5DHRA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 68
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhrA01
4L02A 2I2AA 4HAOA 3VZCA 1U0RA 2AN1A 3T5PA 1U0TA 3V7UA 5EJFA 3V7WA 5EJIA 2I2DA 5EJGA 5DHRA 1Z0SA 1YT5A 3V8RA 2I2BA 1Z0ZA 5DHSA 1SUWA 2I1WA 3V80A 3V8QA 3V8NA 4WERA 5DHTA 2Q5FA 4V24A 1Y3HA 2P1RA 2I2CA 3V7YA 3V8MA 4DY6A 3VZDA 1Y3IA 2BONA 5DHQA 2QVLA 5DHUA 3AFOA 3PFNA 2JGRA 3S40A 5DHPA 5EJHA 2QV7A 4WRRA 2I2FA 3V8PA 3VZBA 1Z0UA 2I29A
chains in the Genus database with same CATH superfamily
1W4ZA 2P30A 2XR1A 1T5HX 2ID9A 4MB6A 4B8YA 5L6MB 4TRJA 1NVAA 1VI2A 2BZSA 4L4RA 4LHVA 3UNMA 4D43A 3F4LA 3M1AA 1Y9JA 1NMZA 3T4PA 4DIKA 4CEHA 3H4MA 5BQOA 4C89A 3K7EA 4E1AA 5E1MA 2JLQA 1IY2A 3VNRA 5I4KA 4HXEB 3DV2A 4LAFA 3IXQA 5JZVA 1RYYA 1UZLA 4KO4S 5M2QA 1YOVA 3AK4A 3C5EA 4HHEA 3ZW9A 2EJWA 1SC4A 2CNWD 1GCIA 4LDZA 1ACMA 4FC7A 3QFHA 3VZSA 4FYYA 3HXPA 1MA3A 1VOTA 4MVJF 4JP2A 1COWA 4ZT7A 1VCHA 3MUFA 4MGHA 4XRGA 4OOEA 3A6JA 5IAAA 2ZT8A 1T1JA 3LX8A 4DLKA 5I7VA 4YALA 3BA6A 1FTYA 2OHOA 3UV6A 3VNBA 2FMUA 3WLHA 3O7MA 1YNOA 3FCYA 4IHJF 4S05A 5ISMA 1TE2A 4O3MA 4H35A 4C05A 3U3DA 3IKJA 2OB2A 4U7HA 3QUQA 3D54D 2WU1A 8AT1A 5JWRA 2P5TB 3GO4A 1J9GA 4YJKA 1CF4A 5K8VA 1FHRA 2R6ZA 2J9XB 3E81A 1BDJA 2I03A 2YWEA 4N01A 3USCS 3VZQA 4C9BA 4KKVA 1MABB 2X5OA 4H15A 1XRMA 4WADA 3FROA 3TR6A 4B3SB 2IU3A 2QL7A 1KA9H 2OD7A 3IILA 5A5VA 2RHGB 4U5QA 1K2NA 2ZWOA 4HKTA 2Z2KA 1AO0A 3UBTA 5IHXA 4F2DA 2IU0A 1ZW1A 3KQKA 3H19A 1E1MA 3GAZA 3OLVA 1CRZA 4HTFB 4QJ5A 1UH5A 1PE0A 2EFEB 1XZAA 3HCBA 5D5PA 4J1TA 3W5AA 1RP1A 3LXMA 1DCMA 3UATA 5JTTA 3C3BA 3N2GB 3K6SA 1IEVA 4I1SA 2B8WA 4E4RA 1NNSA 1B6SA 1TEVA 1D4ZA 1AZWA 1KVRA 4KPYA 4HDCA 3DW1X 3NM5A 1YTLA 1P18A 4NPCA 5DCWA 3F7OA 4E2WA 1T0PA 1G8KA 1PZMA 421PA 4EA6A 3KB2A 1YE8A 4TWAA 4Y2YA 2XT6A 2PEZA 4RK6A 4BX0A 1FMJA 3CF0A 4OV6B 4V38A 1AK1A 1MVLA 3K0FA 1THGA 2QAGA 2HF2A 2WF7A 4R0NA 3G59A 5EJ8A 3RQIA 5JAOA 4GT1A 3U60B 4G0UA 4QTYA 1FTGA 4PHFA 4HAOA 1C7RA 4MYSA 4OMCA 4HV4A 1V4VA 5WRFA 4MWZA 4M7PA 3PZBA 2EKZA 1UDAA 1E1DA 1Z2OX 2P2YA 4GHWA 3WWEA 3KB1A 2ZXEA 2C9YA 1KI1A 4ZDKA 1N9GB 2ADMA 2F17A 5J5CA 3E48A 4RVDA 2IIQA 2PL9A 5HFJA 2QG9A 2V9CA 3PNQA 3GLHB 4ME6A 2R47A 1JLLA 3UJ8A 4DLLA 1DIBA 3P8ZA 3U3ZA 4R9UC 2BM0A 3TLJA 4B8ZA 3D0RA 2VDKB 3NAMA 5JMTA 5FRDA 3VQTA 5GZ6A 2WJZB 1E3JA 4QOHA 3FVTA 3GFPA 3QUBA 2BF7A 3KZKA 2IY7A 4QODA 1AK9A 2Z1MA 4AZVA 1U2QA 3BB3A 2DULA 1UBRS 2YWDA 2QNRA 4JK3A 2IKSA 3EQ6A 1N8KA 4TTVA 3TW4A 1JSCA 3R23A 3RVLA 2ZRGA 5DNAA 4EUFA 4RIIA 3SP1A 5HJEA 2OHFA 1XTIA 4QX6A 2PXCA 3DEAA 3CXRA 3QE3A 2BL4A 2RHTA 4RXTA 2I7CA 2IP2A 2P9JA 2FW0A 2Q8NA 2GS9A 4J0IA 5IAJA 2WJGA 3G1WA 1S2GA 4Q34A 3WRXC 3ADDA 1EVLA 1I9CA 5B37A 3SQOA 4RLSA 4RA9A 1IPHA 3HSYA 4FKMA 2B1RA 5BV2P 1CY7A 2PFGA 3M1YA 3M3HA 2HF7A 3OO0A 3G0CA 1SVUA 5GJBA 1M76A 5FOVA 1ML4A 2ZIXA 5B64A 1NSFA 1ISIA 1ZJZA 2NZXA 2QTCA 3PFCA 1Q44A 2QUBA 1TVMA 4G56A 4X91A 1JQ5A 4Y1FA 3M9LA 1CUFA 4RDCA 4XZ3A 1G2PA 2WMDA 3CF4G 4KDFA 2PEYA 1NIPA 3N76A 1KPGA 4YB8A 1Q11A 1JVNA 1G8MA 2FN4A 3CZMA 1H3NA 3N2YA 4BFTA 3E70C 2J3IA 3A26A 4G9BA 4TSRA 4YHHB 2BH2A 3QNWA 1XCGB 1XK6A 4I1IA 2Z09A 4MKHA 4DCSA 3F2IA 1MLDA 4J7UA 1RPAA 3H05A 3MMXA 3L6UA 3NTOA 3W7VA 2EFJA 2I34A 2R8OA 3SLRA 3FAKA 4RCYA 1VDZA 1TJ4A 1PGQA 4KACA 3E27A 1GILA 4FJ0A 1KDOA 4JMPA 1A50B 5IU6A 1OB5A 4UFPA 2FGKA 5CH8A 4CR7A 4G4JA 4MLDA 4IRMA 4XLTA 2X13A 1Z4JA 4UFOA 2FHPA 3GVIA 4D80A 2Y1LA 3B3FA 4NFLA 3F8SA 3UAXA 1BEZA 1G6HA 4Z99A 2WYUA 5DEIA 3RVKA 5DWQA 2CHGA 5JCPA 1DUSA 4NOJA 5CNJA 3AY0A 4GKBA 4QBHA 4G86A 5DLYA 2DJ5A 3P45A 1FUYB 1E7SA 2LIPA 2GZDA 2SCUB 3OTOB 1TECE 4ZVVA 4QUDA 3CLVA 2RK3A 3BXPA 4J4HA 3CA8A 4P9NA 1EDBA 4UPDA 1DNPA 1GPBA 1JIKA 2ZR9A 2GRAA 4X3OA 4EKGA 1L7PA 2ZIWB 4Q48A 2NO1A 5DGIA 4IJKA 4CYMA 5AVUA 5LR6A 1S3SA 2HA7A 2TRSB 1E0KA 1U7FB 2ZRFA 1RIIA 1E1RA 3GL9A 4FDLA 4TOIA 1G59A 2R62A 4QPZA 3GJ8A 4HATA 2FSIA 1EGMB 1JR3D 1QFSA 3KT3A 4BMDA 5AIAA 3VR6A 1GN8A 2G1UA 2HDNB 3CZQA 1LLCA 5IJXA 1F4PA 3IBTA 2ZS8A 4LJYA 5H4HA 3W1VA 2FXVA 3K6RA 2OHXA 4M7OA 3NHRA 1YFLA 3OZCA 4RD6A 3H1TA 3PD7A 2AGVA 4MINA 4MS4B 4RZ3A 4MRMB 4AQ7A 4EVSA 2B2XA 3CF2A 2PG3A 3I64A 4L50A 4PFKA 4PZEA 4R8RA 4ZQEA 3KP1A 5BYBA 3ROEA 3L5KA 3RS8A 1KO5A 3KZ1E 3TD6A 1CR4A 3FUTA 3JVUA 4F06A 1IM2A 2WJ4A 4M8IA 4HSEA 4NQZA 5CA0A 4BLPA 2MMGA 3FM8A 3TBKA 4H18A 3IB3A 1UKEA 3F7MA 1SG6A 4GPBA 4L28A 1VJRA 1SMKA 3D3QA 3OF5A 1C4KA 4RD4A 3GMJA 4G0QA 3ZV5A 2PLAA 2V7UA 3EA4A 5K0BA 1QH8A 3SZRA 1NFQA 4MW9A 2NZYA 4UMDA 2QRJA 2HEGA 1QHGA 1DINA 5CLGA 5D3MA 2ZRNA 1E2GA 1GNTA 3F9CA 5EKDA 3V8NA 4ZVKA 4C0JA 5BWNA 1QRUA 3ETGA 1JU4A 1P91A 2BFEB 1U1CA 5K3BA 1M3SA 2QG6A 4LDPA 1GKYA 3PDJA 5LP6F 1AY0A 3LC0A 3KAKA 2Q5CA 1SXQA 1NX6A 1VIDA 5TARA 2QP9X 4Z7NB 3N3AC 5EHIA 1RRFA 2X0JA 2XDYA 2MSEB 2VWGA 1Q74A 2EKBA 3QVWA 3C1UA 3EQ7A 2X76A 4CM8B 1HYBA 2JJ2D 1M2FA 2VQSA 3HP1A 3ZWXA 1PW5A 5AJVB 4D8VA 5JAIA 1EJBA 5KNDD 2AF4C 4EGCB 1K86A 2YBEA 4WZAA 2HL6A 1RHMA 1TKBA 4XB1A 1M1UA 1U7HA 4UU1A 621PA 1TM5E 3VYUB 2OV2A 1YQUA 2WZBA 2X2OA 3L6DA 3N59A 5EIXA 5J5AA 1AS2A 1M8FA 1PL6A 