5DHRA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 68
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhrA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhrA01
1U0RA 2I2BA 5DHSA 3V7WA 3V7YA 2QV7A 2QVLA 1U0TA 4DY6A 1Z0UA 5EJFA 2I2DA 2I1WA 3AFOA 3PFNA 5DHPA 5DHRA 5EJGA 3V8RA 1SUWA 2P1RA 3T5PA 4WERA 2AN1A 2BONA 1Z0ZA 3VZBA 1Y3IA 5EJHA 2I2FA 5DHQA 5EJIA 3V7UA 2I2AA 3V80A 3VZDA 4HAOA 3V8MA 4L02A 2I29A 1Y3HA 3S40A 1YT5A 3V8NA 3V8PA 2JGRA 4WRRA 4V24A 2Q5FA 3V8QA 5DHUA 3VZCA 5DHTA 2I2CA 1Z0SA
chains in the Genus database with same CATH superfamily
3RVRA 3QF7A 1LLFA 3A32A 3KOZA 3NDRA 4PFQA 2B2XA 2ZJFA 4BP9A 3IO5A 1IBMB 3KAKA 2QQFA 2HJHA 3ZHZA 1Z5NA 1XXHB 3M1YA 1VLZA 5HS6A 1R6BX 5AUPB 3NRBA 5LKRA 1ORIA 2PVPA 2YY5A 1J9EA 2AMYA 1GARA 2A0FA 4I1RA 4X7PA 5CNMA 5E95A 4ERXA 1J39A 3OPVA 2B61A 1GQ2A 3D2BA 3LF1A 3WB1A 1C9YA 5CBPB 2FI1A 1PCXA 1Z62A 1F6BA 1U7XA 4DABA 2B6NA 4IAOA 5CFLA 1KDVA 5DBOA 3WLSA 4XW2A 1LXCA 1DWPA 1UJNA 3LH5A 4WESA 1X1EA 2VG8A 3G2LA 1G6GA 1S7CA 3NYIA 3OX4A 3VVLA 3ZJUA 4BDTA 1J8FA 3BB3A 4BZZA 1IY2A 4I8DA 3KPYA 4GE0A 2ZWIA 1M1NB 4TTQA 1HDGO 2CDBA 2FPSA 3UEOA 3V3KA 5EQJB 5K09A 4HUQA 1TVMA 3SK0A 4R2IA 5FWYA 4MRNA 3GLSA 2CKMA 1TLTA 3HFGA 3GMSA 5CVUA 2G4LA 3T7SA 1OIVA 3UXYA 3WYCA 4YRFA 3LYAA 3VRHA 3LP6A 4HYQA 4C9BA 1C3OB 3KKMA 1INLA 4U8HA 3AZOA 4GOXA 2C2ZA 2JFVA 3GBSA 1BCRB 1SCAA 4FKMA 3KX2A 4C07A 2OC9A 1GY8A 4TZTA 5EXTA 3MBOA 3OPYI 4DMLA 1MUUA 2ERCA 1SD5A 1MOQA 2JARA 4BAZA 3WIBA 4GOMD 4UNQA 4TRMA 4MEAA 4MCHA 3HRHA 3HL4A 3WL4A 4HNAB 2VNSA 3CEPB 3Q7EA 4BFVA 2IW3A 2JFQA 2OT3B 5GVSA 1BMQA 3BJZA 4Q6WA 2J09A 3S1LA 1GCAA 5A0VA 5EE3A 2EJVA 3S1AB 1HWYA 1MXFA 1Q0PA 4N3CA 2HNKA 1KYZA 1QV9A 2VT7A 1E4EA 4B4WA 2WC1A 4C30A 2X8AA 3LWDA 3DEAA 4E32A 2PFKA 1YCHA 1JR3D 4ZZ0A 5K0SA 1LU9A 2V7WA 1KZ7B 2O5VA 3FM8A 1RI2A 1X13A 2G40A 3AETA 3ESAA 2NAFA 4WCFB 4PGMA 4CUJA 2GBFA 3SEQA 3ZS8A 2CLOB 2HZ7A 2YZ2A 4NZ9A 1JI0A 4QSMA 3RYHA 3ZE7A 4E5SA 4E2XA 5JMTA 4HFNA 1UINA 3M6UA 4M1WA 3TQSA 4YAOA 1V41E 3PUIA 4PF1A 4WI1A 4UAGA 2YZMA 4I9GA 4M38A 4OJMX 2HXGA 1DC4A 4DCOA 5BMOA 5LZ2A 3CU5A 1CJSA 5ADUS 2QEQA 2UZ3A 3DVLA 3UAZA 3L7BA 1B23P 2R7NA 4GG1A 3UWKA 4MVJI 4I8XA 1YE5A 2XUGA 3H6GA 5D00A 4LY6A 3T1OA 1Q91A 2H4FA 2WHPB 3FYTA 3GEGA 3BF8A 4RXTA 3V42A 2XQKA 4O4LA 4CYMA 5BUCA 1K98A 3OT1B 4NR0A 1Z6TA 1FNCA 1DARA 4NZPA 1IVYA 4YDQA 3TVDA 4AF8A 5CAEA 3WDLA 3S28A 3K15A 1OCEA 1JAYA 1RQNA 2ZCUA 1OGJA 4AYTA 4WJLA 4QM7A 1M0TA 1D9ZA 3T61A 3ZGXA 1ZLXA 4QOHA 1JLRA 4O2AF 4A4DA 3DMPA 3DBLB 2WYUA 1E7SA 3FUCA 1NASA 3CZCA 4P9NA 4PXSA 5IXYA 3VDQA 4UOZA 5B2EA 1GZSA 2YVLA 3DD1A 2IXAA 5I8PA 1WD5A 3ONVA 3E23A 3NHAA 4B3TB 1EHYA 4DCNA 1J8YF 1SZDA 4Z9FA 4DLYA 3REFA 5K3OA 3WGIA 5AUNB 4FFSA 5F3DA 4XJTA 2UVPA 3LY7A 3OY2A 5JSYA 2FR0A 2BEWB 2OV2A 3NM4A 4TUYB 3ZW7A 5KOJB 2VYVA 3WHIA 3GEPA 4E1VA 5HUJA 2G09A 2QXYA 4E88A 3PEWA 5GOTA 1HYBA 4LJRA 4HQ0A 1QGDA 3COPA 3EK2A 3WHPA 4URZR 3UOGA 1ORTA 1FYEA 3BDAA 3K4PA 4G5QA 2HQOA 3EW9A 4GBJA 1VRCA 2A0KA 4BV9A 4XRGA 1QRUA 2FW9A 1MXHA 1R2QA 1ECJA 1ENOA 1T6YA 5FBKA 1XYYA 4JXKA 4TLAA 5ARDA 2J7KA 1LI5A 1GHTA 4NCNA 3THWB 4GZMA 4Y2HA 3K0EA 5CA1F 2PAAA 3OOWA 4OHZA 3DE5X 2PU7A 3JVDA 2FEXA 1NP7A 4JYPA 4QICA 2WMNB 2WSLA 1DIOB 4RPGA 4COOA 3T34A 4OJNA 4DIKA 5HKLA 4XWKA 4IX1A 2GEVA 2PKYX 3EGIA 3KEQA 5F98A 4G0PA 4MVJG 3WK4A 1ZN7A 1O95A 5JEMA 3EQ6A 4P3PA 4QARA 2BR5A 2JLRA 4CFSA 3MQFA 1Y9DA 3RHFA 3QOXA 4GL2A 3R5SA 5CDHA 5EIEA 1JHXA 2OM6A 4QGFA 1E8MA 1Z34A 3GX1A 4E5VA 2CNOA 3K8QA 2JAPA 2VS1A 2ZUVA 4UW9A 1T34A 5K51A 1M2HA 2HHLA 3ORFA 4W7SA 3W1VA 1GRCA 4K3VA 4QM6A 2VJLA 1COWA 3I9MA 5AJTA 5ECDA 2VPXA 1U63A 1K3TA 2DP4E 1YJ5C 3G7UA 2ZSIA 2FN7A 4OJQA 1H4VB 3A8TA 5A4JA 3N76A 4KQ1A 3NWBA 3LX5A 4RE6A 1DSSG 1OV6A 2IZ7A 2MR6A 4HD8A 2D74A 5HWSA 4ESHA 4JK3A 4NAHA 1M8FA 2WNSA 2X4IA 2WQZA 4N9WA 5M04A 4KJXA 1TW3A 4OQZA 1I6KA 3RKUA 4EPTA 1DT5A 1K6EA 1QFYA 4RLHA 4X54A 4PGGA 3ZZMA 5JANA 1NVMB 4OB6A 4KL8S 4GYYA 2V6JA 1XHEA 5AKJA 3RG8A 2ZXEA 3PXEA 1SU8A 3H6KA 2I4OA 2FLVA 3AV3A 3G7SA 2JJ2A 3ZU4A 2GVNA 4Y2GA 2DETA 3R44A 4L6IA 2NO6A 4LYFA 2IS1A 1V43A 3WO1A 1KORA 3E5NA 2OAQ1 4C0BA 5B5SA 2UXDB 4LRXA 5H02A 4NMWA 2J3KA 3NHBA 3P97A 2VJMB 3R0IA 4EJSA 3EXFB 1NKTA 3LX6A 5HCNA 2QDKA 2LCQA 4QKQA 3ZGZA 1NW6A 1NFRA 4CMEC 2HGSA 4K7JA 4V0NA 4DNPA 2N3ZA 1HYHA 1WZUA 3K2BA 3NWPA 2AYZA 4LOIA 2OBMA 3H3JA 3H5NA 4XASA 2J9YB 5KNDA 1C29B 4Y6OA 1TK2A 2PJRA 3SQLA 1NT2A 2FGKA 2IUEA 3FF4A 4GBGA 1SPXA 5MGNA 3LO5A 2PT7A 5D3QA 1UXGA 2H92A 4GMFA 3F7MA 3UJPA 1J00A 3FMFA 3IMGA 3D3KA 3GRRA 4TKUA 1W36B 2VDNB 1D2CA 5TQ0A 4BEJA 4OYHA 2Q2NA 5F35A 2JBWA 3DW1X 3ZDFA 4ALMA 4C0HA 1ZOSA 1O58A 3PPXA 5FPQA 4FW8A 1F2TA 3DEIA 3UXMA 3QWBA 3OBIA 3NIFB 3KR9A 4I50F 4Z7OB 3CLHA 6REQA 2B35A 2XTJA 4Q4JB 3UT6A 3HYLA 4GNRA 5EKXA 1DX6A 1Y5LA 4F4FA 4D92A 5AW5A 2V3CC 4L5YA 4OY3A 3ZOKA 2Q2WA 1GRQA 3I5MA 1GCIA 4UBKA 1BDHA 1RI3A 1U5BB 1V47A 2XUZA 2IYUA 1JEQB 2EKBA 2B1JA 2D5CA 3A4TA 2ZR8A 3NKVA 1Y8QB 5J9FA 2AW3A 3PU6A 5JEJA 5GPBA 3VR5H 3WWOA 2C2WA 4CETA 2PIAA 1TXGA 1F0NA 4KPUA 1P2VA 4NULA 4WE3A 2FZWA 3O31A 