKDA 2VYND 1GNPA 3KZXA 1BIFA 1KU6A 3NDRA 3OCUA 3GJZA 1N3YA 5AM1A 4I7EA 2G6TA 2WWGA 4MIYA 3X2FA 3ET5A 2AN9A 4V02A 3T35A 1NVMB 4QDXA 3WWZA 3CHYA 2P79A 3IT2A 3F5FA 4ZJPA 3R6WA 1YB1A 1ZHOA 1W30A 3DW1X 2DULA 4G63A 3HYCA 1D4AA 3F5QA 1BROA 3PHBE 1QTNA 4OLFA 3LF1A 4L08A 2A7QA 3STVA 1NLYA 4AKSA 3HCOA 3QHQA 4IG9A 2OLEA 2P5TB 5J63A 4R5HA 3FCCA 1AD2A 4K3UA 4TLBA 3Q85A 3GQBB 3WGOA 2LKCA 2YUTA 4N76A 3LFHA 1VIAA 1DAKA 3IR6A 1JZSA 1PT7A 4LOIA 4C20A 1ZH6A 3C39A 3AW8A 5I7OA 5LXTF 3C3BA 3AKZA 4ER5A 1IFXA 1Y3DE 2ATEA 1KJWA 2ZQYA 1P72A 3LLUA 4Y2UA 3SSOA 3G0BA 1IOVA 2W2QA 3UGTA 3EASA 3A11A 4Q48A 2HJVA 2JGMA 2VDKB 3NIBA 1GQQA 4BB9A 1CY0A 4KQWA 5AHOA 1C1XA 1SPBS 3H9EO 1RKBA 4ZCPA 1OFIA 2J9ZB 4QATA 2WJAA 3MVEA 4J49A 4U7GA 3EPHA 3NBXX 3I5MA 4MJ3A 4LJ4A 5CLLA 3B7GA 3JQ9A 1ZC3A 1D2HA 1S7GA 1TT5A 3EVBA 1JGTA 4FCVA 1JDZA 2DAPA 4RCVA 4FYWA 1G64A 1V1RA 4I5EA 3D1JA 1D07A 3H2YA 1M2HA 1YU9A 4GECA 3T9CA 5L3QA 3ZHCA 2FPGB 3IT1A 3OM8A 5KTOA 1V7PC 1XZFA 3QVOA 3FWPA 4BQIA 1E5XA 3P52A 2MMCA 4D9JA 4NBNA 1RRVA 4HQLA 4BVBA 4D8TA 4WZZA 5CNKA 3TW0A 4IZHA 5HS4A 1NBME 3VA7A 4HV4A 3SBDA 2VQ3A 3DXYA 4A0FA 2RGGA 2OZVA 4PEVA 3AJ8A 3PENA 3MJDA 4R2XA 3HVIA 3ICVA 5DO9A 7AT1A 1RI2A 3F9IA 1D1PA 4LJLA 3BWEA 1KTVA 3IALA 4B82A 1FYFA 1UXHA 1VL8A 1YB2A 3R76A 4AWXA 1A7UA 4BEVA 3CLUC 3NETA 1CULC 4F8JA 5JSZA 1SUIA 4R1TA 3D3JA 5JCOC 4FFOA 3TPFA 1N4DA 4P22A 4S1VA 2GF0A 4TLEA 3IIIA 4MGHA 5G3ZA 3VVCA 3ZGXA 3KEFA 2QHXA 4B47A 3FDXA 3TGLA 2D59A 5EQDA 1BE8A 1UPAA 3ENKA 4INPA 5FNVB 1C1DA 2Q1YA 2VJYA 3U4IA 1NLMA 2ZT5A 1FNCA 4C7XA 4MEAA 1XAHA 2ZWMA 2AC7A 5F7XA 5IVKA 4BGVA 1D2GA 1DAOA 5FI3A 4UMFA 3W6OA 5TQ0A 1GTVA 1C4KA 2HF7A 3D8HA 4FJ0A 3NDIA 5AXBA 5H80A 4NMMA 4EBFA 3F4BA 1RWWA 2FOIA 2WP8J 5EXSA 4ZEOA 4F3TA 3K09C 3RREA 4KIJA 2EIHA 3I92A 5BN4B 4XIYA 3RRJA 4MYRA 2P2CA 3H1GA 5DMHA 3ZJ4A 1NF8A 2Y77A 4RNDB 5DTIA 4C5AA 1JQDA 2PMKA 3L1UA 2JHGA 3R5FA 2ZSJA 3L93A 3M83A 4W9MC 1ANKA 3ESQA 3MAGA 4UHCA 1IULA 3WMXA 5DGXA 3DLBA 3GFBA 3HEBA 2C95A 5FLKA 5LJIA 1ZVVA 3T41A 3RT1A 4IV0A 5J47A 2VLIA 3ILSA 1MUUA 5J2UF 1PDOA 2HA0A 2V0NA 2GPSA 4QRDA 2ZRHA 3MAAC 2C4UA 2EBWA 2HI0A 1Z7GA 3L6UA 5JS2A 1UM9B 4ENVA 1H94A 4YT2A 1G20E 4Q0MA 3DB2A 3IVMA 2VRCD 1J06A 4L3WA 1FE8A 4A6PA 2H9IA 4E5UA 4PHFA 5AM4A 1CRQA 3W9SA 4QGHA 1ADYA 3J7AC 2VPQA 3ASYA 2YMQA 1SQ0A 5HP4A 1SCJA 4F9FA 1ZNWA 3BMNB 3NEYA 5NLLA 4NH4A 1PJTA 4PV7A 3PEUA 3L4JA 1L1QA 5FLXA 1A98A 1YIOA 2DWOA 1E2GA 2XMPA 3E48A 4TV9B 4ES6A 4JCOA 2IP1A 1IHUA 3DVQX 3MUFA 4FK8A 4OUDA 2XIJA 4ZMBA 1QO0D 1RTKA 2PT5A 2IL1A 4NENA 2PFGA 1P1JA 5KYYA 1R1DA 3FTCA 1J8VA 2I29A 4M8KA 1XZMA 3VYRB 4MX8A 2R86A 3RK1A 2BMJA 4HN4B 4RV4A 4WDQA 4R0NA 3ZX5A 3AR7A 3LIPA 1UBOS 4E7PA 4A36A 1E66A 3CLTD 1G6HA 1AUPA 2PUJA 1I7LA 5D5HA 2AG1A 4GPTA 3NRBA 2ZSBA 4MGIR 1YDFA 3JAWA 4PYQA 3V1KA 1CY7A 1DEAA 1ZGGA 4FYMA 3BTSA 5JO9A 3TL3A 1YVPA 4CEHB 2J5BA 1E3JA 1SD5A 2IPLA 1CVIA 3HCDA 2P4QA 1V9CA 2NUPB 4NJMB 3FFWA 4OL0A 2FMTA 1G3UA 4L5AA 1JEAA 3ZD9A 1TEHA 4AMZA 2GASA 2QSZA 4JH0A 3OY7A 1QC5A 4UOZA 1ZZGA 3PD7A 4ERXA 2H11A 4JMLA 3KHTA 3JASA 2ERXA 1T29A 4I81A 4KC0A 1OTHA 2ODPA 4MW9A 4BNYA 4TZKA 3MPOA 5JVDF 4LQDA 4M38A 4I0WB 1BGXT 4FGKA 4RZIA 1BDIA 4ZDJA 3FWHA 3LC2O 3T7TA 2QROA 1Y81A 3IUQA 4FOPA 1V71A 1SHKA 2PKWA 1SHLA 3FMPB 4I6GA 3HYNA 1KZHA 4G37A 1WXFA 1UJMA 3NP9A 1EDZA 2AEMA 2KSQA 3R3SA 3CH7A 3QYJA 1Z0ZA 2FZWA 1G8YA 3BTVA 4ND5A 3HE3A 3R5TA 1AKWA 2GCNA 2ISQA 3ON5A 3D43A 2IX9A 4TTAA 3BICA 1G8HA 1BWPA 2F1RA 2GNAA 1I7NA 3FVRA 5JADA 4N7MA 1BE0A 4NDZA 3RFFA 3L7MA 2VXBA 3R3XA 4ZPJA 1XEXA 4Q9JA 5F78A 3UN1A 5KO2A 1GT6A 1GN9A 5E7MA 2BGKA 3DOEA 4YJKA 1D8AA 3G2JA 4QKQA 2C9OA 2R8PA 3BMOA 3MINA 3G0DA 3FWKA 1TGYA 5TEVA 1WV1A 3RRYA 2XTNA 5BN5A 5EWMA 2RGCA 3ZZUA 5DNWA 4QHSA 1DEHA 1VKHA 1ZN9A 1NR7A 4E2FA 1JG1A 3GGJA 2FEMA 1U8AA 2MYUA 4PC6A 4PFSA 2FG5A 3UPTA 4ZGGA 1ZN2A 1Z68A 3OTHA 4PQEA 3NAGA 4C3VA 4DIEA 1RYZA 4MV6A 4AF8A 3KVNA 2XKKA 3D81A 3PPYA 3GDHA 1EX6A 3I6ZA 4CM3A 1YQUA 3LRTA 1Q7TA 2BD0A 2N3ZA 3MCVA 1SKMA 1NR1A 3K9FC 4XJSA 1DEXA 2C5FA 4WGFA 5FA8A 2NG1A 3FRIA 3UWDA 4QPZA 3M81A 4KRXA 3URMA 2GX6A 3T5AA 3WA7A 1DKMA 3OLXA 2D7DA 1JIJA 5DCYA 4G0NA 5DM70 1L8OA 3DXXA 3ER6A 4I9NA 5LA6B 4NFYA 1X92A 3OKCA 4XLZA 1B0ZA 2DBRA 3IPAA 1G1AA 3KOUA 5HXAA 3E9CA 5K4GA 3ERCA 3GVXA 2XBLA 1GV0A 1V3UA 3EEOA 1UFKA 