5DHEA

Crystal structure of chbd3 from thermococcus kodakarensis kod1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GDLVKPDAFSVKIQDWGSTEYDVTLNLGGTYDWVVKVKLKDGSAVSSVWSANKAEEGGYVVFTPVSWNKGPTATFGFIATGSEPVEAMYLYVNDQLWDVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase
publication title Crystal structures of chitin binding domains of chitinase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis kod1
molecule tags Hydrolase
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2015-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00553 CBM_2 Cellulose binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5dheA00
1HEJC 2XBDA 3NDZE 2CZNA 1XBDA 2CWRA 1QBBA 1E5CA 1C7TA 5DHEA 1C7SA 2RTTA 1HEHC 1EXGA 1EXHA 1E5BA 3NDYE 5DHDA 1QBAA
chains in the Genus database with same CATH superfamily
1DFBH 3BD5A 1P4IL 4TQIA 5HJ3B 2CD0A 4PV8B 2KLSA 2ZE0A 1IC5L 2XWBB 5F7DB 2E7LA 2ADYA 5C6TL 2ZG1A 1FVCB 1I1FB 5AW2B 1DE4A 4H25A 5T33H 3IBEA 3LKOA 1HJBC 4P8QA 4AV4A 4FMFA 5J1SC 1KGCE 1OCCB 5DJYA 2MOQA 3AS1A 3TBVA 3WDIA 3P4OA 1F18A 2F9BT 2OMNA 3DOIA 1TUPA 3M88A 4GRWB 2MCPH 2CRIA 4D2NA 4GUPA 4X4YA 5HGAA 4ZXBB 1MCFA 2Z7UA 3KBPA 5DJXA 4G9FB 4JVWA 4LASL 2H4EA 2ALAA 5MEQA 4PR5A 2GBVA 2WKOA 3EYUL 3SGJA 1RPQA 5KJRL 2GC7C 1UWEL 3THML 5F1KC 4YBHA 3OKKB 1CG9B 5D9SB 1RK1A 1TYEB 5E99H 4LCWA 2ZX8A 2CBMA 4DZBA 4K0OA 3TZVA 3UJIL 1SQMA 3PWJA 4CN4A 4FFYA 3FONB 5EPMA 3TVMC 4APXA 3ZKND 2YXVA 3VWJA 2DAVA 1NPUA 3HE7B 4Y19B 4JVPA 5LGYA 3V4PA 3H4FA 4KKQA 3JTTA 4M62H 1JZ8A 4JM2C 1KB5A 3FCUB 4DCQA 4YR6A 1PZ3A 3C6SB 3OKLA 1M7XA 1G7PA 1PG7H 4NPYA 4PU2A 3L95B 4WJ5B 4JREC 5HJGA 1HWGB 2E7CA 5JHAA 5B7MA 5D2NB 1MHPH 4HXAH 3T2NL 3VACA 3NCCB 2PP7A 5HHQB 4IIQC 1RZKH 4NP4H 5L2JB 3NACH 5K9JL 4MHHG 4LKXA 1OQOA 1ET7A 2ORBH 1JI1A 3VFNB 3QIUD 4FXTA 3GRWL 4BZ1L 1DBBH 4HEPG 4NAJA 5KN5B 3ZE0F 1W80A 2MRYA 4OT1H 4Q0XH 2BNUB 3L5IA 2QGCA 3ZN6A 4ZTPH 2VDQL 4NSKB 2FO4B 2I9LB 1EFQA 2JB6B 4IW4C 3D0AA 4P99A 3Q9QA 3S5LA 4ELKA 1U92B 1XCQA 4L0PB 1S78D 1JYNA 1RFDL 2CWRA 5ANMB 4UILH 1PQZA 2VMDA 32C2A 3D25B 4NWUL 2BIMA 1XWVA 2GBAA 2OMXB 4OTXL 4F7CA 2EUXA 4IJ3C 2A4ZA 3QJFB 1OCWL 2XWZA 4M6NH 1P5UA 4PTUB 3KH4A 4WKXA 2B8OT 4WHTB 4JM4L 4DEUA 4Z95H 5K39A 2BLFA 4NC2B 1T22B 3PHQA 1FYTB 5EF3A 2AZAA 2VDPH 3UAEA 3ZTEA 3T0EE 2B5IC 1BD2A 3NABL 4OZFB 4D9QD 2ZXQA 5ETUA 3Q06A 4NUMA 5FYLL 5I9QC 1BAFH 3GLZA 4JO2H 4OIIL 4X9IA 5DD6A 3RL2A 3LKRB 4Q58C 5IQ9A 3QDGB 3ALPA 3GSRA 2G75B 1OGTA 1AC6A 2XXCB 1F4YL 5LN4A 4QDGA 4L1SA 4LOUD 1PX4A 1YY8A 4LOVA 4OCSH 3M1BB 3SDDC 3N1PC 2WB7A 1PLBA 1MVUA 2YGNA 5EZLB 5GSRB 1AE6L 5LBGA 1HS6A 3Q5TA 2Q7NA 3SO5A 5DGRA 4HIXH 5EUOE 4LFHD 4UAOC 5GPRA 3ILDA 4DTGH 4MJIA 2BOLA 3B7YA 2FT8A 1TYJA 4H8VA 4UUJA 2UWEA 1PD6A 3HC2A 2EEDA 3DKHA 2WLYA 5GRUL 1N0LA 2C9AA 5CJQH 1NC4A 2CDGA 4HDIA 3IYLW 1ECYA 3ZIMA 2ALWA 3OPZL 2YN5A 5C0IA 3AGVA 1E8ZA 5D1QD 1E28A 4CMHC 2WZPD 2LU5A 3QCTH 3T09A 4PW3A 4OFKA 4RZCA 3T1FA 3H3BC 3RZWA 5IROD 5AAMC 1EO8H 4YHIB 1DQIA 1JF1B 1NLBL 4FABL 2DWDA 3NJXA 1CGUA 4M56A 3QUKA 5ALBH 4OLUL 3EYOA 2BDNL 2FEEL 2WLJA 3MNVA 2YPVA 1L5GA 2JCCF 3VFSA 2YK1L 1JNNH 1GMIA 4NXSA 1QYGL 5FYLE 2WINB 4JMNA 4Z7QF 5DHVA 3BIAX 5AUMB 5GZNC 4XBMA 5JW4Q 3O11A 2HSIA 2P5WE 3RIFF 1A3LL 4NQSA 4LEOA 2XT1B 4GI8A 4YSSA 4ZMPA 2IF7A 3O2DL 4M43H 1K4DA 3L1FA 5I17A 2F7QA 4LLWB 5K5YA 3O3EB 4BKTC 3U1SH 1F11B 2I7SA 1TJIH 4YXLH 4ZS6D 5I76A 4Z0XB 4XBPA 1GSKA 1DSFH 1ASOA 1JD7A 5C9JA 1KC5H 3EIFA 2VDMH 1R4XA 2DDQH 2DQEH 2ZXAA 3IMRA 2YGQA 4JHZA 4Y4FC 2XG5A 3GBEA 1A47A 2WXQA 3K2IA 4KKCD 4W70A 5TH2A 4G9FE 1SYSB 4XNYL 4P23B 2RACA 2W0FA 3LPOA 4R0LA 4AGMA 1JNHB 3VE0B 3CDZB 3UDWA 3DRTB 1Z9OA 2X38A 1BWWA 4OZ4A 2BZDA 2A73B 4W4NA 2PW1A 4NZTL 4GW1B 1RZFL 3CN3A 4KMLB 1KTRL 3SDCC 3T0EA 2QGBA 2QHRL 4A2MA 4ZMWA 2X3AA 2FATL 2X88A 4N0CC 1WITA 1YEHH 1UCBH 4BZYA 1U95A 1ZT1B 2GFBA 3CHPA 5E8DH 4IDLA 3ZDXF 1NCAH 5JZ7D 2OKMA 2VZUA 3O0LA 1E2VA 4G6AD 4X9BA 5E00A 1FDLL 2PXYA 2R9HD 2DKSA 4FFWC 4V1DB 4Y19E 1NEPA 1V54B 3BW9A 4FHJA 1TJHL 5CSGA 2RA1A 3SKUD 3OAWA 2J43A 2HWZH 2EDRA 4S1RH 4PJ6A 5H2BB 4YDNA 4GW5A 3W38A 1CFNB 2X1WL 5AAPA 3ZRFC 5EBGA 2ZXWB 2WTRB 4XWOD 1HXYA 1UUSA 4OBSA 1I9RL 3HG3A 1P7HL 5EUOA 3SOBL 1G7HA 1G9NH 4J1UB 4J3OC 1UXLA 4YSTA 4BZ1A 2ICWA 2YAMA 3TF7C 1T0OA 2E75C 1IM9D 1JHLH 1QA9B 2FE0A 2GI7A 2VNCA 4OFQA 4AVKA 5JIKA 3UEQA 4F37K 3VFOB 3QQ3A 4PN6A 3UAFA 3POCA 4Z7NE 1AFVH 2YGOA 3SQBB 1M6OA 2VJ8A 3FPXA 3I9IA 3VD9A 1UA6L 5EO9A 2BHYA 5ANME 1V7MH 1UACH 3BDYH 3AY4C 4Z76B 1PZAA 4GG6B 4NUGH 3J7HA 1VPOL 3V8CA 1CU4H 2ICEC 1I9JL 1XGPA 1T5KA 5HVFB 5FGRA 2Q3ZA 1HI6A 1H5BC 1OAXL 4S2SB 4TSBL 3ARGB 1RHHA 1MIML 5BZWB 3E6HB 1SLVA 3OKNB 3GXNA 5EUOF 4JPSA 1FYTE 2VWEC 3QWRA 3E1F1 4X80L 5E1QA 1O6SB 4LPCA 4CDGC 1SQ2N 2R4SH 4EZJA 4FI8A 5DWUL 1S7RB 2P5WA 5DJ6A 1YG9A 4QO1B 1XGQB 4IDJL 5HJ3A 4BDVB 3AT9A 3FNKA 4LHUA 4PY8I 4B41A 1BFVL 2H0FA 1AQDB 2XWBA 3EYSL 5F7DA 1ZIBA 1P7KB 2VE6A 1WWWX 4UIKL 2YRZA 4RGNB 1CTOA 4UTBA 2G5BB 3WFEL 4DKFL 5IUSA 2APXA 1Z1WA 1I1FA 4I3RH 4C54A 3KG5A 2VDLL 3B9AA 25C8H 2CO2A 4WWKB 5HHVL 4XP9L 1KN4L 1JV5A 3QQDA 1U8OB 3ZVVA 5KANI 5D70H 1IIKA 2IMNA 4EIGB 1RURL 2F54B 4ENED 