5DGCA

Reaction of phosphorylated chey with imidazole 2 of 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
molecule keywords Chemotaxis protein CheY
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dgcA00
2PAFA 3O21A 4RKQA 1RNLA 3TX6A 4B09A 3FFTA 1A0OA 2NZUG 3GBVA 4MLCA 1MB0A 4WXEA 2CHFA 1PNRA 4DN6A 2A9PA 1DP4A 1U2QA 4EY3A 3O1IC 3O2SB 2J48A 4MRMA 2FMKA 4NV3A 1NATA 5DLEA 5B3JC 3T6KA 1PHRA 3O2QB 4MRMB 1DBWA 3DLHA 1NXOA 2NUBA 1RXEA 1TMYA 4LDZA 3RVMA 2WB4A 1NXPA 3IDOA 4TMYA 2WRZA 2X7XA 3SG0A 1H9CA 3KHTA 2H0AA 1Z13A 5B3JA 2HJ9A 1JDPA 3OO1A 5KQMA 3FFWA 2IPMA 2WMYA 1AB5A 5KWSA 1DCMA 4EVSA 2FEWB 1RZRD 1J56A 4JA2A 3LKBA 2LBPA 5DTEA 1DCKA 3T8YA 3O2JA 1CYEA 2JBAA 2F8TA 2MYTA 3URMA 1CEYA 7ABPA 1JFVA 2P4UA 5JNRA 1BDIA 2ID7A 4YLEA 1ZH2A 3KTOA 2ZAYA 2PJUA 3JVDA 3H5VA 4IILA 3GBPA 4EYQA 4QYWA 3SNKA 4OLBA 3OM0A 5FBHA 4WUTA 4KREA 4XLTA 4Z99A 2E4XA 2FSPA 3Q7SA 3H5LA 1USGA 3KS9A 2JVJA 3RVNA 4LZLA 5GOTA 3CZCA 2PE5A 4EYOA 3LUAA 3N0XA 5CNKA 1Z17A 2L19A 4ZMSA 1ISSA 3EAFA 3C3KA 5E3JA 2YHBA 5TPWA 5KQGA 3QLVA 4IGAA 3E3MA 1JF8A 5DKFA 5TQ2B 3A10A 1IIBA 1PNTA 2PKXA 3N6VA 2IPNA 1FSPA 5IUKC 4YGXB 3HV2A 3MA0A 1JLKA 4KK4A 2TMYA 2DRIA 3G1WA 4MAAA 5KC9A 2PL1A 1USKA 3ROFA 3IPAA 5KI6A 1AB6A 3NNDA 4YRZA 5TQ0B 3KYJB 1QP7A 2FEPA 3GRCA 5EWJB 1A2OA 2FMHA 3OLWA 3KYIB 2P9HA 3CU5A 3RVSA 4JAVC 2IKSA 4MR9A 2L2QA 4UHJA 4G0QA 1USIA 2MYUA 4RY8A 5IUJC 3LUFA 4WWHA 1JFTA 3DBIA 3L49A 3VNAA 6CHYA 1BVHA 1UDRA 1VLZA 4MS4A 3HDGA 2HQOA 1SXHA 3H6HA 5JNWA 5CNMA 3KCNA 3QEMB 3B2NA 3RH0A 4D6YA 2QV0A 1NTRA 2R25B 2MSKA 1MVOA 1DJMA 3QX9A 1U8TA 3Q9SA 4HNQA 1M5TA 4Z4IA 1OXKB 2FTKE 2R4QA 4MPTA 4ZYLA 3HM9A 4MQFB 5KQPA 4O1HA 4NICA 2R48A 4LE1A 4MR7B 4PZ0A 2RJNA 3ILYA 3LTEA 2NZVG 3Q7TA 3JVIA 4MR7A 2R47A 3NNSA 4RXMA 5IC5A 2O20A 3LFTA 4N47A 5HQJA 5JNTA 2GBPA 3K9CA 3IP9A 1KMIY 1ZESA 5ABPA 2NT3A 1T34A 2QSJA 3W9SA 5C5EA 1JFSA 4W5TA 1ABEA 1FQWA 4KZKA 5CHYA 5JNSA 4G0OA 4HYEA 2Q5CA 2CHEA 3HVRA 4S05A 4O1IA 1P8AA 3BREA 4RY9A 4ML3A 3CG4A 3OM1A 2KYRA 3N75A 5TPZA 4ETNA 1JWLA 1SXIA 4OTZA 4EGSA 1ZGZA 1VPWA 4Z4HA 3CLKA 3GL9A 4KRFA 3MM4A 3TMYA 5HSGA 1JDNA 4JASB 4YO7A 4RV5A 4NQRA 2WWVD 5TE9A 1D2AA 1BA2A 2QVCA 3D02A 5HM6A 3QLUC 1DG9A 4RY0A 1YK1A 3ILHA 5IEJA 2CWDA 4H3KB 1Z2DA 1ZH4A 3LUCA 4IMIB 4RK4A 4KV7A 2FXIA 3GA5A 3KLNA 3DGFC 4MGEA 3DZDA 8ABPA 4QICA 5FWXA 3SQNA 2JCGA 2IPLA 2VUHB 1QQAA 4S04A 1KRXA 1C4WA 4L4UA 2V0NA 1VRVA 3GYBA 4EUKA 3C3WA 4GPAA 1C0EA 5PNTA 1TJYA 4FB4A 3MQ4A 1NXSA 2RDMA 4MS1A 5IEBA 4RZSA 4QYMA 1M2FA 3IP7A 3Q15C 4LDAA 4MS1B 4O5AA 4WT7A 3KJXA 3RVLA 4XXHA 4TN5A 3OO0A 4HNSA 4UHKA 4W5OA 3JTEA 1QPZA 2W42A 3O74A 3EJWA 1LBHA 1ZAYA 3LKVA 1DRKA 1XHFA 1L5YA 1ZN2A 1NXTA 3HCWA 3HZHA 5KQLA 4Q6BA 2QXYA 3JPWA 3UUGA 3SAJA 3HJFA 1D5WA 1ISRA 4MR8B 3UKJA 1W25A 4EVQA 4JB2A 2FLKA 3OLXA 1ZY2A 3VNBA 3T38A 4MR9B 3GV0A 4WZZA 1A04A 3EQ2A 4Z9BA 1JX6A 4W5RA 4MQEA 4W5QA 2L17A 2LUOA 3BBLA 5T7BA 3LUGA 3IPCA 5GQSA 4RK6A 5CNIA 1MAVA 3Q41A 2FLWA 4F12A 4FE7A 5EWLA 3HK2A 4RK1A 1P6QA 3HS3A 2LPMA 4YCSA 4YV7A 1JL3A 1JBEA 3OQMA 1RXIA 1HEYA 1KGSA 3R0JA 3RVKA 4Q7EA 1MIHA 2PLNA 1BDJA 3E61A 4G0PA 4RWEA 2FQYA 1E6MA 4DADA 4LE2A 4XASA 2YHAA 2FEKA 4RK7A 1ZGGA 2HQBA 3F7NA 4ZPJA 3LOPA 4RU1A 3IP5A 2GI4A 2RJOA 3NHZA 3G85A 3C6QA 3S99A 4EYGA 5EWMA 4Y9TA 3I45A 4YR7A 4Z4CA 2JVIA 1QKKA 3DGEC 3F73A 1DCFA 4OBBA 3RVPA 2PUGA 1EHCA 1URPA 4LRQA 1E2BA 1QP0A 1FFWA 3O1HB 1ZDMA 3L6UA 4G86A 1E6LA 3OLYA 4TLMB 2FW0A 3D8UA 3QLVC 4M88A 1DBPA 3H1EA 2QW1A 2MYPA 4G0ZA 5CNJA 4IRXA 2LIVA 2GWRA 1Z16A 3KKEA 4RXTA 3FMVA 1K68A 2IDMA 2PUBA 3LUJA 3KSMA 4TLLB 5ED4A 1BAPA 1Z26A 2GX6A 1YMUA 2I6FA 1M2EA 3H1FA 3NBMA 1DRJA 4MLDA 2WJWA 1I3CA 5FWYB 2FQWA 3TB6A 4RK0A 4ETIA 1L5ZA 2B4AA 2HQRA 2XDYA 4OG2A 3BRSA 1XWWA 3LUKA 3ROTA 3QEMA 4H3HB 3RVJA 3OLVA 5EWLB 1GUBA 1M5UA 2IOYA 3KLOA 2QZJA 3BRQA 1DBQA 2HPHA 2MSLA 4WXMA 4N41A 3F6PA 2JB9A 4Z4FA 2QVGA 3HUTA 4NCBA 5TPWB 2AYXA 1JHZA 2VK2A 2OENG 4XFKA 1FFGA 3A3KA 3RVRA 3DLBA 5IUNC 1TVMA 3HUUA 1TM2A 5TQ0A 4KFCA 3RVQA 4GNRA 1S8NA 5EWJA 2PL9A 3CTPA 2PUCA 2LP4Y 4G97A 1P6UA 1DC8A 2PMCA 1Z15A 2FQXA 1EWKA 3QLTA 2OQRA 2QU7A 4MS3A 1QMPA 4DQDA 3CRNA 3QK7A 4F3TA 1PEYA 1U0SY 1YS7A 2H3HA 3CHYA 1D1QA 5TQ2A 3KG2A 2JRLA 3M9WA 4ZMRA 1NXVA 4KK3A 2JK1A 4PE5B 4PICA 1LJUA 3LUHA 1NY5A 4N0PA 1Z2EA 5TPZD 3H5OA 2PUEA 2A9QA 4KQCA 4OLAA 3M6MD 4ETMA 3OLZA 3NHMA 3HO1A 2PUDA 3QLUA 2N9UA 1W9HA 3OMXA 3EDCA 1RZRA 1LBIA 3QEKA 3MIZA 4FE4A 2IYNA 4F8JA 4KPYA 5T3YA 1YTUA 1EWVA 5BRJA 3H5TA 1EFAA 3SY8A 2E4ZA 3JS5A 2FN9A 4IF4A 3GT7A 3C97A 4JP1A 3JY6A 5FWYA 1XHEA 1JH9A 3O1JC 1EAYA 2F8SA 2QR3A 4RXUA 4PEVA 3TO5A 4N03A 4EYKA 5IULC 1FFSA 1F4VA 1TLFA 4G0MA 1R8JA 4N76A 5JNUA 5I4CA 1RPJA 4RDCA 3EQZA 3FDFA 1GCAA 1QO0A 5F64A 4YWHA 1QO0D 5KC8A 3IP6A 1Z12A 4D74A 2ZWMA 4Z0NA 2MYNA 3Q7RA 4MQFA 4KMRA 4PYRA 5C5CA 1YVUA 5BQ3A 3QELA 1BDHA 3UK0A 5JS2A 3TD9A 1ZITA 5IX8A 4CBVA 3K4HA 3H5IA 4Z4GA 4H60A 4Z4EA 3EODA 3SM9A 2MSWA 1D1PA 3QELB 4N0QA 4OATA 3C3MA 5IBQA 4XAQA 2WY2D 1D4ZA 3OMWA 1ABFA 1U2PA 4KNYA 1ZHHA 3QX8A 3N0RA 1PEAA 3N8IA 1NXWA 4MS4B 2RGYA 4E7OA 3RQIA 5BRAA 