5DHVA

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
b'QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvA00
5AG9A 2VC2H 5E1AB 5BV7L 5F7UA 2FX9L 4I3SH 1K8DB 4N0FA 1P2CB 3NGBB 3QDAA 4PRHE 4L9LA 2GCYB 4P9ML 4XWOC 4BZ2L 1KTDA 3ZHLA 3PF2A 3K0WA 1VSCA 5F1NA 4GRMA 5HY9A 3AUVA 4W70A 1MELA 2IAMA 1DQDH 1ZT4A 4IDJH 1YPZF 3R0MA 4HIIB 4ZG1A 5CP7B 3G6JA 5DVMA 3RWHA 2FO4A 1ZLSH 1GAFH 2ZOKA 1WZMA 2QSTA 3WFDL 3SPVB 1BGXL 1HNFA 5DJ6B 4NCC2 2AJ3B 4JRYE 1S7RB 2QQNL 2XN9B 3C6LA 5MHSE 2GSGA 4Y1AA 3BHBA 2FSEA 4GBXB 3WFCH 1R0AL 2XNAB 1FL3B 3RJQB 2AJVH 4JDVA 5ANMA 3VXMD 3F7PC 4YBHA 4HUUA 5CS7A 3ZYIA 3X3GL 2NY5H 4Y4FB 1KCRL 3PV6B 5I1KL 4OCWL 3A6BL 4PJ7E 1RUMH 3TYGL 3ABZA 1HYSD 3J7HA 4HGMA 2FL5A 1U92B 4YR6A 1UYWL 5AG8A 2EIEA 3A67H 4YXHL 4P3WA 3V0VB 3QDGA 2DI9A 3QUYC 2ORBL 1AGDA 2I9TA 5HYEA 4NUGL 1G9NH 5L2KE 3HAEG 4K8RL 4AEEA 3LN9A 5DJYA 3T4YB 1VDGA 3S4SG 5KS9F 4Y5XC 3VJ6B 3U36B 4RMWA 3WSQH 3MLRL 4HKJA 4TYUA 3WD5H 3PQYA 5DHYA 3GM8A 1FC1A 3DUUB 4PUBH 1HOCA 5DK0B 4PJGB 2ICEA 1SYSB 2CPCA 4F57H 1WWWX 1LO3H 2HWZH 5EPMB 4Y5VB 4K7FA 3RWFB 1R3KA 1CVSC 3P4MB 3SKJL 4KU1A 5BS0E 5IBTL 5I1IL 4HZLB 3WXVH 4G6JL 2EXYD 3VDAA 3ZSTA 3BPLC 5SWSA 4NNXB 4NPYA 3V52H 3KPSD 3HZVB 1KN4H 3FAWA 5ALCH 1BJ8A 3AROA 5FXCH 3VXRB 4YDLC 4MXQD 1ORSB 5DVOA 5FKAB 3W9EA 1MCOH 1CG9A 5BQ7A 3VXUA 1QSFE 5TE6L 3UJTH 2XACC 4YLQT 5IBUG 4GXVL 1Z9OA 2XYCA 3JWDL 1B2WL 3RY6A 3FQWB 1FC2D 2IANE 4AEHL 3N06B 1U2HA 3VXSB 4OCNC 4RCAA 4F2MB 3MLVH 3ZE2E 3BAEH 3MCG1 1SYVB 3DPBA 3SE9H 5FV1L 2OQJB 2CLZB 2E7LA 3MACL 1K4DA 5KZCB 1UQSA 3MODH 1A8JH 4KKCC 4X4ZA 3T0DA 4WO4C 3VFOA 5I30H 3OZ9L 5I18L 3MA9L 4NO2B 1EK3A 4D0CA 4CGTA 5CGTA 1G6VK 2JJSC 3D0LB 4NRYA 3NCYS 4NN6B 3AREA 3CDCA 4UIMA 4KDWA 4MJID 1WFUA 4P23D 4KJQD 3BWUC 1UA6H 2Z0BA 3ZKND 4WY7H 4W4OA 3VRIA 3CVHB 1UM4H 4PJXB 4HJJH 1CXHA 2DWEA 4ZUVB 5IEKB 1V05A 2B5IB 1X5YA 3QCUH 4PGCB 4LKXA 1PEWA 2ATPA 2YPLA 4R4FH 5KS9A 2VLJD 3S5LB 4XWOD 4F7PB 5IFJA 4I0PA 4JO2H 4HWUA 4KROB 4G80A 2YD7A 4QYOB 4WUUD 4XNMA 4GKSB 4PJIE 3IDNA 3FFCD 4M93B 3GJEB 4K3HA 3OX8B 5T3ZL 5HYFA 1ODAA 4R9HA 4U1IB 4ORGA 4NDMA 2DLTA 4MNQA 5BXFA 2DI8A 5I17B 5D71L 5DQDH 2Q76B 1V7MH 4I18B 1NC2A 4HK0A 3LRHA 2E6QA 3ZDZF 4P2OA 5T5FH 3VXNA 2F74A 3ALPA 