5DGCA

Reaction of phosphorylated chey with imidazole 2 of 3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
b'ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dgcA00
3KYJB 3NNNA 3FFTA 3JVIA 2A9RA 3OM0A 4LDAA 3CG0A 3OLWA 4DN6A 3GYBA 3RVRA 1XHEA 5KC9A 3EODA 1DCMA 5HSGA 5KQPA 4MR7A 2IPAB 1ABFA 5I4CA 1E6MA 4P98A 1RZRA 5HM6A 2PMCA 4KK3A 5B3JA 3HVRA 4E7OA 4RU1A 4F11A 7ABPA 3LUCA 3K4HA 5JNSA 3LUFA 3OQNA 1QMPA 3HUUA 2FVYA 5EWLB 1DC7A 3CTPA 2RJOA 1EAYA 1ZAYA 1DBWA 4RK7A 2TMYA 3HCWA 1BDIA 2FEPA 1NY5A 2HJ9A 2JBAA 2KYRA 5IUNC 1Z26A 3JPWA 4JOQA 1DJMA 1JDPA 2E4VA 2FMIA 4RK4A 4RY0A 5CNIA 4LX8A 1AB6A 4TN5A 1PEAA 4DADA 1U2QA 2LPMA 4N47A 4Z99A 5IULC 1I3CA 3T6KA 3CHYA 3HV2A 4QYMA 2JVIA 1OXBB 1MB3A 3I09A 2VUHB 4UHKA 4YLEA 3O2QB 2P4UA 2L19A 5CNMA 3SNKA 4FB4A 1ZN2A 1ABEA 3CZCA 3Q7SA 4JA2A 5BQ3A 4H60A 4KQCA 5JS1A 3O2JA 4ETMA 4KK4A 3N0RA 4W5TA 3D8UA 1FFSA 3JPYA 5IEBA 4H3KB 2QVCA 1FFGA 4O5AA 4MS1B 3N6VA 3LMKA 1CHNA 1JX6A 3KLNA 3KTOA 1VPWA 1K68A 1BDJA 1ZH2A 3MF4A 3Q41A 1VRVA 1VLZA 3E3MA 4RDCA 1RPJA 5F64A 4N03A 5TPWB 3LUKA 1F4VA 1LBHA 4MS3A 2NT4A 4JAVC 2J48A 1QQAA 4TLMB 1GLGA 2NUBA 4MAAA 5DCLA 3CLKA 5JNRA 5ABPA 5BRAA 3KHTA 2CHEA 3TB6A 3BRQA 3HEBA 2WY2D 1GCAA 5C5EA 1M5TA 2GWRA 3IP5A 1QPZA 2QZJA 2ZAYA 4G0OA 3S99A 3H1GA 3RVQA 4E7PA 1LJLA 5KQGA 2N9UA 4IRXA 2WWVD 2R47A 3BRSA 2I6FA 2QR3A 2F8SA 1EWKA 1U0SY 2FLKA 3HDVA 3FDFA 4P1ZA 4MR7B 1NXPA 2H0AA 3MIZA 3NBMA 1TJYA 1D1PA 5PNTA 1YK1A 1A04A 5BR1A 1C0EA 4WT7A 1RXEA 4YP9A 1DBPA 4PEVA 4CBVA 2HQRA 2O20A 4MS4A 3IP6A 1DCKA 5TQ0A 3H5WA 4KFCA 2HSGA 2QSJA 1PNRA 2CHFA 1PUXA 3O75A 1MB0A 4Z9AA 1EFAA 3LTEA 3QEMB 4G86A 5IUKC 1APBA 2PUEA 3KG2A 1D4ZA 3CZ5A 3BILA 3FMVA 4G0PA 1VKRA 4MRMA 3I42A 3EQ2A 1USKA 3KSMA 1S8NA 2YHAA 4N0PA 4RK5A 3IP9A 3Q7RA 5GOTA 3H1EA 4KV7A 3T95A 4S04A 4W5RA 3FFWA 4OATA 3I45A 3QLVC 4ZYLA 1ZY2A 3SY8A 1ZESA 1U2PA 2PJUA 1DG9A 2IOYA 2V0NA 3I5AA 4NV3A 2FKAA 1Z2DA 4L85A 3A0UA 1K66A 2FTKE 1RXIA 3JS5A 5EWMA 3EDCA 4WZZA 3GL9A 3LUAA 1EHCA 1ISRA 3F6CA 4XARA 5IEJA 5KC8A 1JFVA 1NXVA 3MQ4A 2ID9A 2E4YA 3OO1A 5FWXB 5FWYA 3RVNA 5JNWA 3C6QA 4LDZA 2PUGA 2LUOA 1E2BA 1A2OA 1GUBA 5TQJA 3HZHA 1YVUA 4MS3B 2FSPA 4RV5A 4RY8A 1UDRA 4F3TA 2WB4A 4YGXB 4IMIB 1YIOA 4MYRA 2HQOA 1SD5A 4JP1A 2PAFA 2F8TA 4EVSA 2GBPA 2OENG 3LOPA 4KNYA 4KREA 3KJXA 5B3JC 4MR9B 3IPCA 4RKRA 3G1WA 3K9CA 3O1JC 1P8AA 2WJWA 1QP4A 4HNSA 3GV0A 1YK0A 2QV0A 3NNDA 2XDYA 4RSMA 1D5WA 2R48A 3QK7A 1DBQA 1JBEA 2ZWMA 4OG2A 3OMWA 1KRWA 5E3JA 1RZRD 1DRKA 3QX9A 4JASB 3T8YA 1XHFA 5T3YA 4EUKA 2CWDA 4WWHA 3H6HA 1NTRA 1ZDMA 4IGAA 2OQRA 3N8IA 4Z4HA 2HQBA 4XASA 2WJAA 5TQ2B 4MLCA 4MQFB 3O1HB 1DZ3A 1URPA 1KMIY 2L18A 3HUTA 6ABPA 2PKXA 4MS4B 4EYGA 5TQ0B 4YS6A 3IDOA 2R25B 2L2QA 4W5QA 3F73A 4G0YA 3RQIA 4F8JA 1W9HA 3JTEA 1JFSA 5KWSA 1Y1LA 1XWWA 2NZVG 3NNSA 4JB2A 4L4UA 4TMYA 1Z16A 4IMJB 4MRMB 3RVJA 1H9CA 5FBHA 4G97A 4OTZA 3MYYA 4ML3A 2FMHA 4N0QA 1MIHA 3B2NA 3ROTA 3LKVA 1FQWA 1QO0A 1HEYA 4Q6BA 3DZDA 4RK1A 1RNLA 3CKMA 1YTUA 2JVKA 3HS3A 3OLZA 4ZMRA 3DGEC 3DLBA 2FQWA 3LUJA 4MQEB 4MLDA 1W25A 3LKBA 1TVMA 3OLXA 4DQDA 4FE7A 4KRFA 3OLVA 2PUDA 3JVDA 4FE4A 1NXOA 3EULA 1E6KA 3GBVA 4GNRA 1LBIA 4EY3A 1AB5A 5DKFA 2MYUA 2M98A 4YWHA 5TPZA 3RVSA 2MYTA 4Z4IA 3H1FA 1DP4A 4ETNA 4QICA 1ZGZA 1ZITA 4PICA 1TM2A 3QELA 1EWTA 5TE9A 3LUGA 4KZKA 4RY9A 2PL9A 5DGCA 2JCGA 1JYFA 2VYCA 5GQSA 1Z17A 3QLTA 1QP0A 2PUCA 3HDGA 5IBQA 4KVFA 1E6LA 1PHRA 2IPNA 3CRNA 1F51E 3M6MD 4EGSA 1USIA 1L5YA 1PEYA 2MYPA 2GX6A 3H75A 5DLEA 1GUDA 3DLHA 1YS6A 2IKSA 2DRIA 3Q15C 5TPZD 4LRQA 3O74A 3R0JA 4XFKA 1TLFA 4EYOA 4D74A 2JBAB 2BGGA 9ABPA 4G0ZA 5JNUA 1U8TA 1QP7A 4H3HB 3CNBA 3LUHA 4N41A 2PUAA 3TO5A 2MYNA 1DC8A 3GRCA 8ABPA 1JFTA 4ETIA 1QKKA 4GPAA 2PL1A 1JLKA 1L5ZA 4D6YA 3HSYA 1U04A 2RGYA 2YHBA 5CNJA 1JWLA 3H5IA 5IUJC 4LE0A 4EYKA 1MVOA 4W5OA 1M5UA 4N76A 1NXXA 2WMYA 4RWEA 2QW1A 3IPAA 3BREA 1PNTA 2FN9A 3QLUA 3N75A 2LP4Y 3EAFA 3H5LA 4PYRA 4UHJA 1NATA 4EVQA 4YCSA 4YR7A 3OM1A 3TD9A 5TPWA 3QLUC 1WETA 5HKOA 3W9SA 2B1JA 2E4UA 3GT7A 2H3HA 2QVGA 3N0WA 3NHZA 1Z25A 4NICA 1JF8A 3H5VA 3CU5A 3BBLA 1KRXA 3GA5A 1SXIA 5ED4A 3C3KA 4Z0NA 4Q6WA 3CS3A 1DRJA 3C97A 2FLWA 3QX8A 5JNTA 1YMUA 3A3KA 2CD7A 2QXYA 3L6UA 3UKJA 3UUGA 3KCNA 1M2EA 1BAPA 2JK1A 2MSWA 3QEKA 2L17A 4LE2A 1B00A 3OQMA 4OLBA 1SXGA 1OXKB 4Z4CA 4EYQA 1IIBA 4MR8A 5EWJA 1R8JA 3RVPA 1QQBA 4YV7A 4TLLB 1NXWA 3Q7TA 1P6QA 4JB0A 3H5TA 3QELB 3SQNA 2FEWB 4G0QA 1LJUA 1J56A 4WXEA 4NCBA 2X7XA 2GKGA 2HPHA 3C3WA 3H5OA 1ZVVA 3KKEA 2RDMA 2M1ZA 2A9QA 2AYZA 3T38A 4QYWA 3OMXA 4G0MA 5JNVA 4YO7A 3QEMA 3A0RB 2NZUG 2LBPA 1FSPA 4F06A 1P6UA 2IPLA 1M2FA 4NCAA 2JB9A 4XLTA 4HNQA 5KQMA 2VUIB 4LZLA 3H6GA 3HK2A 6CHYA 4PZ0A 5IC5A 4D6XA 2FN8A 4OLAA 3JY6A 4Q7EA 5KI6A 4W5NA 4RS3A 3ROFA 4IF4A 2MSKA 2IYNA 4LE1A 4RXMA 2FQYA 3C3MA 4HYEA 4S05A 2P9HA 1SXHA 4Z4EA 5D2CA 4ZPJA 2NT3A 1Z18A 2A9PA 2FQXA 3OO0A 3HJFA 2A9OA 1C4WA 3O21A 5HQJA 4RZSA 5EWMB 2JVJA 3SM9A 1FFWA 4RXTA 4RXUA 3D02A 3SAJA 3UK0A 3TX6A 5C5CA 1USGA 5FWXA 1LK0A 3CG4A 3GWGA 1QO0D 2IDMA 4G0XA 1TMYA 1P2FA 5FWYB 3F6PA 4B09A 5CNKA 2ID7A 2W42A 4Z9BA 