3OZ9H 3QBTB 4ZXBA 4KX9A 2DMKA 2Z9TA 4UNUA 1S7XB 4MAYB 4PLKD 4TPRL 3ZHLA 3ZSTA 1NIAA 1XXFC 2EC9U 4HS8L 4M1CC 1A8JH 5KVDH 4CSSA 3MDJA 4RH4A 3QNXB 4WTZG 3GBLA 1MRCL 3QG7H 1XDTT 4WK2B 4I0PB 3DGCR 4GXVH 3OKKA 1CG9A 1MY5A 2WLNA 5D9SA 4OH2A 1ZGLM 3CSYB 2XN1A 1WFOA 3QZPA 2H47C 4ZBJA 3NRPA 2DEXX 2EKJA 3FL7A 3FONA 3T0BA 4GOSA 3PF2A 1F5WA 1IAIL 2JF1A 3SDYL 1XBRA 2J8UB 3PWUB 3HE7A 4Y19A 3WENA 4A04A 1AS7A 4G9FD 3LRLA 2KMWA 1T1YA 1A7BA 3KL0A 4M93B 1XIWC 1NMBH 2AEIT 4ZMQA 3X3FH 2FWUA 3CZKA 3C6SA 5I8CB 1ZHLB 4WJ5A 3CU7A 1MFCL 5IBTH 1QEWB 3BZEB 5D2NA 5HDQH 1OTUC 2H0PA 4BRVA 4BFBD 5HHQA 3C6EA 1F2QA 2V7HB 3BC9A 5D2LF 4Z1PA 5L2JA 4QTFA 1I8MB 3QDMB 1ROCA 1BDYA 1MIEL 4ERSH 1UT2A 2H2SC 2DPKA 5FB8B 3VFNA 4AQEB 1YEKH 4WNJA 1HH6B 2B77A 5BRPA 4DEPC 2BNUA 3VFGH 4NSKA 2FO4A 2I9LA 2JB6A 1IFHH 4BQ9A 4B9IA 4NHUB 4DN3L 4QJ5B 3SGKA 1JFHA 4NN6C 4Y2OB 1U92A 5D4JA 5D72H 2K9FB 1F97A 3QT2A 5ANMA 3FO0H 3WE1A 3D25A 4ONOA 4WFHE 4LSPL 1NH6A 4ZOAA 4WI8A 2BIHA 4PCYA 2OMXA 4ODTL 2W91A 1O7SA 3OF6A 4OLZH 5C09B 4EQ3A 1OQXA 4MCYB 4TQEL 2HB0A 4PTUA 1A7OL 1W8OA 4WHTA 1J18A 5TDPB 5ISZB 1OTSD 1JERA 4JRYD 1T22A 3EJSA 1FYTA 4XCFL 4K3DH 2WZ5A 4A2DA 4FFTA 4PJBB 3V4VB 5AVSB 3IDYC 3U9PH 1DJYA 3CH1B 4LSSL 4NHCH 3DIFB 4OZFA 4BA8A 1KWKA 2R2CA 3ZBMA 3ZTNH 5D7JC 1G9EA 3B43A 4WHYG 3BJLA 4MMYB 2UZYB 3SE9H 3CDCA 5DEJA 4FQ1L 3LKRA 3U9WA 3BQUC 3QDGA 2O6DA 1CPUA 1C7TA 1LLAA 4Z7NF 4V1DE 2AJYL 3LNDA 1JGVH 1CF8H 1A7NL 1BG9A 4JO1H 1UKQA 3IDIB 2DTML 3CZGA 5EZLA 5GSRA 3NJVA 5E8OB 2CUIA 5LXVA 1OAZL 2J1ZA 4N2FA 1HHKB 2CHNA 4KO7A 3S8WA 5C0RH 2ZOKB 3TWCL 4JCMA 4JG5A 4GMTH 5EIQA 5KG9B 1RZQA 3QHFL 3H1ZA 3EHBC 3IETB 2N1TE 2VXSH 2PYEB 3K6DA 1OZUA 3D8MA 2W95A 2CLZB 4FS0A 4UAHA 2YMOA 5KSBB 3FRPG 4GAJL 1PJWA 4B96A 3QEQA 5E9DB 3LXUX 1CFQB 3HC3L 1H0DB 1MCEA 2JXMB 3PGFH 5JR1H 2XKUA 3L4YA 4GG6E 1JF6A 4N3TA 4DESA 2WBWB 1JF1A 1DJZA 4R3SB 4XHQA 4YBQD 5KW9H 2PO6B 4NM4H 2A9CA 1SVBA 3QDAA 4HXBH 4XH2B 2ED8A 2WZ0A 3MXWH 4FG6C 3I50L 5E4IA 3PFQA 3ZKSD 2FQFA 1MW3A 2HKFH 5CSZB 5FUZH 3T8MA 1NSNL 1BQ5A 4G6MH 1EO7A 3Q48A 4IBZA 5ESQB 2WINA 4FFYH 2ARJA 4P5MA 5LN8A 5I1KH 1AGFB 5AUMA 2BHZA 5D7EA 4FD0A 1T5WB 1VGEL 3WDJA 1TTFA 3IFOA 2WQUA 5DJAA 5D4QA 1KBVA 1TO4A 2MNUA 3LB6D 5I74B 1KT2B 5JQIB 1J5IA 3MV11 5IQNA 3V4PH 4Y2DD 4LOEA 3DC0A 3QJQB 3KVDD 4QHMA 4LLWA 1KB5H 5T5NG 3O3EA 3FOLB 5FO8B 1F11A 3DURB 2Q20A 1KCWA 4YSCA 2XPZA 5MEND 3L5XL 1XMWA 2D0GA 2OSWA 3WD5H 4HF5H 1LHZA 3I6GA 3EDJA 4M48L 2GJZB 2W9EL 4ODWB 1WWBX 3IPFA 2QDWA 2L7QA 1HQ4B 3OGOE 2YN3A 1SYSA 2QVTA 4P23A 3GSUB 2MPAL 1A1NB 1JNHA 3JWNC 4GO8A 3CDZA 3VE0A 4D7PA 3DRTA 3FH7A 5FAAA 3LRKA 4HFUH 4ILDA 1VACB 1WP6A 4K3JL 3G6DL 2H0JA 4GW1A 4KO9A 2D31B 2XWDA 3O6ML 1I3RA 1HVXA 5B7FA 1LP9E 4MQXC 1ZT1A 2G5RA 3V4VL 2RR3A 4K5NA 1AKPA 1EGJL 1FRGH 3L3GB 3Q1EA 3R7QA 1MQ8A 4Z0BL 4HZ1A 1Q94B 4V1DA 1WTGT 1S7UB 1GOFA 4Y1SA 5I1LB 1OP3H 1EUTA 4WFHD 2EDFA 2WPGA 5DS2A 1U8LB 1CDJA 2Y36H 3K0WA 4L3CB 5H2BA 4DAGL 1CFNA 2IV8A 2IGLA 3QNYB 2WTRA 3ZKMC 1GRWA 2GTWB 4KROC 5C7ZA 3LNIA 3Q9PA 4X99B 3G04B 4J1UA 4XNXL 4QIRA 3MLYH 3QDME 5ITBH 2FZ3B 1MY7A 2R7EB 1QA9A 1FQ9C 1X3DA 4JGNA 5AW6B 3U7WH 4DP0X 3VFOA 4G6FD 4NCDA 2EAEA 3DJRA 3S0PA 3C5ZC 1CMOA 3SQBA 2XACC 4KUZH 1U6AH 2BM3A 1H3VA 1QHPA 5K9KA 5M95B 4FTVB 4G42A 3V0GA 4L05A 4P2AA 5T1DH 3FHAA 1FG2B 1O7DC 1MF2L 5AW5B 4Z76A 4GG6A 3QO1B 2OJZH 2GABA 3HFML 1GA2A 4S2SA 5D6DA 5ISZE 3ARGA 2COQA 2D7MA 4MNQD 4B9JA 5IOKA 5BZWA 3E6HA 2VJ0A 3V6FB 4H8HA 2X6MA 5CWSB 1O6SA 1O6VA 4PJBE 1WZMA 2DQDL 1S7RA 4LCUA 1M71B 4S11A 2OMUB 2YS4A 4QO1A 5C0GB 1XGQA 3HTLX 5HHNB 2UZIH 4PVNA 3IK2A 3POHA 2YPVH 1INDL 3NYKA 3DDFA 4Y16C 1AQDA 3NFPB 4S1QL 3V10A 1P7KA 5I0XA 1D5IL 4WTXA 2G5BA 3SDXB 2H6PB 1AZUA 4ZMNA 1QO3B 4NJAL 5DHVH 2CGYA 2Z7WA 4J27A 1MFBH 1YAIA 2AQ3A 4WWKA 4DZ8B 4M1DH 1U8OA 4GG6F 2PETA 5F3HA 1VJSA 2HKHL 4KV5E 2F54A 2X41A 3AB0C 4HMEA 3SE3A 2W92A 4CNIB 4UOQA 2FX9L 3P9MB 4HPHA 4U49A 4O5LL 3U30C 1D3CA 4LOFA 1UA3A 2MHAB 1BBDH 2E74C 2EUVA 4B0MM 3C60C 1S7XA 4LQFL 4MAYA 5F9WC 2XYCA 2KBGA 2PYEE 4EDXB 4WI7A 3QNXA 2NZ1A 4JQIL 1XR9B 2MPVA 2RH0A 5CINH 3DK0A 4TSCH 3BAYA 4U1KB 5EORL 5IESH 5LCVL 3AU1B 4KXBA 1OAKH 5ADPL 5KSBE 4I0PA 3V9FA 3EYQC 4FCHA 4ZTOH 3Q43A 3CSYA 3QCUL 3EYUH 4JLRB 5KJRH 1M1XB 3LHPL 1UWEH 4AQ1C 4EN3C 1J87A 3U9UB 4AQAB 3NK3A 4QKXB 4JFVA 5GZOC 4R97B 1EQWA 4Y4HB 2BSCA 1A64A 3UTZB 3UJJH 3VGAB 5CEZH 2J8UA 3PWUA 4Z7VE 1RIHL 4JFSA 4TUJB 5DHYB 3SGEH 3W3BA 4OLYL 5HYJD 1P1VA 5AVTB 1XF3B 1T1WB 1ZHLA 5I8CA 5ID0B 1QEWA 2OZ4L 2A3TA 3HMWH 3BZEA 2ZWKA 4MBRA 3FDWA 1Q1PA 2VKWA 1SMAA 2V7HA 4PJXB 4WZ9A 1I8MA 1WQVT 1OHQA 3ZJAA 3QDMA 4AYGA 5FEBA 3QPQC 3R8BB 3NN8B 1PX8A 5FB8A 3GF8A 2Q1EA 1UD2A 5F7WC 4AQEA 3U79A 8FABB 1I1AA 1HH6A 2FWSA 3BN9C 1KIQB 1LP9F 1CLVA 3ZIYA 1FZMB 4JUTA 4NQXB 1FFNB 3O41B 1BCIA 4NHUA 4OLVL 3CE1A 3KJ4B 4Y2OA 2GUOA 4EDWH 4NUQA 2D3VA 3TJHD 4XMXA 3BDXA 4JPWL 5CP7B 1LD9A 3VD2A 3IBOA 2NNCA 4WEBH 1BW8A 1MCIA 5C09A 3JV6B 1YEJL 4MCYA 2Z3FA 3BH8B 4XN5A 2OZNA 3BPCB 2UX7A 2E76C 5TDPA 2WNWA 5FM8A 3GDBA 4NC1E 4NWUH 1X5HA 5I75C 3FUNA 2H3XC 2QPDB 2F7IA 4PJBA 5GGSB 3PXJA 1CFTB 1OCWH 2DL2A 1UB6B 3CC5B 4X5LA 3D48R 4NFDA 3V0WL 3DIFA 4N8PA 