5DHEA

Crystal structure of chbd3 from thermococcus kodakarensis kod1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
b'GDLVKPDAFSVKIQDWGSTEYDVTLNLGGTYDWVVKVKLKDGSAVSSVWSANKAEEGGYVVFTPVSWNKGPTATFGFIATGSEPVEAMYLYVNDQLWDVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase
publication title Crystal structures of chitin binding domains of chitinase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis kod1
molecule tags Hydrolase
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dheA00
2CZNA 1C7SA 2XBDA 1HEHC 2RTTA 5DHEA 1QBAA 3NDYE 1XBDA 5DHDA 2CWRA 1E5CA 1E5BA 1EXGA 3NDZE 1C7TA 1HEJC 1QBBA 1EXHA
chains in the Genus database with same CATH superfamily
3LRGA 2Z0BA 1NLBL 1NOAA 4GBXB 4OJEH 5SWSA 1M7UA 2EZ0D 1M05A 4M7JH 1G7LB 2Z1KA 1J0YA 1MHPL 2Z64C 4NQDA 3KPPB 3U7WH 1M7IA 4PCKA 4OVVA 4LCWA 5AB1A 4Y2DC 1BOGB 2L8AA 1AH1A 3BVNA 2WVUA 4MA8H 4A38A 3RAJH 3ME0B 4FYQA 2ATPA 2FLRT 3ML8A 3UBXI 1JGLL 3CH8A 3F7YA 2A9NH 3O11A 5DHVB 2FIRT 3HG1E 3VFUB 1DBAH 5DMKA 2IOIA 1VAHA 4KVCL 4AV0A 4AVIA 3CZFB 1QACA 3EJYC 4N5EC 4I5BB 2QVKA 4FQ1H 4Y88A 1QW8A 3PS6A 2XHNA 3NZ8B 3VCLB 3W82A 1MFBL 3V4PB 2HLEB 1IL1A 3JTTB 2ITCA 2XWEA 5E8EB 1L3WA 1DZ0A 1BVNT 2APXA 2FATL 4DP1X 4OQ1A 4L8CA 3GMQB 4AW4A 2FX7H 1KTBA 1HKLH 1KXVC 3WKMH 4JFPB 1HINL 1WWCA 4YK4C 3UTZA 1A1MA 4B9IA 1TTCA 5GISH 3L3GA 5LWYL 1MCPL 4K8RL 4BFEA 4K94C 3HPJB 4NO3A 2A0LD 5AZUA 2R39A 4ODXB 4MXWH 4WW2F 5FUCE 3GTTA 3MBWA 2NY0B 2P5WB 2OMVA 3G5YA 2X3AA 2J44A 2NY5H 4GKZB 4KKCD 3ZL1A 3KLDA 5J11C 1B90A 1UURA 1ZIBA 1NGZA 4U2ZA 3PXLA 4HH9B 2W9LA 1LEKA 4OZGB 5E94A 5TDOA 3J7HA 4NBYB 2DLTA 4JG1L 4M61B 5ERWA 1QWNA 1OGSA 2VN3A 5IY5B 2FT6A 1Q94A 2J8UB 2YK1L 5B3SB 5FDWA 4OR1A 3L3HB 2VXSH 3SZKC 4MS8D 1JI2A 4XO4A 4HDIB 3QNXA 3VG9B 4HJ0C 1DQLH 3OXSB 5ID0A 3A23A 2W60A 4PRID 2OL3L 4OLXL 4Y4HD 1R33A 2KC0A 2CIIA 2DQDH 1IGCH 4H40A 5FFOA 4YSQA 12E8L 4WNJA 1FFRA 3UC2A 5HHMB 2ZOWA 2VQTA 3L9EA 1YNTB 4NHUB 1C8QA 2CK0H 2X4OA 4GINA 3IDMA 2JB6B 2AMUA 2BNRE 4XXWA 5JO5B 2MFNA 3QCUH 3ZTJG 1UEYA 3MV8B 2PWDA 1DBKH 2VSCA 3CHRA 5LGKA 1MSPA 2JIXB 2ITFA 2IALB 4KRLB 4EI5A 1WITA 4AYBA 5L2KE 3B2VH 4XMVA 5IMOA 2EEBA 1EEYA 4NHCL 3MBEB 4BZ1A 4TSAH 2HN7B 5C0CB 4AGOA 2WUBH 1YEGH 4OTXH 3WFCL 5C0IA 3FO9A 4PV8B 4RETB 3S88H 4Q0XL 3HBPA 1UB6B 3DDGA 1ET5A 4BWTA 2P44B 3SBWA 3LPGA 3QRFM 4HPOL 4E9XA 2V17L 5ES4B 1F97A 2EIMB 1MLBB 3HRZC 3VD4A 3RZCD 5CIPA 4UU9A 2KS0A 1GYCA 4YC2B 3LNEA 4JQIA 5JHLL 1IKOP 1G1KA 2WTRA 4GSXA 1OT1A 2AANA 3U9UA 2BVYA 1ORQA 3GYRA 2VQ1B 4IOIA 4PVMA 3HZMB 4YHML 3JQOB 1JZHA 2LU4A 2KLTA 4NPYB 5EFIA 2VLRA 1MRFH 4ZMYA 1ACYH 4S1RL 2DKSA 5DEJA 3HS8A 2BS8A 3V6ZA 5C2BL 1O0VA 1P6WA 3CHQA 2G2RA 5ITFB 3M1BA 4AW7A 4L8DA 2ITEA 1DLHA 4IRSB 3V0JA 3UTTA 4LHQB 2O4EA 1EZLA 1PDKA 4V2CB 1XZ0B 3QZWG 5IUSA 1HK6A 4IDJH 1UVQA 4G11A 4M1GH 4PJ5D 4LCVA 1SBSH 3TL5A 4E5XG 5CINH 4JG0H 1SLVA 4B5EA 5BQDA 4KTDH 5CJQH 2XN9B 4NO2A 5DFTA 5DD0L 4F91B 1B2WL 3MREA 4TOYH 4PJHF 3PQYE 3NA4A 4Y1AD 1IC7L 4JJOA 2CRIA 2OMYA 5SWSD 4LPVA 3RBGA 2HTLC 2V37A 4X80L 4DGIH 2DYRB 4FQQB 4PJ8A 1A6UL 4G71B 4GRMB 4U05A 3D4GA 2C1PA 2DAVA 5CGTA 5BV7B 3VE0B 4JFEB 2BC4B 5C0AA 5L2JB 5F1OB 4AJVA 1BJ8A 5FCUL 1SRDA 3QEUA 3SKOA 5AB0A 5JIDA 2YMOA 5IEKA 5CLTA 2VR8A 3TURA 3OKMA 1MCEA 3NSYA 3MRBA 3O6LL 2RACA 3ZMNA 4XCFL 2FECI 5AYUL 2R69L 4QTHB 1T20A 4WV1B 5HI3D 4J27A 2N56A 2QV4A 3SYCA 1YC8A 1NICA 2GY5A 1QKZL 5GRWA 2BSRA 1FVCB 3ZUCA 3US9A 4UNTA 1G4MA 2WD0A 1OQXA 2L3BA 3GDBA 1NMAH 2NXZB 4D3CH 2JCCF 1A3LL 2N0MA 2WXGA 4GSDH 4QRPD 3WHXB 3MRCA 3QIBB 4X8JB 3HC3H 3DUSB 2HVJB 5I1CH 2QPDB 3QDJB 3U0PB 4L3AA 5K69A 1W72B 3DJZA 3ARTA 1RFDH 4K7FB 5E1AA 5J6HA 5JQIB 1L9TA 1U58B 3HNTH 5C6PB 5F21B 3A21A 5GGVL 4W4NA 2ZX9A 2F9BT 3W2DH 1MFCL 1IM3D 2E7LC 2A6IB 3ZE2E 2F7QA 5HYJE 1HT6A 4NOFA 3D9AH 5LXGL 4QT5B 3HN8A 4FXGB 3INOA 1FL5B 1Z9OA 5MP6H 4D0CB 1WTLA 4IKNA 1P2CB 1FFQA 3Q8CA 2XLLA 4BSWB 3X13A 2PO6C 3FAWA 3FTXA 1QA9B 2IQ9H 3EBIA 1QSED 3APDA 3HNVL 1NKRA 3VWKD 3GXPA 3PWNB 2KLRA 2X4UA 3HG0A 4JCWA 5E00A 4F3FA 1NKOA 1IAOA 3LEYL 3V4VA 2WQAA 3NABL 4WJ5B 3A0OA 4XTRD 5AKSA 4GAFB 4G8GB 2WANA 5FLVA 4JO2L 1JTTA 5IFHL 3QWNA 3DXAA 1XH0A 1ECYA 4NLHA 5D96C 3GSRA 4B95C 1IBHA 5A16A 1N7MH 3CN4A 3FQYA 4TUKH 1F11B 5F6HI 3G9VA 1KGJA 3WEOA 2ZP8A 2PF6A 5H37A 1I85C 2ATKB 1CICD 1NSNH 3IBOA 2LTQB 1NFDF 5JIHA 1KLGA 3ILEA 4PP2B 3V0DA 5KBPA 1YPZE 4M48L 4N6RA 2H2SC 3NSCA 3ENEA 3MDJA 1TEYA 1KEMH 5KSAB 1S2EA 2JELH 1XH3A 2XVGA 2QKSA 1G43A 4IGBA 1TZGH 3IJYB 3RVWD 4ZTEA 5LJYH 3EYFB 3C2AH 2AVGA 1NCHA 3OAYH 3BWAA 2FX8H 1RZ8B 1Q9OA 1J8HB 5HXMA 2HJFB 3WS6A 4YUEL 4FNUA 3FRUA 3MRGB 2KI6A 2BDNL 4JFXB 1NBZB 4MHHG 5HPOA 1KPUB 1XGUB 5GGRA 4D8PB 3BD5A 3LPWA 1DJYA 1Q38A 5DJAB 4AUJA 1BIIA 2NT1A 3STLA 4X6EB 1KIUB 1KXTB 3VFTA 1CD8A 3QEQA 4L3EB 4OD3L 4O02H 3NCJL 3WKNA 3X12A 5KOMC 3ZDXB 2NT0A 5IBTH 2VC2H 2ZT9C 2PCYA 5ABZA 3TONA 3VXNB 5KVGL 2ZG3A 1SMAA 1H15B 2L0DA 1TFHA 5K39B 1HOCB 2X38A 3BAKA 3TA4D 3S4SB 3UTTD 1T7VA 1Q0XL 4NQCA 5D7HA 2J4WL 5JR1H 1OAZH 2VM3A 3UPRB 1BQKA 4X6DA 3GBNL 3UYPB 4KUZL 1QEWB 2VWEC 1HHKA 4UDUB 1MXDA 4A6YB 1P1ZB 1IFHL 3MLUH 5I5MA 3PDGA 4QPEA 5BNXD 2CE6A 