5DTEA 2E4WA 3N0XA 3P9YA 3RVOA 5JS2A 4QPJC 2PE5A 3E61A 3HXMA 3G85A 2WRZA 3KLOA 3M9WA 4ZMSA 5KQLA 2JRLA 4Y9TA 4YRZA 3N53A 5EWLA 3EQZA 1Z15A 3NHMA 2E4ZA 1Z13A 3KYIB 4MR9A 4ZJPA 5BRJA 3L49A 3OLYA 4MGEA 3M9XA 3A10A 1EWVA 1CYEA 4RK6A 2FXIA 3DGFC 3HM9A 5FBKA 1A0OA 3OQOA 1JL3A 1ZHHA 4MPTA 1Z2EA 4O1HA 4RK0A 2R4QA 1D1QA 4Z4GA 4MR8B 3IP7A 5EWJB 3EGCA 4KQ9A 3HO1A 3VNBA 4KPYA 3RVLA 5TQ2A 4EVRA 4MQFA 2AYXA 1CEYA 4IILA 3O2SB 3FFXA 4M88A 3MMNA 3SG0A 3VNAA 5T7BA 3RVKA 1NXTA 4WXMA 3EJWA 4MS1A 1ISSA 2LIVA 3FGZA 1BA2A 2GI4A 3LFTA 4KMRA 5CHYA 1JYEA 2RJNA 3Q9SA 2B4AA 3RVMA 1BVHA 3MM4A 4HNRA 1ZH4A 3QLVA 4PE5B 2FEKA 1BDHA 4OBBA 1NXSA 2PUBA 3LUDA 3CFYA 2VK2A 1Z12A 5IX8A 1D2AA 3TMYA 2MSLA 1KGSA 1GCGA 1ZGGA 3KS9A 3O1IC 4F12A 4XAQA 1MAVA 1YMVA 3ILYA 4NQRA 2QU7A 4RKQA 1JHZA 1YS7A 2Q5CA 4O1IA 3MA0A 3GBPA 4MQEA 2FW0A 3URMA 2E4XA 4WUTA 3RH0A 2PUFA 3DBIA 1SRRA 1JH9A 1QNLA 1DCFA 1T34A 4Z4FA 3F7NA 4XXHA 2FMFA 2FMKA 2IPMA 3ILHA 1JDNA 2PLNA
chains in the Genus database with same CATH superfamily
1ZK4A 1IQ0A 5C8YA 1BHQ1 4E32A 1CHDA 2A9RA 2Q9AA 1BE0A 4HC4A 1PDVA 2LKDA 2H1CA 3GYBA 4D26A 5JCOC 1Z28A 3KYBA 4I4CA 2IW3A 4FT2A 4P93A 2VJNA 3SBXA 2FPMA 4GQAA 1XVIA 1MNQA 2N0SA 3QXHA 5FOTA 4JYZA 1HKHA 4FGJA 2Z5VA 1GP2A 3K0SA 1QP8A 4HGOA 3VNSA 2ZSAA 2VP6A 3T06B 1ODFA 2DQSA 1NYTA 2FX5A 1EHIA 2DC1A 3GJ7A 3WQHA 3W7BA 3IT2A 1B7GO 2ILVA 1O96A 4L0MA 5A5EA 1KXJA 3T9CA 5BNTA 2XNHA 2JIDA 4AG3A 4E4YA 2Z5FA 3R5KA 3PFCA 1EX9A 2KYRA 2P2DA 3LLCA 3PXCX 1Z26A 4G1BA 2DPLA 1JDPA 1V7ZA 3ZGOA 1CKEA 1YAHA 5HOQA 2XB8A 1DAPA 1CY7A 4Y2PA 4N47A 3F8SA 4A92A 1I3CA 3CRW1 3T7RA 1ZK0A 2E55A 2WJJA 4TKUB 3AKYA 4A10A 3CLTC 1UBRS 221PA 4FD3A 2YJ6A 1U3CA 4LMPA 2VH2A 1UXKA 3AM5A 4ZICA 1AGPA 1CJCA 3GMDA 5EHZA 1PKEA 3O73A 4CU5A 3ZW8A 5JAMA 1RQ2A 3OURA 4PS0A 1MXHA 1LS1A 2GJ4A 2JKZA 3FCSB 4KNYA 3L1UA 3OZBA 4I50B 3I83A 1KU6A 3R8XA 3JZIA 3WGGA 4BN0A 3GFRA 5ALHA 5AM2A 4KEAA 5FF9A 4AKIA 4P80A 2EATA 1RPZA 2BSXA 2HDNB 1QTQA 2O19A 4Q12A 5H82A 4CTJA 1ISGA 4NBUA 2CJXA 3EA0A 3KTOA 1N0HA 3P2KA 2EV9A 4N4AA 5ALQA 1BDJA 1ZH2A 4X6XA 1WOYA 3AQIA 1GQOA 2NU6B 4FWIB 2WIDA 1PQYA 1F60A 2AF3C 4Y9SA 4DV4B 1Z8HA 4W8OA 5HKBA 2Q7OE 1Y1KE 4ZVMA 1A8PA 2XW6A 3BK7A 3C3BA 3IP1A 4TLMB 4FDTA 5E4YA 1A97A 5I9SA 1W44A 3IMFA 1QTNA 2X7HA 3LHIA 5AK4A 1EWQA 1IWPB 3RFXA 4DV3B 4X64B 4C21A 5KOHB 2Q4DA 3V1TC 3WGHA 4WNAA 4ZGBA 2HJHA 3Q7QA 2IV3A 4JJAA 3ZVLA 1W2GA 4A4DA 1R3DA 1V4VA 2EVWX 2I66A 3NR2A 4GLOA 4NIMA 3WGVA 3SNHA 4UUBA 1AGXA 1R12A 2W58A 5K4HA 3EW9A 2H7XA 2WKWA 2X0DA 2J9GA 4YMWA 1D7OA 1A2BA 3SHOA 3ZV5A 3TLCA 1DV1A 2C5BA 2BZGA 2VDOB 2XEDA 4ZRDA 4ABYA 2PRZA 2CB9A 4C4SA 4AYTA 1C30A 2DFNA 3WNZA 3DHWC 3OT4A 5EKSA 5AVRA 3WKBA 3P0EA 4YT4A 1W94A 2WINI 4YP7A 3BSFA 5JR3A 1BHO1 2EZ9A 1FIUA 1PF7E 5ULLA 4M1OA 1B8PA 1XROA 4IDEA 1O6BA 1A1SA 4IIEA 1Q2UA 2YHIA 3P2IA 3FJOA 2Y1KA 2A1IA 4ND8B 4QEZA 3GYGA 5H68A 4Q4AA 3EF1A 3TJZA 3EFEA 3JARA 1JHDA 2OO5A 4Z9AA 4HG2A 5J43A 4UHDA 2QS9A 4F6RA 1Q1QA 1A9XB 4P08A 4P38A 5AM4A 4H0FA 3OHMA 3KTDA 1HE1C 4G0PA 2V3WA 1SHLA 3G6WA 4ZZ0A 1THMA 3CRVA 4HCJA 1GGNA 3SXPA 3ZD7A 4RIEA 1CEEA 2ZM6B 3KB2A 1JTEA 4UCQA 3WISA 3ZCPA 4F5WA 2FV8A 3HVKA 3EPRA 4LJRA 4R2IA 1E2PA 3EBOA 3QG5A 4YRNA 3UMCA 3WGYA 3LHDA 4EB3A 5LOVB 1Q0PA 1LWNA 3RYIA 2R97A 4QC2A 5K3FA 4QGAA 3FCEA 4MUHA 2W2PA 3FDJA 4BB9A 1PZNA 2PX6A 3V2GA 2V0NA 3TNDA 5DVZA 3NHPA 3NYIA 4NV3A 1UAGA 3NHKA 2D1YA 5BV2P 2ZPUA 2NU9B 1SVKA 4WGFA 1UEXC 2H1FA 4KLNA 4RJ2A 3GLGB 3UB2A 5DCUA 1E8NA 2JEYA 1U4OA 3A06A 4DJAA 5HUHA 1I2AA 2I55A 3MUFA 4KB5A 4M0DA 4J0JA 2QTNA 3DF7A 4UQPA 4QBTA 1ZIPA 2WF6A 1W35A 2E4YA 1TK9A 1X1EA 2XB2A 5E9WA 3U81A 5DBFA 3AUKA 4JVNA 1PFWA 4LF4B 4KPFC 4YC7A 1UR5A 3PD1A 1VA4A 2PO5A 3HP4A 1GKLA 2ONJA 3D4LA 2J67A 4ZT7A 3PC3A 4YGXB 3WMEA 2HFKA 5M5BA 4DLBA 1YIOA 3WO1A 3NHJA 5AI4A 1J23A 4WEOA 1ZD9A 1S3SA 1PQPA 2M32A 3CNLA 5ELMA 3QTLA 4K9NA 1VE5A 4YJKA 2J59A 5HZMA 2R11A 1PVVA 2WJVA 2XYHA 1XZIA 3A6JA 3PGVA 4K1LA 4XCXA 2PFSA 3TMKA 4Q1FA 3OECA 5MN4A 4TWAA 3NVKI 4IFEA 4KXNA 3R5SA 2QRGA 2R85A 4M9XA 4TMVA 5CR9A 2Y3IA 3ES9A 3PB3A 4ZOEA 1CZNA 1FDVA 1XHFA 1I1QB 1MDBA 5AKZA 4TMFA 1VHDA 2XH8A 1BOOA 4TS1A 3COPA 4REMA 4MRSA 5JI3E 4QSHA 1P5FA 4TZ6A 1WIWA 2YV1A 3ONVA 2PS9A 2HNAA 3BF8A 4X63A 4B3HA 2Y0DA 5BW4A 2EBUA 2ZXFA 3N8IA 3NAZA 5KMGB 1XJ0A 4NENA 4J1QA 3PXDA 5BNWA 2IS4A 1ESMA 1KMIY 3KJZA 2I3ZA 3OPXA 3UOAB 2ZAMA 1JEYB 2BE9A 1N78A 3ZXYA 5CFPA 1CE8B 2RKWA 3IVMA 4LCBA 5ILGA 3RQIA 1LK7A 4EKGA 2P6UA 4BDTA 4DKJA 2Y67A 3K8OE 3M6XA 4P2BA 4XGRA 3BRWD 1KZ9A 4HNVA 2I9KA 4AJLA 3ZVMA 1W36B 1LRKA 1XWWA 1N2CB 1PCXA 2GDJA 2R8PA 1E60A 1ESCA 3RTEA 4ASUD 4E11A 1GILA 5LYJF 1CWUA 3FYUB 1DAMA 2PGDA 3B2NA 1Y7TA 3CNEA 5EHNA 1GOTA 2VRCD 3I4LA 1W7AA 1NLZA 1RNLA 2QX4A 2IEIA 1YTUA 1FFBA 3JATA 3QOXA 4L5YA 5JWHA 3KZKA 2XBUA 4H1TA 4TMWA 3V7FA 2V7PA 3ZWWA 1DAOA 1EJBA 1EP1B 4OREX 5EUBA 5K99A 4TX1A 2DYKA 4V0MA 1V37A 4N5LA 3R3HA 1HG1A 2C0QA 1ADGA 4LYYA 4P0TA 3UXHA 1N36B 2P40A 4C2TA 1XMPA 3OLVA 1T1JA 2ZS9A 4REQB 2HSWA 4M37A 5DXJA 2YXBA 4FMCF 1DIOB 2QROA 2J4CA 4PANA 3QTTA 4LWZA 3K1AA 3V7NA 4BNWA 1LI7A 