5DHUA

Crystal structure of nad kinase 1 from listeria monocytogenes in complex with a novel inhibitor
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
264
structure length
263
Chain Sequence
MKYMITSKGDEKSDLLRLNMIAGFGEYDMEYDDVEPEIVISIGGDGTFLSAFHQYEERLDEIAFIGIHTGHLGFYADWRPAEADKLVKLLAKGEYQKVSYPLLKTTVKYGIKKEATYLALNESTVKSSGGPFVVDVVINDIHFERFRGDGLCMSTPSGTTAYNKSLGGALMHPSIEAMQLTEMASINNRVYRTIGSPLVFPKHHVVSLQPVNDKDFQISVDHLSILHRDVQEIRYEVSAKKIHFARFRSFPFWRRVHDSFIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 8-Thioalkyl-adenosine derivatives inhibit Listeria monocytogenes NAD kinase through a novel binding mode.
pubmed doi rcsb
source organism Listeria monocytogenes serovar 1/2a (strain atcc baa-679 / egd-e)
molecule tags Transferase
molecule keywords NAD kinase 1
total genus 65
structure length 263
sequence length 264
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.23: NAD(+) kinase.
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01513 NAD_kinase ATP-NAD kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.30 Mainly Beta Sandwich Tumour Suppressor Smad4 Probable inorganic polyphosphate/atp-NAD kinase; domain 2 5dhuA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 5dhuA01
2QV7A 3T5PA 5DHPA 4DY6A 2I2BA 3AFOA 3V8QA 2I2AA 5EJGA 3V8RA 5DHSA 2I2CA 3V80A 1Z0UA 1Z0ZA 1YT5A 5EJIA 5DHRA 3V8PA 5DHTA 3V8MA 3VZBA 2I2FA 5DHQA 1Y3HA 2BONA 3V7YA 3V7UA 1SUWA 1Y3IA 2P1RA 4V24A 2I29A 1U0RA 2QVLA 3PFNA 3V7WA 3VZDA 4WERA 4WRRA 3V8NA 5EJHA 1Z0SA 2I2DA 5DHUA 2Q5FA 2AN1A 2JGRA 5EJFA 4L02A 3S40A 4HAOA 1U0TA 2I1WA 3VZCA
chains in the Genus database with same CATH superfamily
1GTJ1 2WJAA 4CFZA 3A31A 4NZ9A 3PYMA 2PX0A 4IHQA 4D96A 2XGMA 3D4NA 1NXWA 1VA5A 3MWLA 1PJBA 3TFQA 4A8JB 1BE1A 1E2DA 5BORA 2OSBA 2IGBA 1OIVA 2ZSDA 3L79A 3QU5A 3KTAB 4UXJA 1VE1A 3NJ4A 3T38A 3VC7A 1H9BA 4EJMA 1KO4A 1TZMA 3B53X 2WU3A 3L4EA 4URUR 4KXYA 3DKPA 4INOA 2Z2IA 1JXOA 2IPMA 1JKJB 2P6MA 3H1PA 2J9FB 1QXSA 2B82A 4HGZA 1Q84A 1S8AA 3BXEA 4RZIA 2CC2A 4MYRA 5BV8A 1E6UA 2HRRA 3JQPA 3EOZA 3MINB 4KPFC 1T3ZA 3ISTA 1DHTA 3IPYA 1GPBA 4P3PA 3NORA 2O7NA 3TLZA 4AZ0A 2BSQA 1X86B 4CUJA 4WY5A 5CA1A 3ABRB 3H86A 4AG3A 4XFJA 1Q0RA 3GMJA 4O4LB 1UJNA 3PRJA 4DA6A 4JXKA 3NOQA 1A4UA 3WV5A 4NZMA 1MT3A 1XCJA 4CU2A 2G9RA 1SBNE 2O2ZA 3CX7A 2E7ZA 3CUVA 2YHBA 5ULLA 1C0KA 4B83A 2RHBA 1BCSA 4MWGA 3RAPR 3EDRA 1S8FA 1XE3A 3JZFA 4DCPA 3GJ4A 3BE6A 2ETVA 2RHLA 1FP6A 3QKRA 4KXXA 1PGOA 3CC8A 3IUMA 1L5OA 3M3PA 4MAMA 4IXWA 4ZAGA 5H70A 4TMFA 3UJPA 2IH5A 3IKLA 1E1QD 4L5BA 4UM7A 1OLOA 1MGOA 5JXWA 3HCNA 2PUGA 3QBDA 4D6XA 3X1DA 2GF9A 4DUPA 4MWDA 5HKKD 4UEKA 4BVJA 5FKJA 2OQ2A 2DCMA 3QLUC 1Z6XA 2TMYA 3PUHA 2YJNA 1Q11A 4RKWA 2O8BB 4EH1A 3DQPA 4LJ7A 4M1YA 3T7SA 4YYEA 5K4GA 2WA1A 3DAFA 5EJGA 2VP4A 3Q5DA 5EKUA 5CDUA 1JMKC 1Q7GA 5LLTA 3LMKA 4IWYA 3RRYA 1DCMA 1HDRA 1YT5A 2EGUA 5LQSA 5JFTA 2ZU6A 4IUCS 5IJAA 2PQ0A 2IGTA 3FWYA 3KWMA 5C18A 4G4SP 2D1TA 1A96A 3MJTA 4R6WA 4NXMB 3WK7A 4WCFB 4DWOA 2Q4DA 8AT1A 3KYBA 3GGGA 4ZI2A 3I5UA 4C0HA 3EQZA 1O08A 1IN5A 3D6HA 3KLOA 5DBHX 1THTA 4I1YA 4Q4DA 4S1OA 4DR3B 1SY7A 4D9MA 3KCQA 4OSOA 3A4TA 1UPCA 3NAZA 1KH2A 4NBWA 1V39A 3A04A 3DF7A 4K9DA 1GYPA 3I76A 2NYUA 3USES 4U7DA 2FWNA 2RHGB 1L7XA 3WGZA 3RRXA 1W73A 3KZMA 3A3KA 1R9JA 4ETNA 3HG7A 3M83A 3D6JA 5JEKA 2GK4A 2B5OA 1MAAA 3B7GA 1QH8B 3MJVA 4E2FA 2RGBA 2OV2A 2C7VA 1LQUA 1Z7BA 2RG7A 1IUKA 4FKBA 4HZGA 2ZIUB 4G0MA 2H2HA 1S2IA 3RNOA 1POWA 2GM5A 2SHKA 5AKIA 3ZD6A 5T8KC 1RLJA 1IHUA 1V11B 1SUEA 1BMFD 3KL2A 4TV9A 3K1AA 4UHJA 5F7JA 1AZWA 1JWBB 4NX2A 4LBVA 1Y9DA 1M8GA 2HRZA 4IKEA 3P0JA 3FPHA 4GYYA 4AN0A 2ADMA 1PR9A 3A1SA 2AC4A 3PGMA 4TRMA 2O8CA 3TFOA 1PT9A 1JDPA 1XF1A 2IYEA 1XEAA 2QUJA 2B9EA 1TIKA 2JJ1A 2VT6A 3PNQA 4KJXA 1TYDE 4JJAA 4EVSA 2OYCA 2I80A 4FS8A 2ZSEA 2PBFA 2B99A 2J4FA 3BXPA 4Q82A 1WVIA 3WNVA 4Q0MA 1HTWA 2V4MA 3MWKA 1I3LA 1V7CA 2QGFA 1NW3A 1STOA 4KDRA 4WN9B 4RFSB 1S8NA 1HDZA 2I6XA 2WD7A 1EQ2A 1OJ7A 1DO8A 1TIPA 3TMKA 4AWXA 2XDAA 1DIAA 4F5WA 1NQAO 5AK0A 1KJ9A 2OLKA 3D81A 1UFQA 2EGHA 3Q88A 4G86A 3HXMA 3GLFB 1ECFA 1DEOA 2IL1A 1BW9A 1BZYA 2XGSA 4KUHA 3VOBA 2DVMA 3E7XA 3FRJA 3HDGA 3W1EA 5BOSB 1R8YA 2V6MA 3TW6A 4WOJA 4MR7A 2CUZA 3VU3A 2CT8A 2XE8A 1DJMA 1ZICA 4KWCA 5DBOA 1Z15A 1YB4A 3BL5A 3FPKA 5CLHA 3E1KA 3K9GA 4Q9IA 2UVDA 2CHFA 2ECFA 3K8YA 2FZCA 1TJYA 3GU3A 2FPIA 4QUBA 4A03A 3RNLA 3H5WA 3OCZA 5HA5A 1J23A 9LDBA 5EP1A 3QELB 3GDFA 3V34A 4ZDJA 1U1GA 2WNIA 2WLSA 3F7MA 3QIVA 4RK1A 5DI3A 5ES4B 4F1JA 2YINC 1NLMA 4BBPA 2OFPA 2EBFX 2GPJA 2J0UB 3LWBA 1SBHA 3D6UA 5IABA 2ZYGA 2IITA 1ECLA 2FW6A 1NI5A 3N8KA 1TUEA 1YA4A 2Z5FA 4JB2A 1J21A 3UENA 2ZCUA 2A1TR 4B7CA 5A3JA 4B85A 4A23A 2QJWA 3VZSA 5B7GA 4QJBA 3RS9A 3JYLA 3JPYA 3A10A 1PEDA 4FCWA 3HR8A 5FJJA 2PYZA 3WLMA 3WLTA 2XUJA 3ZKWA 4EDHA 3R6DA 3TIIA 2WU8A 3LBNA 1T24A 3G5MA 5KKNB 1ZD5A 4JLSA 3TX6A 2GPTA 1W88B 1G20E 2J6IA 3T7IA 1P91A 2B3TA 3S99A 5DNCA 2Q3JA 8LDHA 1E7WA 4MQ4A 4FGSA 2NT3A 1IXSB 5JISA 4FYYA 4IJQA 3CVXA 3WAJA 2XZOA 3C3JA 3RVJA 4FM9A 3ORSA 1WCV1 1E9CA 1EU1A 1X8JA 4W8GA 3KQSA 2VTBA 2CXRA 5K9ZA 4TRNA 4LHEA 1G4AE 3UNXA 3ZWYA 1IHXA 5DZSA 1IZYA 1H2WA 1OPRA 1U9IC 1C29B 1Q1GA 3LPCA 4PV7A 