3JT2A 4LCUA 3B2UD 3H7BB 4N8CH 1R34A 2LFEA 5FF6A 1DVZA 1WQVT 1SF5A 1E42A 3DVIA 4PG9B 1WA0X 4POZC 1RIVL 1CB4A 5CD3B 1QYGL 3IDXH 1PNDA 2OSLA 3BVUA 3KJ6H 1JF6A 4PB0H 3TN0C 4FQXB 3UJJH 4N8VB 4YWGL 4NZUH 2OR8A 3QORC 2X3CA 1S7XB 5D7IE 1HS6A 3PWJB 2HWZH 5D6CB 1N2RA 1ZHNA 1LE9B 4NN6B 3O3AA 3NFSH 5BO1H 3O3BA 3HG5A 4TPRH 1EH9A 4JDTH 3ETSA 3QPQD 4YFEA 5IW1B 1FLRL 3QDGE 3QAZB 4GG6E 1YMHA 3BAIA 1KCSL 2X70B 1DLFH 3FFOA 5FW7A 3TT1L 3ULVH 4ZMQA 4K7PH 3IMUA 5GXBB 1XMWA 5EA0H 5SX4I 3IFOB 4QRQA 1ADQH 1KG0A 2VABB 3D3VA 3RI5F 2XVLA 1RHFA 2M83A 5CCKL 3DX2A 1B0GB 3UACA 5IB1A 4NC0B 3A4DA 1HNFA 2Z8WC 2P1YA 5HHNB 4ZUWB 4H7VA 2FWLB 1AIFB 4TUJA 4Z76B 1WAAE 2A77L 2AAAA 3HVDA 3PJSA 4LAQL 1AJ7L 1SYVB 1V7ML 4X4YB 1JXJA 2XZQH 2AP2A 3WN5B 3EFFA 5F8RC 4PRPD 4UILL 4QKTA 5CZXC 1ZLUH 4UQ3B 1WTGT 4I9WE 3O3UN 4BH8A 1UOWA 2NZ9C 2CHXA 4PJDE 1E9OB 1A47A 1S7VB 1PLGH 1H5BB 3ULUH 1Z0MA 4RMRA 1T6WA 2W92A 7FABH 4K5LA 5MI0C 2CMRL 1EEZB 4KK5D 5GS0D 2VLJE 2PYED 2VZUA 1NC4D 1NFKA 1JGEA 1A6TA 5C07B 2J43A 4ZD3L 3BHBB 4Y2NA 3TZVC 5IG7A 2AQQA 4J39A 4ZJ9A 3U1SH 1QRND 2NY5C 4FI6A 2CGZA 1RP9A 4WTXA 3JV6B 1PY4A 2KH2B 3E3QE 2VDNL 1IC0A 2R8SL 3KHOA 43C9A 5LG6A 1GGBL 4IOFC 3RA7H 1G0YR 3K2UH 5J1SC 4CVXB 3TEZA 1AY1L 1NGXA 2EH7L 4CBPA 2I07A 1B4TA 1H0DA 2BIHA 5I74B 2OYLA 5E6IB 1HWGB 1AKJB 2H6PA 4AUYA 4YSAA 4ETQB 3TPUA 1S7WA 4I9XA 1YQVL 4WW1B 1CDHA 5C0ND 3LH9A 2MMXA 2OAAA 4N20A 3DBSA 4FFWD 1NBVH 5EG6C 2LT9A 2BZ7A 5D2LF 3SKMA 1F58L 1CBVH 2DQEL 5DURD 3KZ8A 3V52L 1WS8A 3INUH 4G1MB 4JB9H 2VJ8A 1ZMYA 3NJNA 5AFAA 3BP6B 5DZAA 1KBGL 2EIBA 3QIWB 3NIDE 3WKPA 4MBOA 1U2YA 4Y5XB 3DUHA 1ZTXE 4U3SB 3SQBB 3HCVB 5HJ3B 1J1PH 4GXVL 2XTJB 3H9SB 2VL5B 1A6ZA 3WTTA 3MJ7B 1A7RH 1ADWA 5INCB 4OZHB 4YHZH 4QXTB 2F08A 2IC2A 4LASH 4ZMLA 3F8UB 4GG8B 4GMTH 2WO2B 3MR9A 5MENB 3UTPD 4NKOB 1LDPH 2B2XL 5FM5O 4AIZA 1XF5A 3EO1B 5D7LA 1I1AB 1JHKH 2D8KA 3B9AA 4N1HB 4ORZC 4YNYB 4NLAA 3RUGA 5AENA 2OTUA 5HGAB 2ORBH 4NQCD 2YBRA 2RFXA 5CKAA 2FBJH 4MQ7B 5EZPA 3SPGA 1SXBA 4RAUA 4APQA 1S5HA 4IMKC 1HQRA 3ZDYE 3J8F7 4HUVA 4XWGH 3RIKA 4KHTL 4W9KC 5HD8C 2O61A 4IRJB 5BZXA 5JW3L 4MHHI 1ZE3H 4KK8D 2WSDA 2P7TA 4UV7L 5C0GA 3W11D 3FO2B 1KN2H 4W6XB 4ZW5A 4I18A 2CCLA 5IB4B 4NN5B 1OCCB 4KNSA 5DJDB 4JZJC 4Z3HA 3BISA 4NFDA 4HEMA 3SGDH 4MA1B 2OMZA 3CN3A 3UJTL 1P9MA 1QTPA 5I1HH 3VD1A 1AI1L 4RFOL 5SWZD 1EXUA 5DD6B 3V6FB 4EN3C 4MVBD 1HXMB 5BZWA 5BVPH 1LO5A 4ABQA 1E4WH 2IH3A 3QIUA 1YNKL 1IAMA 2EVJA 1G94A 4D9LH 2BMKB 3BH9B 5EHFA 1S4IA 1WAEA 3CQPA 4IOSD 4GO8A 1ZHKB 1CT8B 3SOTA 1LO3H 4PU2A 5HGBA 3I6SA 4PJBA 2DIEA 1MCJA 1QFWH 1V3MA 4U1IB 4P3CL 3GTNA 2OL3A 4BE6A 4PRAA 4MNQE 2DICA 2R4SL 3VFNA 4MJ6B 4OD1H 1AHWB 2IVFC 3AC0A 2MCPH 3Q7JA 4LCCB 4BYHA 2ZNXA 2AXGA 4WNQA 2QPSA 3D3VD 4TQPA 4QOKD 2HAZA 5IHBA 1OE1A 2AJVL 3O4LE 3NZUA 4R7VA 4L8BB 1IKFH 3QXUA 4QEGA 3L48A 3IJHA 5FB8A 2FYYA 2PXYB 2V2TB 5SWQA 3OTTA 3MV9D 1AIZA 3LMJH 4NO0D 4B7LA 1UKTA 1SJMA 3TOPA 2VE6B 5I71B 3QWRA 2Z65C 5E9DB 2DJMA 1EERB 4PWEA 1JZ2A 5F0MB 3R7QA 2ZX6A 5T3ZD 4L0YA 5IB2A 3LCYA 2TSAA 2CBMA 3O81A 4P46C 2QLVB 1KENL 4J6RL 4WI0A 1I3RA 5I1AA 3ELAT 1NLDL 5JHLA 3IYLW 1HXKA 1UQSB 2JQMA 3TVMD 3MRRB 1HU8A 4W6YB 4Z7UB 4N9GA 1MCNA 2EIEA 1ZVSA 3I6LD 5E8OA 1MUJA 4LPCA 3TFKC 4DQOL 5BW7C 3WY1A 2NY6C 4XVSH 2AKRA 1G9ML 2BNQA 3BUQA 5L7XL 2QFRA 5E0FA 1B6DA 3BIAX 3LNHA 4WW2A 2EKSA 3E9UA 5F9JA 5HY9A 3N0AA 2OLDA 5D93C 2ZXGA 5ACLA 1R3KA 3JBG7 3TIEA 5L88H 3MRJA 2K8QA 3DMMA 4HWEL 3MOQA 3V5DA 1FGNL 4YEEA 3I75A 3WEBA 4BUHA 3FKUS 5DQJB 3OHXC 4G8FA 3W9DB 1X7TA 1ES0B 2RMNA 2AXFB 3QJHA 1MFAL 4LSRL 4U6XB 4FQ2H 4PV9A 2GJRA 2WXQA 2DQGL 3CQFA 5D2NA 1PZ2A 3VXRA 4GRWF 4HXAL 4YSSA 1HL4A 1N19A 1U8CA 3F85A 3C09C 3HAEA 1CFQA 4U33A 3SJVA 1DBJH 2ICEB 2P8PB 5EWIH 1F4AA 1QEXA 3FU7A 2OZNA 3OR6B 1VA9A 5GJTH 2BS71 5T1KB 3TCTA 1TENA 4ONFL 5HI4C 2VAAB 2YRBA 4LSUH 4ZYKA 4N85A 1JWUB 4WUKL 3L9RB 3QR0A 3MRIA 3P69A 4WQOA 4ZX5A 4ZFFA 4U3CA 2QQNL 4F57H 4C54A 4B7IA 1VZGA 1JPGB 2BP0A 3B5TA 5D7LD 3DSFH 2VM9A 3DLQR 5L6YL 4RIRB 5DRXA 5FIEA 5C0BE 3P9MA 4HLZG 4P5KA 3VQMA 1L0XA 2O6FA 2H9GB 3ILQC 3WS3B 5IZ7A 2OCFD 2OM5A 1KCWA 3RDTC 1FNSL 4BFIA 1OGAB 3PRZA 1EHKB 4JM2D 3SDCB 1KB5B 2V7HB 3ETBF 1NOFA 5IK3A 4FQLL 1A9EA 2H3NB 4NZJA 3O6KH 1RSYA 4ERSH 1INDH 4MJID 3TESA 4Z95H 4JY5H 2E9IA 3EOYG 1I8KA 4ODTH 1DYZA 2AEOA 3B7SA 4FFVD 4PJAE 5DMIH 2ZTBA 4H20L 5CILH 5ENWB 3GSWA 3I6KB 2WMPB 3Q0HA 4JDEB 5D1ZA 4PTUA 3KL0A 1UCBH 4XHJC 4Y4FB 4AITA 1E4HA 4M5ZH 2Q2EB 3ATEA 4ZNEE 5CUSL 1S9YA 4M6NL 2VXVL 4HJGB 3S36L 1CYWA 3WE6A 1J1XH 2HT4C 2B1AH 3VVWA 2ZXQA 2GTWA 6CGTA 1OAKL 2I60L 3PAVA 5HDBF 2V9UA 4NQEE 4L8SA 3FN0H 5A2JH 4TSCL 4C58B 1SHSA 3VD7A 3PREA 4WWOA 4GOSA 1N18A 3DPBA 4N8VG 3NN8B 2EICA 4H26B 4N0UB 2H0FA 4N2GA 3HLKA 4OFVA 1FIEA 3EH5B 2ZZUT 4PJHA 3F2LA 4UIKH 4WTZG 4IJ3B 2AABH 1UD5A 2A9ML 1CLOH 1T04B 2Y7LA 1WFNA 2BP3A 2WOYA 5JHAA 4QJ5B 3TH3T 4HJIA 1G87A 2MOVA 1BM7A 4X5XB 2FECL 4IBWA 1MCQA 3W39B 3Q3GB 2ADJB 3I3EA 3MXWL 1Q1PA 1WZKA 2ZE0A 1L9PA 4MDIA 2ESVD 3FULA 3CSYB 4O2CB 5EZOL 5JIKA 4URKA 5HHQA 4EE2A 4UT6A 5KVMC 2P28B 1KZQA 5FV1L 5D1XC 1C5DB 4U6HB 5MERB 3QWRD 1HHJA 1D5XB 3CFQA 2V2WA 5GHWL 2BSTA 