5DHEA

Crystal structure of chbd3 from thermococcus kodakarensis kod1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GDLVKPDAFSVKIQDWGSTEYDVTLNLGGTYDWVVKVKLKDGSAVSSVWSANKAEEGGYVVFTPVSWNKGPTATFGFIATGSEPVEAMYLYVNDQLWDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of chitin binding domains of chitinase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis kod1
molecule tags Hydrolase
molecule keywords Chitinase
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dheA00
1C7SA 1EXHA 5DHEA 1E5CA 2RTTA 3NDZE 1XBDA 1E5BA 1C7TA 1EXGA 1QBBA 1HEJC 5DHDA 1QBAA 1HEHC 2XBDA 3NDYE 2CZNA 2CWRA
chains in the Genus database with same CATH superfamily
3FUDA 4QCIA 4YIQA 1BBJA 1E3ZA 2DTMH 4LRNL 4NN5B 1G9MH 1D3CA 1GZPB 3P30H 4WW2C 4M61B 3R4DA 2EECA 4FHKA 5ABAA 1PZ3A 1QO3B 5AVTB 2WZPD 3O45A 1R0AH 1MHPL 4Y5VA 1IBGH 4WK0B 1DCLA 2GSGB 2ILLA 2E6PA 1FVEA 3CJJA 2ITDB 1VDGA 2KLTA 5EORH 4UIMB 4IMLA 4IU2B 4Y2DA 4K2UH 4M8QB 1AQ8A 4NZFA 1IQWH 5F1NA 2V17L 3QIWC 4ZQKB 1XGZA 2CR6A 1NMAL 5A2CA 1V55B 2VUKA 3ZTEA 1YJDH 4M1CC 4JN1L 4P3DA 2OXHA 4WLCA 3FT2A 4G43A 4Y9GA 5FYLH 2P24B 4L9LB 4BZ1H 3D5OF 1A22B 3RUGB 1IM3A 3CH8A 3BW9A 4LOUD 3AT0A 5FW6A 1F4XL 4AZUA 4C55A 1BZEA 2F74A 3L5IA 1M1XA 3OAZH 5DVKA 4LPCA 3QEQB 3D1MC 5JR1L 3N42B 4P4RB 1WC7A 4FFWD 1KIPB 1U8PA 4JFEB 1NGZA 3LZFL 4EF3A 3L3JA 5F0PB 1E7VA 2YEQA 3B7RL 4OLUH 5DRWB 1VF5C 5A2FA 3II3A 3QCVH 3W82A 4OLVL 1AG6A 1QRNE 3U0TB 3DHUA 1URZA 4WI7A 1DSYA 4Y88A 3BHBB 3LQAL 2IC2A 4NQEE 5EO1B 2V3FA 5IF0B 3QXAB 2A9CA 4NNXA 1KZYA 3NH7H 3FU0A 3BPLB 1IEHA 4KUZH 2FSEA 4EI6B 5CGTA 2CHNA 4NENA 2XCMC 2WLZA 4LPTA 5KYNA 3C6LB 5FO8B 4GAGH 4X9GA 1I85A 4ZXBA 2X3AA 5JOFB 3TO2A 3TA3B 4JKLA 2HN7B 1YNTF 5KN5A 1AZVA 4RISH 2R56H 1WA2X 3B2XA 1H15B 3HG1A 3VXNB 2W80C 1S9VA 2LOEA 3TFKD 5C08D 3MRNA 1V10A 3QEGH 4R83A 1YAIA 3ESPA 4FXGC 4K3HA 4LLAA 3S3SA 4E9SA 2RR3A 1MCEA 2A83B 4MD5A 4F8PA 4ZMLA 4JG9A 1KBPA 4HUUB 5C0RH 4JHAH 3MUGA 4TNFA 1DJIA 1XF4A 1GMEA 3L3HA 4JPVH 4RNRA 3BUBA 1E90A 1RV6X 3PGCA 1GCFA 4OFVA 5I66B 4P5MA 2R8SH 4X7SL 4OTXL 5ICXB 3ALPA 2AXGA 3OMIB 1OF2A 2QFRA 4KVCH 4AT6A 1K85A 4LFHD 1U8JA 2KDGA 2WXFA 4RBPK 3DTXA 1OKEA 3L81A 1CDHA 1K6QH 4AM0A 1KXTA 5IHBA 2D9CA 2BCMA 1NUFA 3FQYA 1EAQA 3EHBD 4JVUA 5DYOA 2MKLC 2VR3A 3HI5L 5IJVB 2H41A 4Y19D 1SM3L 3QO1B 1J86A 5J56B 5I30H 3BZEB 3EYVB 4X5XA 4PWJA 2X4PB 4BWUA 3EYUL 4PJ8D 4AGLA 4UILH 1B0IA 4LBEA 5D5MF 1J9QA 3UBGA 5I1HL 1MCWM 2HVJB 1ZA3B 4J27A 1XSOA 3P9WB 2JI1A 1HVXA 4PWEA 2NSXA 1A7PL 4KNQA 2FWOB 4JDVB 1C5DB 4G7YH 4KRPD 1IGMH 3PREA 1RVFL 3B34A 3CFEA 3HNTL 3PJSA 3MODH 3MMEA 5DFTA 4GG6F 3AS3A 4BFKA 2OV0A 2B16A 2ZYRA 3TTSA 3PJSB 2QKIA 1WJ3A 4LGSB 4HAFA 2X88A 3SDCA 1D5XA 1EUTA 4QMEA 4PP2A 2DYPD 5IWLC 3SY0B 5GGTL 4AEHH 2J8HA 4JAMA 4HU8A 1NCWL 2XZQL 5D1ZB 2XVLA 3E9UA 3EZ8A 4QI3A 3U4BL 5BS0B 4OGYL 2C1PB 2UUDH 2BS9A 3CC5B 2P7TA 1A7NL 3BEWB 5KVEH 5IEHB 4YBQD 4TVPH 1LO3L 5EV7A 5GRWA 2XTJD 1HE8A 3HE7A 4QLRA 4PRHA 1ZGLM 4N6RA 5LAXB 3T08A 1U8KA 4BFGA 5BJTB 2Z91B 4PRBA 3MJ8B 3W38A 4NRZA 2BRRL 2FSEB 4U3SB 4RMRA 3FRUA 3S6CA 1N64H 4HS3A 4N9OB 2G5BB 4GRWF 1RCYA 1G7HB 1U95A 3BSGA 1UA6H 1K8DA 5E2JA 1QYGH 3QH3B 1AGDA 4XOAA 4QRRB 1FO0H 1NKOA 2WTPA 4IBYA 1OV8A 4ATWA 4Z7UB 5HGDB 3EFFA 4JS7A 1JPFA 3DSNB 5EPMA 4ZZKA 5IMLA 2GAZB 3DHMA 4JDZB 2FZ3A 3AU1A 1JDCA 2DD8H 4NN6B 1IFHL 1WZAA 2Z7ZA 1C7SA 2MTPA 1OAUH 1AOZA 1PLBA 3P3RA 5DA4A 3W9DB 4W9CC 2HJLB 2ZKMX 3BPNB 5B8CB 1TQTA 5F93C 3CBKB 1OALA 5IMKB 3EBHA 2E9GA 1VZIA 5F6IB 3GBML 1OQOA 3BIKA 3JWOC 4O2EB 2VUOA 1ZT1B 4OZGB 3DTXB 4U1NB 2RJMA 3T3MF 1A9VA 3B2VH 2GG1A 4TSCL 3LMJH 5C71A 3TBYB 2Y1VA 4S1RH 4QIRA 4F7TB 3FCUB 4ZW8A 3LNGA 1QLEB 2HTLD 3RDTD 3HN8A 3RVXD 2WQAA 1LWJA 1JF1A 2Q7NA 4XBEH 4LSTL 4LRNH 1OWWA 1KGCD 4BFRA 3WU1A 1UM6L 4GH7B 1JNLH 1QR1A 4WTZG 4UTBH 2ZX9A 1ZCRA 5EUKA 3MJ9L 3MV9E 5KANG 3CLWA 3O0RL 4P9HL 4TNWK 4Y8DC 4H5SB 3T1FA 4PJ8B 4AG4L 4UTCA 5CSGA 1QBML 3TN0B 5DMGC 3IKKA 3GJFB 1X9LA 4K5LA 3QFJE 4GEIA 1DUYA 4AWJC 1LO4L 5KYWA 5E8DL 3KYAA 4H0HB 1YJDL 1PLGL 3MLWL 4QRFA 3FQTB 4Y5YC 1OARH 3CFEB 3B7YA 4G11A 3R7QA 1U3HD 4HDIA 1KNOB 2LAAA 4IHOA 4WU7A 2DYSB 5D1QA 3QQDA 3UTSD 2H8PA 5FGBC 2WQUA 3T2PA 3N1MC 4AQAA 4D3CL 4PPTA 4UDUB 3DJ9A 2VB5A 4R6UA 5E08L 1R6VA 3SQBB 4CVXB 2XVKA 1I8LC 4G8AC 1NIFA 4WI8A 1MFAH 2NY0C 1AQMA 1ZJAA 2H9GB 2XRAH 3QE5A 3OPUA 3LZFH 2VN4A 1PKQE 5AW5B 5SX5K 5AZ2L 1DZ0A 4NO5A 1MW3A 3ASWA 2C9SA 2H1LM 4UQ2B 5CKGA 1KLFA 2X4QB 5IREA 2X6CA 2WO2B 5IHWA 5L6YL 2GJPA 2NNXA 4HG4J 1FNFA 2VNCA 2PPEA 1I7RA 2AGJL 3S96B 1JP5A 3FB8B 4OZFH 1KWKA 2XDHA 3CVHH 1K4CA 2NY6C 4R3SB 1Z3RA 1MEXH 2NR6A 3FB8A 2EH8H 5I18H 4YEFA 1X5KA 4I13B 2H3NB 4RISL 1MWAA 3H9SB 4LBEB 3P4MB 1BIIA 4RVBA 1FNSH 2DRUA 3F85A 4BSWA 4H20L 5CP7B 4IBZA 1KIUA 2CXKA 4QJ4B 1RZJC 1NANI 4L4VE 5FYKL 5DMJB 3QAZB 3SE3C 2XG5B 1ADQH 3QEGL 5DURB 3RKDD 1W6LA 1M42A 4KTGA 3B7UX 4NZ8A 4PJAE 3IFOB 1F56A 1TTBA 2XQBH 5IBLD 1MIML 3HMXH 3JWOH 3QXVA 4FQPA 5DMYA 4BV1A 4JFPA 2AV1A 4AK1A 2VDRH 1AD9B 4TSBL 4ODSL 4OTXH 1S7RA 4KVCL 1EAPA 3T5WA 3NIGB 5AW3B 2DKSA 4DPRA 1RKRA 3KJ4C 5ID0B 2XTLA 1OE3A 2FJUB 4AQOA 4KOCA 3HZVA 5TDPB 2YLHA 4QAMB 