4S1DC 3IDMA 3EDEA 1ZEAH 3FTGA 3C9NB 3FJTA 2V5YA 4NWUH 1DUYA 5EC1A 2LQRA 2ZUUA 1HCFX 1U3HA 4OM1L 4LLUA 3T0BA 3C60A 1NEUA 5FGCE 5C0NC 3B3IA 2GJ6B 1BM3L 2F5AL 2YK1L 2DMBA 3TA3D 3GSNL 4OCMC 4LP5A 3DARA 5DHVA 5ESQA 3VD3A 4M1DH 4DUWA 3OAZK 1HNGA 4G6FD 5FGSA 3F7VA 2FGZA 1KPRB 3CXHJ 4LLWB 4KV5E 4P99A 4ZD3L 3LZFH 5E94A 3EFFB 4BK4A 4XP5L 3MV9B 4NC0B 3TNNA 1IAOB 5HXMA 3QUYD 2J5LB 5LCVL 3V4PH 4LPVA 3WNMA 1HILB 3TT3H 4G9FA 4EI5C 4HKZA 4WUKH 1AD0B 2EDYA 3M07A 3ZDXE 1TENA 4DTGL 4JANA 4KRPB 5EWIH 3IDGB 1BWWA 2XTJE 5LGJA 5TQ2H 1TJGH 2PYFB 4XBGB 4JFFE 2EH7H 3HG1D 1IAIL 5J0BA 3PGFL 3QUKB 1FVDB 3GBLA 4M6NH 4PYHA 5CFHA 4N0FB 3NIGF 2F53D 4U1LA 5E8EB 5IVXB 1XIWC 4HC1H 4L9LB 5E08L 3O6LL 4QRQA 1PD6A 2W9DL 5JIIA 3TESA 3DO7B 1KTDB 2HLAA 4Z8FL 3UDWA 5F1NB 5EZOL 5FYLE 1KCKA 5HY9B 5DGRA 1HHIA 1PJ9A 1ZT4B 5C07D 3G6JB 4HLJA 3RWHB 5AAMA 2FO4B 1EEYA 5FM8A 2ERJC 1GL4B 4DVRL 5C1MB 1D5BA 1T2XA 5JO5B 2YMXH 1TETH 1ORQA 3S36X 4Y1AB 3ARVA 2GTZA 3BHBB 2FSEB 2UWEB 1O7VA 3X3FL 1QPXA 2E8ZA 4LSTH 5E2VH 4JDVB 2XXCB 5ANMB 1KJ3L 4HUUB 4G8IA 3S5LG 3H9ZA 2B1AL 3P30L 4YHOL 4KKCD 4WO4D 2YPVH 4U6TA 1K9TA 4ODXA 2FL5B 4YR6B 4JY5L 2R9HC 1TZIA 1UJ3C 4I2XE 2YSSA 4JRXA 4OF0A 4TULH 2FJHA 4IS6A 3MRDB 5HDQH 3QDGB 4WHDA 4U3CA 1AGDB 2J12B 1S5HA 2HKFH 4O9HL 1NGYB 4PJBE 3ARWA 2F54D 4M43L 1PG7W 4PJCE 2F8VA 4FXGA 4H0HB 4F33A 4ZXBC 4KGLA 4EBQH 5DVNA 2ITDA 3T0EB 4JPKL 3MRKB 5FYJD 5EIIA 4HKJB 3PQYB 5DHYB 1NDMA 4HIEA 1TQBB 2HT2C 3OKNA 1HOCB 3U46A 5J1TC 1P69B 3ZHDA 2BHYA 1QRKA 4PP1C 1TTUA 4M5YL 2CR3A 4R7NA 2NY1B 4Z78A 2DN7A 4HIHB 3ARYA 1QKZL 1R3KB 5HHNA 2BZDA 3NH7H 4OCYL 4D3CH 3RQ3A 1JF6A 2KQNA 2PNDA 3FMGH 5SWSB 2VLME 3QCVH 5F9JA 1SY6L 1D7FA 3C08H 2NY6C 2M2DA 3HI5L 5E0QA 1JIBA 5BCAA 2DQEH 1J1XL 3QEGH 4S1DD 5JPMB 4KHTH 2ZPKL 3BDYL 1CG9B 5BQ7B 3LH2H 3VXUB 3W5MA 2C4FU 2R39A 5I1HL 2DS4A 1YPZB 5T33H 1N8ZA 3N1MC 4IIQC 2AGJH 5C2BL 5C0ND 1RIHH 3UROR 1EFXA 3B9DA 3MRPA 3L7FB 1U93A 4QOKD 5D1QA 2APFA 3K1DA 3RPIA 2Y7QA 1JWUA 3B2VH 3OAYK 4RGOH 2F5BH 1K4DB 1UQSB 1I4FA 2ATKA 3ARFC 3S37H 2ZOLA 1DN0A 3KXFE 5H2BB 4X9BA 3GSNA 3VFOB 3QPQC 3WDHA 3SDCA 4D0CB 3AY4C 2HKHL 1G7JA 1FE8H 4EI5D 1EJOL 4NRYB 5ADPL 4YNYB 2GSIA 3AREB 4UIMB 3CVIH 1P1ZB 4LPUA 1J1OL 2AJXH 3BP4A 4LLVA 