1IBBA 2ZXDA 4MMYA 2UZYA 3S97C 4LCYB 2XVKA 2Y6SC 3P3UA 2BS8A 3NABH 2CO7B 4GS7C 3CBKB 3VDAA 3FB7B 4LQ1A 5FYKL 5FYLH 3KXFD 1JOIA 4WI6A 5A2IH 2KZBA 1WZAA 4D0DB 4HJ0D 5K9QG 3IDIA 5HDLA 1XCXA 3REWA 5ISZD 1EFXD 4PI0A 2G2NA 5E8OA 4KDTA 3SE6A 5KBLA 4K5MA 3S34L 1F4YH 4E5XB 5HVWA 1N6QH 3LN4B 4S0SD 1IBHA 4PS4L 1DJWA 2FNWA 1AANA 1HNYA 1HHKA 1QSVA 4UTBH 3K3QA 4WU7B 1AXIB 3ATBA 5KG9A 1AE6H 2NCEA 2CLVA 3IETA 1ZLSH 2PYEA 2VISB 1SLUA 1PVHA 2R4RL 2Z93B 5DC0A 1U42A 4KH9A 4HOZA 3KM2A 4BH7B 1KJVB 3SSGA 2CLZA 4GRWH 5I6MA 5KSBA 2YA2A 1AOZA 4MS8C 1JZ5A 2OM5A 5E9DA 1CFQA 2Y9RT 3D0VB 1OE3A 2RALA 3RG1C 1OO2A 5GRUH 3FQNB 3P4NB 4FTVE 3US0A 2JXMA 4FNPA 4OCMC 4JMXA 1PZDA 2X0VA 2XN9B 4N2CA 3K8KA 4AYBA 4R3SA 3BVTA 4QXVA 4XH2A 1NIDA 2VM9A 1K9TA 5L7XL 1BMWA 3GTTA 4KV5F 1CDBA 1UOKA 2NY3C 4F1ZA 3DYPA 4CN6A 2NNRA 1M7IA 5CSZA 4I9XA 1RK0B 2VLLB 4FABH 2JFCA 3KLDA 1T6BX 5ESQA 4E9YA 1AGFA 3WAJA 4H88L 1T5WA 4KKNA 5T5NF 4YSPA 1KT2A 5DUBB 1QYGH 4ZUUB 5FYKE 1BJ1H 1CYGA 3ZUCA 4HPYH 1N0XL 1CIUA 1ZY9A 4NN7C 1FNFA 2FT7A 4FQPA 4X6CE 3C09C 1FNAA 3S3SA 3FOLA 5EO0B 5FO8A 3GWJA 1OSPL 2WBJD 2VZVA 3CFCL 4QY8B 5AKTA 1AY1L 3EF7A 1MOEA 4AV0A 2GJZA 3MOAL 4MDIA 5C7XH 4ODWA 3RWJB 2Z65C 2YUZA 1YCSA 3G3LA 5JPMC 3QULB 4Z7VF 2VMCA 3UROR 3LH2H 3ZR5A 2ZP8A 4FXGC 4AM0B 4FQLH 1OK8A 2WUBL 3KYMB 4MYWB 3GSUA 1A1NA 5JHBA 2O61B 2PYFB 4H0GA 2FJSA 3OMIB 5CGMA 5B4MC 1VACA 4UMSA 1OB1B 3IXAB 3Q6FB 3Q2LA 4Y5VC 4FLQA 4AYSA 1GZPA 1GZHC 5A16B 5AAWA 4PMFA 3II2A 3A67L 1CD9B 2JJSC 2X4UA 1F3RB 2EQDA 4A7SA 2X40A 4AYEC 4NZTH 1RV6X 1RZFH 3L3GA 4IRJB 2IG2L 3WUWB 3WV0A 2JK5B 2QHRH 1A1MB 3ARDC 5SWZE 1S7UA 3NEEA 3MA9H 4K9JA 4BUQA 4YL9A 4OZFH 3W11C 2OK0L 2A7BA 2PTTB 2J88H 1U8LA 3D2UB 2C9PA 3TN0C 2OZ4A 4TULH 1VFUA 4GSUA 4L3CA 2OW6A 1O9VA 3ESMA 1MCPL 2EP6A 4R4ND 3MV9E 1KEGL 3QNYA 1TJHH 1TITA 2MQCA 3HI5H 1G7JB 1HDMB 4X99A 3A21A 3D3VB 4KJQD 2Z8WC 1IM3D 1WD8A 5F72S 6FABL 2FZ3A 4LSVL 4PGZA 2VUYA 1HJCA 2R7EA 4ANWA 4Q6IB 3Q44A 1GGCL 3AROA 2O5ZL 2Y24A 4C55A 4LIQL 3AS0A 3OV6A 3BAIA 2K4WA 5DC4B 3FAWA 3MPCA 3IMUA 4J6RH 4FTVA 3O8XC 1FG2A 5GS2H 1A4KB 1NIBA 4BK4A 3CXDH 3QO1A 3SYCA 4MBOA 2YD8A 1IGJB 5IQLA 1IGIH 2YLHA 3MLSL 1T83A 2DQGH 4G5ZL 2G4GA 3V6FA 1VPOH 5CWSA 1XT5A 3U7AA 1I1YB 3QI9C 3PV7A 1OAXH 1DSWA 1FNEB 2NY1C 2VRKA 2GSMB 1X7QB 5C0GA 1MIMH 1M71A 3BRFA 1NLDL 2CA3A 2OMUA 5HHNA 3WXVH 4OD3H 1MPAL 3IMBA 4X80H 3N85H 3KEDA 1UWGL 3Q13A 4XXWA 5BS0B 1UEYA 3NFPA 5SWSE 4IBWA 1DBJH 3NEXA 3SDXA 1PLAA 1AHWB 1SUHA 2H6PA 2VXVH 4KY1L 1UM5H 4FA6A 1QO3A 2D7OA 2AGJL 4WKZB 5CKAA 1KGXA 4Q4IA 2VN4A 2IAND 3UC2A 4DZ8A 2B0SL 5GJSL 3LD8C 4M6OH 2GI0A 2XJLA 3O3UN 3DMMB 4RGMB 2EH7L 3FK3A 1FP5A 3MJGX 3WFEH 4CNIA 4GAFB 2JKNA 4XZ4A 3SKOB 1RPUA 3P9MA 2W38A 1HQRB 3AM8C 3BGFC 2G5UA 3EAKA 3FC8A 4K15A 1KN4H 2MHAA 1DJGA 3K8MA 5HHVH 3O4LB 4MNHB 3JYCA 1EV2E 4HULB 5M94B 1T7XA 3OB0K 4XC3H 2RBLA 1H9VA 4LIQE 3IMSA 5CIPB 1GOGA 3BYTA 1XR9A 5E0QA 1IZJA 4N2GA 3WTYA 2R0LL 4I5BB 4U1KA 4ABWA 2C1PB 3AU1A 3KM1A 2Z6FA 4PBDA 3QAZB 3B5HA 1A3QA 4JFYB 5F89B 4ZK8A 4UZUA 4JLRA 1JE6A 1M1XA 1MRCH 3BESR 4K7PH 4P48A 4X6CF 3RRQA 3U9UA 4AQAA 2D3NA 1B4TA 2FR4B 5E2WH 3MRHB 4PQXA 1YSOA 3WLBA 4Y4HA 3WNLA 1SN2A 3UTZA 3DX0A 1CFVL 2WQAA 1ZWIB 2LU7A 4HZAA 4TUJA 1N64L 2NYYD 3KCPB 4KHTH 5DHYA 4ZDHB 4P5TB 5D93B 3L16A 4HUKB 4MVBD 5FFLA 1IAIH 1HZLA 2ZX7A 3SDYH 4FADA 1T1WA 5ID0A 4UIMB 4G82A 5AOZA 4XTRD 1K6QH 5FM5O 3L2MA 2X5PA 2C9VA 3KS0J 5J3HC 4PJXA 3KBEA 1F4WL 4L0ZA 3FQ4A 1BZQK 2GCYB 1NAKH 3U6XA 5BNXD 2AITA 1MFCH 2OQJB 5GIRB 3NN8A 4HHAB 1V7NH 1JVOA 4U3XA 4XAWL 8FABA 4K94L 2D9CA 1B6UA 2OI9C 1CYWA 5HHPB 3DSFH 5CZRA 1KIQA 3B2MA 5SWZD 2ZOLB 1FZMA 1MIEH 2BY3A 4NQXA 1AZNA 1FFNA 3O41A 3VXMD 3S5ZA 2QGDA 1CWVA 4DPRA 5CN1A 4X4KA 4BSVB 2IWFA 2AJSL 3B5TA 5CP7A 2ENQA 1W72L 2KZKA 3MV9D 4Y5YB 2E9BA 2P28B 2XZAL 2EXWC 4UV4L 3JV6A 4TLTA 4EF3A 4FG4A 3VYOA 4OJCA 3BPCA 4P46D 1PS3A 3V6BR 1MW1A 2Y06L 4F8LA 4GKNB 4LSPH 1KCUL 2K7QA 3UJTH 1IGYB 4UQ2B 5B8CB 4I77H 2R8SH 5GGSA 3ORJA 3H9HB 1CFTA 3CC5A 4UNIA 1UB6A 4GI6A 1A7OH 1B0WA 4U6TA 3CZFB 4BXSV 4F8OA 2DQFB 3KW7A 2WOYA 4QXUH 4LCYA 4XCFH 3OB0H 2EDOA 4G71B 4KKLD 3T6XA 4ONGL 2CO7A 4ZZFA 4EI0A 1SN5A 4S1SL 3FB7A 2AAVA 4PVLA 4AYDC 3B5GA 4Y9CA 4D0DA 2XWJA 1IRAY 3LQAC 4XVJL 4PWEA 2NY2C 3WN5C 5F7HA 5LXGH 1U8QB 4HIIB 1A3RL 1DVZA 4X4MA 5FF6B 1JPGB 4DUVA 3UH8A 1BQRA 4E5XA 3ROOB 4EO5A 3MGOB 4TL4A 1SNRA 1A22B 3B3BA 3D3VE 4JY4B 4WU7A 2C7FA 2DTMH 2FHCA 4P5KB 4LARL 3WY2A 3G6JB 2CKBH 3JV5A 1AR1C 2VISA 4PVBA 1Y6MR 5JDSA 2WWOA 2Z93A 1FHNA 1YJDL 1LWJA 5SWSD 2UYLA 4BH7A 1KJVA 3LN5B 3EXJA 3QIBB 1IVLA 2EE0A 5AW3B 2ZCZA 1CICB 3D0VA 3FUFA 3ES6B 2VCOA 3OSVA 4MXQC 2LFEA 5ECJE 3SJVB 5GS1C 3V0JA 3FQNA 2AJ3B 3B8SA 3P4NA 4KRPC 4QHUB 5DRNB 5KYUB 2J5LC 1FJ1B 1ZLVK 2XN9A 3UZQB 2L7UA 4DOHB 2AF2A 3HC3H 2AAAA 1U3NA 3HE6B 5E9AA 1O9WA 4E9WA 3N42B 4L2LA 5J6GB 1NWOA 5AWNL 2A9NL 3G7TA 1RK0A 2VLLA 2ZSVB 3A6BH 4MSWB 2HTLC 1A8ZA 1R3HB 2X53A 4JHVA 2J12B 3QNZA 1SY6L 2YJQA 4NXKA 1PBYA 2QMKA 5CXPA 4NFBA 1CGSL 1NSNH 5HI4C 3ARSA 4ZUUA 3X1NA 2BIQA 3B9EA 2Y25A 4XOEA 3S3PA 5BUGA 4F8PA 4KK9C 1VENA 4OCLC 4TNEA 2FBRA 5EO0A 2VXTL 3IU3B 1BQKA 3RB7A 3DI3B 4WEEA 1DVSA 