4GRWB 4PP2B 4OZGA 5SX4H 1I3RA 3JWNH 1ECZA 1N59A 1SLUA 4FTVB 3U2JA 4BZ1L 2Z8RA 5GRXG 5HDRA 2FT8A 4XMPL 5D8JH 1TPXB 4ODVL 4X6DA 4BH7B 1SDYA 4PRIA 1S9KC 1RI8A 1ZHLA 4X5WB 2C1OB 2EDFA 1T3FA 1W91A 3S37H 3D69A 3MCG1 5KTEH 3BJ91 4B0MB 5D2LA 3DKHA 4D8OA 3WXVH 4K9JA 1DVFA 2FVNA 3B7TA 3HR5B 3T4AC 1E27A 4N3UA 4H8UA 1D6EB 2JK5A 5F6HJ 2J8UA 5TQ0H 1DVSA 5KSBB 3WJMB 3OLIA 1O9ZA 4QF1A 4WI5A 4K9EL 1E27B 3SQOH 2DM2A 2QPEB 3G9AB 4U3HA 3QCUH 4WW2F 1B4RA 3ATFA 1FF5A 5FUZH 3QZWG 3ZQWA 2YRPA 1AFVH 5I6PA 1UJ3C 3I2CL 1QUPA 1RVFH 4GKNA 5EA0H 5CEZE 2PW1A 2GKIA 1E2WA 5LGJA 4AC4A 3L1GA 4GP4B 4V1DB 3FZUD 1HI6A 2G4GA 3VXRE 2Y1ZA 1A1NA 1RXLA 3MLZL 4CBZA 2X7LA 3QDGB 1UA7A 4JQVA 1JPGB 5JLZA 5PCYA 2GJ6E 4NGHH 2YD7A 3L3KB 5JHDE 3INUL 2XWBA 4R2GB 1Q38A 1AD0A 5EN2B 1CFMA 2OQJA 4LPYA 1YEKL 3IFLH 2BIQA 3B9KC 2Y2TA 4TL4A 2Q76A 3LRLA 5I5RA 3Q8BA 3QQ3B 1GOGA 1NCWH 4NCC1 2HSIA 2VZVA 4XP1H 4F5CA 3NK4A 3BQUC 4KV5F 5IFHH 4FNPA 4Z3IA 1MCHA 2WP3O 3TTYA 4QXUL 3OHXC 4AIZA 4JVWA 4CW1A 3G6JA 2Y7OA 1DVFB 4PW4A 3OKMA 1DO5A 5ALBH 1FE8H 3LNEA 5D72L 3H9SE 1PU0A 2YBRA 5HSFA 4D9LL 4NJ9L 2HT3C 4JO2H 2BP0A 4CJ0A 2WQWA 3P4NB 5HYEA 3PFUA 3ZDZE 3H55A 3ETSA 1UEYA 1MFCH 3SPHA 4MVBC 4U6YA 1TKWA 5AVUB 2DLEA 5D7LB 3RAJL 3VXSB 4OCSL 5IMOB 5B8CC 2NY6B 1F6AB 2YARA 5JPNC 3JWNG 4JRYA 5AAMA 1BMWA 3PHOB 4DHLA 3ARGC 3BUPA 5CCGE 1BQHG 1TTUA 1HIML 1UXLA 3RNQA 4XNAA 4C56B 3VFPA 4NAQA 2XY1A 4TL5A 1I8KA 4LCUA 3V4PH 3VO0A 3VXUB 5C0JA 5FO9B 4EIBA 1E4XI 3PWPE 5D1XA 3GMOB 2YUVA 3STZB 2VXSL 3CSBA 4PV8A 5F72S 4ZUVB 4ZMQA 4GRLA 3GSQB 3EFOB 4MB5A 4NX0A 4DZBB 4Y4KA 4QOKA 4JANA 4NQQA 1YY8B 4YX2L 1AGFA 3OF6A 3PGFH 4POZD 4HOMA 2D2OA 1JV5B 3LEXA 3KJ6L 1MAKA 2X1PA 3CHOA 5SX4I 1XH2A 4Q58C 1I7UA 2J8UF 3F62A 4IRSA 1O6SA 4M6ML 2VGLM 4YDZA 3CXDH 4PSRA 2GPZA 4Z6AT 2JJUA 3G08A 3I3BA 2PO6A 5C0NC 1CUOA 2VQ1B 4RA0C 3D69B 3COOA 4FG6C 3P2TA 3U4EB 3N04A 5HPOA 2FLRT 4FJZA 3V9FA 5KBKA 2QR0B 2QVTA 2X2UA 4UTBL 5FYKU 1NCAL 1P7QD 3F12B 3HMXA 1X9RA 3O0RH 4P9HH 5ILTL 3EHBB 3WE6A 4PJ7F 4WTZA 3IDXH 1X5GA 3OXRB 3C9NA 4WSJA 5IQ7H 1P84K 3MXWL 3QNXA 1JD9A 3HVDA 2IALB 4IS6A 5DD3L 5ISZB 4OQ1A 1BM7A 3HHRB 2Z6FA 3L48A 1DBAH 1V7ML 2J1XA 3L4CA 1I85C 4LU5L 3RNQB 2ORBH 2ZWKA 1OARL 3L9BA 3BAKA 3D0LA 2EIZA 4NUJA 5F1OB 3VFWB 4F7PB 5A2BA 4KTEH 1UTDA 1U6AL 2HRGA 4GW5A 5CJBA 2JB5L 1UA6L 2H0PA 3QIUB 3CFQA 2OZ4A 2IH8A 3MLYL 2H32B 3MNVB 3FFOA 3L4VA 5EO0A 4NXSA 3VXQB 2IQ9H 2PF6A 4LVNB 1RMFL 2EICA 2RMNA 4NQED 5BQDA 2OMWB 4OSUL 4B5ZA 3MRMA 4DEUA 5DD5L 2VLRB 1CYXA 3S4SA 4OB5L 1UADC 4WI4A 5EU3A 2GC4C 2HYMA 3FO2B 1IGCL 3MN8A 3QJRB 1E5BA 3OAZK 2G0KA 2LU5A 4HKXB 2EXWD 1N2RA 4O4YH 5KVFH 2Z1PA 4MNGA 2W59A 5IHZB 1OAKH 5DD1L 5AALA 1H3XA 4GAYB 4D94A 5E4EC 1E2VA 4M62L 4UQEA 4P23C 3QFGA 3L8QA 5TD4A 3HG3A 4Y5YB 2E7LA 2BIHA 5BS0D 2VR6A 3DROA 4L9LC 4N86A 3HNVH 4OCMC 2DH2A 4S0TD 4TXVB 3RTQA 5AB1A 4UIKH 1MCWW 1U3YA 2UWEB 5FKPB 4A2HA 1IUZA 3QJTB 1WSST 1UD2A 4L8SA 4M00A 1BAFH 5F9OL 5JW4M 2P1YA 1UXWB 3MLUL 3EF4A 3TH2T 1CJYA 4NNYB 4ELMA 3LPWA 2Q8BH 4N5EC 1Y1UA 2Y5TA 4N8VG 4G6KL 4UB0H 4FGMA 2QR0A 2WXLA 5DSCA 4LSVH 4QWWD 2VDRL 1SOSA 3WIFA 4GXUM 3GZQA 3W5NA 5I1KL 4X99B 1KGIA 1KTLB 5EIIG 1NMCB 1T0OA 4L9DA 4AYBA 2XQYK 1CZ8H 4PS4L 5K1NA 1IT9L 3DECA 5DD0L 4M5ZH 1FYHB 1P2CA 3GSUB 2YD4A 2CO6A 5EU6B 3PF2A 4PRBB 4JEGB 3QULB 2LVEA 3T0EA 5D4IA 3GXMA 2CO2A 4ODVH 1W72A 4PRPD 1XGUB 2FJGB 1PBYA 4HSAC 1XB6A 4UUJA 4WWKB 5JORA 2BWDA 4UM8A 3ZTNH 1KCVH 4KMQA 3BSZA 3C8KB 2YQ3A 2A74A 3WFHB 4ZXBB 1JXGA 4OFDA 2QGDA 5TQ0L 5DO2C 3O4OB 4JPWL 4X9FA 2V3EA 2OZNA 5DRNA 2X1XR 4BH8B 3RZCB 3GO1H 4ZS7L 4MX7B 4EN3A 3TBWB 1BFOA 4I8DA 5ITFB 1D5MA 3RYMA 2X4UA 2EEBA 5EA0L 1ZGLP 3W9DA 3EHBC 3IXTB 5FOJA 4LCWA 1BF5A 4KDVA 2OTPA 1VPOL 2A2QT 1CIDA 1DLHB 4NWTH 5MEND 3CSGA 2W95A 4XN4A 5JO5B 3P0YL 4WO4B 3IJYB 2FK9A 2VRQA 2ZXBA 1O5PA 3GXUB 3LKQA 4BFBD 2BERA 3MRRA 5IQ9A 3OD3A 2QSTA 1BZDA 1AZBA 2ATPA 3UTQB 3NCYS 1FO0B 4GKZA 4XN7A 4AL8L 1AXSA 4O9HL 3GMMA 4YAQA 4KX8A 5FECA 3OJMB 2PWEA 1QBLH 4G8EA 2CIKB 4GAJH 3AMKA 3SYAA 4XP1L 1L0PA 1RU9H 4XXWC 2ZOLB 3HI1B 5SWZE 4Z78B 1JZ5A 3J27A 1O75A 4G5AA 1N5YL 5IZ7A 4D2NA 2ZOUA 1T1YB 2E0PA 2IOOA 3LNDA 3II2A 3MV8A 3GLZA 4NRZB 5CU9A 1KCUL 4KXZH 1YJDC 2TRYA 1CXEA 4MSWA 3L6FB 4ODSH 3EG9A 5GGSY 3UZQA 3TO4A 5IESL 3BAXA 3QWRA 2VDKL 4K3EH 5ESVB 1L7IH 4JY6A 5D72H 2G4EA 3BESR 5I1LB 1CDBA 3R06A 4D9LH 4DVBB 4EZJA 1F5WA 1ZSDB 1G0YR 3ISWA 4NO0D 2MQ0A 1A14L 3C6LA 5FO8A 4PLOB 1LE9B 4XP9H 2DIBA 1BXVA 3OGOE 1Z66A 4XMPH 1FVDB 3D2UD 5IB2B 2CLRB 3L4TA 4XPTH 1TQWA 4AENA 2OBGA 4HIEA 4N24A 3MJ7B 2R69L 3JZYA 2IGLA 3WELA 1I1YB 1O7VA 3WUWB 5F88B 3CK0H 5KSUB 4APQB 3F58L 3RVVD 2R4RL 2V7HB 3Q6GL 4K9EH 3VYPA 5GXBB 4LAJH 1BOGB 4XBPA 4TQEL 3VFNB 4N3TA 4E42A 4YBLB 1EZVY 3FPXA 4MZ3A 1KY7A 2RA1A 2DQMA 1JJUA 2HRPH 1JZHA 4NKOB 4FFZH 4S1QH 5IVXE 2EYTA 4XH2A 4HZ1A 3HG1E 4JKPL 1G6RA 5CJ8A 3UTPD 3VD0A 4Z77A 4R90L 4Q14A 2IWGA 3BGMB 1A47A 4HC1A 5IKCA 3LNIA 4XI5D 3B3BA 1E4JA 1N3NB 3QO1A 2NT0A 5AYTA 4GUPA 4JY6B 1NFDE 3MFFB 2CPUA 2QL1A 2G9HB 4FQXC 2FRGP 3OGCB 2AQ1A 3T3MB 1IBBA 1WG3A 3S35H 1QNZH 4JREB 1OGPA 4QO1A 1LP9B 2GBAA 2N0MA 2BX5A 2HFTA 3KGTA 1D5ZA 2BPBA 