2VAPA 3SOPA 3UCFA 5KHOC 3V7YA 4G5YA 1X14A 2CNBA 2ZJ6A 3G0GA 4LE1A 3RWMB 3MS2A 5HMLA 2QVLA 1OVGA 2BR5A 5LOVB 2OZLB 2Z5FA 1D6MA 1GAQA 4PYOA 3D7NA 3DDHA 1W9MA 1VIYA 3FG9A 1WMFA 3FH0A 1XQYA 3BTUA 4FMPA 2Q49A 4M0KA 5TXGA 2H2DA 3SK0A 3W78A 4Z3KA 2J31A 3DLPX 1UZMA 2Q46A 2YDXA 1J2JA 4NG5A 4BFYA 1QV7A 1N77A 3OCCA 4P3PA 1V5GA 1BKDR 4F2HA 4X7RA 5AW6A 1YF3A 3U40A 2ZTMA 5EMJA 1TQ4A 2A1TR 3AVVA 4R8LA 2OGSA 5DHFA 1X70A 5FNZA 1ULHA 3L0YA 1VA4A 1YRQA 2PZEA 3AUFA 4I3GA 2PSEA 2BYTA 2YVKA 2ZE6A 1OQAA 2A3RA 4H0FA 3VDMA 3BKWA 2A5YB 4UXIA 3KCQA 5FCDA 4MR7B 1K5DA 3VX3A 4EI8A 2QUIA 4JVMA 4G0ZA 4BTVA 4EL0A 5JMOA 3CJQA 3DLHA 3AEKB 4XM2A 4DA8A 2GMWA 1Q0RA 1OKKA 2YWXA 2HRRA 4EFDA 1XRNA 3NUZA 3T3NA 1W44A 3GOQA 3K53A 1ZMXA 3GCZA 4O4IF 4O8CA 1XFDA 2GZAA 1HYQA 3KAPA 1TA0A 2D7CA 2I62A 4IXWA 1PSDA 2GF2A 5D5HA 3L1VA 5DYYA 4A27A 4DF3A 4BQFA 3BRWD 1SBNE 5AW1A 2WSBA 4YBZA 4AMGA 1Q14A 4JP5A 4ABTA 3LCMA 3ODGA 1S89A 2HDOA 5FLEX 3JQBC 3U5ZB 2IU4A 2WKQA 3T95A 3HDJA 1RLJA 4JL8A 1DPFA 3ETHA 3V00A 1RMTA 1XN4A 3JVVA 2Y1WA 3MIZA 2FR8C 4Q3AA 1G20A 2CDCA 3DE6X 4QU8A 4WLOA 3SC6A 3UXMA 4YMSA 4B6RA 2BKLA 1PG2A 2CSUA 1U02A 1U2DA 2GHTA 5JAZA 1MXFA 5BORA 3I72A 4IH1A 3KEQA 3R5KA 1RRMA 3DE2X 1C14A 3KVOA 3S29A 1QF6A 3HJUA 1T3ZA 1DFIA 1VCMA 4MB0A 3M6WA 1PN3A 1XR3A 3U26A 1M8KA 1Q0TA 4BPRA 3CH5A 4UPVA 3MYYA 2OZVA 1H0RA 1SQGA 4YUZA 1C7ZA 3GMDA 2ZYGA 4BFSA 3ZYCA 1KO1A 4B32A 4LJ7A 1XPJA 4X92A 1NSTA 3FPGA 1C1XA 3RBAA 1M0SA 3F3YA 4O4JF 2BI8A 4KSBA 4MA5A 1Q16A 1QPGA 2ILTA 1FXUA 5IDXA 4MVJP 2EW1A 3E6AA 2Z4SA 4I6GA 3CT4A 4TS3A 2HLNA 4OQNA 3W2FA 4B6QA 4PO9A 1NU6A 1EAMA 2EX1A 1QIKA 4E5PA 4Y2HA 4INAA 1RXEA 2VYNA 4O2AA 3MOIA 2WRZA 3GPBA 4D4GA 3U80A 1XMIA 3M70A 1YAJA 3LWBA 3EDCA 3TCXB 4CTOA 2GBGA 1N5KA 1OR8A 3RB8A 2WC1A 5F2NA 1K7XB 2C31A 1ZM3A 5AVOA 3SZGA 1LBSA 2ZLBA 3D64A 4YRTA 3LO5A 3RM3A 3PUXA 2QTZA 1QUFA 5IXYA 3PUVA 2BZ1A 4LRYA 3SC2A 2ZSBA 5JY6A 1Q0PA 1XZFA 5MF6A 5CIQA 3F78A 4NWIA 1YRBA 5HM6A 2PX2A 3DTVD 4K46A 2ORWA 2J4CA 1K7FB 4M8SA 3IHLA 2JIDA 2Q6KA 4R98A 2QTNA 2GHIA 5EWLB 4G5QA 2C9CA 1X1SA 5CW1A 3H0KA 4MWBA 1V37A 4U8GA 4QNMA 4YT2A 3MM4A 1ZINA 1U9IA 5JCOA 1N1GA 3LVFO 5LXTA 2YVLA 2QRNA 2OO5C 3NDBB 1IMOA 1Q91A 4JLUA 1QC5B 2AX4A 3JQFA 4ISCA 3SFVA 1YBFA 5TX7A 2N9UA 4ZZ1A 2OENG 1N0UA 4IMJB 3MTAA 3LT4A 1M0TA 3QOWA 4R1UA 5I47A 5BOVA 1KE1A 1U3CA 5K0SA 3R0JA 2X9NA 4TZKA 3UAZA 3RADC 1ZNQO 5AHOA 2H1LA 1P7YA 3C3JA 3KTFA 3ILSA 2OHVA 2OEPA 1Z75A 2FSHA 1IHPA 4R7ZA 1MG0A 2AK3A 3QBVA 5H16A 2NVUB 4B3RB 1E9FA 4R83A 3ZU2A 1L6IA 3C45A 2NUTA 1OYVA 4UZEA 4WESB 2JHCA 3RC1A 3IEKA 1PNOA 2DUWA 1PGOA 4IUCS 1WXWA 3DO5A 3W2HA 4CW7A 3KXDA 2BEWA 2FF7A 3MTIA 1NX9A 1SIBE 3TZEA 3CNNA 2ACVA 2XCOA 2I4OA 4DDKA 4AM8A 5LLDA 4QEDA 5GJWC 5I4BA 2H92A 4BIMA 4RY2A 4YRAA 2Z3WA 3BD9A 1A8HA 2YWBA 1QZXA 3B6MA 4FGWA 2CCGA 2Y1CA 4GI1A 4RXMA 2RAFA 4PRYA 3RFUA 1B3RA 5F4BA 5IAKA 3NBKA 4MYRA 4V0RA 2PL3A 3ETLA 1IN8A 5I7OA 2R4TA 4L2IA 1U31A 4FFNA 1HBJA 1SZPA 3K92A 5FL3A 1WM1A 3H5WA 3Q98A 2GM5A 1DGQA 4GZ6A 1KY3A 3ADKA 1AH2A 4GOJA 1AUQA 3EPRA 4EA8A 2CNLA 5F35A 1WDTA 3PEYA 1Q0QA 4FYVA 3I9JA 5E7JA 3L6RA 2NO4A 3VR4H 4IV5A 3A25A 3MNFA 1IIRA 3UGKA 4UOEA 2YINC 4I4TF 2Z95A 1CF9A 3DTTA 2JFNA 3L7DA 1KIFA 2X77A 3O83A 2YN0A 1JXOA 4HGOA 1DBRA 1XTSA 4NYJQ 1U6KA 1P1JA 2DVMA 1ULSA 3CF4A 3IUJA 2KWIA 2FZEA 1BN7A 1O89A 3NM6B 1YK0A 1JJ7A 2QOEA 1QHIA 1WKCA 1MNAA 3D8SA 4AP5A 1NQXA 2RGEA 3NOVA 3PI6A 1L7MA 4IDGA 4DDHA 3O8RA 4ZFNA 2GK6A 3SM3A 3W9YA 1R37A 4EY5A 1J56A 4WK2B 2G04A 2NU9B 2WWGA 4G09A 1P1FA 5I7SA 5JJCA 4YJHB 1EDOA 2COEA 3QGMA 4BX3A 1H69A 3Q40A 2YH2A 4PCUA 1MENA 4UBNA 4YLEA 1JEYB 3AVYA 4EFKA 2DUNA 3FBWA 3JQDA 3G2NA 2EWWA 4OQLA 2M6KA 2VF7A 2FF4A 1RQLA 2WWIA 4R1MA 1M34B 4ZRDA 2ABWA 4WCVA 3VR3D 4DPKA 4FIDA 4ZJUA 2O3UA 1DAMA 4JX8A 3H75A 4LBYA 3IPLA 1VMDA 3UNXA 2Y4OA 3MTQA 2F9LA 1QCDA 4G41A 4Y9SA 1SN7A 3ZWAA 1P0MA 2O54A 2C5AA 3H9JA 2Z6VA 4K8RB 2WAYA 4FGKA 4XWKA 3JQ7A 1YHZA 1N5MA 2JLAA 3VZRA 4LMPA 5ADHA 2EAUA 1O5TA 3FMVA 1G4HA 5D3QA 3ESYA 1KDYA 2X4LA 3QVOA 5CEFA 1J4QA 1XA4A 4C14A 3OSUA 4D3YA 1KMNA 1Z45A 2IZOA 5LBTA 1GZ5A 2WWXA 4EPXA 2OOKA 1IN7A 5BWLA 1OFTA 3TLGA 3GRRA 3JATB 1Y8AA 3QF7A 2VKTA 2ZU6A 4BEBA 4MVXA 5CLHA 4DV5B 3DSHA 1TZBA 1X92A 4IG4A 4KQXA 5BMVB 1UBOS 2QXUA 4FQ7A 5J4VA 1P31A 2EDAA 2CL6X 2H06A 2H2GA 3UT5B 4UTXA 1UWVA 3RC9A 4BMPB 2CLLB 2RK4A 4J7XA 3PC3A 2WJWA 3GLKA 1BMFD 1NN0A 1KZYC 2EZ8A 2L19A 2PCJA 3HB1A 2XKJE 4Y2PA 3WKEA 3E61A 5F2EA 3G2MA 4L3OA 4CQLB 3AH8A 2X3FA 3LUCA 2P0EA 4KXQA 2TMKA 2B5WA 3EULA 2XECA 4KHZA 2R7KA 4TMFA 3SSNA 2WSIA 1WXHA 2CVQA 4EOGA 4HNHA 4J94A 5KNBD 4PPNA 5EE0A 1DBQA 3ZLJA 4ZOLA 3U5TA 2J33A 4Q03A 1JAYA 5JS2A 1ZAKA 3LVQE 2JGKA 1NVBA 1QH1A 1V7CA 3BCUA 2GVNA 4AICA 4GM4A 4ONEA 1UAYA 1Z5WA 3LA8A 4K9MA 4OVKA 5FI3A 4AY4A 5CA1A 2F90A 4RY9A 4V0LA 4GMKA 3IUMA 2IRWA 2VDRB 4KQEA 1UR5A 4QO7A 4J49A 3RSLA 3CINA 5DM70 2F3RA 3DF9A 5ALNA 3I05A 3HPQA 4B3MB 3PQ7A 3I0ZA 3G8AA 2VHEA 2O0HA 4RPLA 5EMHA 3JQRA 3QM1A 1P7CA 2BGJA 3EAQA 1HDGO 5A9SB 2KB0A 2QN7A 4M4SA 3QTLA 5FOTA 2OR3A 4BUCA 1D3AA 3ZOKA 1K8ZB 1Q1QA 