2OM2A 1E3SA 4NBWA 3GROA 1JXQA 1OZ0A 2C5LA 4KO3S 5TPZA 4FHCA 4FYVA 1AE1A 1OXUA 4B71A 3O82A 4LW8A 3NTOA 1TM2A 5F33A 1QO7A 4EG8A 5TX7A 3ZJVA 1GCOA 1VIVA 1UKZA 1D2RA 3HG7A 3FZEA 3TR0A 1QP0A 2QZZA 2JIPA 4BX2A 1W5TA 2OE2A 1QUFA 1PHRA 2WSBA 4AJJA 3MELA 1G16A 2PBRA 3CE9A 2ZS8A 5HCUA 5HJ7A 1YS6A 5LFAA 3RFTA 3F5QA 4ZQIA 5EG5A 1NKVA 5CA1F 2O2JA 4Z0PA 4HQLA 5B1EA 4G65A 5KOJA 5JNUA 3EY9A 3ZD6A 2ZIXB 3TLAA 4B83A 3CNBA 3DC2A 4C1NA 5FEUA 2N46A 4UXJA 4HF7A 3LW7A 2BPOA 2H0QA 3KDAA 3KQTA 5AI8A 5HK8A 3WIOA 1M2WA 1VXRA 2R6HA 5CB0A 3S81A 2H1RA 1QKKA 4PCAA 5IZ4A 3DWIA 2VJCA 1QG4A 5H02A 1JLKA 4WLUA 3AVWA 1Y1QA 4NL4H 4HRAA 5HTOA 2JJYA 1T9DA 4PF1A 2BFEA 4Q24A 1TT5B 1OXVA 2XUFA 1SBYA 3SJCA 5LSAA 2YKGA 4MDFA 1NF3A 1V8BA 3A3YA 4N8DA 4CKEA 4GAEA 3VV2A 2P27A 4ND7A 3KOWA 2C59A 1RHMA 1PDOA 3CUEF 1NPTO 4IP0A 1E4EA 3CBQA 1RHKA 1GSHA 3DTVA 3NKLA 1N32B 2B94A 1FX1A 3MBKA 4WFKA 1SOAA 3NTUA 4AZ0A 4E4RA 4YUXA 1D9ZA 2RBEA 2C77A 3R3SA 521PA 2EKZA 2O6HA 3KWMA 2IYPA 4P34A 4GOLD 3VVBA 1W52X 2HDHA 1C9DB 3EFOA 2QJTA 4RZXA 2G9RA 1Y1TA 1ZGBA 4FGKA 4OU4A 1UWVA 1YL7A 5CX1A 5E7QA 4MQ6A 2ZQYA 1KEKA 1ZM4A 2VPTA 4M9ZA 3Q9UA 4DA0A 4L9WA 3ANTA 4BTVA 4QU8A 2XLBA 1CK4A 2FFQA 4R1OA 1PG0A 2H8KA 1CUSA 2W11A 1I36A 3BJIC 5DIZA 4CFYA 5AW6A 1N6RA 2DWUA 1X86B 2C7RA 1O5IA 1RI4A 4M54A 5A4KA 1RKVA 3B60A 2IBMA 2GA8A 3ZHUA 1Y3HA 1ZNYA 2IYVA 2VXYA 4ESVA 4CTOA 2XA1A 7ADHA 5JS7A 1GGKA 3L5KA 5AHWA 3HACA 4MGHA 5DBEX 2J33A 1AMUA 5LDDC 3NH6A 2UXBB 1Y4DE 5C3UA 1UZAA 4HBGA 3SEZA 3ZGYA 4BNYA 5CRIA 4XI9A 3EZ2A 4CKEB 1YUMA 4JB0A 1QG2A 2SKDA 4LTMA 5F5XA 1P60A 4YRLA 4XD2A 4G0QA 3W6UA 1ZR4A 4LX0A 3GEDA 3EWAA 3OJLA 4CR6A 5BSKA 4UM9D 1U2SA 4QO7A 4I9FA 1UP6A 4UVHA 3AR9A 4XGQA 3UATA 4LUCA 1JFLA 4DLSA 2V0GA 3UT6A 1UKVY 1N2ZA 1UADA 2V9PA 4NZNA 3PXBA 4IJUA 3TEFA 3HFJA 3RRNA 1HLFA 4TSFD 4HFMA 3THYA 1ZG3A 5EXXA 1S0UA 3QMWA 4X1YB 4ITUA 3UQYS 4F06A 4NCAA 2I8CA 2ZYIA 3DUFB 4CDMA 4AKTA 1KOJA 2IS1A 4TXHA 4IJVA 3PX7A 4ZYYA 3GOHA 4GOND 1CR2A 5HJEA 3TL3A 1WSWA 2UXDB 4MV0A 2CXPA 5B53A 1FBNA 2H5IA 1GU1A 4RQTA 4HDSA 4M49A 4BMNA 3AEKB 5M3BA 3N2NA 4M89A 1K9SA 1A71A 1UODA 2AJLI 4P4NA 2F64A 4RS3A 1OCEA 3OY2A 1KK2A 3HABA 4O63O 2J8ZA 1H1LA 1G21E 3NT4A 3OOYA 4MRAA 3FNFA 4QO8A 1UKEA 2V4ZA 1MT3A 2FQYA 1ND5A 2OC9A 3EGIA 5AHKA 1C29B 3BJMA 3JQFA 1N5LA 3FSGA 4J0CA 4RIHA 3T41A 5FO0A 2A9OA 5D6OA 3PWSA 2Z2IA 4CEHB 1P45A 3IKLA 1U7HA 3GP5A 5CVUA 5D3ZA 5KVQA 4FJ1A 4P33A 4UASA 3UFXA 3UHOA 3MRVA 2FWMX 2VYND 2DH5A 4XB1A 2JGNA 4GEKA 2EWVA 5DGTA 2V1UA 4N54A 4B09A 1OLUB 3CPEA 3JAKB 2R7KA 3O84A 5DTEA 1N6KA 3TOXA 2QX7A 4KYVA 4YAOA 3L7NA 2AFVA 3D59A 3FFAA 3KQMA 2B7CA 3L0YA 3P5SA 2PRKA 4JUFA 3W2IA 4CE6A 3B13B 1UBOS 2Q2QA 3NEJA 4QPJC 1E9EA 3EVNA 4Y30A 3DZBA 5TQVA 1AMNA 1P2UA 4P5EA 4GECA 5LQCA 3W7AA 1V5IA 1IHOA 1H0KA 2BC9A 4FXOA 4UFNA 5JAOA 5KSOA 1U1CA 4GZLA 4BS9A 2GTIA 1U90A 3BMCA 3L41A 3M9XA 5EE1A 4YAGA 1M8FA 2D0OB 1J0BA 2WHPB 1HGXA 3BFXA 1GIAA 4F46A 3K9NA 3DVQX 3F3KA 3EQ7A 4PYLA 4R0NA 5FWDA 3LBIA 1NWHA 4EB6B 1Z2EA 5K3EA 2FOXA 3PXEA 2COKA 5SZIA 3VC7A 2I87A 1VIYA 1VIDA 2DHQA 5CLQA 5DTQA 1V1MB 4DEXA 4DZZA 3BSSA 4F2PA 2DECA 1NOKA 4HH3C 2FE4A 1WB5A 5EJ4A 5CT8A 5JAPA 2WBLC 3H65A 5TQ2A 4MQFA 3DA8A 3JQRA 2P9BA 4IILA 2OC4A 4ZT3A 3VR1A 4EM6A 1E59A 3QH4A 2VAPA 4Z9XA 1RWOA 1T5SA 4ZHQF 1XA4A 2BIFA 1UXJA 5IJXA 3VNAA 1P2TA 2XEXA 3HLTA 3A9TA 4F38A 3QBVA 1ISSA 4DA9A 1PYGA 1T36B 3FHOA 2X8JA 2Y9MB 3LC2O 2RJNA 4G4SO 5K4AA 4LWPA 2X1MA 2P2CA 1X15A 5JG7A 4LXHA 3ASVA 1RKBA 5CVTA 3VPCA 4ECEA 3T5BA 1LSJA 2V0CA 3S1AA 4CZ2A 1OTYA 1RZVA 2NZXA 3COWA 3NRCA 4NDNE 3CVJA 5I7OA 3M1LA 3QJ5A 1BRMA 4DXHA 4D4IA 3UZUA 2QRJA 1R0WA 1WB9A 1RFLA 1C3OA 1JRLA 2NNWB 1KVQA 3MA0A 3I1FA 2LRHA 3IUBA 1X7YB 4NRDA 5IF9A 3RUCA 1ODKA 3DOJA 4D99A 1QH1A 1JH9A 1BX0A 1N4AA 2VWHA 1K0UA 1DIGA 9LDBA 3JQGB 4Q3AA 4I3HA 2OXEA 1IB6A 2ODBA 1Y8RA 3AI7A 1Z4KA 4M0PA 1JEEA 1ONBA 4HZGA 3N28A 1S3FA 1CNEA 2CEAA 2QL9A 2XDQA 3BQ9A 3QYPA 5AOCA 4B80A 5AVUA 1EGQA 1XZKA 1L4BA 3ICPA 1YR1A 5AHOA 3EZ9A 3L84A 1B0UA 1T6ZA 4KQIA 2D54A 4N7BA 2WYUA 2V6BA 3L8HA 121PA 5FOWA 1DCMA 4M9RA 5KC9A 3O9MA 3Q9LA 5JMPA 1O97D 3KVYA 2R4UA 3PNPA 5JZ9A 2H2IA 5HM6A 5IK2D 2JGIA 2QQ5A 4GPD1 4WK6A 2PUVA 5D5QA 4ZVSA 3VISA 5MN6A 2DR0A 4UMEA 4RU1A 4TRNA 3K9LA 3SSMA 3VI4B 4EB0A 3N2GA 5ICMA 4LCEA 2C9ZA 1X3SA 1L4EA 3TEJA 3CX7A 2H4HA 5T8KA 4CLHA 2QMYA 5IM5A 4GC5A 4G01B 4PLFA 5IYZA 3GLGE 3VU1A 1V47A 3GY0A 2FEPA 4ZVKA 2H5JA 5HF5A 3KOZA 4BQNA 2A86A 1DDIA 4AZ3B 1YB4A 5IUNC 2A5LA 5GADl 3BCHA 2HB6A 3DAYA 4I1VA 4KQ2A 4O4HA 4D43A 1FYXA 2CMKA 4RY0A 3TG8A 2OSBA 3I6MA 4DCGA 2FDXA 5LP6A 4H3SA 5ALRA 1MRZA 3FLBA 4Y98A 4BNUA 1KOFA 3T6KA 4F86A 4YRPA 3QIAA 1QYWA 3ER6A 4PIPA 1UIMA 4FYXA 1CS4C 1K5HA 3DT8A 3QJYA 1R8QA 2VAMA 3C41J 1TUGA 3BH7A 3I05A 4ANFA 4HRYA 1RKUA 3KC2A 4FB4A 3KETA 1XCGB 1ARZA 4O3FA 5AKXA 4B76A 1FU7A 1O9HA 5JS1A 4QG7A 5ICSA 5FNZA 2GZDA 3AG5A 4RTKA 1JHRA 3CLTD 4XFJA 4CNBA 4BP3A 1ZCFA 1FFXB 2J9RA 4MMYB 1QQ7A 2Q8QA 2HPZA 3U4DA 1D6NA 2AW5A 2ERXA 2GESA 1RRCA 2O8DA 2AZ4A 5JD4A 1SBTA 2XUDA 3IODA 3L7AA 3ISJA 2Y4OA 1B74A 2Q6TA 1D8TA 4HDMA 2YHSA 