5DHUA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD kinase 1
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
total genus 65
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhuA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhuA01
2QVLA 4L02A 2I2FA 5DHTA 1Y3HA 1Z0ZA 4HAOA 2JGRA 3V8QA 3V8PA 5EJHA 2P1RA 3PFNA 5DHRA 5EJFA 4WRRA 1Z0UA 2I2CA 3V8MA 1YT5A 5DHQA 4V24A 1Y3IA 4DY6A 3S40A 3V80A 3VZDA 3V8NA 2I1WA 3VZBA 3AFOA 3V8RA 2I2DA 5DHUA 4WERA 1U0TA 5DHSA 3VZCA 1SUWA 3V7YA 1Z0SA 5EJGA 2BONA 2I29A 3V7UA 1U0RA 2AN1A 2QV7A 3V7WA 5EJIA 2I2BA 3T5PA 2Q5FA 2I2AA 5DHPA
chains in the Genus database with same CATH superfamily
4KITB 1Y4SA 3PLAE 1HORA 1UC4B 1WXHA 3FRHA 5JVDF 2FW7A 1JHOA 3CUWA 2I7VA 4P7GA 4N49A 1QS0B 5L3ZA 3RC1A 4BMVA 1SIWA 5FUYA 2XCRB 2YXDA 3D8BA 2QVYX 2XBLA 5K6RA 3ZXUB 3DE0X 1Z88A 2VF5X 1WXGA 4FOSA 1YIAA 3VTZA 1I4DD 1RTKA 4KAXA 1BD4A 3EXIB 3PHJA 3D6AA 3RD5A 4AG6A 2JAUA 5CT4A 1JA9A 1EK2A 2EW8A 3KB6A 5C7LO 4MAMA 3E9EA 2O2JA 5EPEA 2ORED 5JXWA 1LS6A 3FCYA 3L0YA 3ZU2A 1L9XA 2JNWA 4M49A 3I0NA 4OH1A 1FZQA 1NE7A 2QD3A 1CF9A 3GNQA 2I4IA 3QKIA 4NIMA 3SJZA 3D3QA 4O4JF 2QENA 2XTAA 1R6DA 4KGZA 3WHPA 4REQA 1BRMA 3ZGZA 1XE3A 5CAEA 2QQ5A 5E9AA 4QU9A 4L5CA 2X0FA 1YB2A 1N5IA 4BQPA 3D2AA 3NMUF 1HE1C 2G8NA 3I04A 3RAEC 3UENA 1F7VA 4BOYA 1QRRA 4Y9DA 4QICA 4ZT6A 4LF9B 3H9JA 2OZKA 1QHHA 4J94A 3KPJA 3ZKWB 4AJNA 1NATA 2QN8A 3KPYA 3L0PA 1CRPA 1KEVA 1GTMA 2AXPA 4HRYA 5SZJA 3GPCA 1XRJA 1QGZA 1IY0A 1QFYA 2J0SA 3GEGA 1MKYA 1E7RA 1DC5A 1TDJA 2CUNA 3OH8A 4WW0A 1MD9A 4AG3A 3SYLA 3H84A 1EGQA 1YA6A 1DC4A 1UCFA 4UHKA 4UXIA 4IUCS 1L5LA 4RAQA 3WB0A 4YS6A 2CXQA 5JXHA 4G5FA 2GFIA 2WUWE 3MBIA 4Q01A 1JAZA 3DTTA 1T5OA 4IIDA 1WS6A 4UE3S 1E61A 1YDFA 4CLRA 4OQMA 2A9VA 4L3OA 2ID4A 5CDHA 1SVOA 2AGVA 1T9KA 4JU9A 1K97A 1S7GA 2R2GA 2ZAMA 3B13B 3C45A 5AJXA 3U4DA 3V32A 4HAWA 1MC5A 1P74A 1Z5GA 2OQVA 3WMXA 1JDVA 3EVDA 3QX3A 3C3YA 4URHA 3I01M 5AW3A 3PG5A 2EATA 2P30A 3T1HB 1O08A 2ES4A 1ADFA 1RQ2A 1LK0A 3EPLA 4PBSA 4ZQGA 5DK6A 2DY0A 1NM5C 3LC1O 4XDHA 1MXHA 3ZJYA 3Q3HA 3W6ZA 1D6SA 1C3VA 4BC0A 1DAKA 1VI5A 2XVXA 4N40A 1OI2A 4BRWA 3ESZA 4Z4HA 4NOLA 1N5RA 1NN1A 1WA5A 5E6SB 3QTBA 2E82A 1JMKC 1C1YA 1LX6A 3WYDA 1XQWA 2OK8A 2W0MA 2HNAA 4CLDA 5CBPB 4MIKA 5DM70 2JHPA 1E2GA 4ZVOA 3LYUA 3IUJA 4CLOB 2G3YA 1WV1A 4INOA 5I7UA 2OZLA 3BXFA 3M5PA 4HNHA 4KQ1A 2DWPA 1ZXXA 3UBMA 1ZUNB 1BQEA 4M3NA 3SR4A 4DBZA 5F2EA 3OPMA 3EGXB 1WOYA 4PG5A 3FPFA 4RHYA 1ZHOA 1NP6A 3DXFA 2QXYA 2PYDA 3LKDA 4RIEA 1ZMXA 5BWLA 1Z8NA 2G8LA 2GRUA 5CD9A 4LHEA 3WGQA 4B6FA 5HDQA 4BO6A 1YGYA 3K92A 1RM4A 1EWVA 4E3ZA 4BMCA 3VPBA 3AGQA 3D1JA 1KJWA 3EK2A 4BJHB 2XHZA 1SCAA 2PGIA 3AONB 1OC4A 3BXZA 3KG2A 3LUFA 2QY9A 4X0EA 3ER6A 3LPMA 3O1HB 5LZ2A 2ISQA 1GRNA 1HYQA 2B5WA 3OFJA 3ELVA 4YB8A 5EKXA 4BJ6A 5JS2A 2EG9A 4X6XA 2MSEB 1LC0A 4LX8A 3CBGA 4IFBA 4U2BA 3WIUA 1U2QA 2DTDA 2RIRA 3P32A 4OSOA 1DBVO 1Z6ZA 3GR6A 4TLDA 5KINB 4EECA 1FDIA 1DAMA 1UWKA 3RLFA 1QZUA 3MRSA 1RYDA 3N7TA 1VJTA 4YDSA 5A4FS 4F1JA 3EG9A 3OWHA 1PDWA 2HT6A 3H8JA 4GS5A 4C21A 1DP4A 5AIBA 3NC1C 5KNCA 2PL3A 4BRSA 1T0IA 1XTVA 2AYYA 5I7EA 4BBPA 1QIEA 4KK3A 3L5OA 1LLFA 3QVSA 3FPGA 1YHZA 4PZ0A 3LNCA 5FAXA 2CJYA 3VPDA 2ZUTA 3HTXA 2R5FA 2RHLA 3AUFA 2H2FA 2DFTA 2KB0A 1NW6A 3H0KA 5K4HA 4EVQA 2ZAOA 4PBRA 1WV0A 4QLAA 1N3BA 2ZRQA 5JTUA 1JFTA 3SY8A 4HAIA 4WCFA 1XA4A 1RYFA 4JDUA 4Y1FA 1XELA 2GAJA 4DW8A 4Q05A 3KVNA 3ZEIA 3JS5A 4G2SA 1DEVA 3C6QA 4BUCA 4YRLA 2ODBA 4ZZ1A 1YSCA 2FWJA 1JEOA 2V59A 1ZEMA 4YP6A 3N59A 3SEZA 4ENQA 4F4HA 2ZVPX 3VJKA 4EQZA 1VE1A 1HWYA 1G8MA 1OXBB 4XQ0A 2RAFA 3DWIA 4CODB 1LLCA 3LL4A 5K0NA 4ZIRA 3DKPA 1U9CA 1J7KA 4KLCA 1NMEA 1JDBB 1CPYA 1CZKA 1EK1A 5AHWA 4COKA 4CM6A 1WDWB 4RDCA 5LFAA 5I7HA 1YFKA 3KT8A 3QXCA 1HEUA 2WIJA 1UP6A 4LY0A 5CH8A 1VL2A 2X3YA 1NQTA 4YEDA 3RYCB 3UZUA 3PUZA 3M0EA 2RAVA 3OQ1A 4QOHA 3GEDA 4XIYA 4CJXA 2VJBA 4BWYA 2R11A 1H42A 4ZZ3A 2H11A 4WN3A 2CC2A 3TNYA 4AN0A 4B6GA 1UFOA 3O9VA 2IF0A 1VE5A 4WZBA 1BOFA 5CM2Z 2BFNA 5KKNB 3L02A 4UFPA 4F56A 1C3OA 1G4AE 2WRZA 4LJ6A 3STHA 4BVKA 4RA9A 1XPJA 2AA3A 1DSSG 1F2UB 5FI1B 2Y2VA 5LR6A 5DT9A 1AKVA 1QNFA 3RS2A 3A32A 3N3AC 4K9MA 2Q5FA 2C8LA 1EWKA 2PZ8A 3UO8B 1LBEA 2QRMA 4R4JA 3PQ5A 3KM0A 4PE5B 1P73A 3UAZA 3ORQA 1WZUA 2O5RA 4Y2QA 3W6UA 4RD0A 2OXRA 3S7TA 4PZPA 1BMDA 2C96A 1K75A 4JLDA 1N2IA 1HBJA 4CTJA 5HQTA 1O94A 2WABA 3A1VA 3KJNA 1JL3A 4MUAA 1O95A 1W5BA 1M3SA 2E4YA 2ZYUX 4RTQA 3EW7A 4HVLA 2OCDA 3KYIB 4UNIA 1NAHA 5YASA 5ENZA 1GITA 3ONNA 4X65B 4CG1A 4B4OA 2R8YA 2K4MA 2NU8A 3VNVA 5LP1A 1ZNYA 2PNFA 3SVZA 4OXKA 4HLDA 1SEPA 1A9TA 3ORRA 5DNCA 1B73A 3D3KA 1XO1A 4EDFA 1GZHB 4U2FA 3TIVA 3P26A 1QPGA 1TMKA 3DEFA 4EW3A 1XHEA 3FGPA 3USCS 2DSTA 5KTRA 2H1WA 1BO6A 4A4YA 1EK5A 1M2KA 1RU3A 2Q29A 3PNPA 2NUAA 3NT4A 1Z39A 3G9QA 3PITA 3IAFA 4WY5A 4QNRA 4RELA 3W77A 4UBKA 4FD2A 4I9UA 3AESA 3L0DA 4AF8A 3JAKA 3KJHA 4EHKA 3NKLA 4X84A 3GCDA 4GOMD 3RRBA 2AOTB 1A9QA 1CRLA 3F5SA 2I8LA 2D1SA 2PKQP 2VHWA 5KTNA 4PGMA 1I7SB 4QM6A 4LHXA 4PTZA 4A8JA 2ATIA 3DMYA 1T4MA 2Z5LA 3DMFA 2YJ5A 3FBGA 4QYMA 4N5IX 5DHFA 1P6XA 