3P9YA 2PUFA 4HNRA 4W5NA 2M98A 4ZJPA 1WETA 3FFXA 4RSMA 4MQEB 2A9OA 3CG0A 2FMIA 3N0WA 3A0RB 4RK5A 1MB3A 3EGCA 3CZ5A 4P1ZA 1Y1LA 1Z25A 1LJLA 1DZ3A 4MYRA 4QPJC 5DGCA 6ABPA 2AYZA 1YS6A 2GKGA 4KQ9A 4JB0A 3EULA 3CS3A 4NCAA 1K66A 2FKAA 3H5WA 3I09A 4Q6WA 1GLGA 4L85A 4F11A 4Z9AA 4RS3A 3GWGA 2E4UA 3NNNA 3RVOA 5DCLA 1VKRA 5BR1A 3JPYA 1YIOA 1PUXA 4G0YA 3H6GA 2E4YA 2ID9A 3I5AA 2FVYA 3A0UA 1F51E 3CKMA 3H1GA 1JYFA 2HSGA 2M1ZA 4MR8A 4P98A 3HXMA 3F6CA 4MS3B 2FN8A 1P2FA 3N53A 5D2CA 2A9RA 1LK0A 4G0XA 1B00A 9ABPA 2CD7A 2VYCA 1QQBA 3BILA 1APBA 3CNBA 1QP4A 3M9XA 4XARA 4F06A 1SRRA 2FMFA 3CFYA 3I42A 4KVFA 3FGZA 2IPAB 4RKRA 2WJAA 5TQJA 3MMNA 3OQOA 2JBAB 4LX8A 3MF4A 1QNLA 2VUIB 2PUAA 1OXBB 1Z18A 1SXGA 3O75A 1GCGA 2L18A 4YS6A 2E4WA 1E6KA 3H75A 3OQNA 4E7PA 5HKOA 1GUDA 2JVKA 1JYEA 5FBKA 4D6XA 5JS1A 3T95A 1EWTA 3HDVA 2B1JA 1DC7A 1YK0A 3MYYA 5FWXB 1ZVVA 1U04A 4LE0A 4IMJB 3HSYA 4EVRA 1SD5A 3LUDA 1NXXA 3LMKA 2BGGA 5EWMB 1CHNA 1KRWA 1YMVA 2NT4A 4JOQA 4YP9A 3HEBA 2E4VA 5JNVA
chains in the Genus database with same CATH superfamily
3FSGA 3IDSA 4E5MA 3JWGA 3U81A 1NBEA 3L1JA 4BEBA 4ZMBA 3HA5A 1FB5A 2GK7A 2NZUG 2W4QA 4JP2A 4AJIA 4DLAA 3EZ9A 4D46A 4PAMA 2QTRA 1DP4A 3TEMA 3ZHRA 4G65A 4JVOA 4YMLA 1QYVA 1CUHA 3O1IC 4MRMA 3DCIA 3H1TA 1NATA 5EQDA 4FINA 3MSXA 1NULA 1DV2A 3EAQA 3NJ8A 1RKQA 4UOEA 2BMWA 3OIYA 4JLWA 2CUZA 2NU6A 2HB6A 1TE2A 2E9SA 4CMEA 1D6JA 3ELWA 3WR5A 3I32A 2D4HA 3JAWA 2G0NA 2Y1WA 2W22A 3P9ZA 1NL3A 1T9GR 1J22A 4UNNA 1AGXA 1MZVA 3CLTC 4J9UE 4X5OA 4ZU3A 2X7XA 1SVUA 4PIPA 5GJBA 3A9UA 1L5OA 4DCGA 3UWSA 2QG4A 3ORQA 3OG9A 1U5AA 3K92A 2AQIA 2PN1A 1QB8A 2NXWA 4G8CA 2ZUFA 3DVSX 2FUEA 1W4CA 1IJBA 3FXAA 4HWOA 4EVSA 5IN5A 1SHLA 2OHJA 5A9SA 3GLFA 1T1GA 4B9AA 5DTEA 1DC3A 3GFVA 2F8TA 4CI0B 1CEYA 5LQJA 4XX0A 2PKWA 4N1AA 1VLHA 4BBPA 2VT7A 4FPXA 1P1BA 3ZWMA 3EEBA 3OEHD 4OJKA 4XIIA 3QTLA 3Q0IA 1P6XA 1Q84A 1T3GA 1X80A 3KJEA 1PJ2A 2ODQA 4ENUA 4F2HA 3A1TA 3NZEA 4M1SA 1IN1A 3PUYA 5F52A 2BELA 3EZYA 4MJ7A 3CEHA 3PZBA 4UULA 2KW5A 2PX8A 3AY7A 2Z4SA 3KAJA 4K9SA 1LLFA 4QOIA 1SHTX 4KU4A 4BKPA 2B37A 1NP6A 4ZDJA 3MWJA 1MENA 2A9JA 2C2ZA 1DX9A 1J4AA 4EJSA 2H29A 2VBCA 3I9JA 4YDRA 1RHQA 2V7QD 3RC2A 1AN9A 1BVRA 2HCFA 2IUEA 2XW6A 3GLGB 2QRKA 3LY9A 2Y3IA 3WJAA 1Z0FA 3FBWA 2QKYA 1ZM3A 4XTCS 3R7DA 4IY1A 2ZI3A 3GD5A 4C7JA 4CF4A 4J03A 3MA0A 4YXFA 3RC7A 1E79A 1IK4A 1RBYA 2IGTA 4QECA 3RFVA 1LBSA 3R9XA 1J2JA 3FE2A 4XIJA 5KI6A 2VYVA 3LBAA 3LI2A 4FNMA 4IIJB 4DLLA 5JTUA 2DGDA 1XDGA 4RPKA 5AKKA 2FEPA 1HFWA 3T3DA 4EAQA 3NH9A 5JAHA 2FMHA 3L8MA 3OLWA 6Q21A 4MDEA 2BTQB 4KPEC 4MWCA 1EP9A 1I9CA 2NZWA 2XD4A 4K3VA 3SBOA 4BP3A 3VO1A 3I37X 2JGKA 1FZTA 5LUAA 3FLAA 1PJ4A 4HSGA 5IF9A 2XUPA 3KHSA 2Q3FA 3TFWA 4Q9AA 5K05A 2YV1A 2M6LA 5LN1A 3MMZA 1ECPA 1XEAA 5BNIA 1COZA 2B9VA 1NZJA 4OJTA 4XX0B 5JSYA 1NUAA 2FFHA 2PTGA 1LK7A 3JQEA 4U63A 2MSKA 1MVOA 5EIOA 3TGWA 3UK6A 421PA 1EXDA 2DTXA 4W6ZA 1M5TA 1TW3A 2AB0A 2Z43A 1ADYA 4WW0A 2XAUA 5EL0A 4J4HA 4HQ0A 1K6EA 3THYA 1KJYA 3VYSB 3A7DA 1G55A 2IE0A 2J7PD 1SK9A 2KLHA 4HC4A 5T4EA 4F2PA 4FLEA 1WA5A 2WJHA 4E14A 1A7AA 3FR7A 2I6SA 4M9XA 4RO0A 3QMWA 2PS3A 3K9QO 3AZPA 3LL7A 4P8RA 4CUZA 4LPSA 2IOQA 2VWPA 3GLUA 4HMQA 2VOJA 3QXSA 1PS9A 3IH5A 4GQBA 3WL5A 2XSZA 5KYTA 1NFQA 2Z1DA 1HYEA 4BNHA 4OHZA 2JD0A 1DUSA 4N7RA 4KSCA 1Z36A 2PA0A 3JQDA 4KLNA 4ZI7B 2Y1KA 3CMCO 3H11A 3K0BA 3AUSA 3LT5A 4KRYA 4DR6B 3OQJA 1E1MA 3U4IA 1YVRA 3M5CA 2HBRA 1NVVR 2CZQA 3AVXA 3X2SA 1YULA 5JSUA 4RV5A 3AIKA 4Y6PA 2A0KA 2BF7A 4IIVA 1II8B 2V6FA 1HT1E 5DO9A 2WOJA 1C30B 4FCCA 3PLNA 2H7XA 3D02A 1MC8A 1DG9A 4RM2A 4NBTA 5H7XA 4BNFA 3TNJA 1I2BA 2XUIA 3LYHA 4H1VA 5BV1A 3K1AA 1M6WA 5AR1A 1KYYA 2O5CA 2I7DA 4X1IA 5FA6A 1N33B 5FEMA 3OC6A 3ZH2A 1SUIA 4ZANA 4PYNA 1U28A 4A8TA 3OBBA 4MHSA 1Z4KA 2WIJA 1RM5A 2V0NA 3K2QA 3D0RA 1G5QA 4J4TA 2FSHA 1O87A 4G3XA 3C3WA 2VNAA 2R86A 4FB4A 3FHLA 2GB4A 2A14A 4FFVA 1YJ5A 3AW9A 3B89A 1KYZA 2BKUA 2ZT8A 1I2ZA 4JP8A 1NYQA 3PZRA 4PG7A 1C7IA 1MDBA 2VPXA 2CUKA 4G6ZA 4PN7A 1Q1BA 4CN9A 1M0SA 5AH0A 1EFVA 3P4YA 1WQ4A 4ZYVA 1LS1A 2ONCA 3VHQA 4S1PA 1LBHA 5BW8A 2DFVA 1KSFX 2ZWVA 1L8OA 2QUHA 3AHEA 4L08A 5ALYA 5JG7A 2FRVA 3OHMA 3HCWA 2AL7A 2FPPA 2QP3A 4CCSA 3SBXA 2YZKA 1N2CA 4BX8A 3SAJA 4GZ3A 1KDVA 4WNAA 4V1CA 2D2EA 3GA0A 5EUCA 2ECPA 3HJNA 5AVRA 1T24A 3SYNA 5A04A 2PUHA 2I2CA 1N0HA 1EZ1A 1VJ0A 2C0CA 3QUBA 4JLPA 1F2UA 1F8UA 3PITA 1R74A 3ETCA 4CF6A 3U62A 3CX8A 5K0BA 5THXA 4N01A 1PU2A 1KEVA 1JHOA 1S7CA 4I50A 4D6PA 1M1UA 1J09A 3DV0A 4M7WA 4MRNA 4Q1BA 4Q16A 2QLLA 4HK4A 2CXRA 5EZSA 2ZBQA 1O9HA 3VGPA 1Z37A 4FI3C 3TXXA 3UFBA 1RIIA 2WMNB 3OCWA 3AX6A 3MOIA 4CUKA 1IXYA 1K7XB 1RXIA 3K1AB 3RVKA 4I3GA 4MI6A 1XPOA 1S4MA 1H6BA 3KXIA 3QYJA 1K97A 3RK0A 1SCBA 4TXMA 3SMQA 2DPGA 3ZWKA 3FN4A 4DLYA 5F2OA 2G1UA 3MTDA 3ZGYA 2BGRA 3NCTA 1J8FA 3A26A 5H83A 4BB6A 2XUAA 1GDHA 3OLQA 2G9RA 4YGYA 4TLCA 5JCOC 2YDYA 2MMCA 3F7NA 3ZD8A 3GOHA 1R0WA 5LKRA 1YC2A 2PX3A 3ACCA 3AVOA 3L9XA 5EIWA 3C6QA 4WFIA 5ALOA 3TSOA 5KOHA 2ZIFA 1C3LA 1QRUA 3I45A 1SVLA 2EQBA 2V4MA 1WP4A 4Z0PA 3TR6A 2UUOA 5FBWB 3TSZA 5HUHA 1URPA 2GFQA 1E2BA 1ID1A 