3VRIB 2O5ZL 2DWEB 1Y18A 5K9QI 3F58L 1IC4L 1J8HA 3L3IB 1URLA 4LKXB 5IFAL 2COQA 2YPLB 2E7CA 4XB8A 5KS9B 1XIWD 1JHKH 5IFJB 2HJLA 5LVEA 5JTWA 4G80B 5BV7B 5GGSB 4NO0D 4XNMB 2IBGA 3IDNB 5F97E 2J8HA 5KVEH 4ZAKA 1CLOL 4L4VA 4LFHG 2DQCL 2X9YA 3H7BA 4MA8H 4XXCC 2WZPD 4NDMB 4XPAL 4MNQB 5KOVC 5BXFB 5EN2A 1X5FA 1NC2B 2X89A 4NBZB 4M7LT 5IK3A 1XH3A 1BD2D 1RZJH 3MBXH 4KKLC 3VXNB 3D85D 5EFIA 3IDMB 4K2UH 5E6YA 3FTGB 1IGCL 4K7PY 3QNZA 1D5MA 5EC1B 1U3HB 1X5IA 4LLUB 1IQWH 3C60B 1Q0XL 5D70L 3B3IB 3RX8A 4GMSH 4LPWA 2BX5A 4R90H 2LU3A 3OAUH 3EOBB 4DGYL 3SDYL 2D0GA 3FT4A 5DHVB 2H2SD 4YBLC 5ESQB 5DLMH 2OBGA 2QLVB 5HVHC 3BD4A 2R2BA 3F7VB 5EU7C 1QTYT 5JQ6H 2R9HD 5E94B 2FNBA 2MPAL 2X4PA 5SV4A 3QWOA 3LKPA 5INDA 3NA4A 3BXNA 2BNUA 1NGPL 3BKMH 4R0LA 4G9FB 3LN5B 3MV7B 4NQCE 4ZXBD 4WHTA 1CXKA 4NHCH 3LKOB 4JANB 5GGVY 1I1YA 1QA9A 5D7KE 1JVKA 5FHBL 5LGJB 2HT2D 3TCLA 3VWJB 2E27H 4O5LL 1AIFA 4YQXH 4TSCL 2NW2A 4OGYL 1I7RA 3EYVA 2X6MA 2HH0L 3QYCA 2G60H 4PP1D 5I73B 1BF8A 4YEEA 3HHRB 1MVFA 4U1LB 1JL8A 1CDJA 1MRCL 3N1GC 1NGWB 1AO7E 4Y2DD 5D2NA 3RAJL 2DLGA 4FTVA 1H8SA 1IM3A 1YQVL 3VMOA 2HLAB 3PWUA 3RL2B 4YHIA 1JE6A 3SBWA 5J9PA 1MF2L 1A3QA 5E70A 2NY6D 1N6QH 2X5PA 1ZHBA 1HHIB 2P8MA 2HFFB 1MHPH 2J4WH 1IBGH 5I8EA 3RHWK 1JN6A 1F58H 5F6IC 3ES6B 1EEYB 4LVHC 4A6YL 4JM4L 5FYLH 3PNWA 2PYED 3OHXA 4KHXL 1SY6A 1KJ2L 3PHOA 5J6HB 4WJ5A 2DQDH 5CZVL 4EXKA 3PV7A 4L1HA 4XP6L 3A6CL 4R4BA 2L7UA 3DX6A 5EBWA 1ORQB 2BY0A 4AQ1B 3BZEB 2BRQA 2GTZB 2OX5A 2NY0B 5T3XE 1CT8A 1UENA 1A9BA 5MI0B 1CZ8L 4G8IB 4LQ1A 4X0KA 5CCKL 2XWJA 5C0EA 1I9IH 2A2QT 4MX7A 2EICA 2IAMC 1T5WA 3ARFD 1EO5A 4TSAH 2GUOA 4ODXB 3QPQD 5E9DD 3SQOH 1CXEA 1TZIB 2VQ1A 2ZCKH 2FJGB 4JB9H 2FJHB 1B0WA 4IS6B 3WFZA 1Z6JT 4G9DA 2MQ3A 1S5HB 3TJEL 3WCYA 4W6XB 3WN5C 5TF0A 4YK4B 3C6LC 5KANG 4K94C 2EH8H 1QRNA 4FXGB 1OY3B 4LASL 4F33B 2NXYB 2JB5H 3VXSD 3OG6B 2ITDB 1TJIH 1OAXH 5CGMA 4LCWA 3MFFA 4EZMA 4JQXA 1KSRA 4L5FL 1XGTA 2Z92A 4TN9A 4BA8A 1NDMB 4HIEB 3OKNB 4NZJA 3MRLA 1MIEL 5IFHL 3V5HA 4WI2A 3U46B 3V8OA 5D1XA 3VDCA 2QTEA 2X1OA 5L8KB 4WTWA 4Z78B 4PJEB 2I9LA 5JLZA 5J89A 1WAAE 2QQKL 1MH5B 2D0HA 5HHNB 2FBJH 4KK5C 1KCVH 2BVUA 3VXQA 2C3WA 2VSCA 3CVHH 3EOTL 3GJFK 3BP5A 3EYFA 3UBXA 3F7RA 1S3KH 4JFZL 4YIQA 