2W8BA 3W1EA 4KXQA 1PKXA 1OPRA 3DM5A 2C2GA 4J1TC 1QYDA 1P9LA 4S1TA 2FGJA 3PDJA 2NO9A 1L5VA 5T4FA 5ICEA 1DRKA 3FKQA 1A2BA 1MJ5A 1JJAA 5CIYA 3CF4A 3O82A 1DBSA 2WYWA 1EINA 3BCUA 1G4UR 3D2AA 1SIBE 5DXJA 3UQZA 4B3HA 3PX7A 1YH3A 1PJ8A 1UBUS 1QVZA 2YW2A 3ZWCA 4KCGA 4QUDA 2QKYA 1GT91 4DIUA 4BBZA 3CH4B 5B1YA 1WEKA 1YVUA 4HDKB 5EKUA 1JR3E 1ZDMA 1S2LA 1S2NA 4GX5A 5A62A 4ND1A 2AXEA 2WAAA 2HK7A 3CC8A 2NU6A 4DGQA 1WHTB 5EE5B 1E5TA 2PKQO 2WEKA 1EVQA 4UU7A 4G0ZA 5ER9A 2CV2A 1M8GA 2QJOA 2JQIA 1NU6A 4BO5A 2GEUA 1LF5A 3NNDA 2WZDA 1K3UB 2B98A 2ZIFA 4YT8A 5AK5A 5IN4A 1HG0A 4HSEA 3DB2A 4D44A 1B8NA 3IBTA 2K7FA 3ENZA 3QUAA 2ES4A 4C4AA 1KY2A 3KT0A 2YH2A 4ZZIA 4LF9B 3BGIA 3IBCA 4Y67A 4R0VA 5EP1A 3O4GA 3CF2A 5FUMA 1H8HD 1PUIA 1WXHA 4BQQA 2V7UA 1QLWA 4NFLA 2C9CA 2PXHA 2XT9A 1B0PA 2PCLA 1BS2A 3D43A 5JAMA 4R81A 2AR7A 3M6FA 4KQ2A 1CR6A 2D2VA 2ORYA 1VYTA 2GUWA 4R7TA 2A0TA 2FW1A 1P45A 2GASA 3GH1A 3NBKA 4HQOA 4MCJA 4WVFA 2ZRFA 3TLEA 1GAWA 1RZVA 3WJ1A 1JZSA 1NE2A 2O3UA 4MKRA 1KDRA 2GMWA 3KR2A 4FNAA 5AXBA 5C8YA 4CLDA 4D43A 1WRBA 5LWQA 2QMHA 1NVDA 4L7QA 4EATA 4NMLA 3PUZA 2C99A 1WW8A 2P3OA 1XTKA 3HB0A 3WP1B 1ZG3A 4A0HA 4TWJA 2F1KA 1EK2A 1UOOA 3HLKA 3B3FA 3LQRA 4YC7A 4F84A 4LNAA 1H0KA 1Y9JA 2KJQA 3E8XA 4GLJA 4C7JA 3T1NA 4I1IA 3O8OA 2PO5A 2UKDA 3MUOA 4BZPA 4ZEVA 4LCEA 5EEGA 4TLDA 4CEJB 4GNKA 3MTAA 5A06A 3RHSA 4RHCA 5FOUA 1V4NA 1U1IA 1EQ2A 1T5HX 1PZFA 1JE1A 4D9IA 2J1LA 5IBRA 1U0EA 3KLBA 4M37A 3OFND 2YC4C 3DO6A 2HK9A 4KVFA 5ADHA 4DV3B 3H7IA 2EHDA 4NXNB 2OILA 3REQA 4IRUB 4LGVA 1YT5A 3HBJA 2YV4A 1ITZA 3LHFA 4D9EA 3B20A 4Q15A 2GOYA 3U7EB 1FU8A 4RYLA 1UUFA 2G9NA 1DEKA 1HX7A 3ZEIA 3TRIA 2GT1A 2VQ3A 1NRWA 5F2EA 2IY9A 4L0DA 2AG1A 2QLBA 3L04A 4NBSA 5UKDA 5FEUA 1Z38A 3L6BA 4BJ3A 2UYOA 2VFAA 1RI1A 1E3JA 4B6OA 3PC8A 1SA0B 1V1JA 4J03A 3AXTA 1CSEE 1BRMA 2FMKA 2FNAA 3RTCA 1C30A 1TK3A 1KDOA 1U8AA 4DUYB 2J5QA 2I3GA 3RVSA 2AVNA 4A0QA 1NVUQ 1ONSA 1K8XB 3JV7A 4CG1A 3I4CA 1NC3A 4P92A 3V2UA 5LMNB 1EXDA 1O57A 4YMUA 2O2YA 1YCFA 1ZIPA 4LMPA 2QBYA 3BQ9A 4OP2A 1ND6A 3F90A 4JQYA 2C3MA 2FF4A 3QU4A 1LCIA 3BMQB 4N7RA 2CEAA 1JFSA 4ZRNA 3JR7A 2JAQA 4C0JA 2PSSA 4G4SO 3W7VA 4U6QA 4OGKA 5AH0A 5LIPA 4WKCA 4F92B 3B60A 2PQMA 1KYVA 3DV2A 1LX7A 4PGAA 3W2TA 1HEIA 1JLLB 1QO9A 2H1RA 4UEJA 1Y6RA 2X9QA 4CMIA 1LI4A 1WKBA 1GTG1 5EUQB 1SOWA 4LRTB 3ZHQA 1KERA 3K31A 2ZT5A 4LTMA 3TXAA 2GLTA 1BHO1 1I2CA 3ILVA 1AMUA 1YK0A 1T3TA 2VUUA 1Z7BA 4GOND 3A9RA 1Z6ZA 4C7KA 4DQDA 3DMDA 2CNKA 4AZWA 3TOXA 5DV9A 4Z99A 3HVRA 3FVVA 1KVTA 4O4HF 3PHIA 4AJ2A 3NRCA 1LLUA 4K9QA 1BSVA 5FNVA 2ZU0C 1AUXA 1AE1A 1H2WA 1ECGA 5JROA 4H6PA 5HIIA 1X9HA 5HIAA 2C92A 5BMVF 1GITA 4A0RA 5SYMA 2I7CA 2QUZA 4QWMA 6CHYA 2V4MA 1FTSA 2OPBA 5J47A 5GJWC 5JSKA 2NP6A 1IN5A 4IDFA 4ZAVA 3H1FA 4ITRC 4F6LA 4DADA 4TKVB 4X45A 4DANA 1YE8A 1DG3A 1LKZA 3HCOA 4NPHA 4AZTA 4H3KB 4Y0NA 5JI2E 2W4MA 3BXZA 3MTIA 3PXCX 3N53A 3RK1A 1FTWA 5G2OA 5JZ9A 2OUKA 3TCXB 3BXGA 4LPSA 2PX3A 4BIMA 3L8MA 3JZMA 3UJ7A 5DOZA 4UU8A 5BYAA 3IE2A 2FAXA 3KJZA 1U3FA 4Q4CA 2RB4A 3ZCVA 1S1MA 4UC0A 2AC7A 4YO7A 2ADFA 4OHVA 4RV4A 3A6JA 3TZQA 5T8KC 4F6RB 3R23A 3PDIB 4XB1A 3R7AA 1D5CA 2Y2VA 2J3MA 1E9EA 3OG9A 3R5FA 1TAQA 5FHQA 4LOJA 1YZYA 4M1EA 5HG0A 4EY7A 5J63A 1GVHA 1BXGA 3VOSA 4EFKA 2DC1A 3DOFA 1TUGA 2QTWB 3PSHA 1XD8A 2VEOA 4G23A 2P7HA 1O9HA 2WUFA 3DL0A 3JRNA 4FQ7A 1G8YA 1MRNA 3JQ7A 3KQSA 1OLUA 1WUIS 2F67A 3B85A 3MWJA 4X5OA 3HK2A 2ZRNA 2H2GA 2EGUA 3QLVA 1G7TA 1DEOA 1EEHA 3T3PB 4BJ1A 3DXXA 5EKSA 1C1DB 5BWOA 1I5OA 3STTA 5KYGA 1QQTA 3KSZO 4Y6PA 4CR6A 4AZ3A 3EVAA 1Z18A 4MVXA 4M0KA 4RIGA 1JR2A 1T2FA 1Y98A 1R50A 4O1HA 4J90A 5IAJA 2IYNA 1TZJA 3CGWA 1VLJA 4OKNA 2IWHA 4U2KA 1NVVQ 1S8NA 2C7OA 2FPIA 3DTVA 4KO4S 3DS8A 3JRWA 1V1RA 3AY0A 1BWRA 3DWEX 3SZRA 3U7FB 2CFOA 1KEVA 4ARZA 1NRJB 1TAGA 3LGAA 2QL9A 1A9PA 3MRSA 3N58A 3TX2A 1ZD9A 1ADCA 1DPGA 4UHCA 3TBKA 4V38A 3X1MA 4KITB 1ENZA 5KNBH 1MT3A 3GJZA 5CFPA 1E4VA 1N5OX 3N8GA 3LC2O 1I6LA 4NRDA 2I2XB 1Q0QA 3DDZX 1T35A 3KXIA 3F9RA 4Z49A 4NBVA 5K8UA 1CJBA 5BNTA 5A3RA 3M70A 2P4EA 4M1KA 1UBJS 1KTIA 2J5RA 3CCCA 3GFRA 4BVHA 3ADKA 5CYFA 4DCCA 3NGXA 2H2HA 2CDAA 4Q3DA 5KREA 1AKEA 5E9WA 3UJ3X 4WT7A 5ISMA 4RIEA 2XYQA 1HL3A 2BEVA 5GONF 4RK0A 1Z22A 1U1DA 4FWBA 1YE3A 4Z53A 2DHCA 3ZOZA 3WDKA 3BHMA 1NNEA 4RFLA 3S8MA 4CFZA 1L4HA 3DL2A 1OI3A 3PLRA 4PZAA 4WL0A 5CH5A 5CU7A 2NADA 1D7AA 1P8AA 1SOVA 3MJDA 4PC7A 4ZRDA 5HE9A 4DQUA 1Z3IX 2C4UA 2ADOA 2OVBA 5HSGA 5DJOA 2P78A 4H7JA 4JP2A 1R5JA 1T2UA 3UAOA 4CV1A 5EIAA 4KAXA 2JD2A 3IUYA 4LDPA 3SQOA 1RC0A 2QZPA 3MHPA 1R0RE 4ARIA 2G83A 1T2DA 4NFHA 3LP8A 3AERA 4NYIR 4RTMA 2P9HA 4F8JA 1LRKA 5LP6F 4QHYA 1JMVA 4RMJA 2YV2A 3ZIAA 2PMWB 3LS2A 1HT0A 3T94A 1H22A 2C77A 5I9NA 3DE6X 4GPAA 1WMEA 2IPXA 5DGTA 4GX2A 4BO4A 4Z9AA 1IN8A 3JQ6A 4XZ3A 3QK7A 5FBVB 2OFXA 1EFVB 4G07A 4MLPA 4MWGA 3WLJA 4E2WA 5KYNA 1MX5A 4J76A 2EFDB 5CDFE 2E4ZA 4P5PA 2WICA 4TWAA 3C43A 3EXHC 4B35A 3G2JA 3JQFA 5B2FA 5I7FA 3KVOA 2CV0A 3ZDAA 3T4EA 2Q9CA 4L3OA 2AX3A 3OHPA 4NS1A 1H69A 1VPVA 3ROGA 3T7CA 2AFIB 1GADO 1RNLA 2GXSA 4IP0A 1AXEA 1NVKA 5K3BA 3RBXA 3UJCA 