2AOTB 3KHSA 3KEQA 4QXPA 1JEDA 4MI1A 1F0NA 4WA7A 3QVLA 5IEBA 1I3NA 1V35A 1KQ3A 3DBIA 4F2DA 3DMGA 1P33A 2OTCA 4G8BA 4TPKA 3HJAA 5TS2A 3ZLUA 2F9MA 4N12A 3FCYA 4AUMA 4LZJA 4AJ9A 5B36A 1DAPA 4TUYA 4XUCA 3MILA 2PRJA 3MWJA 4KXLA 4Q4LA 5JS8A 2G17A 4MLCA 1XLWA 3CH6A 4A73A 2IXGA 2SECE 1VP9A 3ANSA 1JH9A 4M3NA 4PFJA 2P4UA 1GZUA 1OX4B 1UMKA 1MOQA 2QX7A 2FPXA 2O8VA 3BMCB 3I5UA 1VSUA 4FX5A 4B46A 1OX6A 1U8YA 1ZD1A 3HSYA 4HYTA 1AKNA 5AVRA 5JAOA 2QSYA 2H9YA 3GLHA 1FNBA 1SXJD 3F7OA 1NOJA 1THTA 1U28A 3AJDA 4K81B 4MW4A 4DMLA 3NV9A 3EVDA 2J9RA 3EGVA 1UAYA 4G1CA 4G0QA 5J58A 2XZLA 2TMYA 4F3CA 3UTDA 2ZTVA 3M5WA 4NZ9A 1YJXA 2FZCA 3OTIA 3HB1A 1M5TA 4X95A 4KMMA 2LCQA 3RO7A 3QF4A 4LHZA 3SC2B 3ZH9B 4AYTA 3LV8A 1R4NA 3H9CA 4TXHA 5DHPA 1SELA 1VJ5A 3VR5D 3WR5A 3KTFA 3ZHOA 4LNAA 3ZNOA 1Z6QA 3K0HA 1IZYA 3ZKWA 1IHPA 3E22B 5EP3A 5HPYB 2HNKA 1NV8A 1KYZA 3PICA 4PPYA 4M0EA 1L7NA 1ZO8A 3IBSA 4E70A 1XU4A 2Z98A 2CCGA 3FLBA 1SXIA 3RU9A 5K8TA 3WP0A 5COQA 3ET4A 4ETIA 3AP3A 4OSOA 4G1BA 2HN9A 4RKQA 2ZAGA 3KQYA 3F8SA 4OH1A 3TKLA 1R00A 3NKFA 1NN1A 2LDBA 5U9CA 5TPZA 2QZ4A 3NCTA 3OLWA 2J5QA 1B8PA 2AQHA 2BMEA 4PGMA 1L5ZA 1JWAB 5HBRA 2LPMA 3ZI0A 4D1YA 4G5GA 2I9KA 2O57A 2CXHA 5GV7A 3K6RA 1FBTA 1DPGA 4DMHA 3K0EA 4CEIA 2ZK7A 1WOYA 3W6ZA 4ARUA 4ASUD 3IEUA 2PRYA 3LOUA 2PH1A 3IFSA 5FOSA 2F1JA 3SZ3A 4E32A 3OBBA 4QC2A 2H2FA 1KFKB 2VPIA 4PLGA 5DTQA 3TD6A 3GRUA 3D7RA 1KGDA 2FPIB 1N4AA 2QTRA 4PPNA 3I5XA 4LPSA 3R8CA 3K0CC 5DULA 3R4CA 4MHSA 4X93A 2AFHE 4N40A 3VOBA 3BXFA 1IRXA 1E4OA 1HYGA 4V2IA 3S2FA 1T9GS 2WJPA 4DILA 1TF5A 5KIAA 4JI2B 3M70A 4FR5A 1P2DA 3DQQA 1OU4A 1XVVA 4IWNA 1XTTA 3ZY4A 1JI3A 1G63A 3QPUA 5TV2A 1X9IA 4LBVA 3RROA 4LDQA 4MS1B 4QTUB 3LGAA 2EWVA 3N58A 2BGMA 4IHJB 4WCFC 1P2VA 2QJOA 3R7WB 2F43A 4Q4AB 3ZS8A 4LMPA 4W5TA 1HNZB 2VDWA 5EUQB 1RPTA 2EARA 1U3GA 3VPDA 4NU0A 5CJJA 2C9YA 4R8KA 1NY6A 2XVZA 4IZIA 4R41A 4ZVNA 4BNNA 4OI0A 3HDJA 2DCUA 2VHXA 2DBVO 2OV6A 2ZRDA 4M1TA 4GZLA 2BE7A 2P40A 2P9TA 3BGWA 3C6BA 1NQXA 1MOSA 3GEBA 1K7EB 3B48A 4WNYA 2ON6A 1M34B 2MSNA 3PQEA 1EX1A 1SAYA 4O8ZA 1CNFA 1W36C 3IDZA 1ND5A 1NA5A 3JY6A 3NJ4A 3F9RA 3MS7A 5IBQA 3V1UA 2HBZA 4C88A 4MV5A 1KO8A 4GI3A 5DNCA 4YRFA 4ENSA 1K3TA 1JSZA 5C53B 3L1KA 2VSQA 4GEKA 4EYSA 3OZRA 5JQGB 3WAGA 5CJ2A 4DABA 3RCBA 1F3LA 3K1ZA 3U7RA 2WUWE 3B52X 4NJOA 3GNTA 3C48A 3CZ4A 5CAEA 3OMLA 1M2WA 4RH0A 4GUDA 3KLNA 4O59O 1E7QA 5FX2A 1ICIA 1W5FA 1I3MA 4ZOLB 4YYZA 3ED1A 1OBOA 3EISA 3OFKA 4P93A 3NT2A 4R2IA 1QCCA 4YJHB 4WAUA 1D0IA 2H92A 3WGZA 4ND2A 4ZVOA 4H1WA 5LB2A 1QGDA 1XPJA 2HJRA 4EATA 2ZS8A 2ZRBA 2PS0A 4L5CA 3S40A 2P9QA 3Q1KA 4IBOA 4FMCB 3PLRA 2GKSA 1T2DA 2OCLA 3TTTA 1UMBA 3JZIA 5I9TA 3RLFA 4MQUA 3WNQA 1DQNA 3KO8A 3N7AA 4CFZA 3TRFA 4ZAXA 2PV0A 2VDPB 1HKUA 1MLDA 1QB8A 1JDTA 1WRBA 3EF3A 2GPWA 4M7WA 4MV1A 5AIAA 1XD8A 1J2UA 5DEIA 7REQB 2VQ6A 5KMGB 4RAOA 3RR2A 3B51X 2VT6A 1QFXA 4CW7A 3QKRB 1A5BB 4ER6A 1T25A 4QELA 1OYWA 4Y7DA 2X9NA 2Y68A 3AT1A 4E03A 2Z43A 4B48A 2ZAYA 1EMDA 4LC0A 3UUGA 1FYVA 3D8UA 1SWWA 4ME6A 1QONA 5HYVA 4WX2B 1YD7A 1J97A 1XZLA 3PHLA 3H4MA 1JH8A 5K0CA 2WJGA 3QKSB 4DIMA 4E14A 1MQAA 1O2DA 2QR2A 5GIOE 2VEDA 3OCXA 1ZKDA 3ESXA 2KB0A 3MXOA 3BULA 4LSWA 5H9WA 4RKWA 5JC8A 4TYWA 1EK0A 1IUKA 1MDBA 3L82B 5FI5A 3DOFA 4UD6A 3A06A 5ALLA 5CIYA 4WHMA 3IQXA 4D80A 1NVFA 4L57A 3R5SA 1WQ3A 1U0TA 5DCWA 2HQ1A 3FCSB 1PR9A 1ZA2A 1SZCA 4KWCA 3NDJA 1Y4DE 4TUYF 3UANA 4YRLA 1T1RA 3F98A 2P4EA 4EY7A 5JZSA 1D3AA 2YJ3A 5CVEA 2MYNA 1L7XA 1OZGA 1KKMA 1C7ZA 1T2EA 2C00A 3EULA 4M1OA 5KNCH 2P2GA 3FD8A 4GQBA 4AD8A 1UXOA 4OQXA 5PGMA 1LLDA 2JGJA 1B4DA 2GN6A 4C2BA 2GBPA 3I34X 2O9JA 2VLBA 1M6EX 2YFQA 3CUVA 1D0VA 1ZOSA 2F4NA 5HHTA 5HJEA 5F1PA 2YASA 4O1IA 3GLGB 4R2WA 4OO3A 1KOJA 1QP0A 1TKBA 5BWLA 4QXAA 4BFWA 1R6BX 2EKBA 5E1MA 4DBLE 3CNBA 1UBTS 4L1KA 2VXOA 4QSHA 4X24A 2GBIA 1EK5A 3DVSX 5EYPB 2JLRA 1DDOA 3RG2A 3UKOA 1TTQB 3C8UA 2VBCA 2B8WA 2B4KA 3HKEA 3FGZA 1PZXA 1JAIA 1Y1KE 1AVTA 3B3FA 3EZGA 4GPD1 5DXJA 3NDBB 2CD9A 5TNXA 5CT8A 3NOXA 3NWBA 5B3LA 1UFVA 2BM1A 1IOZA 3G2HA 3VR5H 3SVTA 3I9V6 1ECFA 3A3KA 3LFTA 3MJCA 4DT1A 5KS2A 2NU8A 1JHPA 2UUBB 2DFNA 3GQVA 4V2UA 4BFXA 4F9GA 1GCIA 1KAMA 5CDSA 2OAP1 4KAXA 3OZTA 2R3SA 4H3KB 5HGJA 4EG6A 4Y67A 4OHYA 4D9MA 1P60A 2J0SA 1KVUA 1W4CA 1M74A 2ZITA 3KG2A 4MDHA 3GLQA 3IQHX 3Q9SA 3UM9A 3RTCA 5DNDA 