3WLWC 4KKLD 5C7XL 2PF6A 3MOAH 3RWIA 2CD0A 4F9LC 4OLUH 2DTML 4X6DB 3RNKB 4LQFL 1WC7A 1PAMA 1PSKH 1S7TA 4HKBA 1GPOL 1Q94A 1EFXB 4G7YH 1T0PB 3MRPB 4JZOA 3R4DA 3RBGA 1U93B 5CIPA 5D1QB 1BAFL 3RPIB 4P5TC 1JWUB 1MLCA 4LMQE 3GM0A 2VDRH 5L6YL 1I4FB 2ATKB 4NC2B 1NAML 2ZOLB 4LDEB 4JZJB 4YFLF 1DN0B 3BRFA 3GSNB 4LHJB 3K80A 3KLDA 5DURB 3SDCB 2WQ8A 3GKWL 3K2UL 1G7JB 4OFPA 4IRSA 1GIGH 4WI3A 2X7LB 3IETA 5I16A 5HGAA 2GSIB 1KCUL 5ID1A 2GK0A 3U7YH 3RY6C 3T65A 3GSQB 3VXME 2P5WD 4PS4L 4NN5B 3BP4B 4LLVB 5LGKA 1Z9MA 2BVTA 2X4OB 1CN4A 2IWGA 1Y18B 3C5ZA 3IDYB 3V4VL 5L0QB 4BZ1H 1FYTB 1J8HB 5K33A 4YDIL 2R69H 3BW9B 4YH6A 4JHAH 5KSBA 1MY7A 1OP5K 4HXBL 2V2WB 4ZSOE 3RIFF 2HJLB 3U0TA 3DX8A 3VD5A 3RNQA 1BBDH 4GSDH 1A7OH 4HS8H 4OUUA 2Q8BH 3C8KB 3LHPL 5C0IA 3EHBC 3LEVH 4ZAKB 1FP5A 4QCIB 4L4VB 1QSZA 2R0LL 1EHLH 4C83A 4W4OC 2BVPA 5EN2B 2X2YA 4B7IA 2VNCA 5C71A 1HINH 3JUYA 5FA4A 2V7NB 3ALXA 3KLHC 4UILH 5IK3B 1XH3B 3IVKB 5EFIB 3O2WH 3AGVA 1JGLL 4A6YA 4I0PC 3QNZB 1D5MB 3IS1X 1KJ2A 2WUCL 5EH1A 2VABA 2XWTB 1E6OL 3VI3E 4F9PA 4FFZL 5BVPL 4Q6IA 5FGBA 1OSZB 4NZRH 5C0CD 2VR5A 5B3NA 2Y06H 1EGJH 4OT1H 3FT4B 2IAMD 3QUXC 4LLQA 1NCDH 5E2TL 1CR9H 3HE7A 5CEXB 3B9KA 2JJVA 4P2OC 2OXGA 3QWOB 3LKPB 4FP8L 5INDB 4S0TD 2DKSA 3MR9A 3BXNB 4OQTH 3IKCA 2WWKO 1RHHA 3QB7C 3C6LD 4XWGH 5EA0H 1HIML 1S5IL 3QDJA 3VFGH 4WHTB 2HJKA 5L88H 4APQB 1FGNH 1HQRB 5JIHA 4RGNC 2NX5E 1I1YB 1QA9B 2EYRB 3UX9B 4MQSB 3BH8A 4XVTH 1KB5L 3B8YA 1G9MH 5J8OA 3TCLB 1I1AC 2P46B 3IU4H 4U6HA 5CGYC 4R26H 4LSQL 1I7RB 4K3JH 5TH2B 3CX2A 3L3HB 3EOYG 1OQOA 3HA0A 5D2NB 2ZCLL 3O6KL 4KTDH 1LILA 4KK5D 4FTVB 4HFWA 1KLGA 2WBWB 4L4TB 2D31A 1HN1A 3PWUB 3O4OB 4MJIE 4YHIB 5J9PB 3EFDH 1DANT 4JY4A 1B0RB 5EBMA 5FV2A 5DFVC 4D9LH 2P8MB 1DLFL 1ES0A 3ARUA 4FQCH 5GJTH 7FABH 3KWWA 5I8EB 3WLWD 3GSOB 2A1WL 2NXZC 4OBSA 2PCPB 2R15A 4ZUTB 3PNWB 4JR9L 1UCBH 3OHXB 5L2JA 5IMLA 4WJ5B 1YNLH 4NQEE 2VLJE 4CMHB 1JF1A 4R4BB 5TF1H 3AS1A 5EBWB 4DVBA 1RJZA 1IGML 4WUUE 1QR1A 1CVRA 3AVEA 4K07A 2OZ4A 1MRFH 3FZUD 1CT8B 3AC0A 3FFCE 1A9BB 1UXSA 4FZEH 5TE4H 3UDWC 4P5TD 3QEHA 1LP9A 1T0NA 2XWJB 1AKJD 5C0EB 2VDPL 5T3XH 4MX7B 1MFCL 1BFOA 1L7IH 3U0WH 2GUOB 1NC4B 4CU6A 2XZAH 4B50A 1LO0L 3K1KC 3UTOA 2R2EA 4P59L 3QQ3A 3VXUD 1P4IH 