1B2RA 1OGJA 3H9QA 4X20B 4YAWA 5AW0A 4D6PA 2BHLA 1RTTA 2IH4A 1KHHA 3QLJA 2B83A 3HYRA 1QTNA 2QU8A 3GRFA 2WAMA 5KVAA 3MGBA 4LWQA 3EW9A 1WB5A 3O5AA 3WIBA 3N2ZB 3WHPA 1HTWA 3PIRA 3DOFA 4UUAA 1E6WA 1FYVA 2W0MA 4OL9A 4WBXC 3ZNQA 1OLXB 5KS2A 3A6GA 3I9OA 4YMLA 1DLIA 1J07A 2VBIA 1V8PA 4X7MA 5KJEA 4D2IA 1GTVA 1UP6A 2XTMA 3A7DA 3JVIA 2QMUA 2G0NA 3TLAA 3QLUC 2H9AA 1J39A 2NM0A 3MPUA 5B1HA 3T0IA 3DPIA 1JZSA 3MT9A 4B82A 1KGDA 3B7WA 4FMDF 4JLVA 4LZNA 3HZZA 4OLHA 4GSYA 2JARA 3PR1A 5CHYA 1DTSA 1UJMA 2E4VA 3KXIA 2AFHB 3PITA 3ZJ5A 4ROSA 1QIHA 1V7PC 3ACCA 3CPEA 4LI3X 4Q1EA 2G1KA 2BUBA 2ESRA 4AZ3A 1TIKA 2DWQA 3LBIA 1W4BA 5ADVA 4LZWA 1GTG1 5JNUA 3I1YA 4MHTA 1HR0B 8MHTA 3IJRA 1ARZA 2XAAA 2VJKA 2JASA 3ZHXA 1P72A 1T9KA 3HBJA 3K9FC 1EP9A 2O2SA 5FOXA 3PIIA 3ULKA 4ANFA 4HN2A 2C03A 4EO7A 1BEEA 5JADA 2AOTA 3FE2A 5LUAA 3VGJA 1RWPA 5A3JA 3KYDB 2H17A 1I2ZA 1L4UA 1T3GA 2IP4A 2V9ZA 4LMRA 1V3QE 3AL2A 3JXEA 2FZVA 2R00A 3W7AA 3WYDA 1DIAA 5K1ZA 4J0EA 3OHMA 4FGZA 2WQ6A 4N6GA 5KKNB 5FR1A 1U80A 3VH1A 1AM4D 4FFPA 1E79D 1YGPA 2D5AA 2Y05A 4EH1A 1QZZA 4Q82A 4XYGA 1TFUA 2BKUA 2OYSA 2G0AA 2J9ZB 2K2QB 4FDUA 4JEUA 1C3VA 3M6UA 4Q7MB 1N6RA 4TRMA 1ZGBA 4LKRA 4Z8YA 2XCSB 3CB2A 3TR0A 1H3EA 4FCTA 1WZCA 1U90A 3D7KA 3GT7A 3BERA 1T4CA 4V0NA 3X2EA 2B5VA 1QS0A 2DLDA 2EV9A 2WFLB 3A1NA 5E3IA 5HIMA 4BCDA 4CV3A 2Y0EA 3WFJA 2WF9A 4F2WA 1X7YA 1E5LA 3N70A 1U0GA 3PLRA 1G8FA 2Y93A 4I9NA 3OI7A 4UBKA 1Z8FA 4G1CA 5CYPA 1X86B 3R9XA 4JJ6A 5IBRA 1PEAA 3UFXB 4Q9IA 1HE5A 2OL4A 3D6TB 4NENB 1KFBB 2AMVA 2NO5A 1IUNA 3I9V1 4G1VA 3TSOA 1P2DA 1DAFA 1WKBA 1VGVA 2XSZA 3H3XA 3OWOA 4LBVA 3PR2B 3TW8B 5BSWA 1R6UA 1X80A 2H4HA 1PJTA 1MDBA 2P65A 4JYPA 4BO8A 2WT8A 2Z5LA 3IVXA 3HEAA 4G6ZA 4XJTA 2B5OA 2Q6TA 4KQWA 2IBMA 3ICWA 4ASUD 4BFUA 1WXQA 1U8UA 2MYPA 3CFYA 3KIPA 1M73E 2X4IA 3O3NB 5SY4A 1O7JA 3KTAB 4UHEA 3TLYA 3B1XA 4RL4A 4M6WB 4AKTA 3WGVA 4GOOD 4ZHQB 1Y89A 1G63A 2ZB4A 2OGZA 821PA 3B8HA 3OHSX 2X4DA 3MAAC 1STOA 2PS0A 2CXUA 4K87A 3HDGA 3JR3A 1FFXB 4FD3A 4LX0A 4OQ4A 4XPIB 3ZWOA 5JTUA 3FPJA 2RC6A 1EWTA 1XF9A 3RJZA 4DQ0A 3R5JA 2W70A 2P4EA 3ZTYA 3BOSA 1M8PA 3CG0A 5KDLA 1QAQA 2YOHA 4I8XA 1V8FA 3PQ3A 4KEAA 4F8YA 1I2MA 1RXSA 1GXCA 1BGVA 1SXJC 4DCTA 1TCCA 4C03A 2Y67A 3GDWA 4L9AA 3E9EA 3CBQA 3UICA 4GW3A 3H42B 1WLNA 1T13A 1WF6A 5ICGA 4CQJA 5H4GA 4DBVO 1T26A 1HFJA 5AH0A 4F3CA 1Y1PA 4TMZA 2ZRAA 3C70A 3WL7A 1XTRA 3GEGA 3K1JA 2CC2A 4CM4A 5COAA 3GFBA 4LJAA 4IFBA 5AM1A 3KLNA 5E3JA 1ZIOA 5TVKA 4JI1B 1YJ5A 1C4OA 2WIGA 2V8OA 1CJCA 3VU8A 4KWIA 3H2JA 3DR3A 5EKXA 4BVGA 2GLUA 2ZAGA 4R8VA 5BV7A 2H18A 1KYWA 3KYBA 2JKYA 2FPSA 1KEVA 1OVMA 3BIJA 4GMXA 2FMHA 2XNSA 1HT0A 2WG2A 4D3SA 1EP2B 2NXCA 4QSMA 3N0RA 1H0SA 2HNAA 3F5SA 3HFGA 2UU9B 4BBZA 1NQOA 4FLEA 2DQKA 3IELA 2M1ZA 3VHLB 4HDQB 2HU5A 2QRZA 4JJZA 1IG3A 4NDZA 4O2BA 4QWMA 2B1QA 3D3WA 1V4NA 4PPFA 1CEQA 3OFJA 1BC5A 4CEJB 3U37A 4MXDA 2RIPA 4IXTA 4DRYA 4FLFA 4JAVC 1DC3A 3IHKA 2JATA 4MV5A 1F6WA 1JHZA 3I6ZA 5ES4B 1E7MA 4Y30A 2HF8A 4RJJA 1GIAA 3AESB 3R8XA 2H16A 3BXGA 4IVNA 1UMDA 5THXA 1EIWA 1M6EX 1Q22A 1O4WA 1RPJA 1E3WB 1V1JA 2FX3A 2IQIA 3JQ8B 1K9VF 1EIZA 3NDRA 4HJRA 1UODA 4LXXA 4UM7A 2XRMA 4Z9AA 1QHSA 4YV7A 1G20E 3TF5A 1KC3A 1HZZC 2A4MA 3T7JA 2ZYAA 1UOEA 1DEVA 1T3LA 1UPCA 2CLDX 3ZBPA 4D0NA 3KBBA 1L5ZA 1TVEA 3E9DA 3GEBA 4RQUA 1V11A 1MO5A 1MAWA 4PICA 1VCNA 4JJKA 1UWLA 3NGMA 1C7EA 3P97A 3U3RA 1KDZA 1JKJB 3UAWA 4EECA 4XE5A 4K6CA 3ORQA 1NF2A 1TTPB 1UKYA 3D1JA 1OBVA 3OECA 4FFRA 4FPXA 2AEEA 3ISVA 2ECPA 4RZUA 5ULLA 3TSYA 2IYWA 5LJIA 3PNLA 3UKOA 4FMBB 3OEEA 2IXFA 1PQ4A 4M22A 1RXYA 3HJGA 3GJ3A 5FHQA 4PG8A 3Q1KA 2J46A 2XUPA 4MPDA 1U9CA 4BVJA 2V6MA 1JPUA 4FBMA 3Q88A 1RI3A 2AFRA 4IUDS 4CDMA 3N05A 3LZCA 2J9RA 2RGNC 2Z1NA 3RIEA 1VE5A 4N7RA 4ZVSA 1M1XB 4D82A 3K72B 1BXZA 1T9ZA 4BTEA 1AGPA 3Q7IA 1LX6A 3RLIA 4B9EA 4WA7A 5JEOA 5AVQA 1JZTA 2ATXA 2EFYA 2WSSA 3HKEA 3PWZA 1N8SA 3PQ8A 4IVPA 4QYSA 2XNHA 3V4VB 4CV1A 5CDYA 1JL3A 3QLTA 4BLOA 2N1MA 1RC0A 1WJGA 4Q6WA 4EHFA 3V8VA 5FTMA 3WRYA 3ZGVA 5B58C 3VR4D 4HRYA 3I1IA 2P4HX 3NWEA 4QXMA 2A86A 4EJ2A 1J24A 3W5BA 4JUBA 5AK3A 2HHLA 1V1MA 1OBHA 2ASVA 1Z15A 2MINB 3HU1A 1IPFA 3GLIE 2OV4A 1TT7A 4IGFA 2B0JA 3O8QA 3OZUA 3UJCA 1NWCA 1U81A 1GPJA 4U2BA 3ZVLA 4O59O 2PTHA 4DYVA 3IAUA 2XYVA 1G4UR 9MHTA 4O4HF 4R7GA 1NBEA 2ZUCA 2ZREA 5KTTA 1RE0A 3WJ1A 1BAPA 1T0JB 5J4LA 3WLAA 5DTJA 2UV8A 5CG2A 1F8FA 1T8WA 5EINA 3PLAE 3I6YA 2YDYA 5TB5A 2CFRA 1E5QA 3DAGA 5I3CA 4YRQA 5CYGA 1N2CA 2J30A 2W4QA 1NPDA 4Y2QA 1UFRA 4U9UA 1SVKA 3E4DA 4IHJB 3ZGYA 4B4UA 1AHIA 3PXDA 2VT3A 1PJQA 2DXIA 2VF4X 3SG0A 4JP8A 1NKSA 5DASA 2IH2A 2XQGA 3I8OA 2XZLA 3PYLA 5K8TA 4TKLA 2P6RA 3BMQB 4K9SA 3OZRA 1ZR2A 1BWSA 1NVDA 3MUEA 1NE7A 5I8WA 1LPAB 4AWBA 4LYYA 5CLQA 3ER9A 2REQB 3DYBA 4CTJA 4NMXB 3I30X 1ZH2A 2P2GA 4L85A 5TIIA 1BA3A 4Q9LA 2IF0A 1R9MA 3HVIA 5ALQA 4N0PA 1PV1A 2F1HA 4BNHA 1PEYA 1EHIA 3LP6A 1M5RA 3O0DA 1XZNA 5AK4A 1W49A 2JFHA 5LCXA 1BNCA 2AEMA 1U0SY 5EJGA 4D1YA 3MOGA 3ZC3A 2W2KA 4HFJA 2AFVA 4HSGA 4RH3A 5FF9A 2CLHB 3V7FA 4DWOA 5FX2A 3AIOA 4AZ0B 2GYVA 2PX6A 1YI1A 3B1KA 3KJHA 2QLJA 1VP9A 