3FNGA 3ZCUA 5FADA 4DQKA 4CCWA 2IBTA 1PJBA 3G9QA 1PJCA 4WK4B 4KWIA 2C7VA 3DLIA 4IJUA 4WZAE 4CM6A 1Y8AA 2UVDA 3B53X 4OMFG 2XGSA 3BWCA 3C6XA 1Y6FA 2XDQB 3SR4A 2JGAA 4RHYA 3TFOA 2ACEA 3CB2A 3OZFA 5FR2A 2JFZA 3COSA 3UVEA 5CMLA 4MB2A 5DBHX 4BATA 3VNVA 1FRZA 3F2VA 3OIYA 5FUYA 3TL2A 1PR2A 4BPBA 1B6RA 1P5RA 2OO5A 3TUIC 3UAVA 1EUDB 3O73A 2JAXA 2P3SA 3GRVA 1MB2A 5DHUA 5H4GA 2JAUA 3KSDO 2FE1A 1KPGA 1D9ZA 1RAIA 1SUDA 2AR0A 2O3UA 4HDKA 4M8SA 4TQAA 5JO0A 1ZMXA 2R2AA 3EW7A 3I0MA 5IAJA 3ECCA 2XCUA 3ONDA 1FMTA 3KVOA 4B35A 3EXHC 5I5EA 5KOJA 1PR5A 1YOVB 3JQPA 4OMCA 1RYDA 5EIHA 5HFAA 3WK8A 4OQQA 1XRSB 1YZ3A 2QM3A 1Z2NX 2ZUUA 4IQGA 1M0SA 4BNKA 1OZ0A 4FE3A 2O0LA 3Q9LA 3WTCA 1Q7RA 2VH1A 3LHDA 4K46A 5T6BA 1ZD8A 3R2JA 1ZD9A 1SBCA 3OZEA 3QXSA 1ODJA 4G81A 5FBQB 3Q8XB 1W5AA 4E33A 3KFVA 1AGPA 4ZVVA 2Z8XA 4IVRA 3AF1A 1AH2A 5ESWA 1Z29A 4B45A 2BCGY 4KO1S 1A97A 5HMMA 5JZ9A 2Y6VA 3LLSA 3G2NA 1Q16A 1F38A 1VKRA 2FPKA 2Y8EA 2XE7A 3O9ZA 2GUGA 4G65A 4DEVA 1WA5A 4E30A 2E5LB 3FCXA 4GKVA 4PICA 1YWGO 2W6NA 2VA9A 3HZZA 5KSWB 4DPLA 1GAQA 3R1IA 721PA 2RFLA 1J70A 1NXSA 4AC9A 3OIWA 4IGFA 2IEZA 4N7RA 4FFVA 1E4VA 3LDFA 1JYEA 1OYYA 3PUZA 3B12A 3Q2KA 3S2YA 1Q92A 1Q1EA 2RIRA 4F86A 1KETA 3NNNA 5FUQA 1M2EA 3CLSC 5FD8A 4ML3A 3WJAA 4MICA 1LKZA 1Y4UA 1ZH2A 2QOEA 4LWZA 4ZXFA 3SHOA 1RXUA 4MWOA 4W5WA 1AGYA 1YI1A 4JENA 4RZSA 5F73A 5ALFA 5I9MA 1FYWA 2R60A 4L6IA 3RH0A 1E96A 1V8FA 4HUTA 4B3RB 1IDOA 1AQUA 3NXKA 4PIMA 4YC7A 3LCUA 4HX9A 3LCJA 1UXJA 2QAIA 4LHSA 2D1SA 4URUR 3I64A 5LU8A 1DB3A 4A4DA 3I76A 4JC4A 3SBXA 8ATCA 1A71A 2G71A 1C4XA 2QRUA 3EJWA 3JQ7B 3OA2A 3P9XA 2R85A 4TRJA 1HZJA 1RQPA 4DA8A 4BVJA 1L9KA 1HMPA 2W7TA 3ASZA 2AVNA 1YRWA 4RJIA 2PMBA 3KZVA 3WIUA 4D79A 4F92B 4QT4A 2CMKA 1OR8A 1T4CA 3AHIA 3BTOA 4DBVO 4L74A 5G1PA 1N6KA 2GI4A 4DJAA 4LY0A 3OPNA 1GA4A 4GW3A 3GJ8A 3V4SA 5KWJA 1W0KD 2K6GA 1GFWA 2G72A 1Z2EA 3L0ZA 2YW9A 1UJ5A 1XNRB 1VHDA 2FP4B 2PZKA 1OBHA 3TW6A 4BLTA 1E3QA 4UUAA 2VJMB 4DA7A 2B7LA 2X40A 4TSFA 3QX8A 1S2OA 1EFAA 4D44A 2J7KA 4YJDA 4EHHA 1GTJ1 1JJFA 4YXWD 4MKFA 2HRDA 2FXIA 1E58A 2VUIB 4FDVA 3C97A 1OGYA 1QHYA 2ECOA 4X7BA 5T64A 3GH3A 1K89A 1XXHB 4LDPA 5EKDA 1NAHA 5TC4A 3OIGA 3RBZA 3ORHA 4J03A 3OHMA 1SUBA 3TBKA 2RH5A 3DKIA 3EMBA 3I52A 4LXGA 4ZAYA 2HLNA 2DYKA 5E6RB 3ZBUA 2G28A 4CMBA 1HDEA 4MWGA 3OE4A 4BQEA 1LLCA 4BGIA 1XMXA 2UV8A 2WU4A 3WLSA 1XI2A 4GX5A 3TDKA 1O6ZA 2WFLA 1LSUA 2Z1DA 3C3MA 2Q62A 1TT7A 4FOTA 1M1YA 3HI6A 3H99A 3S27A 3UQZA 1O6CA 3DC2A 4N3AA 3FNRA 2ZIZA 4KQJA 1J8FA 2VP6A 4O4LA 2H29A 1XD2B 4L95C 3FYCA 5J43A 5LU9A 1W1WA 3DNMA 3KUCA 4RFSB 5CR9A 4BV8A 5IXYA 2ZJBA 4IMPA 5CUQA 1ULSA 5IJZA 3NRCA 1KH2A 4YDHB 5K9ZA 4I4LA 1PWEA 1NOKA 1ZSVA 3GJ0A 4TKVB 2YOFA 1L5LA 5B4TA 2CDNA 4F6RB 2HV9A 3CZMA 3FNFA 1K06A 2XUQA 3OF3A 4XVHA 5JNUA 5KQPA 2B3TA 3UBTA 3TR0A 3TJRA 2HT6A 4IW3B 3HRHA 2IYXA 2EZ9A 1H6CA 2YQ4A 2JGFA 3ACBA 3HN7A 1NI4A 1NJGA 3JZDA 5DLPA 2J3IA 1MORA 3MRVA 1TK9A 5LBIA 1NQUA 2Y71A 4LDZA 3OOJA 4UEJA 3WLJA 4CV1A 4DA6A 5EIWA 2QN6A 3LP8A 3PXEA 2NQ8A 1WB5A 4ZQCB 1X1EA 2G1UA 2OXFA 2O1SA 2HZ7A 3OQMA 1OILA 2NZVG 2PPVA 4Y0NA 5C5EA 4RPHA 5CVVA 1SK8A 4XRRA 1MDFA 1XDGA 1R6TA 4QUDA 3U3DA 3GJRA 5A4IS 2AUMA 2XMZA 3A6KA 4EY3A 5EUMA 5L45A 4AQYB 1URPA 4XSGA 1A4XA 1SQ5A 2CSXA 5AVSA 1PEKE 4W9NC 3WA6A 2BISA 5BV8A 2ZUVA 5JARA 4XVRA 3IGFA 3E7DA 2ORED 4CKZA 2AK2A 1VLJA 3DDCA 4ZZIA 3I42A 2YWDA 2QG4A 2Q46A 4JJZA 4KQ9A 5F2OA 5JWHA 4G4IA 2J9XB 3QI7A 4DEYA 2IU3A 3HWWA 3C4JA 1J1UA 2AGVA 2B36A 2DH5A 3C70A 1GRCA 1RXSA 4OB8A 4YUYA 3U6BA 5F9HA 1V1MB 1X70A 4PS0A 2EYUA 4D82A 4W1PA 3H9JA 2CJWA 4CCSA 4UTZA 1CEYA 1R5BA 3RWOA 4NHOA 3FYUB 3KPVA 1IY9A 3OOSA 4RFLA 4W5HA 5HFJA 1P9NA 3U4MA 4HGZA 2R11A 4LV8B 1V2GA 1DBSA 3ZWOA 5A9SB 1OI2A 1QHXA 1L9XA 2JAQA 3HXTA 3DLCA 4G9BA 4EG0A 5CBPB 3GB9A 4RL4A 1WQ4A 2Y05A 1FSSA 2XJ4A 1RHRA 5EJ5A 3C16C 3BD8A 4K0RA 1IY2A 3CT4A 3DEHA 3HNPA 3CVXA 1I24A 5I7HA 2HBQA 2QD4A 3KOWA 3KL4A 3VPXA 2W22A 2DZDA 5F4BA 1QBGA 1JAXA 3LK6A 1DLIA 4KYUA 4KFUA 1IATA 1ZINA 5BSHA 2FEAA 1CUCA 1DEKA 4GOMD 3VHXA 1BDHA 4QUIA 3ZDBA 4MK4A 3VX3A 4PYKA 3A7DA 4BO8A 1FX0A 1YBMA 4I6JA 4NONA 4Z0PA 1M2NA 5TXGA 2NM0A 4ESHA 2JATA 3SJZA 4QD3A 1R0BA 1QZXA 4J6EA 4CE6A 5BVGB 4DJJA 2W8BA 4RETA 3JAKB 3FI0A 3FMVA 3ROKA 4M7OA 2BKLA 2XNJA 3FPAA 1KZ7B 3W2TA 4IDNA 2I7XA 1QIIA 1OJ7A 2RHCA 