4X8CA 3GS7A 4ZO9A 2XBZA 3KDPB 4NHUA 4S10A 3KLKA 3FFCB 4XX5A 4QXUH 4ANVA 4WW1B 4YNYB 3MHZA 5DD3H 1CYGA 1N4XH 1A9BB 3SGJC 5B39A 3LN9A 1Y0LB 3L3OC 4GRMA 1QEXA 1V7MH 4LU5H 5BW7C 3DJTA 5IEKA 3MFGB 2PLTA 4PB9L 3V5DA 1GGBH 3PGDB 3X14B 5EZIH 1NBYB 4ABQA 3DJSA 3RWIA 1GTFA 5I8EA 3MNMA 3FO1B 5DUBA 2FO8A 2GSGA 3UP6A 3OB0K 4CKQA 1ZVSA 5I76B 4KVNH 4P3CL 5F96L 1ZGLB 3Q1EA 1W0VB 4KI5F 3VSQA 1HIMH 4PS3A 4YR6A 1MCSA 2IG2L 3B9AA 4LP8A 2E86A 1MRCL 3WG7B 1J05A 4QRSA 4JM2F 1WZ1H 1MCNA 4O4YL 5KVFL 3QFDA 3RX5A 2HKFH 1MCCA 3ULVF 2ZXQA 3RWJA 4YSPA 2IBBA 5E9DE 1OW0C 1OB1B 5FDYA 5B4MD 1OM3L 3GJEA 5GQBA 1SUJA 3JVGA 4UNIA 2EDXA 3WIHA 3G5YA 1HHIA 2F5AL 2Y2WA 3NPSB 4G80A 4KI5C 5CGYC 1UGKA 5CBEA 1RK0B 5JHLH 1XZ0B 3S0PA 1I1RA 4ZYKA 2H1PH 1FPTH 1C5CH 2R0KH 4DKEL 2JJTC 5HHOB 5HJGA 3ULUF 3IB4A 2X0UA 1PZUB 1CDUA 1TZGH 4FLHA 3NPSC 1C5DA 1FH2A 2A0LD 1JAEA 4ZFGL 1PSKH 2K6WA 5L8KB 1MHPH 3TBSB 2QADB 2G2RB 2XY2A 3K72B 4P2QE 4YHKL 4TQ8A 3CQPA 1HHKA 1P4LA 4GBXC 2GK0A 5ABZA 4EKJA 2OMYB 1HWHB 2PXYA 4IKIA 4KO7A 4NKMB 5EORL 3RFZC 2NY6D 4U1LB 1TQBC 3HEIB 3ES6B 1EBPA 3IMRA 4HIIB 4OAWB 5KOVC 1SLXA 4OZGF 4I87A 4XE5B 2P8MA 2ORBL 2HLAA 1KF9B 2EDQA 2ZJSL 4U1NA 4M5ZL 5FYLL 1D7BA 1NDMA 2AEWA 1AIFB 4U1MB 3IVKA 2M83A 2XPGB 3FQXA 1FFPA 3K2MC 3PNWA 1I7ZA 2IMNA 4FXKC 3VYNA 3RE0A 1EVUA 1T1YA 3MV8B 4DGWC 4E41D 5C0AD 4H8WC 3ZTNL 1Q72H 1JNJA 2YK1H 1SHSA 3V2AR 1XMWA 2Z4TA 3JT0A 4Y16B 4PJEA 4JRXA 4NJAL 4OLUL 4BWTA 3H0TB 3Q44A 3QHFH 3NSCA 2MHAA 2EKJA 1CDGA 2W0KA 1QQDA 3QW9A 4HP5A 5D1QE 2NY1B 3JTTA 2QSQA 1OHZA 4MNHB 4LLWB 1ZS8A 2E27H 2NLJA 3W2DL 4AVIA 4HGWB 1FQ9C 4AYFA 3B9KB 3L5WA 5I0DA 1FSKC 2VZUA 1E4KA 3HAEG 4PJIE 4QRPD 4QRRA 2OMTB 4BHUA 3QUYD 1N68A 1SEQH 4XTRD 4XX1G 2PTTB 4BFJA 2CLVB 2OYMA 3L5WB 3BKCL 2CBPA 1W8NA 2V5MA 1E43A 4O51A 4U7MA 2GITA 5D1XD 1JGUL 2P47B 2QQNH 1WDAA 3EGSB 3P0YH 1OB0A 4LCYB 1ONQB 4AGQA 4CSZA 2Y69B 3B8YA 4RMQA 1ZTXE 3EFDL 5HGBA 3SDCD 5ID0A 1FNEA 1S8DA 3ME0A 1NLBH 4ALAL 2KL6A 1M2VB 4NZUL 2G2NA 4W81A 1BAFL 2NT1A 1ND0B 4XVJH 5F9OH 1QSFA 2MJWA 3A5VA 2N0KA 2BZDA 3FQ2A 2AI0H 2WGXA 1OTUD 1ZHNA 4JL1A 4M48L 4FTDA 4YVNA 5GS1A 5I1IL 4UYPA 4G8GD 3BDXA 3FQ1A 1I1AD 2NX5B 4H26A 4JG1L 2IPTL 1VCBC 4QHUB 4Y2OA 5B7MA 3A47A 1JXKA 4X7SH 4QHLB 3MRJB 1WBZB 4E5XB 4WNQA 4AMXA 2ALWA 3FZUC 4TYUA 2ESVD 4Z8FL 4ZSOA 5IW6B 4FEIA 1AP2B 4HWUA 2GUOB 1G6RL 1GC1C 2M8XA 5KSBA 5KYXA 2ADJB 2FATH 3EUDA 3QRFM 2DS4A 2BWQA 1CTNA 3ARPA 3IGUA 1HFUA 3E8VA 1ET7A 43CAB 3FUNA 4N8PA 3NQIA 4ECNA 4P2AA 2LABA 1F3JB 3D3VE 4OGQC 3HI5H 5FKAB 3C5ZA 2TRHA 2X4OA 4XWOC 2KS0A 1CR9L 4AV0A 3KW7A 4MZIA 3FFCA 1RIVH 3VFRA 2XX0A 4ZOBA 4YGAB 4HFUH 4Q9RH 2OMBA 5J6GB 3TFBA 2F53E 3GSQA 4QJ5B 1B0RA 2VZ3A 4UQ3A 1QOKA 4Z7VB 5HI3D 1JYNA 3T0WA 3IS0X 3WEXB 2OXGB 1KJ3H 4HEPG 1Q9OA 3TCXA 3QNZA 3BUDA 3MUZ1 1QAWA 1BJ1H 3RPBA 1JGEA 2DQTL 3DGGB 5DWPA 1A7PH 4PRAA 2NCMA 4NI6A 5EBLB 1X6LA 1DO6A 3Q6FB 4MA3B 1NIAA 2EXTA 4UV7L 5B1JA 3U9WA 3QWOB 3OXSB 3RU8H 4JFDB 1E30A 4JKPH 2ZAIA 1QA9B 5I0ZA 5DI8A 4CUCA 3OKDA 5JIPA 4R90H 4NQVB 3L95B 1CT8B 5TF1L 2VE6B 1TVDA 3DOHA 3DX8B 4JFHD 4WUUB 5CJ5A 1EXUA 2SEBB 3T0EC 1MELA 5AKTA 1O0VA 4FLOA 1SN0A 3CZSA 1A2YB 5J4MA 2CO7A 4RIRA 1BQHA 4JQXA 1QNZL 2AANA 3RURA 4F7CB 1QHQA 4FL4C 1S78C 4MAUH 1RU9L 3OJ2C 4NZTH 3R1GL 1A7NH 2YXMA 1T21A 3BPCA 4G1MA 1R3IH 4HGKC 2JKSA 3K74B 5KVEL 1U8QA 2C7FA 1AGBA 5KUKA 1Y6NR 4Y16C 4ELMB 2NY1D 4XB8A 1NGPL 1MHHB 4GW5B 4XNZB 4A7QA 5E5MB 4FNRA 1RD6A 4UOW1 5AOMA 3SE4A 1YYLL 4U6HA 1R17A 4I77H 4B7IA 1WBZA 2M1KA 4BINA 3RPIB 2NW3A 2ICES 5D2LE 1SBSL 5ANMB 4GIOA 4XCEB 1DFBH 3QXTA 1FYTA 2XFXB 1JWMA 3S5ZA 2YEVB 3GHEL 5KVGL 4KJQC 5H4YA 1JZ2A 4LCWE 3QULA 4FX5A 1I7TB 3BHBA 4J5VA 5GZOC 2C4XA 3QUGA 5I19H 2MH4A 5HHPB 3BYTA 1MFEL 4E9TA 5EG6C 1YNLH 3CDCA 2E56A 3U6RB 3IM1A 4ZPVA 3JWDL 4G72B 4NBYB 4CVUA 2BNRA 3G08B 5I9QB 2JLPA 4GS7C 5E6ID 1UOLA 5F9JB 2NUTA 4E5XA 4AQ8A 4E9RA 5C0AB 2ALAA 3ZDZF 3EBAA 1GS8A 3CH1B 4ZX5A 4AQEB 4OV5B 3OSVA 4FMKA 1EMTL 4KKBD 1XBRA 5ALCL 4OF8A 4J3VA 4QHMB 4ZD3H 1S9VB 4HXAH 5CN2A 3BFOA 3AG4B 1AO7E 1BQKA 1XCWA 4JFQB 4WTXA 4TRPH 4F5CE 1HE7A 3VG9C 4NUGL 4YXHH 1N6QL 2C3XA 3FYIB 5FFLA 2DJSA 4ZFGH 1KN4H 3MVSA 3S35L 5INDB 2KKQA 4ODHL 5IQLA 1TVBB 1YHPA 1AIZA 4IYKA 5EEWA 4LXFA 4ODXA 5ITBL 3Q9PA 1ZANH 2XBDA 3FFDA 4BDVA 1R5VA 3AS1A 4JPQA 5LWYH 3SDDA 3ARXA 3QG7H 1LO4H 4ELDA 5C7XH 3BN9C 2HH0H 4CC0A 2ZD0A 1JNNL 3FO2A 3WD5L 4E9VA 5L0QC 2WCPA 3QB7C 2AQPA 4WV1C 4M7LT 3VGHA 2NY0B 1MHHA 3NG5A 2IWKA 2KT6A 4FC3E 2X53A 5CJQL 5F9JA 1SJHB 1B6UA 1P6WA 3QUXC 4N2LA 2BSEA 1Q72L 3ARFA 1M3IA 2VQ1A 3RPKA 5T1LA 4P4KA 5I0VA 4NQSA 3LPPA 4G70B 5E5LA 2YGVA 2Y2YA 4QWWC 2MIZA 1YNTA 1KDIA 3BP6A 4S0HA 1WZ1L 1MIEL 3I6KB 2FX7L 3W2DH 2WMPA 3KAAA 3QNXB 3WY3A 1TJGL 3V4LA 4JR9H 2DDQL 2UWEA 4OZIB 3MNWA 1AGCA 3BVNB 4OU3A 3AFLA 4C56E 1ES0B 2ED8A 5L2KB 4RFOL 4YJZL 2ZCHH 3RL2A 3QEUB 3VYOA 3S3JA 3TVMC 3ESNA 2F5AH 4FQIL 4D7PA 4WI9A 1JGUH 4NKDB 3MBEA 5E1HB 2C4FT 3ULVD 2GABA 3EADA 2BRQA 3DTDA 4G5ZH 4QTHB 2K7QA 5DO2D 1WIUA 2JKJA 2K8MA 3FNKA 2A6DB 4QHNB 1WP6A 1HDMA 1NQBA 2BFGA 4HJSA 1ZKAA 2B59A 1VHPA 4C57C 2B1AL 3H4FA 4PBVC 4GG6B 4YDKL 4YH6A 1J9CT 3FAWA 4K55A 