3MYZA 5FYKL 3CZJA 4G9DB 5E8PA 2Z8SA 2X1QA 4OIAA 1NAMA 4WU5A 1QRNB 4MJ4A 4OKDA 5ALBH 3RWCB 1JHLL 4MA7H 1JYVA 1K5NA 1ZLVH 1U36A 4DGIH 2W91A 1X4XA 4HLZG 4LCWB 4HBCH 4YXKL 2Z92B 3JWDC 5BRZA 3MRLB 3FHAA 4HGWB 3V5HB 1F3JA 2NY3C 4MJ2A 2IQ9L 5D1XB 3RDTA 5MEPA 1FFPA 1I9RL 3DTXA 2AV1B 4JJ5A 5IJKA 3VFUA 1GC1C 1NH6A 2A77L 2D7OA 3WMSA 2I9LB 4C57C 4I77H 5JLZB 3VG0L 2DYPA 3EHBD 5A2KH 2IMMA 4G6MH 1MCKA 1XF4A 3VXQB 3L9RA 4NM4L 4NQDB 4GG6E 4XI5C 4OD1L 1II4E 4DN3H 1C12A 2ENSA 3BP5B 3EYFB 4U1KA 3UBXB 5I74C 1JZ6A 2FEEL 2H32H 5TGBA 5GXBB 3N1QC 4JJHA 4YIQB 3KLHD 2YPLD 3CGTA 5E24E 2VITA 4MQ7A 3VGBA 1QYGL 1IGTB 5JIPA 2NZIA 4I0PD 1PG7L 4NJAH 2F53E 4PTUA 1K6QH 4QXGL 2KQMA 4KMTL 1JGVL 5EOQH 2VXTL 3S36H 2DD8L 1ACYL 4HKBB 3OSKA 1Q94B 3JWOC 1C5CL 3GMMA 3QQ9C 3GIVA 3X12A 3QUXD 1IRAY 1LEKA 1A6UL 2X09A 1MHEA 4TQEH 1KIUA 2N1KA 3MRNA 4ODWA 5DRXA 4Z7NE 4QXTA 3REWB 4RGMB 1MLCB 3GI8L 2CK0L 4WEMB 1NC2D 4B41A 4KQ3L 4D94A 3F6IA 3NCEB 2FCBA 4FQHA 4P2OD 4OLXH 4KK9C 5DUPH 2DLHA 3IT8D 2J3SA 2VUYA 4IRSB 5F44A 1RJLB 3I6GA 3IETB 5I16B 5HGAB 4XBPA 5ID1B 3CFKA 4RGND 5HYQB 2GK0B 4A2LA 3IFNL 1T21A 1A1OA 3T65B 1CE1H 5IB5A 4M9PA 1I1AD 1YEFH 5D7JA 4OGXL 5D1QC 5CGYD 3FFDA 1AXTL 5E8NA 1EAJA 3L3DB 4OCWH 4CUCA 2APXA 5DR5H 1KB5A 1WWAX 3U0TB 1CS6A 3DX8B 2H6PA 3MV8E 2CMRH 3SDCC 2CO6B 3RNQB 4UV7L 5J6GA 5D93C 3VWKA 4OUUB 3ZYZA 2F54E 5C0IB 3FL7A 5DFVD 4X9IA 1CFNA 4C83B 2M1KA 4KTYA 3UTSD 2NXZD 5FYJE 2BVPB 4FFYL 4KRNA 5A2JH 3DXAB 1YYLL 1RY7B 2C3VB 3MLWH 2OLDA 4K71C 2IF7A 4Z7UF 5I76A 5GGUB 1PX4A 1NFDF 4JM2F 3OJ2C 5D7IE 3TWCL 4AZ8A 3KPLB 5GISL 4A6YB 1YMMA 3QI9C 1KJ2B 3D1MC 2VABB 2UVEA 5E99L 4RWYH 2CRZA 4ZAKC 3SKJH 2PN5A 4XC3H 4Y5YA 2ZJSH 5I1IH 4LLQB 2YXFA 1BZ9A 3CNKA 3DIFA 3JXAA 4R3SB 1KOAA 4ZTOL 4OBRA 1C16A 3HE7B 3BZFA 4GFTB 3B9KB 4P2YA 2DDQL 3HMWL 3QP3A 3MGAA 3MR9B 1L7TL 5DVLA 3IKCB 3GUTA 1EO7A 1RHHB 5JW5A 4X6BB 3OXSB 4LSVH 3PGDA 4G43A 3HUJF 5TE6H 4KK6C 3QDJB 1AY1H 3O2DL 1KIRA 1X5HA 3T09A 1YJDL 5DTFA 4G8EA 1BOYA 5MEQA 1B2WH 5TFSL 4TNWF 4YUEL 4LSUL 4LGSB 4QOKE 5IT2H 2KDGA 3TBSA 4P4KC 2NY3D 2R2HA 3L1OH 3B2UC 4U6HB 1GOHA 2LFGA 2ADFH 3BIKB 1BVLA 1B0GA 4S1QL 3TO4A 5I1JH 4GRWF 2Q3ZA 3MJ6A 4JRXD 4N8PA 4PGJA 4NFCA 1H5BA 4EIGB 2XA8H 3D9AL 4XP1L 3CLFL 