3TQCA 4K9LA 4Y6PA 2PG3A 1SCIA 4MUYA 2PLNA 3UWPA 1OLUA 1SC9A 2DLNA 1MGPA 4BLSA 4DNQA 4BNUA 4K6MA 2IKSA 3D8TA 3JVEA 2RGRA 1EE9A 3RTBA 1CR2A 1G4AE 3PJRA 4KITB 4P7GA 1V16A 2XNSA 3AR6A 4U2EA 3PGJA 1X7WB 4J4HA 5E7IA 3GAMA 2A9FA 2JKZA 3OIDA 3V8MA 3U7IA 3AVVA 4EZBA 5DI3A 3L7DA 3QXJA 3LDHA 5JH7A 1E7WA 3ZDCA 1G7TA 3BWDD 5G4KB 1VYVA 3P9CA 4UNNA 3G9XA 3P4UA 1QIHA 2WNSA 4JL5A 4EJSB 4J0GA 3DVAA 4N8DA 4PNZA 2N9UA 2XMCA 3PYMA 1F8GA 2VQDA 4L0DA 4OVKA 5A4JA 3VI3B 3I8XA 3KYDB 3PXXA 4S35A 1CFJA 4IFIA 1PVDA 2OD7A 2B2XA 1YL5A 3AUTA 3LT0A 4FGZA 4HQ6A 2HU8A 2P7IA 4XIJA 4F21A 4Y6LA 2HMSA 3DEJA 3P71T 4G5XA 4BQFA 5JCJA 4LXYA 1FF9A 3QNUA 1H4TA 2ZI9A 4LZWA 3LPCA 4JQZA 3RC3A 1WXIA 3T5MA 4GOXA 5GADl 1Z2AA 3EFBA 3X1WA 1RMYA 1K92A 3NHZA 2GPNA 3F1LA 3GT0A 2MSCB 3PCRB 1UDWA 4C03A 3M6WA 1ZD4A 1IPEA 1T5DX 3CY6A 3BKXA 3P5BA 4ZHQF 3AVUA 2Q1UA 1QH1B 4JX9A 3FI9A 1CEEA 1U3FA 1JLRA 3NC1C 5AJYA 3IT3A 4XUGB 5HKAA 2GM9A 1XV5A 2YVQA 3GU3A 5GZ3A 3C3PA 1B76A 1PIWA 5K0FA 1E3EA 3KLMX 3QX9A 4HK4A 4RD0A 3ETLA 3I0ZA 3WKCA 2W90A 3RC7A 1PJ2A 3SBOA 2ZE5A 3JWEA 3FB4A 4JZKA 4V3BA 4B3FX 3R5XA 4JI8B 2B99A 1L1EA 3CTMA 2HWKA 1C4WA 2FN9A 3IB3A 1SOAA 3QFTA 1VJ0A 2BKVA 2J6CA 2RK3A 1E77A 4RD4A 1ZCBA 1HOXA 4RENA 4KE6A 3I8SA 2G0NA 4ZYYA 2ZJ0A 2H18A 1ZCFA 3HHEA 3T7AA 4GH5A 4NYIR 5I45A 5HX7A 2PQ2A 5EKTA 4OJYA 3HKDA 4O4LF 2NYVA 1MJHA 1T8YA 2IYYA 2IUFA 3ZZTA 1I2CA 2E87A 4QQRA 1QHHB 3GFGA 621PA 3IMFA 5CFNA 2XGJA 1BCSB 4LMAA 3ZPXA 4M1YA 1PK9A 3QU7A 4R01A 2BFOA 4EW3A 4RPGA 2NTVA 1PNRA 1QP4A 4AJ1A 4NL4H 1FUYB 5I01A 2EZUA 2R62A 3FDIA 4WOJA 1EP1B 2G8NA 4FBMA 4DLZA 1UDBA 1W0CA 3W2HA 1RHJA 5KWIA 2Y66A 2VF4X 1KEPA 3AM5A 4QQNA 5A7GA 1FSZA 2QA5A 3GCDA 4M99A 3RJZA 4A03A 6REQA 1E9BA 3FNQA 2J9YB 3ZVNA 3ZOZA 3B3JA 1UEJA 1G9XA 1E89A 2FWNA 4L78A 2DLDA 2PJRA 3CURA 3ZEIA 1R0YA 1FFEA 3G5AA 2A78A 3OZIA 4QEDA 4PG6A 2O1XA 3I9MA 4CJXA 1MXFA 3ISVA 4KMRA 4X20B 3EXFA 4XQEA 2X3YA 3L92A 4DMKA 1S9DA 5ALTA 3V1YA 3AQIA 3EIWA 3H84A 4I08A 4BVGA 4B4DA 4D9HA 5I7UA 4N01A 4GEGA 2DT8A 2VHTA 3FAKA 2BM8A 2WWFA 3EUFA 5FL3A 4OQFA 2A5YB 4G1EB 4HFRA 5EJ9A 1R88A 3FSEA 4BPRA 4F1WA 2QN8A 1DNPA 1KJ8A 3PQ7A 3T4XA 5L53A 4YP7A 1VP3A 1L5NA 2R5NA 2OC9A 4YCJA 3PJDA 3M2TA 1USWA 3PPIA 5CIQA 2L69A 1EGVB 1VPTA 2D8AA 3QQPA 2WJZB 4G86A 4HCJA 1YFZA 2DKOA 2EDAA 4YP1A 2R66A 1HBJA 1VYUA 4IIVA 3ZVLA 4TYNA 5KU7A 2BONA 3R9XB 1KORA 3ADOA 2YWCA 2JIDA 2VP4A 3P0IA 1NBIA 2FLKA 1X7YB 3K2EA 4NU6A 5A62A 1YTUA 5EP2A 2O7RA 1PLLA 3W05A 3MS2A 4ZDKA 1KJZA 1NVVR 4LJAA 4ZT2A 5LB4A 2FX2A 4GLLA 3L7NA 1WNFA 3HXMA 2E4AA 1JYFA 2GEBA 2O2CA 3QEMA 1P0CA 2J67A 1EFPA 4IHQA 4BAUA 1AMNA 3IP5A 1G20B 3TZBA 5JCOA 2LRHA 1Z16A 4OXQA 3UC5A 3S81A 4X64B 3ZE2B 3E58A 4JLWA 1RC8A 3D4LA 3QM1A 3PUXA 3ZQJA 4Q9HA 1PFUA 1D5CA 2N0SA 2OESA 1O77A 1XTJA 4PHTA 2C1XA 2JNWA 3WADA 3SF0A 1E3WA 2EIXA 1ZLXA 3HY6A 4GXTA 4P36A 2RE8A 1YONA 5H68A 4Z9XA 4HAYA 3UCFA 3AY0A 3H5NA 2GBFA 4D3SA 3BYZA 3KP1A 4P0TA 1KO5A 4Q9IA 1IY0A 1O9BA 3CT6A 2EL9A 3QUQA 5I7SA 2ZUBA 5HTKA 5ES4B 3K09A 3OCYA 4J29A 4JIGA 2XY4A 2IV7A 3V2HA 1Z22A 5FCDA 1WEHA 2J0QA 2ID8A 2PL3A 2WTMA 1RT9A 1MP0A 3KJZA 4G4SP 5AKIA 3VJMA 5D86A 1NMXA 1NW3A 2Q41A 1XQ6A 2VDVE 4JLVA 5BQPA 3SHVA 4JYAB 3V55A 4N5MA 2XBUA 4ARCA 4RQTA 2PE5A 3PJGA 4RMHA 3WV5A 1X1QA 2C4WA 3IVRA 3ZHYA 1IM8A 2G25A 1SG6A 4DJ5X 3FSGD 1GZSA 3V1TC 3H6GA 1G4UR 3MCTA 4R1UA 1YUBA 4AX4A 3N2KB 4Y2QA 2J08A 5HIAA 5E8JA 1KTIA 4LTDA 2G70A 4RMGA 4JNKA 2G9QA 1RQXA 1Z5OA 2HDHA 2A92A 3DT9A 2GEVA 5B58C 3G6KA 3D3NA 4C7JA 5JH7F 2IY9A 3TRKA 3FG9A 5LQRA 4RF4A 4D3DA 4WBNF 5DKFA 3JSAA 3F3MA 4M6WA 4YUXA 2FZ4A 2NVUB 2WE7A 3HLTA 4GMXA 3TVTA 4AJJA 4LBZA 1Z2OX 3N3AC 3WFIA 4B3XA 4GKBA 4JODA 3L6RA 2QVGA 3MJSA 3FMIA 4XKJA 5IKPA 4N8SA 4OJKA 2QLJA 2X2PA 1Z0KA 3SS8A 3ZCQA 5BXYA 3AR5A 1S3SA 3EZYA 2GNOA 1L4UA 2JVIA 3B2EA 2GN1A 3AJAA 4J76A 3C3JA 1OAAA 3DKVA 1KFJB 3LYHA 3NAMA 1OQAA 2GHIA 3LUGA 4XWOA 3WWEA 5CXQA 3MC1A 1B1CA 1XDBA 1X8LA 4LC9A 3OEED 3OJWA 4A8JA 5ITSA 3PBKA 3A3OA 5FYDA 3CIOA 2YHUA 3K1YA 3NVAA 3VU9A 3LCRA 3ZWAA 3FHJA 4G5HA 2BFBB 2WIGA 3E8XA 3LSYA 4MVCA 4C5CA 4JL8A 4BASA 2H5IA 1U9CA 13PKA 3NWEA 2AHOA 3BERA 1GPBA 4K26A 2AKYA 2DLCX 5CIWA 2R84A 1RWBA 3DEKA 3VR6A 2D5AA 2QU8A 4FXPA 1Q83A 5A3SA 3UW3A 5KZMB 3IHWA 3SYLA 3WMFA 6ADHA 1QUEA 1NMEA 4UVDA 3M7IA 3WHLA 4KAAA 4C05A 4KGDA 