2GJ6E 3ULVC 1MCFA 1NCDH 1Q72H 1GPOH 5DUPL 4ATTA 4M8QA 3OBAA 1A8ZA 5F7EH 4TVSa 2EINB 3NCYS 4QHPA 1RU9H 4X4XA 3VXSA 1CFSA 5IT2L 1ZXKA 2EXTA 3Q44A 4LSQH 1EJ6A 1UENA 3DBXB 3L1FA 1KLUA 4JFED 1RZ7L 4U0QB 3RGVC 5IMMA 1T7YA 4PJFE 3L2LA 2E3VA 2JCCA 2NLJB 2F53E 2NTFA 4HUNB 1AOZA 1XIWC 1YYMH 3NDZE 3X1GA 4KNQA 1YDPA 2CHNA 4HHWA 3CZJA 3O3DA 4Y2DB 1R47A 3ZQ9A 3US1A 3WSQL 4WEUD 4Z7IA 2X9YA 1FZMB 2CO6B 4L4TD 4XH2A 5ACMA 2EUWA 2OFQA 3GKZA 1MNUL 1FNFA 1NCCH 3O41A 3K6DA 4H5SB 5I30H 3NAAH 1IJNA 2ZWSA 4LLDA 5JIPA 1ECZA 4WU5A 3H2WA 2WW8A 1ODAA 3ULUC 1RUQL 4KVNL 5DYFA 3G08A 4ZT1A 1R0AH 1E5AA 4HUWA 1AE6L 4A55A 3GJFH 2IDFA 5J1AB 2XU9A 3P9LA 3TBWB 3IGKA 1DBMH 5KVFL 4K2UL 4OM0H 3QBTB 1UYWH 3ARWA 3K74B 5HJDA 1OXYA 3KR3H 4HPYL 4YK4B 1KC5H 2ARJB 3VXRD 3RWEB 4LKXB 3REVB 2GT9A 2NXYB 1E27A 1D5MA 1A9VA 1DANT 3THML 2H26A 3TBVB 1BVOA 3O9WC 4Y19A 1GGUA 1A7NH 1D7DA 4PJCF 4RFEA 2F7RA 1DVTA 1WBXB 4CC4C 5C0JB 3CFEB 4YMPA 4PJIB 1W91A 4S1QH 4XBGA 1EPFA 1WEJL 4DKTA 4EI6A 3Q1EA 4CAGA 1JAEA 1OPOA 2HH0L 1NFDA 1XCQB 4B9FA 2IANE 1V10A 1RJLA 3OV6A 4GFXA 4KKLC 4OLVH 2MJWA 1LO0L 5FA3A 3WIFA 2VRQA 4ORGB 4TNGA 4F1SA 1ZLSH 2XWRA 3D18A 3QCVH 25C8L 4PJ9D 3B9KC 4DK3A 3P4MB 2WQRA 4EO5A 2ICWB 4RGOH 5DFWH 5DZLA 4BFKA 2EDNA 2MHAA 4PQXA 1BF8A 1FNHA 1ED3A 5AALA 3G6JA 3KBFA 4HGWB 1MCWM 3FQTB 3GHPA 1OANA 2ADIA 5IVXB 4LRNL 5C6TL 1QFPA 1H6UA 3VI3B 1M3IA 4TUUA 1NINA 5DJXB 3OKLB 1K8IB 2X4TA 4HUUA 5KSAD 3OB8A 2I27N 3J07A 5D1ZD 4ABVA 4RDBA 4A2LA 1MCIA 4KZEL 3BW9B 1N59B 1KB3A 5KSBF 4XCYA 4DKEH 5E5MB 2N1KA 3HMXL 3DO7B 4L4VA 1SEQL 2VISA 3O45A 3PU7A 4KKAD 5DI8B 5DSCA 1AQKL 1JUFA 1OSPH 1Q8MA 4CILA 3MNMA 1T2XA 2FO4B 3VG0L 1P4BH 3DSNB 2B14A 5JOFB 3VB8A 2A6KA 3IGAA 3TEYA 3LIZL 4XNYH 1ZE3C 5ALCH 4EZLA 3O3EA 1IAKB 1LO2L 5JORB 1IEBB 4X5QA 2FLMA 2QSTA 3OZ9H 1M1SA 1IIKA 4R84A 1R24B 3VD2A 3IPEA 4ZK8A 3QO0A 3RNKB 4G7YH 3ARFB 4L29B 5H2BB 1JGUL 2VMDA 4X6CB 5LDUA 1N8ZB 1ID2A 5AVRB 3DVNA 2FJFA 5F96L 3DIFA 1RZIA 3HAEH 4MCYA 4LSDA 3FUKA 3UMNA 2VDOB 1BZ7A 3BRGC 3D8MA 2M8XA 3ZKXB 1IZJA 3SDXE 4ACPA 3MRKB 1QHPA 1U3NA 2LLGA 1RUML 1G7JB 1TTFA 2KDYA 3G5ZA 4MZ2A 3UP6A 3MKKA 3RWFA 1U95B 4M62L 1K8DB 4PAZA 3ZE1F 1I9IL 1T1YB 4L2YA 2WO4A 3BUBA 2EO7A 3NBNA 1JYNA 3RFRA 3SDDC 3UPAA 2WO3B 1I7UA 5DJ6A 5EU4B 2OMTA 4K3DH 2ZKYA 4MCZB 3VDBA 4M43L 1UGNA 3UTQA 4WUUE 3HFFA 4XR8C 3MUUA 1S78C 2Q6WA 1BAFH 2J20A 3QI9C 1KPVA 2XKSA 2EC8A 5J6GB 2GCYA 1RZKH 2G9KA 1EZVX 2W91A 4PJEA 4R2GD 5FKAA 4ZUSA 2X6VA 3DROA 5EBWB 4NT6A 3S37H 3PNWB 2IXQB 1QQDB 4JDVA 1Y18B 4FHJA 3FH7A 5A6LA 2Z9TA 5DFAA 5IV2B 2VXUL 5JUEH 3V8OA 1ITBB 3ZYJA 4N22A 3GKWH 5E4EC 2PP9A 4NKQB 3U7YH 4PRHB 3ZT7A 4ECNA 3OKKA 5EORL 1FO0B 4YBQC 3TTSA 1H3PH 3V0EA 3LD8B 3WCYA 1A3RL 4OZFA 2J73A 4OLWL 5IHWA 3MLTA 3VWJC 5CEZE 3EFOA 2ID5A 5IQ9A 3QHTC 4OAWA 4OGAD 1P69B 3SKJL 3TIDA 3MA9H 5BUPA 4AEIH 3GPEA 1BZEA 2E27L 3X3FL 1BJ1J 3ILPB 5JQ6H 5K59E 1JNJA 2HJKB 2O5ZH 2UV3A 5KWYC 1UZ6F 3K0WA 4DP0X 3BVTA 4XP4L 3WTUA 5J0BA 2EE3A 3H9YA 4XT1C 2VDKH 4DGVH 4AYMC 1A6AA 1JVOA 4HS3B 4LPXA 4ZO8A 5KAQF 1KYOK 2CBPA 5KVEH 2XSKA 1ZGLB 4LKCA 4DGWC 3ARBC 5I5RA 1A4CA 3UDWA 2VN6A 2PO6B 1TIUA 4UTBH 2FT8A 1EZSA 4ZAKA 4UT6H 5E9NA 1UHVA 2QKIC 1AANA 1JZ5A 1CFMA 1T5XB 2B9AA 3CVHH 5D2LA 1AGFB 2Q7AA 3PXJA 1CVSC 3IJ8A 1MH5A 2D3NA 3APNA 3JVGC 3UBXA 3DGGA 1CR9L 5T1MA 1KTJA 2XPGB 1B3JA 1MG3C 4JJ5B 1UM6H 3KGTA 4XVUD 4OGXL 2AQRA 5F7FA 5E6ID 4C4BA 4GAJL 2DL2A 4WFHD 3VMPA 1LNUB 4LU5L 3CG8A 5DO2C 4RX4D 1F6FB 4AQ1A 3L95A 1EGJL 4U6YB 3A6CH 2XN1A 2PCFA 4FMVA 1MJ8L 1INEL 4PD4K 1O6VA 4WCYH 2HG5A 3I9AA 5CEXA 1FL3B 1MF2L 4YSDA 1MAKA 3E80A 8CGTA 5F9WB 3CDZA 5GZNA 4KO7A 3C8KA 4JRYB 1MI5D 2ERJC 2HUHA 2UUDH 2ZKWA 4L4VD 2R4RH 1RVFL 2AI0H 3TT3H 3ZL4L 1BV8A 3MJGX 5GZOA 4UYPA 2ROYA 1T89A 5C8JA 2CR6A 3D0VB 2NNAA 2ZUYA 5B38B 4UNUA 1CO1A 1PLCA 2Y06H 4WLCA 5FO7B 4X0NA 3OKYA 3FFCA 4BCYA 4IIQC 3MFFB 5TF0A 1J9RA 1ONQB 3WO3B 1KNOB 4FKKA 4K5MA 1MIMH 1NEZB 3LY6A 4L23A 4QHUA 1HX0A 4I2XB 2FX9L 5DR5L 4FULA 3TJHC 3CBRA 4L9LA 2Q7YB 3ZDZB 4JHAL 3H3PL 2QJDA 4OZGF 4OCRH 4G83A 4E9TA 3QW9A 1XGQA 3HG3A 3IDGA 3DETD 5JPNC 4KQ3H 1INQA 3WY2A 2H0PA 4P23B 3RHWF 4W70A 2J8UF 2YQBA 5JOPD 4OFDA 4NKMB 3U83A 2YMTA 2Q7NA 4GUOA 1NBCA 4I77L 1ZT7A 4I1PA 4KZDH 5DJZA 3T2PA 5C0FA 4DN3H 4WI2A 4X6BB 3CK0L 4YHNA 2CLRA 3OQRA 2WVVB 3D25B 1YNTF 1E67A 3MA7A 2F54E 4NRZB 3T2QA 1HIML 5B4MC 3KLAB 3SDAA 5DLML 4FS0A 3RY6C 1F90L 1IEAB 5HHPB 2AJUH 1JBJA 1GOGA 2XQYG 1U8HA 3GS4A 5C09B 4YHIA 1CU4L 1BEXA 5JPMC 5CSZA 4JRLA 1JK8B 3UO1L 3JUZA 3MLVL 2UZYB 4FERA 3B43A 4YDJA 2O6EA 2A83B 2ZWKA 4F2ME 2L04A 1CF1A 1EO7A 2RQEA 3CX5K 1IC5L 3JVFC 5CMAA 5ANHA 2VR6A 1SXAA 4LVHB 1T80A 3WMQA 1TVBA 1RIUL 3C8DA 4X4ME 3O6FB 1TEFA 5FUZL 3SDYH 2SODB 4DESA 2V5YA 4U1NB 4L05A 5D55A 4G6KL 1VERA 2WWOA 4TLTA 3WXWL 1E2WA 2H32A 3N42B 1IBGL 2D9CA 2PNDA 2TSBA 3CVDA 4DO4A 4JKPL 3NFNB 3BAEL 4V2BA 4MGXA 3GEWB 4H2CA 1XD0A 4ZMVA 4JPSA 3U6XA 5EU5A 1UZGA 2A6JB 3SOBL 1TETH 4XP6H 5DVOA 1A02N 3UZVB 1MRCH 1P84J 2NDGA 4XMPH 2VJXA 1FORH 4MD4B 4KXDA 5I76B 1CFVL 4FXLA 4O51B 3KPRA 5HYSA 3BEWB 5KYXB 3WY3A 3F7LA 3EOBA 3TBCA 2R1YB 1UA6H 1RI8A 3DVFA 4HFUL 2IAAC 3DC0A 1K2DA 