2K8MA 4QY8A 3S7GA 1PZCA 3V52L 2LFGA 3JBG7 4OFYA 4R6UA 3A6OA 2AJUL 4JJ5B 5CFHA 2JI2A 1NC2D 3L13A 4LCCC 3RWJA 3Q5OA 5AB2A 2BHFA 2DKUA 3Q3GA 5FUCE 3CAFA 3QULA 3SGEI 2P43B 1MAKA 4RWYH 4ZMZA 2WIIB 3O4LE 3CFIC 1NBYB 4RAHA 3S5YA 4AM0A 3KYMA 2D7PA 5T3XL 2BFVH 3EXLA 2E8ZA 2W9EH 2O61A 3KPRA 1BJ8A 2PYFA 5KJ7E 2V33A 2DH3A 2ZPKL 1K8IA 3P77A 1ETJA 5CGTA 3L1OH 4CBPA 1OB1A 2GB2A 3PABB 3IXAA 3Q6FA 1G4RA 2MPAH 3QDJB 3BPOB 3D18B 5A16A 4QKTA 1D7DA 4OCNC 5AZ2L 5BRZB 4P07A 4JW3A 5FW6A 1A6WL 4N5UA 1T0PB 4EBQL 5C2BL 3G6DH 3ZYOA 4A7GA 3WLWD 2ITCB 2BSSB 4IRJA 4JKNA 2DM2A 4M5YL 3WUWA 2JK5A 4HOWA 2I5YH 1A1MA 2ICWI 4L5FH 5GGRY 1PDKB 4AIOA 4UM9B 3ZHKA 1BVLA 2PF6A 2JIXD 3B6SB 3D2UA 5DD1H 5CCJA 1KLGB 3CFNA 4C56B 1JFQL 3RDTD 4KITB 2XQYK 4MDRA 5BV7C 3DNKA 1ZLVH 1G7JA 3DHJA 1HDMA 1NCWL 3D3VA 2VL4A 3GO1H 2CBOA 3STZB 4ZMLA 4P05A 4Q6IA 1Z3GL 1U8CB 5KTEL 1YECL 2J1YA 1IZKA 5DVNA 1P4BH 2ZYSA 2NSQA 1IC4H 3KYKL 4Q74A 4I1RA 1QR1B 2FUTA 5T3XE 4BE5A 5T3ZL 3QUZC 1GOHA 2CO3A 5EU3B 1A4KA 1VADB 3SBRA 4GP5B 4WQOA 5D96B 5C0BB 1KTJA 4BGLA 5E5LA 2NTSP 5G4NA 4U6XB 4JPQA 5AW1B 5TF0A 1NCTA 2C7UB 4QXGL 4RMBA 2AQSA 1NTDA 4JPKL 4PEEA 1FNHA 1I1YA 2BSEA 5DC2A 1FNEA 3TO4B 3S6CA 1X7QA 2JH2A 1L9QA 2X2HA 4KI1A 3KAAA 3NA9L 3TYGL 1XBDA 5GISL 3HVNA 4N0UE 5EU6D 1LK2B 3LPGA 5BS0A 4RRPA 4FQXD 5LUMA 2APFA 2E47A 5IT2H 1U3HD 5DO2D 1A6TB 4TS6A 4WKZA 4LL4A 1YNKL 1IE4A 4H26B 4S1QH 5GGVH 1YN7B 3A6CH 1ORQA 2IALB 2VLMD 1D5IH 3DMMA 5D7LB 3GI8L 4TTGA 2QTEA 3NDYE 3SKOA 2NY0B 4UWQB 1W91A 2N4IA 1BZEA 1HQRA 1RUKL 5D1ZB 4HA1A 1UD6A 4MAUL 2R29L 5EO1B 1A21A 5F7NC 3O4LA 4MNHA 2XXGA 2HKHH 1FIEA 3G6JE 2Q86B 3QUHA 4DK6A 2FEEI 5CIPA 2HMID 2GSGB 3BRGC 4XX5A 4I5BA 5IHUL 1FV1A 2C1PA 4M9OA 1AAJA 1WC7B 3D07A 4JFYA 1OGAB 5T3ZE 5F89A 3SJVE 1CZ8L 2L04A 2R2HA 3ZL2A 7FABL 1EMTL 2FX8L 2FR4A 5IG7B 2F0CA 4DOHE 1CL7L 4UOW1 2GSIA 3H9SB 3VXTA 4YDLB 5JXEC 3FH5A 3HNVL 3QCUH 5I6LA 3SPCA 1DJHA 3L8QA 1ZWIA 1ODUA 1A5FL 3RHWK 3KCPA 4ZDHA 1UB5A 4P5TA 4G8FB 5ID1B 1EJ8A 4KMQA 4HCIA 2HJFB 2BRRL 4KOBA 4RMSA 2E6PA 2YXMA 3BWAA 3WKQA 1GYUA 1MJJA 2GCYA 1D9KB 3E7JA 4WY7L 2OQJA 3K6IA 5D7HA 5GIRA 4GYBA 4JFWA 2OZ4H 4HHAA 3F7YB 2C5DC 4OQTL 2XZCH 4HJUA 3JV4A 4BQ8A 1DVQA 1UUNA 3CZJA 3JWOC 4DP2X 5HHPA 3MLWH 1PIFA 1DVFC 2ZOLA 3C8KB 4I9WE 3OSKA 4D9RE 5DYOB 4OZGB 4Z78B 2WZ6A 4KVCH 1I75A 5J06A 3QUYD 3V4UL 4HC1L 1EAPB 4Y4KC 1I1RA 1XV8A 2WSPA 3IF1B 3VQMA 3S35L 4Y5YA 2ENSA 2ADGB 2DQHL 3R0MA 4R7XA 4ZUSB 3D4ZA 4JRXE 1JZJA 3BKCL 5KSAD 2WXHA 1AI1H 2EDQA 4GKNA 2VKXA 1O7VA 1IGYA 4UQ2A 4QOKE 5B8CA 2FECL 2WWNA 1K8DB 1GHFH 3H9HA 5KBMA 1J9TA 1XSIA 1AGEB 4JFEE 3CZFA 5B38G 5JYLA 4R7DA 3F7RA 3FTXA 2DQFA 3CG8A 3H9YA 1OAQL 1PZUB 2F1BA 2WIMA 3RKDC 5DA0B 4TOYL 4IKIA 4PD4K 3PDGA 3KGTA 2WY3B 2X70B 5T5FL 3RX8A 5F8RC 1RZJH 2P26A 3VTAA 3CTTA 3RKPA 5E1HB 2WLKA 2DM7A 2R1YB 3AG3B 4PSRA 1U8QA 4QI3A 4PJHB 5FF6A 4PLJC 1JPGA 5FYKH 3ROOA 3CFMA 5C0AD 1QKZH 2XQBH 1X4ZA 4JY4A 5DZPA 3WFDH 3L3HB 4P5KA 3QSKB 3UO8B 5FR3A 3G6JA 1SOXA 2ILLA 2E86A 3VD5A 2QADD 2XWXA 3HEIB 1QOKA 1WGVA 3ZTDC 1HHIB 1M9SA 3LN5A 3UOAB 1QFUH 3MRKB 3QIBA 4DQAA 3ZQWA 1M56B 3EUDA 1CICA 3LS5L 3ES6A 1MAJA 3SJVA 4W81A 1NEUA 4OM0L 1B0GB 3PUUA 3F6LA 5DRNA 3LYRA 5KYUA 1H8SA 1FJ1A 1NL0L 5C0BE 3UZQA 5CILH 3KLQA 4FI7A 4JDZB 3HE6A 1QEXA 3STBA 3D85D 1AZZC 1QR4A 2BNRB 1DQDL 3DVIA 5DZOA 2X3CA 1PJ9A 2VAJA 2V3EA 2ZSVA 4MSWA 3BKYH 1XSOA 1R3HA 3CSFA 4R2GC 3SCMD 2Z8RA 3APCA 4N3UA 3RY4A 1JBJA 2Q8BH 4EPSA 4AMWA 3WOVA 4F7PB 5T3ZD 3N43F 5J5EA 3FSZA 3V79C 4U1GB 3EYFA 5HHXL 2VRAA 3NOIA 5DC9B 4G8AC 1SM3L 3TBWA 4HIQA 4HX1B 3HG1D 3LEYL 3VSQA 5D5ME 2D03H 2HUEA 1AGBA 3HZYB 4PWGA 3TA3B 3MRQB 4ORGA 3BUDA 3UTTB 4FA8A 5I5RA 3TPUB 1QBMH 1BYOA 5D7LE 4ONFH 4ZUTB 2VLRD 3RX5A 2R29A 4CADB 1F8TH 1BV8A 4NBXB 4JO3L 2K78A 3CFCH 4L1DA 4NGHL 1IAII 2MSPA 2WIIA 1NBYA 3SBPA 1PEZA 2D0HA 4GSXA 1GC1C 2VGLM 2W9LA 1CGVA 3HAEH 4LK4A 2N3JA 5T1KA 3RX7A 4YWGL 4XBGB 3Q8CA 4GP4B 1YYLH 2WUBH 3PABA 2YO3A 1OGAE 3QDJA 1H6FA 1RHFA 5BRZA 3ECBB 3SBWC 1XF4B 3OKMB 4G9DB 4JQXC 1TENA 4URKA 4YEFA 1EIBA 2ITCA 2ERJB 1W9XA 2BSSA 2X6CA 3G6AA 1TFHA 1AGDB 1CT8B 1BFSA 5JIPA 3A67H 4D8PB 3PV6B 3VXPB 4PRDB 5KS9B 3IMTA 1PDKA 4UM9A 3IS1X 2DLHA 4MA1B 2IG2H 3SDAC 3U4AA 3B6SA 3NCFB 4JRXD 4MNGB 4JDVB 3D33A 1KLGA 3K7UA 4PW4A 2GHZA 4KAQL 2DYSB 3T0WA 4C56A 1B0IA 4PSPA 1WZKA 4GRMA 1JXDA 1L6ZA 2OK0H 4QOKD 4JFED 2V2WB 2X10A 1FZOB 1TTBA 3STZA 2HG5B 1KEGH 1LILA 1FLTX 4K55A 4NQUA 4XC1L 3AXIA 4NDMB 2QQKL 4U1HB 2D3JA 3VMNA 1U8CA 5DQDL 2Z7ZA 4CU8A 3KYAA 4KHXH 2PWEA 6FABH 4LSVH 3L6FA 4OZGE 3MYJB 1D6VH 3MGTB 3NCJH 2WTPA 1M3IA 3EH5B 4IGBD 4P3CH 1QR1A 1TO5A 4AUUA 1PY9A 4W6XB 3ZXAC 5EU3A 4Y1AD 1VADA 5C0BA 4M7ZC 1S4IA 4MWFB 4AK1A 5BMFH 3O81A 4DPCX 4H0IA 1SDDA 4U6XA 3FUDA 3PLYA 1PZSA 3BSZA 4OCRL 5CLYA 1J0ZA 4BFNA 4PG2C 1TG8A 4PJ8D 5GGUB 5HHMB 2IVFC 1GCYA 1EJOH 3GZQA 2YGVA 1IQWL 3ZKNC 3RY6A 3VD7A 4ZFZB 4EEEA 2WLMA 1LK2A 3M7OA 2PWDA 3BUQA 2R2BB 4S0TD 1IV8A 1YYCA 1R19A 3O9WB 4I0KA 4GMSL 1AG6A 2DYPD 5IIEB 1NLDH 3MJ6A 1LDSA 1AYOA 2BSRB 4KKRA 3ZLQC 1A6TA 5JW4N 3PNRB 4W9DC 3SYAA 3V55A 1KFAH 1YN7A 12E8H 1IGMH 1SZNA 2IALA 2P8LB 2IAMC 4PJHE 5D7LA 3RIKA 4KY1H 1WF5A 