2CVFA 1FNSA 2HU7A 3EZ6A 2PY6A 2VWQA 3IBTA 1N5IA 3B6EA 1LW7A 4B5LA 2YN0A 3W5UA 4F8EA 4DR7B 4MAAA 1KNQA 3NM5A 3RBXA 4C7VA 1X7DA 3EMDA 3OTIA 4NU8X 1Z0SA 2CEKA 3I8XA 3KHTA 3FPGA 3H97A 3X2EA 3IHTA 4IUBS 3CEPB 1XPOA 1IHPA 4KKVA 3VPAA 1OT3A 1U3DA 4D3YA 2X5OA 1W0KD 2ISQA 2HHCA 2Q3HA 2BR5A 2WYWA 3JD0A 1PV4A 4YT5A 3A7EA 3R3WA 3WNVA 2PQ0A 3UMRA 5KQGA 2N9UA 1AH2A 1EFCA 2C5FA 1LNZA 3DL7A 3CF4G 5SZJA 5KNCD 3ROMA 1ZHFA 2VHZA 2R47A 3QY0A 2N47A 1F2UB 1GSAA 1ZM3A 3AEXA 1P1CA 4DLAA 2HIAA 2B8EA 1Q2XA 3KFXA 2ACWA 3PV0A 3OPNA 5J2UA 3QPBA 1JFFA 3R0QA 1G3RA 2GEKA 2V3VA 1ZK3A 5I9IA 1ODIA 4FFPA 3LQRA 2BLNA 4LYAA 2XCSB 1AXGA 3ILXA 2Q0HA 3L6OO 3NDJA 3PUIA 3WWYA 4G9EA 2DFDA 5KYWA 3GEGA 3IP6A 4FN5A 3GMSA 2CVOA 2WAXA 5CTJA 1NULA 1OVGA 2RAUA 4MUFA 1HDXA 3ESRA 3O75A 1MB0A 1J5PA 5E6SB 3AEQA 4FB5A 3FW1A 5DK6A 2JCBA 1L7DA 1Y3CE 3CR8A 4G67A 2IHTA 4OUKX 2MHCA 4UQOA 3EXHA 5A3QA 3BD6A 3HWSA 5JI2E 3KJHA 1DAGA 1CR6A 1KC1A 1FDOA 1XB2A 3R0IA 4AKGA 1EJ2A 4NAVA 4Q19A 1B4DA 1MPTA 1JAXA 4ZRNA 4DB4A 3BWVA 3AZQA 1EK1A 3R4VA 1SNYA 2ZZKA 4IWYA 3A1VA 3G8BA 5K6AA 2ZBFA 5JZSA 1MF7A 1L7AA 4RDIA 1KEEA 1M73E 3DE4X 3E3OA 4IVQA 1JMYA 4R1UA 2AD5A 4YAEA 4MZXA 3FLEA 2FTKE 1N34B 2XXBA 3AR6A 1L5LA 1EKXA 1EZ1A 2A3RA 2IPXA 3AUYA 2IK8A 2ORIA 3DMPA 3HBAA 4HLCA 2ZSFA 1ISRA 1X1RA 1LD3A 4OKNA 3N7UA 2IX9A 1LDEA 2CUNA 1PD0A 2ZUUA 2FFHA 2UV8A 1BXGA 3QW4B 4H7FA 4UBJA 4ZCLA 5LYYA 2G5PA 3OO1A 1E9CA 3N1UA 2HCJB 1PLLA 1U9IC 2VNHA 2FMUA 5IT5A 2GD2A 3R7WB 4B2PA 1E0SA 2XRZA 3RFCA 3NXSA 4GZ6A 5KTRA 4IMIB 3P52A 5ALUA 4C3VA 4MHTA 4JWKA 1SXJB 4Y2QA 4GEGA 1ZVJA 2BMJA 2WI8A 4YJGB 2V9CA 4V02A 2FSGA 1RI2A 4ZO8A 4R9VA 2O57A 4XIGS 5AK6A 1MJGA 2FRXA 4KMSA 4NBTA 3NNDA 3WHLA 2II6A 1YF3A 4JOCA 5DXFA 2JLYA 2R84A 2GR9A 1LTHR 4P7BA 2FR0A 1D0SA 5I3ZA 2F1HA 3QUQA 3IBGA 4JASB 2XYPA 1LF0A 3ISVA 3UHFA 3ZE7A 4EWLA 1CQJB 4TMTA 2DB3A 2EFYA 5MHTA 3VPSA 2DTEA 1DXOA 1NTRA 2FHPA 3PUXA 1ZDMA 2IXBA 3VYSB 4LF8B 2ST1A 3R0XA 3LDUA 2X15A 5AVTA 1ZICA 4QTYA 2F17A 4MLCA 3KT3A 1W59A 1DZ3A 4ZWNA 4M6WA 4Z7JA 4COOA 2BLLA 3VPFA 1RTTA 1RHQA 4D8WA 1LPPA 2F4NA 1KP2A 2EP5A 2WMDA 4D9NA 2VPIA 4OUDA 1VLHA 1MJFA 3ZZNA 2BGTA 5CA0B 2VCYA 1U11A 2ATVA 2NZVG 5A6SB 5FH9A 2ERCA 1U0LA 2YOHA 2ZEJA 1F4LA 1Q0LA 2C98A 5KVCA 4S1VA 4M8SA 4D9MA 2X0KA 3DBHA 4BX0A 1HT3A 1R9JA 1EVLA 2IZ1A 3BUSA 4QPNA 3U4QB 3FF4A 3NUQA 4K81B 4XOUA 2H29A 3LWNA 4DCTA 1E2NA 2VNIA 4ZK2A 5C8XA 3E2MA 5G0UA 5JLJA 1ONNA 4DNFA 4DCJA 4ZU3A 1Z6AA 2AN5A 5FO1A 2V7BA 5IN5A 4R8MA 1KARA 1ZX1A 3WL5A 3D8HA 3W6ZA 3T5AA 4UXIA 4EYSA 2Q5EA 2EG9A 3LUJA 4TKVB 5LKRA 3P94A 2I2AA 4RD6A 1V6CA 1DT3A 2AWOA 2M6RA 4EO9A 3IURA 2XIQA 4C20A 1W8DA 3MRTA 4MGYR 1WZCA 1X0XA 2ZPAA 5DX0A 5IM4F 4IOKA 3MINA 1CBUA 4GNRA 3WV5A 2OMEA 2WHXA 2VJOA 1WMAA 3VU9A 4ENQA 3UJ6A 1Z88A 2Q5FA 1WQ3A 3PXAA 4GMDA 2IC5A 3DLCA 3ICCA 1M1YE 2FHSA 4ETNA 2LV8A 1Q0RA 3QELA 4NYIR 5JQGA 3IOYA 1XFDA 2R6ZA 4CQMA 4D5EA 3PD7A 3THRA 1L4UA 2JAOA 3CF2A 3QLTA 3QRWA 4W8GA 1PSZA 2VI5A 3VH4A 1B3RA 4RTMA 1OXSC 2Z58A 1YNSA 3KTFA 4RH3A 2C5AA 1F7UA 2GHTA 4IJ6A 5J1TB 1P5ZB 3VR2A 1PEYA 4HWGA 5LU9A 1KXZA 3RU7A 1J2YA 3REQB 1RQXA 4FFSA 1IUKA 2C9MA 3O74A 4HAZA 3WMWA 5E9JA 4EL0A 2FFBA 2X7JA 1UDWA 3K30A 3FVQA 1QSGA 3V4ZA 4L7VA 4I1IA 4TQAA 5IF3A 4X1KA 5LA6B 1LVUA 4I3GA 2XTNA 1EDOA 1V1RA 4X8OA 1MC5A 1S02A 1SD2A 2WU0A 3GAFA 4Q0MA 4CLEA 2FSIA 4ETIA 1NQAO 4B31A 1MJGM 4BBJA 4UTPA 1B93A 3PRYA 2W6QA 1JVNA 1YRHA 4JYCA 2JDIA 2P67A 2WWYA 1XTTA 1G7SA 2C4UA 3WYAA 2WKQA 2Q1YA 3K94A 1UMBB 3C6BA 5BWNA 4RVFA 4CEIA 4FSDA 2IHKA 4PRYA 3TBKA 4HWTA 5EKUA 4ZKEA 4EKYA 4WZAB 4Z5XA 3K92A 4D8TA 1RLOA 3CGGA 3OHSX 5DEIA 3OEEA 2OHVA 5J4KA 1N6OA 4WIAA 4UTXA 3GB9A 1OREA 2FX2A 1O54A 3FB1A 2QP9X 4U0JA 1IULA 2XCUA 3PGLA 5CIWA 1JLSA 2VN8A 3AMVA 5L3ZA 4EVQA 4OX9Y 4HR7A 2B9EA 3ITDA 4WNIA 3IUYA 1XC7A 2VPPA 4J0FA 1SAYA 5CXQA 2GCOB 2GAOA 3S0JA 4XUEA 3R7LA 2G0NA 1MDFA 2RH4A 4F4HA 1EB9A 4CM4A 1E1QA 4LFAB 2WTEA 1QOZA 3T9BA 1H22A 4Q39A 3TQQA 1ZMBA 3M2PA 5C3MA 1Z4JA 2WT9A 3GJ3A 2XJ4A 1L7QA 3U9LA 1CUUA 3VR5D 3VV3A 3NHRA 4Z0NA 2RMKA 3ZW9A 2B3DA 2Q5LA 1FVHA 2XYGA 4TYYA 4DGSA 1YS1X 4HOYA 2X86A 3TSCA 2PKQO 4UHFA 2XMCA 4IOMA 1B00A 2WE8A 1YA6A 2GHRA 3BMNB 3SZGA 4WY8A 5KTKA 1XD8A 1NOIA 4UTVA 1XZMA 1NXWA 2NSJA 4R9NA 1XNJA 3T5GA 4C03A 1UMKA 4DLVA 2DT8A 1S3IA 1WPGA 3KR1A 3OJOA 3MYRA 2I91A 1AGYA 4YP0A 1B76A 4CMKA 4US1R 2HPHA 3R9WA 1GKKA 2PGXA 2RDMA 3LF2A 4O4IF 4Q01A 1M2KA 1EUZA 3V8VA 4DIEA 2AJCA 4G0MA 4DY6A 1HMPA 3SSNA 2JI9A 3E8SA 4IV0A 2AKAB 1UMCB 1RRVA 2OXRA 3B9BA 3H83A 1RLUA 3MGKA 4YJDA 2Q28A 3E7XA 2C2YA 3KEQA 4JOSA 3LUPA 1EXMA 4LI3X 5C53B 4XQGA 3F7MA 4FLMA 1EDEA 1PWZA 4B4OA 4LZLA 1IIRA 3PNQA 1ZI6A 3MBIA 3MJDA 4PZ0A 5D8DA 3HL0A 2W6MA 2DUUA 2YZ2A 2IU0A 4R3NA 1P74A 3KKMA 1EUCA 5TARA 4KTVE 4W5NA 2PRSA 4OFBA 4EI9A 1T3TA 2ZBUA 1RP7A 5F9MA 3RFVA 2ZSJA 5M04A 3CB2A 4IUYA 1ENPA 4DMMA 1VHJA 2DQYA 1ND6A 3PYXA 3KWFA 2DBRA 1QAMA 3F6YA 1JH8A 1FTWA 4LV6A 1SXHA 1L5HA 1E3DA 4WBXC 1PFVA 4LRXA 4YRSA 4OHVA 1I7QB 3EX7C 3RYTC 3DHEA 5HBGA 5LZ2A 1F20A 1K5PA 3VHXB 5TRTA 1BDBA 3FBTA 4BRZA 4HMPA 5JO9A 5FWXA 1T8UA 3NLLA 