4OJYA 3HKDB 4Q4JA 1BH6A 1ZDMA 2ZRHA 1KQFA 4G86A 1XD8A 4DF3A 3ADPA 4BQNA 4MVCA 1QH8B 3Q0TA 2A84A 4HDRA 4PG4A 2WUEA 1CRZA 4D4LA 1JHYA 2EFEB 4YJ2A 3A05A 2A5YB 2ORIA 2V6GA 2B9EA 5DSTA 5KYWA 2VPWA 1IE3A 5LLDA 1U2ZA 2FHPA 3HB4X 3FIUA 3LC7O 2FPUA 1COWA 3PP8A 1R6XA 3I04M 4JYZA 2JBHA 3KKNA 2XUHA 5EJ9A 1AKUA 1KK2A 2ISQA 1TLLA 4RK0A 4ALMA 4UHBA 3L0PA 4LDNA 5E4JA 1IEVA 3LUKA 4KAXA 4H3HB 1K5PA 2NLOA 5FF9A 4D8VA 1Y7LA 2O1XA 1A8IA 2IOYA 5BSHA 1RWNA 5EOVA 1O0BA 2PGOA 4K86A 3IUQA 3VC2A 2HPHA 2X2FA 4XEHA 3BKXA 5A6VA 2BH9A 5J47A 1YS4A 3BHIA 3HUTA 4LYFA 4R4JA 3WMRA 4EECA 2AYXA 1H94A 2W93A 4HBGA 1FXUA 1WY7A 4KI7A 5GVRA 3ORRA 2O8NA 3DG9A 3L41A 5JXJA 1DLJA 2ZYDA 2DUWA 4I1RA 3HLTA 4K1XA 5ULLA 1KO8A 1TVMA 2QUKA 4KEAA 4EWLA 2IV7A 4NDZA 3FAZA 3FB1A 5KSOA 5EJ7A 4XA8A 1USUA 2HSWA 4Q02A 4R9UC 2QNBA 3W4KA 1SC9A 2LNDA 3ZI7A 2RHCA 3BXOA 3RHTA 1I3OA 1Z62A 2V7XA 2PWAA 4IZOA 3ASZA 1NNSA 1JDVA 4HY3A 3DMNA 2ESRA 2JCVA 3L6RA 3VFDA 5GJCA 1PEYA 5CCXA 1TIPA 5J43A 3OIFA 4C21A 2XLCA 5TQ2A 5HKLA 7REQB 2E18A 2FZEA 1MZPA 3PVCA 4YT5A 1ADBA 1XB2A 3ZKWA 3DBRA 4JL6A 1GNVA 3DKIA 2Q62A 4PPFA 2ONYA 2ZJ6A 3U7IA 2IBTA 5P21A 3KSZO 4P6VF 4FEGA 1B8PA 1KH3A 2XQVA 4R8RA 1EK0A 4GUDA 1YB7A 3DFMA 1HUQA 4A0SA 4U3JB 1CY1A 3MWKA 3GFGA 5EXSA 2CLSA 1E3EA 1M6EX 1YD7A 3IEIA 3MZ0A 3EDQA 2V55B 1K7YA 4HD8A 4LYGA 3KM0A 1JPVA 1ISIA 4JOSA 4K9LA 3RIXA 5CA1B 4NQZA 2JD2A 4AQ7A 3HZRA 1RRFA 1LY1A 2JFWA 2F8SA 1TFUA 2B5WA 4BQSA 2IH4A 1R4NA 1Y3DE 2Y68A 3OPNA 4EX6A 2X3UA 5DN9A 3NTXA 3DFIA 3IO3A 3A58B 4JC5A 5LP6A 1SU6A 1EE9A 2WG0A 3AXTA 3WLPA 4X62B 1C7QA 1R8JA 5CD1A 1SCUB 5I4CA 4RDCA 4NG4A 1AHHA 1QV9A 2Q5EA 5KAPA 2YBDA 4A82A 3DBLB 1E2UA 3HTXA 4RPJA 3T7IA 4C89A 2I8LA 2OGSA 2EZTA 3MMXA 4BDTA 1QGYA 2FSUA 3NBUA 4GGPA 1ENZA 4N54A 5GV7A 2N75A 5IX8A 3SPXA 1Z22A 4W8GA 3MINB 3FOFC 2EDCA 1Z5OA 4D80A 2C77A 2CBZA 2QUIA 1M1NB 3W3AA 1J1ZA 2X4DA 4GLBA 1Y9AA 3OCUA 3E3NA 3UB2A 2GKOA 4M1MA 5BV0A 1CIPA 1U2PA 4LSZA 3FFAA 4LC9A 2FMTA 5AI4A 2C3MA 1Y8CA 3N0RA 4M1WA 2C07A 4N3CA 1QOZA 3NYRA 2W90A 3CRQA 1RAEA 1XJCA 3N8IA 5EIFA 4E7OA 4BLOA 3UGJA 2OE2A 1GFWA 2J0EA 3IV9A 1ZM9A 4MQ4A 4A91A 4A7PA 1NLYA 2GPNA 2WTXA 2FMIA 3IQXA 3U3ZA 3AXSA 1L5NA 4EI2A 1X86B 3D5EA 4F21A 3DHNA 4YEDA 4AKTA 3FOWA 4HX2A 4YHHB 2I9KA 3EVFA 1ONSA 2YJ6A 4ABYA 1KIFA 2GGSA 1A76A 3VU9A 2Q7DA 4EFLA 2AYZA 3GRVA 4BO1A 3H9QA 4HRYA 5KNLA 1P17A 1GG2A 4J0FA 4WOBA 3MT8A 4UQPA 1N5RA 3MLEA 1NVFA 2ABWA 1M34A 2UZ1A 3LG2A 4MDHA 5JAMA 2DXIA 4BEWA 3MTJA 2P9CA 1XI2A 3GNTA 5CB4A 3D7SA 3PC7A 3B6ZA 1D1SA 2X23A 5DGDA 2LZ0A 2BLNA 4U0KA 2WV9A 3MWYW 1YR1A 1TJ5A 3EEIA 3CX7A 3H6GA 3II6X 1D4AA 2E4YA 3ZLTA 4AC9A 5U9CA 1GWNA 3WSVA 3DHWC 3IQHX 1MDFA 1V26A 1W5FA 2M1ZA 2QTZA 4B0PA 4ARIA 3H4MA 2C20A 1A8QA 2G9UA 1J21A 2QB5A 3EVGA 4CL0A 4D4HA 3UAWA 2VYVD 3RFUA 4LDQA 4M9RA 2I4LA 2ZSDA 4OFWA 3U2QA 2XVMA 4Y2YA 4LVNA 1APBA 1EKXA 3SNHA 1EVLA 1SBZA 3EPLA 1J07A 2G77B 4DLTA 1WSDA 3WX0A 4EA9A 4MKZA 4KH0A 2XD9A 2R97A 3PPIA 5EJFA 2WJAA 1CQXA 3MMNA 1AZSC 1H5QA 2O57A 2FP4B 4IZ6A 1YVDA 4HH3C 3A6HA 1QNLA 2GFHA 4LYYA 5ALDA 4W99A 3TVTA 1SBIA 4A6PA 3NM6B 1ZCBA 3SLRA 3O91A 3O75A 5EZ5A 4EFDA 4P3KA 2HDHA 4CKZA 1KTIA 1AGNA 4PZLA 3ZE2B 5KOYA 3VH3A 4JUCA 2YOGA 4JC4A 3H0EA 4AZ3B 1GL9B 2ACWA 3BA1A 4PPYA 1AF4A 3T9EA 1UXKA 4QYIB 1VCHA 2RHWA 2C4MA 4DTCA 1J8VA 1VE9A 2E2WA 2J3LA 3FI0A 4EVRA 1NXXA 3GLIB 1M0TA 4BO4A 1QTNA 1EYZA 2EFHB 3LPDA 2C5BA 2QRNA 2WMDA 5CT8A 2ZUEA 1ILWA 5HEKA 1DQSA 3B70A 1FDIA 2OV1A 4Q9KA 4WTOA 3VR6A 4ARBA 3U31A 4Y9DA 1YCDA 4MEBA 3EF3A 1XAHA 1ZL0A 4P31A 3C98A 4B09A 2ZRPA 2WA2A 1Z5WA 3GBVA 4OI0A 3JARB 4R2WA 3VO9A 4WXEA 4DN6A 1HTWA 1MOSA 2ZRNA 4EY3A 1XRSB 4KXNA 3FNRA 1EP1B 1I7LA 3O2SB 1R2QA 2QTBA 3RHFA 3ZD6A 1T9CA 3ND7A 3VH4A 5AJZA 5BN4B 2W6QA 4J2TA 4MRMB 3PA8A 2FOLA 3DVQX 4HJRA 4KC0A 1XZ8A 1AV7A 5AI8A 4CQMB 4RLQA 1ZK1A 3DHVA 1GSAA 1SBQA 2H0AA 1IPFA 2R96A 1SG9A 1AURA 2Y99A 4QJBA 4F5ZA 3TFOA 4NOLA 5JPDA 4OHRA 2ZK7A 2IPMA 2IYRA 2V7GA 2FY8A 3O4HA 3QBVA 1V5WA 2YVLA 3ZXXA 5FLYA 1GV1A 2XITA 4AY3A 2B2NA 2QUZA 3GRFA 5KYUB 4YC7A 2VRWA 4YCMA 3PF8A 3BCRA 5JI3E 2VK4A 2MYTA 3KZVA 2EBHX 4BNYA 1T10A 5IWAB 1DQYA 4FFBB 3PDCA 1K8QA 4XPIB 1OYWA 4KO2S 1EUYA 3KYDB 3RJ5A 4WCDA 4JHXA 3RAEC 1A9PA 1C0LA 1R5JA 3DO5A 3LCJA 4GI1A 3X1DA 4BVFA 4LBVA 1XOIA 1D6MA 3GBPA 3TD2A 2B94A 4EYQA 5EPUA 5K0JA 4HL6A 3BIJA 5BOSA 3OM0A 3TNLA 3KJZA 1FDRA 2W71A 4BVJA 4E4TA 1J24A 3F97A 2EJUA 2LIPA 4H59A 3NUZA 1LF0A 3F3KA 5H4HA 4TS9A 2CCGA 2E7ZA 3EAFA 3CW9A 3OAAA 1XZKA 4QYSA 5EJ2A 5DCYA 1W85B 5CB8A 2BDUA 4EITA 2Z9DA 4J75A 2I6XA 1T2UA 3QVGA 1UZUA 4PCUA 1A7JA 2WWIA 1AK2A 1T0BA 4Q9IA 4TUYA 1U3UA 5I9NA 1ZJJA 3O4IA 5P8WA 2H11A 1UWLA 3DYIA 2NTNA 4I1SA 4IEFB 4NH4A 1X7YB 1Y7IA 4EJSC 4ZKDA 1Y4ZA 3ZTTA 1H0SA 5K3FB 4N6OA 4EFKA 4YIHA 3AUKA 3CLSD 4OBXA 3R7WB 2QD3A 3RU3A 1IVNA 2NQ8A 5EGNA 3TJZA 1QQ6A 4UJ5A 3JAMA 4MWZA 5DP2A 2HY7A 5AVXA 1TCAA 4HRXA 1RPTA 4ZI7F 5IRCD 2GLUA 1PV1A 3IAAA 4HMPA 3ZQ6A 4FGKA 6CHYA 1H2BA 3HDGA 1Y1KE 3BL6A 4Y9RA 3H6HA 3V4SA 2ZQYA 3PEEA 4YBRA 5I7FA 1G3QA 5HQTA 1XV5A 2A67A 3O7WA 5JZMA 4FFBA 4R2KA 1DG3A 1FDWA 4M9CA 1L1RA 2R25B 