4B7XA 5F23A 2OBMA 5AO9A 3RF7A 1QWSA 4P08A 2FU5C 2PLRA 3EH2A 3IVXA 3L4EA 4R51A 2ID8A 5IASA 1DOAA 1J8YF 3EC7A 4GAEA 5EAIA 1LPMA 1NQUA 1NFQA 2BKEA 5K6TA 4NAVA 4R98A 5DGCA 1BS9A 3V1NA 3V8PA 2WT4A 4DRZA 1Z2OX 1M1XB 3FLMA 3ABZA 5FWXB 1JSCA 2X8JB 5E3HA 3DBHA 4C0QC 3A1UA 2NM0A 5DTEA 5JWHA 3GCXA 3INYA 3Q3GE 3A6ZA 2G5PA 4GF5A 4QNNA 1ILEA 1NU6A 1X80A 3K0CA 5TQ0B 1P0QA 4JU8A 4AZVA 5FPHA 3TQFA 4IHJB 1W0JD 3AYZB 3C3DA 4YTEA 3FZGA 4RCVA 3RIGA 3S70A 3R8FA 3RV4A 4B34A 5K8JB 4M1YA 1NAIA 3G59A 1WUJS 2V55B 4P82A 3VU1A 3L8EA 4YRZA 3H2JA 1J9ZA 2AQIA 3F7TA 4IZOA 5AKYA 1Z2EA 1Y3DE 4P34A 3MCTA 3D4IA 3QLTA 4IUBS 1M10A 3GD5A 3JQ9C 1FQOA 4PFSA 4Y1RB 1MJNA 1VGQA 3W4IA 1CW2B 2HA7A 3A10A 5EFOA 2WFAA 3DPSA 3UXEA 1WCIA 3H13A 1N6OA 2HSZA 4A2PA 1GYQA 5AR1A 2PJDA 3KXDA 3NONA 5TQ2A 3E2MA 1W88A 4BNHA 3EQ6A 5IJAA 3HMKA 2Q49A 4ATNA 4OLHA 1OJLA 2JRCA 3D7NA 1VMIA 4QUKA 2V7QD 1WKCA 4GOND 5HQJA 3BUSA 1E5LA 1VOTA 1XXHB 2CJXA 1MO6A 4PFKA 2C04A 2FN8A 1OI7A 2VPIA 2XQGA 3EEIA 3P5SA 4ZVPA 1OUMA 1II8A 5E2AA 8AT1A 4NV1A 1RRGA 1NTOA 1WSAA 1ZD9A 2P2LA 1Z0AA 4NRDA 5FF9A 3TFWA 1JEYB 3Q9SA 2ZBQA 5F35A 5F1OA 4PZLA 4QQFA 2K2QB 4ZAWA 3GUVA 1PEKE 1H85A 5EN4A 3A6EA 3D7MA 2RGXA 3PFWO 3U37A 1OPXA 2ZPAA 1G20A 4GLBA 2EKPA 1RZUA 1WVGA 4Z0PA 2OV2A 4QOIA 4RO0A 3TLEA 1MEEA 4F3RA 3F2IA 2I78A 3LQQA 4O5OA 3WL4A 2VP2A 4D26A 2ANBA 4DR6B 2A0YA 1OAOC 1MJ5A 1JGTA 2QZPA 1E3SA 3ECCA 3R0JA 1QHNA 1ORRA 1Z08A 4KTTE 3CNOA 4EVRA 3CG0A 3PFNA 3OZFA 5DPMA 4PAWA 1QJCA 3RUIA 5KTPA 4HYEA 1DQSA 1MOSA 3BWVA 4MR7B 4PPFA 4OHXA 1N77A 3QU5A 3DWFA 3TLXA 2Y71A 4MINA 5HM8A 2HTEA 3TRIA 3MTEA 1VIYA 3VTFA 1K63A 1FUUA 4QRDA 1TA0A 4ALLA 4CDRA 2A0FA 4IVPA 4NCNA 4R9UC 4ZQBA 3L1KA 1GEEA 4B7UA 3B5JA 1UP7A 3DDSA 2FDRA 2UZ0A 4LVUA 1FFSA 5F7ZA 3T95A 4TTRA 5CGQB 4YACA 5DLYA 3JZAA 4YJ3B 2XT9A 4JJ4A 2VSYA 1BXZA 2QVLA 1EDBA 2I55A 2XODA 3MMNA 4R8VA 1DXQA 4WUTA 3VPSA 3ICWA 2J3EA 3QYJA 3C5EA 1NC3A 3GRYA 5EE1A 4CF7A 2UVPB 3U09A 1QPBA 2DLDA 2FNAA 1PTJC 4LZLA 4EEXA 3DDOA 1ZJ4A 3C3JA 1QP0A 3ZJUA 3P19A 1ZBDA 1X7ZA 3R0IA 1Z7GA 3V4PB 2E2WA 1KYXA 1Y6RA 3F8SA 1PTKA 1ZAYA 4DDKA 3K9NA 3NVKI 5ICMA 1IOVA 3TWOA 1UKYA 1YIDA 2C9ZA 2FW6A 1XA3A 3JQDA 3FR7A 1TUBB 2BCJQ 4E32A 3UJNA 4JX9A 3KYCA 4YP9A 2CL5A 2W6ID 1T2EA 4UEWA 1H8HD 3ND8A 2YRWA 4CU2A 3LUHA 3GELA 1OWPA 3TPCA 4B1FA 4EJ2A 5ELXA 3AJ9A 4TMVA 1C1XA 2C5EA 5DOVA 4JI8B 3BGSA 3O94A 4FOPA 1OX6A 3IE0A 1EVZA 1CXZA 3LVBA 4CQNA 2C92A 5HIKA 3AF4A 4AY6A 4X90A 1W59A 2O54A 3Q5DA 5ARBA 2HBYA 5CB8A 3Q9NA 4AN4A 4OHCA 1UFQA 2ZJOA 1HG0A 1SBZA 3PD7A 4ZXFA 2RC6A 1W1UA 1W1WA 1Z73A 3L43A 5JXGA 3MUFA 3B3QA 3NORA 1Z33A 2FK8A 3ENZA 3EPRA 1SCQA 5IXJA 3ZY4A 3BCUA 4MA0A 1YI0A 4V38A 2ZS8A 1PR0A 1WPQA 1JHAA 1APBA 2MSDB 5AW2A 3H11A 4OYYA 4WK0B 3PD0A 1U7XA 2LR0A 3GROA 4Y7DA 5HF9A 5EA2A 3HP7A 4EZIA 2I9KA 2CWDA 1JQKA 1X3LA 2R85A 5EIHA 1L7NA 5AM4A 1CQPA 3CUUA 1NW5A 1TCUA 4YAFA 1QZXA 3SPXA 4D46A 3DZDA 2JGRA 1GPJA 5ED0A 2JIOA 5JRZA 1HFJA 3ZD8A 5EJHA 1ZZEA 2ZTLA 4OL0A 2VBCA 2H2IA 1KSJA 3UMJA 3HCAA 5B36A 5HJ7A 3IJRA 1A82A 1PW7A 1HQDA 4B87A 1UAAA 4O0MA 4GI7A 2XNDA 4MJXA 2ZJ5A 5DGHA 4HATA 5LWHA 4JLNA 2O2YA 1D04A 3AUUA 4NATA 4KE9A 4BQIA 4EI2A 5T6MA 3B48A 2NPFA 4EM6A 2QTGA 4FGJA 3VYUB 4MKXA 5BUCA 2QYTA 5CCEA 2XAUA 4LDZA 3SDZA 2IOFA 5KYXB 1PX2A 3O47A 4PLPA 1XZMA 4P83A 4DLRA 3MPOA 1N6NA 2RHDA 3O73A 1PVDA 2W6JA 1WL8A 3K5PA 3T52A 3DUWA 3MOIA 1P1FA 4FN5A 4YCJA 1G7CA 1GTL1 3HY4A 5ITWA 5KCZA 2Z6AA 4Z9XA 5H80A 1ZIOA 5C8YA 4A23A 2XA2A 4O4IB 3PIRA 1RAAA 2VRCD 5FOUA 5JATA 5BQ3A 1H1TA 2F1RA 2DAPA 3F5QA 3H0EA 2FMIA 2J7PA 2HXSA 2JI8A 1DWUA 2FLVA 1TQ2A 4WESB 4I81A 1SXJC 1VJ0A 4OIFA 3GGDA 3GVIA 4JSYA 4BC1A 1IFXA 4L5JA 5HSGA 3VA1A 1XTQA 1G5RA 2JCYA 4X61A 1OH8A 1Y3BE 1W0KA 3PQ4A 1Z37A 3BXGA 4R2IA 4Y67A 5H68A 1WMSA 2O9JA 4DMRA 4CM9D 1KI3A 3HPQA 4EPRA 3WMRA 5CBPA 4NPCA 2ZAIA 2C4WA 1NT4A 1K4KA 5SZHB 4RKFA 1J5PA 3AEZA 2YX1A 1MVNA 5FNZA 1AGNA 1YOVB 2CLCX 1KOGA 4HH0A 2O0JA 2K7FA 2WVAA 3EGXA 2ZRLA 2PWAA 3NR2A 3U16A 4FUQA 1W85B 4FFLA 3RIXA 1NBIA 1LVHA 3N75A 4GWKA 4UNPA 5IC6A 3VDMA 1U0FA 2QB5A 1GZ5A 4NG4A 4HSGA 1PRYA 5CMLA 1X3SA 4G4GA 4JYPA 4ZO8A 1A88A 1XDBA 4TZTA 1C0PA 4HDKA 1RR6A 2D0DA 3V7WA 3KOWA 5I8ZA 5E1DA 4D25A 3I42A 1RMYA 1K3UB 2X2FA 2I4MA 3BXHA 4KCGA 1X9GA 1EGVB 3RVDA 2QBYA 1PJTA 1CS0B 2IYPA 3CR7A 4LMRA 4GXTA 5F3WB 1OFVA 3SS9X 5EJEA 3P4UA 4JXXA 1T2VA 1RKBA 3GRUA 4OMFG 2C1EA 1MB9A 5FTMA 3MQ4A 2CSXA 3IGFA 2RARA 4FT4A 2FW8A 3CNHA 1OD6A 4Y9TA 4NMMA 4NZMA 4DDTA 2H1SA 1B6GA 4FBMA 1ESDA 2GEFA 2MSKA 1B2LA 1D2NA 1PHPA 3RSHA 5G2OA 4YCAA 3EZYA 5KQGA 1J1ZA 1E9RA 1IY2A 3BZUA 2QPLA 1XF1A 3SWWA 3MOGA 1N25A 4E5PA 2YOFA 3RO7A 2O8CA 3TTSA 5AJWA 1ZU4A 4LVCA 2GEVA 1J1IA 3OEHD 3VMMA 2J0QA 4BO4A 4PO9A 4HWPA 2RH8A 1OW3B 3ZE2B 4WLNA 5AVVA 2W2KB 3KOYA 3EXHB 3I6WA 5CR9A 1GG9A 1L7XA 3ESBA 5E1OA 3EZ9A 4N7MA 4X3OA 5K99A 4H1WA 2Q1TA 1CU1A 2H54A 3DE4X 3A6PC 2PZMA 2PPVA 1FL9A 2C3UA 3KQSA 1LV8A 5JS1A 1TF7A 1L5MA 2ZR7A 1NLUA 3OLVA 4Y7CA 5DE3A 3KTAB 4Y9UA 3DP7A 1M66A 1OA1A 2VHZA 3NBUA 2F8LA 4LPSA 3SM9A 3TRDA 4UNNA 4URFA 3INRA 1VYTA 5TMEA 3BIOA 3RS3A 3P71T 1J1UA 