1M6HA 4BO6A 1F2DA 2PS3A 2VTEA 3JQ6A 4OM8A 5IVPA 1MQ9A 2CFOA 4IKPA 1VC2A 3U0BA 2YY5A 3PEEA 3OFSA 3A8TA 4WOPA 1CW2B 3ZU4A 5AJYA 4ZYUA 3PJRA 4P1ZA 5LZ5A 3QE9Y 3VR1A 4D9IA 1P1RA 2A1TS 2RGUA 5AKLA 5B30A 4ZYWA 1LV7A 2JW5A 1F2TA 3HB7A 2R96A 3GGPA 2NV6A 1P9LA 1NAHA 3NHFA 4RZ2A 5FBQB 3L7BA 1H8HD 1V8BA 4EHBA 2XNDD 5J2TA 3VHXB 1CEXA 4D3FA 4IIUA 4GZ3A 4WLFA 4B7UA 2ECQA 2B4YA 3G49A 5DLPA 2BFBA 3UW3A 2WJJA 4KYVA 1SBIA 5FLYA 2F43B 2XAUA 3C7AA 1LI4A 2H4JA 1E2HA 3WV4A 4LYAA 3BWVA 4LIPD 2DQSA 4EKNB 5K20A 1W7AA 1XVUA 1QB8A 2Q5OA 2Y2UA 4M53A 4B3JA 4L8VA 4MJ3A 2FPLA 4JA2A 1NDUA 3L9WA 5A4AA 1K6MA 4W9RA 4LSWA 3RS0A 2Z0MA 1OWPA 3RU2A 1LGQA 3AKEA 4BB5A 5A02A 3NQ41 3TQTA 1Z5VA 5KHAA 3RF6A 3IBGA 1QANA 1SRQA 2AHRA 1EK5A 1H23A 3X2FA 5TE9A 3G89A 2CLOB 2AJTA 1JLSA 3U7JA 1G16A 1O0SA 1S2NA 3HL0A 4HNAA 5K4GA 2WT9A 5TQVA 4QUKA 2XXAB 1MW9X 3GXOA 4L95C 5EYPA 4BNGA 1TVKA 2F2TA 1LSJA 2FZGA 4WT7A 3IPXA 4F9FA 2IA5A 1V2GA 5AI5A 4DSAA 5GINE 1W36D 1FZQA 1NXSA 1UK9A 3SHFA 2AW5A 1M66A 2JAPA 3CZ4A 5KSZA 1JJFA 1GTMA 1P9RA 3M8KA 4FT4A 2NUAA 3VYWA 4EJ0A 5IJWA 1NI3A 3UJBA 4AKHA 2X0KA 4Z1OA 4YCCA 5T3YA 3QEOA 4GM0A 4P3XA 3T34A 4EUHA 3EIFA 1HOXA 3UMSA 4RADA 1NQWA 1I2AA 1FDUA 1G5TA 3GT3A 2JFGA 3RAEC 5EKSA 5E3HA 1V96A 3EZYA 5MN6A 1XTKA 2D2EA 2HGSA 2JQJA 3AKYA 3NALA 1K4YA 1U7PA 3DQQA 3FSGD 3U7QB 3HI6A 1J8QA 4GXNA 1APBA 1YS7A 3OM8A 3DE7X 3ZY4A 1Q77A 2HPZA 1WBJB 3FLAA 4Q37A 5AVKA 1WXGA 1NY6A 2JEZA 5K0JA 1JLRA 4NKRA 3QVUA 1YA4A 2BEVA 2NSDA 3NOQA 2JHGA 2RGCA 4E14A 3TKYA 4YUVA 5A5FA 1EBUA 1Q7RA 2HHAA 1E66A 3OD1A 3BD7A 4R2HA 1RU3A 1FHQA 1ZRHA 2NQTA 4X3CA 4DCVA 1SC3A 5HKKD 4JA0A 1VE6A 4PYMA 1MAUA 3R0QA 1US8A 1L5KA 3DL2A 3CKYA 3G79A 4YCDA 1ONBA 1DJMA 4AMUA 1J2TA 2P7IA 4Z53A 1P5RA 2VYFA 3BRSA 3W05A 2BI4A 5AKIA 1DD1A 3IT1A 4UZFA 4DKXA 2CJXA 4BBAA 3PVZA 4D9NA 4ER0A 3NEJA 1R0YA 3TJMA 3ROQA 3WYCA 2IZ6A 4NPHA 3DGFC 3OIFA 2QM8A 2MCFA 1GSAA 1ZWKA 2X5KO 3NWBA 4MUAA 2CV2A 4Q01A 1Z28A 2VP3A 4N5HX 1IFXA 2ZYTX 3F71A 5EQJB 2PGOA 2DT8A 3D8RA 5E9AA 2IODA 4J29A 3ZWPA 2B92A 1FFBA 2FK7A 3IH5A 1E5DA 3HCOA 3LCRA 1NVXQ 2BOVA 3FNGA 4KI7A 4Z4CA 3KB8A 3L4SO 3DR5A 5TNXA 2AUTA 1LDGA 1RKXA 2BBOA 5L53A 2MSLA 1FQWA 4FSDA 4PYRA 4FCVA 4I5FA 3JD2A 1S1MA 2RI0A 3QU2A 3GT0A 1QSGA 3UMYA 5BOSB 1ELOA 2OV8A 3AVQA 4QECA 2XCQA 2BMWA 1XDZA 5FV4A 3B48A 4AC9A 4MVCA 4FE3A 1NU8A 3O4HA 1CZOA 3JTMA 3ZHYA 2F6RA 4I9FA 4UOQA 2PS1A 4CQMB 2GD2A 1BROA 3KAQA 3G8YA 1LVHA 5CTJA 3E7XA 1LJ8A 5A1TA 1N1MA 2O4CA 3KNZA 3HHEA 4XDYA 1LVUA 5EUBA 4OU4A 2FQXA 2OXTA 1YQDA 4MDHA 3W8EA 1E8NA 5DI3A 4BP3A 2HZ7A 4CL8A 5E2AA 4NFYA 2QZ9A 4I1RA 1QTIA 3BXZA 1TJ5A 1U5CA 2IUTA 1Y37A 2J5RA 1Q3HA 2PGAA 3KSZO 3Q6NA 4GXTA 2R86A 4QOJA 1CETA 5CM2Z 3RYTC 4CV0A 2QD4A 2XE4A 3I5YA 1FLAA 4U00A 1GPH1 1KJ8A 5J2UF 3M6XA 1CERA 1Z4MA 3MT0A 5EUMA 5JAMA 3BICA 4C7VA 3VX4A 4C4SA 2XWBF 5K3CA 5ITVA 2D7JA 1J1UA 2MIIA 2VTDA 3MIIA 1JDPA 3O03A 1CR6A 2B6NA 4K03A 1JQAA 4NQRA 1FSPA 3JX9A 4TS4A 2CMDA 1A8UA 2C8JA 1DBSA 3I2KA 3BXXA 3EXEA 1IQUA 3BILA 4OGLA 4C78A 5JFGA 1E2BA 5FKJA 1ZICA 2W2PA 3GDGA 3NWJA 4JC4A 1LQTA 3HV2A 3CS3A 4B7ZA 1X9HA 2QMOA 4BNKA 5LP6B 3TK1A 3LUGA 5ELLA 3E23A 1Z6GA 4KGZA 3U19A 1N75A 4EHLA 4PN3A 4HLDA 2QW1A 2FTKE 3GX1A 5ALJA 2UYCA 5FUXA 4P32A 2ILVA 4Q3CA 4JENA 5CAEB 2I6XA 2GESA 2NV0A 3U1VA 1YGSA 3P32A 1CUJA 1OZ0A 1OXUA 2XWJI 4H1WA 4D9JA 3MB8A 3X44A 3WVNA 1MVNA 4BB9A 2OAGA 3D0KA 1K1EA 4ZIRA 3LWDA 4G5FA 1F2VA 2EW2A 4CXMA 1GAJA 1O94C 3MVEA 4BQOA 3AONB 3T41A 1KQFA 2C7QA 3CSUA 3AIMA 5TS3A 4IIFA 4KIGA 2OM6A 4XM0A 1GQ2A 4QPPA 4OQYA 2G9VA 1VE7A 3BSFA 3FIJA 4DSOA 2QTRA 3DONA 1U5BA 3KAJA 2L18A 1HG1A 2QM0A 2V97A 1KH1A 5TDHA 4P3NA 1L7BA 1R50A 3H5LA 3ONVA 5DISB 2JNWA 3L02A 5FBZA 1X1DA 3MFYA 2BT4A 5CCXA 4KE8A 5F3WB 3EPKA 5CVCA 3M4JA 4JLOA 4FC6A 1PJRA 4QAQA 2HJVA 4CR6A 2P67A 1YBAA 1Y7PA 2VDVE 2WHPA 1AHPA 1YTUA 5HUJA 3CVXA 2QW8A 2JD2A 1OFIA 3IDSA 1E96A 4B87A 1XDWA 4MHSA 1W5TA 1PWYE 5C53B 3FCCA 1Z6PA 1RIFA 3GBVA 1VCOA 4B40A 4IICA 5H81A 4EF6A 3PFBA 4KZPA 3E5NA 3QMWA 3GDOA 5JANA 4P34A 3FFAA 4K2AA 4KQ1A 5B3JC 1D8AA 1ZH8A 3C4VA 4FGLA 1SBZA 2X15A 1ODIA 1QBKC 1OHHA 1W4CA 1DWPA 1ODCA 2REXB 2XPCA 3AEXA 3B51X 2WU0A 3FRHA 2QN3A 4O4IB 3T99A 3WLOA 1UPBA 4CM9D 2I6SA 1P17A 4DA7A 5C8DA 3LKBA 2N0SA 2QMQA 4YLYA 4RMNA 3P9YA 4YRNA 4QJBA 2C99A 1RR6A 2HJWA 5BN5B 4URVR 4J1TC 4LNHA 2XYHA 4Q9NA 2G70A 1AUXA 1ITZA 1YUMA 2Q5EA 3KYCB 3ZCRA 2J41A 4A7PA 3FOCA 2A0KA 5KBYA 1X7WB 1QHYA 4FEEA 4X64B 3AZOA 2VOJA 4GMGA 2OLJA 1PJAA 2ZBDA 1G8JA 4DKJA 1KC1A 1W8DA 4IDCA 4UM8B 3FMIA 4IGAA 2Q45A 1XNHA 3CLUD 3M81A 1HY3A 4FKZA 2MSCB 3SX0A 4P7GA 4DIDA 4IDBA 4C29A 3EISA 3BGOS 2QAGC 4MA0A 1P3Y1 3E9CA 3F6BX 3VHRA 3RUAA 3GIWA 5EJMA 3I01A 2O7VA 1SCDA 3ID6C 1I2DA 2PXXA 1I14A 1ONPA 3EYAA 5FL7D 2J1LA 1IOVA 3VXKA 4I5GA 2UUPA 4J75A 4X94A 1NBMA 4GNKA 2GN0A 3KO8A 1QGUA 3MMSA 4GPEA 4MQUA 3I8SA 3IBSA 4O4JB 4TLLB 4YP5A 4EYEA 5HCIA 4GQIA 3ASZA 4DN6A 3ED5A 4LYFA 4YMHA 2UUOA 3ZUGA 2H5IA 3NXKA 2C61A 2FXIA 2QT9A 1N7JA 1YZVA 2EJVA 2AYYA 4ZMSA 2JIPA 3M1LA 4PRKA 5LMUB 1CY4A 2W0SA 1N36B 1ZU4A 4DCGA 4TLBA 4JR2A 