5I3CA 1N1GA 2WUGA 2H17A 5BXQC 3LCJA 1J0BA 1JLKA 4DLXA 5K0BA 1TC1A 5JQGF 4V0RA 1XJCA 2DHRA 4P84A 4Q9LA 4Z4GA 1O0SA 4FDAA 4E03A 2HX1A 3H8JA 2XRMA 4WZAA 3DBVO 4XYBA 4YT2A 4UKDA 1OLSB 2J3LA 1BW9A 2A5FA 3V2IA 4CT4B 4DC1A 4GI1A 3KFVA 4E94A 4C5BA 5B57C 4ZDIA 2SCUA 2P3QA 3QA3E 4C01A 3IOCA 4DLNA 4E5NA 5BN3A 3DMRA 2P8SA 4BC0A 4MUHA 4GOKA 1HE1C 2QAGC 4EGAA 4DJFC 3DV0B 2C5HA 2VXBA 3GRYA 2P2SA 1G5TA 1PS0A 4JLUA 3ZJ5A 3RUAA 1P5JA 2MSNA 4WKBA 1JWBB 2ZI9A 5JCXA 4HWKA 1YR9A 3FLEA 2VP6A 1CYDA 5HRUA 2ZJ8A 1T8PA 2E2WA 2R4TA 3A6GA 3BTOA 2I2DA 3LGXA 3TDNA 5DTEA 3WBJA 1UM8A 5GZ1A 3W5SA 4RVFA 4O4JF 4G1BA 1Y7PA 3FOBA 1WR8A 3T3MB 1Y6FA 2ALJA 3DH0A 3NJRA 1ZJ6A 2YDYA 3DW3X 3L1VA 3IAFA 3Q3EA 5DI3B 3RFXA 5FL7D 4C14A 3WS7A 4DKXA 4YV0A 5JDCA 3H5RA 3VOTA 5IABA 5EG5A 1R37A 3HB1A 4XYMA 3RSZA 1DV1A 1TVKB 1SKYB 2BCJQ 4LG1A 1EHCA 2PYZA 3B5EA 3BFJA 4MGEA 3IJRA 2J5BA 3P26A 3O3NB 4BZXA 1OI7A 1WULS 2H0QA 3A1FA 4M6WB 5C1OA 4B3SB 4MQEA 1D8TA 2B0CA 3BJMA 4NP6A 4D80A 5LN1A 2HFKA 1GXCA 1Q2UA 5JS7A 1GXSA 1AY0A 3AIKA 1RT9A 3HDJA 3HJUA 3LVFO 1GZ3A 4YLEA 4R7GA 3S7ZA 1QH9A 1FFXA 3SY8A 1Z5VA 2X6TA 1NLUA 3CNNA 2FSVA 5H70A 1XQYA 4CEIA 2FPKA 4DPMA 1XA0A 4EJFA 4LC0A 3NV7A 4ZOAA 4M8NE 4DDTA 2CMFA 2I2FA 2JHPA 1DDGA 3E0XA 1CETA 1I3OA 3O03A 4MMYB 3U4QA 4XQ9A 4J9VA 2NX2A 5DK6A 3ZU6A 2IUTA 2NYUA 2XAUA 1HSOA 4M1QA 4PONA 4XIGS 1RI4A 3CUEF 3HN2A 3EGWA 4LYHA 4TTAA 4EAAA 1M72A 2FMIA 2P3SA 2Z08A 3G79A 4D8XA 1MJGM 3NV9A 4GZLA 4EF5A 2XGJA 3WK8A 1J20A 2IDJA 4LWZA 3STXA 3CZ9A 5BOSB 5E7MA 4ZZ1A 2JZOA 3GLFE 1OVMA 3HZHA 4HG2A 1COZA 2DLCX 2DBYA 5CDUA 1CR0A 2FRVA 1CQWA 4K8OA 4MLZA 3KQLA 2IYQA 4O8CA 4CODB 4GLOA 1KAOA 2FW7A 4NU6A 1F2VA 5DYGA 3C85A 2QOEA 1L4BA 3D8NA 3KK0A 3CR3C 2VJYA 4ND8B 2QUBA 1N6NA 2DFTA 2WJHA 3VJMA 4FFNA 5CHYA 1NDQA 2QRHA 4NNPA 2GCOB 4K5QA 4PNEA 1X1BA 3T7EA 1UCFA 1YRHA 3D7MA 2C59A 1WHSA 2WMOB 2CLIB 3DB1A 1TCAA 1J6UA 3MTQA 4B81A 4GP9A 2XGMA 3JS5A 4E15A 2V7QD 2WJJA 2ZBEA 1YR7A 2EWWA 4OTZA 4H7HA 3ZVLA 3V46A 2P69A 1TE2A 4O4IA 2YYZA 4CTOA 1KI6A 1CVRA 5KS2A 4JBYA 1R4AA 2BF7A 3B48A 1AUQA 4ZYLA 1L5ZA 1ZINA 1OXMA 3A6PC 1Z08A 4MQMA 1D4FA 3ZZ0A 3I6YA 3J7AC 1HI9A 1XZFA 1NPYA 3FNHA 1MMFB 1FYWA 1KJQA 1M2OA 2PVSA 3C4JA 2CHQA 2UZ1B 3IKJA 4H77A 4IL5A 4MI9A 3LT1A 4X1IB 2LIVA 2X77A 4O2BF 4PVDA 1J1UA 4HATA 3RIXA 3GLRA 3DTYA 3LOQA 1KYXA 2XNSA 3E03A 3JY6A 1NZFA 1JKJB 1O6GA 4GGPA 2AH5A 4TTSA 5COAA 4ZXFA 2V74B 3AYXB 3I73A 3ZUGA 1L2TA 5C32A 2PSHA 1CZUA 3AHCA 2ASVA 1Z47A 1K6XA 2WB4A 2QG9A 3ANMA 3O8BA 3BT7A 2GN4A 3USES 4J2HA 1Z5ZA 1DX4A 3PC4A 1T9AA 4JIGA 5I8WA 1TQDA 4HFRA 3TJRA 4BZQA 5AP9A 2XRYA 3SFVA 2AOWA 3IVRA 1SWWA 3D0OA 2E4YA 1G6KA 3IHWA 2P4QA 4OHUA 3TOVA 1A5TA 1YQDA 1TUBA 3FCOA 5LBIA 1YBAA 3RDPA 3H16A 2WM9B 2GPJA 3THSA 3QEAZ 3EG9B 1Y63A 4OM7A 4IUYA 2A5LA 2AZ4A 2D2EA 4YFVA 3ULKA 2QLMA 3LQ1A 4DVJA 1UZLA 4QO8A 3TSYA 2WE8A 5E3IA 1MKYA 5KNLA 2VSYA 4YCBA 1GA6A 4MDYA 4B0PA 3R9WA 3L02A 4I3HA 3NYRA 1M34B 4DQKA 1QYVA 3HCBA 4HZUB 3L0SA 3OPXA 3PQ5A 2Y1GA 1J1IA 2ABWA 3D1LA 3OJLA 1RJ9B 4FYXA 5E1DA 1QHIA 1N9GA 2ON6A 3ZDRA 1YONA 1OU4A 4XIIA 5IVHA 5F1PA 2H2AA 1HFEL 4H60A 5JY1A 3AP2A 3ELVA 4F8YA 3CVUA 2G9RA 1GQYA 3PDCA 2VNIA 4FILA 1W4BA 3HY6A 2JH3A 3PT5A 3M5WA 3FBTA 1FBNA 1E7YA 1SUEA 2ATXA 3L40A 4FJ2A 3I8XA 4BY9E 2G5GX 5EQTA 4LJYA 4PFJA 5IC6A 4RC9A 5F7ZA 3QVSA 5IARA 3LXMA 3ZVRA 1V16A 1T15A 2YFHA 3KTFA 4TXLA 1KF0A 4B3XA 4GKBA 1KEWA 3TIVA 2PO7A 3SHWA 1Z4NA 2CKDA 1TZKA 1I32A 2DHEA 4L0CA 1OWPA 3V7UA 3H18A 4K26A 1E2DA 1PP4A 2WV9A 3GLHE 3KR1A 1IB6A 4R9SA 1P91A 3KZCA 1NFFA 4C05A 4RMIA 2R5NA 4CR8A 1NATA 4ZCQA 5JH7B 4QIHA 1E9VA 3M83A 3U56A 1Y8RB 2QAGB 2ZCJA 4FFDA 3Q5GA 2I6TA 2J5KA 2V7XA 3E9EA 4TXJA 2RSLA 1C4OA 3WL3A 3RJ9A 1ARZA 3PL1A 1ZVVA 4R2XA 4WJZA 2RJNA 2WKQA 3HADA 2HBZA 2H48A 2C4HA 2L17A 1TFUA 2BRUA 2PX8A 2QVXX 1E9BA 3LDAA 2ET6A 2YS6A 3A9VA 3CUUA 3FUWA 4ESEA 4URFA 1PR0A 1ZZGA 3FVTA 1E2HA 2FPGA 3OECA 4S2EA 1Q0TA 3VZBA 2PWAA 4JQSA 1MENA 3FYUC 4MKZA 2ZUTA 1JHYA 1TCVA 2OGWA 2G8NA 4PO1A 1C1XB 2CDRA 1CG6A 1Y34E 2HJ9A 7YASA 5JNTA 3NUZA 2HEGA 2BMDA 5IDWA 4P08A 4P3KA 4DG9A 3U3ZA 4FMCB 1B2LA 4X20A 2PWBA 3ILYA 1JSLA 1RHKA 2QMEA 5IJ0B 3DMHA 3HHPA 3UA3A 5HJ7A 1GGKA 5AKKA 5IM4A 1FS5A 1DADA 1I2AA 1N6OA 2LGJA 5AKIA 5BWNA 1LB1B 3ICCA 3QENA 2QL7A 1L8LA 3P0RA 1SOUA 4UE3S 5CJ2A 1U94A 4L4RA 3SKYA 5K0CA 5T7BA 2ZJYA 4Z3OA 3THYB 2NP7A 2FK7A 4ZP1A 4YRAA 5AFSA 1L4LA 4CKEA 2AJTA 4DMKA 4RQAA 1QFZA 5F3WB 4BQIA 4K8RB 3RV3A 2Z2XA 1UXIA 4OLAA 1LFAA 1SBNE 3ETGA 3PWKA 1NDHA 5FOWA 5A7HA 1S3GA 1BEEA 2VTVA 3LK6A 3B36A 1EJ0A 3IUQA 3VPAA 4K9OA 2MOKA 1S2GA 3E1SA 1APBA 1CZOA 1VG8A 3A27A 3VMMA 3TR6A 4QX6A 5KQLA 1KZ4A 2JKYA 3AP1A 4C4XA 3SMVA 2GJAA 1QS0A 1I6WA 1QMGA 3SZGA 1ETUA 4NBKA 2HRBA 5G0UA 1RRVA 3NI2A 3Q88A 4HX2A 1QWOA 2IHVA 2JCXA 5EJ6A 4IJVA 5KWJA 4P81A 3VV2A 3DE1X 4OLBA 4TXNA 4IXMA 3UC9A 4ZVOA 2JLXA 5A4AA 5AM0A 4K1LA 2Z2JA 2FUKA 4QDUA 1L7NA 1A4UA 4NQZA 4ZIRB 4ZTZB 4PANA 1QTNA 3AK4A 4EVQA 5ALMA 3WK9A 1X19A 3GRPA 3SHVA 1CQIA 3P0IA 1A7KA 1BKDR 2JGNA 3AU9A 3GEBA 3VR4H 3ZJ4A 1NY5A 4JI8B 1N34B 5GGXA 3PXDA 4IM7A 3UWPA 3A4IA 