2IBZX 2O26U 3OAYH 5BW7C 3TZVC 5D1ZA 4V33A 4ODVL 2FWLB 5EO1A 3TO4D 3QIUC 3MRLB 1SXNA 3BLBA 3PYCA 2EH7H 2Q86A 3F84A 4ZTEA 2H26A 4MA7L 2HFFB 2GSGA 1TZ8A 5CR8A 1Q9OB 3GMMA 1NIFA 5IW1B 5CCHE 3D51A 1WC7A 3VXUB 1S78C 3FTYA 1OGAA 1OAJA 1T89A 3WHXB 4D0BB 2R0LH 4RMVA 5DD5H 3BVDB 4AEIH 5D5MF 4EVNB 1H3UA 4BWWA 3H9SA 2CA4A 3CXHK 3AITA 3UABA 4AM0Q 3SE8H 4PB0L 4HSQA 2AXJA 2VW6A 4AGLA 1NCGA 2WMPB 3L3DB 3CNKA 5F0LB 3I9PA 3B83A 1SXCA 9PCYA 1ZD6A 5ID1A 2W8CA 3JVGA 3JWDH 4G8FA 3RGBA 3WGUB 5B3JF 4J23A 3CX5J 5I71B 2HJFA 1X5IA 3H7BB 3GRGA 2QFPA 5H4ZA 3BE1H 1MG3C 1QNZH 2DMGA 1GJWA 1HIML 4RBPK 1D9KA 4LVOC 3VH8B 2KQNA 2ZT9C 4LOUC 5AW0B 3FSAA 4AVJA 2R2EA 3F7YA 2PWGA 3GZKA 3QE5A 3ARQA 1F4WH 5C0DB 1EAQA 4UI2A 4ETYA 4F7TA 3C8KA 4Z78A 5DYOA 4OZGA 4PJAB 2BXYA 2X4QB 1OSEA 4XAWH 1MVFA 2CRYA 1EAPA 3BZFB 4K94H 4ES8A 2PR9A 2XNAB 2QT6A 3IF1A 4IK7A 3MCLL 3FB6B 4W9JC 4QGTA 1QUNB 1KBKA 3QQXA 4ZUSA 4HLJA 1ETA1 3S9DB 1L9RA 1RD6A 5IREA 4NLHA 2AJSH 3IGFA 3TFBA 3GKWH 3UTSB 3V95A 3VW3L 3FUJA 5D1QC 1JAEA 2F8IA 3DUHA 3ZYIA 5C86A 2XZAH 4UV4H 4BQBA 2ZUWA 3VWKB 5TQ0L 2K1MA 3IAPA 1FE8L 1K8DA 1E2ZA 1L0QA 5IROC 5CEXB 2V7NB 1AXTL 1M2VB 1AGEA 3BUIA 2E7DA 2ZX6A 3MBWB 1BVNP 1OM3H 2RCSL 1N67A 4PJ5B 1DHKA 2CR0A 5DHEA 5J1AB 4Q9CA 6TAAA 3VRJA 5HJBA 3KPMB 5DRXA 4B9GA 2X70A 3GLEA 2P3YA 3HI6L 5KS9E 3RFZC 1NDMB 2PWFA 4L9LB 3KWXA 5EF1A 1OPOA 3IFPB 3P2TA 2LTQB 2R1YA 4ONGH 5EU7E 4S1SH 5C08B 2IPKB 3L48A 2G3NA 4U2ZA 2ZUVA 1BVNT 2OYMA 1JTPA 3CQQA 2IDSA 3RURA 2VH5L 3PQYD 3QXAB 1PZ5B 1ZHKB 2P8MB 4PJEB 4A37A 4TUUA 3L3HA 4K3EL 4WGWB 1HZHH 4MMZC 1S6NA 2ZUTA 4CC0A 2IBGA 1ZK5A 4RFNC 1CR9L 2VSCA 3O6KL 4IRZH 4ZS6C 3REVB 4AZ8A 4HETA 5IV2B 1JD9A 1NEZB 3I3BA 5D71L 1HHIA 1KLUB 3BWUF 4LARH 4MB1A 4TM9A 2LLLA 4XXDB 4HLZH 1BPLB 3R4RA 2WP3O 3V0EA 1PD0A 4KKCC 2VSKB 1Q90A 4AC4A 2IDTA 3NSYA 1B0GA 2F2HA 4RBPH 3O4OB 5CIPH 1R3JB 5G5DB 5KYXB 1N12A 2JKIS 3WIFB 5CJOH 4K8RD 2X6BA 1KGUA 4JDZA 5DCCA 1THCA 4JG1H 4ZAKC 4PJHF 3EH1A 3MUZ1 5HGHB 4JRFA 4M03A 2X09A 1U4EA 2BNRA 1JJUA 3VI3F 4WUUE 4BXVA 1OIOA 5F7LB 4ZSOE 1PLGL 2COVD 5JZ7C 4NQTA 5T1LB 4G6AC 1A7QL 3MRPA 4GW4B 1J5HA 2A9NH 2R9HC 5BO1L 4LDCA 2JI1A 1BEYH 2PUQT 4YIQB 4HX1A 3UDWC 3WY3A 1CGSH 3IRCA 3TA3A 1NEZG 3HZYA 1SJXA 2YAHA 2FQGA 4GT7A 3MC0A 2WP3T 3UTTA 3DXAE 4G8GB 3TPUA 4XWOC 1TZHB 1PSKL 3D9AL 3O6FD 4HQQL 1E6OH 2B1AH 4ZUTA 4MNQA 4PVMA 3RI5F 1ZTXL 2UVEA 1W6WA 4CADA 3ULSB 2IPUG 3E6FB 4IU2B 1KTBA 5IHZB 2LGNA 2J71A 2UXFA 4K7PY 3ARED 2EC9T 4UT9A 1L9MA 4JFDD 1E2WA 1BF5A 4L2YA 2Z0BA 3FBQA 4OGAD 4HW6A 1T6VN 4OKVB 4XBGA 4WCYH 1FNGB 4YHML 2CIKB 3VXUE 3F12B 5T3XH 3CK0H 1JG9A 4FDWA 4J8RB 3BMWA 3ECBA 2ZPKH 1XF4A 1QWUA 3K80A 3OKMA 5L4MA 4G9DA 2XI9A 4I88A 3RJDA 1KJ2B 3HBPA 1DYZA 4CJ0A 5IHBA 2B3RA 3H7LA 1NGXB 1AGDA 1CT8A 3ILQD 3LNFA 5F7FA 3WS6A 4N5ED 2VM3A 4D8PA 3PV6A 4PJFF 3P9WB 4PRDA 1NCCL 2CAKA 2WVUA 35C8H 4X5WB 5ABAA 5KS9A 1WFMA 1JGUH 4KMTL 3LPFA 4MNGA 3NGBC 4JDVA 4HS6B 1KCRL 3T3ME 2E7MA 1U93B 1NJ9B 4E9RA 4R4BB 4BK5C 4OZIF 2YSSB 2V9TA 1ZGLB 5I1GH 3GNMH 3E3QE 4B97A 1N7MH 2PR4L 1JFQH 1PIGA 4A7VA 2V2WA 5CGYD 1FZOA 5F7EL 1KCLA 2GBTA 2HG5A 1X5XA 3BDBA 3CN4A 2Y7NA 2OULB 1NCWH 5AVVB 1QSEE 3TXAA 5FCSH 1ZTXE 2HH0H 2VDRL 1V3JA 2R59A 3B9KB 4U1MB 4R7NA 3S2AA 4ENEC 1R5IB 3MYJA 5EOCL 5IB4B 3MGTA 4LLAA 4PJAE 1O5PA 5JHDB 1KPUB 1J8RA 4HWEL 4DGIL 4K7PX 1J10A 4L3AA 5HYEA 4E9LA 4FEMA 1Y1DA 4GQPH 3BH9B 4MWFA 3V5HB 4GIAA 5I0ZA 1DEEB 3KE0A 5L6YL 4KOCA 2GIYA 4MD5B 1BM3H 3I3EA 5E2UL 1J5OL 3BVXA 3UTSE 3QC5X 3QISA 1ADQA 3CDFA 3H2PA 5DHDA 4WHDA 3IDXL 4LLMB 4OBRA 3NPZB 5GGUA 2H1LM 4G72B 3TFKC 3MN8A 2QTVA 1DQTA 2C3HA 4NQED 1LGVA 2V8LA 4IM8A 4AKOA 4QXGH 5EOCJ 1KY6A 3P0YL 4JPKH 4NQDB 3OZLA 4B9KC 2AEWA 4ZFZA 1L9TA 4GQQA 4PJ5E 4UU9B 4N85A 2VN7A 2R2BA 2XTJB 4K2UH 4PLNC 1ML0A 4ZMTA 3O9WA 4YHPB 5IIEA 1U3JA 3NA9H 4AOFA 3V2AR 4EXKA 2CLRB 5GISH 1IKFL 3TEXA 2BSRA 1CDCA 3QXTA 1AXSB 3D34A 5H8DA 1YPZF 3NFSH 4ACPA 3N06B 1DEDA 2P8LA 4R5VA 2J6WA 1SXAA 5C08E 3ZO9A 1CTMA 3GIVB 1F13A 4WUUD 4XGZB 3US9A 3N40F 1RZ7L 2C9UA 4W68A 2DW5A 1YNKH 2IOIA 5JIIA 3GMPB 1B2WH 3MRLA 5A2AA 5L88L 5I1JL 2HFFA 3TEYA 1AQ8A 2VQUA 2R29H 1Q9OA 5IW1A 4XB7A 1XB6A 3VXUA 1XGZA 3GEWB 1WZ1H 2EDMA 2EZ0D 1J8KA 3WHXA 4D0BA 3DXAD 1YEGL 1BQHB 3TJPA 3TEZA 3PDDA 1I8AA 3EBIA 1OKEA 4EVNA 3SKJL 1JDCA 3SYQA 3V6OA 1JGLL 1CZ8H 1KJ2L 4F2EA 1OTSC 1U36A 5FDWB 2WMPA 3L3DA 1GTFA 1HKLL 1EMTH 2FX8H 3DWTA 1CL7H 4ZMVA 4CMMB 2EDDA 1WFTA 4PY7B 4P57B 5F97E 2NZIA 4U6HB 4QRPE 3BAJA 3QO0A 4X6FB 1XB8A 2W88A 4N2HA 2ODHA 3GSQB 5GS0D 3H56A 3VH8A 4MAZA 2BRRH 5IBUB 4P2OB 4JZJC 3D39B 5FOJA 3ZDYF 2BY2A 2CO1A 5EIVA 3TBSB 4CGTA 4PRID 5C0DA 3VAEA 4WY7H 4G8GE 1NMCB 1VAHA 1DLFH 3O0RL 3S88L 3NVQA 4PJAA 3OQ3B 2X4QA 5F7BA 3UZVB 3BZFA 4GBXD 2E8YA 3WIHA 1BQHG 2XNAA 1D2PA 3NJMA 4TNVF 1QUNA 3V4UH 5A2LH 5DO8A 5I6XB 2FRGP 3T3MF 4XP1H 1A4BA 2GTZB 1EBPA 3GXDA 1ACCA 3UTSA 1I4FB 3QFJE 1P7QB 3U6RB 2DQHH 2E4FA 2KDYA 3VWKA 3ET9F 1QSED 3T3PB 5CEXA 4NAQA 2DQCH 2V7NA 2OL3B 2YUVA 4GRLB 2FJUB 1M2VA 4FLRA 4PV1C 4YBQC 4H8WL 4W9FC 5F6HI 1HSAA 3LNHA 1E5CA 1FFPB 4L1LA 1QZNA 1N6UA 2YQBA 4PJ5A 4OLXL 3BSZH 5J1AA 2J1XA 4LKCB 8PAZA 1J1PL 3VO0A 3P54A 2LAGB 1WV7T 