4Y16C 5KANI 1D9KA 2WAHA 1BOGA 1LDPH 1KLGB 4HFWB 5HHMB 1BIHA 1KFAL 4R0LC 4GKZA 5B22A 4JDTH 4LGPB 2DBJA 1A2YB 2ADJA 2D31B 3MNWA 4DKFL 4XI5D 2GJZA 1KLFA 4ZPTA 5EU6A 4JY4B 4LLMA 1R5VA 5EBMB 2E9JA 1ES0B 2VMFA 2YD2A 3KWWB 4Y8AA 3SE3A 1NMAH 5C6TH 3PHSA 4QTHB 4UV4L 5HBBA 4X7SH 5AWNL 4LK4A 3CPLA 5L2JB 3GHEL 4AIXA 4IOIB 3OKOB 2L4OA 4PRIA 2XG4A 4N0YL 5C09A 1JF1B 5F6HJ 5F96L 2P4AB 4DVBB 3PWNA 4WHCA 1RJZB 4P3CH 3M1BA 5CEZL 1D5XB 1QR1B 5EORL 5HI5C 3QQ9D 4Z7UA 1WWCA 3ULUH 1WBXA 1UXSB 5DYOA 5SWQB 3RVWC 1MAMH 3SBWC 1GXEA 5AD0A 1HKFA 3QEHB 1T0NB 5CAYB 1P53A 3AS0A 1MLBA 1QLEH 4HUNB 5T3ZH 1K2DB 7CGTA 3FQNA 5ACMA 3VGEA 3WJJA 1BFOB 4KK9D 2G5BB 3LKRA 5LBSH 4X7EC 2R2EB 4ZYKA 5C08A 4HT1H 1FIGL 5D7SH 3QQ3B 4OIIL 1FGVL 4XNQA 2EYTA 1BD2E 5E8PB 1O7SA 3EW3B 4O2FA 1NAMB 1BQHA 4Z7WE 2ZZUT 1HE7A 4AG4L 4WU5B 3BDXA 4NSKA 4L1DA 3NTCL 1OOAA 1MFBH 4AEIL 5JNYA 1JHTB 1K5NB 4UOW1 1BM3H 3O3EB 1S7SA 2AI0L 2VN7A 2YK1H 3FOMA 1INEH 3HUJA 1CI5A 5BRZB 5C8JA 1F3JB 1IFHH 3MGTA 2XPGB 3SDCD 1IC7L 3RDTB 4ZD3H 5TDPA 5J11B 5GGVH 5MEPB 1FFPB 3S3SA 5GRYA 2P1YA 3TPKA 1BQSA 4JJ5B 2P44B 3VFUB 4OZ4A 3N50A 4ZO8A 2DYPB 2FB4L 4XC1L 4X7TA 1XF4B 3RHWF 1H3TA 4OLYL 4PREA 3L9RB 3I9GH 4Z7QF 3H9SB 1A7BA 3WO3B 3PJSA 4KVNH 1C12B 2EC8A 4MNHA 4U1KB 4JFOA 3ZDYE 4JQXC 5TGBB 3DMMA 1OWWA 4HK3N 3W0WB 3GMQA 5I75C 1IAIH 3PGFH 4UT7L 5C0AD 1FBIL 1XGYH 4J3UA 3V9FA 2XZCL 4PTUB 4QT5A 3QI9D 5H35A 4K55A 2RJMA 4FQJH 4X4YB 1FJ1A 3ARRA 1WIPA 1UKTA 3RBSA 1BJMA 5E5MA 4IRZL 4QGTA 1QFUH 4ZAKD 1OCWH 3UAJC 2AKRA 4UT9H 5ITBH 4NNPL 3GMMB 2VDML 3NOIA 4Z6AT 4KKAC 3GIVB 4YGVA 1CYGA 3X12B 4HX1A 1NUGA 1ED3B 1INQB 8FABA 3MRNB 2EYSA 4ODWB 4QHKJ 5DRXB 4QXTB 1MCNA 5K59F 3O45A 3VU2A 2X89D 4FQHB 4M7LH 4HUWA 2XQYK 2O5YL 1U8NB 3BRDA 4YHPA 5GZNC 1T7ZA 2PYEE 3GRWL 1AI1H 1DDHA 5TE7L 4M7JL 2LAAA 3MLSL 4KK6D 3FO9A 2W0LA 4MDJA 4OZFA 4BFBD 3RY4A 3WIFB 5CLWA 5JXAH 1CLYH 4P57A 1EJ6A 3CFKB 3DGCR 3KJ4B 1G0XA 1T21B 1A1OB 1I3RA 4G7VL 1VPOH 4WI4A 3X3FH 3TVMC 4P4KD 2BP3A 5D7JB 3RJDA 3O2DA 1HXMA 3B2UD 2GAZA 3FFDB 1CD9B 5E8NB 4NQSA 4EDWH 3F5WA 3G5ZA 5F7WC 2R1XA 4MAUH 3OR7B 4PJAF 5E9DE 3AFLA 1KB5B 4KVCH 4Y16D 3EYUL 2H6PB 3DV6A 2K9UA 5J6GB 1KCLA 3CFIC 3VWKB 3WEXA 2E6PA 4O9HH 1KF9B 2YN3A 4GMTL 3HFML 4NP4H 