4CU7A 3WIHL 5DQJB 3EH1A 1WCBB 4WRLA 3QIBA 4A68A 4HIXH 2KQNA 4XPBL 5DA0B 1NCOA 2VXQH 4CC4A 1S7VA 2BSTB 4IU3A 4ZRGA 2NUTB 3U1PA 1PZ2A 4UMSA 5LLIC 3FN9A 3DOIA 1H19A 3ARBB 2V2TB 1XIWC 2IWEA 5DF0A 1KOAA 1A9BA 4JG0L 2CKBH 4P5TD 4FI7A 4OFYD 1R5WB 1RZ8B 3VXPA 4B50A 5JUEL 3WLWC 2QMJA 3L17A 4LL9A 2Y6SD 4JFQA 3TCLA 2R0ZL 1F13A 1QEWA 4FP8L 1QLFA 2QLVB 1DBBH 4GXVH 3S3DB 4PLKC 3ARDB 2B8OT 4Y9BA 5DC4B 5ECGA 3I75B 2D7OA 2R83A 2EE0A 2HJLA 4YQXL 3QHFL 2YD9A 4LP5A 5L2JB 1U8JB 3VNZA 4KITB 4FAAB 1Z32X 5D7JA 2WLJA 5IHLB 4RAVB 1IKFL 1NBVL 2R9HD 1P4IH 3QO0A 2L0DA 1Q9WA 2IDCA 4QTIL 3FCTA 4Z7AA 4YVUA 5ISZD 3AU0A 4BCYA 3GGWA 4BKTC 1KIRA 3L5HA 1SYVB 3NSXA 3O3AB 4GINA 3WXWH 3QIWD 3QRGL 2XV2A 2A6KB 4HS8L 3HNSH 3BP4A 5L9DH 3V5HB 1WTGT 1OAZH 3K46A 3OGCA 4PJCF 3FT0A 2GJ6D 4ODTL 5B21A 4N0UE 5HYJE 4RBPH 2DL9A 3UJIH 3IE9A 4DZ8A 1N67A 3CN1A 4AXWB 4TNVF 2EDJA 2R7EA 1B9KA 1K8IA 2OLDA 2KC0A 4M48H 1CWVA 1R3IL 4IK7A 5C08A 3TV3L 5C9KA 4GXFA 3KYNB 5DK2B 1HU8A 3SKMA 1K8IB 1IAII 1J0HA 2J88L 4FN0A 4LMQI 3UROR 4X0NA 4ZFFB 3QXAA 1BAWA 4K5OA 1R24B 2P5WA 2VLJD 3AREB 5DQJA 4AITA 1I8LA 3VGAB 3OR6A 3P54A 2L7UA 1ZA6B 3MBXH 4GMSH 2JI2A 1ZS2A 1E0OB 1PJ9A 4HJGA 2VDMB 2VO5A 4XCNA 3TYGL 3UAJA 4IIQA 5EU4B 5FEBA 3VI3E 5SWQB 2L04A 3FO0L 1OAQH 3QUML 4P4RA 5JXEA 3ALWA 3O9WD 1GVIA 3C60D 5C0FB 2YEZB 5B1KA 5E24E 2ZWSA 1UUNA 4NC1C 1ZD6A 2XHNA 3MUJA 5FF6A 3VCLA 2KMWA 1AXSB 5CR8A 5DVPA 5I19L 1B2WH 5GGRY 4JW3A 2D7TL 1SBBA 5EEXA 4KZDL 1OB1A 4JGMA 1EAJA 3SHSA 2X70A 4GSDL 5BOZG 1BD2B 3RWHA 1HCZA 4BQ8A 4PIBA 1NBCA 4GQQA 3O4LD 5C09A 3TO4B 1H5BB 3LEVL 1MJUH 1KGYE 4FQ2L 1N7ML 4U1KA 3VGDA 1QUNA 4LKCB 2KZ1B 4AQ1B 5EIIA 1KXQE 3GRGA 1D5IH 3MR9B 4UDTB 3SD2A 4MCZA 3MLVL 4ENED 2ZP9A 4N2NA 2H47C 1TEYA 1NFKA 1ASQA 4MAZA 4O5LL 5DMKB 5FUCC 3B56A 4NQTA 3ABMB 1WFMA 4Z3EA 2WQ8A 4PBWD 1M7DA 3SY6A 3B8SA 3FQTA 4H1LA 5F7UA 1N6QH 3QPXH 4UAOC 2IOIA 2XNAA 4K8RD 4UNUA 5IVXA 4ZMZA 4ZDHB 5IQOA 1P7HL 1H8NA 2W9LA 3ABLB 1TPXC 2GSMB 2YD3A 2OX5A 5DUBB 2V7NA 4IOFC 2BSSA 3L3IB 4QRPE 4JFZL 5LWYL 5CGYD 3TWCH 3U7WL 5J9PA 4WAFA 1JDAA 1XZWA 4CMMA 3WNMA 1DBAL 3ZHNA 4JM2C 3VD5A 3MCKA 3MLRL 3MRGA 5F71A 3WD5H 1BFVH 1NCJA 1OP5H 1ZLSH 1ACCA 2AC0A 1YRKA 3RJDA 4YC2B 4A2GA 1QHOA 5AZEH 2IADB 3ARZA 1F02I 5DRXA 4Q7DA 2X89D 2J7LA 1HAUA 1P7KA 3WN5A 2CUAA 2KYIA 3ARGA 5IKCB 3BGMA 3KPSE 4MB4A 4Y16A 1FG2B 5IY5B 1HKLL 2CO4A 3OAWA 3QAQA 1JF1B 1SFDA 3OC5A 4HS6A 4GSQA 4JGJA 4OSUH 5HDBB 3VRLE 4IDJL 4LKCA 4JM4L 1VCAA 2DWEB 3C09C 1CK0H 1PZ5B 4APQC 1CBJA 4NP4L 4HMCA 3NAAH 4PD4K 32C2B 4YHMH 4ZI8A 3BMWA 4ELKB 4NO2B 2FX7H 3ZL4H 4YDJB 3DXAB 1HCVA 4AZ8B 4N8UA 2K4AA 1N8OE 2X87A 3M1OA 2CA3A 1BM3H 1ZOXA 3S3PA 1UHVA 3N43F 3MV7A 5FLVA 4PJBA 1T0PB 3ZKSD 4FQIH 1K4DA 2YN3A 3N50A 1KGXA 2OMUA 3SPVA 3B5TA 4PYGA 2DBLH 3K6DA 3RVTD 5CF3A 1ETA1 2O5NA 1RZQA 4Z7QB 5K33A 4WTQA 4I5BA 3LPGA 4PJCB 3IJSB 3QORB 5J12B 4JL2A 5BZDA 1UB5A 3D05A 4TRPL 4YHLH 4ZTPL 2GBVA 3RVUC 3BZ4B 4J28A 1NL0L 1L9TA 4Q9CA 4KJWD 4YSCA 2AQRA 1JWSA 3HI6L 4P57B 4DNLA 1MLCB 2ZZUT 3IXAA 2NX5A 4H26B 4QHUA 4AKPA 2SEBA 5LN4A 4UQ2A 2AEQL 1QKZH 2RH0A 4O02A 4LCWB 3ZRCC 3KPRB 1QFOA 4L48A 4EVNB 5LBSL 2B39A 3PIQA 2DM3A 3MC0A 1FDLL 4Q6KA 5ANME 1GL4B 3L3OB 4F15C 1JHTA 2KZKA 4TUJA 4DCQB 1AOHA 2HH0L 1EXHA 4U6YB 3AABA 4I0PA 4NQXA 4RZKA 2BJMH 2QADD 1T0NB 5AAMC 1KPVA 3CLFH 4DEPC 1CPUA 4RDQG 3RFZA 1B4LA 5EEUA 2GHZA 4P5RA 3MRGB 1AC0A 1BOYA 1LWRA 1JGLH 2EC8A 5FDWA 5JUEH 3B5GA 5CINH 2XQYG 3CC1A 1RHHA 1AHWB 4NAJA 3FBQA 2YFNA 3TONA 4PRPE 2VJXA 3CFCL 3F6JA 2J21A 1NLDH 2NY3B 2XN9B 5A16A 1I1FA 3C2SA 2XWXA 3RZCC 2B3IA 2KZWA 2A6JA 4XO9A 3JVFC 1A6TA 1AZNA 1QVOA 2UVFA 3S34H 3HMWL 5CEZH 1IARB 1BLIA 1I1AC 2WWMC 4ELME 5AW2B 1CYWA 2AXHA 3J7HA 3TESA 3O6LH 4G7RB 2BY1A 2UZXB 1ULVA 3ZDWA 5J7CC 3I6GA 2NNAB 2MOQA 1NC2B 4R4FL 1GSMA 4AMKH 4FRWA 5JQIB 5ADPH 1JCVA 4Q2ZB 2JVUA 3PDOB 2VERA 1JHLL 2PW2B 4H40A 4XVSH 4JQIL 5DMGD 4QDGA 2XWEA 1E3FA 3AM8C 3TL5A 2RFXA 1VJSA 5DZLA 1EGJL 3VXSE 1FFPB 3SYQA 1XD1A 4LPWA 5LXVA 4HS8H 3TN0C 4F57H 1F3RB 3TZVC 3QDMA 2G3NA 1GKEA 2UY6A 1BZ7B 1X5MA 1VB9A 4FABL 1DVQA 3IDJA 2BVPA 2A9NH 2FIRT 3M6DA 1MWAB 1KV3A 1DDTA 5BZDB 3QR0A 2NY0D 1EBAA 5BRZD 5LQBH 3QJHA 3TV3H 2QELA 4XH2B 2AKRB 1XR9B 4KO9A 4YHOH 4HV8B 5JDJA 4Z76A 3ZQ9A 2FGWH 1WRFA 2XPYA 4XE0A 5C92A 3ZL1A 3H6JA 2AMUA 1EEZA 2Y23A 2A9MH 3A4FA 3LKNA 4GMSL 5T1JA 3DO7A 3G5VB 4S11A 2Q87A 5EO0B 2H4EA 1YPZA 2VLKD 3WI9A 2DICA 2NZIA 2WPGA 3C2AH 4PJGB 2VN6A 4P5TA 4XOBA 2W38A 3RWGB 3V6OA 3ETBJ 4XPTL 4HJTA 1U30A 1UWFA 1G1YA 3DURA 1FNEB 4JBSA 1OSZB 5HGBB 1MXGA 3BUTA 1PG7W 1FRGL 2DKMA 2WTRA 2UY7B 1ILUA 1T7YA 3SKOB 2ENJA 3SGEI 2HRLA 3K5RA 2HKHL 1CXKA 4LNRA 2OMXB 1T03L 3MQIA 1I8MA 4ZW5A 1KC5L 2YPLD 5KSBE 4X4ME 4MNQE 3IDYC 5HHVH 3DX3A 2EDNA 1YEJL 3VU2A 5JW5B 2Z4QA 3L2MA 5CCHE 3VTTA 1J8RA 2X2JA 3U9UB 3QJSB 3NP4A 2VC2H 3GBNH 5ESQA 2FHCA 2AJYL 3BO8A 4HA1A 4QHMA 3O8XD 2DV6A 1D9KA 4UAOB 1TJIH 1CD8A 1GYCA 3GXTA 4FFZL 4S1QL 3Q1SH 1RUML 5CEYB 1DVUA 2DQHL 4AGNA 4LSPH 43CAA 5DQDL 1UUSA 1C16B 3C87A 2JXMB 3R7RA 4XNBA 2QJDA 2OMNA 4PBDA 2VDOB 4OFYA 3NCCB 2Q2LA 1THCA 2EEFA 3FBKA 1SUHA 3MRLA 4JRXD 3QPXL 1IGYA 4YUEL 4QOKB 