2NNFA 3DYMA 1IC7L 1KJ3L 3KPMA 4PJAF 1TTRA 1KYOJ 4JAMB 1OAQH 1NDMA 4L9LA 1G4MA 1J0JA 1AKJB 1D5XB 2F7OA 2QLVB 1EH9A 4P4KA 4TOYH 3IFPA 4GKZB 5INCB 3G5ZB 3LB6C 2AXGB 2YOAA 2IPKA 3FQYA 5AW9B 5C08A 1KXHA 4YSEA 5K33A 4F27A 4Y2DC 1T7ZA 3H55A 4L3EB 5IF0B 1A6VL 2HYMA 3FKUS 4AG4L 3QXAA 1PZ5A 1ZHKA 2NR6D 2P8MA 2CU9A 3NIGE 4HKXA 4PJEA 5ACLA 3MKGA 5CR1A 1E3ZA 1TU2B 4K9EL 4NQVB 1WE5A 3REVA 4DO5A 4MXWL 2XKSA 4R4FL 1NCJA 4ODUB 2F8XC 1KLUA 3EYVB 1UD5A 4XXDA 3KJ6H 3OG6B 4BSJA 4UQCA 4R8WH 2OR9L 4FNQA 5JHDE 5IMLA 2OMYB 1YMMB 4M5TA 2BVTA 3GSXB 2D4DA 5A6IA 1R3JA 5GHWL 1Z32X 5G5DA 3X17A 1Q8MA 4ZX4A 3WIFA 1F58H 4A7QA 3LS5H 1UWXH 4F1SA 1JZ2A 1CLCA 1FIGL 4OM0H 3TIEB 1TJXA 5HGHA 1ITCA 1C7SA 4HCRA 5HTSA 1SLWA 4MA8H 3TV3L 1U8HB 1UZGA 3GMLB 3MROB 1JTOA 4KXDA 2BZ7A 3MHZA 4Z3JA 4PHZA 3NJLA 4JDTH 4M02A 5T1LA 7CGTA 2A1WL 1KENL 4GW4A 4NQDE 3RZCB 2QSTA 3GI9H 5GJTL 3GLAA 3U1QA 2XTJE 4LSQL 4YIQA 5E7BA 4OGYH 3ULVH 1T20A 2AQNA 2A5UA 2WXRA 5HHOB 1TLMA 3DI2B 1MCWW 4G8GA 4U2YA 4LMQI 1TZHA 5KYNA 1SM3H 1ID5I 3F04A 5ELIA 5JOFB 1JYWA 3LEYH 4XPAL 4F5CE 3HKZA 3ULSA 5A2JH 4IU2A 5IHZA 1OL0A 5LG1A 2KT6A 3WNPA 2BX5A 4QRPD 4JFOB 4G7SB 2EH8L 4FP8L 4JFTA 1HHJB 5EF2A 4NGHH 1L9SA 4OKVA 3HJ0A 4U4IA 1FNGA 5HGGS 5CBAB 2CIKA 5AOIA 2AHIA 3A23A 3F12A 1WD9A 1OSYA 3VFTB 3QP3A 1ZXKA 2BZCA 5CZVH 2AERT 4J8RA 5I15H 5IFAH 4ZD3H 4PJ9B 4POZD 5E6ID 1KJ2A 4Y9BA 1NICA 4FG0A 3IDUA 2CCWA 2UZXB 2OL3L 3F3HA 5A2FA 4H2CA 1JDAA 1HINH 4OCXL 1NGXA 5C97A 5JQ6L 5ANHA 1KULA 2JSFA 3MJ7B 3UL4A 4B0MB 4N8VB 3K6NA 4XOBA 3FRUB 4X5WA 1MREH 3B37A 5EULV 3ULUL 1MZZA 1GYWA 4MB5A 4YUEL 1ILUA 3BPLC 4F7KA 4HS6A 5L0QB 1HEZB 1KBPA 5FYJU 2IQAB 1A9VA 1U93A 3QFJD 1EHKB 1NJ9A 4JHUA 4R4BA 4YC2B 5ITFB 2YSSA 1MW2A 2HLFD 2R56H 3GQFA 3HPJA 3IJ9A 4PHXA 2X2JA 3IRPX 4KAQH 3ARFD 1G1OA 3DJSA 3D39E 1KCSL 1MJ7L 1L4IA 2QKIB 3EO0B 4YDMA 5DF0A 3UC0L 1UYWL 4U1MA 2F68X 3B9KA 5KBKA 4GIPD 1R5IA 5IB4A 1LE9B 3DTUB 4XC1H 4XO4A 2VQTA 2QQKH 4YPGB 5DQDH 5JHDA 1KPUA 1MAML 3GZOA 3L4TA 2DWYA 3ZKXB 4WGVB 1LWHA 3MLXL 3BH9A 4U3CA 3V5HA 1R75A 1SPDA 2YRBA 1ODAA 4LSDA 1G7IB 3HB3D 3EGDB 4MD5A 5KANG 2IFFL 1LO4H 4BZ2A 1MCNA 3UXFA 4DNLA 4YXKL 4LLMA 4D3CL 5LDUA 3EFDH 5I1CH 4B60A 3NIGF 3TP4A 3T3PE 2G2RB 4CW1B 2P5EB 1KBBA 1FZKB 4OCRH 3FT3B 4ZODA 3GJEB 2E9GA 2VZSA 1S7QB 4UU9A 4L8SC 3R18A 3FN3A 2LHAA 5ADOH 1N4XH 3VI4B 1GGYA 3T4AB 4ZX5A 4OQ1A 3ULUE 1IQWH 4YHPA 4XRCB 5EA0H 5KSUB 2CLRA 4JPVL 1EXGA 1RSYA 1AXSA 1CDHA 3FTGB 1BZ9B 3DOHA 3BPNC 4DPAX 5DEFB 4EIZC 3KW8A 4EIUA 1U3YA 3GIVA 2JE8A 1NBZB 1SHMA 4ZOCA 4RDBA 1HCVA 1MSPA 1J1XL 3M7FB 3X1EA 4NQDD 4HUXB 5KAQF 1ZEAH 3CFJB 4FYRA 3HMXA 5CJ5A 5EDXA 2YRPA 1AGCB 3FTUA 3BGMB 2CJ3A 4H20L 2ZKYA 2EEFA 4JR9L 2FB4L 2WYHA 2NNXA 4HJIA 4M93C 4J3XA 5DEZA 4MA7H 3TJHC 4EI5B 3BMVA 5DJCA 2HRGA 4UT9H 1YMME 1MWAB 1VRSA 3ZYZA 2BJMH 3NP3A 1U8KB 2CIIB 4A55A 4WEMB 3FUEA 4Q52A 2YMTA 2DY2A 3WNMA 5FDWA 1JZFA 3BAXA 4RA0C 4CMMA 3C2AH 1PKOA 4PB0H 1QW9A 4C4UA 3U36B 43CAB 4PY7A 4P57A 3F62A 5LQBL 1G5AA 3UZEC 3PCYA 3WSQL 4JFFD 5IB2B 1MFEH 1KY7A 1THAA 4X6FA 5AKVA 1MHCB 3GSQA 4J4PD 4P9HL 1Q0XL 1UH4A 3QB7C 2WZAA 3IPEA 4PY8J 4X7DC 4HJ0C 5E70A 3VMPA 4P2OA 2DLEA 5J6HB 3SPIA 3D39A 3QYMA 1HIMH 1JWMB 3CVHB 5HHOE 3TBSA 4XMZA 1OAUH 2CK2A 2ZKXA 2Q7AA 3Q2VA 5CLWA 1OP9A 4JDEB 3QQ4B 3DUUB 3D50A 1RZ8A 3INUL 4XXCC 5D6CA 2XFXB 3UZVA 1AZBA 3GB7B 2FGWH 2X1OA 5CZKA 1SEQH 2OSLB 1Z2KA 4FQCL 1KV3A 4RGOH 5EBMB 4GSDH 3M6DA 4WK0B 1TETL 1SEBB 1SHXA 4IKLA 3UTOA 3CSPA 4WK4B 2GTZA 3BFWA 5BJTB 3MCLH 1I4FA 1G6RL 1YAZA 1P7QA 4ODXB 4MZ3A 1HKFA 1IBDA 2VDKH 4DP6X 3TL5A 4GRLA 2OL3A 1QFPA 1WAAE 3TURA 5I1DB 1FFPA 1JUFB 1U8JB 3MBEB 1FSKB 4WFGE 3OD3A 5DS8A 3FT1A 1FE8H 1ADQH 5D1XD 3CVBA 4I85A 4JAMA 5BZZA 2EXSA 1NMAL 3FW6A 2NY6B 4TNGA 1D5XA 2AEQL 3LAFA 3B2VL 4PGEB 5INCA 3G5ZA 1LO0H 1N26A 2BVUA 2VOTA 1QLEB 2AXGA 1EZUA 1CIDA 3OWEA 1G9ML 3HI6H 5KEZA 1VZHA 4LPYA 4L3EA 1KTLB 5IF0A 4E41E 4FZ8H 3IWUA 3VXRA 5B1KA 4H0HB 2A0LD 1G94A 4U1SB 1FZJB 2PO6C 1TU2A 4NQVA 2WBJC 5ICYB 2OXHB 4YE4H 3APNA 4B3VA 4U1LA 3PS6A 3TEUA 2VM4A 4MXVE 3QIWB 4K3EH 3ULUD 3EYVA 4OSUH 5JHLH 4JANB 4A2FA 3R7RA 1E4KC 3O6KH 4RIRB 5GGTA 2HTKD 1AKJD 5JIHA 5H35A 2WC7A 4NO2B 2OMYA 2HJKB 1YMMA 2VSDA 3ULUF 3GSXA 4YVNA 4XNAA 2J5WA 2PPDA 4KGLA 2ADFL 3D4CA 2R83A 3F05A 1AO7E 5I2IB 1SFHA 2ZZUT 3C6LD 2UX6A 3TIEA 3MXVL 3QH3B 4AEHL 1GYVA 4B5EA 1EEZB 3IPBA 1U8HA 5B4MD 3GMLA 1CGXA 3MROA 4WNSA 2P5EE 2YA1A 3MTRA 4UOW0 3VX1A 4I1PA 2CKNA 3RZCA 1RLBA 2F19L 1TQWA 3SD5A 1PU0A 5IZ7A 4OCWL 3VI4E 4HH8A 4HMDA 2H1PL 1BA9A 1R17A 4FQHA 3HIZA 1DFBL 5BO1H 1XF2B 3DV4B 2NY4D 4JL2A 3AWEA 4NC1C 2ESVE 3CVHL 1HSBA 4ETQB 5JOFA 3IM1A 5DD0H 1MCWM 3LPPA 4GO6B 4KJQC 4RESB 3LXBA 3UIZA 3F65A 3N44B 2HG0A 5GRYA 5DFAA 4AL8H 5T33L 2RJMA 1CL7I 4WI0B 5L9DL 1PSKH 3D9AH 4PGDA 3I6KA 2IDUA 4U4BA 3FAXA 3OC5A 1RCYA 3C8DA 4JFOA 4XMTA 3MNZB 5I5MA 1NUFA 1HHJA 2MCPL 2ZNXA 1PMYA 1KIPB 3TVMB 1A6UH 5CBAA 1I7ZB 2G0LA 2H0EA 4YFLI 3WIHH 5JOEA 3P4MB 4QPEA 4YHZL 4LEEA 3VFTA 4HS3B 3CFTA 1HL9A 1TZIB 1WAAA 4M8VA 1JNLH 1YQVH 3PWLB 2UZXA 4JM2B 5IWLA 4A38A 4AJYV 1EVTC 1KELL 2VAAB 3RVTD 4ZNEE 5E99L 4JREB 3MJ7A 4Z7WE 4N26A 1G43A 4N8VA 4AYFB 1ORSA 