2ZWAA 2X9GA 1Z35A 1K6IA 3JQ9A 4LOIA 3G7NA 5B3AA 2VPYA 4GPD1 2WOOA 1GQRA 2D2XA 5BW6B 4N8EA 1J0EA 1EJ2A 2B99A 1H2RS 2CBXA 2R1VB 1RPNA 1W85A 2WK1A 3LCUA 2FP4B 4O6VA 4XB2A 3WI7A 1E2IA 1ZIXA 1DS6A 4KNWA 2RC5A 5KPDA 4BLRA 4RSGA 1A5TA 1YDEA 5FNVA 4NZ9A 4JXZA 3OWXA 3UBMA 2NUBA 4QOIA 3BQNB 4IO0A 3CNHA 4B48A 3AMVA 2Q4EA 4EEXA 1P0FA 2OCLA 1QYXA 2RGYA 3AF3A 1BDHA 4IDAA 2J5KA 2VDPB 2WY2D 1MORA 4X8OA 1KI4A 5M34A 2TS1A 4BZXA 4CF7A 2BKAA 1CUXA 3VTAA 4PGAA 5EWMA 4HVLA 3C41J 1TAQA 2OM2A 2R6FA 4Q3NA 1Q7GA 1QP4A 5F9HA 2IDZA 2OXFA 1B8UA 3SFTA 4RTKA 4F6RA 2XMQA 2IW3A 3UMZA 4KLZA 4BLUA 1CEYA 3LOPA 3DVAA 3PNSA 4QLAA 5EKTA 4EZEA 3KQHA 3HNPA 2I3AA 4H7DA 2MSWA 3IIKA 4ERXA 2GJ8A 1RXUA 1DTWB 3DUFB 1OFUX 5EHQA 4I2NA 4FVTA 2EEZA 3EZ7A 2HXSA 1GPDG 3OZXA 3AUKA 1QMGA 5DGHA 4JI3B 2WKSA 3V55A 4AULA 4A15A 1OTXA 4RZIA 4CMJA 1CQWA 1K7CA 3WQHA 3PA8A 2O3TA 3OBBA 1YCGA 1WDLA 3AZPA 2WR8A 1GY8A 3PEUA 4G5OA 1AQIA 2JLSA 3EFOA 3V2IA 3AM5A 5BYJA 2GJSA 3LVBA 4LE2A 4BN4A 3UH0A 3TX2A 4REQB 5GZ3A 4ZZIA 4AJNA 1VKJA 3V7WA 1GCGA 1PTJA 3PC8A 5KWIA 1M1ZA 2XYQA 2JGIA 1JG1A 4IDEA 3STWA 1UM9A 3C3MA 1XROA 1Z5PA 5CDUA 2GA8A 5F5LA 2QD5A 3U3OA 4KBYA 2ZAYA 4BP1A 3TMYA 5SZJA 1TEHA 1U0NA 1ECGA 3OUNA 3PE3A 3PUIA 2SKEA 4I50F 4IDPA 3CUUA 3OZAA 1PHRA 2AG6A 3CLSC 4EW3A 1I4EB 3GBSA 4KTVE 2PMDA 2OE2A 3QUSA 2JH9A 2Y3IA 1M6YA 1G3IA 5EPOA 3MBOA 1L6RA 3GVHA 3ZY6A 4YXFA 3NEYA 4A0EA 2RONA 4MKZA 2XB6A 1QK5A 2WF5A 1S01A 3DZBA 1KH2A 1F5NA 1TEXA 4KIJA 4OHUA 1ZIYA 2F8LA 2QTHA 3VAZA 2EC5A 2X14A 3F98A 1H9BA 4DADA 2EZ4A 1P6QA 4I4TB 4NU6A 2XWPA 4Q3KA 3SKXA 5AM5A 2JEYA 1G1MA 3KPYA 3VH4A 4JI2B 2AN5A 2UAGA 3V5NA 3WB2A 4G4GA 2X8JB 2WAXA 3N5CA 1R1DA 2HXYA 3V8BA 4ALMA 3RYCA 1HT1E 5F52A 4V0KA 3BMCA 2JJ1D 2GCOB 5BVGB 4QLBA 4GF5A 2VOEA 3IRUA 1KS2A 1QH0A 1YS6A 1NT4A 5DMHA 4IQ8A 3CT6A 5A06A 3BEDA 2G5PA 5C4MA 3VAAA 3NEPX 2CNKA 5TPWA 4IS2A 2GZ3A 1S9HA 2CK3D 2C82A 2KLBA 3OKCA 2G9QA 1KRHA 1NYTA 1OC4A 3BGWA 1JKFA 1Q1EA 1HT3A 1SOUA 1NZJA 1UPFA 3HWRA 3BJMA 3DUWA 3H8SA 3HLTA 3PGVA 1E3QA 4GOND 1JAIA 4DUGD 5KX5F 1Z3CA 2RE8A 4LCBA 3RS2A 3D7SA 4JROA 1J2RA 1R9GA 3L1JA 3L8FA 5AKJA 3WNZA 1HTBA 4KUGA 3WYEA 3P52A 3L8HA 4NFHA 2BR4A 3U44A 4OH1A 2J5XA 3K96A 3KJEA 1S02A 2EQ5A 4N41A 2AE1A 4NAVA 4RNCA 1QU3A 2XRYA 3U9TA 1KOLA 4JVNA 3U49A 4ER7A 2ATCA 4FZ3A 1KP3A 2XHEA 4NG4A 3THXB 1KU0A 4WJLA 2O1EA 2ZYUX 1QYVA 3A1VA 4BRWA 3WLQA 4GPIB 3SZ3A 3DMYA 5CRIA 3NTLA 4BWVA 4XQEA 3UFBA 4BNJA 1XFAA 5LIRA 1WCIB 3OZFA 3MRTA 1G18A 2ZVPX 1PDWA 3ERCA 1SM4A 3B1VA 3PLNA 3GGCA 4ARSA 1PD0A 1HC7A 1L5MA 1JDSA 5HG0A 5BQ5A 4LOLA 2BMJA 1GP2A 3GJ5A 4N5DA 3RU3A 1ZQ9A 3FPBA 2R2GA 3IMCA 2G7ZA 4C0SA 1OASA 3NDJA 4Q1AA 1CC1S 1P0PA 1QVVA 1YR3A 1Z13A 3D43A 3DDOA 3F49S 3VTZA 4X63A 1J25A 1T4BA 2NTJA 3DKIA 3FMGA 3LTNC 1HE4A 1PFWA 2JAHA 2ONKA 5KNCH 2VF8A 3MS4A 4EO4A 3BK1A 3Q12A 2CJFA 5AVXA 1QIMA 1U3TA 2JIZD 2W2VA 5KWVA 3L8GA 2BGKA 3DC2A 1PI3A 3PL1A 5FOQA 1COWD 2CWWA 3NHMA 3HBLA 2W3OA 4D9MA 2WINI 1OYOA 3V8RA 2INGX 1TU3A 4KOEC 2XJ4A 2AYXA 1H2AS 4Y1GA 3SLKA 4C3VA 1P0CA 2P3OA 5IHPA 1DPGA 2R9VA 1UKCA 4M54A 2FPGA 3VOTA 1MJ5A 3LXRA 4EATA 4HNVA 2ACEA 4JT2A 4B4WA 1LWOA 1NYRA 3M4NA 3N6XA 4WXPA 4OQPA 1YZLA 4QE3A 3VV2A 4FEGA 1JU3A 2XZPA 4GX5A 3KHKA 1PNRA 1HNNA 1C3OB 2XH8A 1ZJ6A 4V03A 4DILA 4QO8A 3SM9A 3ZXXA 5EIBC 4OGKA 2FPRA 3LP8A 3EWIA 4KUEA 4YLGA 2JKDA 2HU8A 5IARA 3VOAA 3LUKA 3HDYA 3FF4A 1TAUA 3GNSA 3AIIA 2CLMB 4CWAA 4MVJG 1Y5NA 4L5AA 3KM0A 1WNFA 3OA0A 3N3BC 5FPYA 4C01A 1CQIA 2EBUA 1TUGA 1W5BA 4RE6A 3VJRA 1O77A 1FYEA 3A1FA 2VDWB 2YNMA 3F1LA 3AR8A 3KSRA 4OXQA 4JYCA 2RHOA 1U0FA 3KQYA 3V9AA 1AGNA 2FW9A 4OO3A 1WVIA 3FUXA 2JFZA 3PJEA 9ABPA 2HA3A 4ZGGA 1U2DC 1DO8A 1HK7A 2FN8A 2VAVA 4MJLA 2HU2A 4AQDA 4UUBA 1JHOA 5SICE 5JV5A 2VNHA 4OHYA 5FOUA 1RJ9B 3A0UA 3I6WA 4FMDB 2AXQA 3RSQA 1Y0BA 3MBKA 1ZOIA 2BFOA 3NTRA 3QU9A 4CODB 3R5XA 1ZD5A 4ZT2A 1TUEA 2WUVA 4RHXA 4F04A 1LTKA 4FONA 3EXIB 1RS0A 3SS9X 3FPCA 4JNKA 4AG5A 2QG4A 4FFDA 2DFNA 3D8NA 5K8IA 5J23A 2I7DA 2FWMX 1QTQA 1ZRSA 5KYUA 1ZUNB 3OO1A 3RO7A 4JR0A 4BNDA 4EDHA 4U39A 3CR7A 4KSYA 1PSWA 4DRZA 4WFQA 1YHYA 3GGSA 4CZ2A 2WVJA 2Q8PA 2Y27A 4R6XA 1F14A 1FS5A 3OTQA 1VKHA 1E2PA 4MW4A 3E2IA 2FOXA 5DH9A 1P4SA 2AC4A 4XYMA 5LQRA 1F7VA 2DBYA 5KTNA 3CN7A 2Q6VA 2JQLA 1FPMA 3NHAA 4U3JB 3ZU3A 4MCIA 4PW0A 2O07A 2DPHA 3RUCA 2FDXA 1NXVA 5DMXA 2JCXA 3OQMA 4CIDA 4FNGA 4IIHA 3SIPA 4PG7A 1MV8A 1Z4QA 3C6BA 5BSEA 1TJYA 3IT3A 4B3DA 2DBQA 5HIKA 3L6OO 3T4UA 3LTEA 1TIPA 5HP4A 3N7UA 1NQAO 2PPLA 4BAUA 5AUPB 5AVZA 3B2EA 2FZ5A 4TLAA 1U9IC 4CMGA 4EARA 3X1JA 5JCOC 4NYIQ 4J16A 3WGQA 3ZZMA 1LFAA 1DKPA 3DPSA 2IC5A 1M0WA 2Q5JA 1GQYA 1F8UA 3JQFC 1C9DB 1QQTA 3EIUA 1WW3A 4UUMA 1QO0D 3RYFB 5KOIA 4J0CA 4ARVA 1CJSA 2A1UA 2ZZMA 3IC5A 1HL7A 1HPLA 2X1HA 3NBAA 1MC8A 3W4JA 1VBNA 2H2WA 2JJQA 3P2KA 3CTMA 4FNOA 3C4JA 1XXHB 4I4CA 4M1YA 4Y1RA 3FOFC 1Y3HA 1JX6A 8ADHA 3L04A 2EJCA 1NW9B 5F3RA 5T6BA 2P6NA 4EKYA 5JZOA 2A7QA 3ND9A 4NV3A 3AWIA 1FSSA 2O5EA 2PX0A 1WHSA 4PBRA 5D6OA 2YTZA 3CVWA 3AJDA 3HCCA 4FBGA 1IJKA 3OLZA 1NDQA 5FJJA 1ZWLA 1EVIA 3OIVA 4GL4A 2QTAA 1JTEA 