3SM3A 4X7MA 1ICEA 1CZRA 1NN0A 3STVA 2ZJAA 3T7KA 1ZY2A 4DR7B 3OOHA 1VL2A 1Y42X 2J48A 2JCBA 3CLVA 1V1JA 3K71B 1EB8A 1G21E 5B1YA 2PY6A 1LK0A 4LJSA 2PUCA 1D9ZA 4P34A 5G3YA 2F1RA 3NDJA 4O02B 1QGDA 1R6VA 2K5UA 4YJ3B 2ID8A 2OZVA 2I22A 3AEQA 3QUCA 2YY6A 1JILA 1SMKA 1LB1B 3MS4A 2C2OA 3Q2IA 2O3SA 4J4HA 4MIEA 3SJ7A 3X1JA 4QYMA 4XM0A 2Q2NA 5EEGA 2CE2X 4EKYA 3NWOA 2XIJA 2JFNA 1FP2A 4HMPA 2B37A 1X8KA 2FR0A 2E4UA 4L5IA 7REQB 4IIFA 1M0SA 1HORA 3RPEA 4OKNA 1JPUA 1ORHA 3STHA 5IVPA 1UINA 2C98A 1JFFB 1OKKD 4K2HA 2KS6A 3WRYA 3FPAA 3H65A 1IZ7A 2OXRA 3M1LA 4PGHA 4M8KA 1II8B 5DM60 5FPKA 3QJGA 2BFEB 2W2OA 2EG9A 4QASA 4KE7A 3SK0A 3MLAA 2ZIFA 5JT1A 1FJ2A 3LG2A 1ESDA 3TRIA 3A28A 1X1QA 3MW8A 5E4YA 5KAMA 3NNNA 5EXXA 2QF7A 1EXVA 2QRLA 3JWIA 1K3FA 2IYNA 2XTZA 3A6LA 2N3ZA 1KS9A 5HRAA 2A88A 3L5KA 3R9XA 4G1CA 1JEQA 1GFIA 1Q0HA 3TG8A 4M7WA 3MJRA 1O0BA 5IKOA 2DPYA 2WHEA 3QEJA 5T4BA 3RHFA 3LZDA 2CL0X 4PFSA 2GN0A 3CEMA 3QWBA 4QOSA 4RDHA 4CQMB 2BLLA 3AVUA 5LCXA 2D5IA 3I23A 3G7SA 4G0NA 1KS2A 2W2TA 4XB6B 4WV3A 4MEAA 2VATA 1BGVA 4UJ3A 5JU6A 2IIBA 1UJXA 1HO3A 1E0SA 4F3NA 1IXYA 1U4OA 2AE1A 3GUVA 3IOYA 1VJ5A 4NMLA 4GLLA 3F3YA 2IDZA 3LF1A 3NTUA 2EFCB 1MFPA 3AJRA 4EF4A 1QU3A 1N3IA 4ZK2A 1DKNA 1AB6A 3LHFA 1G8FA 4M89A 3MERA 2ODNA 3OZEA 1L7MA 1MO2A 4IH1A 5AVSA 2PR2A 2GXUA 1J1ZA 2ZTLA 1G3IA 3F5FA 2GMWA 5B6JA 3QLUA 3TTUA 3IELA 1QZXA 3MDBA 3O6VA 4I3FA 3NNDA 2CDNA 2W2KB 2FVYA 3LL4A 3R3UA 2VSQA 3VA7A 4Z53A 4N5HX 1H8EA 3NO4A 3X1KA 1VE7A 1ETUA 1ZA1A 1JG4A 3WLAA 1FSFA 3A25A 1N2BA 1DRKA 5BURA 3C5EA 1CLEA 3UJ9A 2QLNA 2AUMA 1VJRA 4JP2A 2CSUA 3ZQKA 3PLAE 3IMFA 3W8EA 4LC1A 1ZHHA 1MQ9A 4CIBA 5CHYA 1P18A 3BD8A 2CBZA 1W36C 2O52A 2C7BA 4YJGB 2QDXA 2X8JB 1AM4D 1UZUA 2CLFB 2ES4A 2OD7A 2ZIXA 4YREA 2RMKA 4RABA 3FYTA 4OFZA 3FOZA 4OHUA 1GWNA 1ORIA 2VQDA 2OESA 3HABA 4CEJA 1E2PA 1QK5A 3IBTA 4M9UA 1T0HB 1JQKA 3B5EA 4GYJA 4M1SA 4X3OA 5FA8A 5FTKA 1U2ZA 3C4JA 1IJFA 1OGYA 2GLTA 4XGNA 4G36A 1LK7A 3TSCA 1D8AA 1Q57A 2NQ2C 2WI8A 3LY7A 4RGYA 3OJWA 3H83A 4HQFA 2VH2A 2CEAA 5JELA 1G6GA 2FPLA 1XCPA 3PTZA 5EPUA 4HLCA 3UHPA 1GAWA 3O26A 4YJKA 3LW7A 3WDSA 4ZTUB 4M9QA 2Q3CA 3H2YA 3K35A 4CKBB 3UKDA 1NM5A 3BDIA 1ZK1A 3EN0A 3K5HA 1GKLA 3ZCVA 2FK7A 1HX7A 1QIJA 4I2NA 1QV9A 1BXRB 2ZYWX 2W2LA 5CXXA 2OBBA 3DOUA 4N8DA 4G9EA 2I29A 4DA7A 1C9MA 2PAAA 4EKNB 3G13A 2C2GA 2IKSA 1QUFA 2ILVA 2P6UA 3ZU3A 3OLZA 3V8NA 1RMYA 5I45A 2BMJA 1BEUB 1E3JA 4BY9E 1WSBA 3O4VA 4RZHA 3LOPA 1C9KA 4EW6A 3L05A 3RSCA 1H4VB 3AR3A 1J09A 3AB7A 2I67A 3SZRA 1SEVA 3M6AA 3TDMA 1UBRS 1PFGA 1YZVA 4CJXA 1ENOA 1EH5A 3OX1A 4TXLA 1NSFA 3I01A 3TCNA 5L3SA 1R21A 2HW8A 1PVVA 2Y3IA 3KKPA 5E1DA 2FLVA 1H1LA 4C2TA 3FTQA 3VU1A 2C31A 3VNAA 3VR2D 1NC1A 4XYLA 1AH2A 1Q1AA 2DJ5A 3AHDA 2O8DB 4ZEMA 3V32A 4D3FA 1W85A 2HTEA 4P81A 3QTBA 1XMIA 2C3MA 1YBAA 4MVXA 1JPVA 2H16A 4OG2A 1KVRA 1UPAA 4WVLA 2VP5A 5TMDA 1SHKA 4OQDA 5KTSA 3GJYA 4JFAA 4TMZA 1JLSA 4GWGA 1NKVA 1PX0A 4L9WA 4ZVQA 3K0AB 1C9EA 2WQZA 3TKYA 1NTOA 2JGMA 4BUZA 2ZUUA 1E3WB 2IXTA 3CF0A 4EPRA 4EZIA 5LQJA 1KYXA 5JQGB 1E2KA 2NO9A 4C07A 1TTHA 3Q3HA 3ASZA 4I6JA 5CXUA 2O0LA 5JQGF 2GUGA 4OV6B 4EY5A 3RASA 2QTFA 4JP5A 5EYPB 1SKAA 1JIUA 1LC0A 3EGVA 6AT1A 2K7FA 4DG5A 3MFQA 3FNEA 1ECPA 1XHLA 3DNFA 4LOHA 3RFVA 3BA6A 2XMZA 1QRAA 5DJOA 3HEAA 5CFLA 1T6BY 3OWOA 4YMHA 3T95A 4TXHA 1MQSA 1SXJA 3DGFC 4RD6A 2JVJA 4X94A 3VKGA 3GUCA 1PBNA 1W87A 3PIIA 4YUZA 3MFYA 5G1PA 2VJLA 1LC3A 1PK8A 2XEXA 4G25A 4UEJA 1DKLA 3B3QA 2AH5A 1NW7A 5GZ1A 1HE8B 1MABA 3AJEA 3F0TA 3WVNA 1BWPA 1K2WA 2HRDA 1K2NA 4GICA 2W9XA 4YQZA 3TUJC 2JHFA 1W7AA 5JLJA 3SQLA 1Z28A 4A73A 4N82A 1NYRA 5T3UA 3LS2A 1IQRA 1KU6A 2VJMB 3J7TA 2I2FA 1MZVA 1PDOA 1QHNA 3DBHA 3JZAA 1IC6A 1PYGA 4G8JA 1P31A 2NO5A 3BAZA 1PR1A 1ZL0A 2FEXA 4OAOA 5GGYA 1TK3A 3WSTA 4D9IA 3F7NA 5ED4A 1PN3A 5AXAA 2JLSA 1NVBA 3TECE 2PUEA 1YBVA 1EMDA 1WY5A 1KI4A 1EG7A 3K2BA 3DFIA 3MPOA 4K81B 4ZOEA 5FBRB 4C3VA 3JAKB 5B1HA 1T1EA 5T5QA 3VPGA 1EINA 2IYPA 2XUGA 1H2HA 3ZJVA 5HTOA 2MWMA 1JFSA 4J0HA 3LYUA 3AH8A 1S3GA 4Q7LA 2W2KA 1NQOA 3PYLA 4J91A 4Q3NA 1D0IA 1T3TA 3P1JA 4QE3A 2OLJA 5CT8A 3TLEA 4E07A 3NHZA 4HAVA 4PZLA 1W46A 4KE9A 4YRSA 5IJZA 1WHTB 3FFBA 4BX3A 1I7QB 1G88A 3ZCSA 3HHPA 5ITZB 1GYRA 2FSHA 4IEIA 1DXHA 3PQ2A 3I09A 4Y1EA 2FQXA 5KQPA 1A2QA 1TU4A 3GJXC 4AYWA 1L7AA 1SBQA 2PMDA 3DZHA 4LRYA 3JTMA 3QF4B 2HU2A 4B45A 4A2QA 3FUVA 1QFYA 2C4NA 3B1FA 3DT9A 5IKMA 1I9GA 3B7PA 5EZYF 4KO8A 3I9FA 2RKOA 2JA2A 5J2TB 1UJ5A 1EJ6A 3H5AA 4N9QA 1H2EA 2BKEA 3LPLA 4LKRA 4NFHA 4S1WA 3B9PA 2O2DA 3OPMA 3QEMA 3EWSA 3HJUA 2FUG1 1UKEA 5C4IA 4D99A 3LFHA 5FUWA 5HCIA 1DQNA 1W0JD 1OGIA 2BGIA 4RBNA 5JATA 3N8IA 1MC1A 5EIXA 4EX7A 3FMPB 3FKSD 2ZVJA 1WEHA 4MRNA 3FM9A 3GLRA 4BP9A 2PJDA 4EI9A 3PUWA 4ZJUA 2JEZA 3TIFA 4FXOA 4GOOD 1RACA 4OAQA 2ZFUA 3MRTA 2CNOA 3UC5A 4EP1A 4CBVA 1J90A 2K6GA 4OIMA 5A4DA 1KJJA 2IP4A 2XB8A 3C8DA 2P4SA 4ALKA 1RJEA 2D54A 4BE9A 1DXQA 2WWXA 5K03A 1E7RA 2XB6A 1A4RA 4S1TA 3UQYS 4R01A 5CIYA 1F0YA 3D6AA 1EVYA 3SHQA 1USKA 3FWNA 4JITA 3ZG6A 3N0RA 4XVRA 1OLUA 1DAFA 1VI5A 5FPYA 3LLCA 1Q7TA 3G17A 3I9LA 4CCYA 5DYTA 5K8CA 5CCXA 3H6KA 3A1CA 1O9HA 3SQXA 3PDIB 4RC9A 4DTIA 3DA8A 5LZ8A 1XYGA 4OXYA 4ZFNA 1KDTA 4BWVA 3POAA 4P2BA 1SD1A 4NU8X 3K73O 4AY6A 