3NDZE 3GHBL 3BWUF 5AW8B 2C9RA 2R23B 5LBSA 5BRQA 4U1JB 1R5VB 2PPCA 5IFJA 3C12A 5AAPA 2MEJB 4HHAA 3SCMA 3PDGA 4YHZH 2BVEA 4MJ4A 2AJXH 3FT3B 4WWKC 3UYRH 3X3GH 1N4XL 5CZKA 1NC2D 4PJ7A 2JE8A 2VM4A 4K4KA 1UCBL 2ZP0T 4URTB 1GJIA 4RGND 4DGVH 2ZONA 5HYQB 4O58L 1IZKA 3H9ZA 2FSDA 1M2OA 2PYEB 5C0CA 1I7UB 5CD5C 4O02L 4A6YB 1NMBH 1Q94A 1I82A 2EZ0C 3FH5A 2LHAA 4ADIA 4OV5A 3A3YB 4ES8A 5MEQB 2WOBA 4KJPC 4P4KD 3UG4A 3IJHB 5AB0A 5F1KC 3ZE1E 2DI7A 4Q89A 3AG1B 1MFDH 5IVOA 1NCCH 3UL4A 1U41A 2X41A 3GIVA 4IMKA 2CR0A 4YDVB 5TFSL 1BIIB 1LO5A 4RDBA 4DAGH 5F88A 3PS6A 5IR1B 1HL5A 4GSDH 3TBTA 3VG0H 3ZDXE 2PABA 4AJVA 4O2FB 4BK5C 5FYKE 4YHYB 3P77B 1L6PA 1MZZA 3ARBC 4EO5A 4HBCL 1MJUL 3IDGB 4L3FA 3VD3A 2ZXCA 3VFWA 5DSCB 2P26A 1M05B 3BFQG 3K2UH 4G59C 1F8TH 4P99A 4HUCA 4OJFH 5SWSE 3H8NA 1N5AB 4O5LH 4X6EB 2Q3AA 1CD0A 4ZTPH 4YHLL 2GQHA 1FV1B 1BQRA 4NUMA 3U83A 3MGOB 5DUPL 3MZTA 2IGFH 3QIUC 4W6YB 5F7DA 3ZYOA 1NBZB 2FBOJ 4LVNC 5FB8B 1MAJA 3C09B 2B5IC 1T0MB 4YHKH 3MRLB 2VITB 4HWZB 4PGCA 1INQA 4Y5YA 1B0WA 4PGJA 3UTZA 1FDLH 4N20A 1BIHA 3HPLA 1CF8L 3ARFB 3LRMA 3NZSA 3TVMD 3VTAA 1P5UC 3BRGC 3NFPA 4AJ0A 4MA7H 1HQRA 3Q2VA 5EH1A 2AVFA 4TUOB 3O41B 3MX0A 4R8WL 1KJVB 2WBWB 3MLRH 5LBGA 4FXKB 1VFBA 1ZLSL 3PFQA 2JCCF 3WFDL 3LEXB 4XP4L 1A21A 4HJIA 3CSTA 3E8UL 1QASA 3SKJL 3KLAB 4UTAH 4POZC 1M9SA 2R0WH 3V95A 5CD3B 3AQXA 1N0XL 2I60L 3OB8A 2E76C 5E2TH 1SN2A 2C3GA 2HKAA 1QFWI 2ITEA 3HKZA 4LLYB 4Y2OB 2H5UA 4LLDA 3ARVA 5CEZL 4JM4H 2VXQA 5C0AE 3MNVA 2GCYB 2IXQA 2D8KA 1O9WA 1NUGA 1RK1B 4XPAH 4F33A 3MUUA 4FG6D 2AZUA 2FB4H 4RGMC 1F4HA 5EOCH 2NRDA 3ZL4L 1W72L 5E8OA 4FHJA 5AKVA 1GZHC 1MOEA 2VO8A 5J13C 5E8EB 2R29H 3S36X 1BM3L 1WFOA 4ZMOA 3HS0B 1RUQL 4W9LC 2I5YL 3VFRB 4HUKB 2ZSWB 3BP4B 2J2ZA 5DQ9A 1YEGH 3ORJA 3UAJD 3RY6A 3Q48A 4HWNA 2FNWA 1TZIA 4PLJC 3RGVB 3K8KA 4KRLB 2YRZA 4Q97A 1TT6A 4QEGA 5FGRA 4J3XA 3HUJF 4PLKD 1XT5A 3V7AE 2H32A 2VYRE 1X44A 1QG3A 1X5YA 3WOVA 2VLME 3LXBA 3NUKA 4AIOA 4CVWA 4X50A 3HJEA 1F58H 1XH3A 5KN5B 2Y5EA 4XVJL 1BD2E 3QC6X 4IKJA 4LSUH 4K8RL 4KROB 5GRUL 4RMVA 2WY3B 1XDTT 2XU9A 4XOCA 2VR8A 2DYPA 4HUMB 3WIIL 4F2MA 1E9PB 2R0LL 3GSRA 4PI2A 4Q6IB 1UXWA 3IEAA 1XGTA 4ZOEA 2ZIDA 1AE6H 2EH7L 3H7BB 4ODBD 3KHQA 2AV7A 3RL2B 4DF9A 4KK9D 3AGVA 1R3LA 1TZHB 2VKXA 3OJDA 4TUKH 4E5XG 2DH3A 3C5ZD 3OAYK 5IOKA 4OT1H 1KBBA 5D6DC 3HPJA 3AY4A 1GIGL 2J25A 4Q6IC 3LKOA 4P23D 4JFDE 1KIPA 5IW3A 1BREA 1PW3A 4ZMTA 4FXKA 3F5WA 1QI5A 5LG6A 2K6ZA 2YPLB 2OP4L 5KW9H 3O6KL 5DD6B 3DLQR 4Q0XL 1FRGH 1IAKB 2CBQA 5C0BA 2YHGA 3TNMA 1Z9NA 3S5LA 3VI3A 5MERA 1L9MA 1A6VL 2K3TA 4JY5L 5IK3B 3PWNA 1N19A 3TPUA 3WY2A 4KNUA 4OW6A 5EZJB 1Q9KB 3VRIB 3U6XA 4TTDD 5G4NA 4IKNA 1T0MA 4G8FB 3PWLA 2AJZB 5HHVL 5DS8A 3ROOB 1KJ3L 3LB6C 5A7EA 3EUUA 3MOBL 2AZAA 3TBVA 3DUHA 1L9NA 4W9JC 1P0SE 2B14A 4DGIH 4EUPH 3PWJB 1YYML 4OD2B 2R69A 5JPMB 4MX7A 2BY3A 5HPMB 2HFGL 5CFAA 4JQIH 4KPHL 1GSKA 1ZT4A 3OWEA 3Q1SL 3IGKA 1EPFA 1KELH 2DQHH 1OE2A 3D87B 2A77H 4GRWH 4IQHA 1U42A 4H13C 3ARSA 2DMHA 2NTFA 4TLKA 5GGTA 1LE9A 4KGLA 4BE5A 1UWGH 3QA3B 4AE0A 3MRHA 1GMIA 2MCPL 4ZBJA 4UUJB 1NICA 5JPMC 1VIWA 4LHUG 2ZOKA 5AOZA 3G5WA 4K7PL 3EGDA 1JVLA 3LQZA 4F8QA 2FX9H 3D51A 1F90H 4JHWH 3KLQA 3RWIB 3QIWB 5DJ6A 3W57A 2VAJA 2Y4SA 2W1NA 2QDWA 3TZVA 4GG8A 1I9JH 3CZJA 2E7CA 2DLGA 1E6JL 4Z77B 5I6KA 4JFEA 1TQBB 2ADGA 2EO1A 2O4EA 3E9TA 4MS8D 3WDIA 3VXOA 3TPUB 5I17B 3QJFB 2ZE0A 3CFKA 4UF7C 5JIHA 1JN6A 4P06A 3N1GC 2X0WA 1LTXA 4GI9A 3P02A 3DX6A 1HINL 4M7JL 3I6LE 1FL3B 2P45B 1RJZB 2NXZC 3IJ7A 2ERJC 4QJ3B 4B9FA 4JO1L 3SKUD 2WVUA 1JYVA 3QH3A 2X4SB 1G7MA 3ETBF 2IVFC 4N2DA 1EFXB 3VFOA 1XHHA 5C07E 3TBWA 3V6FB 1NCCL 2X1WL 3GZPA 1E9PA 4P8QA 3EYQD 3QQDB 4IHOB 1SVZA 3BH9A 3UTSE 5A2JH 4P2RD 1L6ZA 2C7UA 4I0PD 4U2YA 1EAPB 3R4RA 4IBVA 1H0DA 2F7OA 3ATAA 4KXAA 5I6XC 2NNAA 1DQIA 3BPLC 5LKNA 1EH9A 1H3UA 2H45A 1FCCA 2X6AA 4OZHA 2JTDA 3DXAE 1TJXA 4J8RA 25C8H 2J5LC 2DM4A 1DUZA 3CFJB 5D9SA 4I0CC 5I8EB 5J9PB 4P46D 3PAUA 4BWWA 3F65A 4EZMA 3VXRA 2JB6B 5BXFA 3APDA 2NX5D 2V4LA 5E1GA 3W9EB 1UVQB 1VKXA 3BDYL 1RZIA 2Y25A 4YFDB 4ZODA 5CN1A 3BWSA 3QRLA 2WZPA 3V9EA 2J5LB 3VRLF 1IFRA 2F58H 2CJSA 2CGYA 3PHAA 5E6YA 5I1GL 3QJOA 3W39A 1SDDB 2AW2A 4BZ2H 3EYVA 1T1XB 4AUJA 4Y4FA 3QUHA 5IJKA 5LCVL 4KKNA 1YMME 2XZAL 3F7VA 1JNNH 1OANA 1QD0A 3OLDA 1QUNB 4AQ1A 4XP4H 2CJ3A 4UU9B 1TQCC 4P5KA 1OP3H 1FHNA 2ZX7A 1RURH 2EXYC 5CLZA 2VLKE 1JRHH 4IKKA 4KJWC 3LKNB 4NC2B 5EU7C 4O02H 1SXAA 5M94B 4KXZI 1P4BH 5EC2A 3BOVA 3P40A 5DHVB 2Z8SA 2OA9A 4L8DB 4WY7L 5GRVK 3WUWG 2AJVL 4JRYE 3IJYA 4I2XB 1DBJH 1DLFH 1MFDL 4LZKA 3II1A 3BAYA 3CNKA 4OM1H 1KCRH 3ZMRA 3EH5B 2X89A 3P9LB 1MXDA 4OCLC 5FM5O 3V4VA 1DQQB 5IB1A 3JV4A 2MWCA 3TS8A 2H0FA 5FHAH 5H37A 1QTSA 3MMEB 2C1OA 3KYKL 4N90E 4IJ3B 4IEFA 2VE6A 3EJZC 1YEGL 3FC8A 3P30L 5EN3A 4N8VA 4K9EC 3DSFH 3V52H 4QAWA 4C4KO 2GB2A 1BQLH 4JHAL 1JHTB 4H8HA 4OZHB 4EDWL 2R1YA 3VXSA 2MNWA 1XH0A 2WWMD 2YD8A 4X8XA 2XIBA 5C3IA 2VMDA 3MI6A 3R06B 1Z9SA 3LSOA 1TR7A 1QZ1A 5K69A 5DK0B 5GRUH 3VFOB 2V17H 3HZMB 3UFIA 1IAIL 4NXKA 3MCLL 3F8UB 1KB5B 1UM4H 2ADIB 1YO4A 5JA8B 7PCYA 4A37A 3UPRA 1ZLUK 5E8NA 4OGXH 4FQJH 2W9DH 4LCYA 1TYJA 4HIXL 1ORSB 