4KZPA 3ZCSA 1WMEA 5LZ7A 1QO0A 3HJNA 2ACKA 2QE7D 1Q7EA 1GQFA 3HJCA 3PQ8A 4XJXA 1KYYA 2A9PA 2ADFA 2LBPA 1NMZA 1W9MA 2VSNA 2ETVA 3I0ZA 3BXPA 3S1AA 1J21A 3ZV7A 3KDSE 5E8JA 3F4BA 4A5OA 2D5IA 4ZQCB 3RYCA 1JEAA 1SUEA 3QWHA 3RC9A 4OREX 4WA7A 5AM2A 3G89A 2G88A 3LPCA 3NAMA 1R4ZA 2GCIA 4O4LB 1E6KA 4WSOA 2NUBA 4KXNA 4FKZA 2IPNA 4PC2A 3N6VA 3LZ6A 1U4OA 1XX6A 4K9KA 1GZ6A 3KFXA 4KR6A 3SMVA 4D9VA 1RLIA 3PC6A 1JR3E 2A7XA 4TKZA 5HIMA 1ZLYA 1P1CA 1ZESA 4B17A 3PICA 2TRSB 2Z9BA 1U0OC 3QLEA 1J22A 3H5OA 2X9GA 1UR5A 1XLTA 1JLSA 1JQLB 4FOTA 4QVGA 4AM8A 1B6SA 4AT1A 5IM4A 3MFQA 3D81A 3T1NA 5J2UF 3RVPA 2ICAA 2FSVA 2IRWA 2R44A 1RE0A 3MINB 4K2HA 2G83A 5CNMA 2ZRJA 2Z56A 4NBNA 1H2YA 3DS8A 1QQ6A 3HYRA 4GNRA 3V7NA 1OWMA 4Z99A 4JJZA 2QP3A 2PR7A 3V8RA 3MAGA 3RYHB 4LRTB 5IJ9B 2PUBA 4JXZA 5B4UA 2JD1A 5LOVF 1PJBA 1R4AA 2QJWA 3KAJA 1YCHA 2DHEA 4NH4A 1TM4E 3H2ZA 1GPYA 1FJ2A 1KEWA 3CEMA 3PDHA 2FZGA 3WIVA 5ALDA 4AYXA 4YXFA 1OKKD 3UA3A 2HSGA 1VE3A 2HJHA 5AXAA 1SBTA 4NBUA 4OXYA 1QYWA 4QPDA 4E09A 3DE5X 5FBQB 3GJ4A 5FYDA 1SBYA 4PM4A 4RANA 3ZCUA 4ERNA 3CB4A 4IAOA 1T15A 1COZA 1J25A 1Q1NA 3A11A 2NO9A 1LF0A 3DAOA 3GJ0A 3GZTB 3G2LA 3DXXA 3N53A 4MVJI 3RI3A 4B81A 2XDWA 1VSBA 1I3MA 1JDPA 2JLYA 5C37A 5KS2A 3ESCA 4R1TA 2ZVDA 5AI9A 1H5NA 5E4TA 1F2DA 3K8QA 2Z5GA 3CLHA 4WJZA 1JB9A 3OJ0A 4TT3D 3AIOA 1MGPA 4KSBA 2IQIA 1KKMA 2J9ZB 4FUTA 4P4NA 2G25A 1XTPA 1IY8A 3K70B 3H5NA 2VDNB 4C0BA 1X9HA 2QAGA 3MB8A 3TTXA 2YN4A 2VI5A 3GP5A 3I28A 4B2YA 4F5YA 3AF3A 2GZ3A 2VJCA 3QH4A 1XD8A 4CM3A 4LK3A 3O8BA 1Q0RA 4HN2A 5E8RA 4BNXA 2Z9DA 1FS5A 4CM8B 5A4AA 1W44A 3C85A 3HDJA 3WGOA 4AAYA 2YXLA 1ABBA 1HMPA 5KYYB 3O2SB 4YHHB 4G0UA 1EH5A 5FWXA 2X8JA 1OFHA 3DVSX 3RYFA 4Y9RA 1YH3A 4FNOA 4UAGA 3WMFA 4NZ9A 3IUQA 2NVWA 4QFMA 2FVXA 5I5EA 2H0AA 2WYUA 1PW5A 4JC5A 4MUXA 1M74A 3QKSB 5TQ0A 4ZOEA 3G3EA 4KN9S 1R2QA 2A9KA 4KO8A 1JG4A 4UTXA 1U8ZA 1FYFA 1DJPA 2FJ0A 2Q4TA 3IEKA 3O2NA 4S1NA 5AW8A 4MGZR 1Y7LA 2ZETA 2ACWA 4EA6A 1K5PA 4R7TA 4GYYA 1MC1A 3MSCA 4ZHSA 1I6MA 1DBRA 1LI5A 2D5CA 1N2ZA 2GLUA 3IEIA 4XDGA 2IDKA 4D43A 1Z4PX 4WXPA 4F2WA 4NXNB 2IIVA 4BUZA 4BU0A 4M7PA 5H3HA 4KXMA 3R5TA 3KLBA 2J0VA 2CK3D 3FMGA 2HWKA 1LW7A 2QAJA 1O2DA 1MFPA 4KB5A 1CP2A 2A5LA 3COVA 5KOJB 4HQLA 2IYOA 3ED5A 1FP4B 1I3NA 4V0LA 5AIAA 3TLCA 4DUGA 2AEMA 3JWHA 5JG7A 2ZIZA 4G8DA 4I19A 1UZAA 1FEZA 4UHJA 3RANA 2VYND 2ZT6A 1X1AA 1GO2A 3TQIA 3LXXA 3F9CA 1PG0A 3T15A 1KDRA 1QOZA 4XJVA 2HEIA 2HF2A 3OX4A 1XXHA 4OYLA 4D92A 4DVGA 2Z5VA 1B26A 1SC4A 1P81A 5ED4A 1VI6A 3NBMA 1E0DA 4OUDA 4EJMA 5DWDA 4NU5A 3EC2A 2ACVA 4FWBA 2HPHA 1DKNA 2TMGA 2QMHA 1JV2B 1NA5A 4BO3A 5JSFA 4RJIA 1O4WA 3T5GA 2ACEA 2WVGA 1FYVA 3ITNA 3UJHA 4DM7A 2FX5A 5LQSA 1RWBA 3RGWS 2PZLA 1HSOA 1X42A 4JUFA 5LMNB 3DFFA 3KKNA 3SZ3A 3CLKA 3VYRB 3L7AA 3UK6A 3NJRA 1DC6A 3K8OE 3EARA 1LXCA 4FYMA 4JVSB 1T1IA 2B4TO 1T5SA 4OGKA 4KH1A 3BWDD 3VGPA 1E69A 1GHTA 3PTZA 5JMPA 4IV0A 1NHGA 4DT1B 4YUVA 1ADBA 3JQAB 4QTYA 3KP1A 1D4FA 4M8IA 5AOVA 3W2HA 3FVRA 4MGKR 5H9VA 3F6BX 3N05A 1ZUIA 4DE5A 2C1ZA 4NYIQ 4IXDA 1YB5A 3E9QA 4KXWA 3ZQKA 5BMVF 1OLSA 4B80A 1YQXA 1FYDA 4MWCA 2QTZA 4I6JA 4MKHA 2GKGA 5JDCC 3P0JA 4ND2A 2V5AA 1LVUA 4YJ3A 2P4QA 1EFPB 4JB8A 1WBDA 4RD2A 3UHOA 4CKCB 1UPCA 2ZDHA 3H6KA 3PCTA 4BFTA 4ER3A 2B7BA 4XWGA 2DT8A 2QQFA 4BTLA 3T4PA 2CJFA 3LUBA 3LHFA 3C87A 3ICPA 4FOLA 1GU0A 4D9CA 1J8VA 3JYLA 4RHUA 2GN2A 4N82A 5FJJA 2C5SA 1P18A 2GN4A 2VJLA 5CDFE 1P7WA 5AKHA 5D7BA 3WNBA 3U4HA 1FLAA 5F7OA 2HMTA 1AGXA 1Z5PA 2AG1A 3I8OA 5IP5A 1EQ2A 2OVFA 2NMVA 5LYJF 1TUBA 3G0BA 3T7KA 5K45A 5ECWA 3MC1A 1ZPDA 3KQMA 1N6LA 4PRLA 3V7UA 5B3JC 3U13A 2PGJA 3FBWA 3R9WA 1P0FA 4YJ2F 3VHXA 2OXEA 3TQCA 5LYYA 5ALEA 1VRVA 2H00A 4PAGA 1QB7A 4F9TA 3LZCA 5A3JA 4FQ8A 3TBKA 3NFYA 4UJ3A 1MEJA 3RM3A 2VNIA 1W2GA 3ILVA 5A02A 4A0SA 3IT3A 2LKCA 4XIGS 5KKCA 1F0NA 2PRZA 4H3KB 2Q4RA 2QNRA 3AF5A 3I6QA 4XE5A 1IZ7A 4UM7A 2Q6KA 3WADA 2CEKA 3H9QA 3A4NA 3FYCA 3MJHA 2W6MA 4OMCA 3RJ5A 1TK9A 1MOPA 1QTNA 2OYCA 1A7UA 1XZFA 4M37A 4F8EA 3LYLA 1J7JA 1HK7A 2GYYA 2MYUA 2VQEB 1HXHA 2PMWB 1ZUWA 2RHWA 4J0IA 3TPFA 4EKYA 2JDID 4BP8A 2GXSA 1A97A 3G0CA 1I2MA 2MTBA 4MVJH 3RWBA 1HLFA 3ZHBA 3OTOB 5CPBA 4EJ0A 3OMXA 3HX1A 2UYHA 1ZSNA 3OOEA 5CTAA 3VV3A 1JR3A 3Q8MA 1DJLA 1RPNA 3M49A 1WHSA 1WRBA 4JYAB 1HLDA 1QG0A 3CEAA 4UMDA 1G5TA 2M6LA 1NPDA 3A37A 4IRMA 2VZLA 5FOWA 3W3ZB 2W2QA 4CKXA 1N1EA 2BFDB 1Q95A 1XZBA 3BE8A 2XGOA 2Z09A 5KYXA 3R7WA 2CCJA 2G1JA 4GP9A 1TFUA 1VMAA 2PGNA 4JBWA 4XLTA 2EIHA 1O0SA 4G4SP 1Z12A 1EA7A 4E2YA 1TXGA 4DJTA 1MORA 1UZUA 2NYVA 1UFRA 3B70A 2GARA 1QZZA 2HC9A 4AS2A 1ADCA 2MU1A 4O4IA 3AETA 3IT0A 2Y1LA 4NJMB 2Y99A 3KAQA 4GE3A 4CXMA 1ZGZA 1XEWY 1N32B 3KQKA 4J1TC 3RTGA 3W1WA 4B6JA 5BSVA 4F38A 1ZD2P 1J4QA 5FFNA 3PJEA 1QK3A 2JCGA 2UXCB 3R4VA 1WO8A 2XCTB 1VHQA 1YQGA 3IBYA 3R3WA 2H7CA 4XD7D 2C4TA 1YR2A 3JR7A 3F7NA 5IWCA 5G40A 2PKEA 3SOZA 4QTUB 1YDEA 4UEQA 1F06A 4DLUA 5HRUA 2NYAA 1EHCA 3N70A 2QX4A 2B82A 5JOQA 2QL6A 2PZKA 4PGHA 3NEPX 2HAEA 2E18A 3UAWA 5EEGA 7YASA 1FZTA 2CLKB 3LC2O 4KLRA 3U3XA 1YOVA 1TVCA 3DZHA 2ZJAA 4I55B 4MV4A 3OJCA 4E5NA 2GJSA 5DEOA 3CH6A 