2JGFA 1CUUA 1Z56C 1KFCB 4FDAA 3UV0A 1HH4A 3FB4A 3K4QA 3BCHA 1YGPA 3IP3A 3R0QA 3CX8A 1JQEA 3CINA 3FTDA 3A4VA 2YASA 4BQEA 1GTRA 3C39A 3OZ7A 1O97D 2BHSA 3UEOA 3V6LA 2IZ5A 4NZYA 4CQMA 2JCGA 3ADOA 1M1YA 5D3KA 4D80A 1FTSA 1IB6A 1ULAA 2PSSA 3KSUA 4QOJA 4KSYA 4XVQA 3ZOZA 4XWOA 5F2KA 5KVCA 3DOHA 4YECA 1FUYB 5DLPA 5E8RA 3ZWAA 1V3QE 2HJHA 1IEXA 1U1IA 1V8ZA 5AW7A 3QSYA 2AOUA 4V02A 1PTJC 3PGLA 2JFVA 2PO7A 3DE4X 4QYXA 4QATA 4FDVA 4XJVA 1NFRA 5F2EA 1LWOA 4CQJA 2X2OA 2FF7A 4OD0A 1EXMA 4S0XA 2RH4A 2RGWA 2X9GA 3MUEA 4M38A 4UAUA 4A2CA 4UDYX 4QG7A 1GKUB 2Y0CA 1A5BB 1N7IA 4JYPA 5DX0A 1PUJA 1TF2A 2QTTA 5ED0A 4NPAA 3HY6A 3P27A 3WKEA 1F1JA 2CCGA 2PFGA 4X97A 3S1AA 2WWYA 3B89A 1YS9A 2OGSA 2PZKA 3A2MA 1Z7GA 2QQFA 3EA4A 3OKCA 4B5LA 1GZHB 2JLXA 1RXVA 1UAYA 3QW2A 4LVNA 1HDEA 1Y6QA 1SXIA 1Y3FE 2DJIA 2YX1A 4RQTA 4BVAA 4DJTA 1ZCAA 3BCSA 3R7LA 3EEIA 4DS3A 2PUHA 1OTHA 3F7TA 3E82A 1U80A 3VO9A 3VKHA 1OQAA 3U44B 2QVYX 1P1BA 2O3RA 3AX6A 3T54A 3UUWA 1JL3A 1TM4E 3FWPA 4BVLA 2IPLA 1SHLA 2QD1A 3WNCA 2FFAA 3K20A 1AHIA 4PYKA 3K6RA 1IL0A 2FPMA 2EZ4A 3DW3X 3MB5A 1QP7A 5KDOA 2R66A 4QPPA 5K5EA 3U37A 4X85A 4YUXA 5HPYB 1SC9A 5L9AA 3ELVA 5IBCA 4L7QA 4DMFA 3UHOA 2FAXA 4OPMA 4NBTA 3ZY6A 5SYNA 3ZHRA 3OAAD 2FUCA 5CM2Z 4YV0A 1GIAA 5F35A 4OHYA 3GNTA 4C06A 2CLMB 5KDLA 5KPJA 4WD3A 2C1ZA 2BFPA 3E8SA 4AJOA 1E7MA 4EYQA 3BYZA 3EOAI 4LV5B 2J08A 4ZQFA 5GZ3A 2G9UA 3TW0A 3N6RA 4JQYA 1DADA 1P60A 1IEVA 2P2YA 5DIFA 1YCFA 1M7GA 2PDAA 3EIOA 1UPXA 2XNSA 5DGIA 2YNMD 3B6ZA 2C3PA 1DMZA 4FHEA 2NTNA 4B44A 3T1TA 2BUBA 5ALRA 3UMJA 1CV2A 1OAKA 1VJ1A 3INNA 3LFTA 4IILA 3T1YB 1RZRD 1V7QA 1VHLA 2XCOA 5P8WA 4RD4A 2QLMA 4CLXA 4LHWA 1DWUA 2W2MA 1JIIA 4UZEA 4BRZA 1WBDA 1XVLA 1DC5A 1QBGA 4BLUA 1IULA 1NY5A 1G41A 1UK7A 4QQ8A 2A5YB 5K09A 3EBLA 3W5BA 4IF6A 2GR9A 1Y7LA 2GJ4A 2PKXA 3COWA 1E4VA 1REQB 3UNNA 1GZ7A 3N6XA 3QKSA 5HF9A 2C61A 2FOLA 4CDRA 1F7VA 1KYQA 3KYCB 4D5EA 2ZBPA 2OBFA 1W1UA 1ECGA 5LKRA 4MX8A 4XCQA 4AG6A 4G8BA 4OX9B 2E2WA 1P0FA 2HZ7A 1OJLA 3CB4A 3HYNA 1NMZA 2AOWA 4IEFB 1CY2A 3PXDA 2HA3A 1KR2A 2C2HA 1FTNA 3KYDB 3V4VB 2PS0A 4KVGA 3VZRA 3OO0A 4BFZA 1D03A 4FT4A 4RDXA 4WINA 1Q19A 2O5RA 2RHCA 3PSAA 3SIWA 1TA0A 4EOGA 1YB1A 3VX3A 3HZHA 5C8DA 4IRMA 2NO0A 1ZJZA 5C7YA 2VSFA 3DVRX 3C85A 1S1MA 4XYGA 1I5EA 5LQCA 2Z5GA 3RIMA 3AKEA 1ESZA 3NM5A 1MEOA 2EX0A 3ZY5A 2I6UA 4BXOA 5H5JA 1CDZA 4KMMA 2EQAA 2Q9BA 3DOFA 4JAVC 1WXDA 2OC4A 4ZVMA 2R00A 5TB5A 4Q16A 2B21A 2I1QA 3ISVA 2QSYA 1GA1A 1G8MA 1P5HA 3SS9X 4DNQA 4Q00A 1D09A 2BCEA 2P9TA 2G8LA 2NVBA 4J2OA 4MQEB 1KC3A 2CFOA 3IAS6 2GJ9A 1J2TA 1JFVA 2Q9AA 3FVTA 2F64A 1QYWA 1CQIB 1HSOA 1LZLA 4AQYB 2BGKA 5CVJA 3E9ZA 4OO3A 4WLOA 3NZEA 1Z29A 4QLAA 3M89A 2BVNA 2XY4A 1KH3A 2KFUA 2IHJA 1NXQA 3PEEA 3PEUA 4BCDA 4WOCA 3AB3A 1WD7A 4IH9A 1TM2A 1RWQA 1RYDA 2JCXA 4KW7A 4Q03A 4TYMA 1UFKA 6REQA 5FV4A 4YJ2A 3UAGA 4XQEA 2W2QA 4ZVNA 4BE4A 5IDWA 5F1PA 4E21A 2ZDGA 4X1OA 1RJFA 3E1SA 3CUSA 5I3CA 1B0UA 1SXJB 3P9CA 5JWHA 4EHLA 2KB3A 2HT1A 5DH9A 4HGOA 3TMAA 3WLKX 3CN7A 4UAGA 5ER6A 3PXXA 2QPLA 3VR1A 4D44A 5FFNA 4BP1A 2ZBUA 4WFJA 4AJJA 1QPZA 4KR3A 2ZXUA 2AK2A 1U11A 9ATCA 2V98A 4JENA 2PD3A 4WBSA 4CUKA 1RJ9B 2IFTA 4JI2B 3IKVA 2M2IA 4RHYA 3GVPA 4M7OA 1GT6A 4HDMB 4IM7A 4S12A 3K4PA 2QBYB 2J8ZA 3RS2A 5H8WA 4GMHA 2QG9A 2DTXA 5L7TA 1VKHA 2ZJ3A 5KX5B 5LBUA 1WUKS 3P32A 3CM0A 2C5LA 2C29D 4GMFA 1JT9A 4NH0A 1UM8A 1DJQA 2JJYA 4O25A 4R98A 3NFRA 3TQCA 1RZRA 1VIYA 3LCMA 3EC1A 3MMPA 2HCFA 4QM7A 1X2BA 1EUDB 1E6WA 3QLVA 2X13A 3EGOA 4OU4A 1WLNA 1AQUA 4HWPA 2VBGA 4JLJA 2WVAA 5KU7A 2BGWA 1QIIA 4ZALA 3I1IA 4BJ6A 2FKAA 5FWAA 2R9VA 3WKCA 4C0XA 2EG5A 1DNPA 3C6MA 5TQ2A 4BMOB 3N76A 1WAMA 3SHOA 1V26A 4PZPA 1FHRA 3AHCA 2R8ZA 2WV7A 5G4LA 4NATA 1VCHA 5DLQC 3OIFA 2ZLBA 4ER5A 4NENA 3TZ6A 3G1UA 5D1HA 3L18A 2RBKA 1DXOA 1XNRB 4DDTA 1OFUA 4E46A 3ZCXA 3QU9A 3AP2A 1AD2A 1AGYA 2X8WA 3IP8A 2F9LA 2EJBA 4FP9A 4M1TA 1TT5B 2WHXA 4R16A 1RZUA 4YT2A 2OV6A 2WF7A 4C0AC 4DPKA 1YQWA 1DT3A 1EX6A 1QFXA 1EBUA 1QIGA 3V4ZA 2FTKE 2Y0DA 5HILA 1UWVA 4WK2B 3DTTA 1BRMA 1I1QB 3NYIA 2D2FA 4KQCA 1O94A 3U9TA 2FQWA 5J1TB 4LV8B 3EPPA 4ZJZA 3UXYA 1VI2A 3VDXA 2D8AA 4ZVUA 2EX4A 2ZIEA 1OYWA 2XD4A 1KPGA 1OZGA 1Z3CA 4N48A 4DY4A 1P33A 2Z2KA 3L1HA 4Y3UA 4P98A 3RLIA 4CCYB 2OHJA 3L46A 4ESEA 3KQLA 2QB5A 5HFNA 1N0IA 4ROTA 2XZTA 4PZCA 4JC0A 1YC5A 1GGFA 4CR6A 5G40A 2ZRHA 3QE4A 4LDQA 4YRDA 3TPCA 4DJEC 1U8FO 1MGPA 4S05A 4C03A 2AWNA 4BQRA 1AKWA 3GMSA 4RA6A 2IXBA 3GXBA 3M1YA 5JQGA 2QZPA 1L7PA 1ZU4A 3QVXA 4QM6A 1C7FA 4J3FA 1PYOA 1R15A 2QD2A 3HWRA 2HSWA 5KQGA 2O8CB 3BF8A 5DYYA 2COUA 3A6JA 2ZXEA 1IRIA 4WCVA 3K5WA 3OFVA 3OX4A 2D0DA 3OJEA 5JAMA 1T9KA 3BWCA 4AN1A 3AONB 1Z5OA 1WO8A 3T7RA 2OMKA 1GGKA 3OMLA 1RM5A 4L02A 1KGSA 4B71A 4EG7A 4OBBA 1QQ7A 2FB9A 3OM1A 4QQFA 5AM0A 5H59A 4EY6A 4JVMA 3IE1A 3T1QA 1IN6A 3HA7A 2H6EA 3HC7A 4FJ1A 2YV3A 2QJFA 3LT5A 5FOSA 4I1PA 2VHXA 2RB5A 5CXSA 3KQKA 1LQ2A 2B5WA 3CH6A 4BJ3A 4C87A 2C3UA 5IK2D 3L0ZA 1HLFA 4N0DA 3WQHA 2KB0A 1Y3HA 1RWOA 1YQUA 4LKOA 4RZSA 3F9CA 3VM6A 2ZUFA 5KYGA 1RBMA 2WAMA 1KK1A 4KXWA 4KAFA 3GG9A 3PRKE 3NEJA 2UZAA 3KKZA 2VJMA 2PZGA 4JHXA 3L3BA 4Q93A 2WB2A 1RRKA 5I9BA 2HREA 5JAHA 1Z4IA 1ZM2A 1SVUA 2J6HA 2YS6A 5EN4A 5AUOB 1ZOPA 2DFLA 2IEGA 4QFCA 3CNBA 