3DZJA 4U9UA 4L51A 4L5BA 3GEEA 1DC6A 1JG7A 3C24A 4INPA 4DDKA 5JISA 1VE9A 2C9OA 2B83A 3F0TA 4KI7A 3OC0A 2LXNA 2GTPA 4BU1A 2VBGA 5M3BA 3F4LA 5KX5F 1AKVA 1MFPA 2QE6A 4QELA 4WX2B 5CJPA 5EMLA 1YA4A 1BXRA 5IBQA 3I9OA 3LHKA 3LQKA 3WWYA 1AGYA 4NZZA 1S1CA 5IUJC 2RFLA 3OIFA 3UNXA 1GAQA 2F90A 5MN6A 4UXHA 1E3TA 1ZK2A 3U7JA 5IWCA 2ZDQA 1F5NA 4RV9A 4B3FX 4LNUB 2WZBA 3FTEA 4E5UA 2ICAA 3E27A 2YFYA 3V2GA 3BB4A 2QVGA 4DJ5X 1UDRA 3MWEB 2BFCB 5BV2P 3FRJA 3TSZA 2GD1O 5FL3A 2QQ5A 4PQGA 2OCYC 1VJRA 5JJCA 2XX3A 3STVA 1SR8A 1M2GA 1LQ2A 3BHNA 2H16A 4MWBA 1W35A 5I9MA 4OAPA 4OX9B 4XDGA 3ZUPA 1Z45A 1XD9A 2C96A 1Z28A 3C1UA 3CEHA 4HQRA 1P1HA 2BLLA 2VDPB 4I1YA 5L51A 3SHOA 2YIVX 4QYXA 4C6RA 2AJDA 1SH7A 1UXOA 1JF8A 3BL8A 3HP1A 4V0KA 3I04M 4QLBA 2ZTVA 4MROA 3DMTC 3NFYA 4HDMB 2OMKA 2KB3A 1XL0A 1KMHB 1V11A 4TROA 2FG7C 3UZUA 5JS6A 4BNFA 3EPHA 2ACKA 4RVOA 1AT1A 4AX4A 1QJCA 2BFAA 1V25A 3T3NA 1N3BA 2IZ6A 1WLNA 1I4EB 1KZGB 4M8LA 1AKMA 3H0KA 1OJ7A 2I67A 4RA9B 2NZUG 3SQWA 4N76A 4TVKA 3I0ZA 1SU4A 2P6RA 3IERA 3MWKA 3UWSA 3VDXA 3D7KA 1HDXA 3NHZA 1DJPA 3FGNA 3O73A 4ZO7A 4F5WA 5CXUA 4KUHA 4E07A 2AYYA 3ODPA 1ADYA 3R24A 4E5KA 5C1DA 1DMSA 2FQWA 2YJGA 3DPIA 4TSKA 1BOOA 1DU4A 3OQHA 4EHIA 5KTYA 3Q3JB 5JYDA 2P7IA 2POCA 2G1PA 3KL4A 3PBKA 3IVMA 3PFIA 1FEZA 2W90A 4XEHA 2YVUA 4RMHA 5CJJA 4FDMA 3H1EA 2BGJA 3DOHA 4FYWA 3EWIA 1KMMA 4YCJA 1J2JA 4LX0A 5IF9A 5EA2A 1CE8A 1TEXA 2FK8A 2IIQA 2XOEA 3EFBA 3FPLA 3L06A 3MJHA 4TMVA 5CCDA 2WT4A 1H6DA 3KE8A 3LFHA 1I51A 1XFDA 4ZREA 4MJLA 4INAA 5AVXA 1KQGA 3EC2A 1CIPA 3OICA 4HYYA 2WYVA 1W36C 3BM5A 1NHWA 1TYDE 2J9ZB 2VNAA 4GUAA 4LBVA 4O59O 5CX4A 4O3MA 2YTZA 3NR2A 1V3UA 1LZLA 2YIJA 3P52A 5CVCA 3V32A 5IF3A 3OSUA 4JFAA 1P7WA 2IVFA 2VSQA 2ZIGA 3BTVA 5HJ5A 4IWNA 4BGEA 4CEHB 3M5DA 3ZE2B 3O83A 4I9NA 1O5IA 1DEXA 5EJAA 5EZ5A 1JNXX 3ANNA 2XD4A 1YMVA 2QN3A 1PHRA 2X5JO 5E4YA 1P6QA 1A9SA 4MV7A 2YHUA 4B7UA 2VHEA 1YJQA 5IUKC 4FDUA 1JBEA 2AN3A 4K9MA 1DFGA 4KXNA 2OZVA 3JSXA 5JS1A 1H1LA 1I14A 3R0XA 4CKXA 1JSRA 1T1JA 2FWBA 3IQDB 4TV8F 5BSRA 1BU8A 1RLOA 1WPRA 2XKJE 4PO3X 4RTLA 1J9ZA 3ZGYA 2AJ8A 3RSSA 1IUPA 2Q62A 2YNMA 4HNTA 3GUYA 3G8AA 3VR3D 1U7HA 3GRVA 4MPRA 1U9YA 3A31A 2IU3A 2XKBA 1NIPA 5KYVA 3D8RA 1ISRA 3FYUB 3RVOA 2V0GA 2RAVA 3OIVA 1WSWA 1D1QA 1LDNA 1NE7A 2R65A 4GMGA 3G3EA 5J2TB 4OX9Y 3IAM1 3NIGB 3ZHOA 1M83A 1DKQA 3CZ4A 3VTAA 1D2GA 1QGED 2OCXA 2HJWA 3H87A 4J3JA 1R6UA 5E4FA 3IEUA 5TQ2A 2NU9B 2BGRA 4E7PA 1NXQA 4FUTA 4EA9A 1Y4ZA 4LAFA 3FCEA 3L8CA 4XR4A 1JKFA 5ERYA 3T3EA 1SXIA 4TYMA 1ZN2A 3KPWA 3QVLA 3X1ZA 1L7DA 1PS8A 4F72A 3AUKA 1GQSA 2I91A 3AKYA 2WRZA 3QLJA 4BO9A 1N2CA 5E7IA 1II0A 4ZU3A 2DECA 5HKAA 5GIOE 2NZYA 4B85A 3WYBA 5JSZB 5HMMA 2ZSBA 2CJWB 2QX9A 4ND3A 4MVJD 1RIFA 1K6JA 3S44A 1E61A 1OWLA 3OQMA 1SC1A 1C5KA 3D02A 1LD3A 1LS6A 4BEBA 2CLLB 4QU5A 4AIIA 4NESA 3DF7A 4CF7A 3AHFA 5CLIA 4H7PA 2HJGA 2ZYRA 4AD8A 3SBEA 2O8EB 2BH2A 2GJ9A 3NT4A 1LLCA 3TVTA 4Z1MA 4BQNA 3KG2A 4DA8A 1EFLA 3QELA 1QKKA 2ZJ0A 3U7QA 1TJ5A 5BN5A 1ZUIA 3NAMA 4UBOA 1BAPA 1N5DA 2EGHA 2IYZA 2RHCA 3OTGA 3PQCA 4LDAA 4HUJA 4NOJA 4CF6A 4NCAA 1ODSA 4H31A 2J41A 1L7MA 1RDFA 1A98A 1DX9A 4URHA 3NG1A 4LFCB 3WC4A 4EQ6A 3RTEA 4GPTA 4BMSA 2G0NA 5JQWA 1J4OA 1YQXA 3BSYA 2JJQA 1YR1A 4R0MA 1XDWA 3KAQA 3G2QA 3C3MA 4M0PA 2AXNA 3E70C 3UBTA 3W3ZB 3VKVA 2IQ5A 1QYXA 2VHUA 4O8ZA 2R1VA 1P81A 2HCBA 2WF8A 1BVUA 2EF1A 2FETA 3ZWBA 2GN0A 4CL8A 1R9NA 2Y0BA 4U2DA 4FQ8A 4TZKA 1THMA 1GUDA 2IP2A 1MB3A 3EXG2 1WIWA 3IMEA 4WN9B 1LA2A 1Y4UA 4XX0A 1XI2A 5CVVA 3MJSA 4JP1A 3COSA 5BT8A 1E32A 2QN2A 4DARA 1GPYA 1LF0A 3T4XA 5MFZA 1Z39A 1EFPB 3CUWA 4OBWA 5IYZF 2JI8A 3ELDA 4DJDC 2WFZA 3KEFA 3OP1A 4IJUA 1KR5A 1XD2B 2GPTA 1DUIA 2LVBA 4QPCA 4TS1A 3ZWVA 4ENVA 1G2QA 4HWSA 3QUSA 3ISVA 4Y1FA 1QVWA 2CLHB 2X5KO 4TLBA 4AKSA 4JB8A 2GNPA 5PGMA 4AJEA 3DAPA 3GPCA 4EABA 3A6EA 3M3DA 1L4FA 1WZCA 4BNDA 4ZTUB 4CHTA 4IF6A 4QQRA 5T64A 4YAEA 3PVCA 1RAIA 2EQ5A 1KO5A 1J56A 3BZUA 2ZVPX 3D9QX 3DQZA 3N5CA 3QVTA 4EY5A 2C7GA 3QUCA 2OK8A 2BMWA 2PKQP 1UKVY 2IZ0A 4YAUA 1I2BA 3MWLA 5CVDA 2VNHA 2P27A 1ADBA 5K4GA 2E0IA 3HWRA 2PNJA 2HN9A 3F8SA 1E89A 1T8SA 4YWHA 4KPEC 3AY3A 4P0QB 1ODLA 3DL4A 4N7JA 2QTMA 4ZOCA 3ASUA 1E62A 1WL8A 2DULA 1Y9ZA 2QG6A 3H9CA 3UFBA 3WMRA 1C8BA 3WLRA 1ODTC 3GA5A 3O6VA 5JZVA 1CUJA 2UUBB 1PTJC 2J30A 3HCNA 4MVYA 3MIZA 5DK4A 3PQ4A 3VYVA 3BTUA 5LMCA 4MCIA 1EM8B 3ET5A 4NJEB 4DXAA 3WYNA 3AV0B 4AECA 5CA0F 4UTPA 1P2TA 3VR6H 4KWTA 3N2KA 1JFVA 5EJ8A 3EW7A 2H2IA 3DHYA 4N41A 2I1VB 1EU1A 2FZLA 4AUMA 3PEYA 2REQA 4QEDA 5HK8A 4HZIA 5FAXA 3DC2A 4FEGA 1ACMA 2NXCA 4TQUS 4XA8A 2B9VA 4IOLA 1NSYA 2NNLD 5EHGA 4CGZA 1XNHA 2W00A 1PR5A 2Y0EA 3F4KA 3QGMA 3PQ8A 4JROA 4DR6B 1QQ5A 3MWDB 4GZ6A 4QWWA 3L1HA 3ORYA 4RJJA 5ENDA 2EBHX 1Z29A 3KT8A 3M0EA 4NS4A 4WN3A 1WPGA 4HNHA 4A0FA 4LYAA 3ZWMA 3Q3CA 1V7CA 2ZI7A 3IIMA 2C7RA 5EJGA 3LSYA 1VCMA 2R62A 5ALHA 4KV7A 1QHSA 1SIOA 1ISMA 1VBMA 1WAMA 2Q4BA 3AO0B 3EASA 3EZYA 3GRFA 1PZGA 3IOBA 4UMFA 3WL6A 4F2WA 3ETHA 3WTBA 2B20A 1NRXA 1G17A 2HD4A 2C3YA 3DUFA 3WXBA 4PCUA 1ORWA 2C58A 4DWJA 4LCJA 1UOPA 1V3QE 2F3RA 4ENQA 5J58A 