1WZEA 1IVSA 1Y6QA 1L7VC 3R8FA 2EW2A 2XYPA 3OPYB 5EGSA 3AKYA 4BWYA 4KOAA 2AJCA 1Z2DA 4EA6A 1J24A 4B3CA 1GOTA 4RW0A 1H3NA 3TZCA 4E31A 2L82A 2OHJA 4HQFA 5AOBA 1FLDA 1WCWA 3TECE 1A8QA 3KHKA 2I1VB 4MAAA 3X3HA 4D43A 3M33A 4RXUA 2WV7A 2ISSD 2XYQA 2GKGA 3VNQA 2HJHA 4JASB 1WJGA 4NCJA 1U7WA 2V0GA 4R6XA 5KYWA 4NEQA 4NI5A 4A6DA 4IIBA 4MA5A 3TTXA 3MGAA 1XMSA 4GLJA 3ZWYA 4XGKA 3ADCA 4EA9A 5FRDA 2I3AA 4HLCA 4XD7A 2A8YA 4Q6WA 3KEGA 3QX7A 1BMTA 3SF8A 5CURA 1USUA 3THXA 1Q19A 4HAWA 1NLFA 3NOQA 1T8TA 4Q15A 3MLEA 4W5JA 3PKIA 2AYYA 4MVJD 4EHFA 1ORWA 3AX6A 4TLCA 1YZFA 2JHPA 3CLRC 4M98A 2KI5A 3ABSB 4EMSA 1E9VA 1ADCA 2YZMA 1ZIPA 1OWNA 3D4BA 4X41A 5KI6A 1S2MA 2V96A 1Q0HA 4YBRA 4CV2A 2W2OA 221PA 1YQTA 1D0SA 2HK6A 1U9YA 1WZNA 3QBVA 4NZZA 3U26A 4HWKA 5JSUA 4IS2A 1SKBA 1U8UA 4OH7A 2Z9CA 3OZWA 2R68A 4D96A 4L5JA 3OOWA 2I2XB 5DV9A 4I1VA 1U3TA 4PQYA 1S89A 1V5GA 2E2WA 3AHCA 3BE5A 2CXPA 3PNYA 1FFWA 2ZQZA 1KY3A 3BK1A 5LNK1 3ZJVA 3GJQA 3P1JA 5ECDA 1Y3CE 4BLWA 3AEZA 4D41A 5KQSA 1FRQA 1CJKC 1A72A 2PLAA 4DLLA 3DDNA 1YHNA 3COZA 3LUFA 4LVUA 4QBKA 4UATA 3A1CA 1A7KA 3A4TA 5FUWA 4H7HA 2C0PA 4UZFA 3ONFA 3TIGA 3WTBA 2QZJA 1GXSB 1DC5A 1QG6A 2OFXA 3HBMA 4HX5A 4Q93A 4YRQA 3V32A 3I30X 4HNQA 4QJ5A 3AHDA 4GVLA 5YASA 3NHYA 4YEDA 2XMSA 2ZUCA 2C7BA 1M7BA 2J0EA 3CBGA 4XR4A 2CFSA 3D2AA 2E49A 2C9MA 1UOEA 2HSGA 5ESDA 2UUPA 3A4MA 2XOXA 3OP4A 4CL0A 1UODA 1PBNA 1NVGA 3F8TA 1B7GO 1F4LA 3O03A 3UO8B 4B8YA 3SXUB 4JBGA 4KXWA 1Y6ZA 4ZT4A 2IKQA 3VR3A 1J0BA 5CTJA 5JYBA 4B0PA 2UAGA 2PM8A 3OQIB 5D5PA 5CFPA 3M1LA 4BKOA 4RD6A 2O6HA 3KKEA 3TSYA 1XNJA 2D62A 4WCVA 1C8VB 1SRRA 3HGQA 3IIEA 4EJMA 4WOCA 3R7SA 1V96A 4L28A 4CMCA 4LZZA 3MCZA 4XR9A 5K51A 3WZMA 3WQSB 4YAGA 2VAXA 1CSEE 5JJCA 1L8QA 3PE4A 5LMZA 4CQJA 2AZ4A 4Z54A 4CG0A 2GVNA 3S1LA 2BEJA 4BFTA 4J7UA 4DIDA 1YQXA 1LW7A 2Q2OA 1IN1A 3LM8A 1NNLA 4DG9A 5JCJD 1V4BA 4MW0A 1MQ8B 2NZJA 2C2XA 3T7RA 1YB4A 5KSYA 3NW9A 2Y92A 2WT8A 2E89A 3BD7A 1BS9A 1CRZA 1T43A 3OZGA 3S2GA 1LBHA 3W0LB 3ZHVA 3Q5GA 4PO1A 3QV2A 3OU7A 4HQRA 4H27A 3UG6A 3VBEA 1EBFA 3WGNA 4FIDA 4J0CA 3T7DA 2XGMA 4D4LA 2QX4A 2QMHA 3DV0A 1KI1A 1EXWA 4WNIA 3ZUPA 1Z83A 2QXUA 4ZICA 1TQHA 3U5ZB 4RD3A 3IYLW 3L7YA 4DUGA 1RZRD 4YS6A 1Z0AA 3GJ6A 1C3LA 4NK5A 1EBBA 4IXNA 3ZXYA 1HH4A 5DX0A 1NBWB 5BQFA 2PBRA 5D3MA 4Y9UA 1R6DA 3IDQA 4UPDA 4PRKA 1U0LA 2P35A 3KJEA 4BO2A 2IYOA 1OV6A 1F4VA 1RCTE 1PT9A 4YMLA 4RCZA 1OFVA 1XDSA 1YIAA 3HYSA 3M4ZA 2HB6A 4V24A 4REMA 1HE8B 1Y8CA 2NTJA 2O48X 4IIJB 2CNLA 3Q98A 4ZI3A 1FIUA 1Y8RB 3QKTA 3JD1A 4AO6A 2I8CA 2O07A 5JCZA 2FJPA 4QECA 3UJ7A 1BKSB 3INYA 4KZPA 1GPMA 5DYGA 4A23A 1DO8A 1V7ZA 4EEXA 3P2IA 3BFVA 3NVDA 5BW5A 1N2JA 1WDKA 1JSRA 3SG0A 5AVWA 5CB4A 1ZWLA 1ZX1A 4D8VA 3CF4G 1BA3A 3F6CA 4DLWA 1JHQA 2OC4A 2PUBA 3L8HA 1QIGA 2J9GA 4TZ0A 4QGSA 4ER3A 2EF1A 5JJLA 1KAOA 1YJCA 2FJ0A 1BGVA 4X8HA 2QW8A 3EMVA 2FKNA 3SMVA 5BOSB 3SDZA 5BUQA 1YF3A 1CRWG 1M6WA 4WCFA 3WC4A 5AKGA 2X0RA 1J4AA 1T10A 2NUAA 2XWSA 2VRBA 3SIWA 4DCMA 1QJCA 4QFMA 4BDSA 1MAWA 2AI3A 1JG3A 1MMFB 2FEKA 2YV2A 1T5TA 1X42A 3F49S 3AVQA 3IE2A 4QREA 4W7SA 1P2TA 1CS0B 1PJLA 3IOEA 3U81A 4KR7A 1TCAA 2VCHA 1C81A 1BS1A 1EVQA 2BTQA 5JWOA 1KEKA 4QUKA 3WBKA 2WYOA 2ET6A 2QAGB 4UUNA 1KU0A 1SPXA 2VWHA 4NBWA 4WFKA 4FJ1A 3B1YA 1UK7A 2FJUA 1SCNE 2H07A 2WFAA 1E6UA 3K9NA 2XT9A 3QVWA 2DSTA 1R3DA 1N6PA 4H4EA 2FUG1 1T9AA 4HMQA 3PQ2A 3K31A 1VL0A 1O97C 1MB4A 1MR3F 1D1TA 1S0UA 2ZB2A 3CZAA 1L7DA 4JI7B 1HDZA 1SBTA 3K0SA 4ESOA 4CIXA 3DEYX 4D4GA 5DBEX 4IOMA 5DHAA 1RE1A 4EGFA 1PTJC 3EMKA 1KYXA 1PZNA 1JS1X 1W35A 3NWPA 4YALA 5C1OA 1JQAA 2G4VA 1KJ9A 2VK4A 5AJZA 1AO0A 1H05A 3W8NA 3DP9A 3RKUA 4X92A 2HHJA 4OX9Y 3G79A 3CPSA 4P31A 1SQFA 1H2BA 4HAVA 5JLAA 1WMDA 3L05A 3WO1A 4L5IA 1J07A 1X7ZA 4UEKA 1ML3A 4EITA 2GRUA 1T9HA 3CLUD 4DSTA 3BZUA 1RQLA 1EX9A 4B3JA 3T3NA 4P4LA 3PCXA 2QT0A 5I5GA 3HCAA 1YJQA 1QH8A 1JEQB 4U6NA 4IJQA 2CFRA 2D1TA 2DGDA 4BKUA 3ZBQA 1ZGHA 3SLKA 2IP4A 1UFRA 1Q0UA 2R6ZA 3EBOA 2VF2A 4CDMA 4G5SA 2PN1A 4YCMA 1T8PA 3QU2A 1M1XB 1TLFA 1W59A 4N5IX 5DBFA 4RHEA 4IP0A 3ROXA 1XN1A 2WJIA 4R3UC 1JSXA 1OY1A 3F4LA 5DX1A 4LJ8A 2HL6A 3HZRA 3KPUA 1L7BA 3BF7A 4HNAB 1QYXA 1O6BA 4O8CA 4ITVA 1HNNA 4S3MA 5FORA 3L9WA 4ICIA 5CG2A 3J81A 1RQGA 3BQMB 4GYWA 2VZLA 3KSZO 1KAQA 3VI4B 3LNTA 3E2IA 3KCQA 1CYEA 1JIIA 1MPTA 4CDGA 1L5FA 3JWIA 3KB2A 