5CFPA 2ZJ2A 5E3HA 4DBLE 1Z63A 5K3EA 3JAKA 1ZH2A 2I1VB 4PPFA 3BL8A 5BSWA 4UFPA 4ENPA 1VKNA 4KQXA 2J67A 4Q15A 3SZGA 4R0NA 1D6SA 3TTYA 4XSHA 2VDJA 4OFXA 3OZRA 3PC8A 3E5RA 4YCJA 3VHXA 4B3SB 1GLNA 3PDJA 3I5AA 2F1JA 2QP3A 1E79A 2GLXA 2G82A 4NZNA 5KWJA 1MW9X 2H52A 3O1HB 2J5QA 2WU0A 2EOAA 3SC2B 1KDZA 3A37A 2HJGA 4N76A 1EE9A 1K2MA 1HFKA 5CXQA 1CUCA 5C8YB 4O1HA 5LL6P 2XYHA 3D2AA 2A5GA 2ZI6A 3A36A 4TT3D 4HVCA 2I7CA 4KWEA 1O95C 1G66A 4I4CA 2CV0A 4BVGA 1O03A 4LA4A 1NU6A 1CJVC 3OSUA 4YB8A 1RI5A 4JOSA 2M6SA 5JPDA 3GARA 4OA8A 1KZGB 1ID1A 2ARKA 1GNTA 2NPIA 2IPNA 5ALFA 5ICEA 4YAEA 4PAMA 1HMPA 2WYWA 2WF9A 4AKTA 1C8BA 1Y3DE 1GRCA 1E9FA 2HT6A 2GH1A 5EYPA 4UUBA 3I5XA 5LFAA 2E85A 2GN2A 5COQA 1GGEA 2HZBA 3JVDA 3NLLA 4UDOA 2CDAA 2VDPB 3VR6H 4CI9A 4LI3X 2X41A 2PRKA 4GZMA 4I46A 3A4MA 3GT7A 5HGJA 1CTQA 4WZAB 4D1YA 4F2PA 2FN4A 3UT5A 1EZ1A 3LUBA 2F3QA 1MHTA 4N7BA 4NENB 4V39A 5J5AA 4TWJA 4NAHA 2WUVA 2AZ4A 4JJ8A 5EESA 1TCCA 3VDMA 3L4KA 3U3DA 4AU1A 1K0FA 2PQMA 4PU0A 1GTVA 3SJZA 1YKGA 5HK8A 2H4XA 4BLPA 2P6RA 4GM4A 1UP7A 3T06B 1Z5NA 2Y71A 4C0SA 2IHBA 4PPQA 2W6CX 2P41A 2GAOA 3LYHA 3DE0X 1DEAA 4IY1A 4QUGA 1G5PA 3EQ7A 2MSLA 4RKRA 1XTQA 4TKLA 3ZXYA 1I7SB 1E9BA 3RS8A 2A8YA 3O8BA 4TZKA 4RJTA 3MWEB 4LQCA 3KSAC 2IX9A 4DEXA 3IAFA 4EW3A 5EPOA 2QAGC 1NBME 2MMCA 3BRWA 3QVMA 4RTKA 5KOJB 3UUFA 3FHLA 2GM9A 2A57A 3E9YA 4CEHA 1G8PA 3KBOA 4F38A 1KEUA 1JKJA 2Q1TA 2EHJA 2IHTA 2JLRA 1VCMA 3DBVO 2BJHA 1QSGA 1ZL2A 3KAJA 1MFZA 3SJBA 3UB2A 1EK0A 3VO1A 5BP7A 1ZLXA 3SDSA 2VHYA 5ICSA 4WUTA 1C81A 5FWDA 2WJGA 1AZSC 2O48X 3G8CA 4JLAA 2HLNA 3LE8A 5FO0A 1Q7EA 4ENUA 2JZNA 1GNVA 4GIBA 1K3UB 1IMJA 2OXFA 1BROA 1M1UA 1P3DA 2ZANA 4U9IS 3SNHA 1BN7A 2FW7A 4BNXA 1NPDA 1J8MF 1GPJA 1FVFA 1LJUA 2CDRA 5EE3A 2I9KA 3URKA 2Y1CA 2Q5LA 4LQDA 3OCXA 4JVSB 1Z68A 2AQHA 3HEBA 3TQHA 4WFKA 1X7YA 4MQMA 2GBFA 2WFLB 4ZA2A 4L3WA 2HGSA 3DMDA 4BEJA 4A8JC 3CE9A 4LXIA 1VI6A 5IWCA 3KT0A 3ZZ1A 1PVDA 4PC3A 3KOYA 3CR8A 2TRSB 3IB6A 1G63A 4Q7EA 2N47A 2NT4A 3ZWOA 4PYOA 5C4MA 3KAPA 5K8TA 1DOZA 2GZ2A 2VXYA 3AU8A 1PT6A 1X74A 3ROFA 1P1HA 3DMYA 3Q1KA 3P4XA 5DLDA 3P52A 1OTXA 3OHSX 4FD2A 4OB7A 4PRZA 2VK1A 2V0NA 5E1MA 3DKIA 1ZCBA 3VYTB 3HN6A 2ZJ1A 5F21A 2OGZA 3N3BC 3FMVA 2FPWA 3KHTA 2QYTA 4RORA 1TQ6A 2P9HA 3AUAA 3OF2A 5I7OA 5J9FA 4OJMX 2ZI9A 1RKUA 2DTEA 3LWDA 3O95A 4YMUA 1K68A 2HC9A 4P7KA 1PLJA 4V0NA 3OMWA 3U3RA 1RXEA 1YGSA 1T3LA 2BKVA 4X95A 1DFGA 2DWOA 4FMDB 3ZIDA 5JS7A 3Q7TA 4FFLA 3C3AA 5IM4A 1XXHA 3FX2A 1RWNA 2F3UA 3GWGA 3KTFA 4D4MA 2VTVA 3TPZA 5A3QA 1U28A 1AK1A 3A05A 3E15A 3E3NA 3IMEA 4JJKA 3U17A 1LVGA 5C8YF 1A9YA 4B3XA 4BUCA 3HYCA 4OI2A 2ZIXB 1EG2A 3WLJA 5A02A 3PJGA 4JUDX 3TN7A 2O8EB 1MN6A 4Q47A 4MKHA 5HMMA 1IEWA 1SBIA 1Y9JA 3BJRA 1B2LA 3FD8A 3ENVA 3Q3EA 4HXEB 1ST3A 4AJPA 4CV2A 1QRSA 2VRBA 3IV9A 5HUHA 1DO2A 1E61A 3JATA 4E1VA 1FRNA 1V48A 3G1WA 5AM5A 1C4KA 2YIVX 3GBSA 3QV2A 4N01A 4HQ0A 1CE8A 3WP1B 1KQFA 1IBCA 1IN4A 5JARA 2CHEA 1B76A 4U3JA 2OUIA 5JEDA 1E3IA 4JT4A 5TQ0B 1I80A 3BJEA 1ENYA 4YJDA 4BV8A 4UJ5A 3C2QA 5KTPA 3T3NA 3ROEA 3VJMA 3JQ8A 4ENRA 2XPCA 4HAOA 1GRVA 3PEFA 4DJAA 5CBPA 4FPXA 2EP5A 1WCWA 1QF6A 2FZGA 4IP0A 5TGTA 1M2OB 2JFYA 4FI3F 4HX5A 1DRUA 4RQAA 4F4UA 1X3SA 2HWXA 2NGRA 2CNBA 2PXCA 3OI7A 5MGBA 3D7MA 3QJYA 2X5XA 1WUYA 3DV0A 2R44A 3OUZA 1AUQA 2A1UB 4DXDA 4B6QA 3PXBA 4BZQA 4B48A 3HKDB 5JG7A 3DZGA 4KNYA 2Q2QA 4JI6B 4RH3A 1QK3A 4C2BA 4WXMA 4PF1A 4PIVA 4OQZA 4B4UA 2F3SA 3ROPA 1ISRA 3JXEA 1IM8A 4LEIA 1N33B 4TV9B 1FK8A 1AO0A 5EJMA 3FYUC 1KY4A 4L51A 1FFAA 2GN9A 1M6VA 4MNTA 3RABA 3D3JA 2QAGB 5KQMA 1ML3A 1S6YA 3L8EA 2I7DA 2IUYA 2Q9CA 5IHXA 3HU3A 3MEQA 2QLTA 5DGHA 3FGZA 3CVWA 3UMGA 4O08A 3MTIA 4X20B 4Z9XA 5C52B 4K40A 2ZTMA 3T3MB 2R7KA 3BD9A 3Q10A 1CKEA 2BFCB 5EVCA 3LF2A 3UK2A 2VUSA 3UOGA 1NP7A 3AHFA 5AVRA 4BATA 5DOVA 3EG5A 2H2DA 5LR6A 2AFRA 4PLYA 2GBIA 4D9KA 2P9BA 3U3JA 4U2BA 5LOVB 4PLGA 4TTPA 4DHEA 4B6RA 4L0CA 4P7BA 1IH8A 4AZTA 4S2UA 1U28C 1LJ8A 1P2DA 1W25A 9MHTA 4MDYA 3ICVA 1O0SA 4D79A 3FGOA 4DLWA 1QKKA 1PR0A 4FGJA 3FPBA 5DWDA 5CCDA 1EXNA 1FX1A 1T8YA 4J0JA 3COYA 1SKQA 2G80A 3LP5A 4UU7A 4QTTB 2ZBQA 4LRUA 1VPEA 4DSAA 2C58A 1WW8A 2V58A 1IM5A 1HRKA 4G5XA 1J0XO 1TX4B 3Q3IA 3IKMB 4KH1A 4RK7A 4V0OA 4ACBA 1V4VA 4D0GA 1QANA 4YQYA 1YHZA 1Z0AA 4F8JA 5IT0A 4Z7OB 3P9YA 3F1KA 1OV6A 4DMKA 3MC1A 1SELA 2NYRA 1XUOA 2XUKA 1H2ZA 4D4HA 3UV7A 1DRWA 4BN0A 4FT2A 1HG1A 4LE2A 1CEYA 3EDCA 2PEYA 5B4UA 1WNFA 3RYCB 1UDXA 4TMXA 4N7JA 5CPBA 2EV9A 2BFBB 1RYZA 4AZWA 3BMOB 1A04A 2CHVA 3CUEF 3F3SA 1WLSA 1UODA 4NOLA 3RVMA 4ANFA 3T3EA 1JG3A 4QCJA 3QKIA 3T99A 3N7AA 1N3YA 5DNEA 2O7RA 2QRNA 2ZAGA 3L7BA 4AWBA 3DFKA 4CQMD 3CGGA 1J33A 1WJGA 2V4UA 3ELWA 3D54D 3H5TA 1DAKA 3KJIA 3S29A 1KEWA 1RMQA 2DUUA 2QT0A 1G55A 3QUSA 5ADWA 3AERB 3EEYA 3C8MA 2ZU0C 3DUFB 3ETEA 3O2SB 3WWOA 4EO7A 3FCSB 1QG4A 1NV9A 4KHZA 1LGQA 4M6WB 4P86A 4PLFA 3TR0A 4N3CA 4RFSA 3GRRA 3EZ6A 3EOBI 4LXHA 4Y2JA 5KVSA 2FN8A 2PPVA 1GQ2A 5AVJA 4BLWA 2VAVA 4RJIA 5C8YA 5IAAA 3HWX1 3K0EA 2ZT5A 3NWEA 3RSGA 3GT0A 2RH8A 2COKA 4MW2A 1Y3AA 1T9BA 1N0HA 4OMUA 1XRSB 2BFDB 3HXKA 1PDWA 5I9SA 1QX4A 2GAFA 1X2EA 3FVVA 4RH0A 2H0AA 2H7YA 5CB6A 1QUEA 4R1UA 1CYEA 1EUZA 3HP1A 5D84A 5LXTF 3KXPA 1ID8A 4UHFA 3QGMA 3CH7A 1JU9A 