2PX6A 3NVAA 4ANFA 1UPCA 3LT1A 4DC9A 1MEEA 3L0DA 4INJA 5D5HA 2DFPA 3BHMA 4Z4IA 1EP3B 4ROTA 1NQ5A 3FTFA 4W7IA 1YOBA 4RABA 3KZ1E 4A0FA 2R48A 1R0KA 1Y9ZA 3E2MA 1JZSA 5CW2A 4EGFA 1GTSA 3ZDCA 2B92A 3MS2A 1XBTA 3NNSA 4OSPA 3RUFA 1X9HA 2VKQA 5D3MA 3IT3A 1FUKA 1U9YA 4PHTA 2MIIA 3G9TA 2ICAA 2WYUA 2YICA 2VT6A 1IXZA 3K9CA 4KQ1A 4URYR 1AA9A 4DSNA 2GHQA 2DPHA 1RXVA 4HXFB 1CR0A 3W9SA 1FW6A 5HCIA 1UUFA 5EZYF 4ZJUA 1VCMA 1PT6A 2P3OA 2ZJ8A 3EIXA 4RJTA 4KKXB 3LVRE 5ALEA 3T5GA 3OF2A 4WY8A 4BKRA 4AG3A 2OAP1 5KKNB 3WGMA 4K9DA 2HSJA 3OTOB 3L92A 2KYRA 4JUFA 5JPCA 4ETNA 2XYGA 4EKGA 4EGSA 2FQQA 3CLKA 3GL9A 1R4AA 5EQJB 3KUUA 2FPKA 5AUQA 5G41A 4B17A 3DV0B 4KRFA 3E7DA 4F4JA 2VO1A 4C4YA 4C22A 5BV8A 1EBBA 2C54A 3DOEA 3HJUA 1QIKA 3LCVB 2H7CA 1E3SA 1BJRE 2NZ8A 1R0XA 2XEDA 3AV0B 4PO1A 4TYMA 2RGDA 5HM6A 4IDPA 1GA6A 5I7OA 3IP3A 2QE6A 4R8MA 2FDRA 3BWEA 3LXMA 3RUDA 2LKCA 2B82A 2P9JA 5D6OA 3C74A 3DGFC 3T7EA 3V7WA 1BXZA 1NE7A 1VLLA 3TW6A 2E4AA 2WFZA 1DC5A 3QEJA 2IPLA 2JIBA 5JQGB 3M3HA 1S01A 1GUAA 2G88A 3AUJB 5F4BA 5AIBA 3P9PA 5DBEX 3BFVA 1SU7A 2XE8A 3CWQA 4I5DA 4BFCA 3E7FA 4JC8A 3KXPA 4M1TA 5HZKA 2X86A 4IIDA 3UV6A 3E81A 3I92A 5BNWA 1ZI9A 1I32A 1ZS9A 1U2DA 3VOAA 4LG1A 1FFBA 2FZWA 1PAUA 5B1DA 3WNZA 1YUMA 5A4IS 3KVOA 1SOAA 5AP9A 5IS2A 3B53X 4BFZA 1V7ZA 1CJVC 3L0CA 5JD4A 3U60B 1CF9A 3JVUA 1RLJA 1XLTA 4JBIA 4KN6A 3ZC3A 5CP8A 3T1OA 4YRQA 4CU2A 1EFVB 3TOCA 3UUGA 3LBHA 1A4XA 2ZSHA 3E9MA 2V7VA 4E15A 4N12A 2FWIA 2YWEA 3DAPA 4IEEA 2JLYA 1Y3FE 3S1SA 1DBVO 4DARA 4C6HA 3B5JA 5ALGA 3W4JA 3LGSA 4RHUA 4E5KA 3OLXA 1TAGA 2DFKB 4L4XA 2N3ZA 3VNBA 5J23A 3EXHC 1FYXA 3WQQA 2INGX 3KOMA 1EWQA 4DEYA 1XDSA 3PV0A 3OQ6A 3RIGA 2VTBB 1SD2A 1J8QA 3BK2A 4G5GA 1CJTC 1M6NA 4QDUA 4PV7A 5BYAA 1D2RA 3NU1A 2Q0XA 5IZCC 3TNYA 3ZV5A 3KJHA 1S3SA 3A28A 4QYTA 5J2TA 5ELMA 2IV3A 2FLWA 4ZGGA 1Q0HA 4OFZA 2I03A 2F9LA 1YU6A 4FE7A 3NG1A 3HK2A 2LPMA 2R7AA 2J87A 1Y8ZA 3LZCA 3X1YA 5K20A 2OORC 1R5BA 1V95A 3VR1A 3SJ7A 1MNAA 4AIIA 4D5EA 3KOUA 1N2SA 4O4IB 1Z47A 2YJTD 2FWNA 3NV9A 1UT6A 1V7PC 2V8OA 4KXUA 2AF4C 1KERA 3C1AA 4KHZA 2IYSA 3BCUA 4PSUA 1ECGA 1BU8A 1UFQA 1GD1O 1W4RA 2WJJA 5EHNA 1V45E 4N39A 3U7FB 3WGTA 5LMZA 4RKEA 4RKFA 1EDBA 4LJYA 5EXTA 5CIYA 2OXEA 3LOPA 2GWHA 4RU1A 3V7NA 2RJOA 4FHFA 2H65A 4YXWA 4EJMA 1AMUA 4NYJQ 3VR2D 3E70C 3LZ6A 2ATXA 3S6JA 2DY1A 4YRJA 1DKUA 2UVDA 1MBZA 3IUYA 2D1FA 1T0JB 1JDBC 4IOJA 2AFHE 3AY0A 2PUGA 1EHCA 4QQRA 1SXJE 5LDDC 4A26A 2B1GA 4HDNA 5IM4F 1FUEA 1E6LA 2CWWA 1YUBA 3AEUA 2VJYA 1RD4A 5IT4A 1YI8A 1OLSB 3H1EA 3L84A 1YZTA 1ACJA 2BMVA 3P9NA 2NO6A 3EN0A 1K86A 4EBBA 3O8OA 4M83A 1NN5A 2SICE 2IXFA 2Q0QA 1C1DA 3JRWA 4LJSA 4ESOA 1PG2A 2QJRA 3ITDA 4TLLB 4CKCA 2Y71A 3EWSA 1A9QA 4JI4B 4UNSA 1TQHA 5DEOA 1KIMA 3O0TA 5B1YA 2I3DA 3RYFB 2BD0A 4ETIA 3ZCRA 2CNDA 3B38A 1JKIA 1T2NA 3HY4A 3ZQ4A 2PQ0A 4NZNA 4PPQA 3DD5A 3QUCA 2WAOA 4X85A 2O7SA 4C0AC 1PBNA 2RBKA 2QW8A 4I4TF 4PSAA 5KSWB 2GBIA 2YMLA 2QZJA 2QHXA 3AF4A 4UEWA 5ALZA 2NM0A 2LGJA 3NX4A 5H82A 3WL4A 1FBNA 1ONNA 1U7UA 3HHEA 5FL7D 1ZM7A 4U7PB 3COVA 5HF9A 3L04A 3SZMA 4IDCA 1GZ7A 1ZUNA 3HEMA 3MCAA 4CM4B 3THWA 2QX7A 4LI3X 2UZ0A 3OFSA 2XIJA 4RBNA 3ACBA 1W36D 1PJZA 2RH8A 3K8YA 3PDJA 1O95C 4PXAA 1ULSA 2HHCA 3MTBA 2Y0EA 3E8SA 4G5QA 2IXGA 4GNRA 1DXQA 2Q1YA 2ZQZA 1FLVA 4Y8VA 2QMZA 2Z09A 3W9UA 5ALTA 4ENPA 3N2GA 3GD7A 1GKUB 3UWKA 4AKEA 4CMJA 1R16A 3K1YA 4DT1A 4RLHA 2CE2X 1G8YA 3EXHB 1T4CA 4MW7A 2CV2A 1OXUA 2R2AA 1TTHA 3DZBA 4JENA 4Y6LA 5EMJA 2OHGA 3QKRA 1D1QA 1KSGA 1NF3A 5AFSA 1A8HA 4QBHA 5DLPA 3LL4A 2PIAA 1P3Y1 1ZWLA 3FGNA 1IAQA 3FKSD 3I9V1 1NMXA 3PUKA 4P32A 2NSHA 2PUEA 1UFRA 1PHPA 2PKCA 3IAS1 1XF9A 4XCXA 2BJWA 2FG7C 4X0EA 3HO1A 2P2LA 3Q10A 3DKVA 5FT9A 1DT3A 1O8CA 4BX3A 2QU8A 2GARA 3O8OB 4NDAA 1N8KA 1C1DB 4RY2A 5FHRA 5KTOA 3GG2A 4CR7A 2GN0A 4KPYA 4B3RB 4F96A 1Y0BA 3B2EA 4JQCA 1A27A 2ZRLA 2JFYA 3CX6A 1ATIA 3BMNB 5CJPA 4CPDA 4DJTA 4G1BA 3ZTWA 3OPQA 3JQCA 3D31A 1W94A 3SEFA 3SQDA 3U9LA 2EOAA 3O1JC 1JI3A 5KYXB 2Q3LA 1BU5A 2P6PA 3CWCA 1NLZA 1DBRA 1NP3A 5K6RA 1IBCA 2KMLA 4KHPB 5D5QA 4BLSA 1Z0JA 4P0QB 3S0JA 3RIHA 1SK8A 2R6FA 2Y1DA 3WK9A 1UBTS 4N76A 2CBGA 3GROA 4FCVA 3AG6A 4BFTA 3U26A 3UW1A 2FFQA 3GP8A 1O89A 3IP6A 4R2IA 2C9YA 4B71A 1JJIA 3LPAA 4ITUA 4AUKA 1I14A 5B4VA 1HNWB 1QUFA 1RXYA 1GEEA 3OE5A 4IYJA 3O1LA 4REQB 3V48A 2CY0A 1GLVA 2H1WA 4PW0A 2AMVA 3F3SA 2WIFA 4UPVA 5TF4A 2RK4A 4BN0A 2RGRA 3EIEA 5HKKD 3JD2A 1FW8A 3SD7A 2V1XA 3C3MA 3HXQA 4XAQA 4U9IS 5EJ5A 5CT4A 3ZHXA 1L4LA 1NC3A 1PTJA 2IS2A 4MWBA 2OMKA 1JAIA 2VQSA 3WL7A 4JWTA 3IVRA 3ZDYB 3ZWBA 3F9IA 1SXPA 2A92A 2M98A 3JQAA 1PWXA 4Y1FA 1A8PA 1EGAA 3ZKWB 1WX1A 1YNOA 3KL2A 1U0EA 3USZA 4DCJA 4J7UA 4QG7A 3W7VA 1V9LA 4BECA 4BGIA 2A5JA 3K6JA 4NJMA 1P0CA 2NO7A 3OJLA 1I7DA 1RJ9B 3SSAA 3MT9A 5LD2B 2ACVA 1XRLA 4IIEA 2SECE 2YKGA 3HU2A 1GV0A 3ND6A 2WIGA 4O2RA 1FTNA 3BDIA 3VPFA 1Q1AA 3ZGZA 4LJLA 5C53B 2I2XB 3AJRA 1ESDA 4D57A 4DMLA 2XYQA 1DAFA 2FKNA 3T0GA 3VU0A 3G2LA 5CVJA 4LY3A 2WSSD 1Z5GA 3KBOA 4QU8A 4UVEA 4KQWA 4ZVQA 4EQZA 3AC0A 4MV7A 4X1KA 5FWNA 3L6OO 1VQ1A 3TOXA 4TV9A 4Z1MD 3PQ2A 1KNQA 2ECOA 8ATCA 4XJSA 