2VWPA 3L8HA 4DARA 1ZRMA 5FPYA 3FCCA 5ADVA 1AB5A 2VT7A 4KO2S 1DT5A 1W85A 1QK5A 1YASA 4AVYA 1XZDA 1YVDA 1TYAE 2Q5HA 2F67A 1UEJA 2HIAA 5LDGA 3H3XA 3ZBQA 4BVLA 3U60B 5GOTA 3T7CA 4JJEA 4B44A 2GCNA 2PGLA 1P8AA 2JGDA 5H81A 3U9LA 3JQ8A 4O2RA 1U3FA 3ZQ6A 3C3CA 4TTTS 1IZ0A 2J46A 3D2BA 1L4FA 4JP8A 3RSGA 5HM6A 4FYXA 4R1UA 3RROA 4HB3A 4A82A 4AYWA 1CS0A 2A9QA 2WSSD 3B6IA 4H15A 1U7FB 3WB2A 4GFDA 3F1KA 3VYSB 3RSZA 1VGVA 1RHJA 2WILA 5AW6A 2C0QA 2ZOSA 3OU2A 4JGBA 3MQFA 1X8KA 2BM1A 1P8JA 3JSAA 4UNRA 3B1JA 4OQYA 4C2AA 2CVZA 1CUWA 2II6A 1OGJA 2JEOA 2G9NA 1A98A 1T1RA 5JARA 1V4BA 5FLEX 1TEZA 2JHCA 4DMGA 1ID8A 5LXTF 1RYHA 5AK6A 1P2TA 5A06A 3DYIA 3F3SA 3TRFA 5A9SB 2IXDA 2ZSJA 5IH7A 3ZHRA 5ENVA 2GJAA 2H1HA 3I34X 4QE3A 5DCYA 1XQVA 2BMVA 3WGLA 1R21A 4D8UA 4DIKA 3MJEA 3Q7RA 1H6CA 2W2KA 3EXHA 3VKHA 4BQOA 3EULA 2GN9A 3C8UA 1V16A 1XC7A 2J9FB 2CVOA 4YP7A 3O8QB 4IJWA 4D9FA 2HWWA 1ISFA 1OZGA 3H75A 2WP0A 5BYJA 2CCGA 2J3HA 2RGNC 1V8DA 1BQ4A 1PU2A 4TL8A 1PDVA 2RFLA 5TIIA 2Q8NA 2H2HA 3IQFA 2VHVA 2VSOA 2NZJA 5DNUA 5FV4A 3N8GA 4YBRA 3Q12A 1EEXB 1GCIA 1KYQA 1XVIA 3N5CA 4HXFB 4C5BA 5IVPA 1YZHA 3P9ZA 1A95A 2AB0A 3P2EA 4L8FA 4MWZA 3VKWA 1USWA 5C1PA 1VFNA 4IIBA 1H3FA 3DZIA 1FNSA 2ZJBA 2AJLI 4GOLD 4CE6A 1SXIA 2XLCA 4HFRA 2P6OA 1ESZA 1T2AA 2XQVA 3UAOA 4BQRA 3LYAA 1Z4MA 3MWGA 3LI2A 5DLEA 4M1TA 1GNLA 3V55A 3VX4A 5D3MB 4DIUA 1H8EA 3FPCA 3HVUA 5MDHA 3U44B 4JT9A 4EFKA 3U9SA 4DUGD 2A1TR 3I2HA 4O4LA 4LX0A 1HL3A 2VJMB 4DKXA 5C81A 3SJUA 3RKRA 3TFQA 3VX3A 1AA6A 2NV0A 3AI2A 4G1CA 4M53A 4Q3LA 1DUSA 1TZMA 2QXTA 2HHHB 1GG8A 5T3YA 1XI2A 2R8RA 3HDYA 5LD2B 1H6BA 4RZUA 1BQ3A 2G9VA 2I7DA 4GMDA 3DCYA 4MUJA 2WW8A 2QZZA 1WZNA 4Q7KA 4WOJA 1OBHA 4FFPA 2BI4A 2HMWA 3HEMA 3P94A 5LZ5A 2FPXA 3T12A 4BNUA 2X6RA 4JYCA 4IGKA 2FN7A 4RPCA 1RW4A 2XCOA 3PNVA 2A4MA 4V0MA 5IULC 4FCCA 1DRUA 2O0HA 1CNEA 2GBIA 4NOKA 2FX3A 2NO0A 3L07A 1Q1GA 2QM8A 2YHIB 3O4GA 4JR2A 2GPWA 3HUUA 1USVA 3G85A 3TAHA 1CR1A 5J2TF 1J4PA 4RORA 3V1LA 1U7PA 2OCGA 3JD1A 3MINA 2AEFA 3GFPA 3L18A 3L6OO 4N0QA 4AULA 2FVYA 3U4IA 3PGLA 3RYHA 5FUMA 2EEPA 4KV7A 1UT5A 5K51A 5IJ9A 2GSDA 5DM60 2OHFA 5KJFA 3FWZA 4K6KA 3DFZA 4LQDA 4QUAA 5AW9A 3FTDA 4BNKA 4P0PB 4CPDA 3H16A 4M36A 2WKWA 4CTOA 4IQ8A 2GAAA 2H51A 4KE8A 3D7KA 4RY0A 4NDZA 5CDFA 1YVEI 4IO0A 2FW1A 3TDNA 1JS1X 2W5UA 3OTGA 2QGNA 1JE0A 1Q1AA 2C5AA 4Q21A 1K5DA 4FKBA 5AVJA 4DNXA 5HTKA 5JYDA 3GPIA 4Z0HO 1SUDA 2BISA 4IDFA 3NNSA 1TYEB 1UKAA 2JKZA 2WT9A 3PFBA 3THWB 2COUA 1GTSA 3LDHA 3E82A 7ADHA 2AN3A 2SNIE 4ZVTA 3AFIA 3KCNA 1SK8A 5COAA 5GJCA 1D2GA 4E94A 5HOQA 1EXDA 4B3IA 2IKSA 1EM6A 2JLAA 4MWBA 1LC3A 5F1KA 3W8NA 5J4YA 3BYZA 4L6AA 1ZGJA 1D4AA 3Q7PA 2VKTA 1O97C 3KOMA 1JIIA 3UB2A 3HY3A 1KXJA 2HRRA 2OAEA 2XOXA 3NT5A 3OTQA 1GGVA 1ZP6A 3OKFA 1Y7TA 2EZUA 3W3AA 3JX9A 4AMVA 1ZN2A 4HUTA 1B0PA 4TYNA 3WTCA 3WGMA 4Y2HA 3LPLA 4LHVA 2O6LA 4CQMD 3VH4A 4CV3A 1L9KA 3JQ6A 1L2TA 4R8RA 4X85A 5HIAA 2I3AA 2J7KA 4L5BA 2QXUA 4G6ZA 4OHOA 3GA5A 1X8JA 5FXMA 2JI6A 3TD2A 4E6EA 5LNK6 1EYZA 1KA9H 1T26A 3MT8A 4X92A 1IJBA 1SUIA 2KWIA 3PV0A 4EMUA 1C3XA 2P35A 2Y66A 1G98A 3QKSA 1BCSB 5J59A 2ECPA 4Z7JA 1MG0A 2D7CA 4G5SA 1GGNA 3LK7A 3STVA 4E2XA 1PI3A 4HF7A 1KVRA 1M7GA 2IHTA 5ALUA 2IHBA 5BR1A 3NFRA 2A88A 3GN2A 4UREA 1P5FA 5COBA 1N2CB 3NLLA 4EUKA 5DTQA 1QAMA 1UK7A 1DFHA 2CF6A 2DWCA 2X41A 3ZV3A 4E4RA 2IYFA 3H6GA 1OIWA 4UUMA 2MR6A 3IQGX 4Q1BA 4MVCA 4DJJA 5JMTA 4FN4A 1BKSB 1QV9A 3KTDA 1SD1A 4O33A 4RVSA 3EJWA 1T9BA 3OAAA 4AW9A 2ATCA 2R8OA 2WLSA 3EIXA 4BZZA 1BHQ1 3OOJA 5HFNA 3G68A 2OGZA 4R16A 5KOJA 2EFCB 4NXMB 1FP4A 2H9IA 2P27A 5TRTA 5HF8A 1MX9A 3N9IA 4M1QA 2C7OA 1RJDA 1YO6A 3ZWKA 2MT9A 4M7RA 1OFGA 1X8XA 2YXBA 1PL0A 4B7AA 4DL9A 5DSZA 1A5SB 2OE2A 2OO5A 1C1DB 3H86A 3LC0A 3EYWA 4K9QA 4R1PA 2O8NA 1UXIA 2H1RA 4BFXA 2FPGB 5KDOA 2PGDA 1TAQA 2G07A 3KB1A 2CHVA 3CBQA 4IQ4A 3TLGA 1OIXA 4PSDA 3CSDA 5KMGB 1YVPA 3LZDA 2BP7B 1T3TA 3BTOA 4HUQB 4DLLA 1A9PA 3JQ7B 3K2EA 4EHAA 2XUHA 4ZVQA 1WNTA 2PMCA 4WRRA 3LBFA 1FMCA 3EX7C 4V0QA 1Z06A 2RG1A 3NHFA 3PTAA 3MTAA 3P0IA 4HZUB 3TM4A 1DOHA 3PXBA 1Y3IA 4P86A 4ALMA 3AXSA 4FHFA 4YQFA 1ICIA 2O8DB 2WU1A 4XJTA 4WLEA 4C2BA 2R6JA 4AZWA 3A4IA 4KHZA 2OGUA 3ZHXA 4IIJF 1XNQB 1XZQA 3LD9A 1MC8A 1QQ7A 2OZPA 4YJFA 3DW1X 3E0XA 4IGAA 2G9RA 5HGJA 1THMA 5G4KA 2R8PA 4PLVA 5TY0A 4AUEA 3OHMA 3UNNA 1ZCZA 3EXEB 5HGXA 1JSZA 3M5CA 3HVKA 4UUNA 5HKBA 5AVWA 4QU5A 4QDUA 5DB4A 3W5BA 3TQRA 5JERA 2VBIA 1COWA 5BSUA 2AF3C 3HFGA 4R3UC 3TF5A 4HPWA 2PZJA 1MX5A 9MHTA 4B9AA 2GXAA 4U6SA 1U2EA 4ZCSA 4LEIA 2I5PO 5IEBA 4C78A 1JLHA 3JQAA 5EJ9A 3D0RA 4M9XA 1OCEA 4N0DA 5FQOA 2N1MA 3LLUA 1YKSA 4WVFA 2NIPA 4IH1A 1UT6A 2OLJA 1NXTA 4YJGB 1J56A 3V4SA 3BT7A 1Q21A 3MCZA 1W48A 2WA1A 3RHZA 1D1TA 3CH7A 4AMZA 2I87A 4KQEA 1OB5A 1UPFA 1J9GA 1P2BA 2FETA 3F9IA 1XT6A 1JZSA 4WK4B 4P7KA 5SZIA 1EFPA 1NGSA 2DCUA 5I7WA 3AR4A 2HM7A 2BLNA 3ET4A 3AR7A 3O26A 2WNIA 2Z1DA 3REOA 1AH2A 4WQMA 5EWLA 2IXFA 1PT8A 4ITRC 4HWTA 2D59A 1FVXA 1CRWG 2FPSA 1KQPA 3AJRA 3E4CA 4EHDA 2EBUA 2UUBB 1RXVA 2XKKA 3SEFA 4RZ3A 4AS1A 5L4NA 2YCLA 3FNFA 3MIIA 5KIAA 1T34A 3I5UA 1V35A 4LF6B 1M5UA 