4GNRA 1XKTA 2V4ZA 1Y33E 4JOQA 1QMPA 1RQXA 1XG5A 3MRSA 4BMXA 3OQIB 4HRAA 4FE3A 6CHYA 1KXJA 3K9HA 1N5DA 5AJHA 4HP8A 1BVYF 3MUNA 4GR4A 4KUEA 3WK9A 3SXUA 1P2BA 1NC3A 2V97A 1R6UA 4BEVA 3AGPA 4BEWA 2JA1A 3QYJA 4TQAA 3AESA 4ITVA 4AW9A 3WRWA 1NPTO 1VIDA 1G1AA 2CFTA 4GAEA 1ISIA 5KYVA 1MBZA 1WXFA 3RRJA 3UV3A 3MJDA 3QPWA 3ON5A 3BC1A 4L0QA 1BXGB 2C2KA 2VHWA 2EIXA 1I14A 2FZ4A 5KTOA 3OZDA 1N6NA 2J3JA 4GZ5A 4BQPA 2AEJA 2PZ8A 2VJPA 3DOIA 4RD0A 3L6BA 4KBGA 2R1VA 3RYHA 3M5WA 5D7BA 4DDMA 3D4IA 3N1UA 5A6SA 4KSBA 5KX5A 4QT4A 1P62B 2W0SA 4UCQA 3TI7A 1CHDA 3BWBA 4YQEA 1A5TA 4C5BA 4S0ZA 8ABPA 3H5OA 2DHQA 1UXJA 1B23P 4L50A 4OSPA 5BRAA 2NADA 4L2IA 5CNMA 5K3DA 2WTXA 4Z54A 3W3AH 5KOIA 3W5AA 4JI7B 1F6BA 1FL9A 4NF2A 3KSDO 4OHOA 3WWYA 1ZD3A 4MCJA 1LPBB 1Q91A 1LPMA 1S96A 1VL0A 2EH0A 2Y77A 3IPRA 4LW8A 3ULKA 1WHSB 5LPNA 3TBKA 4TL8A 2CVPA 2TYSB 1H5QA 1H3FA 1KSJA 4L72A 3ZIAA 2UXCB 1E18A 1FMTA 1ZKMA 2P2DA 4OA5A 1Y8AA 2B69A 2UU9B 1E7SA 4RPGA 3NHJA 3TB4A 2O0MA 5MFZA 5BYKA 1E4YA 3U60B 2FMTA 2VFAA 4FCTA 3ZDQA 2A0FA 3UJNA 2B1QA 4GSLA 5HF5A 3C6YA 2TECE 3GW8A 3L7JA 3KOUA 2XDWA 4HEA1 4P3OA 1DINA 4Q18A 4X0EA 4HJXA 4YAWA 4BNFA 4BNHA 4D74A 3DYBA 4Q6BA 4F45A 3BCRA 5LC1A 3BFKA 3WQRA 3X2EA 4OQQA 1AURA 1Z75A 3C14C 1LF0A 1GUYA 1Q20A 1LV7A 3D0OA 3LLSA 1RTTA 4P0PB 3NALA 1UHTA 5D3ZA 4D43A 1C7QA 4TLDA 2X4GA 4OX9Y 1NNI1 2ZE8A 1G60A 4J4TA 3FM8A 3PI7A 2RB4A 4LOLA 1GG5A 1RRMA 4I9HA 4MIOA 4QHYA 4YJ3A 4KV9A 3ZJTA 3A9TA 4RXTA 1Q7RA 2DLDA 4M0UA 4KB5A 4L5CA 2Q8QA 3BH6A 3I12A 3IBYA 3PDHA 1X1TA 3KTOA 2PHZA 3GRAA 2R6CA 3TJRA 4IX9A 3RO7A 5B55A 2A5LA 1ZGZA 2P8SA 1MX1A 5ALUA 3B20A 2A94A 3TD6A 3G79A 2XKAA 1K27A 4YBRA 3OQOA 2Z2JA 4J0GA 1WXEA 4FYWA 5LLSA 2YJ3A 4Q3LA 5SY4A 3OA2A 3ZTTA 2YNMA 4I4TF 1A8SA 1TK9A 2CL6X 5G0VA 3DJFA 3WJ1A 1ZS9A 3C8HA 3FDFA 2D4HA 3FCCA 3L5OA 3PTLA 2W6QA 3O82A 2O1SA 1M10A 4HNAB 3EAGA 1OXUA 1FTWA 1EHCA 2V9PA 1JG1A 1ZSYA 2R7AA 4DCOA 4BFVA 4AJ4A 1MV8A 2C77A 4LBZA 3T0FA 1CIJA 1T5HX 5E2IA 1E3TA 3GIDA 4BB5A 3SQNA 4J7CA 2EAUA 3GYGA 3FYUB 4C6HA 4XEHA 5FIUA 1ABEA 3NKFA 1Z16A 2XXAB 3Q8LA 2J6CA 1KP2A 3DZDA 1GSAA 1LJLA 2FWAA 4ZT3A 1QYCA 2X0DA 4E2ZA 1JWLA 3FOWA 5A8IA 5JEJA 1M2VB 2KHZA 1E9AA 2V6JA 1A1SA 1EP1B 3LFUA 4MI9A 5KTMA 2Z6AA 2AV6A 5FR2A 2A14A 2IYAA 4N5IX 1KHXA 2MSDB 2ZR9A 1Z18A 3RF6A 2R0QC 4TS9A 2PLFA 2ONCA 3PHHA 4K6FA 3ZLJA 3EDYA 1D1SA 1CP3A 2EJCA 4DDVA 2PRIA 2ON6A 1MTOA 2OSVA 1KFEB 1HF3A 2HK7A 5E6UA 4BX0A 4ZMRA 3AVOA 1BVHA 4RY9A 4YK7A 2HDWA 3NEAA 4CHGA 1CQWA 3AZPA 1WPQA 1CZLA 4M53A 1I94B 1IE3A 4HCJA 2GCOB 1BKSB 3L8FA 4L08A 3C1OA 4RIFA 1XAIA 1F12A 1ORWA 1W59A 1COWD 1RPTA 2CUNA 4XXHA 4OHWA 4UM5A 5DTMA 4Q1CA 5IK2A 4JVNA 1QPBA 2E3JA 2F43A 3K8ZA 5TF0A 2Z2YA 4CGYA 3NATA 5JDCA 4MW0A 1KSGA 4CQLA 1NG9A 3T3GA 3KJNA 4C9BA 3D8BA 4KR2A 3DC7A 3P19A 5LXTA 2C5FA 3NGXA 2PKQO 3UCFA 3ZYZA 1WIWA 1OU0A 3VHQA 2I2DA 4M8IA 2WG1A 1KR5A 4AP5A 2VUHB 1H0KA 2PZLA 2FMXA 5TVGA 4MMYB 2LIPA 3IO3A 3KLPX 1P5ZB 2CY0A 3Q6NA 3WNDA 1U8UA 1QHHB 4QTYA 3RT7A 3RJ5A 1K7SN 4LK2A 3PFFA 1ACMA 2WIGA 2RHTA 4FIZA 1PD0A 1OREA 3TZQA 1C41A 3SHVA 1NULA 2JBAA 1W19A 3AJAA 3QXCA 4QGFA 1YWGO 2PMBA 4TLCA 1GAEO 3CPSA 4X84A 5D6OA 4DBLC 1V5IA 2XUPA 4NBNA 3GFOA 4NMWA 3EFOA 4UHBA 4G0YA 1IG3A 1PHPA 3CUKA 3CMCO 4V0SA 3OTWA 4R5MA 4Y1RA 3ESQA 3RH0A 4KWHA 5SV2A 3W2IA 3VR2A 2VDUE 1PVOA 1XMPA 3AEKB 3BIFA 2BY4A 3HI6A 5TQJA 2P3QA 1YRAA 2XA2A 1GXCA 1BVUA 2HMSA 2HSDA 4ZO8A 3VHLB 2I91A 1IN1A 2QQEA 3LRPA 4KOAA 5G53C 5HJ2A 3K31A 3TTXA 4ZYVA 2Q4RA 4GL2A 1F6DA 4K6OA 4MEJA 3DBRA 5J58A 1HY3A 1PBTA 2V1XA 1N1MA 1V1RA 1ZOSA 1K63A 2HXGA 1EVJA 2WV9A 3FCEA 3A3NA 3OOJA 4S24A 1KEPA 1OPXA 1QP8A 1WPXA 5ILOA 1X38A 5F52A 4PCVA 4B74A 2LKCA 2QUZA 2R6ZA 2ZUEA 2JVKA 4JBIA 4BO2A 4TZ0A 3ZWCA 4DJJA 3WLFA 1AG9A 1J8QA 3Q5EA 2ACVA 1HDYA 3RVNA 4C4OA 1XJCA 2HQ1A 2P68A 4RSRA 1WDKA 4OF4A 1G4HA 5LD2C 1R88A 1Z7WA 4BMCA 3D4PA 1ZW6A 3SZUA 1GZ4A 1YASA 4OM8A 2GD1O 2FR8C 2NZXA 4ESOA 3B38A 5T3YA 5KNCD 5CLIA 3F6SA 3ZUPA 4AJIA 2NUBA 2W8BB 2H8GA 2PLRA 3CZ4A 3NHLA 3PHJA 2A0UA 1T4CA 3HYRA 3LSTA 1QLWA 5AK4A 4YCNA 2PIAA 3AR2A 4HLUC 1DLIA 1LI7A 3PE6A 4ND2A 3B5JA 3M6MD 3F9RA 1CR1A 4ZZIA 4HDSB 3UBTA 4V24A 1TNDA 5TT0A 4BO0A 1RRFA 4HRYA 2WMDA 2FMFA 2C07A 4UUQA 3OQMA 3RTCA 3L02A 1UEIA 3F49S 4G01B 5K3OA 3U7HB 1U7UA 3H42B 3INGA 4EHAA 2AC2A 5CPFA 3NDRA 3N8HA 4NYJQ 2CSXA 1P2FA 3G2LA 4R1NA 3E22B 2IPAB 1C30A 1OILA 3B2QA 1IN8A 5JVDB 4C3UA 5BUZA 5EMJA 3QHQA 3DP9A 2AWOA 3CTMA 3VPCA 2CFRA 4R9SA 5JD4A 2ZDHA 3O8OB 3TL2A 4AQDA 5AFSA 4G41A 4Y1GA 4MV3A 1U90A 1TADA 3ER9A 2BDTA 2JK1A 1VPDA 3KJQA 4CKWB 1T6XA 3WK8A 1CCWA 5GJCA 1U0JA 1EVQA 1BRTA 1QHGA 4W63A 4XE5A 1JECA 1R0KA 4MGYR 5JSHA 1LBQA 1WMEA 4FYHA 3UW3A 1ABBA 2G77B 2M32A 1CY6A 1PWEA 4XIGS 3OM8A 3ESXA 5FEMA 1KDOA 2UKDA 4YUVA 2CCKA 2QXUA 4YV1A 4WESB 3SIRA 1NBAA 3GBVA 4Q3KA 3GUYA 3K32A 4MROA 2AOTB 3VPDA 4A8TA 4OLBA 2C00A 4EG4A 4KPUB 3M82A 3ZBUA 2OL4A 3AW8A 3MGBA 3A9RA 2O2EA 1BG6A 3H6GA 2QRVA 5JSUA 2O23A 3A4YA 5DHSA 1IG0A 1JQLB 1W6RA 2HPZA 4ZT7A 4CMIB 3NHYA 1TJPB 5E9AA 1JH8A 3TXXA 1K89A 4D9NA 3KB8A 1R74A 4FDLA 4V38A 3SSNA 2HHCA 1SU4A 2R11A 2IP2A 5EE1A 2WWTA 2H07A 4MARA 4IDAA 4ENWA 2P2SA 3AM4A 5LNK1 1KIMA 2QL9A 3JR7A 1Y98A 1MVLA 3R4CA 4BNDB 4C88A 1F06A 