1MCCA 4L3CA 4MXVE 2F5BH 4GXUN 1ZDSA 4ODUB 1W0YT 1MJJB 4M5YH 4U3HA 4OLYL 4HHAB 4PR5A 2X09A 3TYGL 4BELD 2DM3A 3FONB 2Q8BH 3RGHA 2FGWH 1I4FB 4BJLA 4PMEA 5IIEA 1GZQA 4N2LA 1YHPA 3WXVH 1OAJA 3FB8B 3N40P 1QBLH 4WWKC 4NO5A 1T4KA 4U1JB 1IBDA 4Q9QL 4ES9A 3CZGA 1FNGA 1NCNA 3TASA 2AEPL 2YMXH 4EDXB 1EO8L 1J8RA 1U8LA 4AT6B 4CN4A 3CPLB 5AG8A 3STZA 1AGCA 3IE4A 3KL5A 2XKUA 1UFUA 4JE4B 4HW6A 2AGJL 1WA2X 3O2DL 1U93B 3LKSB 3LKNA 4TNEA 2DKMA 2DOCA 1CLZH 4EN2A 1RZJH 2X88A 3KWWA 3O2WH 1CC3A 2WAQA 1K6QH 4KTGA 4RGNC 5DYOB 1F3RB 2IPTH 4MDJA 1FFOB 3DRTA 4ODWA 3T3PE 5I1LB 1GR7A 3HEIB 1JRHL 1NIFA 3WFBL 1KN4L 3ETBJ 3ZMEA 4XMLL 3GBDA 4JRXB 1MAMH 3GSVA 3ET9F 2QQLL 1EJFA 4LCIL 3RIAK 1BBDL 2QQKL 2UX6A 4GLRI 5JMOC 1YAZA 1GTNA 1AO7D 4LRIC 4PM1A 6PAZA 5GS2H 2UY7B 3P3SA 2VN7A 3QHZH 2EO1A 3RNQA 3AM8A 2ZUXA 4X9IA 3GIVA 5T5NF 3QQDB 4LSTL 2PTTB 4ZFGH 1KGWA 3D2UB 2H0EA 2Q9OA 4Z7WE 3ZHNA 1BG9A 2Z35B 4PP1C 5IMKA 4KX9A 3IB4A 4PCSA 3MNZB 3U1PA 1KYDA 3GZKA 5FGRA 1TYRA 2VDQH 4JX0A 4E42B 1BDYA 1HZLA 4OUUB 1LD9B 1AXTH 3LN5B 4PPTA 3V7MA 5FPIA 1CLVA 5EOTB 3ARDC 1J9CT 1OGAD 3D39E 3FMGL 4LIQH 3RYMA 2Q0ZX 1YN6A 3AABA 3S3SA 2Y0SA 4GAYA 3WOVA 1MW0A 4IM8A 5FHAL 4IRZL 2JKSA 3UBHA 2OXGA 2BVPB 2YD9A 1MCBA 4PG2A 1CQYA 5D1QD 3VXTA 2J5WA 4YBHA 1K3IA 4XPBL 4RISH 1JV2A 2AAVA 3FHQA 1KWGA 4OZIA 1R4XA 3CLFH 4QHLA 5D2NC 5DGQA 2AJZA 4P5SA 1BJ1H 2EILB 3LSOB 2OYMA 1KT2B 4L1BA 3WJJA 3V5HB 3QZMA 3BQUA 3GSQB 2IADA 3CIQA 4JZJB 4AM0B 2ZUVA 1IGYA 4C56E 1E8XA 4PLKD 5DJ8A 3QUZA 2DD8L 1F42A 1MW1A 2ZYIA 3GXNA 5B1JA 1PG7H 4WF7A 5DK2B 5F7AA 3LYRA 3Q1SH 4KJQC 5GRYA 1R9FA 2X9WA 4LLQB 3BZEB 2F1EA 2OMNA 3D0LA 5IB3B 1TFPA 2C1OB 2E56A 4L37A 4Y1AE 1GH7A 3VUAA 3QA3A 4C83B 4GMSH 3WTXA 4HCRL 4X50A 4ZS7L 2BIPA 1AOHA 1GAFH 1Z6JT 2ZCKL 5SWSE 5EF1A 4S1SL 1DVXA 1I82A 3HS0B 1T5WA 4I8DA 4TULH 2PCXA 1ACXA 4ZXBC 1HILB 4LCWE 1F1AA 4HUCA 1H3UA 4TUOA 2JQAA 1NBYB 4HIJA 4Y2OA 1ZOXA 1CDJA 4YBLC 3GZQA 1RZKC 5D7KD 2NCEA 2XZCL 4CC1A 3DHPA 3FPYA 3PL6C 2F8VA 1R5WB 3TA3C 3L08A 5IOPA 2NSXA 4TRPL 2DWXA 1JTPA 1NFIB 1V3KA 4KH9A 4M6OH 1K4DA 1NGQH 2QHRL 2HUEA 4FNLH 3B5GA 3EO9L 5I0ZA 2AHIA 3V8CA 2CUMA 2DQIL 2SEBA 1BAGA 2B15A 2F58H 2E8ZA 1TZHB 5JIMA 5ESAA 4G6AC 3EJZD 1J1OL 4DKAA 1C9SA 3ZDXF 3QXWA 3ASWA 4HFWA 5JLZA 1R3IL 2O1AA 3HMXA 4QRPE 2VERN 4OBRA 3M86A 1DUZB 3UO8B 3FTVA 4P06A 5KVDE 2AQ3A 1PZBA 4P46B 3DVGB 2J1YA 2ZJSL 3M17A 3C6SA 3SPVB 1S5IL 4FJ6A 2XV0A 4BE5A 1OGTB 4DZ8B 4J2QA 2GABA 1W6WA 1Z3GL 3G5XA 3L4VA 1MHHA 5EC2A 4U1KB 2MCG1 4XOEA 2BNRB 4K07A 4AEHL 2XG4B 3QNFA 4U3XA 1PNCA 3MRFB 5JHDB 3TLRA 5K9QG 3HJ0A 2YGNA 5I8KH 2EXWD 5AWNL 2X1OA 4LSSL 4C4KT 1AS6A 5L2KB 3QZWA 3D2TA 4D0DA 3CUPB 1WG3A 3JV4A 3V7AE 3ZBMA 1IUZA 3GK8H 1F18A 4EXKA 2WJ7A 4E5XA 4XB3A 2WXFA 3B34A 1G7QB 3VRJB 1QSEE 1Z9LA 3DGCR 1AGEB 3Q6FB 1DZBA 5AAPA 1AZNA 3QC5X 3OHXB 2J2ZB 1KGCD 4KUCF 5E6ZA 1DQQB 2J5LC 5J4MA 3T6QC 1HH6A 4Y4KC 3ISWA 7PCYA 3KPLB 5EU3A 5EBLA 1RIHL 1GOHA 4BFGA 1NCUA 1DL7L 4UTAL 3C09B 3BSZL 2V2XA 3QT2A 2LAGB 4RH4A 1KJ2A 4A68A 3LNDA 2YRLA 1JGVH 3M1CA 4NENB 1NWOA 1XCXA 4NRXB 1IBYA 3MGTB 2Z6FA 3ARXA 3MLYL 5JYLA 4HV8B 3P73B 2QGBA 4Z7NE 2W88A 3NIGE 2OZ4H 3EG9B 2B16A 4GKSB 3WE1A 1KXQA 2CHZA 4Q6YA 1I1YA 3FTUA 3IDJA 4PY8I 1UXSB 2I9LA 3NCMA 1PKQE 1TG8A 1KCVH 5L4JA 4QKXB 4P5TB 4IU2B 3UCRA 5JXEC 3CZLA 4RZCA 4S2SA 5B38G 3ZU8A 3BPCB 3RTQD 3SKUD 1AP2B 3LRSA 2IWGA 4X7SL 3WO4C 4F58L 3TP4A 3UPCA 3RDTB 2ZOLB 3TNMB 1PU0A 2P8LA 5KSUB 2ZWLT 3LXAA 4KOCA 3UTOA 4UIMB 3MROB 4FQJH 4R8WL 3PQYB 1X5GA 4K3GA 1TQBC 1JZ7A 1NEZG 1ZEAH 5BQ7A 3CSFA 5EU6D 1F8TL 1FUNA 1RK0B 6TAAA 3GMNB 4AL8C 1BBJB 2G2NA 2YD5A 1DO6A 2HFEB 1HL9A 8FABB 3SY0B 1OHZA 1TO4A 1DE4B 4I3SH 1JHTB 1U91B 2VC2B 4A6YL 5EN2A 3UTTE 1JIBA 2CPCA 4RAVA 3ARGA 4KZCA 4GRWH 3C5SA 1LK2A 1CD9B 2AV7A 2LHAA 3WUWG 3T65B 1FZKB 1OF2B 5J3HC 2KHAA 1GS8A 1JVLA 2AQ1A 1DN0B 2JKIS 3RWDB 5FO8A 4FMKA 4I48B 1PEZA 4R0LA 3HLAA 5DCCA 1SGKA 3WNMA 2FHCA 5KG9A 1RK1A 3VXQB 2R0KL 1KWKA 2NQDA 4P57B 3JSSA 4Y0GA 5CBEA 1IGIL 1AZBA 2CLZB 4FLSA 4YEFA 3VD0A 3K2KA 4XVOA 2WZ5A 4A1RA 3NPSB 4MA3B 1IQWL 4YE0A 1JWMA 5CXPA 4N1EA 1D6EA 2DKUA 4WGKA 5DEFB 1DVYA 3AB0B 4O4YH 1QSZA 4OBSA 1LYQA 1ZHBB 3EZ8A 3V0IA 2EDXA 5GGSB 4YSPA 5DS8B 3R7RA 4K9EH 1PG7X 1A7QL 1YUKB 5C0AE 3UTSD 2EECA 4RMVA 2PWHA 1X9LA 4Q9RH 3QUMA 4PI0A 3G04A 3RVVD 1U8IA 3AAZA 1MQKH 2AJSL 3FQRB 3OF6D 2G60H 2R2BB 3OKDA 3UJIL 1P4IL 5HYJB 3QARA 3FUIA 4RGMC 1YUHA 4OZHF 4PJGE 5LGJB 3FQWB 2B5IB 4YDKH 5MEPB 1PS3A 4HG4K 5I8OH 1HH9A 5D1XB 1UWEH 3RX9A 4JDZA 4GQRA 2XRAH 3UADA 2ALWA 4MZIA 1H8NA 4CVZB 3VSUA 4QAWA 2JKRM 2YPKA 5DQ9B 2VQUA 4LBAA 1KLFB 2X6CA 5KS9E 3LPFA 4V1DA 2H2PC 1G6RH 5DZNA 2JJUA 3FYEB 5D7JC 3RGVB 1B2YA 2NCMA 2WIIA 4ZFOB 2D3LA 3DHJA 3FT4B 3JV5A 5G4MA 1C7SA 3CFUA 1UT1A 3LS5L 4O2EA 3U2IA 3V10A 4PRPE 2NUPA 4F9LA 2CJSA 1A25A 3T0BA 2R0ZH 1TXKA 3T0VA 1OV8A 1NMCC 2DPKA 5TE6L 1HYRC 4RMUA 1HCYA 3N1MC 1A21A 1XO8A 4N0FB 5F3HB 2NR6D 4UBDD 3C12A 5KZCD 3SCMA 1CPUA 5C9KA 1L5GA 2AK4B 4G80B 3IRCA 2GBVA 1ZT4A 2XG5B 3WD5H 1MZYA 2DLHA 1O7SA 4PW4A 1P6FA 2Y7QA 4RFNB 4JPWH 5A7BA 2JH2A 5A6MA 2C9AA 1II4E 4X98B 3IPFA 1QRNE 4M56A 4ENEC 1M9SA 4UQ9A 1TQSA 