3FRUA 4OUUB 1KCVH 2FBOJ 4IIQB 3CZSA 3WCYA 3ATDA 2A74C 1HEZA 5F7KC 3STLB 3T4YB 2IQAA 1DDHA 4JN1H 3DX6B 1SXBA 4KMTH 3JTBA 5I1HH 5ITFA 1NKOA 1QLEL 4M62L 4BYHA 1H9DA 5E4EC 3MNWB 4N9OB 4PJ9D 1URLA 4Q9RH 3CSBA 1G0YR 4CAGA 4XVSH 4AZUA 1UJTA 4XCCL 2QKIA 3EO0A 4YLQT 2CZNA 2NPLX 3I02B 4XO8A 1RZKL 5I28A 2R0ZH 2FECI 5F7EH 1IJNA 4GQRA 4E42B 4IJ3B 1LE9A 4Y8DC 3B3IB 2ORBL 2ZD0A 4YPGA 5GSVB 1E40A 3VG9C 4A7TA 3GXPA 4Q0XL 3LVTA 2JKJA 4WIQA 5FIEA 3RWHB 4UYQA 1X4XA 5J12B 4E41D 1G7IA 2XZQH 3QZMA 5LB1A 4OGQC 3EGDA 4MZIA 5TE7H 5I9QB 4UILL 5FGCB 2HRPH 3RTQB 4TLKA 5IEKB 3QHZH 4WO4D 5KYYB 1KIUB 1ZSDB 2EC8A 4ZQKA 3SPVB 4ANVA 1HYSD 3APMA 5DK2B 1VIWA 2C3GA 5L6YH 2G2RA 4M6NL 2P5EA 5BOJA 1FZKA 2EO7A 3FT3A 5E2UH 5CCGE 4Z95L 2J8OA 2BNQE 1LO3L 2YFNA 4LPXA 1T2JA 3SDDB 1S7QA 1MQKL 2RB8A 4HCRH 5D1ZI 3UAJD 3DDGA 4MXVF 3ZMEA 1PNCA 2K6YA 3NZSA 3VI4A 4OD1L 3T4AA 2NYYC 1TJGH 3OAZK 3U2JA 1KTDB 4MVBC 4U7KA 4XRCA 5KSUA 3RWIB 1EDHA 3GS4A 3MBXL 4JO2L 1TVDA 1T2XA 1AO7D 1QACA 3FTGA 1BZ9A 4XTRC 3W37A 2O30A 4C59B 4LL1A 2WN3A 3RDJA 5DEFA 1HHHB 3TBBA 3K5SA 1JK8B 3ATEA 1WYJA 1IKFH 1J11A 1SYVB 1NBZA 1XCTB 4M4PA 4NX0A 1I3VA 4OCSL 3UYOD 3PFUA 2BIIA 3WNNA 4HUXA 4CMHB 3CFJA 4E2OA 1RZ7H 1AHMA 4RVBA 2X1XR 2HA1A 3ALWA 4KDWA 1AGCA 3BGMA 4Z3HA 1AMXA 2JV6A 3ECVA 1Z9NA 1ZS2A 5IMMB 3ZSSA 3W9EB 3IFLH 1PEWA 2B16A 3BIKB 3O3AB 3L4VA 5LO7A 1MWAA 4NZRL 1U8KA 2ESVD 4MDJA 2CDFB 3IRZA 4P46C 4APQD 4MJJA 2M2DA 3MREA 3UG4A 2W07B 2FEDD 4OF5A 1NOFA 4AXWB 1EO8L 2F61A 4K73A 1Y6KR 2Z31D 1QSFB 1KJ2H 3CSGA 3GPSA 2NX5D 4JY5H 3SIKA 5ALBL 3K2KA 3U36A 43CAA 2Y1YA 2DJMA 1HKLH 4KKLC 5IB2A 4WVRA 1AZVA 4EI5D 1JNNL 2JQZA 1RP9A 3HKFA 1FL3B 2ZSWA 3H0TB 2Y2TA 5J6HA 4MJ4A 4V2BA 4XAKD 4Y4FB 1JWMA 3CVHA 4TL5A 1TEGA 4M43L 4H7VA 2L3BA 4JDEA 4JKPH 3QQ4A 3FU5A 5CP3A 4ZUVB 5HI5C 5B39B 2XQ0A 2XFXA 4ACTA 3GB7A 1W6LA 3Q8AA 2B4CH 2ITFA 4JGUA 4AE1A 4R5XA 4Z7WF 1GW0A 1TJIL 4YXLL 2DL9A 1EHXA 2OSLA 5EBMA 1DBKL 3DGDA 1LE5A 1DSFL 1SEBA 4Z7UB 2E59A 1UKSA 3DYOA 3OMZA 4U3SB 3SDCB 5IHWA 1IGCH 5DJ0B 3LXAA 2DDQL 4FKHA 2DQEL 3UX9B 3PXLA 5BJTA 1HE7A 3LX9A 3OZKA 5EU4B 2AMGA 1L9NA 4O58H 4ODXA 5K9OB 2G30A 4DJMA 2E4TA 2H2PD 3W0WB 4TYUA 1XGYL 3HBGA 1CURA 5DRWB 5I1DA 3QRBA 4NKQB 1JUFA 1B3IA 3MBEA 4F92B 3R06B 4BZ2H 4QGYA 2VLKB 3S96B 3AS3A 4NP9A 4QTHB 2CBPA 1XTMA 2UZPA 2ITDB 1UCBL 3QEHA 2F58H 1NCAL 5G4OA 1OM9A 3ZMNA 4JGJA 2E9JA 4PGEA 1IC7H 2J20A 3RBGA 3W9DA 2V5YA 4YMPA 3UEZA 4MLSA 1FAKT 3KDPB 3INOA 2GJJA 2AC0A 3HPLB 1RZGB 1P84K 3FO2A 3KPSB 2YD5A 4LRIA 2HWZL 2LABA 4S1RL 3GIZL 4U1SA 1FZJA 2BNQD 5ICYA 1E9OB 2OXHA 2AEPH 2YAPA 1A6VH 2DQJL 2C3XA 2VR8A 3LNGA 4NO0D 5GGRB 4AG4H 4DO6A 4JHWL 1CFMA 1S5IH 4I13B 3QIWA 2ICEB 1H3GA 3LV3B 1PTZA 4K9EH 3NTCH 3PL6D 1JHLL 1F4HA 1M9WA 4RIRA 2IMMA 4EAEA 3WTSA 3FFCB 4NO2A 3AXLB 2HJKA 2NMSA 2NW2B 1BVZA 4R4FH 2N59A 4LGRB 4ZO8A 3HMXH 1SMOA 1GGIH 3CMOH 4G5AA 3VG0L 5IB5A 2DIAA 3BGAA 4PP2B 5MI0C 2KLRA 1KWGA 2OR9H 5I2IA 1Y6NR 2MJWA 3FO1B 3RGVD 2JJTC 2BO0A 3OHXC 3PWPE 3ARBD 5FGCE 1V7ML 3QH3A 5JIDA 1EDQA 3A3YB 4NUGL 4L8CB 4X8CA 4J3VA 1CU4L 1EEZA 3D08A 3VD3A 3RPBA 2DQIH 5EOQL 1FIGH 3WLWC 1YO4A 1A4AA 5KZCD 3A24A 4B9YA 2AK4D 1UTDA 2VL5B 5C07B 3VU1A 4M3KB 1Z3RA 4G8EB 4JJOA 2A1WH 4DPBX 1ZGLP 3C5SB 3LKQB 5IQ7H 3LZOA 1XF2A 3U1PA 3LJ3A 2OYPA 3RDTC 3DV4A 1TDQA 3FT2B 4LSQH 3OJ2C 4DKEL 3NIFF 2DM3A 4ETQA 4G7QB 3UBXB 5IKCB 1PF3A 1EHAA 2A77H 2E56A 4WI0A 25C8L 4DK5A 1G7QB 3DX4A 5D70L 4IRSD 5CJXC 1F00I 1WA1X 3S37X 1O0VA 3B2PA 5B1JC 2NY5C 3QYNA 1TR7A 3I6LE 3TVMA 1MI5B 1ICTA 1I7ZA 1KXVC 3QAQA 4N2MA 5JW4R 5DHXB 3P4MA 1BAGA 5KVDL 2EH8H 3DK2A 2P80D 3ECWA 5TDOA 1QP1A 4HS3A 3TT1H 2OW7A 3K6OA 4NKDB 1J8HE 1TZIA 2N7SA 2GQHA 3QG7L 5DJXB 5EIIB 3IJ8A 3PWLA 3QWOA 1XIWB 4JM2A 5IVOA 4OI7A 2VAAA 1J86A 4WI4A 1U0QA 4U6YB 4AYFA 3QORD 3CN0A 1EXUB 4OUUA 2R1XA 4IIQA 4MA3B 5MEOB 4R7VA 4WTQA 3FCBA 5DURD 4L4VB 1QSFE 4MCZB 4OJFH 4GXUN 4LCWB 3T4YA 2APVA 4OD2B 1YNTF 1YEDA 2ED7A 2APBA 3PWJB 5FK9B 2NXZD 3DX6A 4FQXC 5E94A 1RJZA 1FVEB 4G80A 4APXB 4DEPB 4YUEH 5I19H 1NMBL 3NQKA 2F74B 5CLXA 3X3FL 1U3HC 2WK2A 3MNWA 4OJDH 5D7IB 5DO2C 3IJEB 3P0GB 2IO5A 1EWHA 5E6YA 1E43A 5HDQL 4RAUB 3EZ8A 4F9LC 1NCIA 3I02A 5E2TL 1KB5B 1BVKB 5FA4B 2PN5A 4YBLC 1GS7A 4E42A 1KGIA 4HWBL 3B3IA 1KCSH 3OJVC 5GSVA 3KL5A 2XWRA 3PNWB 4HV8B 2QL1A 3FF8A 4YH6A 1IKNC 4XN7A 1D5MA 3FFDB 4YXHL 2HMIC 3BAKA 3VFGL 3RWHA 2QJDA 1IFHL 4Z7UE 5HPMB 4X4XB 3IDYB 4MZ2A 1EAJA 3U7YH 1HU8A 5D72L 1B6DA 5D7JB 1AHWC 4CILA 4ZPTB 2C3VB 5IEKA 5KVDE 3FO0L 2ZJSH 3RTQA 5GGTH 2ATKB 4BSWB 1H6UA 3BQUB 3MLXH 1KIUA 4KKZA 1ZSDA 3SPVA 1WZLA 3AG2B 5DK2A 3TNMA 4OLZL 2F18A 5D7KE 3TCLA 3W0WE 3ABMB 3CWGA 2H45A 2YWYA 3MODH 5EUKB 1YDPB 4MJ6B 4Q8BA 3SDDA 4D3CH 4K3DL 2VLKE 1YJDC 1LL1A 5HD8D 3U9PL 4NHCL 2ZIDA 3DETD 1F4XH 4KX7A 1KTDA 3NIDF 3RWIA 1SHWA 3SE9L 3EFOB 2YD4A 4DVBB 3VD4A 3DVNB 4P2RA 2DEYX 1QRNE 5BPPA 4U0RB 3PWPD 1UENA 3EHBB 5F9DC 1HHHA 5CU5A 1JK8A 1IBGH 2WO2B 1SYVA 1XCTA 3FCTA 1EEQA 3NJIA 3QZNA 1CF8L 3KPSE 3VX0A 1OGTB 4YEEA 1GYAA 2F5AH 4PJ7B 4DFHA 3VVWA 1J5DA 2UXTA 1IQDB 5DZJA 2EICA 4TUKL 2HFEB 2WQSA 2ZWNA 5AAMA 3QUYC 4WUKL 4GMTL 2C9XA 2FQDA 3HUJB 5IMMA 1PD1A 2X4NB 1C16B 3W9EA 