5AMXA 2C2ZA 1BN6A 3CVJA 4MW6A 3D7KA 4E5VA 1RYFA 2UUAB 1FDTA 3EMVA 4FZVA 4TXMA 1GPLA 2V7QD 2QTCA 4KGXA 4LXQA 4BBZA 5C7IO 5JEEA 1OF1A 4YT8A 4DR6B 4OXKA 4RLQA 4F3TA 2CLLB 2BGLA 5CYPA 2HDOA 4UZSA 3BRCA 2GCIA 4IO1A 4AUKA 4RTOA 1RAEA 1ETHA 4DKXA 1WF6A 2AEFA 1V3TA 3GLVA 4EB6A 2RGGA 4YPVA 2X2FA 1UKVY 3N2GB 4JYAB 5B6PA 3LD9A 1OT3A 2ZE5A 1QO0A 5KMGB 1VLLA 4BMDA 4RYLA 1M8KA 3VSEA 4YRNA 3IQHX 4OMCA 1SCUA 1TDJA 4YRFA 4W5QA 4HNSA 1USUA 2DSNA 2BWJA 2Q49A 4CM9A 4HGPA 3LT2A 6LDHA 1QR6A 1IMOA 5AW2A 2O0JA 4HJRA 1SBZA 1RXSA 2LDBA 2PT9A 2MSEB 4MB2A 2AN3A 2WZCA 1PX2A 3VH2A 4A0RA 5LLDA 1P0CA 7YASA 3DB1A 3SR4A 1Y5LA 1DAPA 1UKZA 4HXGA 1BKDR 1DBIA 1I1OA 3CW9A 3PC7A 5T6BA 4QHSA 3V3KA 2AOUB 4FFWA 3H0CA 4BNDA 5HSGA 4DLBA 1PWZA 3FSRA 3HKBB 1D7AA 1ZO8A 5B5SA 1WDTA 1FA9A 5HQTA 2WSSD 5CA1B 4ROSA 5DHQA 1XKXA 2QGNA 3FVQA 4DLLA 4J29A 2J6BA 3S28A 3Q41A 1GARA 1PJTA 2FP4A 3K72B 2DRIA 4YUWA 1UADA 3SE0A 2Y1FA 4NONA 4OQNA 5EMMA 2XKBA 3V6MA 4YIHA 1IOVA 5I6DA 4UTXA 5J1SB 2WU4A 1FS6A 1PR5A 1KAEA 1U8EA 3B12A 4EIWA 2HM7A 4Q9HA 2XXBA 3UMCA 3V46A 4F72A 2RAFA 1US8B 2ZYDA 3VISA 4EGXA 1EWRA 1T3HA 1CUAA 2FG6C 4JA2A 2RGYA 1DWQA 1KPHA 2X7JA 2RHJA 1KK2A 2R62A 4GRDA 5IFKA 2B7BA 4DCSA 2V7PA 4RKFA 1LSUA 1ZOQA 3MXTA 4NR0A 2FETA 3U31A 3DYVA 1VL6A 4MH0R 4XPIB 1VOTA 1Y8RA 4GPD1 5AVKA 4BFTA 3LRTA 1L4GA 1T0IA 2OB1A 4JHLA 4QJ3A 1Z37A 3H04A 4OHCA 3W5SA 4WLEA 2IUFA 4PN7A 2WVHA 2D7DA 3HSYA 1AB5A 1BYIA 1C0LA 1J99A 3HLKA 2D1QA 5ENVA 5LUBA 4UNPA 3CUTA 1LX7A 1DXYA 1R0CA 5BMVF 4KRXA 4TMTA 4AY4A 1JHRA 3L9XA 1G1MA 2F7SA 2QN3A 3CMMA 3GCDA 4GFDA 5DP2A 2XHZA 7MHTA 4Q3CA 5CA0B 3A6KA 5KB3A 4H3VA 4WIAA 4QYTA 2GO1A 1AK2A 1SWVA 1UPBA 3R7BA 3VBCA 3VMMA 5KYKA 4P35A 3FFWA 4CT4B 1ZHOA 1IOZA 1Y3BE 4FB5A 3W3ZB 3ZDDA 2AVNA 4EWLA 4GYWA 5BRNA 4CDNA 4YC7A 4F6RB 5LP6F 2GS9A 5J23A 1QFZA 2GCPA 4FZJA 4M87A 2AFFA 3WJ7A 4Y18A 4Q6WA 5GAJA 5FUMA 1QRUA 4KX3A 2RBGA 4H08A 4KZKA 4FBLA 4L15A 3M4YA 3GB9A 4NBRA 3VAZA 4ABYA 3U9SA 2VHUA 3OY2A 2DFDA 2VQEB 2JHCA 3T4XA 1FCJA 1HTTA 4RJ2A 3GA5A 4H1TA 1Y1LA 4QGHA 1HQDA 3OCWA 3H4VA 3SLRA 3I2FA 3CNLA 1FXWA 3HRHA 1V4BA 4GYKA 2AX4A 5LMZA 1O1YA 2DWCA 2X0RA 3NBKA 3GVXA 1ZN8A 2VYVD 5G41A 2WWIA 2M6RA 5C7LO 5K3BA 1JLMA 4GLJA 2R00C 4MV8A 2EZ9A 2R5FA 3A1DA 3KKMA 2YHSA 4OYYA 2W8ZA 1AV7A 1JFTA 2WC1A 3OO1A 5F3WB 4JXZA 4Q4AA 1CY0A 3OWXA 2DXIA 1O9BA 1S1CA 3Q40A 2C1XA 5A6SB 3GRUA 2QZSA 2HB6A 1B1CA 2Y92A 4FIDA 5FFMA 3TLYA 5CVTA 1CBUA 2QYSA 2Q5FA 5GMOA 1LK5A 2F3TA 2H0QA 2ZEJA 3G7NA 3JR3A 3ESBA 1HSZA 1U5BB 5LBIA 4BNKA 3J81A 4HDNB 2JBWA 1OLXB 1JR3E 2PS1A 1Z6PA 4J94A 3DTNA 3WL7A 4HH1A 3E03A 4Q4JB 2GERA 4ZRNA 3VR5D 1SUPA 2ICAA 4IFBA 4GGPA 1C1DB 1U2QA 1XDUA 3GLSA 3NOXA 3WKAA 4YCLA 2VA8A 4R1OA 3RVSA 4DLKA 3ETNA 4G2NA 4JBLA 1QK4A 3PA6A 1MIOB 1BX0A 4FGWA 4DCJA 5E1OA 2GRAA 5F51A 2VUUA 3FCYA 3FNRA 3NHWA 4O4HB 2FMKA 3ZQUA 3BGSA 4YI5A 3PC8C 5F4BA 3X3HA 4KNVA 4KPEC 4BB0A 4LWPA 4OXNA 3BXHA 1POXA 1B8NA 1L4KA 4LNAA 4EQ6B 3SC2A 2J45A 1L7NA 4I50A 4YRGA 1U0BB 5HRCA 1HBJA 3A2LA 4LRWA 4YN3A 2I2AA 5IXJA 4HAUA 2BZ0A 3JAWA 4FZ5A 2PR7A 3AOEA 1KARA 2X1HA 3I9MA 4W9NA 3LXMA 1G9XA 1G9SA 1Q7BA 1N7HA 3VR5H 4G63A 2NU9A 4I1SA 3ELSA 4GXQA 5KVQA 3WIUA 1MC5A 4PLWA 4R7ZA 2P4QA 4NE7A 4RM2A 4Y9SA 5JYCA 3IIEA 4EZBA 2SKCA 1M2VA 4DV6B 2O3TA 3LXRA 1E98A 5AXDA 2DETA 4JWKA 4BYGA 1FYVA 4R40A 1N77A 3ZBTA 1GQYA 2BEUA 3BE8A 2WKRA 3UUEA 5KOHB 3RAEC 2O7VA 3QVGA 4M0KA 3VYRB 2Z6QA 4A7PA 1WCIB 1JJVA 1UXGA 1Y48E 3HUUA 1SKYB 2OHVA 3L9WA 1P6QA 2OEPA 3G9XA 2VI5A 1KOJA 4C08A 1TCUA 1ZXLA 3M5CA 1MIOA 4KBYA 4ZTBA 4ZVRA 2BBSA 4TQ9A 4AECA 1DCFA 5GONB 1DD1A 4ZEVA 2CD9A 5G1OA 4Y67A 3P0IA 3FKSA 4I81A 4ZJPA 3HY3A 3GFRA 1B93A 2ACEA 3I45A 3OZBA 3K16A 5NULA 3CZ5A 2B1RA 2X6TA 4X8MA 3T5CA 4F7WA 3C97A 1K4KA 2ADOA 3DF9A 1QIMA 4G8DA 2ZYUX 3QPVA 3DLAA 1J42A 4DR5B 1FW8A 4O5OA 3IOCA 1E2EA 4BWYA 3B82A 5B36A 4WECA 4NCBA 3W78A 3BTOA 3EXIB 1J9ZA 1NLYA 2G04A 2EF0A 3MCWA 5EP3A 1J2UA 2OBYA 2GNOA 3ETDA 3ZIAD 1U3UA 1P2TA 3HJBA 1VBKA 2GM3A 2GSDA 2NIPA 2UYOA 2REXB 4KX5A 4TWZA 2DHEA 4XB1A 1E5QA 1KYWA 2HLHA 3D6FA 1XR3A 2AB0A 3CF6R 3DNMA 3IEKA 3SF8A 3LUKA 4B7UA 1LTKA 3ENZA 1JHPA 2IYLD 2QAIA 3KKQA 4HDMA 4Y2YA 5AXCA 5KOHA 1R0BA 4IUYA 4MIYA 4KRFA 2J3QA 4HB4A 1LS6A 4ZCLA 1NUUA 1Z39A 2QXYA 3ND9A 1P2SA 1J39A 1HT3A 2XAAA 2ZCVA 3RSOA 2IHKA 1PJ4A 1QH0A 1TQ4A 2Z3WA 1FF9A 3AR9A 5AK3A 4B7AA 4D3ZA 1OY1A 2H1CA 1GAJA 2FPUA 3K05A 1JDSA 3NHPA 4MV0A 4N0PA 4P54A 1OIXA 3LQ1A 5DN6A 3RAJA 1USWA 3REOA 4ZDIA 5MHTA 3BFPA 3RADC 2QR2A 1SCBA 4LF8B 4GPZA 1T8UA 1I4DD 2Q07A 1KSFX 2FLWA 2X5KO 4OKSA 1C1DA 4TVBA 1T6NA 5DGCA 3RYIB 4DNXA 2F8SA 2YL2A 2FVXA 2QX7A 1FFEA 3MIIA 3SEZA 3RREA 4Z4EA 1IOLA 2R1UA 2UZ0A 4UUOA 2Q0QA 4W9MC 1O3YA 2DFNA 4J03A 2BCJQ 1Z5GA 3SYTA 2FH5B 1B6TA 4B0OA 5BUQA 4MUIA 4O4HA 3NBXX 4X7BA 4B31A 5DTIA 2KLBA 1MJSA 4LCBA 3VTZA 4G84A 4TLAA 4BC1A 2DH5A 2ZB2A 3PU6A 4O2AF 2BFWA 3LU1A 1KE1A 4RETA 2H2WA 4K9LA 1RM4A 1UBEA 3S5UA 4B3CA 2QWXA 2Z43A 1IUPA 2X76A 4HUQB 2HDNB 3E1GA 3WL3A 1RPZA 3LDUA 4LECA 1UOEA 5LOVA 1JMYA 1DU4A 3ED5A 1N32B 5EMNA 3T7JA 1FMJA 1FFDA 4UD6A 1L5WA 2Z08A 4I3GA 1U7XA 2JCSA 4RVHA 1YTLA 4UMFA 5UKDA 5EJIA 3AEKA 3FHJA 3W4JA 4POOA 3D3EA 3NDBB 3KR2A 1IQ0A 1SWWA 4U7HA 3THOA 1ZISA 3FF4A 2XNJA 