2AW5A 5BV7A 3AW9A 3KB6A 1VPWA 1RYBA 2IBSA 2FJUA 3K8ZA 2HRZA 4RYDA 4DA6A 4EX6A 3E5RA 4BX8A 4V02A 4L2IB 5HGXA 4DEVA 1FTQA 5HRAA 1PSWA 4Z9BA 1EX7A 3A0UA 2XY4A 1OFHA 5LLTA 2GN1A 4UE6A 3M3PA 2ZBVA 4D3FA 1TAUA 3PP8A 4N3GA 3W6UA 1G3UA 3PQ6A 4ZQHA 4ZI5A 3MJTA 4D1YA 5JVDF 4J43A 3TAHA 4QPPA 3GMJA 2MDTA 4C21A 1XCPA 2C7BA 4RSRA 1CUZA 2WAYA 4NYMR 2DFPA 3A26A 4ZJZA 2TMKA 1DAHA 2J4FA 1FFCA 1YOVB 1ZX1A 3E2MA 3VOAA 2FN8A 3IAAA 5EJEA 2XQGA 3LLUA 1F17A 3MTBA 4F3TA 4QHTA 1U0RA 1K1EA 4MVJM 1G3RA 2P8JA 2P9QA 2TYSB 2UV8A 1BHJA 1DAIA 1PR4A 1EBFA 1GGEA 2X0JA 1VIAA 3EQ7A 3H9EO 4JLWA 4QVKA 3UJHA 3ZQKA 3U44B 1KL7A 3T95A 5CFQA 2K87A 1N6RA 4FYPA 5EJMA 2X6QA 2ILTA 5JTTA 2WPDA 3HNPA 1MNAA 1TQ6A 4FEAA 4G4SP 4ZYVA 1U8EA 3TBFA 1AZTA 3I72A 1PQWA 1RZ3A 2W8ZA 2ZULA 3PNLA 5K6AC 3K30A 2XTNA 3T7TA 1JDJA 2P9JA 4B6RA 2IDMA 3SWWA 4Z4CA 2B5VA 3WXMA 1ZC4A 1WOYA 1IUOA 1R4NB 1USWA 2BFBA 5C1IA 3LT4A 3W9SA 3I32A 5TGDA 1N5JA 2WWIA 3IA7A 3W79A 5CLLA 2IFTA 2WLTA 3E6AA 4JSTA 1XVUA 4BJHB 5BUZA 1LSUA 2PMFA 3L92A 3CBQA 1XJ0A 4W8GA 2VP5A 3IUJA 4MVJE 1XEXB 2DFNA 2PGLA 2PGNA 1C2TA 2OVFA 2XVXA 1UDXA 3HY4A 5LYYA 3IUSA 3QKRA 1YBHA 2YYSA 4Y7CA 4G0UA 4YT5A 3CG0A 3II6X 3NBUA 3QYAA 4YV2A 1CQXA 1CZLA 3CUSA 4WLVA 3EAQA 1AUOA 5AI5A 5K3DA 3COJA 1M6NA 4KR6A 4ZI7F 1L5KA 1A8SA 5B3AA 3IL2A 2ZANA 1LDMA 2HF8A 3JPYA 4EZBA 3B9BA 2NT4A 5B7NA 1UMBB 1LDBA 4PHGA 3DLBA 2WIDA 4EG7A 1C2YA 4AB1A 3CB2A 3OWOA 1NTRA 2ENUA 1Z7WA 5A1JA 1RLTA 3L6CA 3L8YA 1PEYA 1F4VA 1UZAA 1MABB 3C70A 3NU1A 4LQCA 2HR1A 1JPUA 3HM9A 1SAYA 3JAKA 4DLBA 2V6BA 1R15A 2R47A 4C89A 2CNWD 2ETVA 1XPJA 3RAFC 4NJMA 2QLLA 4QD3A 3ACDA 2QF7A 1Y1RA 5WRFA 1YL5A 2E4XA 2QMUA 4ZEXA 5CCBA 3SZ3A 4HWRA 2BEUB 4JBWA 3FCCA 1T9GS 4MOWA 2XSZA 4PS0A 2WJ3A 3B2QA 2LBPA 2VPZA 2RGXA 6ABPA 3B1JA 2O4UX 4X3PA 1PI3A 3IAHA 4M7RA 2A9VA 1S8AA 1TCCA 3HSYA 4A6DA 4H15A 1TIBA 4D4IA 2YC2C 2YV3A 1FNSA 4FVTA 3DKPA 4NICA 3UJBA 2PKXA 3QUQA 3JQBC 4Z0PA 3E7XA 3WGJA 2FWIA 4HF7A 4EHJA 1LBQA 3QKIA 4B75A 4KQFA 3GP8A 4BVEA 4A3SA 4BQSA 2NZ8A 2PGXA 3CYFA 4ZI3A 4B7ZA 2O2HA 1JDTA 1F4PA 1QHGA 2CJPA 4FOLA 5BORA 1JHMA 3PYLA 1W47A 3FDXA 3WIUA 3KPVA 2H2FA 4DYDA 4MDFA 2XXAA 4L1KA 4PZ0A 4R69A 4OF4A 2EP5A 3BD9A 1UJXA 4GSKA 2FZKA 5FA5A 4EYOA 4DDWA 2GWRA 4IEIA 4B6JA 4JBIA 1THTA 2IZZA 3RWOA 3WGMA 1KOFA 1YZGA 2P2NA 3S1SA 2W0SA 4RDXA 3C97A 1OA0A 2XE8A 4AZ0A 3F6EX 3P94A 1CB0A 1BQ4A 2PGAA 3QYFA 4FOSA 4X24A 2C82A 4UBLA 4X61A 4I4TA 1C3VA 1QHXA 3FDZA 1CV2A 5CURA 4BNHA 1IPHA 4FS3A 2OD2A 4EECA 3UB3A 2P40A 4DNFA 2VIIA 4XDZA 1UPBA 5FCDA 3AUJB 2C2HA 4U2EA 4MUXA 2V54A 4L8YA 1KR2A 3KUCA 1K66A 3ROXA 1K5PA 3PLAE 5FFNA 1PQYA 1W5FA 1CR1A 3GDGA 2DR2A 1ZQ9A 1E1KA 5C31A 1JJVA 4KGZA 2QW8A 1BJRE 2LR0A 4XR9A 5ICSA 1ML3A 4IBOA 1GAXA 4X91A 3TG2A 4R40A 1I13A 4PRZA 1BMFD 2X9LA 2A58A 4M87A 5AVSA 1YKGA 3RSFA 4QRIA 1KXJA 1D4AA 4WZBE 1TT7A 4Y1GA 5CVEA 1LVUA 1MU0A 1SG0A 1G66A 3MT8A 3M1IA 1DOHA 1Q0HA 1E2QA 4I1OA 2OYCA 2AEEA 1F2DA 3V9AA 3HFSA 2B25A 4MRAA 1A7UA 3WL5A 1FP4B 2JVIA 5IDVA 4WOKA 1DC5A 1C8KA 1N6IA 4HTFA 4EFMA 4RTKA 1U3GA 3RIHA 2QMZA 3K70D 3IPYA 2E4AA 2WW8A 4LPKA 2QRKA 3OCVA 3LFTA 4M1MA 4RTJA 2QI9F 1CRQA 1VCNA 2WPDD 3ASVA 3LBHA 4OFWA 4UCQA 4EJ6A 1CS0A 5LJIA 1H9CA 4QUJA 3UOWA 5EUMA 1C8LA 4YDSA 3R7WA 2O14A 4ZMBA 1PFGA 1O94C 5FPKA 4EUHA 2ODQA 4V0LA 5LZ7A 4R2LA 5CA1B 2BKAA 1Z68A 4ZT6A 1DFHA 1ZZEA 3U4GA 4AUEA 2IH4A 1HV8A 3QU9A 3PNOA 1VHLA 1EEXB 1X8XA 2PD4A 4LRYA 1T4CA 1D2HA 1UK7A 4BV8A 5AI4A 2WWGA 1OUMA 1N2CE 2J48A 3IAXA 1KU0A 1GZ7A 4N6OA 1KGDA 1XTUA 4BLOA 4QDTA 2VUHB 4B6PA 3PC7A 2GHQA 1TLLA 3FBGA 2Q46A 3OEHA 1OX4B 5A1TA 4BFXA 4MP8A 4LY0A 5G4KB 1JH9A 2Z3WA 2NO0A 4RVDA 4PHHA 3UG6A 1AMNA 3AUAA 3L6DA 1N2GA 3NXKA 4PSVA 2Q5OA 5DM2A 3IE1A 4HS4A 4WAUA 4ZAGA 2VOJA 2JGMA 4B73A 3QP9A 4QUEA 5HKBA 3AF4A 1YQ9A 3EMDA 3LYHA 3HY3A 2D7CA 1EWKA 2PQ0A 3K1AB 5E6RA 3WGLA 4BO8A 1JSXA 9LDTA 2A4MA 5JLAA 1O87A 1IN7A 3GIWA 4MARA 4G0WA 4Z8XA 1YVPA 4X6XA 3JVIA 4OBEA 2D1FA 3ABSB 4IEFB 5CNIA 3SLKA 4BQRA 3FPJA 3FRIA 4FT4A 5I01A 4HGRA 4RF3A 2PUGA 2CHGA 2JGKA 4NYJR 3PR3A 1NJSA 3UCXA 3UTDA 1E92A 2ZYTX 2NO5A 1N5RA 4JSYA 1U0FA 2O8NA 2BM0A 1CLUA 4J16C 4A8JA 2OCBA 4W1PA 3TG8A 4XD7A 3O26A 1KYIA 2XSZD 3DHVA 3I2JA 3CT4A 3SSAA 3QNUA 1XMQB 3DZCA 4YCSA 4F2PA 1FFGA 3ZLBA 1JILA 3AIMA 1THZA 3LL4A 4BX3A 5LOVF 4EY4A 3TZBA 3ROEA 3AEUA 1K7FB 4PRLA 3GG2A 2WWWA 4LWQA 3RREA 5KC9A 3THXA 1JEAA 2Z58A 3GROA 4H7IA 4EB3A 4HNQA 5C3UA 2CVPA 3SXUA 4Q7JB 3VDRA 1G8HA 4XX1A 2O8CB 2OB1A 3NATA 3KB8A 4JYAB 4PQFA 2AF4C 2F3QA 1LPBB 3ISTA 4R5MA 1OHHD 1I4DD 1G8FA 2GN6A 1U9IA 5KNCA 1YVEI 1XN1A 3PWSA 3GDHA 1E1CA 2E6UX 3DEKA 3I9NA 3KYCB 2ZT8A 4JOBA 1REQA 2UUOA 4Q03A 3S55A 3LUKA 1KPGA 2AUMA 2DCMA 3SSNA 1P18A 4WNIA 3C41J 3QV1A 5EJHA 1H93A 1L7BA 2PT5A 1K75A 2FSUA 3I53A 3PX3A 2VLIA 2FKAA 4JUDX 2QHXA 3AR7A 2C0QA 4WY5A 4C1BA 1E3QA 3GRAA 4IH9A 5CVJA 1FUUA 1QHYA 2Z98A 4I50B 4X97A 1EI9A 3FX2A 3NBAA 1XAHA 1QK3A 2YXEA 4Y9TA 2PZBA 2JFHA 2MCFA 2Z5VA 2OSBA 3VDMA 1PG5A 2IJGX 3QFFA 4G1EB 1HDZA 3QKWA 5AIAA 5FULA 3RC1A 3VJLA 3A25A 5CXSA 4YJFB 4M83A 2VQSA 4NCJA 1BC5A 1CD5A 3IUMA 4FZJA 