1OX4B 4DKJA 2G5GX 3QELB 5JBIA 4HUJA 2BONA 1TJPB 3ESYA 2LTAA 3LBNA 4J9VA 4CT5A 1FY2A 1M34E 5EIEA 2WZBA 3IOBA 3ZU5A 3A1FA 4MWTA 4N6OA 3GY0A 2IYLD 1RYMA 2AX4A 5JYEA 2IOYA 2XIQA 1ZNQO 3AMVA 3BWEA 3I9NA 2HMAA 3MWLA 1V7PC 2O2GA 3ONFA 3L9WA 3FVVA 2YC2C 3TMYA 2V9ZA 2FR1A 4Q15A 3KJIA 1MFZA 1L4LA 2QF7A 3LUCA 4PZEA 4EG8A 2DULA 3N2IA 4MW7A 2VF2A 4RNCA 2FSIA 1NPTO 4MB6A 5F12A 4E5VA 1JIJA 5COQA 2GAOA 2B3DA 4ZKEA 1MDBA 2M6RA 3NH9A 2F6RA 1JILA 4IHAA 1J2EA 2GO7A 4BV8A 1TC1A 3ZU4A 2GN8A 2GBGA 3OZBA 1JZTA 1G6GA 3CZRA 3ZWXA 4IR7A 1V8OA 2BJWA 1DGQA 3BJEA 4ZXPA 3ELBA 3IQWA 4YGYA 4EH1A 2NTEA 1AX9A 2HQOA 3WRYA 4BZXA 1DKOA 3PP8A 2B4KA 3BMNB 3V7FA 1Y89A 1CUFA 1O7JA 1BKDR 4Q18A 1TW2A 3JWIA 5E50A 1AQLA 1U11A 3L7BA 4YIHA 3BGVA 3KQTA 2PQ0A 2FMTA 3FOWA 2WSBA 2OUIA 2QX6A 4KLZA 2F4VB 4J90A 2V03A 3EIHA 1JI0A 4DSTA 2EVWX 1E1NA 2JATA 4MPJA 3WLSA 2G72A 2BBTA 1DIBA 1N0IA 2XNJA 1IJFA 3VYWA 4KPYA 3I1FA 4ZHQB 3CW2A 2UYYA 3NEAA 2DUWA 3FMVA 1RRFA 3IVMA 3O1IC 4QGGA 5BWOA 2HCJB 4OYRA 4PQRA 2QYOA 3EMBA 2PD3A 2WAAA 4BVHA 3GXOA 3AEUA 2E4VA 1NC1A 2I2XB 3TIIA 1P80A 5I7VA 1ETHA 1V71A 4NJEB 4IYJA 1FFXB 3ETCA 4IDCA 4WBXC 2BMWA 2ZUBA 5CNJA 5C8XA 4HQNA 4Q9NA 3R3SA 4HDQB 2AF4C 5EL0A 1RXYA 5FL3A 1JXOA 3AIKA 1XVAA 4FCWA 5EP3A 3KQHA 3ZJ5A 3RKSA 3WZ2A 2FF7A 2GEJA 3HLYA 3MMSA 4RK7A 5HE8A 2EYUA 3UPUA 3SHOA 1ZVJA 5WRFA 2C2KA 2GBFA 5AK0A 4ZT4A 4UM9B 5KHOC 4S04A 4JLAA 1N2JA 1OLUA 1CY0A 2IOHA 1LPPA 3DA8A 3TQTA 2DT5A 1R18A 2J67A 3Q3EA 2P6UA 2ZIXA 1DXYA 1GDDA 3RIYA 1LA2A 2NSDA 2VBFA 2QDKA 4POOA 2BR4A 2XIJA 2Q3EA 3UG6A 4Z2YA 2AOVA 1U9IA 2RK4A 5JV5A 1UBGA 5I7AA 4TLEA 1OTXA 2GZSA 5HKKD 4Y0NA 4PLTA 3MG9A 2IY8A 5JNUA 4LWPA 3OP1A 3DSHA 1KORA 3R6GA 3QV1A 2BEJA 5LQNA 4DV5B 4I55A 3GF4A 5T3UA 1IATA 1PJAA 1CF4A 4A9AA 4II2A 4ER5A 1J00A 2PO7A 4Q1AA 1K3JA 3N2KA 4FXOA 1UWCA 5H0IA 3TAUA 1IBCA 4KN5A 1HRDA 1FNNA 3M5DA 4EFLA 4AKGA 1J5XA 4CMHA 3KUUA 4DIFA 4AQ7A 1KO1A 2UUAB 1F0KA 3T7JA 1JR2A 3UF0A 1U0LA 4I7EA 3QBTA 4OMUA 4TZKA 3BKWA 3D8NA 4IICA 4F12A 4UUAA 1HT1E 3BB3A 3AF1A 1JFLA 5DGIA 5CA0B 1WB9A 4MIYA 5B12A 3FHLA 3GQBA 2G0AA 4PPYA 4K5QA 4XUEA 1QIIA 2WU3A 3GT0A 4FBGA 4AD8A 4QAJA 4URWR 1M7HA 3I37X 4P3NA 3SNHA 1PDOA 3VC2A 4UBLA 4EJ6A 2EP8A 1WMBA 1LDGA 4YJKA 3LW8A 1NQ5A 3WI7A 1RXWA 3FIJA 4GGOA 2OG1A 1U7DA 4JCOA 1VIVA 3P0RA 4NU8X 4BWVA 1RAIA 4YMGA 4PYQA 3VVMA 1KK1A 3RUDA 4C0HA 4DLXA 4R68A 4BVFA 4Z3KA 4A8TA 4ZYZA 1AKYA 3KU4A 5BYBA 1IY9A 1RADA 3QJ5A 4L3WA 4F5DA 4ILEA 1L8QA 4QOFA 3Q2IA 1Q57A 5K3DA 1Y81A 2XT6A 1ZU5A 1PZFA 1PYDA 1R0CA 3GDFA 4UPVA 4AZ3B 4EA8A 1VZ3A 4OSEA 1ZH2A 4Y0AA 3KWMA 3NKVA 5SV2A 4ZK2A 1GU1A 2HGSA 2CHFA 1IRIA 3QVJA 2V4ZA 3SQDA 4QDXA 2D0PB 4XWKA 5L40A 3QKUA 2P68A 3VRHA 2I65A 1Y5LA 3KZVA 2I4TA 1QVVA 4E1VA 1HDIA 2IU6A 4MGIR 5DWQA 3EZXA 3UM9A 1SB8A 4LAFA 5CVDA 3ABQB 5K3EA 1G2QA 1EJ2A 2HA3A 3G23A 2GA9A 1FFGA 3O82A 4LQLA 4LWZA 5F3RA 3SZMA 2VQFB 4X8OA 3DSRA 3JR3A 3FYUC 4BWFB 3A4MA 1WZIA 2DPXA 1N0HA 4L08A 5FOVA 1WCV1 4EY5A 1T35A 5FI5A 1L4HA 1O58A 3A2MA 2NG1A 3HJUA 1KH3A 3UWPA 1A7KA 3ZTYA 4MJ3A 4P2GA 2QLFA 5FO0A 4A6DA 3IR6A 4JOQA 2ECFA 4LJLA 3C3XA 4IRXA 4U02A 1MT3A 2VJMA 3PTLA 3E1GA 4PLFA 5GZ1A 4OA5A 4AX4A 1K8RA 5KU1A 2C78A 5ETJA 4FS8A 1XMIA 1X7WA 1RWKA 5HS6A 3WLQA 2DQZA 1D0IA 5ALLA 2A9JA 1C4OA 2J5XA 1IDN1 3B6EA 2FWNA 1P4SA 3PC8A 1J49A 3Q4GA 4QYSA 5TT1A 2JA1A 2X8BA 5KJ1A 4WNCA 2ZJ6A 4L78A 3UWSA 3PENA 3JD2A 3FUUA 3EPJA 2CNKA 1YZQA 2O7NA 2BFFA 3GGGA 3EGWA 1CZHA 3SHQA 1BU8A 1DV2A 5JBNA 3CNBA 3EIFA 3K94A 4V39A 3T7RA 2ZZMA 2OORA 5HMMA 2ZSUA 2YHIA 1PO7A 5B6PA 5IPFA 1ZR4A 1J0CA 2OAGA 4MP3A 3FB4A 1R4MB 4K6CA 4TKVB 1A4RA 1BFUA 3G7SA 4AF6A 1T9ZA 5DP2A 3VSAA 4C20A 1UEXC 2BH9A 5IBCA 2K2WA 4G0OA 4GMHA 3WYNA 3ANXA 2Q28A 3CX3A 3TGWA 4REOA 1SAYA 2A30A 2XGMA 4IUDS 5I7OA 1SZJG 2OUKA 1IC6A 3ENQA 1U8CB 3RRJA 1PZXA 4CL8A 4L27A 5HK9A 2Q6OA 3TMKA 1SH7A 2FGKA 1KK3A 3U7JA 2IYNA 1JTEA 4X1IB 5KHAA 1IN6A 1PFUA 4IXTA 4RZSA 5CLLA 1YU6A 3C8ZA 3DTYA 3HP4A 5HKAA 3HZOA 3VR2D 3AU8A 5BOSB 4H1HA 3GJ8A 1YDWA 5DN6D 3HJFA 3MTDA 3FHTA 4MP6A 4CETA 3CXUA 4BZPA 4N18A 4URZR 2O0LA 3I58A 5JDIC 2W6QA 3OC6A 1JLRA 5ECGC 3UUGA 1M34A 1X6VA 4KJZA 1FDOA 3BILA 5J1TB 2DFNA 3UH0A 1UFVA 2VTBB 1XCPA 5JY6A 1T8UA 2V6BA 2W2XA 3PCXA 2Z0MA 1T1EA 4RPJA 5JAHA 1Y98A 2NV2B 4JYBA 4K40A 1QDEA 3HBAA 4L9WA 4E88A 3WRVA 3J81A 1OGIA 3K1AB 2C4KA 3M5WA 4KR9A 1UXOA 1WXXA 3RASA 1UDBA 3OPYI 1LNSA 4KQMA 3RVMA 4M46A 1IQ0A 5AUQA 2IFTA 5T4EA 3ZBPA 5BSEA 4HB0A 3PJRA 1DJNA 3GB9A 3KR2A 3OP4A 4GBED 4PR3A 1YCFA 4GNKA 1BAPA 1IVYA 3IS3A 2ZWMA 3E7FA 4K6GA 4CCAA 1ZK3A 1KNXA 4RYLA 3ONDA 3I52A 4NHOA 2CLOB 2PBFA 2XOEA 4LJSA 3OZXA 3T3NA 1QP4A 5JYCA 2I4NA 2XWSA 2FYTA 2GZ1A 3ZDEA 3EZFA 3ZJVA 4OFWA 4PZZA 1LGYA 4Y2GA 3D6VA 2HK8A 2HWXA 1E2PA 2VFAA 3IQHX 1LY1A 2LVBA 2Q4OA 3K6RA 2DXIA 5HBGA 1J2YA 3ER9A 5HZHA 2Z4RA 3LQFA 1N2CA 4XM0A 1H9BA 1ZMBA 4KOAA 1RE1A 4JI1B 1DCFA 3MAJA 4ZCQA 5CJ2A 1OPRA 4F6CA 5IYZB 3W8EA 2PLFA 2ZRPA 5JD3A 1GGJA 2WHQA 4PYMA 1I2BA 2C9BA 5CBKA 2BKUA 2V9PA 1NZJA 1STOA 4KFSA 2BRUA 1OHHD 1U6JA 3LA6A 3PIIA 1SMKA 5AM0A 5EPUA 2ERXA 2J9GA 4GPAA 4MJLA 2BGWA 3INNA 