7ABPA 1AO3A 5ETJA 5C5IA 3CVUA 4I36A 3MRXA 2H4ZA 4L76A 4MITA 4C0WA 1MRSA 1H94A 1BO6A 2FRXA 2O2IA 1GXSB 2WJWA 3CEAA 3GEMA 3NBZC 4YYZA 5A6VA 1H8HD 1CETA 1Y7HA 1Z4MA 2GO7A 3K0BA 3RYHB 2NWQA 5JE8A 5JD6A 1YNOA 5DN6D 4JLPA 3IJEB 4YJ2F 5KYXB 1OBCA 3V2UA 5LNK6 5H02A 3DAGA 2B4QA 5IT5A 3OEYA 1UBTS 4KMOA 2FEKA 3ZGYA 3P9IA 1MRZA 4RIGA 3ICOA 1PJ8A 3I04A 4X60A 2KQUA 3WY9A 2UUOA 2DB3A 5AI8A 1H05A 1ODKA 5H1YA 5FTMA 3R6TA 4OGWA 3P0EA 1C30B 5JBIA 5JNRA 2J3HA 2VP6A 2BISA 2A9FA 1MCZA 1Z6TA 4MCIA 1UBLS 4EATA 2WJYA 4ZI7B 4PQGA 2Z2ZA 4F2WA 1TJNA 3PEYA 3CIFA 1UK8A 3C48A 4MO9A 3U4GA 1NUPA 2Q4OA 3UXEA 2V5VA 3ZHYA 1Y0BA 1QOQB 3TOSA 4CF3A 3BRQA 3GZTB 4GSKA 3OF5A 3CW8X 5CAEB 1MNQA 4B2LA 1TGYA 3U6KA 1EP3B 2AI2A 4JR0A 1U2DA 4RHTA 4XWWA 1ISHA 1TKBA 1X1AA 3DW1X 3D6VA 4LGVA 3RWBA 1NVMB 1B0AA 4FWTA 1I33A 5AHXA 1VLJA 3BQ9A 3WI7A 2B83A 1QGAA 1RZ3A 2D2IA 3FYCA 3F6PA 4RCZA 4ZC1A 1QPGA 3G59A 3HCEA 3MLEA 3B6JA 3OT1A 4KIWA 2R8OA 4ER3A 4EO4A 4YAUA 4P82A 3VU8A 4NYMR 3LX5A 1R00A 3VVMA 4EF6A 4D26A 1F2DA 2B4KA 4BS9A 1SA0A 2D5CA 3EZ2A 1XAJA 4D3DA 5C2JB 4LJ9A 2D1RA 2WA2A 1JTFA 5INTA 2FU5C 4CNBA 3N5KA 3ZHXA 4PLZA 5KWVA 2BJVA 4P7JA 4N7MA 1I7NA 2CFSA 2SCUB 2I4OA 1XQ9A 2NVWA 1CY4A 3F5MA 5DO9A 3WAKA 2D1YA 4RIHA 4ZCIA 5JXIA 3AI7A 1EJ0A 2GHTA 3UWOA 3KELA 5SY9A 3SXUB 1MNAA 1XTRA 4Q9KA 3G5AA 3TQQA 2CVQA 4D0SA 2FDCA 2HV9A 2AMYA 3MJHA 5JBQA 3H2HA 3ABZA 1U0EA 2W71A 1HT0A 3KEFA 4BN5A 5B12A 4PHGA 4BLVA 2VLIA 3ROKA 1AK9A 4BMZA 4BV9A 3WYEA 1D2MA 4HNTA 1TC2A 4P4SA 1BXGA 4UHEA 1UXIA 4PS1A 1S0UA 3C70A 5TQ2B 5DCUA 1R3DA 3Q8WA 3QNMA 5DPMA 4B2IA 2BRUC 1ENPA 1KTVA 1EVIA 2GZSA 5G4KB 5KTYA 3G0DA 3FTFA 4QDKA 3CSUA 4HWRA 3DAYA 2HBQA 4LJLA 5KYUB 1CULC 3B2EA 3UJ6A 3RK1A 4MICA 1BHQ1 1PZEA 2DKNA 4BGDA 1CQZA 2PWBA 4XUCA 1JDNA 4EPTA 1PWYE 2XAUA 3AR4A 2Y93A 4B1FA 3ERCA 1H6BA 2R8BA 5EHIA 2HF8A 3B6IA 1PJRA 5CNKA 1SUIA 3IAXA 3QVJA 5K2OA 4JYZA 3VYSB 1K5DA 1JALA 1M5UA 2QN6A 2C04A 2YW2A 3EMKA 3M70A 4BGIA 1Z6GA 1G38A 1DBQA 2C5AA 4FHCA 3OEEA 1PFYA 3GJ3A 3W6NA 1P9LA 5A4IS 2Z58A 1ZI9A 4W1QA 5HM6A 4RDCA 4XJSA 3FOCA 3LZ6A 1WQ1R 4NICA 2P8JA 3H11A 2YJ6A 4COOA 5ADVA 1IUOA 3QIAA 3HV2A 4P9NA 4JUFA 1ZI8A 3FDXA 1OHHA 2DFPA 5ENZA 2DECA 1SCDA 1G9TA 1V6AA 1I5RA 1K08A 3OECA 4NYIR 4ZT5A 1QTRA 2GTHA 1MAHA 1OAAA 2MOKA 4QOEA 5BSFA 3Q3CA 5BYJA 1DIBA 1K06A 3Q3JB 4A0GA 5KMGA 3JVIA 4R54A 2A2ZA 2WYUA 3LDGA 3HNRA 4DIBA 4MR8A 4UBJA 2OXEA 3E0QA 1KVSA 4A92A 1WPRA 2XA1A 3ENNA 5BVHA 5J4LA 5JHGB 3Q87B 4H3SA 4AMYA 3ZE6A 1ZMRA 2XBLA 3DL2A 4M1WA 1N2GA 4Z9FA 4EPYA 4XIYA 1ZNYA 3K9NA 1QIHA 1BE8A 3ITEA 4IV5A 5B64A 4HQRA 5F1KA 5C35A 3HM9A 4R2WA 3HRIA 3IA2A 4QXPA 4DABA 5BW4A 1ZEJA 1SBCA 3A0RB 3EISA 3I6ZA 4AKEA 1N9ZA 4ER0A 4H4DA 2CMHA 3E9CA 4IUDS 1N5JA 1PW7A 1UMBA 4FYIA 3FA2A 4MKXA 3V7WA 4O4JB 2QR3A 4K6MA 2J5XA 4RVUA 2BHLA 4RF3A 1KOFA 4ENTA 2PGJA 4D97A 1DKQA 2UYQA 3EGDB 1ILWA 1VJGA 4D9FA 4DBZA 2O8EA 3WXBA 1K7CA 2P9YA 1XZMA 1FXSA 2IEZA 5JRZA 1FPQA 3UTDA 3EQ9A 3JALB 4AVYA 2XNKA 3K9BA 3SOPA 2O19A 3I4CA 4XTCS 4S2EA 1P77A 1A9OA 2O2JA 3PXAA 3M3DA 4MS4B 4ZMBA 1RVDA 2ZXFA 1MX5A 2DKOA 3ZW7A 2X4IA 3HMKA 4JELA 4MLDA 4L4ZA 3G5TA 3C43A 2NUTA 3TVYA 1V9SA 1XAHA 3O47A 2QHXA 4WNYA 4EB0A 1BQEA 4L3VA 3FOEC 1J56A 1PUXA 4N3BA 1UM9B 3PF8A 3EEBA 1OHHD 1NF2A 2BEVB 2VP2A 3LUDA 3A9UA 1MDBA 3RSQA 3VDNB 3IQZA 2ZYSA 1XTJA 1F3OA 2LKDA 4MW1A 2H06A 4BPRA 3UFXA 1OGJA 1NP3A 1EHIA 1IZ9A 1VE9A 2Q3BA 3E5MA 4KAAA 4LC9A 5D5QA 4CMBA 2OZLA 5COAA 4MTLA 1KKUA 1R0YA 2R4TA 1Q21A 3LOQA 2Q5OA 1L7BA 5G1NA 3PZRA 1S8OA 3E7WA 5TMEA 1BHJA 3MOSA 1C1XB 2NO6A 3RV4A 2NSDA 3MTQA 5CTAA 3QKSB 4AS2A 2MIIA 4PNHA 4MHOA 4DRZA 1JV2B 4X00A 2XNDA 1XZHA 4P4SB 3OU2A 3OPYB 5A1TA 3N58A 4BRSA 2DU8A 4X6YA 3V42A 4LFCB 1ADGA 1XVUA 2GRJA 2VTDA 3T1VA 1ZJ6A 5GM1A 5LA6F 4W1PA 1EX9A 1ZCZA 2A59A 3R9IA 1LU9A 3JWEA 1GZSA 4YLGA 2OV1A 1XTIA 3VO8A 1V7PC 3JQAB 2O9JA 1NASA 2Y0BA 4RX1A 4DIFA 4CT5A 1H3NA 5BMOA 4CQNA 1NJ1A 3O3CA 1NIJA 1ATZA 2GEVA 1SVMA 3CG4A 1L9KA 2Z9BA 2ZIAA 3DE5X 5A04A 5J2UA 2B6HA 2VYQA 2PIDA 3QYFA 1N3LA 2BMDA 3T9BA 1JKXA 3TYXA 1MZPA 1A95A 4ZVOA 1QG0A 3KZOA 1XRRA 2GBLA 1ORDA 4TVKA 4B75A 2OK8A 1FMCA 4W99A 2KBFA 3UATA 2GVNA 4YONB 3IQIX 2QVGA 3DZFA 2G1JA 4NK5A 1YI8A 3OPVA 1RHKA 1QOPB 2J9YB 3KB6A 4TXJA 4UATA 3PFHA 2OKGA 3D2BA 4V2IA 1KZ6A 1L2TA 2QW8A 4TTTS 3QY9A 4KCGA 5ESRA 2G88A 3VZQA 1YB5A 1ULZA 2PL3A 3OX3A 1RP7A 3C7KA 1NR1A 4R8RA 2QE7A 1TGVA 2BTQA 2C9BA 3PQ7A 2R6JA 1CG6A 2VDWB 3DMHA 2IDMA 2ZDQA 3NOOA 4FKMA 1X15A 2L19A 2YBEA 3QEKA 4D5GA 3L7DA 2G70A 1ZRHA 5HUJA 2XUHA 5AIBA 4B9EA 1IHOA 3GJSA 1IY8A 1E3MA 4OP3A 3ABQB 4RWEA 3RUDA 3LOUA 4ODIA 4S1PA 2AQKA 4HVLA 2FX3A 4GMGA 4O4JF 3UK1A 3DHNA 2ATEA 1G6OA 4OQLA 3AVYA 3EZ9A 3FUUA 3OE5A 2OWEA 5EQDA 4DR1B 3OZCA 1VE3A 1Z3IX 2GCNA 2WTAA 3HJNA 4OM7A 2VZLA 1YHNA 3DYIA 4MUNA 5IXSA 1EK2A 1SVKA 2YMLA 3CX4A 3IUJA 3C74A 2IYSA 1CUEA 1YCHA 2Z4RA 1JAIA 4RK5A 1UWKA 4H4EA 1ZC4A 2ZYHA 2WAAA 3MGAA 3OLXA 5BYAA 1GNSA 1U8TA 3NT5A 5K8UA 5KPDA 3GROA 1YRWA 1GPUA 1QE5A 4LGYA 1JDBB 3LC7O 5FBHA 1JIKA 2HEIA 3JVVA 3LJKA 4E6PA 5BRJA 1V8FA 1BFUA 1NIPA 1NKTA 2XQFA 3IIJA 3DXFA 4BFWA 4DA9A 4BMYA 3ODGA 1DRJA 5BN1A 2I2CA 3MQFA 4A6DA 2CYAA 2OBMA 3F67A 4I1UA 4L07A 1G8YA 5B37A 7MDHA 1FFBA 1U0FA 1NLUA 4XWGA 