2I4NA 1X92A 1D09A 4IGKA 4K7JA 3IOEA 5H3CA 2OSBA 2J4FA 2LR0A 3P96A 4OUKX 4O4JB 5CX4A 1K06A 1SRRA 2Y0DA 1EGHA 4HATA 5HQ3B 3I42A 3Q5DA 3U44A 4CEJA 2C7OA 4LVUA 1O9GA 4BU1A 5KOJB 3JR7A 2F67A 4MNTA 1OXBB 2PUAA 4L95C 3N70A 1Z8DA 3Q2KA 2AG0A 4KWCA 4DA8A 3LNTA 1U31A 4WKPA 3FUVA 2WWRA 5J40A 4RQBA 1Y89A 2R5WA 1VSQA 2V3WA 2JAOA 1NDQA 4KIGA 2QTVA 4L3VA 4RM3A 4J6EA 5AUPB 5I4BA 2AI3A 2AWNA 4OU5A 1NW8A 4CMCA 4AFNA 3NV7A 2P5UA 3L7YA 3QXCA 3HJRA 3ZG6A 3BTUA 4YREA 3HSYA 3IBTA 3FLMA 5FBLB 3JQBC 3WMFA 1O97D 2XUDA 4NBKA 3SU8A 3UHPA 1LW7A 3DDNA 3GRUA 4X8MA 4HFJA 4LSMA 5B53A 2D2FA 4FN5A 1OWMA 1J39A 3GLHB 1EX1A 1Q3KA 1Q57A 4W5HA 5JNVA 3O21A 5L6MB 2C94A 4HZUA 1ZD1A 5AJTA 2YNMA 4D02A 1E7YA 2GEVA 2XNDA 2RMKA 2ZWIA 3VPAA 4H0NA 4U5XA 4NCJA 1ZCAA 1X1CA 2VSXA 3DSRA 3CUWA 3THRA 1R64A 1ZOSA 2DHQA 3GF4A 4BAUA 4C88A 4UOZA 5KYNA 1DO0A 5B3JC 1DL5A 2V9CA 2XYRA 1CWUA 3SC4A 2ZBEA 4ALNA 2EFGA 3GJYA 2SKCA 3OTIA 1QAOA 1J9EA 2XUKA 2JZNA 4HVTA 4UDOA 4WKBA 5LCXA 3ZJYA 3O31A 5HKKA 2HTFA 3R8CA 1W49A 1IU9A 1PJTA 1QCCA 3GDOA 4KG7A 5J2UF 4NABA 1WMSA 2WRZA 5L7YA 3ZHBA 4HN9A 3MWEA 5CT6A 1KGDA 4HH0A 5DJ5A 1RHJA 4ZQFA 1S02A 2VQDA 3ZW9A 5IK2D 2CV0A 3T3OA 1FFAA 2XWSA 2P5TB 3FFWA 3O92A 4W5WA 4ZVUA 4ZZ0A 2C83A 1FFCA 1XRQA 4IDDA 4WKOA 5JSQA 4CEJB 1M2HA 1W8DA 3GAZA 4E13A 3G9ZA 3NXKA 1HDOA 1Y3BE 3K9FC 4MA0A 3B9BA 3T8YA 1RM3A 5GVSA 3VC3A 3BIWA 3GJXC 3RS9A 2BGUA 4FKZA 3OCZA 5JLJA 2H1VA 3RS5A 3RS7A 4CV3A 1ZH2A 1OLOA 3MQFA 1Z4QA 2OC9A 3VR4D 1A9YA 1FVFA 5DYYA 3JVDA 3LJKA 4QDTA 3HFJA 1USVA 1G0OA 4X7RA 3VOSA 1SZJG 2JLUA 1E0DA 4ZCRA 2Z2XA 2ZR0A 2GO1A 3EGDA 1NN3A 1Q7BA 5DLYA 4WUTA 1IUPA 1LV8A 2X14A 4XLTA 1CJMA 4ZARA 4FZ3A 4FB5A 1E2GA 1GLNA 2H1RA 1G42A 3H5LA 3LE8A 4B34A 2GZ3A 4CT4B 4X63A 3BMXA 2VHJA 1P73A 3WWCA 4PYMA 4LWZA 4V0NA 2FB9A 1V35A 2A1TS 1T8SA 2H4YA 3GEGA 2VDWA 1KH1A 4NHEA 5JD3A 4Q66C 3LVBA 1IPEA 4OK6A 4HDSB 2FPRA 4OB6A 3TEJA 3D5QA 3E3MA 2AX4A 2LXNA 1A5TA 1TGVA 4JY7A 3NS7A 2W9XA 5ECGC 3A4LA 5B2FA 2ZJZA 1Z2CA 2QK4A 4ZAVA 4KUGA 2P9QA 2ZIWB 1XVLA 1E1CB 4FFNA 4TRJA 3HCBA 2XIQA 2CL0X 2QV7A 5HYVA 3ACDA 3B1ZA 1RC0A 1QP7A 1GZ5A 3CPSA 2XRFA 3AP2A 5FQOA 3GVHA 4B83A 3R77A 5E1OA 4BQQA 1R18A 1EJBA 4TKUA 4R1NA 2ATIA 2PYDA 2Y1EA 5DWVA 4LHVA 3DDSA 1GT6A 5E7IA 1FDOA 1BCRB 4QUBA 4CQMA 1AVTA 5DK4A 4G0VA 2KI5A 1C3JA 3Q9LA 1PR4A 3GN2A 1QORA 1QNFA 4J2HA 5JQGA 1NIJA 2G5TA 5CLFA 3TM5A 1QGOA 1L9KA 4XEUA 1Q1QA 2VNIA 4OM8A 1T9ZA 3U4QB 4AXBA 1CUDA 2DWOA 3D3EA 2W2KB 5REQA 3FCAA 3KWFA 4IOLA 1M8GA 5CXQA 5T5QA 4D3SA 4BFLA 1PR1A 3ZR4B 3T1QA 1H65A 1SM4A 4Z53A 1VCOA 1FUUA 4HGOA 4P53A 1YQUA 3UHOA 1I0ZA 3Q7IA 2HMSA 3JQGB 3ZHVA 1SUPA 2FCRA 4OF4A 3UB3A 2XQKA 5EVJA 1U0OC 8GPBA 3MT7A 3BAZA 4O0MA 1FF9A 5ABPA 2ST1A 1SXJB 3RE1A 3UO8B 1ZSVA 4KIUA 2PX2A 1HEIA 1BEEA 4QTUB 5CLJA 1OYOA 1K92A 5JFGA 1F6BA 2Q5CA 1PS8A 2C82A 4U2DA 2JZCA 2AF3C 4FW8A 4G26A 4MUBA 1LLDA 1KBQA 2ZR9A 1IONA 1RPAA 1A1SA 1EM8B 1KAQA 2IXTA 2FHSA 2X8LA 1Z6AA 2ZYHA 1XCLA 4KWIA 4WAUA 4D0SA 3W6UA 4WKGA 4WI1A 1D07A 3S8EA 2FETA 3O26A 4JUAA 3TMYA 3UJPA 4Z4QA 4FJ0A 3TAUA 4EPVA 4DW8A 1CULC 4OI2A 3AHIA 4R9VA 4KE6A 4Q7QA 4CQNA 5K3FA 1X42A 4D8TA 4BLTA 3VR2A 4TKUB 3NFYA 3NONA 4G8JA 3C8HA 1TC1A 4JI3B 5A4JA 3HP4A 4QTYA 2J3IA 1NRJB 1CDEA 4KV7A 2YYAA 2VSOA 3RT7A 5BVGB 3S55A 1DDGA 4PZCA 4CIAA 2G07A 3JX9A 4MW5A 2H1OA 2DM6A 2ZVDA 4M1YA 2PVCA 2X22A 3CUUA 5C81A 3ZDAA 1PGNA 2BFEA 4HLCA 1R0RE 1B8NA 4II7A 3RSGA 1NDHA 4O5OA 1VG1A 4DV6B 4CEHB 4AVYA 1Q7EA 3OFVA 1GL6A 4W9NC 3B60A 4URZR 2OZEA 1E63A 5JO0A 2NU7A 3HKBA 4TWIA 4TKZA 4ZPXA 1JECA 3EQ6A 3FKQA 1Y3IA 4NJEA 2VZ9A 3R09A 3ES9A 4XXHA 5F7ZA 4K81B 3TLZA 3USCS 5AUNB 1DOAA 2EF1A 2R79A 4S35A 1ESMA 1UT5A 4DLWA 1L7RA 4L78A 1JJVA 1PZNA 3CKYA 3PGJA 3CO0S 3NHSA 4JBWA 4HADA 1R0LA 3BSFA 3UKOA 4AYWA 1P8JA 2QZ4A 4FD2A 4MPPA 3RYHB 1ZN2A 1NLFA 2ZSUA 1Q0ZA 4PGMA 1JIJA 1KJIA 4K6KA 5IASA 4UFOA 3FHTA 2Q21A 2BM1A 2IE8A 4MR8B 5D3QA 1X14A 2ZI6A 1RRGA 4J3NA 2XMBA 4BMSA 4FILA 3ZIDA 4RS4A 4AK9A 2QTCA 2PXHA 3B5IA 2WT9A 2ZRDA 3FPEA 4N6NA 2O50A 1P0MA 1PNVA 2PGNA 4TVKA 3AKEA 2YHUA 5DT2A 2I1LA 1Z8HA 4J0QA 5KHOC 2X2OA 2PSFA 1RBMA 1B6RA 2H1SA 2ZJ7A 4IXNA 1MABB 4R6XA 1KY2A 4MVJP 2GZSA 3OPMA 5AI9A 5FULA 4BJ5A 2Y0CA 2QRVA 2DYKA 2C8KA 1OB5A 1B73A 4ZAFA 1I36A 1N8NA 1VJ1A 4TL8A 4R7GA 5EFZA 2PV7A 1B76A 3P45A 4WK0B 1Z28A 1OT3A 4CHTA 1K7SN 2QVZX 1TB4A 3VPGA 3F78A 3GEPA 4BEJA 4QPZA 3CT4A 2I54A 2D1TA 2W6JD 2CMGA 4ZZ2A 3OEWA 4W82A 3TLGA 2O0MA 1AZLA 5B5SA 2AUMA 1F9AA 4UM9B 2WAXA 5EJ4A 3T1YB 4ACBA 5G3ZA 1U81A 1DUVG 5JTTA 4FVTA 1U3WA 5DASA 5JVDB 2X5JO 4WLEA 4ZPJA 4C1BA 4I4TB 4EPTA 2GI4A 2N1BA 1DKNA 2YCBA 4FYXA 7MDHA 5ETJA 4E1BA 1TIKA 5IBPA 4EYGA 4INAA 2PEYA 1SD1A 2NZJA 2AZ4A 1I7SB 1XMXA 3H2HA 2WB2A 1KWKA 5DNCA 4RV9A 3EZLA 1E4VA 4CFYA 3PXGA 3B48A 1CE8B 1MO4A 4MYHA 1HKHA 2CEAA 2V3VA 4LC0A 4P7JA 3KSDO 3NWEA 4D56A 3A4IA 1KO5A 4BRWA 5K0GA 3K5PA 4KCGA 3A1UA 1UCFA 2AEMA 4XQ9A 2BVNA 5FXMA 4BX0A 3FCUB 1RJFA 4CGYA 1JR6A 4GF5A 4PFJA 1C9JA 1ZONA 2QW1A 4I4NA 1EZ4A 4LPKA 4RZIA 1Z29A 4IRXA 1H2ZA 4WLFA 3H4VA 2IWRA 1A9XA 4YRNA 2G1PA 4C6RA 2I6GA 3CONA 3UMBA 1GAJA 1K68A 