3KBBA 4AECA 2QPAA 2QTFA 4H3HB 2FP4B 3IDSA 1DT3A 4IVQA 3MXOA 1ZOIA 3TL2A 3X3HA 3W04A 1JKJB 4QXMA 3SYTA 1UC8A 1V1MB 4HC4A 4RIHA 4B5LA 6AT1A 3R1IA 2VTEA 2PSSA 4M98A 3T3PB 7AT1A 5JNLA 3PHLA 4F91B 3NPAA 4NBKA 3KWFA 1Z7WA 4D1YA 1SRQA 1L5KA 1A69A 2H07A 4NE9A 3KHSA 5TPZA 5IC4A 1U80A 2YNMD 2IZ1A 5IXSA 1R15A 2FPGA 4I66A 3EDQA 2XJ4A 1XQ1A 4D9KA 5J1SB 3B82A 5KMGA 4U8GA 2Q2NA 4X6LA 3QPDA 521PA 2BP7A 5F2NA 4HUQA 1Y7IA 3JQ7A 1N1MA 1PZHA 1EA5A 3EDCA 1X9IA 4UZFA 5EE9A 4LXUA 1QE0A 3HHPA 5BW6B 1CD5A 5D8DA 2W70A 1ZK4A 1DPFA 1JIKA 3CUEF 2EFYA 4DY6A 1XAIA 1YXMA 4QBGB 5DRTA 2O8DA 1Q7RA 4TWZA 1GPMA 4ZODA 3HACA 4FFRA 2GLXA 3IRUA 1Z13A 2TMDA 1VSUA 1BMTA 1JHQA 3LFTA 2XUGA 3A3KA 3FRIA 5CT5A 3ZY6A 3G8YA 1Z74A 2K5UA 1K92A 1ZH6A 1N0VC 1A8PA 3EXEA 4HNUA 2XVMA 4WKOA 2CDBA 4ZOQI 4TQAA 3TZBA 2AZXA 3WISA 3UCFA 1YQQA 4YV7A 1M2NA 2X4GA 3UICA 3CPEA 1RKUA 3KJQA 4HQFA 4UOEA 4PYNA 1XMOB 2EZ9A 1A8SA 4TSRA 3EA5A 3ZNNA 2AR0A 3O8OB 1SCNE 1KKLA 4KEAA 5ISMA 1CEQA 1QR2A 2QROA 4GU5A 5F2OA 4AQYB 4W4TA 1TPYA 3V48A 2XVYA 3W2TA 4EHIA 1JG2A 3H19A 4YJGA 4A27A 1U8UA 2AG6A 3IV9A 1VMEA 4NG5A 4RU1A 4IIYA 2XGGA 2V9CA 3TE7A 3K7EA 2P9EA 1KZHA 1S0UA 1XL1A 4BVGA 3FKSA 4IIUA 3Q8KA 2BH2A 4MR8B 3IHTA 1IHUA 1PT5A 1W4LA 2CMGA 2FEMA 4RENA 2C07A 3SZLA 4EB0A 9LDBA 3HR4A 3GYGA 4GXQA 1ZOLA 4LDPA 4JJ6A 5FBRB 4ZFNA 3NTUA 1KMNA 3CZMA 4C05A 5FFMA 2Y68A 1QTIA 1UJCA 4JP5A 4Q7MB 5T67A 1JPVA 1BIFA 1GIAA 1OLXB 2O4UX 2GQ0A 2OV1A 2ZI6A 4JVNA 4BNDB 2JFZA 2LIVA 1R1DA 3QFTA 1ZR2A 4CF4A 4UTRA 1Y33E 3K0HA 2ZBFA 4WI1A 1YC2A 5AW5A 3ROGA 4BE7B 8OHMA 1WLNA 2QP4A 2F1OA 3BMQA 3U26A 1P6UA 3QELA 3ZCPA 4LXQA 4ZGGA 5FPTA 1AQNA 3IA2A 1K2WA 1WUIS 1YVUA 4QSHA 2XEDA 4OB7A 4MB2A 3SNKA 4AMGA 2J6BA 5BNFA 2QLMA 3H4MA 4EJSB 3R74A 2D8MA 2IWRA 3SDBA 4O6VA 1C4KA 3RVBA 1N9GB 3R8CA 2JCVA 2WM3A 2QQGA 3GARA 3KUXA 3N76A 3R09A 5J40A 4OBXA 4F60A 1SU8A 1SVIA 4YAJA 3LP6A 5C8YF 1SIBE 1ZKMA 1DCTA 4U2DA 4ZT5A 2X22A 4PGFA 3RFVA 2PE5A 1ONSA 4ZT2A 1QGAA 4NP6A 1SXJB 2HNKA 3I2FA 2HDOA 2J4DA 4N5MA 2DPGA 4DLWA 3DF7A 1UFKA 3TQSA 3LK6A 2LP4Y 1NG9A 2DE0X 3VR4D 1CHNA 3A9VA 3ZZMA 2J5QA 2R8ZA 4R9RA 4TVOA 2ZI7A 3EW9A 2IYYA 4BKUA 4M9SA 2V5VA 3U39A 2BUAA 4QU8A 2HRBA 3FSGD 3A1CA 5A05A 1X86B 3BMNA 2AT1A 2DR0A 5CT8A 4P6VF 1O89A 2G9QA 1TYZA 3DCIA 2JJ8A 2Y05A 2YJ6A 3FM9A 1KHHA 4JJIA 2O3QA 1GA4A 1IJEA 4ENRA 4RTRA 4GEKA 1NNUA 2OHGA 3TOZA 3ZVNA 4B6QA 2ONYA 2AFIB 4YRJA 1E79D 2NVBA 2EJWA 3CNEA 2YY7A 4L51A 1CY2A 2FW0A 5T4BA 5CVJA 1CUJA 1NVFA 5G4LA 2IX3A 1CSEE 3JWEA 4BWGA 4R2WA 1CUZA 1G8GA 3W6PA 3R41A 2GETA 2EZ8A 4PZ9A 4WH0A 3JVDA 5FL7A 4N65A 4INAA 2P62A 2WAYA 4XYGA 4WCFC 2FPUA 1DAEA 1PG5A 4EF5A 1ZO8A 4R7GA 1J90A 1IXYA 3JATA 1HETA 1ZAKA 2CLEB 3JVEA 4IZHA 4DG5A 1T43A 3C16C 5PNTA 1ACJA 4YCSA 4C4PA 2FZ4A 4QHTA 1EP3B 5K0FA 2GYUA 2DLNA 2GASA 2GFHA 1A0OA 1TW3A 2JBWA 2AOUA 2YV3A 3G8AA 3AR6A 3ADOA 1CZNA 1KR2A 1SZPA 2XSZD 1BCRB 3ILXA 4CG2A 3BHIA 1V6AA 3A6JA 3OSZA 5JE8A 2QN7A 3GVXA 4XEUA 3HI6A 2VP3A 1F4LA 2W42A 1JKIA 5EWJB 4RADA 4C7BA 2TYSB 4GPZA 1J07A 4MRPA 3KUKA 1W76A 1UBSB 4I3HA 2P6RA 5K03A 4HNGA 2X40A 1IM5A 2A0WA 2INGX 1DFIA 4IF4A 4FMCF 2QIOA 3S2IA 1XWFA 2OY0A 2FSSA 4PBTA 2H65A 3CB2A 1OXXK 2KQUA 1N2SA 3DV2A 3G2OA 3QP9A 4HB2A 3X2FA 3ZV4A 5ALYA 1GPH1 1H2XA 2XA1A 2UZ1B 4DV0B 5JLAA 5G02A 4O4HA 1R5JA 4X93A 3BWYA 2IEDA 3UXYA 3AUXA 3ZZ0A 4Q34A 1T9AA 3L1HA 3IESA 3OEEA 3HSSA 3LXMA 3NYRA 3EAQA 3ZIUA 3I61A 2R79A 2LW7A 1C4WA 2PUHA 3IQIX 2Z8ZA 4FOOA 1QFZA 2BWJA 4NFSA 5JBQA 2Z6UA 2P8SA 5CA0A 3AERA 4R1OA 5HA5A 5TEVA 3L0IB 4YRKA 3WFIA 2ZE8A 1L1EA 4G8CA 4YK7A 1IRXA 2X9QA 4CBVA 2VHEA 4DA6A 4MZXA 3ANNA 3GVHA 1EVKA 1EZZA 3KQQA 2QIPA 3WJ7A 1O94C 1CIJA 4G2TA 2NUTB 1O95C 1YGPA 1JU9A 5EERA 3ZZ1A 1CQXA 2QT1A 4LZZA 4JI7B 3R7AA 4E15A 3EGEA 2PSHA 3KJZA 4GKAA 2QTBA 4FEYA 2X14A 2NTYC 5HJ5A 4HGNA 3P2IA 2BZ0A 4HLUA 3TQOA 3L3BA 1Z45A 2SKEA 1NMYA 1WF6A 1IXSB 1E99A 4ON9A 1FNDA 1HOTA 3LV8A 4A2CA 4ISCA 5AI6A 2A59A 1E6CA 2XDYA 1ZJWA 4N3NA 2R6FA 4AZ3A 3SU8A 3A05A 4AS3A 4QZVA 2VN8A 1TAGA 1UWLA 1Y63A 2ZRDA 3E15A 3KZKA 4JC0A 4YRNA 3DL2A 3KKZA 5HS4A 5JCZA 1JZQA 3BDVA 3JASB 4ARZB 1QYIA 1DKRA 3C6BA 3FUXA 1NVKA 1V4VA 2CYAA 5IM4F 2ORIA 1U2ZA 3AUJB 2BAGA 1E58A 2WJ3A 1GXCA 1E4EA 3P4XA 2JJ2D 1PBTA 3DAFA 4HBZA 4KSCA 2G7ZA 1A50B 2PRYA 4GLOA 1AB6A 2FUG6 3BE6A 4WFJA 5EOVA 4C6TA 2UZ4A 4ED9A 1QG2A 4AY4A 1TADA 3W6OA 4EQ6B 2DGDA 4A8JC 1M54A 4YJDA 3FFBA 1QGUA 1T8PA 3LCUA 5E3IA 2FSPA 4HPJB 4YN3A 1W5SA 5BO5A 3SQMA 3KV1A 3THRA 4D74A 5LNK1 3IT2A 4ZKDA 1PLKA 3NPMA 4KRGA 2ZULA 1JXQA 1OILA 4Q7JB 1CJVC 4OI0A 3AF6A 1RJWA 3E3MA 3LF2A 1CDZA 3L41A 1E63A 1O97D 2IBMA 5FWYA 3A58B 3FD8A 4IM7A 1K7SN 2PSDA 3LUDA 2DBRA 4KQIA 3UIEA 3WJ2A 2Q1WA 3TCXB 4AP9A 3TG2A 4Z53A 2R47A 3KXLA 4JJAA 2B8TA 1P9RA 1ZH0A 3A14A 3AY7A 4OQXA 1K6XA 1F8GA 3OETA 3NC0C 4E5SA 2YWFA 1KRWA 3BA1A 3C1AA 3K0CC 3MCUA 3UOWA 4BLQA 3EQ7A 1XGKA 3IAEA 4OLJA 1NJ6A 4HV4A 5NLLA 2HMYB 2YRFA 3NH6A 1H2EA 3UN0A 2ZBPA 5EQJB 5HR5A 1XD2A 3H9CA 2OVBA 3W1VA 1RHQA 4MX8A 4FYKA 2V8OA 2X15A 5SY9A 2IH5A 3BGOS 1OXKB 3HJRA 2FHSA 2OSVA 4RGQA 1M9NA 1T9CA 3ED1A 2KYRA 3LKZA 3M82A 