2FDXA 2FX5A 5F77A 1CU1A 3SYKA 2NU7A 3WL4A 2CUTA 2VJQA 2CVFA 1P1CA 4HNQA 5CGZA 5FQOA 2ATVA 1SUWA 3WISA 10MHA 2JK0A 3NETA 2FE1A 5F3DA 1E7YA 2REQB 4EA8A 4JEUA 3TKLA 3HKCA 3IBFA 3ZH2A 3C4VA 1V1MA 1MF7A 4D4LA 1PNQA 1ISFA 3D0QA 4OBWA 3J7AC 4I55B 1HXHA 3ZE8A 4IIEA 5EEHA 1M7BA 3C5VA 5L3QA 4PIMA 1PFWA 3FOFC 2ODAA 3AR7A 4HV4A 2NZ8A 4C7OA 3GJRA 4O29A 2I34A 1A50B 4JBYA 1X0VA 2WF6A 3ECAA 2V6GA 4IFEA 4NI5A 2CFIA 4QOFA 3RIGA 1PWHA 3T1NA 1E60A 3QBVA 2FW0A 2OE2A 1D6MA 2PVSA 4R1LA 5E6UB 1S9HA 5JANA 4F04A 2J07A 3MMSA 2FI1A 5CW1A 4MXDA 5CVDA 4PG5A 1E63A 1EFPA 1BQ4A 1KFKB 1TQHA 2C8KA 2PMKA 2WZDA 1QJCA 2C5BA 3HN7A 5AKYA 4CLRA 3GH3A 1H93A 1P9WA 3BM5A 4XQCA 1J0CA 3C16C 1LNSA 1PTKA 4HD8A 5K0NA 4BZXA 1QJ4A 4F9EA 3IERA 4MGHA 2V7QA 4WZ6A 3VKVA 4LNHA 3IPAA 1E1RA 4ON9A 3PXEA 4MWTA 1U7OA 4FCCA 2F3RA 3D7NA 3EXHB 3DHWC 4L5AA 4G56A 3KG2A 4NJEA 1EFRA 1R7RA 1XDWA 1JHUA 3LM8A 2LCFA 4OL9A 1I3MA 2WLTA 5FOUA 4BQOA 3DMPA 4ZGBA 1P5JA 3OCYA 5EQFA 4LC0A 3DTVA 5JI3E 3UHJA 1JDVA 1JEAA 2ZUVA 3TGPA 1P81A 4UM9D 3GAZA 5JRJA 3SEQA 2YV4A 4K6GA 4JY7A 1ONSA 4Z4IA 1LTHR 1A98A 4G1EB 2JQJA 3NC0C 2AR0A 2X0NA 3T35A 2I55A 2C82A 2Q0SA 2CB9A 3IOMA 1DJNA 1S01A 3DQQA 2ASEA 3PUIA 4JASB 4JGIA 1R4AA 4KE6A 4WKBA 1HMYA 3SC4A 4DEVA 1TU3A 3V1UA 2HIHA 5BNZA 4TS3A 1XMSA 3I4FA 5U1PA 4EITA 1EWYA 3L1JA 3R7WA 1VKRA 3ZU2A 5AOCA 3FDZA 4GXTA 1FS4A 3HYTA 3MWDA 4HXFB 3AUUA 3N2KB 1DUVG 5JSKA 2PGLA 5FLYA 4BWGA 4DLAA 5A3RA 4E09A 1L7DA 2XF2A 1KOLA 1XFDA 1ULUA 1U6JA 3OLVA 4KLZA 2PS9A 2FDRA 2WUWE 3JQDA 3VZBA 3PVZA 1YQXA 1N1GA 4IICA 4OJKA 1GPNA 5IM4F 1XCGB 3UMZA 2WNHA 3TSAA 3G88A 4IDCA 3UFBA 4J3JA 3A06A 2JANA 4H6XA 5FOXA 5SZIA 3R8CA 3CEJA 1OVMA 1R5JA 1U5AA 4CKCA 3TCXB 1GRQA 2YN2A 3JY6A 1MJHA 4JBGA 4FOLA 1N8TA 1MAWA 2H2GA 4IWNA 1NE7A 2D8MA 3V7FA 1IJBA 5TQ0A 1LY1A 1S3SA 2IU0A 1PDVA 5IYZF 3UK0A 3PXGA 1OX4B 1ITZA 4LSWA 2F8LA 3TK1A 2XT9B 4EUEA 1P7CA 3PC3A 2O07A 1MVNA 3NVMB 5EQTA 2J87A 5EHXA 1CB7A 2V3VA 3WGNA 4BAUA 2ASVA 621PA 3RKRA 4KRGA 2IXGA 3LLUA 4EO9A 2DPHA 2QNBA 4CFSA 1YBMA 3L1VA 2WJ6A 4H27A 3IS3A 3Q98A 3ZY3A 2H5IA 1VRCA 3GEPA 1E2IA 1W49A 3MB8A 3E3OA 4X1IB 1BH2A 3D4OA 4JLKA 4N5LA 4ADSG 4FMBB 4WGGA 1J1UA 4DHWA 1M2HA 2QN9A 2C7PA 3N2NA 3KOZA 1YA8A 2MYTA 3BJZA 4LWQA 2AN4A 3QEOA 1I36A 1CEXA 3CIOA 4BV3A 1JG6A 1YC2A 1A82A 1N5RA 2IYFA 1M0WA 5G0TA 5BO5A 2XWPA 3REQA 3VZPA 2V6IA 4B3IA 4HRVA 5C9ZA 5CB4F 3EZFA 2GZMA 3AHGA 1RRCA 3PFCA 4ZAWA 1P5FA 2VAWA 4IQ4A 1XTPA 2WWHA 3ND5A 5HQJA 1MOSA 1VFPA 4BX2A 3AO0B 1KVTA 3HDHA 5CB4A 1IPEA 4QBIA 3V1KA 2KWIA 5ELMA 3ADCA 3TO5A 5IW8A 3R3ZA 2IT1A 2W22A 4IHKA 4DDUA 3UGQA 4D6YA 4XLLA 5K0FA 4PRKA 4C7JA 2VVTA 1TYAE 3F47A 1PQ4A 4FNGA 4TTVA 4X1KA 4MKFA 5EFOA 4EUKA 1NYTA 1TVKB 4QDUA 4KQGA 3GO4A 4I1IA 1FVOA 2HYDA 2R2GA 5JCOA 3GRPA 1E92A 4L6AA 3U39A 2OCAA 3ETLA 3VDQA 3IPLA 3CPJB 4PPNA 1NX9A 2QL6A 2H29A 4PBRA 5DHFA 5KDDA 4JZYA 1N1DA 1LLUA 2PUTA 2D59A 2XQIA 3BULA 1CP2A 1XU4A 2I2BA 5CX4A 4YLYA 5FPTA 5ANRB 1WMAA 4GDFA 3AI1A 5HF6A 3S2GA 2CXPA 3HB9A 3M2TA 4H16A 4NU0A 4U63A 5DF1A 1JSCA 3MT0A 2DWQA 4OB8A 2CF5A 4ZWNA 5TT1A 3ZS8A 4V3BA 1JH9A 1G5HA 2Z6VA 4Q4HA 4CM3A 2YV2A 1YFJA 3CZCA 3DAOA 3I8XA 4REMA 2FJUA 1SFRA 3UAOA 4OHVA 3UHAA 4A10A 1H1LB 2PWAA 3NI2A 4CTKA 5BXYA 5ISMA 1WR8A 3MQ2A 4K9SA 1K3TA 4A15A 3U56A 1UC5B 5EKXA 4FNAA 2IOFK 4U5XA 2B25A 1ZK2A 4OHMA 5TY0A 2QGZA 1FRQA 3T5PA 1ZM4A 2Z8YM 4JH0A 3MTEA 2AMJA 3CLUC 3Q7EA 4G09A 4Q1VA 1SXPA 4RMJA 4ZYLA 1Z4LA 1ADBA 3KNZA 4KLNA 3CKKA 3SJUA 1T5DX 4Y0AA 3SEAA 2QTVB 1EE2A 3F96A 4AY3A 1RRVA 3M6XA 3EA0A 3EBOA 4MKIA 5I9MA 5J2UB 1KJWA 3T52A 1I1HA 1PSWA 1YQQA 1IATA 4C4PA 2ECKA 1JI0A 2A0TA 1N92A 1VE6A 1BDHA 3HUEA 1EFVB 2YJTD 3WK5A 4D92A 1XKLA 4YRQA 3RVRA 4KVZA 4M0PA 3FZYA 2NTEA 1WMBA 2OVBA 2QD5A 3IT2A 3JVEA 4NV1A 5TPZD 3OLQA 3U7RA 3QI2A 1XLWA 2F55A 3GRYA 5SZKB 3W05A 1EGQA 1D2HA 1U2GA 2JRLA 5TGZA 1O57A 1F8YA 3SVTA 4RCYA 2P78A 3WK4A 4DFDA 5H4GA 1XNJA 2J59A 4LJ4A 5FLKA 4MWEA 5CDGA 3RSLA 1RKXA 4RANA 3DULA 1OYOA 4R8VA 2ZRPA 3T7TA 5JD5A 4AJKA 1CJUC 4MVJM 4X1IA 2Q45A 3ZWQA 4CU5A 2E1PA 1QGZA 3NHRA 4DV5B 1T9GR 1MA0A 2O6LA 2YC2C 2P7IA 2NQ8A 3OZWA 3F4LA 1ZNQO 2P30A 3T4UA 1NFQA 1E6LA 3U40A 5AOBA 3TWOA 4JCCA 2VA9A 2HK6A 4RPCA 2RHHA 5ESDA 1T2FA 2IEYA 1ORRA 1U2RA 5MGNA 2PGDA 2HO4A 1JW9B 1JE0A 1M3SA 4BRUA 2VSOA 2YS7A 1QH1B 1HEUA 1BSVA 2G17A 4R2KA 4GOMD 1N5LA 1T2VA 5FAXA 3G9TA 3ETGA 4QFBA 1E2UA 1QZTA 2CFCA 3E3MA 2ZJZA 1PZXA 3IP1A 3PB3A 3R0VA 5KKCA 3MCTA 2R8YA 4YY3B 1VMAA 4O8CA 3BHNA 1PR3A 4ZHQF 4N49A 3MJFA 4QBHA 3S2YA 2I33A 2QD4A 4CM1A 2ORIA 3PLNA 3EVZA 3NRCA 1TA9A 1DQYA 3BRSA 4MUYA 3TBFA 4NOJA 2NUTB 3JZDA 4ONEA 1DV2A 1ZINA 2IOYA 3A26A 3RUEA 4D81A 2ZRNA 3KUDA 1J8VA 2HSEA 2HUNA 2IHVA 1CUYA 2RG1A 3PITA 3BWEA 1C3EA 4LBWA 5DJ5A 1RADA 2IXEA 4G37A 4ND4A 5G0SA 5CFRA 2LTAA 3LBIA 5A4AA 2Z8YA 2EW1A 1PV4A 3A9SA 1X1BA 4PZEA 3K6KA 1D4AA 3ZTYA 1D3AA 3MJ4A 5IPFA 4AM8A 4WZAE 3QEBZ 3V80A 3HP4A 4MUFA 1RC0A 1G21B 1CQJB 1KQNA 1XN1A 1Z0ZA 1YKSA 2QRQA 4R3UC 3O4RA 5IRCD 4C14A 1C3LA 3Q7QA 4MWBA 5CIQA 3PIDA 2YHIA 4H1VA 1K3JA 4XA8A 1BCRB 3IBGA 4BAZA 1NOIA 2PD6A 3L0PA 5DE3A 3ZW9A 2OZEA 2XMRA 1MW8X 2OLEA 1M6EX 4J0QA 5TQVA 2XB2A 5DHUA 1KJNA 4B9AA 4GP9A 1PNVA 5IEBA 3PR3A 3ILVA 3KJEA 3RT9A 3SC3A 1FU4A