4HYYA 4ZYXA 3BVPA 1BE1A 2J5XA 2WUEA 4BRWA 3N7TA 5H3HA 1NE7A 1OXXK 2R96A 3F6PA 1Q95A 3G17A 4KN5A 2B1QA 4AWXA 1KTIA 1XTBA 4R2MA 4CIYA 1PSDA 4FYIA 1YHYA 1N75A 2V5UA 1BMFD 4E2YA 1KU0A 1TUEA 2CNWD 3ZNOA 1CEXA 2QVLA 3M9WA 4HPWA 4ZMSA 4RORA 1IOZA 1S1MA 1L7MA 3TRFA 1Z15A 4MZDA 4OHMA 3WNQA 2P3LA 1TUBB 3X1ZA 4EI2A 2VDUE 4P31A 4OHXA 4G41A 4QQNA 5C2JB 4L5BA 1UBGA 4X94A 4LBWA 4C4PA 2RCYA 1MH1A 4FMDF 1EWVA 3RUPA 3SCZA 3DVLA 4AXBA 4JOBA 3DGFC 2V6MA 1ADBA 5GVSA 3FCOA 1G9SA 3JXEA 3KOMA 1RRKA 1PL0A 4H6XA 4F6LA 3OOHA 4ZCMA 2BKXA 1C41A 1FMJA 1YUNA 2PD3A 1HV8A 2QL6A 4PQYA 1VYVA 3ZDYB 4DR1B 3GGJA 3EXEA 2P3QA 4J3FA 2FWBA 3FB4A 4RTQA 1YACA 1HE4A 1VC2A 2DUNA 3R5XA 4JN6B 2QTVB 4RHEA 2ZRCA 4B3RB 2GAFA 3NGMA 1PRYA 4ERXA 5IJ9B 1FMTA 4LGMA 5K7SA 4Z2YA 3VPXA 4HX9A 3TE6A 2V7UA 2DLNA 2J3LA 3OU7A 5CM2Z 4QOHA 1NVUQ 3VR0A 2ZI4A 1IAQA 2FZWA 3LY5A 4COKA 1JYEA 2XF8A 3ZQUA 3BTSA 2O3SA 4LCJA 2OT3B 5ALGA 3RIEA 5BSFA 3RUHA 1X6VA 2A9VA 4Q00A 1GY8A 4DF3A 2GNOA 4U5QA 3ENNA 3OMLA 1KGSA 3LPLA 3K1YA 5B1DA 5ITZA 1XLVA 4K6OA 3VKGA 3CJTA 3RJZA 4HY3A 2HXGA 2DPXA 1X87A 5KKNB 3X1XA 1SG9A 3CW9A 3UYKA 2HBQA 4Q5IA 1R0LA 2Y66A 5K3SA 2WU4A 1ISJA 3AH8A 1XAIA 3P4YA 2QAGA 5EMMA 3RT7A 5JMWA 3PJDA 2O59A 3SIRA 1Q5PA 2ZTVA 3TN7A 1NL3A 2H4XA 1FJ2A 1XTZA 3O8BA 3P5BA 1WXDA 5AUQA 1I4DD 2J9FB 3EEFA 4U2KA 4IQFA 1JLLB 1SUPA 3CG0A 3IERA 3O5AA 3OFNA 1RAFA 4WCFA 3CX8A 3W4KA 4DTCA 4RTLA 4E51A 3T5MA 2C0CA 2ORVA 1Q0ZA 3EGWA 4XSHA 4YACA 4MR7A 5BNFA 3W1VA 2BYTA 1HORA 1SOWA 3QVVA 3HWWA 3FDZB 3QXXA 4P5DA 4P98A 4KK3A 4U7PB 4JVSB 2X77A 1PR5A 1CYDA 5AW9A 2JLBA 4M0EA 4LC1A 4CM9A 2DVMA 3EG9B 3K4HA 3EDRA 2HNBA 5EWLB 3C15C 4WOBA 1CSEE 2X0NA 1PYOA 3UVEA 4WVFA 1EK5A 3EUWA 3S7ZA 3BD9A 1SUFA 1HO3A 2R44A 2FPOA 1GGHA 1XDGA 1H0HA 3A9SA 1SQ0A 2XKJE 1D2HA 3AF6A 2FPWA 3O3OB 4Q3OA 2QX6A 2CXOA 1I1OA 3MTBA 5CT4A 3VSEA 1WQ1R 4AKSA 1R2QA 4ER0A 3IQXA 4IOJA 4U3JB 3BGSA 3EMVA 2ENWA 4Q82A 5D5PA 1ZUHA 4GO1A 2ICAA 3RWOA 1YBFA 3W06A 5EJ7A 3IJ5A 3K70B 4OAPA 2FK8A 1PZGA 3JD3A 5HUQA 4Y6LA 3NRBA 4QEKA 5HUJA 3PTAA 1ZN2A 3SC3A 2ZANA 3CZCA 3A9CA 3FUXA 3IMGA 4KG7A 3O2JA 3HCCA 1XVVA 2ZYWX 1ICIA 4YQZA 4BNHA 4N7MA 4J03A 1E9FA 3DTYA 2PH7A 3QXJA 4QXOA 4WH0A 3DV0B 1E79D 2GVZC 5EC8A 1AURA 3EIWA 4TRMA 3LDFA 4ZVOA 3TRKA 3WMFA 2FF7A 5KVSA 1OBOA 4DQLA 3G5UA 3TSOA 4BKOA 4U8HA 2FYTA 2FW9A 3MLEA 4GX1A 4RC9A 3HM2A 3UMFA 5BWOA 3K6SB 4YNBA 1XXHE 1WWKA 2MSCB 5ADUS 4ED9A 5ISMA 1G9XA 1XO1A 3TMAA 1KVSA 4RS4A 4HS4A 4RIIA 4Y2SA 4CMAA 1V26A 3CF0A 2J48A 3MK31 4E2WA 3SEQA 1GLVA 1H2BA 2GCPA 2J6IA 1PP4A 1ZL0A 5DCLA 5JH7B 1GPMA 4A36A 2WWIA 3T9EA 2QY6A 5LPNA 3L7CA 3O31A 3HPRA 2ZB7A 3KJFA 2QZ4A 3EW7A 1NRXA 1E6CA 1VYHA 2GWRA 2IU3A 4KIWA 4A2WA 2CK3A 2AKYA 2EFDB 3FNEA 3RF6A 2B7LA 2WTNA 2WYVA 3S99A 3WB0A 3MWEB 4CM6A 1UT8A 2P30A 3WB2A 1QK4A 1N3YA 5BPFA 2PWBA 2DFLA 1DINA 4XWYA 1NP6A 3I9MA 5IMSA 1E61A 1U0SY 4CDRA 1H9BA 1XHLA 4HLNA 3BWEA 2RHCA 4TT3D 4LXUA 1A04A 4WT7A 1N6HA 5A7GA 1W4ZA 3GCGA 4PXAA 3LQ4A 4LHWA 2IW1A 4HVCA 4WESA 4G9BA 1UUFA 5DB4A 3MS4A 3SLRA 5CDGA 1Z0FA 4A8HA 2I6SA 3BJZA 2RC6A 4HQFA 1DG3A 1YU9A 2ZIZA 4QBGB 4L78A 1OWNA 3LVRE 3LTEA 1Z7EA 3BICA 1VMKA 2YH2A 1YAJA 3M6UA 4NCKA 4CLRB 1PG2A 4MB0A 4RJLA 3DDSA 1C7QA 2C96A 3D7RA 2IV2X 1I94B 3D8SA 4MQ5A 1TEZA 4GH5A 4L72A 4J0HA 1C1DA 3GLIB 1ORWA 3MFYA 1P7ZA 2GVDC 1DLIA 1XTVA 3WKEA 1NVGA 1H6AA 3O3NB 3MTEA 1W0JA 5C4IA 2C1ZA 1QRSA 3VGPA 1CQZA 1TGYA 2Q5HA 2PX5A 2ZBVA 5CJJA 3B9RA 1U1FA 1MO4A 4KQWA 3CUVA 1ECBA 1TI7A 2FCRA 3EXFB 3NONA 2CNLA 2GM9A 4KKXB 1TVKB 2ZTSA 5I3CA 1Y8QA 1DUSA 2B4KA 2PV0A 3G2QA 3VDXA 3C3JA 2POCA 5DYYA 4CLDA 3UB4A 5E7MA 2WT4A 4KO4S 2B0CA 2GEDA 1CRLA 4ER5A 1VBMA 3H9QA 4NFYA 5FWNA 5EJEA 3PX2A 2OUIA 1ISMA 4L2IA 1QOPB 2EHDA 2HA0A 2RFLA 3FYDA 4M8KA 4RA9B 4A16A 4NOLA 2FY8A 3NOQA 1QHHB 4MLZA 5JD5A 1MJHA 2A33A 1OC2A 3EZLA 3PFKA 1E2BA 2G9NA 1PDWA 4ALJA 1UDCA 2GVNA 1QGAA 3ZBUA 5JZMA 1F9EA 4J29A 3NZEA 4DUGA 4RELA 1DFHA 1YVEI 4DLUA 4D4LA 3RSLA 4DMLA 2F8TA 1E2EA 1SOUA 1K7XB 5L3RA 4X00A 2V7XA 2HDWA 1TYZA 3SOZA 1HQCA 3NVAA 4KLRA 4W9RA 4DIOA 2Q5JA 5ELLA 3ND8A 4OY3A 1KQNA 5L3SB 2G1PA 2OCAA 2EZ4A 3RODA 3KTAB 3QU2A 1YVRA 3BMXA 2MMCA 3R3YA 4MPDA 1NX6A 5ALZA 3V4PB 4AMUA 1G8GA 2XGSA 1VPTA 2AMFA 4EUKA 1J8QA 3V6LA 5BSWA 1VJDA 1DVRA 1E0KA 3VGJA 4UUNA 3B1VA 5I9TA 4BZXA 2QNIA 5DBHX 1GTG1 5BN3A 1GYRA 4OGGA 2KBFA 4X95A 3IDFA 4A8JB 4XUDA 4DWJA 4KN6A 3WWZA 3QWBA 2ZZMA 2H52A 3CV3A 3TL2A 3ADDA 2GNPA 2Z98A 3PCXA 4LTDA 4O4JF 4EYGA 1LSSA 2CNKA 2P4QA 3PHGA 4OJKA 4CW7A 3F73A 5CXXA 2FPPA 4CMBA 5DYTA 1HNXB 5C1OA 4EH1A 4AI6A 4ALLA 2QRHA 2W83A 3SQOA 1Z22A 1EVIA 2HO5A 3B36A 4EAAA 4PBRA 2QUAA 3RNLA 4ECAA 3RC9A 3M34A 4Z0TA 4BVJA 1VCHA 1MIHA 2ZCUA 3BIJA 3L0OA 3PQ2A 2J9XB 5FI5A 1QO0A 3ZDEA 1X3LA 2NGRA 1GKUB 1QFSA 3JQ8A 1X1BA 2MSEB 1N33B 4LK3A 1JG6A 3A1CA 1J42A 4EMBA 4QM6A 2FQWA 1KF0A 3GZ4A 3Q7IA 3U7QA 3FUTA 3ILSA 1L5WA 1WCXA 1M1NB 3LKBA 4BJHB 4MUJA 5KJFA 3IQGX 1V8DA 2WWRA 4C3UA 2Q4RA 2AC2A 1TXGA 5KYGA 5AJUA 4P86A 4HN9A 4YJFB 5F51A 4DEVA 1E6KA 3WLSA 1T8SA 1VJTA 2FW7A 3TW0A 3Q5DA 4F04A 1KPHA 1UK6A 1M1ZA 3BXZA 3CNQS 4C6HA 2AMYA 