3P2JA 4JXKA 1XQ6A 5B37A 4EIWA 1N92A 1XZHA 4K1XA 4D3SA 1UJMA 2J32A 3A4YA 1A8HA 1KY4A 3W8DA 5MFPA 4Q39A 3Q8XB 2VPYA 2QN9A 2YN2A 3IELA 1YRAA 5CHEA 1L5OA 1PN3A 1XAGA 1ISHA 2OBNA 4G2NA 1T1GA 4P4SB 1VKOA 1J06A 1GCOA 4EZEA 1MX1A 4S2UA 3DEZA 4WKCA 4H87A 1ENOA 3N2LA 1RCTE 1BX1A 1QFMA 3H2SA 3K9HA 3NIFB 4GRAA 4QYXA 1GY8A 3HB4X 2VSQA 2ZSBA 1WSWA 2JFWA 2Q2WA 3H42B 4ZAVA 3CF4A 5G3ZA 1MV8A 3LY7A 4IIGA 1G9SA 3ZZNA 5B7GA 3SR0A 1P33A 4JROA 1FIUA 3ETGA 4HDRB 1BE0A 2C9DA 3KLOA 4HS9A 4EEKA 2V6JA 3FCOA 4XIIA 4UPEA 3HBNA 5BNZA 3SEQA 1L3BA 5IT0A 1T2DA 5BOSA 1G2PA 1FJHA 3KR0A 5DLDA 1NX9A 2XV1A 4B4DA 4WX2B 4DAOA 1DV1A 1PGOA 5CT6A 4V1CI 5F1YA 1SD5A 3FETA 3UHPA 1SKBA 1NJ2A 1BXRB 4IEEA 2D1QA 4MUIA 4LXIA 4XM2A 3QUCA 4YVFA 3OTWA 3DZBA 4FX5A 4DCTA 2VTBA 1SCUA 1TMOA 3HSKA 3OD5A 2PSEA 1TQ6A 2XZPA 2ZRBA 3ENVA 4HH4A 3K1AA 4DNOA 4GKKB 1TVKB 2WJWA 3IHKA 4QQ8A 3V9PA 5LQAA 4YPFA 3WYAA 1M2VB 5TEWA 4XWYA 2LCQA 1M6HA 4G5XA 1AUQA 4MAAA 5J23A 3EVZA 2OQIA 3TLYA 3U1TA 4XDYA 3QY9A 1GWNA 2J9YB 5E0OA 4DF3A 1P4RA 2N0SA 2VJAA 1FE8A 1ND5A 2E85A 5KYTA 4TRRA 4ZU6X 3M1IA 3TN7A 1XZGA 1FDVA 1FBTA 2I22A 4HAZA 3EF3A 3RVKA 1JLLA 4LY6A 3WFZA 2HBQA 1ZM9A 5A2GA 3PGJA 4A4DA 5L6MB 5GGYA 1RAGA 3GVCA 4PQEA 5K0JA 4OB6A 2QZJA 1E5XA 4BO2A 4PX3A 2NSHA 3L6EA 4ICIA 3T3IA 4CV1A 2H1VA 3X44A 5B1SA 3WRXC 4ZJUA 1I94B 3NW9A 3V34A 1JAXA 2OT3B 2Z2JA 2C94A 5FRDA 4FW8A 3LP5A 1Z6PA 2PXXA 1GTJ1 3GZNB 1WR8A 1GPKA 1K6IA 2F43B 2PCLA 2E4WA 2YOHA 3LAWA 3RPEA 5IYZA 1PSZA 2R6DA 1DI0A 1XTBA 4JDPA 2BEVB 5ADUS 4KR3A 2WAXA 5REQA 2O7VA 3HU5A 2KPOA 4FHEA 1KC3A 4HXEB 5IZCA 2EFDB 5FV7A 4B4UA 4DWWA 4MSUA 3AUTA 1FFYA 3VR4H 4DCVA 4LPKA 3Q88A 4GEGA 4WFQA 2HOQA 3TQHA 5K0BA 2VHXA 5F7JA 2YXPX 3K5IA 3M6LA 5C31A 1JKJA 2GVNA 4Q0MA 2WFLB 3AI7A 2W2TA 3JRXA 1TX4B 2C3MA 4OO3A 2UZIR 4M7OA 1QR6A 1RPTA 4ZU3A 3B9RA 1AUVA 1UBKS 4CR7A 1DXOA 2NOAA 1EPUA 3H6HA 2HDNB 3NC4A 3ROKA 2WVHA 1PZNA 3HCWA 1KDPA 2C5FA 3CF0A 3J7TA 4OP2A 3ZDAA 1PEYA 1TCCA 2LGJA 1MZPA 4M0LA 2NXJA 5D3ZA 4G65A 4CCWA 3GMSA 4YJ3F 3B1YA 3BSYA 2ZREA 5AW7A 3W2GA 4JAVC 2VJOA 2PJUA 3ZYCA 5JANA 5EIBC 4LUCA 3A04A 4EP1A 3U9TA 2BCGY 4ZTZB 1L5VA 3HJBA 1B1AA 3RTDA 3HXKA 1SM4A 3WB1A 4M0DA 5A3QA 3B9QA 1F2VA 1X14A 3EWAA 2PD4A 3MGCA 2H1IA 3DLPX 3ZHCA 4EX7A 4F2GA 5GIPE 3QEAZ 4OHZA 2ODAA 4HAVA 1NV8A 3EIQA 3IODA 2WJIA 4UPDA 3R8XA 3T4EA 5D5PA 1Z63A 5K8VA 1B23P 2ZKIA 2Q9AA 1OY1A 4BTEA 2AN5A 3D1LA 3EEQA 4NZOA 4X6YA 4TKUB 5D51S 2FPOA 4J7AA 3RODA 3U1VA 5CTJA 1QUEA 4QT0A 2R1VB 4JEHA 4MUMA 3S7ZA 2R66A 4E1BA 4Y9SA 2RBKA 2OFXA 4G0QA 2EQ5A 3LRPA 4L8GA 3JSXA 4XSHA 3TSWA 1I4OA 1V1RB 4AN1A 1ZK1A 3H5VA 5GV8A 5AI4A 1U5BB 4D9BA 3MZ0A 3ADDA 3AHFA 4PSAA 5JMWA 1TEVA 2Q1YA 5JY1A 4OHMA 3PX7A 2RG7A 3FDZB 1B41A 1N8SA 3AW8A 2AJBA 4MO2A 4C87A 4D8VA 2FOLA 1JWBB 3LWZA 2FEXA 1BDIA 3JQQA 4UUBA 5FI0B 2Q8PA 4MR8A 1GUBA 1YDMA 2YUIA 3KE9A 4HNSA 5BQFA 3DZCA 4UHEA 4IDAA 1XPRA 4RVDA 2AX3A 5FR2A 1F17A 5JSHA 4EUSA 4O02B 3L05A 1CIPA 1AS2A 4PYRA 3KT9A 4EA9A 4I5IA 2WJAA 3OUTA 1GQRA 1YB1A 1L7PA 1YJ5A 3MTJA 1KAMA 1OLXA 1ZNXA 2GESA 1UC9A 3DE6X 4GZ5A 2YL2A 4BNDA 3KQUA 1RVV1 1HDYA 4RSGA 5C5CA 2VHUA 2ZTMA 3PUWA 4NPHA 4UQPA 4XFKA 2H17A 4CMJA 3T4UA 4PCUA 1GNTA 3B2QA 2B1QA 3OFSA 4B31A 1DL5A 1U0TA 1AKRA 1ZJJA 1GL7A 2OP1A 3O8DA 4TTPA 7GPBA 3NDPA 3BMCA 3F8TA 4JLOA 4OX9B 3QYPA 4JT2A 1VL8A 4HB4A 1ZM4A 1SHLA 5HKLA 2QTMA 4EJSA 4IXWA 3ZCXA 4BLRA 1X1TA 2RDMA 4JBNA 4IGFA 1H0KA 3V6LA 1N9GA 1RZRA 1YJBA 3IV6A 3L82B 1ECCA 2YW9A 2BDEA 2IYXA 1R8QA 5CXUA 1LJ8A 1UODA 1UK9A 3H99A 4X1KB 2DFDA 2VQ3A 1ZG3A 2Z43A 4HNQA 1KDZA 3VOAA 4O4IF 5IVHA 3DDZX 3RSLA 4R6WA 2PZFA 3KKMA 3EF0A 2COKA 3KZ1E 1INLA 1EMDA 1LLUA 3VJRA 2GM3A 4KVZA 3RVSA 1Q2XA 3O6VA 3K9CA 4ID9A 2GDZA 3AM1A 1N5JA 5HCIA 3SYKA 3T34A 3AVPA 5J63A 4OA8A 1D03A 4AF7A 3U3MA 1EFVB 3BD7A 1RHUA 2Q5IA 1IONA 2WWXA 4L4RA 3FKQA 4D9IA 1WW8A 1VHDA 2RIPA 5JAOA 1EK6A 2JF0A 3KSZO 1NW4A 3N1UA 4XSVA 1IN5A 1DS6A 4IRUB 2Y0DA 4F2DA 5B55A 2ID9A 2WWGA 1LDMA 1XMQB 2OGTA 3FLBA 1UIMA 4G0ZA 2F00A 4MMZB 1Q1EA 3LS2A 2GCEA 1ILWA 4XLLA 5EVCA 4HGYA 1MO4A 3IERA 2IX9A 5T6BA 1GL6A 1H69A 1LBHA 3WKCA 1P3JA 1YJ8A 3HJAA 5HF5A 2WUEA 3M34A 2CJWB 3PUVA 4WE3A 3IVRA 4U7JA 5HIJA 3CLTC 2H2DA 4BNVA 4Z9FA 4HX5A 1JBEA 2F1KA 5A1TA 2KS6A 2V65A 4L95C 3AEKB 2HQSA 5AVOA 3AKZA 3UBTA 4OXIA 3CJTA 4D56A 5CFRA 2XZDA 1RWQA 4JZKA 3QUQA 2Q99A 3WICA 1YZYA 1W36C 1DQRA 1QMGA 1CULC 2JHFA 4LJRA 3RLIA 2QD5A 1WZCA 4LZOA 3A6DA 2NUPA 3W90A 1ZEJA 3WBKA 4G26A 5IANA 1ST3A 3I45A 5IC5A 1ZMRA 3MERA 2XB9A 4N5LA 4C3UA 1AGPA 2DG2A 4YDHB 4DEYA 3BBLA 3K15A 1HA3A 1VZ2A 2IPLA 3IAS1 1BCRA 1Y5IA 2FSHA 3KU1A 4ITVA 4JP3A 4QELA 1FPMA 3QIVA 5IKOA 1NXVA 2GEBA 2NZYA 4HNVA 1JDBC 1G0NA 1Y9ZA 1YE8A 3G9TA 2QUBA 1J0DA 4LY3A 4AP5A 4ZDKA 1JBQA 2WJYA 4RE6A 3WK6A 4E70A 1ORWA 1PFQA 3EVTA 3TB4A 3NCTA 5LZ9A 3OM8A 1M8FA 4QUGA 3UTCA 2P6PA 3PT9A 3H4IA 1LK5A 1BE6A 3WL6A 4AWXA 3EGVA 2X5XA 4C4YA 5DK4A 2JFBA 2VP9A 4AWAA 4IV5A 4P5DA 3KS9A 1SG6A 3R9IA 3QMVA 2JFGA 3O1JC 5E1MA 3PQ7A 5IFKA 1V3UA 2F3SA 3EEBA 1DEKA 3LPAA 1WB4A 2UZ1A 1MLDA 4PG7A 1YOBA 4WXEA 3GHHA 3K8YA 4OKIA 5DBEX 3ZXSA 5LIRA 2G4VA 