1HNGA 4WKZA 3BXNB 5F3BA 3DXAE 3Q2NA 1T0OA 3BZFB 3HMWL 1HEZB 4F37F 1VIWA 1YEEL 1EZVY 2FIKA 3DO4A 4M5TA 1X4XA 4KJPD 1RZJC 4UM9D 1OSEA 3O9WB 5EF0A 1S9WB 5CN1A 4GBXA 5K9QI 3DJSA 3HB3C 4JPKL 5AW7B 3DX1A 4LLMA 2QPUA 1OP5H 3E9TA 2K9UA 2YSTA 3GRWL 3MACH 3KPPA 2VCOA 3DX6B 4M9PA 3BIKB 1GIGH 1P7QD 5FS5A 4O9HH 1NDGB 4XX1E 1KFGA 1M6UA 1JGDA 1U92B 4H88L 1AXSB 1LP9A 3IFLH 3VFUA 1X5HA 2Z31C 1GKOA 5FGBA 1OCWL 4OIIH 3B9KB 3FZUC 4DK6A 3SYAA 2FJHB 4HX1B 3ZT6A 4I5BA 2WCSA 4N0CD 1N3NB 1G7PB 2C26A 1EUTA 2YXWA 1A7BA 4ZMTA 2RALA 4BUGA 3TNNB 3NZ8A 2YUVA 3VCLA 2H8PB 1T83C 3FNKA 3V4PA 5B7FA 1VKXB 5IMLB 1ND0B 3QR2A 4UF7C 5A2IH 5E8EA 1RPUA 5BZDB 4FJZA 3CSGA 5T3XD 4EIBA 4J3OF 1NAMH 4DN4H 1UC6A 2XXGA 3GMQA 3BEVA 2R29L 1G1YA 3BD3A 1XXDC 4Z7UF 5HYEA 3QUXC 4JFPA 1XR9B 4PB9H 1JXFA 5D7IB 3AFLA 3WNKA 3UGEA 4NQCE 1NC2D 3V4LA 2N7AA 3HPJA 5GRZA 4NERA 3U6XS 4X6DE 3KPSA 1DBBH 1G9NH 2VR9A 3A6OA 4DZBB 2EO9A 1URLA 2Q1EA 4ISVB 4GKZA 43CAA 1B9ZA 1MWAH 2R1XB 3QDGB 5I1DB 3DX9B 5CGYD 2EZ0C 3MUGB 3I2CL 2BH0A 3CBJB 4R5TA 3UZEA 3V9FA 2QDWA 5FYLH 4TSBH 2CR3A 2W0PA 2X05A 2WQWA 2AJ3B 4WWNA 2UY6A 2QVFB 5I8EB 5JDSB 4HDIA 2XDHA 3OXSA 3EJQA 4KV5F 1QD0A 5F7BA 1JNLL 1F4YL 1GOFA 5JZ7D 5B7EA 3O2DA 4PGDB 4G3YL 2Q76B 5AZEL 1KJ2H 4FFZH 3REWB 1YNTA 4NHUA 2Y6TE 5I17A 3TV3H 3CXHJ 4LLAA 1UWGH 2JB6A 5IHZB 5JO5A 5DRZA 2E7MA 3L3DB 3OAUL 1LEGA 1F4HA 2ZCLH 3MV8A 4P2CG 4XOAA 4Y5YC 1CLCA 1Q9WB 3RWJB 4JGUA 3X17A 4PJDB 4DUVA 4UI2A 2JIXA 5EO1B 2DB8A 4XI5D 5GS0H 2ARJQ 4G9FD 4X7TA 5DJ0A 3FCGA 3D3VE 2VLJB 2HN7A 5C0CA 3CN1A 3HE7D 1EJOH 4KKBD 1HSBA 2VXQL 4UQEA 4PV8A 3B3IB 4PRBB 3F58L 3QNYA 5F93C 3QI9B 4B0MB 1TJXA 2Z4QB 3FFDB 1AQDB 2Q8AH 4UQAA 1DANU 1V7NH 2HVKB 1QOKA 2IMNA 1E7VA 4AGMA 3FO0H 7TAAA 2YUWA 3LRHA 1TMCB 2Z7UA 4MS8C 2YEQA 3FQXB 3R18A 3QDMD 3EJPA 1TDQA 3HZMA 3DKHA 4H8HA 5CEYA 4TLKA 5B3JF 1NGPH 4NPYA 4QR7A 4Y4HC 2OA9A 2VW4A 1FYHB 1IB5A 3MJ6A 5L9DH 2ZQKA 1DEEA 1OB1B 3L3JB 1SN0A 2R0LL 4IRZA 1RURH 1MVUB 3IKCA 4IRSA 3ABKB 4KKNA 3ZZ1A 3I6LE 2R9HD 5E2WL 3RU8L 1OCRB 1R3JA 2VDLH 3U6RA 4GKOA 5CJ8A 3I02A 4B9PA 4RWYH 5IB5A 4GAGL 3T0EA 4QRAA 1MFEH 5JA8B 2HXAA 4YDIH 1YEWA 3FB6B 4NWTL 3ZYOA 5DUBB 4LQFH 3ZKND 1X5ZA 2QLYA 5SX5H 1ZGLP 1KGIA 2V5TA 1S8DB 3BVXA 1NJ9B 1CD1B 1SHXA 2XN9A 4YHOH 4AQ8A 2XZZA 3D50A 3II2A 1IAIM 1CL7L 3KXFA 1U8KA 3GXFA 3IETA 4U1SA 5HHVH 4UQIM 1HQ4B 2YO3A 2XCMC 4ZUUB 1TVDA 3AXIA 5TE7H 4MB1A 2ZPKL 1U4FA 1QHOA 4GRMA 2IFFH 4G9DB 1DQML 1QLFB 3ARBB 5A3IC 2D3VA 3VE0A 5HI5C 5F7DB 2F1BA 2CGYA 3SO3B 5HYQA 1KJMB 5CNHA 2YXFA 1XTMA 3N44B 5IJKC 1DJSA 3KWTA 4HJGA 3ZDYB 3C6LA 4LMQE 5AL8A 4QTHA 2DYPB 4JFWA 4WV1A 1J5HA 4H8QA 4YXHL 2OULB 1F13A 2QHLA 4F9PA 1BZQK 3H42L 4EDWH 1A9BA 2ZD0A 2PABA 3AU0A 3RL2B 1OARH 5IESH 3UAJD 5K9OB 4F24A 4HXBH 5D7LE 3BYYA 3WHXA 3ELQA 2E4FA 3HBZA 3CFDB 3QIBA 3DUSA 4X8JA 5J13C 1QI5A 2WOBA 3RUGE 3D69B 2ENPA 3N50A 1B4JH 5IHUH 2J71A 4DEPB 3QDJA 3U0PA 3CHSA 1W72A 4GKLA 3LDBC 4HAGA 3LZPA 5AW2B 1MFMA 5DMGD 2EDRA 4HLEA 3FUFA 5HPMB 1U58A 3E6HB 3U36B 4UOJA 3KPSD 3PDOB 1CTMA 2M26A 3HN3A 2ERJB 3IMVA 3LZFH 1Z3RA 1YG9A 2OJEB 2NRDA 4QT5A 2C3HA 4MJIE 1ZA6B 2EDYA 3VA6A 1FL5A 4S0SD 1BEYH 1JCVA 5GSRB 2VUOA 4D0CA 4MNQB 5EOCL 3TJEH 4MMXB 1P2CA 4PREA 3LHPH 1JMXA 4HEME 4R3SB 2Y9RT 4HBCH 5AW1B 4YHLH 1GA2A 2XQBH 2QGCA 4UINL 5CU5A 3BGAA 3ZL2A 3QUYD 4JW3A 1QA9A 1B9KA 4IIQB 3TC9A 1EHXA 4Q52A 1BM3H 1FL6A 3O4LB 2BWQA 4Q89A 3X1FA 4AGPA 2G5RA 3CC5B 2DI8A 3CHOA 3TWCL 3KG5A 1QUNB 5EOQH 5AD0A 5HI3C 4WJ5A 5FHBL 2B3RA 2R15A 1ZLWK 2WPGA 1JCKA 1Q9KB 1SLXA 4PJIF 4JKKA 5EUKA 4JN1H 1XV8A 5T3ZH 3ZR6A 1SXZA 1F11A 2MCMA 4AH2B 4OVUA 1S7QA 1QBMH 2ATKA 5GGTL 3FSWA 5E2VH 2W9EL 2ZYSA 4URTB 4PP2A 4BSJA 4FCHA 5GQBA 4LOUD 4K9EC 3V6BR 5DHVH 3WJMB 2O6DA 2YEVB 1FDLL 2BVUA 2HFTA 2GIMA 4QCIB 4UTAA 3BSZA 3S5LB 3HG1D 4G8EA 2GUOB 4NFCA 3RIFK 3EYFA 1WAPA 2L7EA 2CKNA 2GI0A 4IBZA 4U4IA 5DRWB 4WY7L 1RZ8A 2BIOA 4R7NB 1J8HA 2DMBA 2HJFA 1I8UA 1IM9B 2BSSA 2ESVE 2KKQA 2P5ED 5B1KA 1BYOA 1YEJL 3H6JA 4IHBA 1NBZA 3ABGA 3LKPA 4NM8H 5FYKH 5IVXF 3W9EB 1XGUA 3OJ2C 2X1WL 4D8PA 2Y5EA 2BFVL 3VI3F 4KQ4H 1T1WB 5I1JL 4HLJA 4D9RE 4Z7VE 5LCVL 4GQQA 5JPMB 4X6EA 1KIUA 2VR7A 3JTSB 4TKWA 3VWKC 2RR3A 5KSVB 3KYMB 4KJYB 3S97C 3BT2H 1FHNA 1UA7A 4XTRC 5D9SA 3VXNA 4A2EA 1H15A 4DK5A 5AQ0A 1K72A 2WBJC 3HA0A 4XWOD 4L4TE 4NSKA 4Z23A 3O2VH 5IQNA 3G6DH 4RSYA 4J4PA 1HHGB 4BFOA 1CICC 5E2UH 3UPRA 2CGRH 1AC0A 3UYPA 1XWVA 4HVBA 1QEWA 5CZKA 4OLUL 4UDUA 1A22B 4K5PA 5HYIA 4A6YA 4LESA 3BQUC 1P1ZA 3H0TB 2Q10A 1VGEL 2IAMC 1I3GH 3FO1B 3RKDC 4X6CF 3S8FB 3KXFD 3RVWC 5FO9B 4XC1H 4K94L 3HZYB 1ZV2A 3QPKA 1UJ3B 4PG9A 2DQUH 2HZHA 3GJFB 3I84A 4NNYB 3Q43A 3H53A 4N8VA 1ICTA 3VXRE 1S7XA 5TQ2H 2FO8A 1EDQA 3QISA 1XB6A 3PWJA 2BSEA 3DJRA 4HWBL 3KAAA 4ZSOA 1Q1JL 2EIDA 4WTZA 1E3ZA 2I24N 3VD9A 2G9HB 3ASNB 4JFYB 4OGYH 4WWKB 2BNUB 3FTSA 3C6LD 4GRLB 4N2AA 4XPHH 1NDMB 1HWHB 4OCNC 3Q48A 1BGXH 2VW7A 4YHPA 1SXCA 4P07A 1UM4H 3GHEL 5GSVB 3GPSA 4ELKB 1CFBA 2OTPA 3GNMH 3QB7C 5IROA 4PJAB 4CUCA 3T3MB 4YSUA 3GGWB 4UMGA 4B9JA 3DX3A 4DPAX 3ECQA 2JMRA 3MODL 1L9QA 3AVEA 4RGNB 1YMMB 1IQDB 4K3EH 3UABA 3EAKA 1B0GA 2FR4A 1DJIA 3MBXL 1AGBB 3ZZLA 2YD8A 