5J23A 2NSLA 1CR4A 4I5GA 4WN9B 1I80A 3QOFA 2DQ4A 4C0SA 4OQLA 1JTFA 1G21A 5IDYA 3TK1A 1FNMA 3W5JA 1R8XA 2N3ZA 1KERA 2VYCA 3UICA 1YKSA 3M9LA 5AKYA 2PUCA 1LY1A 2EKPA 4AUKA 5JJLA 2IZ7A 2GPBA 2O06A 1NJ1A 5HTKA 2PKWA 1TE2A 4WKBA 1JU9A 2AJ8A 2BTQB 5G0WA 4GZ3A 1CLUA 1E5TA 2IPOA 1ML3A 3V8RA 2WE7A 3THXA 2OAQ1 4EECA 4EYOA 2GH1A 5L7YA 3STXA 1H6CA 1LPAB 5KYXB 4TKUA 1YJCA 2PUAA 5DU2A 4R1MA 3SF0A 1CZOA 1QOQB 1F9AA 1U28C 4FQ7A 1U4NA 3UCEA 4EW3A 3PUJA 4PPQA 4C0XA 2JJ2A 1B8OA 5AJYA 5LXTF 3SD7A 2PWAA 3KZOA 2IY7A 4I50A 5FULA 1A50B 2E0IA 4PGHA 5SZHB 1TO6A 4H2DA 4I08A 3B6ZA 1TA9A 3FOZA 3PHLA 1UWLA 2DHDA 4URUR 5J47A 4NE9A 4EYKA 3BDAA 1G0OA 2JCYA 3ZU4A 4MVJE 4EI7A 3ZE1B 4B3BA 4YUWA 3ITKA 2I7CA 3H5LA 4AZ0B 5ALMA 1HDRA 1JZTA 2IEYA 3M4NA 4JLPA 4O2BA 4OI1A 4EA7A 1A2KC 1C7JA 2ZETA 5DJ5A 5ESWA 3TQFA 4MDEA 2G1KA 3RE1A 2O8CB 3AF0A 3ZHOA 1E2IA 3BK1A 4DV5B 4O2AB 4N5MA 1DO2A 3G9XA 1MGPA 4ES6A 3P45A 1G7CA 4JR2A 3TLMA 1W34A 2YZGA 2OV4A 1DIHA 1H2AS 3GA5A 4EHBA 2QQ0A 3BIOA 4P82A 1IBMB 1KYQA 1XYYA 2BEWB 2VF4X 3AETA 3B5IA 3D2AA 2WLTA 1XUOA 3DFMA 3DDUA 3L4EA 4YIKA 3X0DA 2G17A 3E8XA 3C7DB 3FPKA 5LYJB 4FFVA 3NHUA 2DBZA 2JC3A 4QAJA 2FQQA 4ZEMA 2I0FA 1T5LA 1CVIA 1SXGA 2OEPA 4Z4CA 3BZUA 1XD9A 2PLFA 3UMJA 1IVYA 4FCVA 3OM8A 3ANXA 4MR8A 2RHHA 1R8JA 4D8XA 4KI0A 3HKBA 1O8CA 2HLDA 5IRCD 4U02A 1FP4A 5EJ5A 3FAKA 1E2JA 3OT1A 4FDVA 4DT1A 2EX1A 1O94C 4LZWA 4C0JA 4OSPA 4EY7A 5C5IA 4ZKDA 5D3MA 1C3LA 4V0NA 3T7EA 3Q5GA 3TSZA 4FYYA 2RHGB 4ND8A 2NTYC 4M0KA 1PN3A 4ARAA 1UK7A 1Z6GA 2A0XA 2WM8A 2P0EA 2JJ1D 4DKXA 2CJWB 4R2XA 3OMXA 4CM8B 5BYBA 2EFJA 1COZA 1CT9A 1A9XA 1WMSA 2I80A 4I1PA 3OE7D 2IXDA 2CNOA 3RAFC 4EA6A 1D3AA 1SH7A 2JB9A 1RYEA 4FI3C 3RFFA 3UMMA 2F3RA 3MEQA 2RONA 4JYMA 2JBHA 4X0EA 4C0BA 5JCXA 4KBGA 2ZQ5A 1ZRMA 2YQ4A 1F6WA 3FXAA 4GICA 1RRMA 1RC8A 2FN8A 4OLAA 2PGLA 4IDGA 1BCSA 1VKJA 3FPJA 5LOVA 4HUJA 3IEIA 4G5QA 5IDVA 4WD3A 2CXUA 4FPXA 2YMMA 1K6EA 1MC1A 3U62A 5L53A 3PHCA 5KUTA 4QQRA 5HDQA 4KH0A 1D2NA 2NYUA 3FTDA 5ENDA 4UXHA 1G6Q1 4EX6A 3QQ5A 4RY2A 3GLGA 2FN7A 3PQCA 1KP3A 4EJSB 3EBPA 2C04A 2NSHA 1HDIA 1TO2E 5B30A 4TTSA 3LOUA 2AFIE 3SZMA 1QYRA 1DIBA 2QG6A 4YMVA 5C5CA 3HSSA 3LO5A 2I34A 4B87A 5HQTA 3UC5A 1KY2A 1TMYA 3THWB 2QRQA 2GNAA 2Q3MA 5DHUA 3ZIAD 4B85A 2I2CA 2J5KA 4J9UE 3WV4A 3MWKA 3L05A 3E61A 4U9HS 4D5GA 2R8XA 1N8NA 1P8JA 2J0UA 2JRLA 3KUXA 4UVEA 1ZUIA 3HKDB 3HYTA 3VOBA 3C7AA 4QATA 3OQ1A 3ESCA 1JLMA 2O0KA 2OZPA 2IYYA 2QUKA 1GR0A 3KYIB 1Q22A 3KOXA 4LEIA 4NFLA 4ZJPA 5H4GA 2JHPA 1VHWA 5EERA 4FCCA 3L49A 4JYBA 2ADOA 3QWIA 3IQZA 3N58A 1AVTA 4RF2A 3S55A 3WDSA 4BV9A 1I6WA 1EFRD 2SHKA 4MUMA 4G4JA 4AM8A 2D5AA 5T6MA 1ZMRA 5IAAA 2B4RO 4L1KA 1T5TA 4OGFA 1JL3A 4WA8A 3EXAA 2PX8A 1GM5A 5IKPA 3GZTB 2P0AA 5EOVA 4YP1A 4UZEA 3EY4A 4RD2A 3QG1A 1XL0A 2F9MA 4KLZA 4Y6PA 4YRRA 4Q37A 4JQOA 1US8B 2CCGA 4QUJA 4C4RA 2P9FA 2FFJA 2QTCA 3EQ9A 4N6NA 1P18A 1EGVB 3A37A 3VOTA 4G1FA 2YR0A 5AIBA 4KXYA 1LC3A 1P73A 2I2DA 4JLOA 3WLOA 4C04A 3FFXA 4NR0A 1DKQA 3QFSA 2PT9A 3KVVA 4C5AA 2WT8A 3W5BA 4JUBA 1RWPA 4DLXA 4JUDX 5EZYF 4C0AC 1FE8A 3G2PA 4MV7A 1E4OA 1BA2A 3ZD9A 1RYMA 1HQKA 1AD2A 1G5RA 1VP3A 3CT6A 3EGXA 1JHAA 1YR3A 2WUDA 1YR8A 4IIJA 2IYQA 1TPYA 2Z2ZA 1H85A 2EAUA 5DM4A 1FFDA 1JR2A 5IAKA 3FYUA 4D9JA 4DLTA 3UG6A 1HLDA 4Q18A 4WL0A 5ILQA 1X2BA 1DS6A 2EXXA 4OQMA 3WLHA 3PIDA 1MHTA 3BD8A 4P2GA 1EWRA 2A5FA 4ISBA 1N2IA 1PR0A 2Q5CA 821PA 3JQ7B 3S1LA 4W1QA 3DOOA 4U00A 4WHMA 3URMA 3WIEA 1ULHA 1UBCA 2ACKA 1OXMA 3C6MA 3K6KA 1H4SA 5LNK1 3CLSC 3GLKA 4Z9YA 3DOUA 4XXHA 2GJSA 3ENVA 3ODPA 1CZKA 5DF1A 3C70A 1EE1A 1PL8A 4GXNA 3DMFA 4HHEA 2FZVA 3FZNA 2AR7A 5AO9A 4HDCA 3EHDA 1B3BA 1ORVA 1WR8A 1YH3A 4IH9A 4R8SA 4LFCB 3TKAA 5KTYA 1DIRA 1PHPA 1M8JA 1EK2A 3EJ6A 4KLCA 3T0GA 2HY7A 1KY3A 4WPGA 5HIMA 4U6NA 3GLIE 3C45A 3JYHA 3NCHA 4HD8A 1T5BA 4WOKA 1F2TB 1E6MA 2OCLA 2QJFA 1JSXA 1RBQA 1VG1A 2PMCA 4PXYA 1RZRA 4RFSB 1KORA 1T2EA 2OOSA 4GM0A 3QKTA 4QVGA 4XWKA 1H3EA 3CEMA 2GJ9A 3W0LB 1NMXA 1X8KA 1H8HD 3GRYA 2FVYA 4TS3A 4IWXA 3DZIA 2Q0QA 4IJKA 4O4LF 1P1BA 4G85A 1M6VA 4UBNA 3VAAA 2VOJA 1FZTA 5EXSA 2XQIA 4NOMA 4YO8A 3OUUA 5DM1A 3IQHX 1ECGA 3MAJA 1N6LA 1XQ9A 1H66A 4WBSA 4OB8A 3JPWA 1Z7GA 1ZIXA 4F3YA 1DJMA 4OYHA 3NFRA 1AX9A 1E1DA 1EX6A 4WK2B 3S2FA 3L7LA 1POWA 2FXVA 1Z07A 4Y2VA 3N2LA 4K26A 1DB3A 3GCWA 1QG0A 2JAQA 4QJBA 1U3TA 2VUHB 1OFUA 1T3HA 5LQDA 1DFIA 3Q85A 4QKQA 1ML4A 2R7NA 5U1PA 4RJIA 3NHSA 1AM4D 1NTOA 3Q7SA 4JA2A 1J24A 1TB4A 1TT5A 2OESA 3I3OA 4RSRA 2OBXA 4U7TB 1GPUA 2F59A 3RRBA 2K2QB 2H06A 4N7RA 4W5TA 1Q21A 1Q92A 2W6PA 1FQKA 1W581 1A9OA 4AJKA 4EG1A 5HGXA 3KK0A 4JYPA 4QXPA 3ZDDA 1RACA 1JX6A 1XF1A 2GPWA 5I9LA 2F00A 4CIWA 4FOSA 4HAVA 5AK3A 2VAXA 4RVOA 4YCCA 1PTJC 1ZXBA 1SUCA 2ZIEA 4CCAA 1NAHA 2QRVB 2WPNA 3WYFA 1R9MA 1H6BA 4ZHQB 4OP2A 5F73A 4KSBA 3ZHCA 1ILEA 5G1PA 4NBSA 2OV6A 3U4MA 2XA9A 1LS6A 3HSKA 4JQSA 5KHLB 2JZOA 5G40A 3CLKA 4H0CA 4CXMA 5DBIA 4HXEB 2Q6LA 2VJAA 4FLFA 4FYKA 3BCUA 3T1NA 3OC0A 4MVCA 1KYXA 4WKCA 1DARA 3JWHA 1X74A 2PH3A 4E88A 1UMDB 2NXWA 1BN6A 1T29A 4BFVA 1E5XA 1S5PA 4F4CA 2XQJA 1KYYA 3RVQA 3CLVA 3E23A 2EIHA 