3PNKA 1IWPB 1PUJA 4IQ0A 4BWVA 3M6LA 4FTWA 4MRVA 3BTSA 4KXYA 4FX5A 3INYA 4EUEA 1TUEA 1OSNA 4PG6A 3I0NA 2E49A 4DSTA 1N57A 2X8JA 1BH2A 4FR0A 2PS0A 2XUPA 5KYXB 5KYTA 3KZ1E 1CVIA 4MJ7A 4GKKB 1I3NA 3RJTA 2IU0A 3K0KA 3U4IA 4JAVC 5B64A 1S2IA 4M9CA 2DPYA 1E5LA 2I7VA 2GN9A 3D6TB 3DGEC 4KTVE 3NVAA 2WINI 1M3SA 1Q17A 2FOLA 1K08A 4G5FA 4H0NA 3KDPA 4LWOA 4BYMA 1XJ5A 3DCJA 4HXYA 1ZONA 4OHXA 3BZWA 1HLDA 4JLKA 1D4ZA 4H7EA 2YCBA 1XMIA 4JJAA 1QQ6A 4M0DA 1JQAA 1YHYA 3LOPA 1CY6A 3JAWA 2CDCA 4ILEA 3ED5A 4U0KA 1YACA 2ZBDA 3S8EA 3ONDA 1AN0A 4U7HA 5TPWB 5IDQA 2ZBUA 3S7TA 3LP5A 4R7ZA 4WBNA 2I4NA 5JYCA 3QJYA 5E7QA 4DRZA 3D5EA 3WLMA 4MVJP 3H86A 5KDOA 1EDEA 1NQAO 1U8ZA 1A95A 2ZQZA 2XDWA 1IDN1 1VECA 1Z4LA 2BISA 2Z83A 2ZZMA 1DTWB 1IHXA 1NBIA 4D46A 3RC2A 3TZKA 1JECA 4FC7A 1WPXA 1X77A 1JDZA 2VSOA 4TM8A 3SIRA 1IC6A 4LZJA 3W5VA 3WIVA 4RY9A 2D54A 5EFOA 3RGWS 2AK2A 4GBMA 3DPSA 4X8MA 2J7PA 3GUUA 5IK2A 1VTKA 1ZM2A 4X6LA 2WJ6A 4HO1X 3HN7A 4ML3A 3E2IA 5SYAA 2PLWA 2KI5A 3UMMA 1NQ5A 4NARA 2PUHA 4MPPA 4MS4B 3V33A 2PUTA 3A4VA 3ZV5A 1QLHA 3BE5A 1PK9A 1Z2CA 3NKLA 3PXBA 4GQIA 4KXWA 2P5YA 4IHJF 1FLAA 2R4QA 1XXHA 3E5HA 5E2IA 2O3TA 2QRZA 2ZSDA 1RC1A 3EDQA 3E9NA 1IIBA 4D8UA 2R00A 3JZAA 4B4VA 4JIMA 4RIHA 1S2OA 4LNHA 3RTAA 4JDPA 4B17A 4MW4A 5DULA 5CBPA 2OD9A 4WDQA 1J5XA 3B6ZA 4O4LF 1EUYA 4HN9A 4DBLC 1ZI9A 1Y3DE 4PU0A 3AR3A 2V98A 2X0EA 1KJYA 1ZSVA 4RMGA 4JQOA 3GFQA 1HY3A 3GP3A 3VYUB 4GX1A 4W9NC 4YP1A 2QL6A 3RS3A 4CEHA 3GRUA 4C0LA 1M1NA 4CF5A 2YQ5A 1KK0A 3WP0A 1TT5B 3R4VA 4AW9A 3IALA 1V96A 1RAHA 2HO5A 3RU3A 3PICA 4J9UE 1J4KA 4EW1A 4NDZA 1P4JA 5CGQB 4Q7QA 3VU0A 4EW3A 2DKFA 2ZT6A 1C3OA 2BT4A 3LCRA 2J07A 4IKOA 1BCRA 2OV3A 4O63O 3J7TA 2CVOA 2JH8A 2DB3A 3A6FA 1FJXA 4DILA 2WJ4A 3K8YA 3V55A 4PZYA 4V0SA 3CLRC 4E21A 2GTHA 3DVSX 1FPQA 5KNCD 2YBEA 4ATNA 5FTWA 1UZUA 2YJNA 4L6CA 2AI2A 2X7JA 2Y99A 4HNAA 1RVV1 3MRXA 5AQ1A 4NX2A 2R6CA 4P2BA 4KMRA 4XTCS 1DDOA 1ZD3A 5A5EA 4B82A 3V8VA 4NATA 3H2KA 3X2FA 1J99A 1JQDA 3N70A 5JATA 2EKDA 1T25A 1LSJA 2ID7A 2IEZA 4GBED 4QUGA 5HF8A 3GLGB 4FLEA 3RIGA 5BWBA 3C3AA 3T3HA 3ZY4A 5FX2A 3QHQA 4MDEA 2SICE 3JYHA 4PC3A 1F7VA 3ACCA 1E4YA 1Q20A 2EFCB 5C37A 4DMHA 3B1KA 3ZC3A 1VE7A 4O29A 3H5WA 1UR5A 4HGOA 4ZARA 3DMNA 5HQTA 2XF8A 1JA9A 5HFNA 2WWHA 3C1OA 4CIYA 3A1VA 3G85A 1BDBA 4WCFA 4BMCA 1VZ2A 4NEHB 1C9JA 3IAEA 1KO4A 3N05A 3KXDA 3LPDA 2HGZA 3L1UA 3D6AA 1B8UA 4PXYA 4NCKA 1EH5A 3TLZA 4CMBA 3AI2A 3LY5A 4IIFA 2QN9A 4BRSA 2DMRA 5K0LA 1TQ2A 1Y4AE 1XELA 3NWEA 3B2EA 3E9CA 3QPVA 4YMSA 1WV1A 3WK6A 4B3CA 3KQUA 5ILQA 1K92A 1P7YA 1Q7RA 3GK3A 3L07A 3QYPA 4EY8A 4LZNA 1DP4A 1IB0A 3D8SA 1ID1A 4TTTS 1DDIA 4G3XA 4KODA 1UHTA 1P4RA 2X9GA 4WCVA 5K4HA 1FYXA 3CW2A 4P0TA 2H1LA 3MGKA 3OT1A 4O4HB 5AKEA 1XNGA 1E4OA 1JI3A 2YHSA 3HYSA 3SNHA 3TLCA 4IQGA 4C87A 5KIAA 5THKA 1RXEA 1V5FA 4G8BA 4B44A 1P1FA 3O8RA 1WV0A 1P1BA 1PFWA 1Z16A 2GFQA 1QE5A 3X1JA 3PUYA 2P90A 1JAXA 3PLNA 4FHGA 1B8PA 2BKUA 3MMPA 5CEEA 1V1MA 4LXTA 2G1KA 3AVOA 4Q3CA 4QLAA 3AFNA 3OF2A 4F3YA 3DBLA 4R4JA 2GM4A 1NU8A 1WXXA 1N5KA 3NYWA 4HAYA 4INOA 1E94E 2X0RA 4I81A 2Q7XA 3BFPA 3JPWA 5FO0A 4J49A 5EWJA 2TECE 5DKFA 3UYKA 3W5CA 2GM5A 1QAOA 3OJEA 2IDZA 1BDMA 1EHIA 2JC3A 3C3CA 4XSHA 4HNVA 3GXBA 3OEWA 3ONNA 1D4OA 4UUAA 3X2SA 5IBPA 2VTEA 1UBOS 2W58A 2BW0A 3ZX4A 4U7JA 1E1RA 3VJKA 3D0RA 3WIDA 4TUYA 4KX5A 5KOJA 2IS2A 1FSSA 1VHDA 4MB0A 3U3JA 1WDMA 1ZITA 2CK3A 2G76A 2ERYA 2Z8YM 3TRHA 4R8RA 4DRXB 1JPJA 3OZ7A 1IY1A 4EL5A 5KWSA 4OKIA 5T41A 2JCGA 1PG2A 1RAFA 4PLTA 3OX2A 5JADA 4J7UA 4X7RA 4MIEA 1ZM7A 1P4HA 2QM3A 5BYKA 1TYZA 3BGOS 1XE3A 3THWA 3RQIA 4B76A 3HBMA 1W2HA 5DHFA 1F8YA 4LVCA 1RQPA 3I8SA 2UUPA 1KYYA 1W5EA 3DCNA 3DP7A 1R8XA 3NJ8A 3WLOA 3W5AA 3EZ9A 5BQFA 4C2TA 3LPLA 3MOSA 4R98A 4UQPA 4E1AA 1FFSA 2BFFA 3KV1A 3ECSA 5BYBA 1Z3CA 4CI0B 4EHFA 1WXWA 3RS7A 3V4SA 2BTQB 3SC6A 5FQOA 1O6BA 4OQPA 1BS9A 2RGCA 4N5NA 4MUNA 5HW0A 3BSWA 4RNCA 5JYBA 3K5HA 4WD3A 1E9AA 1S6YA 1BA2A 3AI7A 4M1TA 1FY2A 1JFLA 1D3AA 2NSHA 2Q1TA 2VDLB 4NC9A 4P4SA 3ZK9A 2JFGA 4PIMA 3OCCA 5F33A 4YUAA 4BRZA 1PHPA 1JG3A 3JASB 1GRVA 2QZSA 2ZAYA 1OI2A 1TC2A 4LWPA 2LCFA 5CT5A 4BLPA 3CONA 3DFIA 5AVJA 4UHEA 4DLSA 3L4EA 1JJ7A 1KJ9A 4R1MA 5AOCA 2FRDA 3FTNA 1YB2A 1XVAA 3WAJA 2P4SA 3QNMA 3QMWA 2GVZC 1I7NA 2E4WA 3DONA 7MHTA 1MJSA 3K9BA 3AHDA 2G7MC 1Z4KA 3Q6NA 2BM8A 2JAXA 2WD9A 4KKXB 5A4IS 1G9XA 2QNRA 5JEDA 2QX6A 5LJLA 1G1MA 5AJZA 3H75A 4Y9UA 3ADCA 5JALA 5LXTB 2HF9A 3X43A 2Q3JA 3DR3A 2NU7B 1PR3A 2C20A 4H35A 3KM0A 1P60A 2NUTA 2OO7A 1UBEA 3CX3A 4K03A 4A0GA 5DF1A 2BGUA 5MF6A 1ZIYA 2YOHA 5TMDA 3E0QA 1RXUA 1PWHA 3O8NA 3GUCA 1YBMA 4LHYA 5DNVA 4WOBA 4GYKA 1QB8A 1D9XA 4S1VA 2HJSA 3FPGA 3MG9A 3N75A 4E4RA 3Q3VA 3I45A 3AGPA 3C14C 1AQYA 3OPQA 3P9SA 1IBKB 2GDZA 1LGYA 2VJMA 2C57A 5EWLB 3HLTA 1DIBA 1Q3TA 2Q41A 3QITA 3QYJA 5AM2A 5H5JA 1NULA 2QU7A 4JN6B 5LP6B 1QX4A 4UTZA 3QBEA 3VGJA 1PD1A 2R2GA 1RXYA 2ZJ2A 3OJFA 4YJDA 3WQHA 4JYZA 1V8OA 2PH1A 4BX2A 4JC4A 1SD2A 1NLYA 3W8NA 3SC2B 1R6VA 4D25A 4WOPA 3I09A 4CMHA 1H4QA 3LUHA 1RPJA 2CHVA 4D8WA 2MSCB 3HKCB 4FI3C 1HOXA 2O1SA 1GILA 3ZE9A 3IRUA 1J1ZA 