4NQEB 5HHNA 4HUXA 3HZVB 1N67A 4B6ZA 1AIFA 4FYRA 4H8WH 3B2UC 3I9PA 4N2IA 4Z3GA 2XZAL 4FG6D 5C08B 5I1GH 1ZKAA 1SYVA 2V3FA 4X4YA 3WN5A 3P0VH 2Y7SA 3A67H 2F19L 5E24E 4UQ3A 12E8H 1KTCA 4HKZA 2CBOA 2PKDA 5DVMA 2MOQA 3BH8B 5AUMB 2XWBB 1PBYA 1RHHB 1KCLA 3D34A 4XCNB 5T5FL 3ESPA 1E9OA 1DJHA 1KF9B 4HZLB 3VM5A 1S7VA 2DEXX 1TPXB 5DD3L 2FJUB 1BHGA 4OCMC 3ARED 4PGEA 2X4RB 4P2QA 1E8ZA 3EGSB 4Y1SA 1U3HC 3EXLA 5F7UA 3KBPA 4N28A 1GGCH 1NIEA 1G9NC 4F7CB 2NY2D 2VDMH 1SMDA 3D05A 1MFDL 5KN5B 2WNWA 2C7UA 1KY6A 1OOWA 2F7OA 3WFCH 3ARDB 3VDCA 2X41A 4DF9A 4ZPTB 5I0YA 4CADB 3CMOH 4X4ZA 2FL5B 2GJ6B 3UYOD 3R0MA 3QR1A 2VDOL 4IMLB 4XOBA 1K4CA 4FLHA 2RCSL 4JUSA 5AKVA 4PJHE 3FQUA 1ZV9A 3QG6B 4ETQA 1EBPA 4XODA 4IKJA 1SM3H 1MY5A 3HI5L 3KVDD 4DFIA 4WW1A 4HK3N 2F53B 2VDRB 1DVFC 3ZE0E 3UC0H 2P52A 2FZ3A 4IHOB 4RBPH 5F71A 4C57C 2MKWA 3PGFH 4YJZL 4AC2A 5C2BH 2K4WA 3PHAA 5GS1C 2R2CA 3PUCA 4JLRA 1T6VN 2R27A 3DJTA 4Y5XA 1QUPA 3EHBC 3HCVA 5HJ3A 3SQBA 3H9SA 3EFDH 1QLEL 4X5RA 3MJ7A 3IPBA 1NCJA 5DWUL 4PRNB 4OZHA 2ZF8A 3JWOH 3VACA 4KK5C 5GS0C 4QXTA 1KBKA 2HLAB 1EDYA 5ADPL 4WI9A 3VXSE 1SY6L 1W72H 4KXZH 5MENA 3KYKL 4JR9L 3QRLA 5FOJA 3QQ4B 3EO1A 2IPUG 1GW6A 4WNSA 4ZXBB 1T1XB 2GYSA 1CTOA 3ESUF 3CLEH 4PY7A 4YBLB 4JFHE 3IMRA 2YKLL 3LX9A 3PL6B 4LB8A 3DI3B 4HBQA 3BKMH 4JG9A 3TA3B 3ZHLA 3C9NA 1QABA 2WVSA 5FM8A 3CNKA 1YECL 4MQ7A 1MHEB 5DC2A 5KVGE 1KULA 2E6PA 4MMYB 4F8NA 1JXDA 2QQQA 4JFFD 1Z5LB 2VITB 3CVIH 4IRJA 2WLJA 5C0NC 1NGWB 4I0PA 2NY4D 2ZAGA 4Z0BL 2G4GA 4FFWC 4Q74A 2HRPL 1UGKA 5IB4A 4LGRB 4F7KA 1NCBH 4DH2A 5DJDA 1SEBB 4TTGA 2DLFL 2PP8A 2IANB 4NJAH 4XAKD 5ADOL 2OK0H 2X2HA 2WWKO 2Y2TA 1CI3M 2VR3A 3BWUC 2AQ2A 5DD6A 3QZPA 3ZDZF 5G5DA 3CXFA 3CZUB 5E2JA 4C4UA 1QO3B 2LABA 3BGFB 3KE0A 1CE1L 2GEQA 4FQHB 1X9UA 1Z9PA 4OT1H 2IEPA 2BMKA 4Y19E 4IEFA 3NZHH 4R4BA 3B8YA 3QO1B 1X7QB 1IGJB 1AD9B 4YZFF 4XN1A 3NCWA 3LKRA 4JMNA 1EFQA 3T6VA 4YXLL 1S6NA 1JZEA 1OK8A 5DMYA 1NFDE 1JI1A 5INDB 1AHWA 4Y5VC 1NIAA 4LCCA 3C08L 3LTVA 4DOHE 1NCWL 3QQNA 4Y7OC 2P4AB 1UB5B 2XPZA 4KXCA 3SQOL 4ZFZB 3BE1L 5LBSH 1DDHB 4L8BA 3ZRCC 1AFVH 3CVHB 3AROA 4UT9H 2NW3B 2PXYA 2V2TA 3G6JE 1IBZA 3P1VA 4R4ND 4PWJA 4UB0L 5J06A 4FG0A 2LGNA 2VE6A 2K0RA 2VXQA 5K9JL 5A2CA 4AM0Q 1H19A 3V6OA 3MUJA 4Y8AA 4MVBC 4E9RA 3N42F 3NEXA 2FEDD 2Q2LA 1KZYA 2ZWNA 1O9VA 3OQ3B 3HI6L 3EGDB 4P2QD 3JWDC 4F9LC 3L81A 4M6ML 1UQSA 3RG1C 4FKHA 3ZVVA 1MI5E 1IARB 4L4VE 2EABA 3RVTC 1F6AA 2JB5L 4WEMB 5ILTH 1T2QH 3CXDL 4F7MA 4ZX3A 2G75B 3WNIA 2WLHA 2PPDA 4M93B 4FP8L 5EH1A 2A74A 1DVSA 2QL1A 5CWSB 4LVOC 2QSCL 2IBZX 4XN9A 5D5MB 1TQBB 2WKLA 1C8PA 4AKPA 3QPXL 3S96B 4WUUB 4ABUA 1AGDB 5TQ0L 5DQJA 3W9DA 5IFAH 2NTSP 1MEXL 2X40A 3IDIB 3MYJB 3T4YB 3X1BA 3NQIA 3M45A 1EVTC 4GKNA 1ACCA 3GMRB 3AG2B 1MCOH 3HIZA 2ZOKB 3OMAB 4B9KC 4GBXC 4HIXH 4KDTC 4DKFL 3H9ZA 2WB7A 4KMTH 2ICEA 4ZTOL 5D6DA 4ZMWA 2P9RA 1XGPB 2XBTA 3OR6A 3S5LG 5T1KA 3WDHA 4YHKH 3NTCL 1O9ZA 3SGDI 4D8OA 4HPHA 2IH1A 3TVMC 4KROD 4TVUA 3WL9B 2XYCA 1UUNA 1DEDA 3GZPA 4LHUD 4NAMA 5MEQB 3CDYA 2GSIB 3RX8A 1O6SA 2MKLC 2B8OT 2V3DA 1X9QA 1LWRA 4WHDA 3FU8A 2IWFA 4BBWA 3KM1A 3HNSL 3S34H 1F1DA 3NH7L 2N59A 3CC1A 4X4KA 2AK1H 1DDTA 3Q5YA 5ESQB 4PJEE 2H9GA 1UKSA 3WS3A 4HOXA 3MJ9H 3US0A 1W15A 2CDGA 3KPTA 4Y16A 4BFBD 3VXMD 4M7JL 3IDUA 1QFWI 4I1NB 3IK2A 4I9WD 3U7WL 1R3LB 1KB5A 2QADD 2V7HA 3SDCA 4NRYB 2XXCB 4QRRA 2H6UA 3K72A 2XXMB 2H3NA 4RGMB 4MA8L 3EJUA 3RAJL 1QTSA 1S9KC 4I0PD 4W4OC 1U8MA 4XBPB 1L0QA 2F6AA 1ASQA 3BPLB 5DK3A 4ZBJA 2DMCA 4JDEA 3ZO9A 3QUKB 1MDTA 1IGFH 1KCSH 3FOLA 1EBAA 5ICYB 3OAZH 4G6FD 1YZZA 1MPAH 2HLFD 3C5ZA 3QQXA 4KJWC 4CMHC 4M03A 4HD5A 2YD0A 3DX8B 5D7JB 1KIPB 4P3WA 1N5YH 4JFDA 4R9HA 4B3VA 2NY3B 1FFNB 2FX7L 3L1OH 1HKLL 2RA1A 1QPXA 3WKML 3MUY1 4HOWA 3MO1A 1NUFA 1Y6KR 3VG9C 4R4FH 2DQCH 5GISL 4PMFA 3ETTA 3NN8A 3ESOA 4NUGH 5FX3A 4H26A 1NMCB 1VFUA 3SKNB 4N0UA 4XXCC 3V4UH 4ANUA 4MXWL 3QJOA 1ORSB 2NY5L 2F0CA 1Y7VA 1ZPLA 5I26A 2K6ZA 3ZKSD 3MU3A 4L1DA 4JM2C 4YPGB 3PWVA 4CU8A 4Q4IA 2ADFH 2VRKA 1QBAA 4F7EB 3Q3GA 1BMWA 1PYWB 3P9WB 2ADJA 2WXMA 4O2CA 4M9OA 4XP5H 1EAQA 3TO4B 1JPFA 3CSYA 2VXSL 2HJLA 1BD2D 3MLZH 3MBEC 2EXSA 2CM5A 4FFVC 1DQLL 4IBLT 1MHCB 4ZD3H 5IUCA 1N8OE 1AS8A 3R06B 4U6HA 5MERA 3BAJA 1D5XA 4PS3A 1TUPA 2JQZA 5E6YA 1OQOA 3OX8B 2DQDL 2G3MA 3OWRA 3K6IA 5E5LA 4P4KD 1WYJA 3B6SB 3AG1B 2CK0L 4IKKA 4G7SB 4WO0A 3GBLA 4YC2C 3QCUL 3L1EA 1N4XH 2NLJA 1DBKL 5EIIB 5LCVA 4F2FA 4Y2DA 4N0YH 5AVWB 3WJLC 4NN7C 2Z7ZA 3B2VL 1AO7E 1YQVH 3NJVA 1FZMA 2CO6A 4XB8A 1J48A 3W0WD 3FT1A 2Z31B 5I16A 1N0XH 1T21B 4MZ3A 4TSAL 2WUBL 1YEGL 4H5SA 4OTXL 2DQEH 5CGMA 4C55A 5IVOA 3S88L 5KYUB 4IRSC 4U7MA 2MPVA 4X7DC 4A7UA 2ZOTA 3KLHC 2YQGA 1E6OL 5DC0A 3FFCE 2R0WH 2CHDA 3BO8B 4Z7OE 4OFPA 1IO4C 4ZX4A 1BXUA 1Y1DA 3TBWA 4NZ8A 1U8PB 2Q3ZA 1KXVA 2IG2H 2C7FA 4AK1A 4AQ8C 1CGYA 4XC3H 2ARJA 4BFRA 3IJ7A 3RWEA 3REVA 1NGYB 5TE4L 3VNYA 3WEXB 2I5YH 3IDNA 3E6FB 5T1LB 5K5YA 2BXYA 3OZKA 1MJ7H 5D1QE 1P5VB 5I6LA 3WN6A 3Q01A 1Y1UA 1M7DB 3EJJX 1WBXA 2NY7L 4PS8A 2EIZB 1FPTL 4F2MB 2X44D 5C0JA 2ICWJ 1JF5A 4Q6IB 2FE0A 1OD7A 1JXGA 2BHUA 4KKQA 3S3CB 4OFYD 4IDJL 2QMKA 4HWBA 3T4AC 4M1GL 4HYTB 1FAIH 1XVSA 2W07A 