1U5BB 4ARZA 4RADA 2RKBA 2YTZA 3JSXA 3M2PA 5DM60 7GPBA 2FGKA 5K4AA 5I7VA 2DECA 1SB8A 3R44A 3Q9UA 4H77A 3HI4A 2M1XA 3IQFA 3MTJA 4JA2A 1JIKA 3AH8A 3MYYA 1ZQ1A 4A0QA 1EYZA 1VM6A 5A6SA 4WZAB 1ZAYA 3QWIA 5B1YA 2ZRCA 5B1DA 4Q9NA 4FLFA 5JJIA 5EMJA 3OLCX 3RU3A 5EAIA 3EPLA 2VKTA 3IJRA 2IBSA 1ITZA 1CQZA 2Q1SA 4R9SA 1ESEA 5DT2A 4DB4A 1EEHA 1XCLA 2F3SA 3IP3A 4RTLA 5MGBA 1HX7A 3VISA 5FO0A 4JLSA 2OZLB 3JWHA 1S3GA 1H5UA 5T6MA 1N2CE 2RKOA 1YKSA 3ZDRA 2IY7A 4KMSA 2O14A 4JWTA 5TEWA 1GQYA 3GRRA 5EWLA 3QELA 1A27A 3T1HB 3MMSA 4V1CB 1QV9A 1TX4B 2YWEA 3LHSA 2ATVA 1DCTA 5C3MA 4G9GA 3RNOA 1XCGB 2ZXFA 1W0JA 4DWJA 1XF9A 1U11A 1QVVA 2FA9A 5D51S 2O8CB 2WM3A 3WIOA 1NU8A 1RJ9B 2QUJA 4JOSA 3WGHA 1D03A 1U0SY 5FPHA 5DT9A 3VR6D 4L4YA 5M2QA 3ROPA 1ZM9A 3KZKA 2ZUFA 1LGYA 1NNSA 1PG2A 1WVIA 1ETUA 2YY6A 3WYNA 1FK8A 3C1AA 1KZ1A 4RPIA 4MIKA 1YASA 3ZU2A 4WLOA 3ZBPA 3EQ6A 3G7UA 4UHEA 3TAXA 4EB6A 4DQVA 5E9AA 1UK9A 2PGIA 2SBTA 1GDHA 1SXQA 3RV3A 2FN8A 2UXBB 3UMSA 3N2LA 4PLZA 5ALSA 3ZE0B 4GR4A 4WZBB 1RCFA 5CDGA 5IDWA 3K6KA 5J4LA 3PTAA 4BFZA 1CUGA 3A27A 3CCBA 3COJA 1TC2A 1XDUA 4O4IA 2ZDGA 3QOWA 1RKQA 3RYCB 4JLUA 3O4JA 1Q3HA 4Y2HA 2P9EA 3GRPA 4C4YA 3ZZMA 3G8DA 3MGGA 1EUZA 5H59A 2C3MA 2NU7B 4UU0A 2ODTX 5F3WB 1OLXB 5DI9A 1DV2A 3TZKA 4CLRA 4UCWA 4M1QA 5CB4F 1VPLA 1XTZA 2O2IA 2ZSDA 4EAQA 2VJNA 5KNBA 1CEXA 3MWKA 1DJQA 2EQBA 3AL2A 3EXHA 4CQLB 2BGGA 3FR8A 4KP7A 4KPYA 1N57A 3NIDB 3B2QA 3QWAA 1WXHA 2W2LA 4E08A 4OEHA 3L1JA 2BGNA 2Q6OA 4O2AF 3DFKA 1QP7A 3FKQA 1YGPA 4GSKA 1NWCA 1EXVA 1USKA 1Z08A 3RUHA 4MR9A 3HJUA 4MV4A 2BSXA 4QBGB 4CKBB 5C37A 4HAOA 3W3AA 4B85A 3MT0A 3SXJA 1I6MA 5L7WA 1ZD3A 2NPOA 3Q15C 5CYFA 5IDQA 1X77A 4JC8A 3V2UA 2ZZMA 1E1CA 3UMVA 4IQ8A 3CE6A 1KMHB 1E1YA 3GJTA 3ND9A 5B3KA 1E9EA 3V2GA 4EKYA 2BZSA 4BP8A 1GSOA 4HWRA 2GN0A 4K9RA 3ME5A 1LZLA 2OP1A 4JKIA 5JDCC 3U56A 5IXSA 5ED0A 4BNIA 2RGYA 5FR1A 4A0SA 5EMKA 4ENWA 1RCUA 4DUPA 4PG8A 4KXUA 4LKOA 1Y7TA 1QAOA 4ZD6A 1CIVA 3QYPA 1QJ4A 4HAUA 1E79A 1AUQA 4WKGA 4AQ7A 2OXTA 2OV4A 3D64A 3EZXA 2XUGA 3U2QA 4K2AA 5LQUA 1E32A 1HPLA 2BMAA 1WVMA 3H2JA 3OTQA 3M4YA 3SK0A 4BVEA 2QIOA 1PJ4A 1GTSA 2H7XA 4H4DA 3JRXA 2W58A 3T9FA 3CCCA 3TIVA 1P1KA 2V7TA 2ZR7A 3DUWA 5KQMA 2E82A 3ICWA 2AZMA 4KG7A 1RHQA 1QCDA 1QYCA 2A1TR 3IMCA 1NC3A 2XCSB 1G6OA 3UJ8A 4JVOA 3VR3D 2H1WA 3QK7A 1XDDA 1A8PA 3IT0A 1GSIA 4QTTB 4FWTA 3FJ1A 3I53A 1PRYA 4OHMA 3GL9A 3ZHXA 1UAAA 2HIAA 3SZLA 1GFSA 1I4OA 2NU9A 3EGEA 4BX8A 2QVYX 5C8YB 5IFKA 2X6RA 1F1BA 1QGUB 3WSWA 3GX1A 3ZXUB 1N8TA 1EXMA 1XLUA 5KPJA 1XL0A 2ADFA 5CEJA 1G5RA 2AMVA 3CVWA 5DNEA 1EIWA 1Q44A 2AJ8A 5REQB 1GQSA 3GD7A 1GG2A 4GE3A 1T0UA 5LWHA 1GQFA 5CCXA 4OP3A 5L8VA 1R2QA 1TA4A 3L6BA 3VR4H 3NTLA 3O6VA 1T3HA 1ZIOA 4MUIA 3EXIA 1IHDA 4G0MA 3GVCA 1E5TA 4URYR 1UBEA 5HS6A 4B8WA 4MDYA 4XM2A 3W6NA 3IJEB 2YS6A 1UC4B 2QRVA 3DJYA 4EB8A 2OHFA 4RDHA 4YR7A 3QEAZ 2BYTA 3KKQA 4OU4A 4RSGA 4IMRA 1LXCA 3D3WA 5EJAA 2G88A 3T4UA 4BFSA 4ZFNA 1CUDA 1PWYE 2VJBA 3AIIA 3VU3A 1VE5A 4CM5A 4ZQHA 1L5SA 4BVKA 1ZNXA 4OM8A 5MN5A 3QBDA 2CLEB 2BRUC 2PA0A 1CZNA 2X5NA 1I4WA 3BRWD 2QKYA 3SDBA 2IYQA 4G07A 1NJ1A 2JLVA 1PQYA 3V4RA 2Z2JA 1LBIA 4PAMA 1GL6A 2OHOA 5IMSA 2IRWA 5TT0A 4J0EA 4E5YA 4YY3B 2D7JA 1UPBA 4RDIA 3K9BA 5LDHA 4EGSA 1F0KA 4NZOA 4HEJA 4HNHA 3LHKA 3PA8A 2XNHA 5DSZA 4ZRDA 3GOHA 4C7VA 4W5NA 3KWJA 1WKBA 1EBUA 1F2TB 1LTHR 1MJFA 2LIVA 2RCYA 2ZZKA 2DF8A 1EINA 1N1DA 5T3UA 2Q3DA 5DCLA 5JASA 4LV6A 1E59A 1P9WA 2P3QA 2AZTA 2ZRPA 4JDPA 4MLDA 2OUIA 2H06A 2VBGA 3ZV4A 4EZIA 1FSGA 3G49A 1ZMBA 3TAHA 1RW4A 1T0HB 2IQIA 3BAZA 2COKA 5K6AC 3MOGA 2EFGA 1I9GA 3GN1A 1PNVA 4UE6A 1V11A 1E1QD 1IYZA 4X54A 3K0FA 4PTLA 4EBBA 4TN1A 4EP1A 4FDLA 3OLZA 4MR8B 1XA3A 1PNOA 2VPZA 2W6JD 1AQJA 5JHHB 5EZ5A 1N5OX 1XROA 4ZPXA 1PS9A 2JLCA 3JYQA 3T1YB 5AW2A 3NG1A 1THZA 2WSIA 2R7AA 3L77A 3O2QB 1UDAA 2ZBFA 1J0DA 3K0KA 4M7RA 5A03A 1RPNA 3VR6H 1I7DA 1ZR2A 4IV5A 3FHCB 3JQGA 1B6TA 1EFUA 2OBLA 3JQFC 3ZQKA 1DFHA 2G5PA 2H3EA 4UBOA 3LA8A 3Q4GA 1YI0A 4W9NA 1EGQA 3DE2X 2C5BA 5G1OA 3WBJA 5LKAA 3G5MA 4O08A 1ULHA 1OU0A 3ESAA 1ISMA 2HUPA 2ADMA 3AIKA 3O3CA 4FMPA 4UARA 2J85A 3BORA 3LQQA 5CT9A 3BWMA 3OG9A 4RD1A 3R5HA 5F1KA 3AM3A 3RRXA 5LCXA 3M3HA 1E3MA 3DOHA 1QGED 1C9NA 1ZN7A 4O4IF 4URHA 3EC1A 4Q47A 3ZE6A 2M6LA 4MUKA 3UH1A 1W36D 1XHLA 4PSVA 3A1FA 1BTOA 3BL6A 3HYRA 4EABA 