3HKBB 4OEHA 5MN5A 3E3AA 5DOVA 4RCYA 1I36A 1OX6A 1UFKA 1UZMA 1H6BA 1P2SA 3VKWA 4BMOB 4DOMA 1Q84A 1GSIA 1DRVA 4X94A 3D7NA 1KNXA 1SCBA 2DUNA 4AJIA 5C8YF 4PWYA 4ABYA 1GUYA 3CUYA 4Q4JA 5LUBA 4I5FA 3ROKA 4OXKA 4HNUA 1THGA 5B3JC 2NU8B 4P4LA 4RKQA 1G6HA 1K88A 1ZIXA 2ATEA 2ODAA 3RSHA 1U5BA 5JSFA 2JGLA 5MFPA 1FLVA 1J4AA 1JEQA 2EX4A 4C2BA 5CB8A 3OZRA 5A04A 1DOAA 1Y8QA 4MYCA 1LVHA 1EESA 1IRXA 3CQ9A 2SBTA 3I04A 2BD0A 2Q0XA 2O5EA 2NAPA 5JCOC 4H0CA 3P1JA 1Z5WA 4K9KA 3H1BA 3C5VA 3GW8A 1U31A 4KXXA 1I0IA 2R60A 1U2TA 4N40A 2EKZA 4BWYA 4IMRA 4MTCA 2CF6A 4C3UA 5T4HA 2WHXA 4DSOA 1XZBA 1U7FB 5PNTA 1CUYA 3ABRB 3H4VA 1CB7A 1T9BA 3EODA 3BMCA 1XPRA 2B4YA 4AMVA 1PYOA 4G37A 1QRAA 2CK3D 2QW0X 5FNZA 1Z07A 4DIFA 2IX3A 5IVKA 4C2UA 3QTLA 5K3AA 4O4JB 2EJBA 2JKDA 2BHRA 1R5OA 2PCJA 1A9QA 2Z57A 4HDKA 4IF4A 4XOIA 3ZV3A 5I4KA 1RFGE 3IOEA 3RYIB 1WHTA 2QTRA 2MT9A 3AJDA 4MA0A 1XTZA 2HNAA 1PT6A 3MB5A 2ZSEA 4WEOA 2BSXA 1Q5PA 3G2MA 3GA7A 3KCNA 3SI7A 5IAOA 1J0AA 3NOQA 5EHQA 4B3IA 3MCVA 5B3KA 1RQRA 2CVFA 1WCIB 1UIRA 3GJ6A 5TPZA 4AM8A 2OHJA 5LQUA 2G0TA 4BMDA 3G59A 3RRBA 4LHZA 2JJ1A 2QR2A 4HKTA 2Q4EA 4WK4B 4FUQA 3K71B 5LNK6 4ZHQA 4IDEA 1WLSA 2GQ0A 5TF0A 1QCCA 3IPXA 1EYZA 1JPVA 2GF0A 4LEIA 5E4TA 2ILVA 5DYWA 1SQFA 2W3OA 3KEMA 4E22A 5ELLA 5I51A 1EFDN 2RH8A 1EMDA 1O6FA 2FDRA 3GJSA 2RHLA 3H5TA 1C80A 4BTVA 1Q1QA 4GPBA 3LNCA 1RI5A 4ZA2A 5FLXA 1TMKA 2DFDA 5FADA 5KKCA 4OXIA 2ZIEA 4S0XA 3ZG6A 2YMMA 4Q34A 5ADVA 2L19A 3VISA 3ZV4A 1JJFA 3R8XA 2IZ1A 3BRCA 3A2NA 4G8DA 4HYEA 3UMSA 4AMYA 2QWXA 3M6WA 1PFKA 1R0CA 1H0RA 4OK5A 3MSCA 3OZSA 1AKQA 1MT0A 5DX0A 3WX0A 1YV9A 4AX8A 2X3YA 1T5TA 2MSLA 3H1PA 2HMYB 3TCNA 4Y6QA 5B4UA 4OQMA 3RFCA 5DNWA 1RYDA 2YXBA 1WLYA 2Q29A 4FP9A 1A88A 1ST3A 3P20A 1RBZA 1PU2A 2F59A 1NN5A 4ONEA 3KB2A 4B0OA 5JXHA 4B9AA 3EPJA 3NMUF 3VU9A 4OHYA 1E1QD 1LUAA 3HBAA 1T43A 4BFUA 1ZPDA 4BJ6A 2Z2ZA 3I39X 4ZMSA 5HUQA 1M6WA 3F96A 3WWDA 4OQFA 1GN9A 2IF0A 4B8YA 2DR0A 3PGA1 3PVZA 1EUZA 1BDJA 4O3FA 2IPNA 3OC6A 4Y1EA 1D6NA 3H4TA 3RD5A 4EUNA 5LMUB 4YUVA 4BO7A 1O6CA 4DUGA 4CEJA 1IEXA 5H9VA 4CF3A 1V7QA 1W88B 3K4QA 5KPJA 1IZ7A 1BGXT 1X80B 4KNWA 1GVNB 4K9NA 3PR2B 4DTIA 5KZMB 1WS6A 5ALDA 1S4MA 1ZSYA 2GKGA 3E9YA 3OLYA 5LPNA 3FNQA 2DQSA 2XI4A 3C48A 3HU2A 2RHOA 1GPAA 3CTMA 3ITDA 3JD1A 1QHHB 2RBKA 1OT5A 3BMOA 3ME5A 3NUGA 4RPCA 5ES3A 4S3MA 4RANA 1KK2A 4TLMB 3H8WA 4LRQA 2RHBA 4B45A 3Q12A 4K6FA 3U16A 1NYQA 2IHUA 1MGPA 1DAKA 3HJTA 4RF2A 5FA8A 4NPCA 1FMCA 2W6IA 4MJXA 4PAOA 5LM3A 2ZI5A 3HGMA 1XOIA 3KQKA 4AKIA 1QGZA 1NVTA 2ZRMA 4AICA 3E7WA 1R7RA 1TLFA 2HA0A 5AJWA 3O90A 5D7NA 1VGQA 3P9IA 3PCTA 5BSTA 1CK4A 4TLLB 4ZICA 2QRLA 3H6HA 1KAEA 3NHKA 3FGOA 3K5IA 3LC1O 3M7IA 3MVEA 4AJJA 4ENSA 3QHAA 2OAP1 3WGOA 2ZJ4A 2TMGA 5EJ5A 1FFDA 1JIJA 4W5TA 4LUCA 3RUFA 4JJEA 3UT5B 5AUOB 1YJ5A 3WYAA 3VNQA 3UAXA 1QPBA 4RKEA 1K2VN 2XZTA 3AEQB 5JT1A 2C94A 1QTQA 2Q8QA 2QRJA 2VZ9A 3BMQA 2VPYA 4OSEA 1GAJA 3CCFA 4L78A 4YRCA 1D6MA 1II8B 5KJ1A 3UHAA 3DVQX 3A1UA 3KKEA 4PAMA 3T99A 4KHPB 3DAYA 1JLLA 3KSUA 1KI2A 2O0LA 4LISA 3N8DA 4RE5A 4EYKA 1JHQA 3MTDA 4UEKA 4IMIB 4F46A 1Q14A 3RJ5A 2J4CA 1UOEA 3L7MA 5DNYB 1KZ6A 2XCQA 3PENA 3VYRB 5ALKA 4BASA 4C7VA 1NOJA 1PRYA 5GADl 1YU9A 3TZEA 1UT5A 1RCTE 4BN4A 1IXYA 1N78A 2BEKA 1EB9A 3FLMA 4JVSB 5LA6A 1Z2EA 3UC5A 1IMOA 4DQ0A 3BN3A 5FTMA 1FFYA 1UFOA 4KDFA 5G53C 5FRDA 3ABOB 2HSGA 2Q7OE 4BL5A 1BFDA 1GCGA 1Z83A 1SBQA 2PR2A 2I7XA 4LSGA 4CMEA 3QFRA 421PA 2D2IA 4NHEA 4LMAA 3UGJA 2ECKA 3HXMA 3JQAD 4HCJA 3OU7A 5GM1A 3DOJA 5FOQA 1C9MA 2VDMB 3M34A 5JR3A 3C6BA 3L0YA 3O92A 3LYLA 2YVQA 2FUG6 1YQWA 1YZQA 4WZZA 2HYIC 4V0QA 4RA6B 4TYYA 2VJKA 3TSWA 4DIBA 1E3LA 2CYCA 2IGTA 5DCYA 3B6IA 5TPZD 4TYPA 2K2QB 4NJOA 1C9KA 3QKTA 4CPDA 5J4LA 1UKCA 2FOXA 3BQNB 3ZU2A 3QEMB 3RVNA 2QM7A 3URKA 1KAQA 4IDBA 3PDUA 5EXXA 4L3VA 2EFHB 4JBNA 2IYVA 5LD2C 2AC2A 1L8XA 3D3QA 4OU5A 4G2NA 4YRQA 4CT5A 1ACLA 5DCUA 2VUTA 5AK0A 1YR2A 1V39A 4F6RA 2NVWA 3PDIA 4BE9A 5E9QA 1WX1A 2RAUA 1AF4A 3LG2A 3PEVA 4UAVA 3FLBA 5YASA 3KVNA 4CQMD 3ZWKA 1E6EA 1YK1A 3SP1A 3VX4A 2Y6VA 3MGCA 4IUBS 1QIKA 1T8TA 4HFJA 2KS6A 3M9WA 1T2VA 2DT8A 2OZLB 3C3YA 3Q2OA 4OK6A 3GAAA 1I9GA 5H0IA 4EMSA 1YVRA 3E18A 3ZH2A 2DPLA 4J1TA 1MC5A 4B34A 5FHRA 3JTMA 4WFQA 4I55B 2H7VA 4XVQA 1FUKA 4L16A 3BRWD 3SQNA 2FUEA 3TJMA 2BR3A 1A9ZA 1R27A 2HDWA 5AXDA 1OASA 2ODNA 4V2UA 2PS9A 3DWGA 2VHVA 2A4KA 1IHYA 3QX3A 1P62B 1K0UA 5G1NA 3G8CA 1HQDA 3Q40A 3BXXA 2VF2A 4ZALA 4KE7A 3IUNA 2O2DA 2XF2A 5CFNA 3DLPX 4CU2A 6LDHA 3PXGA 5AVVA 3FLAA 4DKJA 2JFUA 2FPPB 3RAPR 4AULA 1LPNA 3W3AH 3WGKA 3ENVA 3KTAB 2QD2A 2V45A 3FKSA 4JGBA 3KEOA 3KSMA 3OZTA 5AKHA 4INJA 1OR8A 1ODKA 2VRCD 2W6ID 4IVPA 2ONYA 4ZOLF 1KWGA 5I47A 1MB0A 4N12A 5KUTA 1PEAA 2ZBPA 3C8ZA 2O7SA 5J5AA 3FGZA 2FPXA 2IUFA 1A82A 3MAAC 4IKEA 4A5SA 4ZQFA 2H3HA 2GZHA 3O1JC 3P4XA 4D0NA 2YBDA 2R7KA 4FKBA 1Q12A 4P7GA 5LL6P 4P53A 3RT1A 5FJJA 1X7DA 3NUQA 3BWVA 2A94A 2OXCA 1RXIA 1QPZA 1PZMA 4HLUA 4WQMA 1VYUA 3DMGA 3NEAA 3W6ZA 4KFCA 2ODTX 2CSXA 3S3TA 4OQDA 4KC0A 2BM1A 4BP3A 2EBFX 4Q48A 9ABPA 3JALB 2L0XA 1MCZA 3NCTA 4LE2A 3DM9B 3PJEA 2NPOA 