4UXHA 5C1BA 1GPNA 2JIRA 1CETA 1ML3A 4URXR 4UXIA 3OZGA 2VTBA 2HIHA 3CUSA 4BVEA 2QMYA 4KUHA 4FSHA 4D41A 1JLMA 4ZREA 3WMWA 1Z6GA 3IAXA 1BC5A 1U6IA 1YJCA 4PGFA 3QVWA 4OFBA 5KNBH 4HDAA 3VPCA 5EEGA 5EP2A 4XWTA 4MUNA 1GRNA 1RU3A 2IW3A 2V54A 5HZGA 3D3KA 5E95A 3ROZA 4OYYA 4Y1GA 5CGZA 3WIUA 3BFJA 2FR1A 5AM4A 5FPSA 1OTHA 5AIAA 3FVRA 1FMTA 4PPGA 1VZ2A 4UTNA 3DPUA 3FHCB 1DV1A 1NVTA 1ORIA 2C5FA 1YE3A 1RWBA 3AH8A 3R3XA 1TCBA 1YS2X 5JRJA 4EABA 3RVQA 2JI9A 5EWJA 3EZFA 3GCDA 4CLRB 4C0BA 2F17A 2SKEA 4BBZA 2HQ1A 3IGFA 1L1QA 1MB4A 3G0DA 3QLTA 2I2AA 3WHKA 3K53A 1P2VA 4TQAA 4PR0A 4DQDA 5LZ9A 1ZN7A 1TYAE 5EJEA 2Q5IA 2VYNA 1RYNA 2B5OA 2Q8NA 5DF1A 5TSDA 2JJMA 2AMYA 2P6NA 3N2GB 5DIFA 1QIDA 3DLIA 4GBMA 4XE5A 4Y0AA 3QFFA 3IEXA 4YH1A 2FR8A 1AX9A 3DMTA 3K73O 5A9SB 4XVCA 2BRUC 2EARA 1J2TA 1Y98A 1W73A 1G4AE 4ETMA 2CE7A 2XQGA 2GBLC 1L3IA 3C16C 2HGZA 5IFLA 5FBQB 3QXGA 4IJ5A 3EDCA 3ZQUA 3BWVA 1B41A 2ZYAA 1Y6ZA 4KWTA 4X1YA 5I4IA 1JLHA 3VZBA 1WB5A 1F3LA 3DFUA 4AO7A 3T5DA 1N2HA 1VDZA 3NQ41 4AG6A 3EY4A 5FQNA 2C1ZA 4HAOA 2IXAA 1KOFA 1DO8A 3VJKA 1L7BA 1CUWA 4BJ6A 2A5GA 5EHXA 4K9QA 1I5RA 3C97A 4JP1A 4COOA 4OKNA 4GLOA 1K3UB 3CH4B 2OFWA 4B87A 2R4UA 3R5HA 1E64A 3MLAA 1KP3A 4RD0A 3TO5A 2V6MA 4PONA 1I7NA 4AIRA 4ME6A 2FWPA 5CFMA 3FNHA 2XMDA 4CG3A 2DKFA 3B3AA 2WOOA 2PGJA 3HBMA 5KOIA 3TTUA 3ZXUB 3E9RA 3IX7A 4US0R 3DS8A 1JG2A 1SCUA 3BG5A 3QTTA 1GCAA 4MCAA 2FAXA 3L40A 4EB6B 2PX5A 1ULUA 3W5SA 2MYNA 3OA2A 1IZZA 4FUTA 3P5SA 2CJXA 3W4IA 3ZK8A 3A1FA 4J0JA 1WPXA 2RGBA 4HAXA 1YE8A 3VNQA 2IHUA 4PIVA 3KQPA 4D4KA 4JGGA 1R00A 4D9FA 4RTNA 2IS1A 3OJ0A 1TRHA 4HDCA 4HEHA 5JYEA 3AVVA 1XTUA 3AV3A 4BLQA 4D9JA 5IHPA 4KR6A 4WZAB 2NSDA 3FUXA 5GINE 4P38A 2C4VA 5H80A 4BO6A 4JR1A 2WG2A 3FPAA 1GQ2A 1RLIA 3I6IA 4CKWA 2RGYA 3EBPA 1ZH8A 2PMFA 4X6UA 4EEXA 4NRDA 4ILKA 3RW9A 2P2ZA 4FS3A 3BYZA 1R6BX 4FFMA 1LLUA 5G4KB 2ACEA 4KO8A 3V1KA 4RK5A 1CPYA 3GRZA 3HKDA 3VYRB 3P2EA 4EW2A 4WXRA 2R3SA 5I8WA 3ZS9A 2VWQA 1UM9A 1Y1LA 2CFOA 4Q1CA 2AKEA 2AOVA 2ETVA 2B8WA 1Q3HA 3LX4A 4AMUA 3CC8A 4EGJA 5J2UA 1AUXA 5ALVA 4EIWA 2WYHA 4P4TA 1ULTA 3CZPA 3EVNA 3LY8A 1K66A 2FMXA 2HF7A 4YMSA 3SX0A 1A88A 4PCLA 5B58T 4F11A 1GZ3A 2DSNA 3GMTA 3TECE 1DAMA 1WV1A 1Y5RA 3FDJA 5E4FA 4LNAA 4QHTA 4RD4A 5H9VA 4F9FA 4GU5A 5CYGA 4YAWA 1XPUA 4G0YA 4JBNA 2EW2A 2WKQA 3PR1A 4C08A 4DAOA 1T9GS 5JCPA 5DX1A 2Z3ZA 5DN6A 5HVNA 2GZRA 1JYFA 3I6ZA 5B3KA 1J00A 1ODIA 4I2VA 2FN8A 1YA4A 3AJ8A 3HDQA 3LA8A 2DSTA 1KAGA 1B00A 1VJTA 3SJZA 3GAMA 3MUNA 4AU1A 4IKEA 1YZVA 1BVUA 1QDLB 2G9VA 2EKZA 1JIQA 2JASA 3I0MA 3PX2A 2FMFA 2WR8A 1IBRA 2O7NA 2I2BA 3PHGA 3X1XA 4HGPA 1C30A 2HHLA 3WGHA 3LDUA 1BE8A 1VP9A 2VUIB 1N6PA 4KRGA 5SICE 5DPMA 5DNWA 4CF7A 3FWKA 5CFNA 1Q95A 1XG5A 4FBMA 3SF0A 2L18A 2F48A 1FPMA 2AG6A 2UVPB 4YS6A 1E6KA 5DV9A 4F93B 3JQBA 5JADA 1IZ9A 2WPDA 1OBFO 1W1UA 4US1R 4R3NA 3U9TA 1N5KA 5JW6A 5FBKA 3JD1A 3K0CC 5CJ2A 1NBMD 2V6IA 1NW5A 2HXYA 3OOWA 4LE0A 2HPZA 1L5KA 2OCYC 5FO1A 5IAKA 1UBCA 4HHEA 3LMKA 1QYCA 2QRHA 2XEXA 5D5PA 2CFSA 2Z6QA 4CLHA 1EGQA 1GCUA 5C5DA 2OD7A 5E9AA 1KI6A 1TM1E 4H4CA 5B7GA 1YIDA 4RUKA 3FYSA 2RB5A 4U3JA 4BCBA 1S2GA 4H7KA 1CUIA 1DS6A 4NBVA 4MLCA 1Y81A 1OE0A 1SIUA 3TIGA 1XCMA 1U7WA 2P90A 1NSFA 4JJ8A 3KEMA 4LNUB 3AEZA 4GFDA 2GYVA 3WJ1A 2O23A 4FCWA 1QR6A 1WEKA 1JSRA 1G4UR 2Q27A 1QRDA 3IFSA 1L5VA 2X2PA 3GIWA 3UXHA 3SOPA 2Z2JA 2W11A 4HG2A 3WLIA 4EW6A 4Q1VA 1NXPA 1JDZA 5HTOA 2XCQA 3NHFA 4R9RA 2M6RA 4KBYA 3D3NA 1VYHA 2CW5A 4IZHA 4ECAA 3ANMA 2X58A 1DEXA 2QI9F 4AWXA 1I4LD 1JDPA 4HLQB 4WPGA 1YRBA 3HGMA 3Q3VA 1EXMA 4AM8A 3NTVA 3QKWA 2WD7A 4BNMA 3U44B 2R6AA 3L46A 1ZOPA 4MROA 4YJFB 1L7QA 3O2JA 4EY7A 1CYEA 1C3EA 5KOJA 1JNYA 3FPGA 4EW3A 1T1EA 3STUA 5TLSA 2ID7A 2JGJA 3B1JA 4GMHA 3MJTA 2IEAA 5EXXA 4XIYA 2PJZA 3ONNA 3C5VA 2VVTA 2POCA 2G8LA 3E3AA 3H5VA 1H8HD 3KQHA 2PG3A 1JBQA 5KTNA 1ZG3A 1FDUA 4NJOA 5MFPA 1VHWA 2Q45A 4CMHA 2NV0A 5H1YA 1RPNA 3GT3A 1E99A 3DF9A 4J1NA 1LDBA 1I94B 1Y8QA 3GN1A 3LUBA 4CL8A 2H8KA 1R4MB 4GECA 1TA0A 5A2QA 1B8UA 1U0HC 1WIWA 1CX9B 1NMQA 3LBNA 5M29A 2OVFA 3CZCA 3HCAA 4XKJA 1FVOA 2C9OA 3K71B 4UHDA 4PRLA 5FBRB 2HDWA 2FJUA 2VPPA 3WGNA 1UBUS 4DJAA 2JGFA 2QT1A 1E9AA 2B4YA 4WQMA 1V4NA 1YBAA 3KETA 2BZGA 3L2OB 3IVMA 2IPNA 4UUOA 1PZGA 1GQRA 3TCKA 5IC4A 3G1WA 4MAAA 3UK7A 3A1SA 3CGGA 3KD2A 3KZNA 5E8JA 1U7ZA 1XP8A 2ZJYA 4EUNA 1GDDA 4YRZA 1WXFA 4GVXA 3AFIA 2XLBA 2EAUA 3EDYA 3RKRA 1NJ6A 1F38A 3QV1A 3KWLA 3SE7A 1QAQA 3CM0A 3GR6A 3N74A 4JMPA 3ZIAA 1NW9B 1PEKE 2EJVA 4G0QA 1USIA 3ETEA 4S2UA 4XJXA 3QHAA 4DZZA 3LUFA 2PMDA 2AI2A 4GR4A 1JFTA 1E0AA 3T5PA 2BUAA 1TVKA 1UWVA 4AS3A 5IXSA 2O2XA 4XRGA 1S4QA 1P7ZA 1E77A 3OI7A 4FHDA 5SYAA 3UMYA 3VR5A 3GNSA 3QEMB 1YA6A 1CTQA 4GLFA 5I9TA 2R85A 4D6YA 4YAFA 1JEAA 1HEUA 1I2DA 4DBLC 2JAHA 3IKJA 4DMRA 3ZW8A 4C3ZA 3LFUA 3WGVA 3N87A 1DJMA 4U9UA 4F5WA 3KQKA 4EH1A 5B12A 5D3KA 1IOWA 4BCDA 4KV9A 2P6OA 3TTXA 4MPTA 2F1IA 2XE4A 2C4HA 4XWYA 4MQFB 1T9HA 5KQPA 2DF8A 3K09A 2VAMA 2YMMA 2RJNA 3LTEA 5GPBA 2P9BA 2NZVG 2YV3A 3JVIA 5HGXA 3R76A 4MVJI 1UAAA 1E61A 4BEVA 2AFIE 4KQKA 1S2LA 2VTEA 2DBYA 3W2FA 3I0ZA 4BVHA 4YYZA 