2W70A 2FR1A 2NU6B 1UKBA 4NBSA 5JEEA 4OK3A 4WY5A 2YFYA 1N0IA 3AP1A 3R0IA 5EE0A 2UYOA 5JYCA 1SUWA 4W6QA 2ZUEA 5CT5A 1QGYA 4LMRA 1IB6A 1DTEA 5AKHA 1N5KA 1JFFB 3AO0B 2Q07A 2V45A 5FNZA 4CL8A 2WR8A 2OM6A 4N48A 2NV6A 4UW9A 3RM3A 4PAGA 4U9IS 2PXAA 4Z4CA 4NG4A 1H6DA 3UOWA 1UDXA 2XXAA 3RSZA 1LDBA 1U2EA 4K6KA 3QPCA 4OHVA 1T2AA 3B1FA 2F17A 3FRHA 4FKZA 4CLXA 1WHTA 3HXKA 4LRXA 1BHJA 2QQFA 5K0LA 3KXPA 1U7ZA 3HSSA 3NRJA 4DMGA 1QMGA 4EKDA 3TCKA 3ZV6A 3H8SA 2IYLD 3T99A 5F2NA 5LXTB 1K8RA 1IPFA 1LDNA 2Q8NA 2BGRA 4IOJA 4LVNA 2WQ7A 4D6YA 1F5NA 1KAGA 2HWYA 4X1IA 4CGYA 2ZYSA 2W2XA 4BUCA 4JGIA 1ECLA 2IT1A 1LS1A 4ARAA 1CZKA 2B2CA 3AZOA 3DMYA 4MR7A 1M1YE 4PCUA 5JEDA 3G85A 1T5LA 1ZI9A 1KAEA 3NHWA 1ZDMA 3AERB 3GCXA 4DMUB 4NAHA 3PXDA 1H1DA 2JCXA 2GTIA 2DUNA 1ZUNB 2AF3C 4O1HA 5IAAA 2XLBA 4MYTA 2FUKA 3WLQA 3BHJA 2X4IA 5EJEA 3A9RA 3G0CA 1RI1A 3UB4A 3FUWA 5F5XA 5IZCC 4KWHA 2R1TA 3K6SA 3UJBA 4P1ZA 3AGQA 1YBVA 1V7QA 2J0UA 1PO7A 2YHAA 4J0FA 4N6NA 1N6IA 3BFXA 1QBKC 4L9AA 1EM8A 2FUG6 2GD1O 1YR6A 1T2NA 1JW9B 4TTPA 3QU5A 1D2NA 1VSQA 5TQJA 4NCBA 3SQMA 1U2QA 3FOAA 4QODA 4RJKA 3TXYA 3BDAA 2HA2A 2GEDA 4AAYA 1P7YA 1IWPB 3EPPA 2P11A 2Q49A 4TGLA 3INTA 2BW0A 1N0HA 2H31A 2NWQA 5I3ZA 4PX5A 2C1EA 4POAA 2GJKA 3OF2A 5L3ZA 3S8MA 5CVJA 4J4BA 3Q7RA 4URZR 4C7KA 1JLLB 3KKNA 1NUSA 1KXJA 2EU8A 1N77A 2P9YA 4E2YA 4YJ3F 1QM5A 4MXDA 4F11A 3FMOB 1X7XA 2ZBRA 1THMA 1GKUB 2ZBVA 2QMQA 1ZJYA 2C61A 2LD4A 1G8KA 2ZLBA 3W5CA 1Y48E 3LD9A 4K86A 4FFBB 2DM6A 1NW9B 4L0MA 4XEUA 1Y8QB 5EHIA 1UBRS 4BTLA 1ODLA 5DISB 3IKTA 1XVLA 4CU5A 5BWNA 2FXVA 3DMHA 4FZ3A 3HFJA 2XX3A 4GQIA 4U8HA 9GPBA 1HDRA 5KWVA 3UMMA 2OBYA 3IOCA 5FI1B 1W0JD 5AK3A 3ZWVA 4ZK6A 1RP7A 5HE9A 4CF3A 1QVWA 3PC8A 1X80A 2LUOA 1BEEA 3R8XA 1O4WA 3KDAA 3MUEA 4CKWB 4IG4A 4BXOB 4RCYA 5D7BA 1KMNA 2QD1A 3ADDA 4Z99A 2X7XA 5ITZB 5J2UB 2JH8A 3RUPA 5LR6A 2NZ2A 3LT2A 3EIOA 3BD6A 3TKAA 3ER9A 4W5OA 1IRIA 1TQ8A 1T9GR 2V4UA 5KX5A 3K96A 1NQTA 4BAGA 3KSMA 3U1TA 2I9PA 3N0WA 4BE9A 4RJLA 4JI4B 1C3OA 3O83A 4K5QA 1PT5A 3WNBA 2BJWA 2LVBA 1GAEO 2J3DA 4YR9A 1PJSA 4MV9A 4RDCA 5TS3A 3P0JA 4MKIA 1TAQA 4EQ6B 4QUBA 4HN2A 3L8EA 2PUCA 1XHEA 1AG9A 1SXJB 3NASA 3PKZA 4N82A 3FKSD 3W5IA 2B7BA 1H2AS 1HEYA 4XYBA 2WI8A 5HUJA 5F9FA 1MBZA 4JXZA 4LCBA 4US2R 3MJHA 3V4VB 5ERXA 1D6JA 2IXBA 3G9TA 2HCFA 2I2WA 3GD5A 1NJFA 3FVVA 3L3BA 1YMUA 3MMXA 4L72A 4BWFB 3NXSA 4DEXA 3DBHB 5JAHA 1X1BA 5BR8B 1Z8FA 5KNBD 4JLJA 5ECYA 4QAQA 5L6LB 5BMVA 5L9AA 1LPPA 2YV4A 4MKXA 3TLXA 2Q8PA 3V3KA 1DXQA 2X9VA 4MA0A 2O5VA 5CITA 2NO7A 1X94A 1CETA 2W2LD 1X7GA 2HF9A 4G1MB 4JEUA 3U4GA 3UMYA 4BGDA 4UPEA 2CLMB 2SCUB 5I9BA 3REGA 1FFXA 2XDYA 4D8WA 4GM0A 1NNUA 2VPPA 3FJOA 3V1LA 3LF2A 4D57A 1BN6A 2YV5A 3DQPA 3W3AD 3WGKA 5HM6A 4JSRA 2AKEA 1IXKA 3S44A 2FFRA 1GCGA 2BMDA 2B4TO 3WYAA 2O8DA 1FTWA 2IDMA 1UBHS 3SNKA 4KUEA 3Q1LA 3MFQA 1JILA 3DHWC 1XELA 4KPFC 5TMPA 5KNLA 1RJWA 4F3RA 1RLMA 3A58B 5K4HA 2O1EA 3ELBA 3JWGA 5JVDB 2WG2A 3VHRA 4DBLC 5BV1A 5JZBA 3B8EA 1P4SA 1ZNYA 3I2JA 4JJFA 2LW7A 4JP3A 4EI7A 1XRJA 3U3OA 4A0GA 2WK1A 3EGXB 5B7PA 1NBEA 3Q40A 1BVUA 1QS0B 1WIWA 5KC8A 1FMJA 3C5WP 1ECCA 4I1PA 2RHBA 1PJZA 1E79D 3J7TA 5E1BA 2CNWA 1LSJA 2CZQA 5AXCA 4BLPA 3CLSD 3LW8A 3G0IA 5AHXA 4L85A 2G9NA 2SHKA 1F9EA 4GXQA 1T5SA 2P3LA 1WF6A 5BP7A 4EL5A 4AT1A 2I6TA 4MP6A 2NQTA 3ZKAA 1M10A 4FFRA 1T26A 1M67A 1D6NA 1DC6A 4RMNA 5EZSA 4NDAA 2NXEA 5JYDA 2PFSA 3AF6A 2EERA 3BD9A 4Z5XA 1QQ5A 2H57A 3UAZA 5LYYA 2FW9A 4LXHA 4MW1A 1IZ0A 2VP5A 3NBFA 2V59A 1SXPA 1S4QA 2FWMX 3H2HA 4WIAA 4OSPA 1VFPA 1ZOOA 2XI4A 3C3DA 3IPYA 1YR3A 4F84A 2ZUDA 3PWSA 3K9GA 1EK1A 4QOEA 5DZSA 1WUJS 4H4CA 1FLVA 1E6MA 2BP7A 3VMFA 1IZ8A 2XA1A 3LPNA 3ZZ1A 4P92A 5KYXA 5TIIA 4HRYA 3AEYA 4BJ3A 1E0DA 4LJ9A 2I4IA 1WMEA 1ZVJA 1GL3A 2ZTMA 4E3ZA 1E1MA 4BLRA 1TKAA 2XDWA 1C1XB 2MR6A 1Q1NA 2P9GA 2UYQA 4J0DA 1KZYC 2GN4A 1Q1GA 3GROA 3UAXA 3HRKA 4C0KA 2RGNC 2FSGA 4Y2RA 5AIBA 3TK1A 2HV8A 5IKOA 1DBVO 3OJEA 3C43A 4QUHA 5AI0A 1V41E 1YQGA 1GG8A 2C8KA 2A1UA 2R7KA 2A5LA 2C42A 1FOEB 5KQLA 1FDRA 1HE4A 1NVWQ 1Q0PA 3BBLA 1V1RB 2OORC 3FE2A 2YINC 1DQYA 3L8YA 3P2EA 4HLUC 2ZUTA 3CM0A 4HNVA 5LMUB 3R9WA 1GZ7A 3MPUA 1Y0BA 4ZQEA 3GRKA 5L3QB 1AQNA 3D9QX 1P2UA 1W19A 2OPHA 3Q6NA 4QGGA 2GJAA 3A6ZA 1NURA 3GT3A 3IELA 1AHHA 1QIEA 3EG9A 4HMOA 3EIFA 4D97A 4UHHA 3EDRA 1AZTA 1XTRA 2YZNA 2GN8A 