3A9WA 5CX1A 7ABPA 3UKJA 1A9XA 3KQWA 2PUBA 2Z6UA 2ZB7A 3ODPA 1T24A 1SFRA 3B60A 4N0EA 1RYDA 3I0NA 4U63A 7GPBA 1CJBA 1OX4A 2WWHA 3A6KA 1O6BA 2I4LA 1N5JA 2E82A 5KWJA 2C29D 1T5IA 1XNJA 2DPYA 2G63A 1DDGA 2QTTA 5EXEA 3TRIA 3W5CA 3S5JA 2ACKA 3A6FA 4MYDA 1P80A 2PD6A 2ZI9A 4MGKR 4PZPA 8OHMA 5EY5B 3OTHA 2IHUA 3P9ZA 1QFZA 3T9FA 3VPFA 3ORYA 1AK2A 2VPTA 1HMYA 3CRRA 4OJQA 2GBIA 3DZHA 4U7FA 4BKUA 2F7SA 4P22A 4Y6PA 5BT8A 4C4OA 3TRHA 4ZI3A 2PRYA 1LDBA 3DLBA 4LHEA 4HAXA 5FFFA 3C14C 2O57A 3W6NA 4EI7A 1IDN1 1LZLA 5FA5A 4RL6A 4RQBA 4KVGA 5COBA 1FFHA 2FSVA 1Z6ZA 2FV8A 2D4AA 3FFXA 3MTDA 4J9UE 1RYNA 3E05A 4P81A 5AOAA 4ENTA 4BGVA 4G0XA 1Q6ZA 3PNOA 2OCPA 1E1RD 1F8XA 1GSOA 1YT5A 2XUAA 3OQ1A 3T61A 3N86A 3D7LA 1MQSA 3C48A 4JQZA 4BYGA 3G2LA 1S8OA 3V42A 3DCJA 1PW7A 3VR6D 4L8GA 4RV4A 2X3UA 2EHJA 2QRLA 1V47A 2XMGA 3N7AA 4YO8A 5K6AA 3COSA 4R2JA 1FJHA 4IHQA 4C0LA 3ND6A 3WY9A 5B7NA 1KETA 2PIAA 1V9LA 4MV9A 3QEMA 1O3YA 2YC4C 4W82A 1JLHA 4FEYA 4MDFA 3UJ3X 2GKOA 3TLBA 5A6SB 1EHCA 1A2OA 4D9VA 3I9V6 4B6FA 3TRDA 1L1FA 3VO1A 1NP7A 3BMNB 3G13A 1BTOA 3PQDA 4FW8A 3VOSA 4WY8A 1P7WA 3ND7A 1KXJA 4N18A 1AV6A 2W6CX 4HYYA 1WBDA 2EX0A 3Q8WA 4EZIA 2ASEA 5KOHA 5H9VA 1PR2A 1R0CA 1HFKA 3HVHA 3GZNA 3W3AA 3EVCA 4R9VA 4MZDA 3SSAA 1U99A 2GAFA 5JYCA 3MJVA 5JBNA 3V7NA 3ZDQA 5LQMA 3BMXA 4G36A 4ILKA 4RTMA 5KVVA 4LV6A 3HXQA 1KK3A 2NNLD 3ENQA 3GRVA 4GBGA 4P4LA 1UANA 3IIMA 1B1CA 4IMIB 1C2TA 4M1KA 4PGMA 3HYTA 1FMCA 2AF3C 4UTOA 5HBRA 4F1WA 5JFTA 1SZJG 3ESQA 2DTEA 1XT6A 4E08A 1QX3A 2PTGA 2HLDA 4V1CI 3IMKA 1HSOA 2CDBA 4AMYA 4CG3A 2GEVA 4OXIA 3DZKA 4Y2SA 3W1WA 1RNLA 1VM6A 2QTLA 3PNVA 1WUJS 2H1IA 3I62A 5CEJA 1GAWA 3DVQX 3SYRA 3GN1A 3HKDB 1NBME 3O7WA 3P7MA 1NHWA 3IP3A 2XMSA 5G0TA 1Z4IA 4QBGB 5KCMA 3W06A 3MK31 5HX7A 1O1YA 2FH5B 3E2MA 3RT9A 3LWZA 3HNOA 2PRZA 3OKAA 3RIYA 4DG9A 4XVRA 5THKA 1T5OA 5IEBA 2VCEA 4PLZA 3TRKA 2JF0A 2R8PA 3E3LA 1ABEA 3A1SA 3Q11A 5TMDA 4ZVOA 3R0ZA 3REQB 5I9SA 4HVAA 1U2ZA 2CHFA 2GXSA 4S12A 3GEPA 1E60A 3ORHA 2X2FA 5AVTA 4EA9A 4AKIA 3NGLA 2EW8A 1EFRA 1USKA 1AZLA 4OMFG 1TLTA 4ZKEA 3HDHA 2W93A 1GQOA 1Y82A 1E3SA 3KD3A 3ZHCA 4BMYA 1FMFA 3U3MA 1V7ZA 4ZVTA 1GGHA 3O1JC 4K88A 5CA0F 1U8TA 1JNYA 4OAPA 3DB2A 5DYNA 4OJYA 5DCYA 1EE1A 2W8BB 3LE8A 4DPLA 4E33A 3ZWMA 3SCZA 1XZBA 2ZKLA 1QB7A 3JD3A 2V6FA 2XNJA 4NONA 4PRLA 1R6XA 2PFSA 3IHWA 2B2NA 4R05A 1CUSA 3A70A 3GRZA 3MUNA 3NKVA 5DOZA 4DLPA 2JG3A 1DP4A 4KRFA 2ECOA 4O4HB 3HN2A 1CT9A 2QJOA 2VF5X 2XUGA 1M7HA 1HE1C 1JEQB 5G4KA 3VMFA 3W5VA 2QUAA 3TPZA 2DETA 1HNXB 1DOAA 1G8GA 4TT3D 1CWUA 2RHMA 3PPVA 4X41A 3DHVA 1NAIA 4YWHA 1R4NB 2F1KA 4N5IX 5HOEA 1NUSA 3EUWA 2EL7A 1K75A 2HMWA 3FOBA 4IZHA 3AUUA 1N8TA 1Q21A 1NFRA 5CTAA 2YZ7A 1SUWA 2EG9A 3M5PA 4FD2A 4US0R 4DAEA 3GRAA 2LCQA 1BZYA 1VI6A 1A7UA 3PFHA 1ZKDA 3H5AA 4QRIA 4XGQA 4ZMRA 1U7ZA 2IS6A 1G8SA 3UENA 4DBZA 2R44A 1D2GA 5H80A 2P1ZA 2PBLA 2QKYA 1IOZA 1KK0A 3BDAA 5B53A 4MDYA 4CGYA 4XWTA 3B2NA 5IW8A 1EESA 4JHLA 4LNAA 1SU6A 5ILGA 1T43A 4JDPA 3AHHA 4K5QA 4TRNA 2OP1A 3OZIA 3IAM6 2O1XA 5EWJB 3PB3A 2X8LA 4IUYA 3NO4A 3HJNA 2FWPA 4RH0A 4PBSA 4MR8A 4CF4A 3M6VA 1DAEA 1WX1A 1W0KA 2GCGA 2BD0A 4BB0A 3RVQA 3MINA 1VKNA 1RXWA 4GD3Q 3ECAA 3ZQJA 3M4YA 1RWMA 4EPWA 4ITUA 1WD7A 4DSNA 3ML1A 4B3FX 3H8WA 2Z98A 3G23A 5EUQB 2GCEA 3LYLA 5JLAA 5KNCD 1XDSA 1P9OA 3MYRA 4JEHA 2VYND 1TI7A 3TLZA 2R00C 5EOVA 1ZL2A 1Z6QA 2EYUA 2Q21A 5LNK1 5A4JA 3GXBA 3VPGA 3IR7A 3KYJB 3DZGA 1BE1A 2PRKA 4BMZA 1ZI6A 1KR2A 5EE1A 4Z4EA 5KOJB 5KI6A 4KMSA 5HQ3B 1M8JA 2VDUE 4YO7A 3F47A 1RI4A 3E9ZA 4ZVUA 2D2IA 1B26A 3FSEA 3ZCQA 4EKIA 1E4EA 1DJLA 1NR1A 2ZBUA 3FYSA 5BW8A 5HOQA 1SWWA 2WAAA 1PGPA 1L4NA 3UHFA 2J85A 4RHCA 2XHZA 1Z5UA 1IXZA 3H1FA 3JALB 2ODEA 4Y2VA 3MB5A 4LK3A 2WKWA 3MAGA 1P5HA 4G3XA 4BZZA 2G40A 1RQXA 3CPJB 3CLTC 4KQJA 4M83A 1MPXA 1Z38A 4IDFA 1UKZA 4RHYA 5FDFA 4XGNA 3HCWA 4FEAA 2LDBA 3Q3GE 2CJWB 2D2VA 1YA8A 4LHXA 2WZQA 3ICCA 2TMDA 2O06A 2QB5A 3AJ8A 4JBWA 5CG1A 3ZLUA 3M5WA 1C8KA 1SXHA 2YS6A 3QU7A 4N9WA 4R6WA 4N0DA 3TD2A 3Q0TA 3CKKA 4AKSA 3AVXA 3R5HA 3BMOB 4KYTA 1L9XA 1PDVA 3G7SA 1O03A 3FTEA 5LDDC 2H1RA 2DOKA 5L4SA 3ILHA 3IPRA 4PZUA 1O0BA 7REQA 2AW3A 1MRZA 2ZDGA 4RPHA 1XYVA 3NRJA 2DTDA 2FFQA 1P1HA 2NMVA 1D7AA 2C59A 3GJTA 4HADA 1L4MA 2YMQA 3B1WA 3AERB 1WXFA 4FHCA 1VLQA 4V2IA 3ZKWB 2WTBA 3CX6A 3LOQA 4O2AF 3QELA 1JIQA 1X8KA 4LBWA 1NUHA 1D5WA 1WE2A 2A8YA 4RJ2A 5HIJA 1LPBB 5ENVA 2Z83A 4IP0A 3IE2A 1ZSVA 4WERA 2QPLA 3QYFA 3U4QA 2HV8A 3QKRB 1GPUA 5JQGA 2ZE7A 1Y6QA 3PQ4A 2GTIA 2FN9A 3LX6A 1VXOA 4E5UA 1KOGA 4I8DA 1E2DA 3TB6A 4BP8A 2XCLA 4OXNA 2PT9A 1CV2A 1IRIA 1Z3IX 1JEJA 1FU7A 3RRFA 3ZS9A 3FNFA 4MA4A 3H2IA 5KTSA 3OZ7A 2B4AA 5EE3A 5HFAA 4DB4A 4JQOA 4UVDA 1G6Q1 1EA7A 1YJ5C 1CK4A 3PXBA 4EF4A 1QYIA 4RK1A 4ZOAA 4UUNA 5H68A 1V7QA 2XODA 1X1CA 1U4NA 1Z0DA 4G4SP 2EIXA 1Y5IA 1Z2AA 1GNRA 2AEFA 2XUQA 1NULA 1XZLA 1W48A 2GEJA 3WLTA 2CFTA 1G41A 1P2BA 2J7KA 2W2QA 3KZMA 3D2BA 4R2MA 4OATA 4RENA 1WOMA 3S27A 2VK8A 2ZUFA 3RFCA 1E6LA 1R2QA 5KC9A 1WQ1R 2IXGA 1DOHA 3AG6A 3QXGA 1SCNE 4OI4A 3CM0A 1FOEB 1VPEA 1DCTA 1WPRA 3L82B 3URKA 4D4JA 4HQ0A 3CV3A 