1OD9A 3S5LG 3MV01 1NGPH 3CJJA 3BIKA 3FFCE 1CQYA 2XY2A 1FBIH 2F1AA 2Q5BA 3KPQB 4YO0B 3KCWA 4H20H 1N5YH 3TASA 3S8GB 2L0DA 3ARVA 3VRLE 5GZNA 3ETBJ 3X14B 4ELMB 2W07A 2CDEA 1EJFA 2CDGB 5JR1L 4J39A 4OVUA 1QSZA 4AXWA 3S2CA 3MNMA 5KW9L 2ZCLH 4NM4L 5A43C 1QSFA 1MCHA 3CV5A 4A66A 2K7PA 4CU6A 3I6LD 3QJZA 3MV7B 5DMIL 3DA0A 2DIBA 4LDEB 2HKFL 5FO7B 5FUZL 4JKMA 2A6JB 4G6ML 1JZ3A 5EH1A 5C07E 1J8HD 4FFYL 1HCYA 5I1KL 4X9FA 1FL3A 5IJKC 4WAFA 3BAWA 5LQBH 3WDHA 4X7SH 3H0TA 4WW2F 2IOMA 4ZZKA 4Y4FA 3BD3A 2I60H 4P9HH 3HN5A 3VTTA 1UQSB 1UT1A 2DH2A 4XPTH 4ZUVA 1KB5L 5T8IA 1HNGA 5B39A 3VDBA 4LGSB 4WFED 2DQTL 3MJ9L 3N41B 3U2SB 3QJTB 3H3PH 1K4DB 4JCLA 3WD5L 4HF5L 2QADC 3WGVB 3INUH 4Z7UA 1ZAGA 2H6OA 3E8UH 4U3SA 4ZPVB 3SDCA 3GSOB 3CDGB 3MRCB 3AQZA 4FQ2H 4BM7A 4K5PA 3WAKA 5EU4A 2V37A 5K9OA 4HK0B 3UERA 3BVVA 1DO5A 3ZU8A 1A1OA 4F7EB 1NCHA 2AJZB 1JMZA 4RNRB 5DRWA 4BFEA 4B5ZA 4QLRA 4RQQB 3CU1A 3R06A 3ABGA 4FXKC 2VLKA 4HALA 3S96A 3MRRB 2XA8H 1OXYA 1UWFA 4QTHA 4HGKC 4FULA 2EUWA 2ITDA 4KROB 5FO9B 4X6DB 3G5XB 5JUEH 3SCMC 1G1YA 3VGEA 3RVWC 3X1BA 4LCWE 3WNJA 4H1LB 3QYCA 4QYOA 4Z3IA 4YJZL 3N0AA 2HN7B 4LT7A 3DSNA 2Z4QA 1UZ6E 3HPLA 1RZGA 3ML8A 4AK2A 1U2CA 5TD4A 5D7KD 2AEQH 1TZOA 3KPSA 2WXFA 2P47B 5FS5A 3W0WD 3B2VH 2XXFA 5AFAA 2L8AA 4L23A 5D7IE 1DR9A 2XBTA 1E9OA 1G9MH 4L18A 2D73A 5GGRA 3VB9A 3ZO0A 3AY4A 4HWBA 2EINB 4G2AA 3MLYL 2ICEA 3TNNB 2E5EA 2DMHA 3LV3A 4UV7L 1H5BA 3ZE1B 2WCPA 1U30A 4H44C 3FFCA 3AXLA 3AWGA 1QRND 2NW2A 1G7HB 2O5YH 1TPXC 1VFBB 2D7NA 1I53A 4ODSH 2ICWB 1W0WB 4PP2A 2Y3NA 4F37F 1S2EA 5JDJA 3CPLB 4QHPA 4AENB 3FO1A 3FU0A 3QQ3B 5T1DL 2YD9A 4O9HH 5FKPB 3KLKA 4N6QA 5I0DA 3GTVA 4L8CA 2ADFH 2NQCA 1MWAH 3CN1A 2G3MA 2OJZL 4Y16B 1BMGA 5EO9B 1S7VB 4Y88A 1ESOA 3MXVH 4X0NA 1WO2A 4YHNA 5DVKA 4PIRF 1Q0YH 3OTTA 1XZ0B 3K6SB 2VL5A 3PIQB 3QUMB 1PKQB 4G8EA 2E7BA 1CC3A 3AB0B 4GIOA 4NZ8A 3C9NB 3CFBB 3C5SA 3LKQA 2F19H 1MCLA 1ZVNA 2UZIL 3U30B 2EIKB 3ML9A 2V2TA 3VFUB 1MRDH 3C60B 1MCJA 3FT2A 4OCWH 1BD2E 4NZFA 2VO8A 1REIA 1DBML 1CD8A 2H1PH 3UBXA 3GXFA 2OCFD 3VRLF 4U6VH 2XIDA 5FV1L 4LHUB 4DERA 1MFBL 1TT6A 4M1DL 1G7QA 2VE6B 4OW6A 3CVHH 4ODBD 2XIIA 3LH8A 4Z77B 3L4ZA 2MTPA 4PJ7E 4Y0GA 2I27N 5IUCA 3SY6A 2UY7A 3IXTB 2V9UA 4AQZA 4AQ1B 4EN3B 5CP3H 5C07D 4PJDA 1GR7A 2DKMA 5L9DH 1JWSB 1D5BA 2CRZA 1JV5B 1BBDL 1MI5A 3HUJE 3QQDB 3QUXD 4IGBC 4RISH 5FHBH 3WKNA 5F88B 4CKQA 4ZO6A 2H6UA 5F9JB 1X9RA 2EVGA 3JUZA 1EHLH 4XNQB 2G3XA 3Q2NA 3T2LA 4NKDA 5CINL 3GLDA 4TSCL 5IESL 4AGOA 5EIIA 1OAKL 1FNSL 5GRZA 1XIWA 4MJIE 4LLYA 4YHZH 3BVNB 2UWEE 4W6WB 4WU5A 4ZTOL 4HOMA 4JPIB 4GAGL 1XL6A 2P8PA 4U6YA 4ELME 1EXUA 1QWNA 4PJ8C 1C08B 4MA3A 5MEOA 1KELH 3Q8EA 4X42A 4L4VA 5AVWB 4MCZA 3HBQA 3UJJL 5CEZL 1GGBH 5EEUA 4NCC2 4PRNA 4OD2A 3MV7E 1NBVL 2BVQB 3DJTA 4UDUB 5FK9A 1U8PB 4LHUG 4J8QA 1FVEA 3DX8B 3WN6A 5C0FA 1BVOA 2F74A 5D96C 5D7IA 1F2XK 1T5XB 2X42A 2E6JA 3IJEA 3QR2A 3E80A 4IBYA 4W1TA 3HMWL 5J0BA 1N18A 2ZAGA 4LAQH 2MTAA 1QLEH 4RAUA 1T1YB 4TUOB 4X9YA 4TRPH 1BVKA 4HKZA 4KRNA 5FA4A 1N8ZB 3Q2CA 3QDHA 3MJ9A 5HDRA 3TO4C 3IN2A 4KX8A 4XCCH 2IAMD 2WKOF 4J3UA 4PPTA 4PB9H 3PNWA 3IE4A 4LCWD 4HV8A 5G55A 2RAMA 2B14A 3TZVD 5HGBB 3FFDA 5I75B 4OJEH 5HPMA 4X4XA 1UJ3C 2ENJA 3GSWB 2F15A 3DIDA 1EHNA 1V05A 3FS9A 4Q14A 2M1KA 3VWJD 4EDWL 5D7JA 4X7EC 4ZPTA 2C3VA 4R96B 1UZ6F 1WK0A 2ATKA 4XCYB 4WEBL 3BQUA 4BSWA 2W60A 1ZE3H 3G9AB 4GS7B 4RSYA 1KOAA 1KEMH 1WA2X 4XODA 2LT9A 4NNXB 4PRHB 2ENPA 5EUKA 4H0LC 3Q8BA 1YDPA 2XN2A 3C08H 4MJ6A 3RJOA 4FMKA 5DK3A 1FGNL 3E9UA 4F9PC 5K1JA 4LPVA 1AS6A 4N8CH 2OR8A 3BZDA 2FNBA 4XZUB 3BYYA 2DZEA 3FTWA 2WW8A 3JT2A 1LO3H 4X6DE 3QUML 5CEZE 3OPUA 1MQKH 3ZZ1A 3EFOA 2I85A 3G5VB 4DVBA 4EUPA 3DVNA 2MQ3A 2ICWJ 2CUMA 3HC0A 4OD1H 3MRDB 4J12A 5I30L 3MBXH 2V5SA 4WRLA 1N8OE 1E4WH 4DO4A 1ZLWK 3FCSA 1WIUA 4FQJH 4UNTA 4WNQA 1V27A 4PJ7A 4S0HA 1N6QL 4N22A 1IQDA 2EYRB 2WQXA 4KPHL 1P2CB 2HFEA 4ZOEA 4UTBL 5A7BA 5ESAA 4KTYA 1VZIA 3DHPA 1W8EA 3KGRA 3HUJA 4N86A 3KPOB 3UO1L 2X4NA 1C16A 3BIBX 3K46A 3P02A 1NAMB 1ZLSL 4PRPA 5HYSA 3ZE1E 3KPQA 1BD2D 4X7CC 5AW4B 3NESA 2CHZA 3BUPA 4YO0A 2EACA 2AZUA 2V2XB 4LSUL 4UT6A 4X0KB 3FB5A 3X14A 4FNRA 5TF1L 4NZRH 4TKWA 5EV7A 3QEUB 4ELMA 2YAOA 5EFIB 3GMNB 2LE9A 4R90L 4TQ8A 3KBFA 4JKLA 1BBJB 1WAEA 3QEQB 1JIBA 4NN7B 4OZFG 4DN4H 1XSKA 3BKML 3C09B 4PS8A 3MV7A 1KGCD 1W0YT 2IWGA 1KCKA 4FA7B 3UMTA 5IBLD 5FO7A 4NENB 3HCVB 2JCWA 2JELH 4H13C 2A6JA 5HSFA 1WS8A 3N50A 2ZUXA 4JQVC 1PKQE 3HUJF 5CEYB 4S1DD 4ZOBA 3NSXA 3AG4B 2F8VA 4YQXH 4MJID 3K2UL 3QHTC 3N55A 5JO5B 1UURA 4FXGB 4P5MB 2ARJB 3RAJH 1UQSA 4HPYL 1NC4D 2DI9A 3MZTA 2XVGA 4HWUA 1BAWA 3MLUL 3IFOB 2UWEF 5DJAB 2W0KA 4XO3A 2XX0A 1YEIL 5F6IC 1NCDL 5C0CB 2BP3A 3MLVH 3U2SA 4ELMF 3BWUC 3SB3A 4BINA 4Y5VB 1FH5H 5E2VH 1GMEA 1UADC 4QHMB 1RUML 2EADA 4JO4L 3ZOAA 4MS6A 3Q05A 4ZPVA 3Q01A 3ZT6A 4DP5X 4HOXA 1XR8B 5C7XL 3GSOA 3CDGA 3EDFA 3MRCA 3HR5B 5EBWB 5E08L 1DBKH 3LH2L 3I6GB 4FQLL 1JTTA 3CFKB 3NAAH 4HK0A 2Y23A 2NXYD 3ARDB 2B9BA 4F7EA 1BJ1J 2AJZA 4GRWE 3LQMA 1UXSA 3Q2WA 4RNRA 1JCKA 3BT2H 4K8RC 1ZLWH 2VDNB 2RTTA 4RQQA 4DVRL 3TN0B 3WEAA 4LCVA 3GHBL 3HG0A 3MRRA 1XGYH 4N24A 3BCFA 5F1IB 1FO0B 4I1NB 2GT9A 5FO9A 4X6DA 4ZAKD