2BMFA 3T0FA 3D6HA 4YR9A 4XXHA 1I2MA 1P7CA 3BKWA 4G0QA 2C78A 3W4KA 4ARBA 2REOA 3RPEA 1KMNA 4DRYA 5JNLA 2BVNA 1E6UA 4KK3A 1ZUNA 3RHZA 4TL8A 3TOZA 2FWPA 3BJEA 4DA4A 3KB1A 1VIMA 1QVRA 3DE4X 3MUFA 1SVNA 3GC6A 1L5HB 4LY9A 2JGRA 2XCLA 1GNQA 3AF5A 4Z4FA 1VKRA 2IXGA 2C00A 1EFVA 3FFXA 4W5JA 4YALA 4HEQA 2EDAA 1P39A 1MQSA 3MJFA 5B6IA 1BA3A 1I3LA 1YI8A 5C4GB 3LI2A 3WLTA 3TL6A 1AQUA 1NBMA 5JARA 1H1DA 2KE5A 2BGNA 1VSUA 4YP9A 3ZVKA 2O1WA 2GZ1A 3B6EA 4LCBA 1W52X 4A10A 4B6EA 2AFIA 5KSYA 4FYYA 2HPZA 1G8GA 2BSQA 1ZIDA 3AB7A 1JR4A 2ZUCA 3C1AA 4P82A 5ALFA 3SMQA 5A5GA 1GTJ1 4KO1S 2GZAA 3TOSA 3LZ6A 2A7QA 4FWTA 1TM2A 2YYYA 4EG3A 5KX5B 3PTZA 3TZCA 2LPMA 3BFXA 4GX0A 1VJ5A 5ESWA 3T5CA 1IN4A 1E7MA 4A6EA 1GG8A 1OLSA 3H0EA 4EPRA 1E6CA 1A1VA 3SC4A 1PZXA 1TDJA 1W4CA 1FDVA 1W5SA 3MLAA 2W6JA 2Y1LA 3UMGA 3DA8A 5F1KA 1KA9H 4HVAA 4Y2JA 5IHPA 2CEKA 3T5BA 4BQEA 5KAMA 3X1YA 2BMAA 2HLPA 3E2PA 2ZUBA 1LZKA 4CMJA 1DXOA 3LO8A 1E0KA 3STYA 3OFJA 1UKZA 3DV0A 5FJIA 2X1LA 4BOYA 1MAUA 2R44A 4UQLA 2VHWA 1NJFA 2C4VA 4PLFA 4ARSA 2WV7A 5CFZA 3DZIA 3FROA 3MBIA 5KQRA 3I01M 4OYRA 5ADWA 2MTBA 1ST2A 2EQAA 3RADC 3IAS1 1YVDA 5DTJA 1IOWA 1H2ZA 1XZGA 2WUDA 4IQ4A 4O4IF 4XYGA 4Y2UA 1F06A 5IXJA 4PM4A 5KTNA 1EFKA 1LLDA 1K5GA 3AEXA 3CS3A 3GVHA 1FUYB 3HV0A 1L9XA 4DCSA 5A03A 4TZ6A 2ZAGA 2EKQA 2PTHA 4S1OA 1KEKA 4MWSA 1RWBA 5DI3A 1JHDA 3C5HA 3U7RA 1AMOA 2ZKLA 5GV7A 5AQEA 4U2CA 3QX8A 4YRKA 3C74A 4B3GA 1TVKA 1S2DA 3A4LA 2OYRA 2E4UA 2AQHA 1QRDA 1J21A 3U3DA 5K7SA 1PJ3A 3I9FA 3KC2A 2DWOA 2YFQA 3B1FA 1M54A 2EHJA 3CO0S 3V97A 4BECA 4M6WA 3B9RA 2J3HA 2YCLA 1YFLA 1CEYA 4NMHA 2UVDA 4RAQA 4R2KA 3P2EA 5U4XA 4TTPA 4EM6A 3TRDA 1RHJA 4QSHA 4QPDA 2OPHA 1KMQA 2LC1A 4R51A 4DR1B 5ECWA 2CN1A 4Q1AA 4RXUA 3WAGA 3ZHTA 5KQPA 1FJGB 3LBFA 4EUKA 3B1WA 1YB1A 3RO7A 1P2FA 3CKKA 3NHYA 5H16A 4OA8A 3U9SA 5EXDA 3ZQ6A 1JDNA 3QE4A 4B7AA 1KWKA 1IWBB 1NBAA 1QYRA 1RHMA 1QG0A 1V5IA 2IX9A 2WTNA 1GNPA 3FIUA 4QYIB 1I0LA 4EY3A 2QVZX 2Z9DA 3KR0A 5HK9A 3V7NA 4A8TA 3ICEA 3EBPA 2G1AA 3FSJX 4HX9A 2HSZA 2O3QA 4QO7A 4UM9D 3GLIB 3TL3A 5ARBA 3ZI7A 4F1WA 1ZK0A 2JFXA 3EDRA 2APJA 3DMFA 1KGSA 4WADA 4B46A 5LQKA 5LD2B 4MK4A 3CXUA 1TPZA 3ZTYA 1IBCA 1AXRA 1L6RA 1I5EA 2HJVA 2IPLA 3IP6A 4EQZA 3K32A 5T8KA 1LS1A 1VCOA 2B0JA 2QTVB 3JZFA 3EF0A 2AD1A 3GGCA 4PYIA 4MINA 1B0UA 1SOAA 4IG4A 3UWMA 3PQEA 1XALA 5C46F 1EJ2A 5D5PA 3RHTA 3ELSA 1J07A 3D7SA 1TGVA 3NEYA 4ND8A 3EAGA 1NNUA 3E5MA 3T3OA 1I9CA 1OLOA 2OV8A 3VYSB 2H1IA 2Q4TA 2GCOA 5F73A 4TV8B 3WI7A 1HQYE 1JQ5A 3WFZA 5CR9A 2QMQA 2J67A 1Z2OX 3G2IA 4XYEA 3TQHA 2XVYA 4FGUA 4QDXA 4DBZA 4D96A 3L84A 4DLRA 2LDBA 3B3GA 3RV4A 4XARA 4EA7A 5EJ9A 4ZOBA 1RRMA 4I8IA 4XGIA 1N77A 1WVIA 1J2EA 4UEWA 1N2ZA 3GOQA 4BS9A 3MWGA 2ZUSA 4GSYA 3UMBA 1ZCBA 1RAEA 1Z0KA 3WMGA 1B93A 4E2YA 2K6GA 2MU1A 1UQTA 5DMHA 2AT1A 3LECA 1LGQA 4BNIA 3Q11A 4OFZA 3QPCA 3GT0A 1NBMD 4X1IA 3HB4X 2UZ1A 1XDBA 2WIJA 4WA7A 2NSDA 4YJHA 5FP0A 1KFCB 3A6HA 1QKJA 3EJWA 3Q6MA 1CUAA 4JBLA 1FS6A 1CWUA 1T6NA 1G98A 1G18A 1NJ1A 5LU8A 1QO0A 4QBGB 3TQOA 3BILA 3L05A 3KSAC 1XAJA 3QTBA 4LOAA 3VUEA 1EQAA 2EU8A 4ZU6X 4IWXA 1Y1PA 4RXMA 4YX9A 5E7JA 5L4NA 1TM3E 2FV8A 2P2GA 2I6SA 2X4DA 3L6RA 3ROQA 1MDBA 3G23A 2JIQA 4MDHA 4PR3A 5L6LB 3QLTA 2JLCA 3ZWAA 2W6JD 3JYOA 4XUCA 5AK6A 1CJUC 1KFEB 2WJWA 2KQUA 4H87A 5E2BA 2P3LA 3ISJA 3SIWA 2PANA 1ZR2A 3Q7QA 1ZICA 2HTFA 4HOYA 1ZHHA 2F1RA 3R3JA 1DINA 2I76A 3KU4A 2OXEA 2Y66A 3LRTA 5AHXA 5DM60 1RCUA 2BUBA 4JDUA 4LY3A 2CCJA 4P7KA 2Q5EA 1TJYA 3OX3A 1PLJA 3PKZA 2ZRLA 1UKYA 1V3TA 5J2UA 4QATA 5BQ5A 1IEWA 221PA 4ZK6A 3PQ3A 4UVEA 4A9AA 5E0KB 5F2KA 2HU7A 5IM4F 2BKVA 4KV9A 4P5EA 5FUVA 1G291 4BEVA 4PCLA 2G04A 5AKYA 4CUKA 2ZZKA 5A2QA 3EX7C 1M34A 3RS0A 5BSFA 2EWMA 4HZUA 1HURA 2DQZA 1SKQA 2W2VA 4XM2A 2FSFA 3C4QA 2H65A 2VPPA 3V7WA 1RJ9A 3BUSA 3AEKB 4YTEA 5F5NA 5BR7A 3N2GA 3ZQUA 3LQFA 1A97A 1JQJC 3EXHA 1TRHA 2AWOA 4R54A 3HZZA 5B3LA 2MHCA 3DVAB 1GAEO 2XMZA 3D54D 1R0BA 4WKNA 3DZDA 3U7GA 1JA0A 1KFKB 4PYNA 4FXOA 1KDZA 3NBZC 4IZHA 4RCZA 1H6AA 3ZHSA 2HREA 1XZDA 3CGGA 2HU5A 1RD4A 1DV2A 2I4MA 1TTQB 2VHYA 2QZ9A 3V8PA 3NNNA 5JSQA 2WU0A 4EG4A 3WGNA 5IYZB 2OO5C 2OAEA 1VP3A 3GD5A 3OBBA 4JEMA 3AUTA 5LYJB 3H8SA 2B37A 1E2PA 3TTSA 2XUKA 2O23A 4FU0A 3QNWA 1OAOC 4HUTA 1ZCFA 3E9ZA 4HXGA 2G08A 4OGLA 4Q9KA 2BM9A 2PGDA 2GZRA 1W9MA 3OUTA 4JASB 5JH7A 4KLNA 1J90A 3HP4A 2GCEA 1T8YA 1Y8RA 2QAGA 1JDVA 4K6CA 2AQKA 5ALVA 5FBRB 4YV7A 4PNPA 3CJRA 3CR7A 3DLAA 2VI5A 1ID8A 1XWIA 4GW3A 4D82A 4YA6A 3NONA 4UULA 3AG6A 4QHSA 5MHTA 5KU1A 3E8MA 3OEEA 4KGDA 3MJVA 1SVUA 2DUJA 2I3ZA 2VJOA 2Z09A 1EKXA 2QTLA 3E9QA 3H1GA 4JNCA 4PE5B 3W9BA 3WYFA 4CKZA 1E2KA 2D2FA 2PIDA 2Q2VA 2R48A 2WHRA 4KAAA 3WMFA 1C1XA 1MQAA 1TADA 4D8VA 2IW1A 5KSWB 3PHHA 1DLIA 4JJ4A 3O9ZA 2UYCA 1C7JA 1ESNA 4MP3A 3UENA 3CJTA 4YMGA 1GWNA 4FB5A 1XF9A 3EVEA 4I7EA 4WGGA 2W11A 1FXSA 3VA4A 1EGHA 1V9LA 4CXMA 4DIMA 1SXHA 5IJ0A 1MZKA 5L45A 3NFRA 2C03A 4JNKA 2CWWA 4MH0R 2CXSA 3DE0X 1X6VA 1BMTA 3PUHA 4XDYA 3VTFA 1UMKA 2DX7A 3ZWNA 3H9GA 2XNDD 4RGQA 2IS6A 1X38A 1CP2A 1IZZA 3CUTA 2WU4A 4W99A 3RUCA 4GVXA 2G82A 3TLAA 2AOUA 5IFL