4EJ1C 1CFNB 3VXSE 1MJUH 4KI5F 3C8HA 4U31A 1DQMH 2D7MA 2ADIA 3B83A 3QUMA 3UJJL 4E41A 3FRUA 3VXTA 3L5WB 2ZNWA 1A6PA 3C5ZC 4Z95H 5I76B 4NWTH 3QCTH 4OD2B 3TZVA 1UB5B 2DLEA 2Z9TA 3AU1A 1YMMB 5IIEB 1AQKL 3QIBC 5EO1A 5HI5D 5HPMA 3FT2A 3NABL 4BQ8A 3PWLA 2MCG1 3RVWD 3OPZH 2AK4D 4KPHL 4ZTPL 2ESVD 1KJVA 2VE6A 4Y5YB 1INDL 3DGGA 1H3UA 1FO0H 1XGRA 3CIQA 1BZ9B 4KQ4L 3DIFB 1IC5L 2OJZH 1A6VL 1RVFH 1MCPL 3QDMD 4S1SH 3WIIH 3BRGC 1C16B 3BZFB 1T2QL 1HCVA 1ROWA 4JG0H 2FHFA 2PKDA 4S2SA 2FATH 2NY2B 3LD8B 3GUTB 1YEHH 5JW5B 4OCSH 4OFYA 3PGDB 2ZPKH 4G43B 4LRNH 1WV7T 1DBMH 1KC5H 4EDXA 1ADQH 1KIRB 4KI1A 4PGBA 3VI4E 4Q9QL 5FHAH 4Q6IC 5FGBC 5MEQB 3TO2A 2AXFA 2DQIH 3T0XA 2IADA 5I1LA 4OCRL 5D72L 4M6OH 3TBSB 5EU7E 1NL0L 2R2HB 1A6WL 4MZ3A 1BVLB 1B0GB 3TO4B 3L5XH 3VMNA 2WBJC 3HAEH 5DZNA 4ZMAT 1H5BB 3H42H 5ISZD 3JSSA 1UM5L 1L0XA 3BKCL 3DVFA 1D9KB 1BOGB 5ILTL 5KSAA 1WIOA 1N7MH 2ADJB 3QQNA 4PJAA 15C8L 2GJZB 5IWLA 4ZPTB 2GT9A 1MCCA 4LLMB 5EU6B 4K23L 1R5VB 2EDWA 1G84A 1VEOA 2P5WE 4WNQB 4H20L 3ZE1E 2NZ9C 5CINH 4M62L 1MOEA 2QHLA 2HT3D 3CPLB 3MRGB 3LV3B 4PRIB 4RAHA 5C09B 4TUOB 4ETYA 3MCKA 3PWNB 1DSFL 4MDIA 3M1BB 3UAJD 4L8CA 4KKAD 4Z7UB 1WBXB 2O5XL 5FYJU 1NFDB 4WVRA 5AD0B 4JM2B 1QPPA 4MCZA 4MAYC 2WW8A 5IBLC 1MLBB 3IU3A 5DXWA 4C58B 5IESL 5EZLA 2A74A 2DQGL 3FQNB 4KRLB 2EDHA 1I85A 2BY3A 5GZND 3LKRB 1PKQE 1TZGL 2IG2L 1MJ7L 4M48H 4UOW0 2R0ZH 4ZYKB 5C08B 1QBBA 2V6HA 2MOVA 2Y5EA 4Y4HA 4ODSL 1L0QA 4XNQB 1KG0A 2EYTB 2MSPA 5GS2H 1JGUL 4O2FB 3UZQA 1BQHB 3O8XB 5JW4N 3RX5A 2J8UF 4NSKB 3TVMD 5JNYB 1YEEH 5C0CE 3QPXH 4DAGH 4E42A 4QRUA 3WHXB 1S7SB 4NKQB 4L29B 3ZSSA 3HLAB 1VHPA 3HUJB 3G6JE 5JXEA 5C8JB 5CKGA 2VLKD 4HBQA 5FM5O 3MGTB 3T3PF 1TTFA 1DQLL 1QNZH 5TDPB 3SCMA 3IFPA 4JFED 3ZTJH 4GUPA 5HHVH 3D39D 1AHWA 1YEJH 1ZA3A 2Q20A 5KW9H 5JR1H 1S78C 4X7TB 3NACL 4GAJL 5E7FA 4KRMB 4I0KA 3RVVC 4GRWB 5T1MA 5ANME 1YZZA 2D4DA 3ZMRA 3PJSB 1R5IA 2VC2L 1GJIA 1IGJA 1E4JA 3K8LA 4MNHB 3C5ZD 4G8GB 4ISVA 2G75A 4EQ2A 4I3SL 1IT9L 2BJMH 3GIZL 4LSPH 1QVOA 3NIDF 4B5EA 2W60A 35C8H 4RAUA 4QT5B 3L3KA 3QIBD 5H35B 5J11C 2J88L 1J10A 3QDGE 3NN8B 1FJ1B 1UJTA 4PJ5A 5IJKC 5E8OA 3ZE0F 4Y88A 3QAZC 4U1MA 3G08A 2AKRB 3GHBL 4QKXB 4IDJL 4IMLA 1N64H 4YGVB 4HX1B 4FQPA 8FABB 2EYSB 