4BLTA 4RTPA 1PX2A 4F0JA 4FOPA 3BK2A 5CLGA 3LXUX 4D41A 1EAMA 1YDWA 1KJWA 1U0HC 2FZCA 4JU9A 3ZY2A 2ROQA 4HTAA 1DDOA 2QYTA 3ASYA 4TOIA 2DU8A 4A2CA 3KEOA 3KEGA 4GR5A 4ZT4A 3RSFA 3ZWPA 4BWYA 3K0CC 3TBFA 1RQGA 4Z7NB 5GZ3A 2H18A 2P68A 4S1PA 4FFBB 4BJ1A 3AT1A 2NWQA 3BL6A 4ZXFA 2GPYA 3OIWA 4CBVA 1BFUA 1YFLA 4BOYA 3H5RA 1HZZC 2CV0A 1O0SA 3R76A 3UJ8A 1A3CA 1CRZA 4JMPA 4PIMA 4EEXA 3U1BA 1F8UA 3E5NA 2GA9A 4G86A 4JI7B 1GWNA 2GRUA 3EXG2 3ZJYA 3KG2A 2XXAB 1MABA 5FTKA 1LWOA 2HBRA 2R00A 3OM9A 1IUOA 2NOAA 3KR2A 3PVSA 3SJBA 1HA3A 1LV8A 3KSMA 4LJ7A 5HE8A 1Z4MA 1AT1A 3TLJA 3W3AH 1GUYA 3AEKA 1MENA 4ZHQA 1M1YA 3AOGA 1YQTA 3T35A 1QDEA 5ELXA 1BQEA 5I7HA 3FFWA 1MW9X 2G06A 3H2SA 1L5VA 1Z6XA 4L57A 3QLVC 4EHAA 2R65A 3H8SA 3TAXA 4ZYLA 4UZFA 4JKIA 3P9PA 3SY8A 1QAOA 3UMVA 1DJPA 4AUNA 1EUQA 2P6OA 4AZSA 1GTZA 2QW8A 3LT0A 3IVRA 1JXOA 2HF8A 3O9ZA 5JY6A 4GX2A 3OQPA 1Q7BA 4L85A 3UAXA 2V74B 1PTKA 4QSMA 2AIRA 1I6MA 2XYVA 3WSWA 1QZZA 1MMFB 3BPSA 3T7SA 4HNGA 4KWEA 1H9AA 4JBHA 4XARA 3ROZA 5IEJA 1Q7TA 2GJAA 1N2HA 4NCNA 3TH5A 2DSTA 3NANA 1B8NA 1K6JA 1OLUA 2XUZA 4J2OA 3JAKA 4I4LA 4LDZA 3V8MA 1DJOA 2AWNA 2JIZD 3EUEA 1R6DA 2JIOA 4WK4B 1SQFA 1NQWA 2FNAA 3PNKA 5I7AA 2HF7A 2HF9A 3AOEC 5EKTA 4BP9A 1GZ6A 2A0KA 1P1HA 4PCUA 4EW1A 2JLVA 2ASVA 2PSSA 3KJNA 3DG9A 4G4IA 5I47A 4F9FA 4Y2TA 4HXYA 1EK6A 4TYPA 1VHTA 2P0YA 4KN8A 1ELOA 2N42A 4CM3A 1G3IA 4MUAA 3GVIA 1GPNA 2AEJA 5DYIA 4ESEA 2ZTUA 2L69A 2WHPA 1P8AA 1B8UA 1XAJA 2W2MA 2XVYA 3P9SA 3DXFA 4FKZA 5B7PA 3I23A 4D4KA 1JMKC 3LAWA 3P0IA 4X65B 1YL5A 3BGVA 2NZJA 5L95A 3EC7A 3QVJA 4RE5A 3HH8A 3RF7A 4RYDA 1L8AA 1V45E 1IRXA 1V1MA 3FIJA 4LVUA 3UIEA 3G59A 1Z45A 1HOTA 1DAKA 5KCMA 4DIDA 2JLCA 3PWKA 4WWHA 3SF8B 4BE7B 4A2QA 2WW8A 4IGAA 4D92A 1XZNA 5JVDF 4BNZA 1WVMA 2JL1A 3MS7A 4MWSA 1PFYA 4N40A 1AU9A 4PG7A 1N9ZA 5BOVA 2GPTA 4WVLA 1JXMA 3JALB 8ATCA 3QLJA 3GN2A 1RYYA 4TT8A 5KX5F 1A8IA 2ZVDA 4NABA 5IT0A 1T36A 4NHEA 4TMXA 4K88A 2NUPA 3A6GA 1UDBA 5CDYA 1IB0A 3IIMA 3JTEA 1XVTA 5CW1A 1TT7A 3NQ41 5DTIA 1B8VA 2HMSA 2ORED 3M33A 3E1SA 4I1OA 4B35A 1IEVA 1E2MA 3V4RA 1G2OA 4WADA 4UTOA 3ZKWA 2FRDA 3QBDA 4NBLA 5B55A 3WXBA 1RWXA 2EX0A 4H4EA 4OTZA 2H5EA 4L5IA 3HJCA 6PFKA 3EAGA 4BVHA 4QXMA 3BMQB 3CVXA 1T9BA 3HBFA 4QVKA 4C76A 5JBQA 3FTEA 4AFNA 5DX8A 1WKVA 1T9GS 2PX0A 3AF3A 3RNOA 1X7YA 4XQEA 4K1XA 5JMOA 4D46A 5HBRA 4ITVA 4N3BA 2FZEA 1XRJA 3D8NA 3TXXA 3PC7A 3MGBA 4PHTA 1M0WA 1PW7A 3VC2A 4CHGA 5AR1A 1DEHA 2NXEA 3BE5A 3OTGA 1KYWA 1SXJC 3TLBA 1WBBA 3WLQA 2MOKA 1WKCA 2C4NA 5ITVA 4BBAA 2YBEA 1YQUA 4PAOA 5BSUA 4BNVA 3OCWA 3OJFA 1T6BY 4UBLA 2M98A 4HB2A 2UZIR 4BJ6A 2W0MA 3PEUA 4PXSA 3VH2A 1GZHB 1U1EA 4FYPA 1NJFA 5K03A 3H7IA 2XB6A 2XAUA 1YDEA 4QICA 2X5XA 3Q3GE 3DYVA 1A8UA 3REFA 1CTQA 3AONB 1U6IA 2WQZA 2I6GA 3LUGA 3RSOA 4WJLA 4ZAZA 4YMIA 1RQLA 1XRRA 2JCGA 2JHAA 3KLBA 3V8QA 1M76A 3BSYA 1DOZA 3D6VA 3TCKA 5CFMA 2VPQA 1CD5A 4QLAA 1Z9BA 3K32A 4UOEA 1NMYA 4EKNB 5KYTA 5BXYA 4AZ3A 2PEZA 1XRNA 2CLKB 2VA9A 3Q11A 2C94A 1QGDA 3E9RA 3IVAA 3R0JA 3G9TA 4XFKA 5HZHA 1IN1A 2QW0X 4C6TA 2CLDX 2FQ1A 2IIQA 4MCAA 3FOCA 4UU0A 2XZDA 2DTXA 5KKCA 4D44A 3AP1A 2AQHA 3AJAA 2WMOB 3LA8A 3UOWA 3VR4H 4A27A 2CJPA 1QZ3A 2GAIA 1HMYA 3JQ9A 2EHJA 2ZITA 2GYUA 2QI9F 4K0RA 4ZVVA 4HDRA 3NDBB 1L4NA 3X1WA 3DZJA 5B57C 5KDOA 2Y1DA 4HDNA 1HLGA 2AX4A 3IUPA 1OGIA 2YNMC 3D0RA 1I6LA 4H35A 4MKZA 1RZUA 1HSZA 1U2ZA 1XKXA 3OWOA 2G07A 2JAUA 3AZPA 3O4FA 4KL8S 4RWEA 1KI1A 2QW1A 2JFNA 3VR5A 2FN9A 1P9NA 3SU8A 4GBMA 2HHAA 1J2EA 3EZFA 3FWKA 3WIVA 4R40A 1SB9A 4MYSA 1E2KA 4J16C 4GYWA 5SZKB 4J2HA 5AI9A 1Y7LA 3N8DA 4HAOA 2QN2A 4FFRA 1JECA 1BEUB 2DHCA 3IUMA 1Z68A 1JQDA 2QAJA 3W05A 3NO4A 1E4YA 3A14A 4WZBE 4TLAA 4DSNA 2YTZA 1U3VA 5CUQA 4B44A 1Z25A 5AK0A 4JBXA 3T5TA 1DX9A 2G5CA 2RHBA 1J2JA 2YWJA 4WEQA 1FRFS 4G8CA 3BRCA 4FW9A 4TZKA 5AI5A 2QN1A 4LF9B 4NXNB 3ANNA 3C97A 3A3KA 2NSYA 1I5RA 3H7AA 3OAAD 4D4MA 4EENA 4D3XA 1C2YA 3FTPA 2JKYA 1K3TA 1OKKA 3KQVA 1KVRA 3BJRA 3R6DA 1TRHA 1F2UA 1DRWA 3RHZA 3GRZA 2R6GA 4NV0A 1UAYA 1VCNA 4B75A 4CQLB 4DMHA 3VHRA 4HEHA 5EWJA 5HA5A 1FUIA 1PIWA 3RVDA 1E5DA 4GR9A 3ZIDA 4ZFNA 4QBHA 2IELA 4QUAA 2QL7A 1XYGA 4QDKA 2RB4A 2FEWB 1QQ5A 4KTTE 3ZZ0A 5JFOA 4V3CA 5JY1A 4A23A 3DKIA 3PRHA 4NCBA 3RYCA 3FD8A 4V2IA 3A9VA 4U2CA 1UP4A 2EKDA 1CUAA 2A8YA 1Q0QA 3B8EA 3EZNA 3MT9A 1PGOA 1UPCA 1V9LA 2IGTA 3EVBA 1XF9A 3G2JA 1O94D 4QEDA 4PC2A 1H93A 2LDBA 1JXAA 1R9NA 5FXMA 2LBPA 1WLSA 3BTOA 5EIBC 3GEHA 1M2FA 3UW1A 4BJ5A 4D97A 2ZIUB 4A15A 5SV2A 1IOVA 1XMJA 2GT1A 2WWTA 1T8PA 4WRRA 1D5CA 4Z9FA 4MIYA 2C3OA 4P4TA 4XCQA 5LKAA 5F1PA 2PZMA 3D54D 5TVGA 2YDXA 3S2IA 4G84A 1CUBA 3ZY5A 4PZLA 4U2BA 5E4TA 3MJSA 2ECPA 4ZEOA 1U6KA 1V16B 4NNPA 4CI9A 1JI3A 4XEHA 4BNNA 2Q2NA 4DW8A 1YQEA 3K6RA 3OZUA 1P9LA 1E96A 2WYOA 3ZK8A 3C3MA 1KH3A 1DRUA 2H54A 3GLTA 4HYEA 4YJHA 1WKBA 2NO6A 3DLPX 4DEYA 1HFWA 1BMFA 1JA9A 1KZ4A 2J32A 3EGEA 4IDFA 4ZPJA 4R3UC 4B3CA 1VG8A 3CZ4A 1P7CA 1XMVA 4RZSA 1MX5A 2I99A 4BNKA 3OF5A 4HEA6 4P3PA 4F96A 2CDCA 1LK0A 2OWDA 3U61B 3OFJA 4X8MA 1SQSA 2X9VA 4RIFA 4C0KA 3WLNA 3VTAA 2X5KO 4MRNA 1H2WA 5FWYB 2W42A 4EMUA 1G63A 