1XAUA 4JG0L 1D5BA 5L4FA 3MLPA 3O4LD 4KTDL 5CJQL 3WU1A 1AQMA 4TOYL 4ORGA 4PVLA 5FUOH 5BUAA 1W0WB 3FN3A 3SODB 2WQ8A 1E5ZA 3P4MA 1S7UA 4WO4D 4Y16D 2DQJH 2FNWA 3HR5A 5LN8A 5ISZD 5D4QA 4DGIL 2JKNA 4QRRD 3VRIB 2ZAIA 3JWOC 2Y2YA 4M1DH 4N2BA 3LV3B 2E9GA 4PYGA 5D7EA 1RD6A 1DUYB 1A1NB 2BY1A 1X6LA 4J3OH 1QG3A 3L5JA 3OKLA 4Y5YB 1K8IA 4H4NA 5DJXA 4AZ8B 5KYNA 1GYUA 1XSJA 3JTBA 2A6DB 4JFOB 3F3HA 1HE8A 1LVEA 3K3QA 5D7KE 3RL1B 5EF2A 6FABH 1G1OA 3BW9A 3II3A 3PFUA 1WFMA 4FXGC 4F7PB 3C5ZD 3TBSB 5E5MA 1C1EH 1KTLB 3QG7H 5F7LB 3TH2T 3HE6D 2HFGH 1NMAL 4JFDD 4M3JA 4D3CL 4IK6A 3U4BH 2GIXA 5GIRB 1S3RA 2GSGA 1XT5A 3PDDA 2FO4A 3HC3L 1FNEB 3DSNA 4TQEH 3HRZA 5JOFA 2APWA 3N2JA 5I1CL 3WGUB 1LEIB 5AW3B 1VJSA 3F7QA 3GSNL 4FXTA 4OU3A 1QSFD 1IAKA 5JORA 1IEBA 4H8VA 1RFDL 2CLVB 2YIHA 1R24A 3HNTL 1UXWA 4HISA 3RNKA 4L29A 3ARFA 5H2BA 1XL6A 4PJ9C 3W2DL 3O8XD 4BH7B 1OCOB 2YD6A 5DD1H 4BKSC 4X6CA 1ACZA 4PRIB 1JZDC 1ZVNA 2ZXAA 4FJYA 4Y4HB 4JVUA 3D9AL 4F8TA 5DHMC 5E08H 2X2JA 2XQ0A 3I85A 1NCOA 1WZ1H 2FCBA 3CFJA 3D87B 1D6VH 1F4WH 1EX0A 2YD3A 4BQ8A 5MP6L 3PV6B 4UQDA 1BLNB 2FUTA 4AI7A 1ZXQA 2D2CC 2WBKA 2DV6A 1G7JA 3GI9L 1A6WH 1M2VB 2KQNA 4YE4H 2VSKB 1K8DA 2IQ9L 1T1YA 3BPNB 5KSAC 1WZLA 4LVNB 1MDAA 4WFED 2CJTA 4A7TA 2YUXA 1WA1X 5AVVB 3CDGB 5EIQA 2WCGA 3UXFA 3L4YA 5EU4A 4M4RB 4Z7WB 3I50H 1VPOH 3WV0A 4AEEA 4WRLA 2OR9H 1IIIA 2VYRE 4PJ7E 3QJRB 5C0BD 3KYNB 3B9VA 1YC7A 2BCKB 4KKAC 4YR6B 1Y6NR 1KGCE 1N7ML 2FJGB 2XA8H 2PW1B 1VFBB 2XV3A 1OT4A 4P8QA 1KB5H 5J6GA 3U0WL 4ZG1A 3RZCB 3D39B 2ISDA 3MJWA 4KGJA 5GGQH 4KO5A 5I66B 3EGXB 2NSQA 1SY6A 1WE5A 4XRCA 3FSOA 2A73B 3EZJB 5EBWA 5E2TH 5EU7C 3CH1B 5I0WA 1KEML 2DMKA 5FV2A 2JELL 3PNWA 2DQGH 4N5ED 1QQDA 2OJZH 1TZGL 3PWLB 1BXXA 5B1AB 3UG5A 5CJXC 5DK0B 4I89A 1HNYA 3M8OH 5IV2A 2OPCA 4MCNA 2XNAB 4U1GC 3BP7B 4UNVA 5IHLB 3FT0A 4OH2A 3QXAB 3NEEA 4JAMB 4OKDA 5AAWC 3LPOA 4QAMB 5CCJA 2BINA 3H1ZA 1OLLA 4ONFH 4NBXB 1G7IB 3QRGH 4ODHH 3HZKB 5I82A 4D0BB 3HC4L 3MJ8B 2WZPA 5CJOH 1HXYB 5M94B 2Y1VA 4O02L 2BOLA 3D33A 4JPQA 4Z3IA 5I5IA 2VLLB 4ELMA 5IBTL 5L6YH 1ODUA 2FSEB 4FNSA 3WENA 3OKEA 4QTIH 3ILPA 5KVFE 4WDIB 5DTFB 4Y1AB 3DX0A 2E7LA 1MKFA 3DJ9A 2HJKA 4HF5H 4FQXC 3B7YA 3R8QA 5SWSB 4OZIE 3RVXD 1CIDA 1M05B 4AWJC 1U36A 1E4XH 4FOMA 1I8IA 2XN2A 1OSZB 5BO0D 1NEPA 1OAZL 4AJ0A 1HESA 5BXFB 3TTYA 1K9TA 3BVNB 1WDAA 4R2GC 2ATPB 2VMJA 2PO6A 2BERA 2V9TA 3GFUA 2L7UA 3I3DA 3MLUL 5FYJH 3F7VA 1HAWA 2JJSC 4JQVC 1T5XA 2WXIA 2V9RA 2KYIA 4N8CL 3VFGH 2UZXA 4HCIA 3T1FB 3VFRB 1TQTA 2PYFB 4QHNB 4R83A 2E9BA 5C0EB 3IDXL 1IAIH 4PB0L 2LE9A 2VLKD 2XPGA 4MD5B 5TGBB 4JJ5A 4TVPH 3UJJL 4FHKA 4NZUL 2CKBB 1XSIA 4QRPB 2HWZL 4L8CB 2KL6A 3IMSA 3LH2H 3QH3B 1I85A 5EO9A 4LLWA 3NFSL 1E30A 5BO1L 4U6YA 2DWDB 1KUMA 2F53D 4K3JH 4TPRL 4ZOAA 5HJBA 3VSVA 4EZMA 5HBBA 1B6UA 3UTSE 3L3GB 5AKTA 4NO3B 5E7BA 3VTTA 3WN5C 4AQEB 4BZ1L 3MV7D 3FCBA 3RWHB 3MBWB 1DLFL 3MXVH 3AMKA 1IM3B 1JPTH 3P0YH 5F7MC 2GBAA 3ULVL 2OYPA 2A9MH 4K7PL 3GBMH 3MMEA 1TJIH 3KNBB 4B9YA 5CF3A 4QO1A 1I3UA 1CBJA 5EA0L 3V9EA 1TZIA 1H5BC 5TDOB 5E94B 3Q8AA 4TXVB 3VJ6A 4IQHA 1FRGH 4DHLA 1ADQL 4B60A 1JZFA 5ERWB 1I9EA 4XCCL 5E4AA 5KJ7E 4KHXH 1W8OA 2A1WH 4LDOB 2E7BA 5EZOH 1CLYH 5B38A 1WICA 5GJSH 3EJSA 4K4KA 3WIAA 1QSEB 5FO7A 1F4XH 5ID0B 5D7IF 1XGTB 3VWKB 4RCAA 2W60B 4QRSB 3MFFA 4NDMA 4P05A 1E65A 4PUBH 3GO1H 2CIIB 1TJMA 4OV6F 3VGGA 2DIBA 3QXVA 4P2OD 4WTWA 4I2XA 4NX0A 1D9KD 2P49B 5IT2H 2CO4A 3BPOC 4KRPD 4XVUC 3RPIA 2Q7YA 4FNRA 1J0KA 5E6IC 1WHPA 3ULUL 3BDBA 3SBRA 1YEDB 7FABL 1CICB 3A6BH 2UZIH 3N41B 1QFWM 1E2VA 4OFKA 4F15B 2WGNB 1VHPA 1XCTB 1Y0LB 4KDVA 4ZO7A 2QTEA 3WUWA 5JOEA 1OHQA 3JWNH 5IMOB 5DVKA 1FIGH 3OB0H 4UM8B 3U1SL 2O26U 3D85D 3A5VA 3N91A 4Z7NB 5D71L 1GL4B 3NIGB 2PP7A 3O0RH 4DKDC 3FO9B 3SE4C 2E7DA 4MQSB 3QIWC 4LDEB 1G9EA 3RA7L 1PKQB 2HTLD 4UQBA 4J3WA 3K2UL 4X9GA 4NWUH 3TN0A 5DUJA 3L7EA 5G2NA 4NRZA 1Z5HA 5K9KB 4WSGA 3N1PC 3SD5A 4UU9B 4JCLA 3QORA 3BIBX 4U0RC 3KLAA 1UZ8B 3LHAA 2CO1A 1IEAA 2WTRB 5HHPA 2JI3A 3PHOA 1ORQB 5C09A 2ICES 1NKGA 3AS0A 1JK8A 3MGOB 1NBVL 4PJDF 1EA9C 2VM4A 4QRFA 1I1AC 4C8XA 2ZUUA 1ZAGA 5EFIB 2A83A 2C9SA 1CBVL 5EIIG 4YIQB 4YO0B 2G2RB 2WM0A 2H1LM 2YC1B 3P30H 4L8DB 2BY3A 4UAHA 1KXQE 3TWYA 1MOEA 3UTTB 4DEUA 1OT2A 5DFVD 4XMZA 1J1PL 1S9VB 1A7RL 4LP4A 3ZYZA 4YHZL 4A7SA 3NCFB 1X6NA 3V0HA 3DETC 1EHLH 3CZNA 4P4RB 1XXFC 4LASL 4GMTL 1H8SA 3EUDA 3AXLA 5E7FA 3NEOA 2EDTA 3OJVC 4NO2B 4RDQG 2EQDA 3MREB 4AYEC 5I76A 2E59A 2WJ5A 4O51A 4AK2A 1CGSH 2ORBL 5KYXA 4J3SA 5LQBH 1M7XA 4N2HA 4BWUA 4XNDA 3MLSH 1VESA 4N2OA 1AXIB 2FBJL 2XN0A 1MJJA 3GSXB 2FHBA 3IU3A 1ZVHA 5C6TH 4HHAA 4XWGL 3FONA 5DS1A 3SKOB 1I4FA 5DRNB 2YD1A 2GK0A 3FB8A 1KN2L 3B5HA 2PN5A 4U1JA 2YHGA 2G5BA 3TF7C 3TZVA 4ACTA 3V4VL 4PJGB 3CZKA 4M00A 4ZMNA 4WHCA 3EJRA 1PFOA 1V55B 1AHWC 2XWJB 2BSRB 3UAEA 1UWXH 3HG2A 5I1HL 1SVCP 4I1RA 2PPCA 3ZE1E 1A64A 4FZ8H 4FABH 5BVPL 3LKSA 1E4WL 2F8IA 3PGDA 3MRCB 3VG0H 2VMCA 3EDJA 3GIZH 4D9LL 4YX2H 3ARZA 5KS9B 1FFOA 4YXKL 5I1LA 2XY2A 1FVDB 1LO3L 4G70B 5E1AB 2P80A 4MAYD 3ROLB 3N44F 4DW2H 3BGMA 1QFWL 4OJFH 4LF3A 1MCLA 5EUOA 5FECA 4L3FA 3ZDYF 1R6VA 2OTWB 4KZ0A 3H85A 2ZXWB 4BKTC 2MNUA 