1U0LA 1WUKS 2ACWA 3HBFA 4I55F 3T1QA 2FHSA 1VMEA 1E0AA 4KAAA 3AJRA 3DO6A 3H7AA 2YWFA 3KD2A 3N6VA 3V32A 4C7OB 2VA9A 1XDUA 3RLFA 3P9PA 4PNHA 4I5EA 3D81A 2WWRA 4TV8A 1PJ4A 1YZUA 1W96A 4C4AA 1VGQA 1ADFA 3PXEA 1UBSB 4HT3B 3G0DA 4HGQA 1K5HA 3AUYA 1H9CA 2YIDA 3COPA 2ZANA 4GOMD 4OSEA 4LSGA 3U3KA 3ZHTA 2GX6A 4YAOA 3UC9A 2WWYA 2QBYA 4D42A 1JWAB 3BXFA 3UCXA 5IEJA 3ETJA 1SXJB 4FNMA 1A97A 1SXGA 4O2LA 5D00A 4ZJPA 2QT0A 4OB6A 3NBYC 1F9AA 3OQOA 3P5SA 5J2UB 2CYAA 4PYKA 2QGFA 1C3EA 3I5AA 4Y6QA 4AVYA 3HZRA 2BRUA 3SX2A 3MWYW 3LA6A 3PHGA 5KYNA 1MW8X 3N0TA 2HH9A 4KOAA 2WZCA 3K20A 3OJXA 1E2LA 3JVEA 3OCVA 1Z7EA 7MDHA 5IZCC 5DHRA 1C0IA 4S2UA 1XMVA 1KKLA 3IAS6 4XOIA 3SQWA 3DZJA 4UASA 3BE8A 1M2GA 2J5BA 4DJAA 1O9HA 4BO0A 1FNCA 1XZGA 4RHUA 3L4EA 4R8MA 4REMA 5FTJA 1BS1A 1PF7E 2I6QA 4JSYA 5JPIA 5EN4A 3R7BA 1PJSA 1G5QA 4K3VA 2IYSA 2M9MA 1CJVC 3R74A 3PSHA 1XVVA 4YROA 1YJMA 4OHOA 1E2NA 2OBMA 2BSAA 2QRMA 2FFHA 1OXSC 5K6RA 3RJ9A 2YWJA 3QQPA 1Q19A 1IUOA 3K9GA 3KR0A 4L6CA 3A3PA 2O0LA 1HMPA 2CKMA 1EM8B 2FB9A 3TPFA 1DLJA 2K6GA 1T5DX 3WGKA 2R7AA 2R6R1 3AW9A 4UHBA 4UDYX 1ILEA 4TXNA 1B15A 5FV7A 3TOSA 4QDOA 2O7NA 1TZJA 1WMEA 3UHOA 3SQLA 1QVRA 1G0NA 4ZI5A 4QFDA 5JJ5A 5CYOA 1OWMA 4PSUA 4WZ6A 2G4LA 2QNBA 1W34A 3T9AA 4ZVLA 2BHRA 5KYKA 3SJUA 3PDCA 1PHPA 1Z6YA 2D54A 2O2DA 5LDGA 1QG4A 2H11A 4FR5A 4IS3A 3UOGA 4R2KA 4ATNA 4D9FA 2H1WA 3IAEA 3NXSA 5CLFA 5HKAA 1NOJA 4G97A 1G5PA 2QX4A 3AXSA 4LVCA 2KB4A 2G09A 2C5HA 2C0QA 5A8IA 1N5OX 3IKMB 1T0IA 2GM3A 3GJXC 4QASA 3VO8A 4I1PA 1GGEA 2XF2A 3V1MA 1LW6E 2P9YA 4IOLA 4A6PA 2DFTA 3CR3C 3MTEA 2E18A 1SBYA 3UK7A 4HG2A 5JU6A 1B73A 3WLNA 3I01M 4EY4A 1GYQA 1P19A 2GZMA 3GELA 1W25A 3Q3JB 3GLFB 5GVRA 2GB4A 2HSDA 3UANA 3PJGA 4QC2A 3ER8A 2HO5A 2LD4A 2DUUA 3BWMA 5SY6A 2P9TA 1KI6B 2Q4TA 2DFDA 3NBQA 4QYIA 2QHXA 1BX1A 1WUHS 3AHCA 1ZP6A 3GHYA 4DIOA 4Z4FA 1NASA 4ABYA 4DJTA 3M6FA 5GONA 1D0VA 1Y3FE 2AVDA 4B6EA 5E4FA 1Z0IA 3PNKA 4JELA 1INLA 3SXUA 4X1YB 1QDUA 1PG5A 1WP4A 2O1SA 3PHLA 2RHCA 4TLCA 4MYHA 2DFLA 5SZHB 1NLUA 4KXUA 2YIMA 4YRBA 3FYUA 4YQZA 4MTCA 5ES3A 3PGXA 2PNJA 3TFQA 4C06A 4C0WA 1M6VB 3PR3A 4POAA 2AJDA 3KXKA 2C88A 4I1UA 5JXJA 2H0RA 4ZD6A 3IPYA 4ZOLF 1N78A 3ECSA 4LZZA 4RM2A 3W3ZB 3MWEB 1SZDA 2D2FA 1K3TA 2IL1A 1IVYA 4IIYA 3DBHA 3B5JA 2JGEA 3D5EA 4AZTA 1LDNA 1QORA 1ZA1A 4CCSA 2PIEA 1UT5A 1RBMA 4EUNA 5HS4A 1E64A 1I7LA 2M1XA 1JR3A 1BHO1 1DKUA 4JQCA 2NUPA 4WKCA 5H83A 4KLRA 2BFCA 3WHIA 4X6UA 2JJYA 3AR9A 2VQ3A 4HDRB 5JH7B 1B8VA 1C9KA 1ZGHA 2QJWA 2JGNA 2A9FA 3DXZA 1ZY2A 2RBKA 3DYIA 3R4CA 1GGVA 1TU4A 1XCMA 1TZ2A 4UCQA 3FCOA 3SJZA 3LLVA 5DKFA 1DX4A 1IIBA 1FLDA 1R0LA 1R8YA 1TMYA 2XB4A 1CS0B 1BKSB 1KI7A 4PPQA 4BUJA 4CMEA 2ZJ1A 1J09A 1X7DA 1A5ZA 4IG9A 2GBCA 2H9IA 5E38A 5HUQA 1GGFA 2GEUA 1WW8A 2B69A 4K1XA 5DO9A 1JG2A 1GNQA 2RAUA 3X1DA 2N1BA 2WG1A 3IKTA 3E9NA 3HKBB 4Q3BA 1BJKA 1VZ2A 4TVKA 3LLSA 1E69A 1KAQA 2HMYB 4ZCSA 2IEGA 2FUEA 2W42A 4PLPA 1VG1A 2QK4A 3VSEA 1XZIA 4J76A 1S6YA 1OI2A 3JYLA 3S3TA 2OV3A 3SS8A 2F9FA 3VYVA 3SJAA 3K8YA 1ZAYA 3CHYA 2FRXA 3L93A 5FTWA 4CMHA 1L5HA 3EWSA 3U4CA 2GZ1A 3NT2A 3SJBA 1ND6A 1JG6A 1KVTA 3EUFA 1RBQA 1OLUA 2JJ2A 1VL6A 4KIFA 4RM3A 4RO0A 1Y48E 1H2WA 4B73A 3UJDA 2O8VA 1JT2A 2PWAA 1ZM7A 3ZOZA 5KNDA 3MXTA 2CSXA 2IE8A 4TWIA 3UB3A 1L7QA 2XYRA 2PMCA 1YJQA 4Y6OA 4G0OA 4G0MA 3P26A 3WMGA 1FDIA 5JATA 3B5EA 3H18A 5JHHB 2O8FB 2RD2A 3UV3A 5D6NA 1YBHA 1Z9BA 3K0KA 4B47A 3VDRA 3VO2A 3ADOA 3TW0A 5CB4A 4RTSA 4AN1A 4DTCA 3GLGA 1Q17A 3LKDA 2CHEA 2RHBA 2GNOA 3EGXB 2PGXA 1TUIA 5TPZD 2YY7A 3A37A 1T2DA 1XTVA 3NDIA 1NVKA 5AVRA 4E5MA 4ZODA 3MWKA 4LRXA 1XTPA 3FCSB 3OE5A 1BD3A 1YZFA 3K0SA 4KXNA 2FWNA 1XELA 4PCAA 3SMQA 1FSFA 1SCUB 1N6OA 1XUOA 3QKWA 4KFTA 2BMAA 1DMRA 2G82A 2PWYA 3OT1A 5AO9A 3TLCA 1USWA 3BDVA 3DHWC 3E1SA 3PZRA 5CEEA 5FEUA 2R4QA 1HGXA 3V1KA 5JERA 4HY3A 3UIEA 2C96A 2OZKA 3PD0A 4GZ5A 5CM9C 4RPGA 3P0IA 1I0ZA 1GD1O 4MPJA 2X8BA 4G63A 4CMIA 1KU6A 3RUPA 1EJ0A 1AKQA 2PSJA 4I50B 4JV5B 5G0VA 5HZKA 4HPJB 3OJ0A 4PO3X 2NWQA 3EBLA 2C58A 1SQ0A 3E58A 3O8OA 2H1SA 1XMJA 3UEOA 4AS3A 3AR3A 1G5FA 3Q9UA 4LUCA 4YJ3F 5EP1A 1AGYA 2CJYA 3H4IA 4OXRA 1ODSA 4HLNA 1TKRA 2B1GA 3GFGA 4LDNA 3MCUA 1F06A 3KG2A 1JDZA 3PVCA 4MQLA 2XEDA 1U0HC 1U0OC 1Z83A 4GP6A 4INOA 1YB4A 4M38A 1I4OA 4NE2A 4Y67A 5JAHA 5LPNA 4ARZA 2IW1A 1TT5B 4UMEA 5DCUA 5BSKA 3RIHA 3PEWA 3JASA 1AKVA 2QSJA 4U2GA 4F84A 2HFKA 2V6JA 3OT5A 4IWNA 1ISJA 1G17A 2GR9A 4QULA 2MMCA 4XIYA 3UAGA 3V80A 2OXEA 5BV0A 1UJCA 1XTQA 1L4HA 4L5IA 1ZJYA 3IUSA 2ANCA 3EEBA 1OXMA 1Y6RA 2HHHB 2BHSA 5D1NA 2CVPA 4D4HA 2OWEA 5A0VA 2UZIR 1FTSA 2WP8J 3H1GA 2HWKA 4IJ6A 4RIHA 2YXDA 3WGLA 4GIBA 4N3GA 4QIHA 3IR5A 4JGIA 2WMYA 1F3LA 4D96A 2HBRA 3WK9A 3LGXA 5KX5B 3II6X 2FEPA 4E1BA 4NX2A 1W2WB 3HE3A 3HRHA 5C1DA 2WM3A 4K9RA 5FUBA 1EXDA 4GU5A 3VPCA 1LA2A 2UVDA 4K7JA 2O20A 4BJ5A 5FPPA 4QOFA 2FFBA 4EP1A 5IN4A 2QMEA 4C3ZA 2PD4A 3DJFA 2D74A 1USUA 3E22B 4FFWA 1ESMA 4I1YA 5DRYA 2ODAA 1XZCA 4I2VA 3GG2A 1L7OA 2UYOA 2V45A 4RPCA 1W1UA 5BWBA 1KMHA 1QDLB 2I71A 1XIVA 4TZ0A 2QV0A 3E9RA 3PQ6A 3DMPA 3FPHA 1EVJA 1VLVA 4R1QA 2ZITA 