1OASA 3DP9A 1IN8A 1JHMA 4DBLE 3KJEA 1NBMD 3K2QA 3NVDA 3LDGA 2ES4A 4J1TA 1FJXA 3PDIB 4RD0A 1P2BA 4P54A 1Y0BA 2P4SA 5IXYA 1P0MA 4YJGA 1OC4A 3AV0B 1XEWY 2R8YA 4DC9A 3GH1A 2GF2A 3OX3A 4BQIA 2XHEA 3U44B 3LYLA 1PGPA 4OXKA 3UNXA 2CUTA 5C1DA 1JN0A 3E3LA 3OZ7A 3ANYB 4GG1A 2C97A 1ZMTA 1RC1A 3I4CA 2HR1A 1J1IA 3DKKA 5H3LA 5DW3A 3OHPA 4P53A 2GLUA 1CQJA 1BHSA 5BW6B 3MJHA 3WB9A 1XQ6A 1SCKA 1KBQA 3QKSA 4IM7A 4LHSA 3E7PA 1GN9A 4BAZA 1GTJ1 1T4BA 4MQLA 2UYQA 4Q4JA 5FFMA 4KPYA 3KJQA 3L7DA 5C5DA 4I4IA 4KRXA 5K0NA 3X1MA 1YRLA 4CWAA 4OCZA 3W8EA 2Y27A 4UATA 4B8YA 2WVHA 4XIIA 1C7FA 1SC3A 3EWIA 2RC5A 3WICA 1TDJA 2BTOA 2VDNB 3L93A 3BIFA 1P0IA 4RKEA 1IJFA 1M34E 4NYIQ 5EYPB 2GI4A 2XKBA 3U13A 1DLJA 3P4XA 2JATA 1MA3A 4CG3A 5A6SA 4XWGA 2B4AA 2HX1A 4LMRA 4MHSA 4HNRA 1GTMA 2Y1LA 4FR2A 4NZPA 1ZU4A 1TJ4A 4PGMA 3ROXA 3TNFA 3UT5A 2PUBA 2Q07A 3L7MA 4AX4A 2VK2A 3QYFA 4C29A 3U4QA 1H05A 3ZWMA 3BL8A 3FTCA 2QM8A 4LTNA 4G2TA 3RU9A 2E5WA 1XP5A 5IZCC 4ZVLA 4DILA 5DWVA 1EX1A 1XAGA 5JU6A 4L6CA 4NHOA 1JG3A 1JHZA 1YS7A 3IVXA 1R8SA 1TYBE 4NOJA 4O1IA 3GMIA 2WNIA 4QREA 3JD2A 2CUKA 4MI1A 4CF3A 3SHTA 1Q7RA 1X0VA 4TKVA 1QYXA 3AF2A 4FCTA 2NO1A 2WZCA 4EG6A 4OB7A 2OV1A 3DTNA 4LQLA 5JTTA 1DCFA 2YV5A 5DHSA 4PAWA 1EU1A 4KPUB 4N65A 4XX0B 4KUHA 1O08A 2HQ1A 4MLPA 3GUCA 3LC0A 3KXDA 1X1AA 2NU8A 1E5LA 1RRPA 4RHUA 1PGJA 3KKQA 1JKJA 2OY0A 1T0BA 1H2XA 4M53A 3CLSD 4RMNA 3ZHRA 3AM4A 3DFFA 1DJNA 1KGDA 3LBHA 4NJMA 3Q8KA 3QZUA 1XU9A 1O4VA 1U5BB 3M6WA 1NI4B 5C0OE 1RWQA 2X9NA 4ND1A 4YDHB 1PW5A 5THXA 2CDNA 1ZFNA 4Y2YA 3ZV4A 3C5CA 2VA8A 1PR2A 3WRXA 4HQOA 3PC2A 1V25A 2R7LA 5BMVA 5JNSA 3GWZA 4B5KA 1RHUA 5A7FA 4CM1A 4X60A 2ZIFA 3KSRA 1DC7A 1NBME 3CE6A 2RJOA 4ZAGA 1PR1A 2XE8A 5JSYA 5K8IA 4WV3A 1OT5A 3CRRA 4UAUA 1PNQA 4KFRA 1YZKA 4PR3A 5LB4A 2BGWA 4L9SA 3QUTA 4G5GA 2HJ9A 4J8PA 2PKEA 1EQAA 1GAWA 2ZU0C 3HBMA 4TLCA 4F3KA 5IFKA 2G36A 2EEPA 2CV2A 4RENA 1R1DA 1E79A 1PS0A 3PT5A 2QTBA 4HFNA 3W5IA 4GSYA 3G49A 4DADA 2ZJ6A 5HNKA 1YB6A 3NFYA 4CTKA 1GPDG 3THOA 4ZC8A 2DAPA 4UQLA 2AXQA 5IFLA 1PK8A 3TUJC 2OCKA 4HN2A 5BQXA 3X44A 1P1KA 4JYAB 3B9PA 3DMDA 3AKEA 4PPNA 4RZHA 5DM70 2PMBA 1MN6A 2IBTA 4FMDB 3LGXA 4MW2A 3O8CA 3PBKA 3B3GA 4G3XA 1PJZA 3G82C 3V5NA 1U7WA 1UEJA 5B64A 5KOYA 1ZRSA 3NIGB 1VLQA 1ZLYA 2QVCA 4G4SP 1TJNA 2ZB3A 3IAXA 3L1VA 3PUVA 4JBYA 1ULZA 5KNBA 1W76A 3LF1A 1I01A 4A0SA 1BWRA 4OHYA 5JCPA 3RRXA 3SDZA 1Z0DA 4I5FA 5I7SA 1A1VA 3RASA 1E1KA 4F21A 1VPWA 1MC8A 2EJUA 2WC1A 5EJFA 1NVDA 3HKCB 3IIIA 1YB1A 1VRVA 7MDHA 1RPJA 1HDEA 1S7GA 3DVRX 5AJWA 1BS1A 4CG2A 2H16A 1SU8A 1SVOA 4K9DA 4AWAA 1OI2A 2HFJA 4IHJF 1QHYA 4IS2A 1QC5B 4UE3S 3V1KA 1QQAA 1RBYA 1RWKA 1Z3IX 3FJYA 5D1NA 3U9TA 1RCUA 2GOYA 3HNPA 3GH3A 5BQOA 3I30X 1EM8B 3EVTA 3KT0A 3RIHA 3ZV7A 1KBOA 2MTBA 1XQYA 5FA6A 3B7WA 3H3JA 4UEKA 3VO2A 3C87A 4ZO9A 3OCYA 3UJDA 3ST7A 3IELA 3LY8A 2H9AA 4MJ3A 1CZUA 4PVDA 2DETA 2IUFA 5C8YB 5K0FA 2W6JA 1V9SA 1Z4IA 3L18A 2K7ZA 3H19A 3KEMA 3WYDA 2WM3A 2G8LA 1XE3A 3KBBA 4G5YA 2B98A 4X7RA 3Q98A 3C43A 3SVZA 2CHUA 3VKHA 4BL5A 3AIMA 1YK1A 1K9VF 4GOKA 2BHLA 4MARA 1MG5A 4JC4A 2BCEA 4MQ4A 4EOGA 2A1UA 5AUNB 4MCJA 5EHQA 1DO8A 3N6RA 5DRYA 4JI6B 4ALKA 1Q19A 1TNDA 4MS4A 2IUSA 3WC4A 3DCYA 1SKBA 4NZ9A 3TKLA 2UUAB 3K09C 1IFXA 1O96B 1QIMA 1XWIA 2AXNA 3I32A 2VSYA 1VCIA 2V45A 3DDZX 2H59A 2E2WA 4BO6A 4E09A 3E82A 4B79A 4YRCA 2JFYA 2Z9BA 4KR6A 3KQOA 3M4JA 2VXOA 1CRPA 2C4MA 4Q1AA 4EJ2A 2A3NA 4MV1A 1Z5PA 4HH1A 4UCWA 4HATA 1CULC 1RS0A 4C01A 5I45A 1N2OA 4FFNA 5I5GA 3T95A 1ZEMA 3L6CA 3U16A 4CMEC 4RQAA 1E9DA 3I45A 1WAMA 3LGAA 2ZDGA 3H1BA 3LY9A 3PLNA 4QASA 1XMXA 1RQNA 2CHQA 5A3SA 3DYIA 1NOJA 5HCNA 2ODNA 1V6SA 1RLTA 5JD3A 3A6KA 4HXFB 4L07A 2OHFA 3JYOA 4HQ6A 4JSYA 4QQFA 4CFSA 4DIKA 4X6LA 4EF6A 3VHXA 3PWTA 3A6ZA 5BYKA 2DOKA 5J58A 5EHXA 4LNUA 1N9GB 3MQ4A 2QRMA 3ZHQA 4Y2HA 3OC6A 1RM5A 1TU3A 2D1RA 2H85A 1XL1A 4QDOA 1XTJA 3C6QA 1HZJA 1WU7A 1XMQB 1KZ7B 3MOSA 4MB2A 3CLRC 2VP2A 4G23A 2ZYUX 4BATA 1GUBA 3GPCA 3O3CA 4WFJA 1G8SA 3HZHA 4XGNA 4E5NA 4CN8A 4PN7A 4MGIR 2I1QA 4R3WA 3TNLA 2PXCA 5JSHA 3RYHB 1Q7GA 3CLHA 3GLHE 1A27A 1EVZA 3LDAA 2VTKA 4Q7JB 4NZMA 5EXEA 1TUBA 5F2KA 5FL7D 4CGZA 2D0IA 2GBPA 2YMPA 2Y76A 1JTVA 3KJXA 4MA0A 1ECFA 2O3UA 4NH4A 3ZVRA 2PD4A 3G1WA 2X9GA 1BZYA 4LDNA 3I8OA 3CZQA 2J0VA 2OFOA 3EPPA 2PSDA 4MVJA 1MUUA 2OLJA 2XXJA 3E3AA 4BFSA 4B7UA 1P9WA 2YXPX 2PFKA 3GLVA 1NM5C 1IZ7A 3AJDA 3LZ6A 2H07A 2BFNA 4JKOA 4IIBA 5E3JA 3T8YA 1U8UA 3IDAA 5F78A 3ZE2B 1T9GR 1EFKA 3JQEA 3I2GA 3R3XA 4LHVA 3S7TA 4MROA 1PJ2A 4BVGA 2V1XA 5EPUA 3W77A 2QTVA 1FSFA 1WDWB 5DO9A 4Z4HA 2WJAA 5KBYA 3PC8A 3TSYA 5IJ9A 1GGFA 2A94A 3IAS1 1Q84A 3CO5A 2YHIB 2VHTA 1FS4A 1R16A 2QLMA 4OP3A 2EWWA 4RW0A 3MWGA 2WV9A 4Q4AB 1QRUA 2IYEA 4XCVA 2DE0X 1KK3A 2SNIE 4C7MA 3TLZA 4F6RB 2O3JA 2P1ZA 1JAZA 1Y1LA 4UCXA 1P3Y1 1X8XA 5DTRA 5LQUA 3NTVA 1NASA 3NV7A 4XJSA 2YW2A 4CCWA 4BXOB 1W85A 4ML3A 2FMHA 1P1RA 1E2QA 4ZI7A 4DMUB 4DR6B 2CYBA 2TMKA 2EKLA 4YRAA 1GL9B 4HSEA 4YQEA 1CRWG 3RYIB 2C54A 1H2YA 1YI1A 2AEMA 4DJDC 1T9HA 3IOBA 2WF5A 5AJXA 2R4TA 4I9GA 2RHOA 4MLDA 1JI0A 4ZVPA 1KY4A 4DQDA 2AQ8A 4FE7A 1SUDA