1LRLA 1BU8A 4NE2A 5M04A 3SSMA 2H1RA 2PZFA 3HB9A 5E1DA 4B2PA 4OJMX 3HL0A 3K5WA 3NCHA 2WT4A 2EYQA 2WHRA 3O4IA 1QIJA 1L4BA 1Z4MA 2VHZA 2VJKA 3BJEA 3CO0S 3EIQA 2OHXA 4D7AA 4WSOA 3RU7A 4LXQA 5JSZB 1DC7A 1UP4A 5FHQA 3RHZA 2JFVA 1U2RA 4NE7A 5HBGA 3WK5A 1KP2A 4II7A 4FEEA 4II3A 5JECA 3OTWA 4PGAA 1ZI6A 5JPDA 1CK4A 3AR8A 2IYSA 3SVLA 3PGXA 1C1DB 4FFMA 1JIQA 3E05A 4IGAA 1W75A 4B3GA 2Y0BA 4YN3A 1TZ2A 1T4BA 4QBTA 1C7EA 4HDMA 3BUSA 1AF7A 1T4GA 4YHBA 2IDKA 4OREX 3RG8A 2IC5A 1TMYA 3AETA 4R54A 5CCDA 5TVKA 3CW9A 5TQ0B 3HK2A 1W7AA 3A6LA 4GWLA 3C3AA 3CKYA 4MEJA 2R8YA 4AN1A 1XMVA 2OZKA 1XEWY 4FYPA 2GPBA 4JQYA 1ML4A 2FW0A 4FOSA 4PW0A 2YIJA 4G4JA 4DCGA 3U1BA 1BH6A 5FWXA 1UPUA 3FVWA 1WSDA 4FCCA 4GXNA 5CK4A 3T9DA 1I01A 3CF2A 3QLEA 5LP6A 4G8JA 4HDRB 1WPQA 4D56A 1BOOA 3SI7A 5FBWB 2O0MA 3FFAA 4IWXA 1LV7A 3TRDA 1TUGA 5KKAA 3OE1A 4DQUA 1A9OA 3DE7X 3BCHA 4Q82A 2E21A 3B38A 2GMWA 1K0UA 1GAXA 1QRTA 4BGUA 2RI0A 4KWEA 4BU1A 5IVIA 3NB0A 4C0AC 1UT5A 4R3NA 3DXZA 2D4HA 2HA3A 5JMOA 1GM5A 1Z0UA 2AOWA 1WZ2A 1GL9B 1Y3HA 2DH6A 4YPVA 3E7XA 3THYA 3HLYA 5SICE 4LQLA 3B5IA 4KMOA 1AKTA 3SEQA 2F00A 1FCJA 1HL3A 1VCIA 2PRZA 2VNKA 2WTNA 1IB0A 1JXOA 2MSLA 4MQ5A 2ZI4A 1MC8A 3N1UA 3NEAA 4OUDB 4NENB 5JNVA 5KYYB 3VV2A 1N5DA 4WUTA 1CLEA 4S24A 2NT4A 1JDSA 5IC6A 5K0SA 4JKYA 4NXNB 4B7XA 3TLGA 3A1UA 3W2EA 2QBYA 1X8JA 2IEYA 4PZZA 5BMVF 1MD9A 5IYZA 4X90A 3O8NA 1U0JA 3AHFA 4FZJA 3O84A 1AX9A 1MJ5A 1W4RA 3IVCA 3O3OB 3RB8A 4EPRA 3ABRB 5ALMA 4EG8A 5KNBH 2ZJOA 5LZ7A 5BUCA 1NRIA 5JAZA 2ATIA 2DB3A 3H4TA 3J81k 3AB8A 3E70C 4OFXA 3JAWB 4RDXA 3RE1A 1FJ2A 1QE3A 2R87A 5GOZA 4JLMA 5D3KA 3MTIA 1X7DA 5LZ5A 4LZOA 1WDMA 4QEKA 2PNJA 2GLUA 3TSOA 1KVRA 1EFRD 2CJFA 5T3YA 1ZH8A 5B1SA 1WPRA 3PB3A 3REOA 2B1GA 2D6FA 1QFMA 3WLAA 1PQ4A 5B12A 1T0PA 3GUYA 3JD0A 1G8SA 1QC5B 3JD3A 2HGSA 3H9QA 2VC2B 3ELYA 4NULA 3W3AH 3JARA 3JASB 2BEWA 2RARA 3AY3A 3PNOA 2OV3A 1RBYA 1BJTA 3AKCA 3WFZA 3ZXXA 4ALNA 3PUWA 4JKOA 1LVHA 2ZYWX 3BFPA 3JD2A 4QE3A 4IPTA 2B21A 3MUNA 1RWQA 1MV5A 4PWYA 3KELA 4PF1A 3F78A 2DHQA 3QKWA 4HQKA 4P32A 3TEJA 2Q5HA 1WW8A 4DLRA 4KR3A 3FCEA 3C4VA 2B34A 3OQOA 2Y1OA 4MB6A 4MQEA 4H17A 4MQBA 4OOEA 4QFDA 1FMFA 2V5UA 3EEFA 4KVGA 1HZZC 1TO2E 3ISJA 3I2FA 4OQZA 5IJ9A 5IJ0A 3LUKA 1SK9A 4O6VA 1K0FA 5I8PA 3GUUA 1D2EA 2MYTA 4L8YA 1KOFA 3NIWA 2VYQA 3NT5A 4KUGA 4MINA 2C9DA 4O4JA 1T1JA 1GUAA 1XEXB 1UT8A 2QN1A 3U62A 1BDMA 1V8BA 2ZEJA 2P77A 3CLVA 1AS0A 1JJ7A 2V9ZA 1ID8A 1GPLA 3BMOB 3BZWA 3MINB 5F7JA 5BN5B 3A6GA 3UMFA 4PY2A 4RNCA 3JZAA 3OOYA 1FUIA 4WXRA 1JQJC 5ESXA 5EWMB 3W8EA 4Q18A 1HOTA 3PUIA 5HKBA 3B60A 4EHAA 1W34A 4QNMA 4YRNA 4JJ6A 4F97A 1GHTA 2HIHA 4Q3BA 5A5VA 3DF7A 4O2BA 5DK6A 5NULA 3KFLA 1WM1A 4KGVA 2XAAA 4MUAA 4B31A 4BUZA 2I4OA 3UK6A 4QO8A 5K99A 1ZNQO 2PH7A 5KINB 3VAAA 1GT91 1GUYA 1I6KA 3OX2A 4JL6A 1E2IA 4YASA 1U02A 2SNIE 2TMDA 3HZOA 3N5CA 4W7HA 1MAHA 2O23A 3N8GA 3DL0A 4IX9A 1DBWA 1QX3A 2X5XA 3OETA 4MDFA 3CSSA 3L9XA 2RHHA 4Z2YA 3D4NA 1ZI8A 1Z3IX 2VHCA 1PL8A 4ARBA 4GS5A 1QF7A 2H63A 4YMHA 5JWRA 1V9LA 2AS0A 3H83A 1CIPA 5LZ4A 3TG2A 4LOHA 1KC1A 4OHRA 2OCDA 1E7RA 1RWOA 3H6HA 2P2NA 3HFSA 1E4YA 3IDAA 5A7HA 4W1QA 4TWZA 5HVNA 1AXRA 3DWGA 3KUDA 1AU9A 1XMQB 2N75A 1TW2A 1DT5A 2Q3LA 1C2YA 3NTXA 3K7EA 4MRMA 1U6KA 3SEAA 1N2ZA 2CB9A 4B7UA 4FT2A 3D59A 4J3JA 1FDUA 2AR9A 1UKYA 4C6TA 3H9BA 4FJ2A 1N0WA 1AKUA 3BSWA 4P2BA 1W4ZA 1LVUA 2ZUSA 3DM9B 3MBKA 3U7JA 1KS2A 3FPGA 4LI0A 3W4KA 4PG5A 1TM1E 4F2GA 3O8OA 4XI9A 4ZYTA 1EAMA 4TWRA 2YV3A 2C5SA 5EJGA 4XOIA 2PTHA 3RWBA 2OCPA 5B5SA 1R9GA 5TE9A 2ONYA 3AMVA 1RIFA 4ALIA 2VXCA 4HXYA 4CM7A 3PFCA 5GIPE 4I5DA 4WA8A 4DA0A 2FR0A 2JFUA 1HFEL 1OPXA 2QUHA 3GFVA 1AKVA 2IXAA 3BH0A 3GLHB 3QLVC 4NHEA 5KJ6A 2CY0A 4FN5A 2PWAA 1OMOA 3JW8A 1ESCA 3Q8LA 1PQUA 3NANA 2RGDA 4FEYA 5TQ2A 1W46A 1T3SA 4BE4A 1VMDA 1N0UA 3T4EA 1ZW6A 5CPBA 4AG5A 2VXYA 2YR0A 3RS3A 2BFDA 5IF3A 3SKVA 2WB4A 2XVAA 2ZRLA 3QF4B 4LCEA 4V0RA 1JA0A 2D54A 4NF2A 1R4NB 3HU1A 1GPKA 1OIVA 3A6PC 4GX1A 3BE6A 5THKA 4HWOA 3QVTA 1P2SA 4M1ZA 2A0XA 5FOWA 3TVDA 3ZKWB 1FSPA 2IJGX 4M36A 2CFCA 1K97A 3R6DA 2GFIA 3II6X 4X63A 4OXRA 3MGKA 5CD9A 2P9FA 3AB7A 2C3OA 3VXKA 1UPFA 4IIXA 2J41A 2AQ8A 5FT9A 1Y5MA 5LP6F 1MHTA 2Y1KA 5A0FA 2QJFA 5F12A 3UJ6A 3X1ZA 1U0BB 1GU0A 5A02A 2XXBA 1MO6A 3F1KA 4B2LA 1MC1A 5B4UA 5FBVB 1UBMS 3LNCA 1VIMA 4H7KA </