3RUEA 1KMHA 2HJGA 1Z38A 2BBOA 2F3SA 1ND5A 1S8FA 4FIDA 3VOTA 3ZI4A 5B57C 1JYSA 1AHNA 3V33A 1TUBA 5EC8A 4XQ0A 1KK1A 3JYHA 1IYZA 1EUDB 4KXWA 2YOFA 4WLOA 3O47A 1PL6A 3HRIA 4ZU6X 3SIXA 4D9CA 2OZVA 1OH7A 2RI0A 1CJCA 2DCUA 2OXFA 4M6WA 2VZEA 5M34A 2Z4TA 3PHCA 1KIAA 1SXIA 1MABA 3KOXA 4B44A 2QORA 5KNCA 3IULA 1DQNA 2QRVB 1PJ3A 3IKVA 4MW6A 4YO7A 4TTAA 1C4KA 4NQRA 3RU7A 1T5SA 3NHPA 1R5OA 2EKBA 1UK9A 2GF9A 1EEHA 3EVCA 1BA2A 1SVSA 1P1IA 2C2YA 4DV7B 4KOEC 2ZSKA 3TLGB 1G0NA 3FVQA 3UKDA 1WDLA 2NX2A 3ZWOA 2IH5A 4YMUA 2HHAA 4F38A 3IQGX 3VJRA 5IXYA 3TTSA 1G16A 2GJAA 2IA5A 1JKXA 4A8JB 1WDKA 2MJLA 1VSVA 3L02A 3WLMA 2YJ5A 2AMJA 4LRTB 1BS2A 4QEDA 2QYOA 1OWOA 1UFOA 4NBSA 1QQAA 2F64A 4PZZA 5FBZA 2FEMA 4ZZIA 1IULA 3P71T 1VRVA 2JFGA 4I55B 3OOEA 4C6TA 3BRCA 3H0KA 2WDZA 4MS1A 1QFSA 4RPGA 3PFGA 5CVVA 1M2FA 1JHRA 3AO0B 1ZUWA 5COBA 4GW3A 4A5OA 4KNVA 5ALQA 4KB5A 3NVDA 2KPOA 4JVSB 4W5OA 1Y33E 1B3RA 2QW0X 3H6KA 5F9MA 4P0PB 1VIVA 1YNSA 1ZUHA 3E05A 5EQFA 4UCXA 2BRUA 4RQAA 5M5BA 3OCCA 3EEQA 2ASVA 1QIFA 1NMYA 4V39A 2QLMA 2C58A 4RPLA 3UMRA 4OCZA 2OBLA 1YC5A 4RD1A 3KE9A 5E4TA 3ZV3A 4BWVA 4PBSA 3HGQA 4JB8A 5UKDA 2VPQA 3KAQA 3WGYA 4YAJA 1VIMA 4NZ9A 4LF9B 3QX3A 3PS9A 4XUDA 1P61B 1Q21A 2MWMA 2VQ3A 2BHLA 2J0UA 4NVRA 4AJNA 2E5LB 3CH7A 2MTBA 3HYTA 3JWPA 4MW2A 3LHFA 2EWVA 3FZEA 1NT4A 4P22A 2AW5A 5DBHX 3G5MA 3RG8A 4B2PA 4MJLA 4RPHA 5T7BA 2A78A 4YMIA 4HUJA 1UOPA 3B6EA 2W70A 3D7KA 2RD2A 3NCHA 4WCVA 5DE3A 4MLPA 4NBWA 5JJIA 1JILA 1MCZA 5BWLA 3OX4A 2B1RA 4CM6A 3DE2X 3IDAA 4BMPB 2AW3A 4Z9FA 4PN3A 3M1AA 3KXKA 2R8EA 3I05A 4S2EA 4EDFA 2Q8QA 1KGSA 2GPYA 2EWMA 3EGVA 2FXVA 5DHRA 4H2DA 1EFCA 1CQIA 1VRWA 3FNQA 2FFBA 1Z4MA 1H8ED 3WRXA 5CAEA 2V03A 4HYYA 4EPYA 1WVGA 2WZDA 5CVTA 1VE7A 3R3ZA 5DWDA 5TF0A 3WJ2A 3LVQE 2ZUUA 4BC1A 3K05A 5AVYA 1OFTA 2EDAA 2BGWA 5INTA 2DZDA 3IQIX 1DARA 3TXAA 1WZEA 3NDPA 4I08A 1B14A 5TT0A 3SQWA 1PR5A 2H92A 1FFXA 4CM8B 5EWMA 4Z4CA 1HOTA 3VVBA 2EQ5A 5HWSA 1WWKA 4LHEA 2CYCA 4NC9A 2YXBA 1E2PA 1E6CA 1Q14A 1OZHA 4LTDA 3T94A 1AUPA 2EX0A 2WILA 4JP5A 3V2GA 3U6KA 3QOYA 3PICA 3H5AA 4AJEA 4C06A 5F3WB 2IFTA 3AEQA 2OUKA 3FSJX 4A73A 2RAVA 1MA3A 1CB0A 2OBXA 1UC5B 3D8UA 4MUAA 5T8KC 1ORDA 1WF6A 1DBPA 4X1YB 3K31A 1DIAA 1FNDA 2EU8A 2A1IA 5D3MB 5DXAA 1GPWB 3EEYA 3U0VA 3EVZA 1GFZA 1DIHA 3PHBE 2O3JA 4B4WA 4I8XA 4B3IA 4B3SB 4E6EA 4EEKA 1HDIA 2GX6A 3F5MA 3QNUA 3JATB 3U9SA 3OSUA 2HLNA 3WA6A 3H2SA 4R5HA 3QE4A 3HCCA 4MLDA 1Z2OX 3TMKA 1G20B 1L5SA 1LVGA 1JLSA 3MJVA 2GPWA 2VFAA 5LA6A 2XMPA 2B4AA 1ZD2P 2HQRA 3Q85A 1G20E 5TJ9A 3UNXA 1KI1A 1XZJA 2JAPA 1IB0A 1W1WA 3IUBA 2HU2A 3M6UA 1DDOA 3STHA 1ZU4A 2H1HA 4NYIR 1OF1A 3E7WA 4B9EA 2QTLA 2I55A 5F3RA 4C0JA 3U4DA 2C8JA 2FNAA 4QQ8A 3SR4A 5HOQA 4LFAB 1OBCA 3HNRA 4WCFC 3UAYA 5TPWB 3TAHA 1JHZA 1NNUA 5EINA 1T4GA 2JJ1D 4XVQA 4MAMA 1F0PA 3DLTA 4Z7NB 5D1NA 1YO6A 5IYZA 1G21A 4WGGA 5ILOA 5T67A 1QGDA 3IKLA 4GM1A 2W7TA 4J94A 1UFVA 1Z75A 2BBTA 2W8BA 3T12A 3ME5A 3IHWA 4GO1A 3NVMB 1O9BA 3M4NA 4K1LA 2JFUA 2DAPA 2CGEA 1DO2A 4K03A 4PRZA 4UASA 5AM2A 2DPXA 1Z4NA 2WK1A 1FVXA 3G7UA 4KAJA 4EUSA 1GQQA 1A5AB 2GJ8A 2W8ZA 1V39A 2ZRBA 3ZCVA 2UXBB 1GPDG 4P4LA 4DT1B 1WB6A 1M9NA 2GESA 4N3GA 3PL1A 4ZOEA 5JS8A 2BC9A 3F5SA 4CKEA 2XB6A 3M5WA 3TLAA 1I01A 5J3JA 1J5EB 1DJOA 2HREA 3B3JA 3HYRA 2ODWA 4PE5B 4YAGA 1ZCJA 1E8DA 4GE3A 5B2ZA 2ADMA 1R50A 5KYUA 3QYAA 1WHTB 1HORA 1Y4DE 2R0QC 4N4AA 2PD3A 1U3TA 4DUYB 3VZDA 2XKBA 4MGZR 4Y2VA 3U3XA 1EFPB 5J2UB 3NALA 4I4CA 2AR9A 2VJQA 1ISPA 1YL6A 4RAOA 1WJGA 3WK7A 1X1RA 2QN2A 3RM3A 4CEIB 2IYQA 821PA 1ODLA 2FUKA 1PUIA 3IJ5A 1M6YA 1TCVA 4FNAA 4PC1A 3SICE 4KGDA 1IM2A 4IQ8A 1L5MA 1KAEA 4LOIA 5LXTB 4ZK2A 4DWWA 1IVSA 1GZSA 4XR4A 4QHSA 2QSZA 1DQPA 3S7ZA 5FAXA 1OH8A 2GEDA 3PQDA 1FFSA 1D03A 2ZVPX 5C8YA 1UJ6A 1NUTA 1PJCA 3MHPA 4N40A 3RIMA 4BP8A 5L3SA 3V5NA 4J07A 1NYLA 5BQOA 5LQUA 5JQGF 1YKSA 2Q5HA 3DUFA 1N7JA 2GNOA 2J6IA 4O2AA 4R7ZA 5AOAA 4ALIA 2RAPA 3NYIA 1SPXA 1QLHA 1ZOLA 2F1HA 4BWYA 1WZNA 5EMHA 4QWMA 4GHWA 4REQA 3IODA 1WMEA 3NWJA 5ECWA 3I73A 3SM9A 2BW0A 2I1VB 2JFPA 5EJ6A 1HETA 1XTBA 1WDWB 2ZEJA 3GLHE 4IQ0A 4DQLA 2UVPA 5NLLA 2JI4A 2H1LA 5IBCA 4N5HX 4BN4A 5C9ZA 1J1IA 4TYYA 1CUAA 2JDIA 3T4PA 1TQ8A 5DGIA 4AMBA 3BN3A 1OXSC 1W19A 3A1VA 3DCYA 1YWGO 4TTJA 4NULA 1I0LA 3QXHA 5A7GA 2R00C 3WDKA 1ESNA 2H52A 4GZMA 4I50F 4XUGB 3MILA 1QHSA 3OCVA 1ULBA 2E6KA 1KAHA 3A0RB 3AEYA 3H3FA 4IVRA 2VP5A 1XPJA 3EGCA 4GICA 5DM0A 1H2HA 2PM8A 3FDZA 2VH1A 3ER6A 1KOGA 4UBMA 4OQQA 5KHLB 4BE7B 3ULKA 4CEIA 5B1EA 3FYUB 1WXHA 2AR7A 4Y2PA 3EXEA 3JD4A 2FWAA 2Z9CA 3CS3A 5DNAA 4YRDA 2Z1MA 4LYEA 1YQEA 1UBKS 2WKPA 4QOFA 5LB4A 4RTQA 4ZTUB 2XB8A 3WXMA 1P5ZB 1U1CA 1O54A 1UFKA 2PSDA 1WZ2A 4R98A 1G9XA 3D54D 5BR1A 2BCJQ 1Q7GA 2A3RA 4C05A 3AVQA 3UIEA 1C41A 2IZ6A 3E8MA 3HU1A 2JJQA 3P2IA 5D00A 5FLKA 1D3AA 3NTOA 2CV1A 1KC1A 2NTYC 2PY6A 4QIHA 3I5AA 4F71A 1U28C 1BKDR 2I4IA 2J1LA 2XWQA 5JBNA 1F51E 1J0DA 2ZUCA 3ER9A 1JQKA 2UYGA 5EUQB 1S3GA 1QS0B 5F5NA 3IA7A 2BT4A 2JIZA 3QA3E 2X1VA 4MP6A 4X8LA 5AHKA 4H7DA 1L7MA 1WL8A 3EFEA 2G25A 1F3OA 5F51A 1QP4A 2W6NA 3MAJA 1OCEA 2PL3A 4OHVA 1OSNA 5C4MA 5LZ7A 