1D5ZA 1W2KT 2B1OA 4PRPB 5LNEA 4OD1L 3T09A 1GRWA 3Q8FA 1C08A 1JF1A 2MCPL 1TJHH 2ZUTA 5GS1B 4J3UA 4NPJA 5LGHH 4OSUL 3L4ZA 1RZGB 4JBSA 2P24A 4XNMA 2AEWA 3ABMB 4J3OC 4TNFA 4EUPH 3QQDA 5AW6B 1FO0H 1Z9SB 1RCYA 1IKFL 2EXYD 3D2UA 2Z35A 4JKNA 3ZKMD 5KEZA 4GQ9H 2PYEB 1I9IH 3K2MC 1QR4A 1NC4B 2DBLH 2D0FA 3LMJL 2DDQH 4V1DE 2HG0A 5KSBB 4LEBA 3VGEA 2IBZY 4E42A 1BX2B 4HS8H 1SMOA 4OUUA 5E00B 1LD9A 4BRVA 1IAOB 3FCTB 5CEZD 1GSKA 1QRNB 3LN5A 2R59A 4AYID 1MN4A 2GEEA 2QSVA 2JKXA 2OV0A 4LLUA 1AVAA 2QGDA 1U3JA 4IIZA 3KH4A 2VZ1A 3GS7A 5A16B 4PTTA 4ZO9A 4CSZA 4CDHA 3U1QA 3NJLA 5HVWA 2BVPA 2XBDA 4N8PA 4F80A 5JTWA 2ZCHL 4QHMA 1YYCA 2NUTA 4BINA 4IMKA 4JFQA 4YDLC 3HHRB 1OP3H 4F8OA 3E1ZA 5ALBH 1UZ6E 5KBKA 1UH4A 3N1GC 1X7SA 4LARH 4XVSL 3LSOA 1KT2A 3U48A 1TTBA 4XMKH 3PABA 3IDYB 3PHQA 1XF1A 2DWEB 3GSQA 4HIEB 5F3FA 4JZJA 4J28A 2ICEC 5DURB 3BWAB 4AM0A 4RQQB 1Q9OB 4POZD 1F6LL 2JKJA 4J23A 2IFGA 3TN0D 1P7HL 2GJZB 2YZ8A 5L88L 4EN3A 3QORD 5H8DA 4MA7H 5GGRB 1RPKA 3LZQA 1XGRB 4RNRB 1ILUA 3LNFA 1BIIB 3AU1A 1FSKC 2YD2A 1A3RH 2X2IA 5CS7A 4EIUA 3GQFA 4FQ2L 3VW3H 5BRZD 4LDLB 5T3XH 3X12B 5ACZB 4AXWB 3C6EA 4ZDHA 1PD1A 2MEJB 1USQA 2AJYH 2D7PA 4DP4X 1XB8A 3SHSA 2C9UA 1N12A 2YPLD 5DLLA 1NFAA 3BWSA 4PSRA 1DBJL 1HILA 4NUPA 5EWIL 1OO2A 3GRBA 1CZ8H 5GRJH 5GJTL 3PAUA 2FD6H 4NQCB 1LP9E 1R5WA 5F97E 1T4WA 5D1QC 4LSUL 3TO4D 5JIIA 1A4BA 4EZKA 1NFIA 1J12A 3MLXL 4F57L 3SO5A 3BKYH 5DQDH 1K85A 4GI9A 3DSFL 4Y4FC 3GXUB 3VTAA 1TCRA 3RZWA 5FF6B 2EKJA 2X7LA 1RUPH 2IGFH 3X2QB 3QNZB 2RH0A 4FFYH 5CZXD 3GT6A 1CR9H 2WKOF 3P3TA 4P46A 4YSOA 3QHFL 3D51A 4JUTA 4WU7A 1N2RB 1ZHNB 3O6KL 3SPVA 4DJMA 1INDL 5E6RB 4MS6A 4Z95L 1OGTA 1ZK9A 2CWRA 1WVZA 4BRJA 4DZ8A 3KPSE 3CIAA 1UASA 5B39G 2VT0A 5DMIL 5CILL 1DJGA 3TZVD 1RUKH 5I6XC 5MEOB 1QNIA 1SYSA 1TVHB 2BNRA 2J56A 5BW7A 2XG4A 1SJHA 4IJ3C 4M5ZL 1Q9LA 4R7DB 1OAXH 5JHDA 3HFMH 1HSAB 1XGZA 5E0QA 2AXJA 1URZA 1XGYH 1J1XL 4KAQH 4LP8A 2B1AL 3X14B 3ASOB 3CUPA 1PZUB 2IQAA 4LVOB 3ZL4H 4QRBA 1RZFL 4QRQB 3FN0L 3FC8A 5HGHB 3D3VB 5DA4A 4NP4L 4QOKB 3P40A 4GPVA 1AGEA 3WIHH 3Q6FA 2F54D 3VXPB 1MVFA 3OHXA 4J3XA 1GY1A 1EANA 1DQQA 5HHME 4TUJB 3MV9B 3NGBC 3GJEB 1YJDH 5E8NA 3PJSB 4XP9H 3FTYA 4HETA 1QR1A 5FYKU 3KPLA 4UOW1 2X6BA 4JFVA 1E5UI 3EFFB 4OUOA 4UIKL 3RBSA 3IXTA 4XNXH 2AABL 2IWEA 3SGEH 2YSSA 1CLOL 2KZKA 5DDHB 3B2DC 1CGWA 4PJAF 5L0QB 3T3MF 1DQKA 4OF7A 1BQUA 2FX9H 4OF0A 3QJFA 5EO0A 2XJKA 4JQXC 4XZUB 5DHDA 1A7OH 1A65A 1ETJA 4QRTB 3BRFA 4MLIA 4HV8A 4CJ1A 1T03L 1HN1A 4ODSH 3TVMB 5DUMH 1A6TB 3EG9A 4GKSA 2WP3T 3PJLA 2YZ1A 3SYPA 1VACA 1E9QB 1ZPUA 1EAPB 4GUPB 5HDLA 1P1VA 1T0NB 3CLWA 2C8NA 5CCGE 4E36A 2P5EE 1EDHA 4JN2A 1NCDL 1X5XA 1GPOL 4EIZC 4OF8A 3UBGA 3NIFE 1WIOA 5K1JA 3WELA 4JFTA 2EXWC 3SD2A 3BPCA 1RU9L 3CK0H 2ILLA 3QJQB 4NFBA 3RDTA 2ZOLA 3TNMA 4LSQL 1NGXB 3ECBB 2QR0A 4UIMA 2WLLA 1EZUA 1YYML 3RHWK 2H6PB 3WFZA 1F90H 1RK0A 2B4CH 3CFCH 1S7WB 3TPUB 3EH3B 4O02A 5HD8D 2HFEA 8FABA 3OMNB 1DE4A 2NXYC 3BLBA 3SBQA 1JHTA 1GYVA 3MLVH 1NCCL 1YYLH 2X89D 4AYSA 1M1XB 5I30L 3NAAL 5DEZA 3U4AA 2Y22A 3F7KA 2CXGA 3T65A 1OAUH 1OF2A 4KX8A 3QFDB 4MNGA 3RWDA 3T0EE 1DN0A 1I7TB 3S35H 4I48A 4EN3D 2WUCH 4CMHB 5L8LB 1R0AL 1ZSDA 3MRPB 3VXQA 1VLXA 1FH5H 1EQWA 1NM4A 2F18A 3FPXA 2XN9E 1LK3H 2CLZA 1DBML 2DJ4A 4OM0L 1TQCC 1MVYA 1JXKA 3JWNC 1UYWL 1ZCRA 3OLEA 1HCFX 3KR3L 3KXFE 5A2FA 3FT2B 3RVUC 2DTSA 1KC5L 4ZRGA 5DEFA 4WK4B 4PJFF 4AQZA 2ADGA 1GMIA 4ONGH 3C60D 2MRYA 5D7LB 5HDWA 2VN4A 4H8UA 3VQ1C 3T8XA 2VUKA 1CFVH 3RUGB 3FQNB 3LN9A 1CD0A 5KJRL 4O00A 5DS8A 1R5VA 1FN4B 3RTQC 1A7NL 4P2RD 2JLLA 2Y23A 2PW2B 4HGMA 4W9HC 3ZZQA 1ZK5A 2RFXB 4QD2E 5L4MA 1RK7A 1N26A 4S1QL 4WSKA 4YL4A 4B27A 4G7VL 2AS5M 3S0PA 4JM2B 5ANMA 1BYNA 4APQB 1S5HB 2R2BA 4Q97A 5IKCA 4HUVB 4AMKH 2D31B 2GJJA 4EKJA 2AQSA 5HYJA 3L45A 4U1LA 5EBMB 4YOKA 5HVHB 2O61B 4MJIB 5LGJA 3T0AA 1LMIA 1WLHA 4OLVL 2X1XR 4KK6D 3WMSA 2OW6A 5MEPA 2VW6A 1ZLSL 5D1XA 4BEIA 3QCVL 4OCWH 1KELH 1D3CA 3B7TA 4RGOL 4IBTA 2OMZB 2W5PA 1EJ8A 3T71A 1AZZC 4HJJH 4C47A 4KWUA 1EXUB 3JXAA 3GUTA 5BZWB 1LO5B 4U31A 1ADQA 2YEZB 4WI8A 3D39D 3CJJA 2IH3B 4LSVL 3RGVA 3K4AA 4FTVD 1A14H 3DTDA 5SV4A 4FQCH 1XIWA 5CP7A 2ENSA 3L5XH 3S7GA 3WFBH 1JRHH 1X4ZA 1HFUA 2AJXL 3ARFC 1W80A 1JZJA 4NN7B 1EMTH 2NY6D 2JWYA 1F1GA 4KTEH 1ROWA 2QQLH 4P9MH 4DKEL 4YGAB 1NZRA 3L4XA 4N0FA 5F3HA 1WH0A 1U33A 5AVXB 5LKNA 3VH8B 3ZKXC 1NPUA 5FO2A 2AK4A 4C56D 1DSFL 4WNQB 5E99H 3RVVC 1LILA 4QMEA 4LAJH 1P4BL 1J18A 4J8QA 2HPTA 2WLIA 4XNYL 3ZSSA 2QPFA 5ALCL 4DQAA 4F7TB 1RULH 2APTA 3Q2LA 3PGCB 3S3DB 4X98A 2FYYB 1N9PA 2ESVB 3OZ9L 5TF1H 2OQJB 2VDMB 4XPTL 1BVZA 4AMXA 4G7YL 3VFPB 1U21A 2CZNA 3KM2A 3BZFA 1HEZA 3LRLA 1V3JA 4YDZA 4Z7VB 5LBGA 1YY8B 5EZJA 5LB1A 3O9WA 3SEPA 4NQDD 1KDJA 3F12B 4CC4A 5IVZA 5IQMA 4LCWD 4QYAA 1WGOA 4WI0B 1I3RB 1ZVYA 4X9YA 5I1AB 1C5BL 1XR8B 1HYSD 4UV4H 5EDXA 5KANI 1BVKB 3T4AB 1NAKL 1FYTA 1O7DC 3KD4A 2VZ3A 4N9GB 4FA6A 3SQRA 2A9CA 2YBGA 1ZVSB 4YGVB 5E8OB 1MUJB 1NDGA 2E6JA 1QLRA 4GW4A 4L4TB 2PWFA 2WSKA 1J8HE 4X83A 2JI1A 1U92A 1AXSA 3ZN6A 2ZICA 3P0GB 4HKBA 4K3DL 4HJ1A 4Y7MA 3B9KA 2EKSB 3PWUA 5HY9B 4A2MA 2NR6C 4UBDC 3L5WB 3AUVA 5E1HB 3S3PA 1G7PA 4WFFE