4XIIA 5DP2A 5HF9A 3WL6A 4C3UA 1KYIA 4RTQA 2DERA 2DF8A 4FFBB 2UYHA 5HGXA 1XQXA 1FC0A 3IJEB 5J58A 1SKYE 3KQOA 3NT5A 3FB4A 1P2SA 1Y8RB 3LBHA 3RUHA 4CKEB 1O0CA 4ZAFA 2WSSD 3LQ4A 1R8QA 2XTNA 1PR4A 1AJEA 1P3JA 3GW8A 4O2BF 2XOKA 3EGCA 1QP8A 1ADJA 4M9CA 5CDGA 4TVOA 2OYRA 3DT8A 3WGZA 1P2UA 5ALKA 3OLYA 5J59A 4DIEA 2GJ4A 2Q4DA 2X6QA 1A1SA 1XP8A 1R0XA 3DTVA 3VI3B 4N0MA 4QNNA 1EUQA 4HWTA 3L7MA 3VSCA 1VTKA 2P41A 3I23A 1IXKA 1U8YA 5ALTA 1KDVA 4DR1B 3GDHA 3P2OA 4BP9A 3V34A 3D7RA 1X2EA 3JAWA 1XL0A 3CE9A 3D4OA 4QPCA 5G53C 1SC9A 4OQMA 4URUR 1DAPA 4OJKA 1A4RA 4CE6A 1A2QA 4TLDA 1M74A 2CLIB 3GA0A 1D1PA 1QQ7A 2WOJA 3WAKA 1IQ0A 2AN1A 3D8TA 4Y9RA 1Q7BA 4RTRA 4KWTA 2FSGA 5IKEA 4P84A 5EZQA 3O3CA 3AB3A 4IMPA 2BP7A 1G7SA 3C3PA 3GH1A 3IAXA 3O4FA 4BX8A 4E2YA 4MPRA 4HMOA 4WZBE 3TTTA 2WTUA 3FF1A 5L3QB 4OHPA 1CVIA 3G8DA 4JGGA 5T4EA 1BMDA 2BFMA 2H7XA 5CD1A 4RZHA 2PXAA 3B6EA 4PNZA 2P0YA 5FQNA 2YWRA 1PYOA 1FX0B 3DLAA 1N3YA 4JS0A 1VHTA 3WKAA 2JI8A 4NC9A 5JJIA 4MWGA 3VDQA 4P86A 3OEYA 4LEIA 1S9DA 2IX9A 2EATA 4C4RA 4AUEA 3KL4A 3NOXA 5EUCA 2C9OA 4BBJA 4TYMA 4D7AA 4F5EA 1NR5A 5JC8A 2J0VA 4OSOA 3CC8A 4EGSA 2RGRA 3HY6A 3ROZA 2DQ4A 2FPMA 3AR5A 1ZH6A 5AM0A 2EU8A 1N9GA 1FDTA 2WTEA 2BY4A 3O75A 5J47A 4HBGA 4CL2A 3KQUA 3T3GA 4O5OA 1ULAA 1ZITA 2P6PA 3D7MA 4LGCA 3R7NA 1EK0A 3AFHA 1DJQA 2ZT5A 4HL6A 4MV8A 3OQ6A 4N4AA 5AK5A 4EEKA 4EMSA 3CYFA 3GUCA 2OBFA 1ZH0A 1S4QA 5COQA 4EO9A 1D1TA 5DP1A 4Z0HO 5B1YA 3ZDAA 3WSWA 1EUDA 1GZUA 2WABA 5KDOA 1A9SA 4G8JA 4L78A 1ODLA 1UQTA 3GJYA 3WNVA 4G5HA 2QPAA 2DCMA 3ZV4A 1IVSA 2GZHA 3EXHC 4D0GA 1GU0A 4N0QA 3ZN2A 1KZ1A 3H0CA 1BCRA 1GUFA 4WPGA 4B4OA 3PCTA 5IKPA 1U6IA 1JR4A 2EZUA 3GYBA 2XZDA 5IT9A 2UDPA 5AJXA 2HUNA 3BQ9A 3H11B 4IDDA 2HJGA 2JIMA 3KJQA 1BJRE 4C2UA 1L8AA 4Y18A 3C4QA 1KRXA 2WUFA 4AECA 3EF3A 2J08A 4FKBA 5T4FA 1I4TD 4UDXX 1WQ4A 2CCJA 3URMA 1YXMA 2NQ8A 2DY1A 1Y34E 2O6HA 2JBWA 3AHFA 5EJ2A 1QR6A 5CIYA 5GZ1A 1FW6A 4R1OA 4MUIA 2BFDA 4OKNA 3EA0A 4B84A 2RH5A 4EFLA 2H3EA 4BMOB 1B8NA 2LRHA 1EHYA 3JQ9C 1ZI8A 2D8AA 3RKUA 3TL2A 2FZLA 3U48A 3EIQA 1XLWA 4QOSA 4I99A 1Q0SA 1K9SA 2VNKA 5E95A 2RARA 3NAQA 3MCVA 4MP6A 4GR5A 1JHPA 5REQA 1TADA 2AG5A 1KYTA 1EU1A 1Z8HA 2C3UA 2BGIA 2OFOA 3DAYA 3IUPA 3PNPA 3R3VA 5BSGA 2Y1GA 2VYVD 4BQPA 4PU0A 3K6SB 2Q62A 2QJTA 3A1UA 3ANYB 2C7OA 4LS3A 4RKYA 4X7PA 3KYIB 4RDIA 2IWRA 4CMKA 4WEQA 4FYJA 4BZQA 3RVJA 4FN5A 3HJTA 1CQXA 4WUVA 4ZYTA 3DDUA 2NPIA 3FCUB 3NJ8A 4L7QA 4MITA 5E6UA 3ES9A 1PZFA 2CDRA 4IILA 2BHNA 2NSJA 4TZTA 1B41A 5AW9A 3B12A 4UNPA 3K30A 1CYDA 1FNNA 3WL4A 2I3ZA 1ST2A 2YJ6A 3H5RA 1YI8A 5F1PA 2QAGB 3ONWA 2I2WA 2GM4A 1RKBA 2PU5A 3N0VA 3L8CA 4ZYZA 1KEEA 4ZOEA 3RFFA 4FHFA 4Q4HB 5B57C 4YJDA 4QRDA 4LJ8A 2JBHA 1BFDA 1U8EA 4BNYA 1JFLA 1S2LA 5F23A 3AUSA 1YONA 5BRJA 2GVDC 4NFSA 1JSRA 3AB7A 2XDQA 2A58A 4OFBA 4CKYA 3ROFA 4F86A 4FOPA 1U7FA 1X39A 4BJ1A 5JVDA 3TBFA 5KNBA 4AKGA 4G8CA 3WP1B 3N75A 1H2YA 3TOVA 5AKZA 4B6PA 1ZONA 4E21A 4OFWA 2CHVA 3JZFA 1PTJC 1RVV1 1U7UA 2ZDHA 1JMYA 1VSBA 4DL9A 5AW3A 1U1GA 3GUUA 3ORRA 3C7DB 4UBMA 1BOOA 4Y9TA 4ENUA 2WUWE 5LQNA 4MRMA 1MHPA 1XJWA 5TSDA 2QGZA 2NZ8A 3HY3A 5DFAA 1PT7A 1J4KA 3ELVA 1WZEA 1KL7A 2QXTA 9LDTA 3H9BA 4GPAA 2DKNA 2E87A 3MTGA 2FE1A 2IYFA 1FEZA 5JNSA 3E8MA 5E4YA 2EKLA 4W9NA 3T4XA 4I9UA 3IHTA 1T5TA 5LD2B 1SQ5A 3QPCA 1FVFA 1CP3A 3R0XA 3FJOA 4KXYA 4FX5A 2ADFA 3RBZA 2IGBA 1MEJA 3DM9B 1YU9A 1Q1BA 2J67A 4RA9B 2DZDA 2ZBPA 3C1OA 5HZHA 3BHNA 4JDUA 1JKXA 3BTVA 4QUEA 2PO7A 1R12A 1V1RB 2ZIXB 2WM8A 1NW4A 2XMBA 5CGQB 3FR8A 3O4JA 3VAYA 1MJFA 1U2GA 2ZG6A 4OREX 2PZAA 4OXYA 3GU3A 4OUKX 4U7GA 1TQ2A 2VJCA 1HDZA 3HL4A 5IJ0A 1RYMA 3L1KA 4RKFA 4R1TA 4EAAA 1MJSA 2B2CA 3KUUA 5JMPA 1I9GA 3RYHA 5KTOA 5C52B 3GPLA 1UT6A 1JA0A 3EIOA 4CKWA 4UJ5A 4I8IA 1XSEA 3EEQA 4Q15A 1T6YA 1D6SA 2Y76A 5L45A 2WTAA 1Q7EA 3FKJA 3O0TA 4BFWA 1NRXA 4YP7A 4L0MA 3W9SA 4ENPA 4JYAB 5CBKA 1BOFA 4WAUA 4XQ9A 3R3WA 5EHNA 4BKQA 1HLDA 2J3DA 4YH1A 3BDIA 3ZWDA 5LOVA 1ZEMA 3IIEA 3W79A 4PSAA 3TBHA 5JECA 1KY2A 3KOOA 3QF4A 1GLNA 5AI9A 5HCUA 4M1WA 3U7EB 4BWFB 4YUXA 5JSFA 3G6KA 1YO6A 4D46A 4RYLA 2CHUA 3AJAA 1UAAA 3BEOA 3U17A 4QQ8A 2WV9A 4MMXB 3W6UA 4F11A 3HUDA 3BJIC 5JDCA 2AZMA 3WYGA 1ZD1A 3PTZA 5CDFE 2OECA 4DIBA 4WXRA 3OMLA 5DX1A 2HQRA 3NZEA 1CZNA 3FKSA 3QYJA 4KBGA 4KNVA 3ZDEA 1EWKA 1JPVA 2BJHA 4CJXA 1UJ6A 4NMHA 4DMRA 1RMQA 4P53A 2QTVA 4OHMA 1XEAA 1XWFA 3PWKA 3Q2IA 3IP1A 4MKXA 2ON6A 1Y7TA 2YYAA 3QPDA 2PKWA 2V65A 3HCAA 3IVGA 4ALIA 5TT1A 1GARA 1X1EA 1Y1KE 1KJZA 1ZN2A 3A6DA 3B70A 4QEZA 5BY2A 4U7PB 3RFTA 3K0EA 2AB0A 2NAFA 3I5UA 4MUEA 5AI0A 3PQ2A 4AJJA 4RD1A 3WTBA 3PXXA 3R7WA 4X93A 2Z04A 2H9YA 3FM9A 1QG6A 4IRXA 3RQSA 1EXVA 1A1VA 2FWAA 3HP7A 3DBIA 5C32A 5CA0B 3ZBTA 3VPBA 1XA0A 3HXTA 1YE3A 4PE5B 4F45A 3CU5A 5A7GA 3ZXUB 5CLJA 5CT4A 2JD1A 3U3XA 1LJUA 1MOQA 2ZRKA 3PFWO 1PNVA 3MCWA 1QH8B 5ELMA 2NYRA 5D3MB 5K8UA 1EP3B 1XJ0A 1DQYA 4S1OA 1AUVA 3FWKA 2I6FA 1ZN7A 1XZDA 1QOQB 5KSWB 1JA1A 5DXJA 1AKTA 1E2MA 4W5WA 3Q3EA 2LPMA 3ZDXB 4C7XA 3PWSA 4QGFA 3CJRA 1DHTA 1EI9A 1Q5PA 4FHDA 4HX9A 2FMIA 1OHHD 3LO8A 1TO1E 3DNPA 1KO7A 2L2QA 2XCI