3KQTA 5IBRA 5JV5A 1YJAA 4NZZA 1F6DA 3THWB 4CLXA 3FGZA 3G8CA 5L7TA 3DFFA 3I4CA 4TWZA 3R24A 3EBLA 3IURA 1Q5PA 2GBLA 1TT5B 2VJDA 4CTNA 1K6JA 9MHTA 1D9ZA 1NVAA 5TXGA 4ZVRA 4JT2A 1T4DA 1OJ7A 1M7BA 3RABA 2R44A 4UQLA 1VHLA 2W00A 4Y2HA 2JEZA 4NMHA 3SS7X 3G2NA 3KHUA 1S7GA 4QGBA 4CM1A 2GJ9A 1TIBA 4BPRA 3NYWA 1KDZA 2XNJA 2EQAA 2Q6IA 3H2JA 5B7NA 2XXAB 1JQDA 4ZC1A 1W48A 2CXUA 2OGWA 1PFQA 4U6NA 5J63A 4LFBB 3V6MA 3V1TC 3ZVMA 2YXDA 1UDWA 1Z0KA 3TRFA 1N5IA 3U3RA 5KB3A 3IR6A 4KFSA 3RTAA 4GI7A 5MGNA 3A11A 4YQZA 1XQ1A 2QAGA 1VBFA 1JXAA 1G2QA 2V9ZA 1M10A 5F78A 4B80A 3H18A 3L0BA 3BORA 1X15A 5D8DA 1U2RA 1KY3A 5A0TA 4BWFB 2V4UA 1HWYA 3D7RA 5JYDA 4DOMA 4DXHA 1V43A 2W2LD 5LU8A 3L8YA 4U9HS 1VG9B 3KRTA 4R2XA 4MI1A 2ZUSA 1H6DA 3DULA 3G5LA 4DIUA 1YOVB 2BJVA 1KNXA 1KI3A 4JOBA 4PHFA 1XCPA 5H59A 2EP5A 4NBUA 3U1BA 1O5IA 1SCIA 2BFWA 2NVOA 2FX3A 3DOHA 3QPWA 4QU5A 3TWOA 4B7AA 5JDIC 3WKCA 5BXQC 4HX5A 5KNCD 1BFDA 1QUEA 2GUGA 2CL6X 5SY6A 4QKQA 4IM7A 3QH4A 2P91A 4PFKA 5EKUA 4F3RA 1PV2A 1TL7C 3ZS8A 5EXPA 3ZYCA 4DA9A 3PG5A 4UVIA 3FTNA 4PC7A 1UEJA 4I1UA 3A1EA 4EHJA 3G9QA 3D43A 1VIDA 3MC1A 4RIHA 2WMYA 3FCYA 4R83A 5J2TB 2QGFA 3PC2A 2ADOA 2XKAA 4HAUA 2V7UA 1LW6E 3CY6A 4JA2A 3GLVA 1T5HX 3GUVA 1ABBA 4A8HA 1Y4UA 2A6PA 2CLDX 4HAVA 1BMQA 2AXEA 4KGXA 5IVDA 3W34A 3ZKAA 1XLVA 1Q0RA 2F4NA 3HM2A 3FPCA 4YLEA 3AM1A 1JR3E 3F3MA 3RC3A 4GPEA 4UNIA 2RKWA 4LOHA 1QVWA 1P72A 4XYGA 4PNEA 2E0IA 1RJDA 1KRHA 1W6UA 3AI2A 4II3A 5DTJA 2GLXA 5FEUA 3C6ZA 1T2DA 1G8AA 1NX9A 1AGYA 3SC6A 3RTCA 3I2KA 1DPGA 5KKAA 1ZFNA 2XCOA 4URFA 1YB2A 2BEWB 4Q3KA 4R1UA 4RMJA 5LQCA 4I14A 5FADA 2CK3A 3WO0A 5D7BA 3PBKA 5A0VA 2ZJ0A 1F5NA 1VYUA 1MLDA 5GM1A 1XQYA 1KU0A 4GKJB 1WCIA 2VP2A 3CLRC 4M55A 4QUEA 2GXQA 4IV5A 3VVCA 1SBNE 2QVYX 3AMVA 3MVEA 2FUCA 3MGCA 1HL3A 4YMWA 5IUKC 4YGXB 1KE1A 4ETWA 3KVNA 3WDSA 4AN1A 1U80A 2O2YA 1KO4A 1ZIPA 1SOWA 4D42A 1YRHA 1N6HA 3M82A 3OUZA 4FJ1A 1XU7A 2PMWB 4BXOB 3IAFA 4ER0A 4JSYA 2DB3A 1U4SA 2NSJA 3S2SA 3DCNA 4L8LA 3KYIB 3WHLA 4Q18A 1F7VA 3L0ZA 2XB9A 2BFNA 2GEFA 3RVSA 3UWMA 2ZBDA 2ZYRA 3I9FA 1D7AA 4LMPA 3N2KB 1TKRA 3AF0A 2QENA 3WB1A 1INLA 3L6CA 2JLAA 2F3QA 1IN8A 2HOQA 1IHXA 3NP7A 2MSCB 3PDWA 1KZ1A 4GX0A 4M86A 5KNDA 4AY6A 4IO0A 2BBWA 1POWA 4ID9A 4PXYA 5I4KA 4TWAA 1B1CA 3KPJA 4FGJA 1RLMA 2XDQA 2MT9A 5KO2A 2O2HA 4V0RA 3NC4A 2W2VA 3KWJA 3EWIA 2X4GA 1V4VA 3NBKA 1MEOA 1U8TA 2J0VA 1UC4B 2QT9A 3EVBA 3Q9SA 4RDIA 1OXKB 3UMVA 4KE8A 1TF5A 4INOA 1C50A 4MR7B 2X0FA 3IJRA 3L6BA 3N76A 3AJEA 3JQGA 1DMRA 3AT1A 1IQRA 2JIOA 4ZJYA 2BTEA 1RHMA 2GEUA 4NATA 4RACA 2H5JA 3EASA 2VJBA 4DMGA 1X1DA 1XKLA 1XZQA 2OVBA 3QUSA 4QSHA 3W9BA 6ADHA 4P3PA 5CIWA 1OA0A 1QX3A 1JQ5A 4YMTA 2D7CA 2HPVA 2Y4OA 4LZAA 1GITA 1JIIA 1FQWA 1N3YA 2ISCA 3C4JA 1ADJA 3OHSX 2XWJI 3IUJA 1BX3A 4LW8A 5EZQA 3OBIA 3AR4A 3HVRA 4H17A 1ZK0A 3SYRA 3PHJA 4BNTA 2EHDA 1UXIA 4C14A 4DHWA 3THXA 1XA0A 1JWLA 1SC3A 2NWQA 3EPHA 1IL0A 2QQ0A 4BQPA 4Z2AA 5HJ5A 5GAJA 4PG8A 1ZMXA 4DUZB 3K0FB 3TFQA 1SO8A 2BE7A 2X19A 4OMFG 1F6WA 1D2AA 1CYDA 2PGDA 3A25A 1RAGA 1QK5A 4Q3OA 5FFMA 4ND7A 4GL4A 2AG1A 2YJGA 3JRNA 3LY5A 1CFZA 3CINA 3JYPA 1G5RA 4G8DA 4PQGA 5HZHA 5L3RA 1CQIB 3EMKA 2XOKA 4OQ4A 4TS1A 4Z0TA 4B7UA 1MC1A 2WUVA 2CKMA 3R0XA 2Q5QA 4Q4HA 4YJ2F 2HSEA 3VPSA 4GXRA 3A3YA 3P2OA 3FJ1A 4KIWA 1B2LA 2HMTA 3PSAA 1SBTA 3W8NA 1C3XA 1DHTA 2WJ4A 2YUTA 5ILGA 1C4WA 2IUUA 3SHTA 3JTMA 3WSWA 3ZDRA 4ZFNA 1NOIA 4UZEA 1QV7A 1BWRA 1XQXA 5JDCC 2WFMA 2GM4A 1NXSA 1V6SA 3AW8A 3WHIA 4J1TC 4JLAA 2WTUA 2ZJ4A 1PQPA 4AECA 1YB5A 5C80A 3HLYA 3NHAA 3R3HA 1M54A 4WT7A 4X6LA 3JZDA 5BSMA 3RVLA 1LPOA 2HN9A 3SS9X 1Z4IA 3EMBA 1C9NA 1ZUIA 2G71A 2VBGA 4HNSA 3RV4A 3ZWAA 1OZAA 3DB1A 4IUDS 1NHWA 5LYJF 1SQ0A 4GP9A 2QX4A 1YBVA 2Q3HA 3A4YA 3GCGA 5TRTA 2LCQA 1R6VA 5LC1A 3ZZMA 5DNDA 2PSHA 3C3EA 3K72B 1E79D 1NT2A 5A0FA 5TVGA 2PR7A 2VHQA 3DXXA 3AL0C 4UCWA 3JATA 1ZY2A 3AR2A 1WNFA 4RZ2A 1QQ5A 3JQAB 3RNLA 2A4MA 3BSSA 1M6VA 4JWKA 3IT0A 2YIDA 1XCGB 3BERA 4F56A 3ILVA 4QDJA 3ZD9A 5ITZA 3WAKA 2AVNA 2YDXA 4NNJA 2FK7A 1EFLA 2ODPA 3CISA 3CT6A 3FOAA 5EY5B 2BZSA 2GEBA 5H4GA 1A9OA 2OBNA 1F0NA 2CLKB 2QDKA 1FL9A 1XNHA 4XPZA 1X7ZB 1DIRA 2G76A 3G8BA 4JVLA 3KZOA 5CPBA 4JUBA 5WRFA 3WV5A 1E3QA 5L40A 3IALA 2X9NA 1C0IA 2Z2YA 3W6OA 1E62A 4YV7A 5FOQA 2IEDA 5HILA 5IKOA 1TUIA 4FYKA 4B6FA 3N2LA 3GCWA 4XGRA 3CA8A 1F0KA 1P2BA 4AKSA 3OQPA 1DKLA 3MRSA 4ZTZB 3O83A 2HA5A 3TNDA 4NPCA 3TQHA 4CODB 4DZRA 5CYPA 3PJFA 2QN3A 4FYMA 4YI5A 1BE1A 1ZZEA 1CDOA 1TKCA 2FSGA 2L82A 5JWOA 5JJLA 5BMVB 1XVUA 2HQBA 2GH1A 5JVDA 2HLPA 3PEVA 4YXWD 3IP5A 3FVTA 5F2EA 3RROA 2FZVA 4ISBA 1NF2A 1UQTA 4KQ6A 3JAWB 2Z1NA 1RWKA 2XCLA 1QKKA 2EJBA 1ZGAA 2GQ0A 4X3OA 4CMAA 2GEJA 4Z3KA 1CE8A 1JP7A 1EZZA 3B8EA 1HYBA 3SXPA 2PIDA 3FVWA 4KR2A 1P2DA 2OG2A 3VI4B 3R5TA 2O2DA 2C7PA 1GFIA 4PQYA 4LCJA 3DE1X 1UXHA 3ANYB 2Q5LA 2HM7A 3GQBA 4GPBA 3WNCA 3L8FA 4MV4A 4H7JA 4QZVA 2MINA 4ZT3A 4AJKA 7ADHA 4IINA 4DNQA 5CDUA 2AQHA 1JRLA 1M6VB 2W6CX 3WP0A 1VOTA 3GPLA 1F0YA 3I2YX 3LQKA 4TLAA 4KO4S 3RSHA 2OO5A 1QTRA 2RBEA 3HFGA 2GM9A 4BO3A 4UTPA 3LHDA 2CDRA 3M6VA 5LXTA 4U2EA 3I2JA 2FWJA 3JD3A