4GIPD 5CZXC 3G5VA 4O00A 2NCEA 3H42H 4KMTH 5GGQH 4HHAB 3BAEH 4P59H 4KJYB 1RIHH 4OBSA 3TN0D 3TZVD 2X3CA 2VKWA 1U93A 4OZ4A 3OKYA 3MRDA 4HK3N 4JG0H 5I30L 1F6FB 2HVJA 5C9JA 1L3NA 3JTTB 5LHDA 4MMZA 5IVXB 5F7NC 3V10A 3CFNA 1A8ZA 2R0WL 1BAGA 3F7QA 3O2VH 5KAQF 4R97B 1OP4A 4A7VA 1ACYL 3DSNA 5HYQA 2D0HA 3TH3T 1G6VK 1R33A 3DX9A 3WHXA 1XCTB 1OSPH 4QHLA 2CKNA 2OSLA 3VJ6A 3VSVA 4JPKH 1CGUA 4OR1A 5I1JL 5DTFA 5AUMB 2YJQA 1ZDQA 2WINB 2Q86B 2V9QA 4YLBA 4XNQB 3MODL 4MXVF 1AKJD 2H6OA 1OO2A 1JZ4A 3W39B 3WAJA 1MQKH 1KZQA 1SGKA 4LGPB 3SGKA 4KKCD 3VFUB 4L37B 1KV7A 4Y5XB 2OJZL 2O61B 1VEPA 5T33H 5DEGB 3EH2A 1CLOL 2DQGH 5GGTH 3ILPA 3F84A 4PREA 1AGBB 3DRTB 3ZJAA 3T4YA 2G30A 2NX5E 3HG4A 5T3ZH 4NDMA 5EZOH 1U92B 4Y2DC 3IFOA 1HSBA 3AQZA 4N8VB 1V3LA 2VDMH 3JTSA 3PHQA 4WI0A 4LHUB 1WAAF 4KH9A 3SCMC 3ZO0A 2A7BA 2R8SL 4K94L 1JFQL 3AB0C 2Q7YB 5I5IA 5DRWA 4PJ8A 1T89C 4LSUL 4YPGB 3PHQB 4JFXB 3CHSA 2P4AB 4WI0B 5ICUA 5D7JD 1SRDA 1INDH 2A6DA 1Q0YL 2Z34A 4QHNA 1TYEB 4UINH 3PP3H 1QBAA 1PFOA 2C3VB 5DK0A 4ZXBD 4Z5RB 4NQVA 1QSFD 2NSQA 2Q20A 3D25B 3SGKC 3O81A 3PQYA 4ZFOL 1A64A 2CNZA 3QZMA 2UY7A 4TOYL 3QWOA 5DJ0A 1FVCA 2FGZA 4H1LB 3N41B 4JFDD 4M3HA 2BVQA 4Q9BA 1GIGH 3DTUB 4EQ2A 4NO3B 5T1MA 1T7ZA 3UJJH 5JXAL 1AHWC 1Z3GH 5D1XC 5SV4A 1BZ7A 1IVLA 1FSKB 4UZUA 5F7WC 3SPIA 1J5OH 2PPAA 2WIIB 1SXCA 1WHOA 3G04B 3I02A 3FT4A 3L1FA 3LZRA 1MPAH 4HIHB 3STLA 1EANA 2JF1A 3OL2A 4L4TB 4BK5A 3SDCC 4FYRA 3VQLA 1BYPA 1B9ZA 2RTTA 5HP5A 2PNDA 4FNLH 1AR2A 1RJLB 4B9YA 3RHWF 1KXHA 1ZV9A 3CCHB 4EN3D 3UX9B 3NJKA 3DJZA 3PABA 2P5WE 2YUZA 4OLWH 1ANUA 1LQSR 1OGTB 2CO7B 4RIRB 4AT6B 1JTPA 4U1IB 1GAFL 4Y2LA 1FFQA 4XBEL 3TWYA 4B96A 5DWUL 2CRIA 2VLRA 2X2IA 1JSYA 3HW7A 3D4GA 5E9NA 2EACA 2EZ0D 1AGFB 2PR4L 2XOTA 4LQFL 5AFAA 1DR9A 4QHKJ 2ZUTA 5DJZB 4BDVB 1A02N 3NJJA 1L7TL 2J2ZB 3LH2L 2BY2A 1G7JB 3RA7H 4LVOC 3WYRA 3R0MA 4KZEH 4N85A 4N0FA 3DRTA 1MZYA 5EOTB 1NCNA 1LEGB 1G7IA 5BV7L 4U33A 4P07A 1XIWB 2JNZA 4K7PH 5DXWA 1EXGA 5D1QB 2ESVB 2AQ2A 1XXDC 1F11A 4YL4A 2G9KA 1JI1A 2BCKA 2X42A 4JFXA 3IU3A 4YC2C 2LFEA 3JSSA 5LCVH 4HD5A 4QRQB 1KG0B 5CMAB 2F8VA 3IJHA 4X5PA 3MRBB 1MKFA 3BYYA 2DQEL 5GZND 1NSNH 4UOJA 5FUOL 4MXQD 5B7FA 4PTTB 3DVIA 2D3NA 4M9PA 1OCWH 2EDDA 2PWFA 2NY7H 2IH9A 5CLWA 4BFOA 4DT2A 1NGYB 2VJ0A 2UXFA 1HKLH 4TNWF 1PS3A 2A9BA 3QNYA 1IEBA 4MNQA 2JK5B 5T3XH 7CGTA 5BUGA 1EWHA 1WA0X 3IDMB 1TLMA 1KPRA 2Z93B 4HIQA 1WFIA 4L23A 2IV8A 1JYWA 4NSKB 4YHML 5K39B 1I7TA 3FT4B 1FWXA 3MYZA 4OM1L 3PWUA 2PMZA 1KCRL 1T5KA 2QTEA 3M46A 1EDHA 3A67L 3D9AL 4IGBC 3SCMB 3ZHFA 1SYSB 4G3YH 4LL1A 3CN4A 2LLGA 5FM5M 5ESAB 3GMNB 1KTKE 1RPUA 1PIGA 1PLAA 2WP3T 3BPOB 3HRZC 5I71C 5KG9B 1WFNA 3UJTH 4Y16D 3BP7B 1A6UL 1SVBA 2NY1C 1EEQA 1UH4A 5H37G 1U8HB 1UGNA 4XNXH 3FQUB 2GSIB 2VDOH 1MAML 1YNTB 3QZNA 4K5MA 4DKTA 1AS8A 1JPEA 2BVOA 4FJ6A 4PCTA 3IETB 3UBXI 4BCXA 3GSXB 3L5JA 2DWXA 2V2TA 3KDMB 3EJUA 3JBG7 1U8CB 4NYLA 2CGZA 2CJTA 2LU3A 3REVA 4EI5A 2OXHB 4EUPA 3ZDYF 1IAMA 2VZ1A 4AKQA 1VZHA 1BQSA 1OCZB 1TXKA 4XRCB 4Z7UE 4L4TD 2F58L 2K0RA 3SDYL 3K7UA 1NOFA 3WKNA 4CW1B 4EI5B 4EUPB 5GZOD 5J6SA 3Q9QA 5LBSH 5I1GH 4RWHA 4N5UA 4NHCH 1JPTL 3UIZA 1ZA6A 3GLAA 3N40P 5GGQL 4RRPG 5J13B 1Y07A 4Y5VB 2FQDA 2JKRM 3S37L 1ZXQA 3GPEA 4UYQA 2VABB 1PNCA 5EC1A 2W65B 4G71B 2X4RA 4Y4KD 5A3ID 2EDRA 3I74A 4NKDA 4IBUA 4S1SH 5DD6A 2WLNA 1UT2A 1B3IA 3FUHA 1WITA 1EFXD 5LNGA 4DW2H 3HB3B 1NGWA 3O2VL 4JDTH 1KFAL 1O6VA 4LIQL 1AXTL 5ESAA 4F27A 4AW7A 5DUML 3ZQXA 2HMID 4BZYA 4MD0B 1NEZB 4P0DA 3UO8B 4QRBA 4XO3A 3WEOA 2O26U 4WWKA 5I1JH 5FW8A 5FCUH 1TVHA 4HUWA 2Z31B 3V5HA 1H8SA 1MEXL 2PP8A 4ZK8A 6CGTA 2J6EA 3U4EA 4R4FH 5ADPL 4XN1A 5JIIA 3VG9B 5IOPA 1JHLH 4J1UA 4LLVB 2R59A 1MCBA 4XVSL 5GISL 1ZA3A 1XGRA 4GB9A 3BUYA 3ULUL 5AOIA 4YSQA 2WW8A 1KPUA 3AXHA 4G42B 4L4VA 3KWTA 2P24A 4LMQE 3PGCB 2PTUA 2PKDA 1J9RA 5DR5L 3IS1X 3IXTA 4FS0A 4ZUUA 2Z4QB 5DJ6B 1Z2KA 2HWZH 5EOQL 3U2SA 5CEXB 3QHZL 4TTDC 2WLLB 4N0UB 1BECA 5HYJB 2WXHA 3D2UB 3B2UC 3DX7B 2UZIL 12E8L 3BWZA 3ZKXB 1RULL 3IBEA 3EXLA 4I1RA 4G1EA 5EFIA 3MUHL 4J7RA 3MCLH 3VXPB 3HFML 4UI2A 3ZN6A 4F8OA 3DUUB 4J6RH 3P4LA 4Q8BA 3TA3C 4YPJA 3TJHD 4EE2A 1BFSA 1F6AA 5KJRH 3JYBA 3N40F 5C07D 1P5UA 4JDEB 4U2ZA 3P11L 1HTYA 2A9ML 2XYBA 2YGOA 3QHTC 1NCBL 5A2AA 4ZJ9A 1XGUA 2FJGA 1SNRA 3LV3A 4MAYC 3WXVL 4HCRH 2AERT 1MRFH 2FEDC 4OFIA 2UXGA 1YEDA 3U0WL 3BH8B 4P2OD 4PW3A 2K9FB 3UDWA 2A4ZA 5EU5B 4GSRA 3PL6D 5EU3B 4XZUB 1H15A 5EU6D 4Z3JA 3KPPA 1J0YA 1QWNA 3DVGB 2XKSA 3KDMA 4GO9A 1VACB 3SPCA 4Q4IA 1DQDH 5B39B 2P48B 3WNLA 4HJJH 4PY8J 3MJ7A 3WSQH 3I2CH 4HIEB 2VN3A 3BH9B 4M6OL 4MJIE 4P2CG 3WJLC 4WDIA 3KR3L 2FYYB 2PWDA 5G2NA 5BRZE 1E65A 3BRFA 3KPNB 4L29B 1AO7A 3MV7B 4OY9A 4Z23A 1U95B 2GW5A 4L8SB 2ARJB 2VDQH 4HG4K 2PCFA 4KFZC 4YE4H 4LLYA 5FGCE 3ARED 1MRDH 2HLAB 1V7NH 2GJZB 1AG0A 5JHDA 3SPGA 3FUJA 4ORGB 1UB5B 3OXRA 2XTJB 5DQDH 3FT9A 5H4ZA 1BFTA 4MQXD 2FZ3B 2AXJA 4KK8C 5ILTH 1IKNA 1XIWD 3MGAA 3U25A 4DKAA 4L8SC 1G6RB 5GSRA 4G83A 4P5TC 2EYTB 3V4VL 3G9VA 3GIZH 4I1NB 4Q56A 5F7EL 2ZOLA 3HI1A 3MXWH 4Z78A 4D0BA 5BV7H 1SF3A 4GKOA 4K94H 4DTGL 2IANB 3GMLB 1E6OL 2VSKB 3BZDA 3WHE1 3SDCB 4BA0A 1JNHB 1CFSB 5CHNA 