1MAVA 1NR7A 4D0NA 2NP7A 3PPXA 3MAAC 1XDZA 4WK6A 4L28A 2ZIGA 3CZQA 4LW8A 4LZAA 2VL7A 3WGVA 4UW9A 1P4AA 1VHWA 1MJHA 3F71A 2QVXX 3ONEA 1XDSA 1CR0A 3PGXA 3NM5A 4P3KA 2A0KA 2QX7A 3SJ7A 1XLTC 3E9CA 3R5SA 2I6UA 3UJDA 2PHZA 1FOEB 1M2WA 3WLOA 2CSWA 1DNPA 3O3CA 2IF2A 2WU8A 3CKLA 4ES6A 3CCCA 4H6VA 1AOXA 2JGNA 3DT9A 1ZI6A 5DM4A 5AP9A 3R75A 5JALA 2UVQA 2NUTA 2BV3A 2FSVC 4UEKA 5B2ZA 4O4LF 1RI4A 3ANMA 1XROA 3AIIA 4J0QA 4JYMA 4KQ2A 4W9RA 4ARBA 2W48A 1E7SA 4Q4AB 4FNGA 5F3DA 4AZ0B 4D44A 3BH7A 4N12A 1T9DA 3Q3IA 1H4TA 3AH8A 3PDCA 4OQDA 1CC1S 1HFWA 3L7KA 5E7IA 1FP1D 2SCUB 4KIGA 3PWKA 5EG5A 1O6ZA 3OPXA 4MCIA 4UAUA 3ORYA 4RK4A 3KSRA 4MYDA 1ZOPA 4HMOA 3F6EX 4IX9A 4X5OA 4JI2B 3KAKA 1R4NA 1YNSA 3PRJA 1F14A 2JIZD 1SCJA 5AKXA 1K89A 1DLJA 2ALJA 2QVBA 3CG4A 3NASA 3Q72A 3E9ZA 2AXQA 1GXSB 1V5GA 3JASA 4GLFA 4RD3A 3VTKA 4DQDA 4D0SA 4NBLA 4DCNA 4QGFA 6YASA 1YI8A 2Q0QA 2QORA 5JASA 1L5HB 4DJEC 2X2EA 3UA4A 2FLKA 5JZVA 1WPRA 4H35A 3EOAI 3BN3A 3WXBA 3ZNOA 5DNWA 2PO5A 3JAWB 4J1SA 3RE1A 4CIDA 4EQ6A 5AWFC 3K71B 1TMGE 1TFRA 5HZKA 3PQFA 2B1RA 4RS4A 2ZR0A 4HDCA 1QH9A 3CIOA 3UG7A 1CLEA 3ODPA 1JHZA 2Z6QA 2RGCA 4PRKA 4LSWA 2QMYA 5F9MA 3T9DA 1U81A 3THSA 3L49A 3LMKA 3T35A 3QV2A 3AOEA 4ETNA 1D09A 5DRYA 4EELA 4Q6WA 2QMZA 4XZ3A 5I4KA 1JQJC 2I6FA 2AQHA 3IEVA 7REQB 3ECSA 3HCOA 1ZJZA 2LDBA 1TD9A 4XTRA 3ZHYA 5AM5A 3LE8A 4WPGA 3VYTB 4RWEA 2HR1A 4EYGA 3JWGA 5CFNA 1SIOA 4G1VA 5FHQA 5IKMA 5C8DA 4GPD1 1FPQA 2O5CA 2XMQA 3GJ7A 4XB1A 2KSQA 1E8MA 2NZUG 1VYHA 3HP1A 3DOFA 1M8GA 2AG8A 3M6WA 4FJ1A 3VC3A 2CZCA 4GP7A 4C89A 2FRVA 4CFZA 1WWKA 1ONNA 2EFJA 2ADMA 2BF4A 3HA3A 3N2NA 2FPWA 1Y3HA 2CFTA 3P2OA 3BERA 1V0JA 1LW6E 3LXUX 3JPYA 3ZXIA 2W00A 1XUOA 3ZU6A 1ZL2A 2P5UA 1LSJA 1P1KA 2J3JA 2EW2A 4EY3A 1ZGGA 8ADHA 2R87A 4HH1A 2QJOA 3I09A 3I72A 4CI9A 5CW2A 2ZXEA 1BDHA 5ILGA 5KNBD 2C7RA 3OEWA 4OYHA 4HK4A 4WN9B 3VU3A 2NU6A 4X71A 4C43A 2EBFX 4RCZA 3IHLA 3PUJA 5LBTA 3WLRA 4H08A 1QG6A 4ZICA 3L6CA 1GRQA 1GD1O 1T2CA 2W2LD 3PRYA 1A9XA 1J8FA 2CLFB 3IEXA 4YJHB 5DMXA 1RI2A 1HT2E 1SVNA 3ICCA 1IPEA 4HDRA 1G1AA 2O2IA 3HO6A 3CZPA 4BJ3A 3TZLA 3VO1A 1ISMA 3BD8A 3CONA 3JQBA 2ZRIA 1Q16A 3MJSA 4ZEVA 5AI5A 1C7IA 1KJIA 2XAAA 2ZRAA 4MV8A 3LC7O 2DBZA 2PT9A 3NYQA 4M54A 1KFBB 1WY5A 5FUWA 5IABA 3CX6A 2DUNA 2VNAA 4IINA 3NCHA 3OMLA 5JAMA 1XBTA 1MABB 3BPSA 4N39A 3SBXA 5TNXA 1CCWA 3ZGVA 4RY8A 4XEHA 1C29B 1DQZA 4AICA 1KY2A 3LQKA 2BDUA 3A9WA 1TVKA 4DHWA 3N0XA 4PGGA 2IP1A 3FUVA 1C0KA 2IEGA 5CFPA 1GSOA 5ERYA 1WP4A 5EWMB 3BCRA 4WINA 4LTMA 3OICA 3GUHA 4IEFB 1EE9A 2OP0A 2C3PA 4C22A 1TKBA 4IY1A 4YYZA 5JFGA 1AD2A 2JQJA 1XVLA 4F4JA 3GLHB 5EEHA 2K6GA 4F97A 3L4SO 4A0RA 5J3JA 5BMVB 2WP8J 1PFKA 4E33A 4UCFA 3FOZA 3OQIA 4A0FA 3Q0EA 2KE5A 4DDWA 1FU8A 1C2TA 3N2EA 2QLBA 3PXAA 2J41A 4G5YA 4EITA 3E84A 1UBEA 1DVRA 1U5AA 3KVYA 3SLRA 3NGXA 1NOJA 3R24A 1TA9A 1E96A 3E0QA 1AKNA 3BX1A 3G0OA 1SNYA 1X1SA 1H93A 3QQ5A 2DR3A 4ND7A 1SCIA 1K9SA 5F98A 1B93A 1HG1A 5M2QA 3V1TC 4RZHA 3HXTA 3GZNA 4HDNB 1E9EA 1XQYA 4RTSA 4B3MB 3OCVA 2JANA 4C5AA 5AM3A 1YKGA 1NRWA 4EGJA 3TPZA 4MHSA 4OHWA 1ADJA 1NVVQ 4ZVSA 1YMQA 1Z8FA 1R8JA 2XQFA 2X9LA 3FYHA 4NEHB 4A3SA 5LYJB 1P2VA 4LVOA 2IOFK 5HQ3B 4H7KA 4IFTA 1G66A 3VZBA 3SC3A 1UINA 1V47A 1ORIA 4YJ2B 2PKQO 2QX8A 2GF9A 2V3VA 5K2MA 3S1LA 1EAYA 5A03A 1N2BA 1JNYA 3FYDA 1RSZA 221PA 2E6KA 5A9RA 4FEAA 1QLJA 4AJ1A 3LX4A 3NDRA 2WWIA 3TIXB 3JALA 3QJGA 3U3ZA 3K1YA 1KPIA 4J2OA 4J0CA 4NABA 2F55A 5CFLA 4YI5A 5L53A 2XF8A 1XLWA 2AMVA 2XUDA 2ZXFA 3WDSA 4KYVA 2WQ6A 2VDJA 3GPDG 4H7FA 2PN1A 2ONJA 4X1OA 4RJLA 4PPGA 4MVJE 1CV2A 1PZMA 1OBOA 4P4UA 2H06A 3HABA 3D5EA 4LF5B 2V7QA 3QZUA 3R23A 3TXAA 3WLKX 2CDRA 3KKQA 4RJKA 1OH5A 4P3PA 5ADWA 1NXWA 3R7BA 4AP6A 1IM8A 2NYRA 4K0RA 1T6NA 1YAJA 3B3GA 4RM2A 5I48A 2A7QA 5AKGA 1HSZA 4UEOA 1DUIA 4PFJA 2ATXA 2EBHX 5ESXA 3NP9A 4Q3DA 1IK6A 5A0FA 2IHKA 4OJNA 3WGJA 1LV7A 1WMDA 3I05A 2KFUA 2CHEA 2VEOA 3D6JA 3UEOA 1A76A 4N01A 4DLZA 4ENSA 1PUXA 3BXXA 4QPPA 3KSDO 4ZVLA 3RYTC 4G0NA 5D5QA 4CFYA 1E6LA 3QFRA 1U5BA 4OK5A 1I6WA 2V96A 3SXPA 3TZCA 2RHCA 2ZUWA 2FMHA 3ZIDA 2IH2A 4MQ5A 1R0WA 2C84A 3LHKA 1C3EA 5HWSA 3C3AA 2YIDA 2NTVA 1QIKA 1CIVA 1TM2A 2Z83A 2AK3A 4AUKA 3K09A 1Q1ZA 4S1TA 4UBNA 3ROPA 2HT1A 2CBXA 3N0RA 2C5BA 3CVXA 4CV0A 3ETLA 1GGFA 4JFRA 1LTHR 4MI3A 3EY9A 5KNCD 1DKPA 1TZKA 2C54A 4NL4H 5B1YA 1WB6A 4PXAA 4HEQA 1T0BA 1QJ4A 4GVPA 4YP1A 3V2IA 4BAZA 1XN1A 1JE1A 4Y2XA 5H59A 3GDOA 1JDNA 1TT5B 3BTVA 3T1OA 2MSWA 3B1WA 3B5IA 3DEJA 1LSSA 2J5KA 3DAGA 1MVOA 5C46F 3UKDA 2VXBA 5IH3A 4OOEA 4LBVA 3TB6A 3TR0A 3GAAA 2W6CX 2YS6A 1YJAA 4C0SA 1UBHS 3EC1A 3N7AA 4NAHA 1MU0A 2GX6A 1GOTA 3RAPR 3P9PA 2FZLA 2O7QA 4G85A 1NP3A 4FFSA 4JB0A 1BW9B 2FDXA 4M1SA 4QJ5A 4F4CA 1V4NA 2NW6A 2P78A 4W82A 5GJWC 3U49A 4F8JA 4ENVA 4YV0A 3TAXA 5AKLA 4YT2A 4CKZA 1QU2A 2ZQYA 3M2PA 1KL7A 1JVSA 2VOEA 1NNLA 4XD2A 2GF0A 1YA4A 2OOSA 3MMZA 4FE4A 4I1IA 4EMBA 4XCXA 4YMSA 2YZNA 2FHPA 1KS9A 3OT4A 3KX2A 2DHDA 3GOHA 3POAA 2C2YA 5ESDA 1H2FA 5EJ8A 5I47A 2V6MA 1W73A 3T1YB 4DWVA 1GRCA 1JG6A 4MGHA 1AV7A 3SS8A 2VRWA 1NFRA 4V2UA 1XVUA 2XZLA 4EF6A 1ZQ9A 2IEZA 2Q3LA 1XHL