2NQDA 3GXDA 1Q0YH 3NZ8B 2G3MA 5FOBA 3NEOA 3O11B 2K6YA 1TZIB 3PUCA 3H3PH 3TBVB 2PPDA 3D30A 5CIPA 2ODHA 4YLQT 6TAAA 1VERA 4XCYA 4HFWB 3RFZB 4Z1PA 1R19A 3MRQA 1E9OA 4OCSH 4AE1A 1UEMA 1LNUB 3RTQD 5JQ6L 4QLWA 1XB8A 4HT1H 4PJXF 4GQPH 3QAZC 4XP6H 2NY7L 2QTVA 2FR4B 4XO8A 1OPGH 4I3SH 3D4ZA 2VXSH 4EPSA 3RWGA 2J55A 2WZ0A 1H3PL 3ME0B 2FR4A 2QPFA 5LNDA 5CJXA 2UZXA 3WNOA 3FPYA 1FLRH 2EYSB 4LSDA 5HHOE 4M43L 4OIFA 5TFSH 2J1ZA 5IB1B 1U3NA 4MS6A 3ISYA 4TQPA 3KJ6H 3FB6B 1BQUA 3VFTB 5KBDA 4RCAA 2Z7YA 3CIAA 3KW8A 3QZWA 1BP3B 2BSBA 5E5UB 4I3RH 3DPBB 1XFPA 5GRJL 1YLBB 2EADA 3ZKXC 4X7DC 3IXAB 1KLUB 3JTBA 4OLWL 4AOFA 1I9RL 5J11C 2F5BL 2DL2A 4MZRA 3TNMB 3UJTL 2YO3A 3RDTA 4WEBH 2FCBA 2WSPA 1CFSA 4G9FE 1PD6A 5KYXB 2FT7A 2OW6A 4MJ5A 3T2NL 3CX5J 3UAFA 4MASA 4YLCA 2PXYD 3HBGA 3QUKB 1K4CB 1PFCA 5HVFB 1GKOA 2OW7A 1VGKB 1K8DB 2P5PA 2JKLA 5FO7A 3X1BA 1LE5A 1KBGH 4I48B 4YDJA 1QZNA 2EDEA 5BVJA 4OF6A 3O3DA 4Y5VC 4KZCA 3TIEA 4LSQH 2ADIA 1D7CA 2Y7NA 3H3KA 3QXDB 4W9HC 2OL3A 1NMAH 2BHZA 4F58H 5DCCA 2IO5A 5E1AB 4S1DC 5FYJE 3CZFB 4PRHB 4JNXA 1JRHI 1B6DA 2EC9T 3MYJB 4GLRH 2P5WB 2X70B 3HB3C 3PPSA 4ERSL 1OP5K 4AV4A 4XCCH 1LL1A 4Y1AB 1XXFC 1SXZA 3ROLB 5KBPA 3FL7A 2IAMC 3RWEA 1UD3A 1D5BA 2PO6D 2YC1A 3KCPA 5J6HA 3KPSD 4NKMA 3B6SB 3CU1A 4ZG1A 5ECJE 2EDTA 2ZXWB 1X5AA 3WY1A 4F9LC 3T3PE 4OLVH 3DX0A 3KLDA 4XAWL 5I6NA 2F7PA 3DDFA 3E6HB 5J3HD 1NANH 1GZQB 2WJ7A 1S9WB 2VH5L 3GI9H 3W9EA 3GSVB 3RBGA 2VM3A 2C5DC 2EINB 2H3XC 1LP9E 3G6JB 4F1SA 4MD4A 1OK0A 3Q0HA 1T5XB 3UXFA 3AMLA 5FCUL 4DCQA 1WWBX 4I9WD 1Q8MA 2NOYA 2XWCA 1W72H 3U2IA 2ZKYA 3T8XA 3WKPA 5T3XE 3VACA 3FCSB 4JJ5B 1OE1A 1QQDB 5DLML 2R29L 5I8KH 5JXED 2FECL 3OMAB 4YBHA 3Q8AA 3S2CA 1JZGA 4NRYA 3RGVC 4AXWA 4X42A 1HN1A 4EZLA 2ZOWA 3CPLB 4UIKL 2XICA 1G7MB 1G9HA 1KXVC 3CSPA 3Q2WA 1CFVL 3L3GA 5E4IA 2A1WH 2V5RA 1F42A 3MBWB 4IGBA 3OKKA 2B1HH 1DJSA 3LRKA 1B0RB 4UB0L 3F3HA 1FIGH 4X9IA 5GRVL 1EEZB 1DBKL 4LSVL 1PZBA 2XKUA 4YDMA 1TFPA 4W9FC 4I4WA 4QRPB 5BW7A 2IDFA 1SFHA 2NY4D 3WIAA 4CC4C 2Y0SA 5CP7A 1NCHA 3IF1A 2G5UA 2YUWA 4OGAD 4U1LA 4KWUA 3WIIH 5HY9B 1ZT4B 1CZ8L 2PCPB 1U8OB 3POCA 3GMPB 1IT9H 3NJLA 3ZKQD 4EEEA 3I6GB 1BJ1J 2JCCB 5CILL 4XP9L 3S97C 3MCKB 1R1CA 4NHCL 4PJGE 2HP4A 1AE6L 1RZ7L 2PCPA 1RZKC 3FN0H 3VXRB 4IIZA 2DWYA 4ZUTA 1Z9OA 5B3JF 1NCBH 3BP5A 3WHE0 2QHRL 3EO1A 1H9DA 1C5BL 3HZKA 5JR1H 1KCVL 2EDWA 4HAGA 3FO9B 1KYOK 4HWBH 4R26L 1QSEA 1UC6A 3SE3A 2WJ5A 1S7QA 4CGUB 2WIIA 4RETB 4DW2L 3LZQA 3GT6A 3Q6GH 3D39B 3LRGA 4XXCA 3CFUA 5A40E 1DVXA 2OP4H 1MJJB 4Z0XA 3U36B 3M7FB 1OGAD 2PR9A 3MCYA 1ETZB 2ATKB 3N85H 3ECWA 4MDIB 1Z9SB 1DEDA 1M7XA 3MLTA 5B1CA 3VAEA 2NR6C 3CVBA 3C6SB 1TTRA 1EUUA 3U36A 2FBRA 3GBDA 1KLGA 1IGML 4L1SA 4N1HB 5DLLA 5BOPA 2WGNB 3KBHE 4KROD 4X7FC 4LLDB 5GGSA 3RJOA 2EVIA 2OR9H 4U3CA 5G5DB 3JWDC 2F6AA 4NWTL 2HVKB 4WU7B 4KKLC 1UWXH 2WKOF 5E6SB 1WAPA 5KZCB 3HC3H 5MEOB 2WQVA 1TQCB 4FQCL 4YPGA 3KLLA 5A2LH 4AVKA 1IGIH 3DV6B 3H9SA 4R96A 2JJTA 1X5HA 2OCCB 2HJFA 2ROYA 3S3CB 1QBLL 1B88A 2I25N 1N0LB 2X1OA 4BZ1A 1SY6L 2BNQB 4WK2B 3FTUA 5BV7C 4ZMVA 1AQKL 2QADC 2VDNB 5HDQH 5F7EH 3QIBD 3D18B 5D96C 5EOQH 3JVGC 5LG1A 3EOAB 5EUOF 1JZIA 4URKA 1MN4A 5D4QA 5LO7A 1X4ZA 3QDMD 4Y4KB 1E6OH 3DI2B 4JFYB 2I9TA 5IESH 1Y18A 2DYRB 2YA1A 5H94B 2CRYA 3IDJB 5HJBA 1D9KB 4GIAA 4YS4A 2XN9E 2DB8A 5CCJA 2VDNL 4IMLB 4IU2A 3AM8A 4NLHA 4LK4A 3FULA 4BYHA 1EHXA 3MA9H 1MW1A 1FFTB 2LGNA 2YS4A 3N3EA 4WSGA 1TQVA 1PZ5A 4NUPA 3AQDA 5JYLA 4WFEE 4G6JL 1M7IB 3UBXB 3O3DB 3HVNA 1XGQB 1SOKA 1U91B 4OCRL 2ZX5A 4YSUA 3ML9A 2WVTA 5HVWA 1T2XA 1IFHH 4EIUA 2R4RH 3D2TA 2YXWA 3VTMA 1MVUA 4JN2A 2HFEA 4TQHA 5EBMA 1AZRA 1D6EA 1OTSC 1D5RA 4JMNA 4DP1X 3OHXA 2QSCL 3Q43A 3WUZA 1F41A 4BQCA 4RAUA 3MOAL 4ZNCD 2OK0H 4KDTA 1F2XK 3C8HA 2HX8A 4ZOCA 1IIIA 5IK3A 3WDHA 4KKRA 5I2IA 5K9QI 5AVQB 3US1A 1IM3D 1PKQA 2XN1A 1C5CL 3LAFA 1FN4A 4DKEH 2CHWA 1RY7B 3O3BA 3GZKA 1F1DA 4L8BB 2BNRB 1BVKA 2L7JA 1F11B 2F18A 1ZT7B 1KCLA 3QI9B 4KX9A 1B4JL 2OS7A 1EJ6A 5EZPA 2OMVA 4JGNA 3QFJB 3SBRA 2XG4A 3A0OA 3MV7D 3PIQB 2CCLA 2N7BA 4TNEA 2IFGA 4KX7A 4HIPA 2RIKA 4M6NH 2BIPA 1CI5A 1NZRA 3VMPA 1QBMH 5JW3L 1UJ3A 3NFNA 4HKBB 5HYSG 2Z92A 3OKOB 1A3QA 3H9HA 1HZKA 4QHPA 2F15A 5DJAB 3ATEA 3VMOA 3SOBL 1HH6B 1S4IA 1ES0A 1QW8A 1TZOA 2XKNA 3WL9B 4BSJA 4F3FA 5BZWA 5GGRA 4HV8A 1PVHA 4IRJD 4FXTA 2FWSA 2OTWA 3KPTA 3WN6A 4JFFE 5E5MA 2H6PA 3QNYB 2HFEB 3F01A 4JFYA 4J3OD 4M1DL 4ZO7A 4XGZA 3QEQA 5C3TA 1M1XB 3T3PB 4JFOB 4YN3A 3MRRB 1CE6B 1CI3M 2DQCL 5L7XH 1E4WL 1I9IH 5C6TL 5F96H 1KTDA 1SY6A 2IFFL 1W6WA 3QUXB 1N8ZA 2Z0BA 5FV2A 2VMCA 5D6CB 3Q5TA 4XODA 3ZZQA 1CXHA 1OPGL 4I3SL 1HL9A 3ZL2A 1P4BL 1FORH 4EDXA 1TIUA 4YHPB 1M3JA 3M1BB 4H0GA 4N2KA 1KDJA 1BVLA 1J9SA 2JLLA 3VWJB 4J12A 3FW6A 3CVHL 4M43H 2E46A 3O2DH 1GS6X 5DJYB 3AXLA 2X6BA 3BC9A 3GJFK 3BGFC 3FF7A 3B2VL 3KYNA 5DK2A 1HHJB 2A6IA 3LX9A 4FFWC 3NCMA 5A3IC 3RVWD 1JTOA 1WFTA 2HLFD 4Z0XB 2P52A 4GRLD 4OZIA 4WU5A 4RSVA 1W16A 4NZUH 1MFVA 5ACMA 1OSYA 1R75A 3OR7A 5CGBA 1UM6H 1YMMB 3DSFL 1KN2H 4HJGB 2BIIA 4LOFA 4EIZC 1GTNA 1PSKL 1XF3B 4LEOA 1OHQA 3JWOL 1IGYB 1TSHA 4X99A 3SPJA 5GS0H 2VMEA 1H6TA 1SQ2N 1MFUA 5LUMA 1DUZB 1ZAGA 4OFKA 5EUOB 1DSFL 1BFOB 4NPYA 3NCEB 1X7SA 1ZHKB 5E94A 4P23B 4XNZC 2KH2B 4MLSA 4JKMA 3BAIA 2OPCA 1ZTMA 4YBLC 1WCQA 3ZLQC 2WV3A 4P4KC 1DP0A 4K7PY 4PRIE 1MH5A 1UG9A 1YQ2A 1O6TA 2XN0A 1OGAE 1T20B 1WT5A 2UWEF 3LRSA 4F8TA 5D7IE 3O4LA 3BAEL 4JFWA 4UQBA 4JFVA 3RQ3A 1RIVL 3WS6A 1NJ9A 2VDLL 3L6FA 1E5YA 4LCIL 3UTOA 3VUAA 4ODWB 4BFFA 4ZNEA 2YAHA 4LSSH 1FYTB 2VQ4A 2ADFH 3KEHA 3NCYP 2G75B 2VZTA 3HS0C 1HCFX 1KGWA 1JK8A 4XAWH 1YY9C 5E2VH 2DYPB 2ZT9C 4DUVA 4N28A 2YKLL 2V2WB 3WJLA 2GEQA 4AIEA 2E27L 4MA8H 1G5GA 2AK1L 1NAMA 2V2XA 1H6EA 5D7SH 3VD1A 2DW5A 4HKXA 4HEPA 4ZPVB 1T04A 5F9AC 4M93C 4PJ5A 2GJ6B 3TA3D 3TJHC 2RD0A 4JFFD 5E6ZA 2CO1A 4UTBA 2CALA 3MUGB 3AQYA 3K5SA 1RUAL 3RI5K 1FL5B 1DE4A 1TU2B 5TE4L 2NNFA 4BHUI 2V7NB 3WJJC 4NN7C 4MJIA 5I8KL 4NGHL 6FABH 3VXQA 3QYNA 2GJZA 1BQHB 5BRZA 3NZUA 3UG3A 1QI3A 4HSCX 3QIWA 4WFHE 2QQQA 1KACB 2FEDD 2Y6TE 1HHJA 4Z7VF 3RILA 1ZPLA 5ITFA 3V0GA 4K15A 4V1DE 3S4SG 3BVXA 1S9YB 1C8QA 2XZCH 2B1HL 1P5UB 3ASOB 4JLRB 2GVYA 3TC9A 2JJVA 4JHVA 3KXFD 4EXKA 5I8CA 5EEVA 4TSBH 2W9EL 5T3XD 3L5XH 1NGPH 4GLRI 1JS4A 4I9WE 4H25B 3ZK0A 3BKYL 2D73A 2BOCA 4TN9A 3WGVB 3V5KA 1U21A 2DWTA 2CLZA 2WBJC 1SOQA 3UZQB 1JOIA 4LT7A 4K73A 2KDYA 1TYRA 1LO0L 3FDWA 4GQZA 3UC2A 3OAYH 3AREC 4PG2A 5ISZA 3NMEA 2JKXA 1GR7A 1AKPA 1GYAA 5J1SC 1RZ7H 3KH3A 4CADA 1WAEA 1XGRB 1Z1WA 2F0CA 1WD9A 3PG2A 1G9MC 3JWNE 2FIKB 1KPUB 5IB2A 2AJ3B 4GRMB 1J8HB 1LO2H 2AAVA 3NCXA 4YBQC 4NS0A 3V4PL 4KQ3H 4F91B 2XTJC 3FCBA 5A2KH 2J20A 4WFED 4JJOA 2ZKHH 1AYOA 3EOYG 1S7TB 3BFWA 3ZRFC 3QEUA 1BPVA 1UYWL 4FFTA 3N85L 4IIQB 5EU4A 1TUPA 2YAOA 4HWEH 1FL6A 2GY5A 5FUZL 5J57B 3QZWB 1CURA 4D0DB 2GEEA 5IB5B 4W9EC 3ZE1F 2R2EB 2RCSL 4UV7H 4AY0A 2VWEC 3VQ1C 2XVBA 2F53B 3DIDA 4PRPB 2P7TB 5CXPA 1L9PA 2OR9L 1PAZA 3VGGA 4HQQL 4HUXB 2DEXX 1XGTB 4W9ZA 4M6MH 1MHEB 5TF1H 2BH0A 1C08B 3EBIA 3INUH 3LS5H 4MJ5B 1IU1A 5FGBA 1FC1A 4FQCH 4GKSB 5D5ME 3FONB 5HYJD 2QKIB 4U49A 3ZW3A 4WFHD 1KN4L 2PR4H 2AQNA 3C5ZC 1NWOA 2ZNWA 5LBVA 3KPMA 5IFHL 3ULUE 2P5EB 2UZYB 3BH8A 3S35X 2GT9B 4PFEA 1ZANL 5MENE 3QUYB 2OTUB 3QORC 5J12C 2OMTA 2Q5BA 3JV6B 3S48A 1BVZA 3GTVA 3I3EA 4Q52A 1BMGA 1MCQA 1FE8L 5I8CB 2X10A 3BVVA 1L5GB 5CUSL 4ANWA 5E9DD 2JB5H 3BD4A 3RVXC 3GI8L 3RWEB 2X2YA 3K71A 2ZWYA 1U8LA 5AVYB 2HUHA 5CJQH 1DJZA 3HPJB 1ZSDA 3Q6FA 1ZLVK 1W0VA 1RIUH 3PE9A 1QPXA 2YZ1A 3FTGB 3D09A 5E9DB 5HDOA 4F33B 1JWSB 2NXZB 2Y22A 3KLHC 2YSTA 2F53D 1ZSHA 2RFXB 2GBTA 2NY2C 4PJ9A 4Y1AD 3MGTA 3B5HA 4OQTA 1LM8V 5B3NA 5CCKH 1AMYA 3NJFA 3VNYA 4V2BA 1AIFA 3IVKB 3BWAA 4U3XA 3GINA 2NY3D 1FORL 2XN9D 1A6WH 2FE0A 5KZCD 4H8PA 4YE0A 1LK2B 4GI8A 1U3HC 4RFOH 1GGIH 4JE4B 5E2UH 1H8OA 3QUKA 5LAPA 3WKYA 4X4XB 2IANA 2QSCH 3EYFB 3FHEA 4M62H 4BK8A 4UMGA 3GDBA 4L1LA 4XPGL 2JKNA 2OK0L 3C5XA 4JRXB 2L7QA 1EMTH 4XVUD 2RHEA 1LMKA 3FTXA 4AJYV 3LY6A 1NAKL 1MG2C 2PO6C 3QDJE 3DOSB 3QUZA 4ZD3L 3HNVL 4NO2A 2X44D 1RHHB 4PJXE 4X8JA 1E8XA 1A4AA 1OEZW 3HS8A 5GJTH 1LYQA 1I7ZB 4XZUA 1R47A 1NKRA 3TP4A 3MBWA 4HGWA 1MVYA 3KBEA 4XR8C 4MS8C 2X7LB 2FUTA 1U0QA 2H26A 3NSFA 2ZUUA 4CA4A 2OCJA 4Z3TA 4OD3H 3J2PA 3GSNA 4DSYA 4WTWA 1IBGL 3BSZL 4KV5E 2OYPA 1RLWA 1S7RB 1X7TA 3GC3A 3LKRB 1JPSL 3MLXH 4HIIA 4ZTOH 4Z3HA 4IOIA 1DVYA 3KCPB 5J6HB 2BNRD 1DSFH 2DQUH 2GFBA 3WEAA 2IDSA 3WTWA 5TDPA 3BD3A 1SJEB 3LKRA 2DTSA 3TEYA 1Y6MR 2D7PA 4PJEE 3TYFB 1KXQA 3KS0J 1UA3A 4PS4H 1NCGA 4CN6A 1X9QA 5DFVD 3M88A 4RFNB 1PF3A 2P8MB 1JPTH 3EO1B 4KGJA 5FUCE 5I5MA 2FHBA 1J5DA 3QEHA 4UQAA 1YEEH 1S7QB 3DVNA 1NBYA 5DC0A 4J8QA 2OMYA 1I9IL 4OCYH 3M17A 4ZS6D 1JUFB 4BFIB 4QRQA 4S1SL 3US9A 5KYUA 3SOTA 1HCYA 5A7BA 4A04A 4WW2A 2DQDH 3DIFB 1SXBA 4GO6B 3LQAH 1MIEH 2HT4D 4NN5C 3UOAB 5AD0B 5FYJU 3S36L 2C9AA 4N2GA 4OJEH 3RWFB 4DFHA 5BUPA 2JKTM 1ASPA 1QFPA 1IV8A 2ESVE 2HX7A 3BQUA 3U82B 2JELL 3ZE1B 3FF8A 1Y0LA 3QFDB 4PB0L 5HD8C 4NCDA 1G7QA 5F9WC 1P7QB 3L9EA 5K59E 1Q4NX 5JLZB 1AGEB 3H85A 1TTCA 1VA9A 4K07A 4U4IA 4W4OC 4RRPM 4TLSA 1PPIA 2O72A 2P9RA 3HAEH 2PXYB 4J6IA 4U1KB 3KXFE 5L9DL 3GMRA 1AGEA 2W0FB 2QVFB 5DURD 5K9KB 1XGYH 5GISH 4M56A 3T2LA 3IFNH 5DJXB 1SHXA 2YIHA 2VXUL 3BUQA 4R0LB 4JCMA 4G5ZL 3HR6A 5FKAA 5B8CA 4D0CB 1H5BC 4AL8H 1CD9B 1HL8A 1ZPUA 5TE7L 4MCYA 4IRSB 1HEJC 2JCCA 4FZEL 3HG2A 5D70L 1A6AB 2XZCL 3CFBB 1A7RL 2OMZB 4B97A 4JPVL 5TK4A 3MNDA 2H26B 3QEHB 3PWPA 4G6KH 5D1XE 4LVEA 3WIHH 2AEPH 4Z7VE 4WQOA 1OK8A 3HRPA 3M17B 3KS0H 2VDKH 4K3EL 2DN7A 2COQA 4QOKE 1KCBA 3CH1A 3E1F1 3GEFA 5HYSA 1KLFB 1KG0A 1JMXA 5DD0H 1J48A 3ILDA 1XZ0A 1G94A 3BPNC 5F7KC 5I15L 3TF4A 3U9PH 4FXLA 1KGUA 4N2IA 4MDIA 3B9KD 3HBQA 2EIZB 1L9QA 2N4IA 4IW4C 4F7PA 5ICYA 1EHLH 3ZE0B 4P2YA 2OZ4L 4PJFE 5BQ7A 4LCWD 3HC0A 2WHVA 4CJ1A 3LZLA 1AI1H 3VXTB 4FFYA 1QACA 4KNSA 3LZNA 3UGEA 4I7ZC 3U0WH 1E5CA 3L3KA 1YN7A 4M1GH 1G1OA 1W0WA 4QXGH 2NDGA 4KHXH 4PJGA 1KMGA 4PEEA 5ANMA 5AWNL 2AABH 1NBVH 4Z7OF 3U0TA 3ZE0E 5D6CA 4PRID 3KM2A 5DJCB 5GS0C 4JG5A 3UCQA 3LPOA 3GMQB 4FQ2H 4LLMA 3A6OA 4M4RA 5AD0A 4MNHA 4PWIA 1K5NA 3TT1H 4I5BB 3DETD 5HY9A 2JJWA 1JPFB 3VJ6B 5DT1H 3VRJB 1O6SB 2Q0ZX 4JFUA 4A2LA 5AENA 3MACH 4XB3A 3D18A 5IB3A 1RZGB 3FHAA 3VRJA 2CUIA 1KGCE 4CU8A 4ANUA 1UJTA 1KYAA 3EOBA 5CZXD 35C8H 3K1KC 3RIAK<