1GAFL 4YFEA 1TJHH 2OI9B 3GMOA 5BW7A 3TBWA 1JNHA 3O45B 1BLNA 2JLLA 3G6AB 2Z31A 4HUWB 4PY8I 3X14A 2FJFB 3CJJA 4TUKH 4YHPB 1DDHB 5F21B 3I50L 3WFCL 1Y6NR 4UB0H 4PJ9A 5IF0A 2AJYH 3DV4A 3BQUC 3LKQA 2AJVL 1MCLA 4OZFB 4QLRA 3IRZA 2PR4H 2NY5L 4RZCB 5CMAA 3QFDA 4P57B 1FAIL 4QXWA 5I9QB 1I3RB 2DIAA 1RUML 3CSPA 4PRNA 1CLZH 2B2XH 5KSUB 4RFOH 1HXMB 4Z5RB 2GAZB 3A67L 3QEQA 5MENA 5JDSB 4NQSB 1G7PA 3PWVA 3F5WB 3G5ZB 1IEHA 2J8UA 2R1XB 2ZNXA 2WBJD 3MLUH 1XGQA 3H6JA 4DK3A 3DV6B 3VXUE 4R96A 4HPOH 3WEXB 3QDJD 3TJEH 1KELH 3WSQL 3KJ4C 1Q0YH 5HVGB 4JKKA 4R6UA 3WD5L 2NZ9D 4PUBL 3NAAH 3SE4A 4E41B 4ELKA 3WUWG 3FRUB 2IGFH 3S96A 3VXTB 3EYSH 1BQHG 3MREA 5DQJA 3HZYA 4L5FH 4F57L 2G5RA 4YHNB 4CW1B 4P3DA 3TZVB 1LO3L 2HWZL 1JRHL 3CUPA 1A9EA 5DD6A 1G7MB 3S34H 2C3XA 4JZNA 3PWPD 3KDMA 5I66A 1MWAH 5HHMD 5SV3A 5EO1B 1D3CA 3WXVL 3WIHH 3FT2B 4XPGH 3PWLB 1OGAA 1VESA 1F4HA 3V52L 4HDIA 3WNOA 4MAYD 5IBLD 1KN4L 4AL8H 1P7QD 5GS3A 2VE6B 2WANA 5ALCL 5I71B 3DGGB 4XNZB 1CTOA 1XGRB 4JCLA 3MRBA 1S9XA 3O2VH 1EXUA 3U82B 1MCOL 5E6IA 5CJ5A 4FA8A 3UJTL 2WNGA 2YPLE 5HYIA 1KIQA 2MWCA 4O2CA 4MNGA 3I3EA 2F8XC 2GK2A 3AM8A 3SOBH 4EDXB 2A9MH 4F7TB 3BAEL 5BO1H 3SE9L 2R4SH 4PGBB 3B6SA 4XRCA 1X7QA 5ADOH 3TO2B 2AXFB 3V6OA 4F15B 2IADB 5I1LB 3MODL 5FK9A 4UINH 4Y5YC 3LY6A 4JHZA 5I30L 4YAQA 3MJ9H 1CFSA 1WTGT 2GIYA 3DX7A 3OJVC 4NHUA 1WT5A 4LHUD 4WGVB 3G6DH 1YUHB 4F3FA 3HKFA 4YHMH 1S78D 4JO1H 1UA6L 5KSAB 1RIVH 3C09B 4WY7L 5DJXB 1NSNH 4EI6A 4XAKD 4PJAB 1GOGA 4HJJL 4RGNE 4JCMA 3UTZB 2GT9B 4QRTA 5CSGA 4PRDA 4Q9CA 3QCUL 4OGAC 4HWBH 3P9WB 2V17H 3PP4H 1A7NH 4R4FL 4YXLH 1U95B 4OZFG 2AJZB 3H3PH 1AXIB 4IMKA 4JO2L 2EE3A 1XR8A 3OB8A 4U7SA 2AS5M 1T66C 3TO4C 2KH2B 4LL9A 3N85H 3KYOA 4TVPD 3MCKB 4HPYL 1CU4H 2HTLD 4BZYA 1ZA6A 4I3RH 5GS1A 4MDIB 5DFTA 4POYA 2RGSA 1CDUA 4L8CB 3KYKH 4NGHH 5EZIH 3FRPA 4AIZA 4P4RA 1QSEA 3W2DH 5DQDL 4MCZB 1V7ML 1X4YA 3BPOC 5EZLB 3TN0C 3UTSE 5BZWA 5T5FL 4YDVA 4M4RA 4BM7A 1ZEAL 2NW3A 1K4CA 5EO9A 2B4CH 1DANU 3HI1B 3BQUD 3JWNC 5IHUH 5IP4A 1U3YA 5J12C 1DZBA 1FPTH 1PLGH 1ZVHA 4MA1C 3SHSA 3VA2C 2X4SA 4M1DL 1LE5A 3E2HC 1E6OH 3INUH 4NUJA 2EIBA 4E42B 4QRUB 5H37H 3ZKQD 3RFZC 3LZFL 4OZIF 3OAZH 3CK0H 4LBEA 1MREH 1KN2H 2HT4C 3V4PL 3CLEH 3TT3L 5EUOF 3SCMB 4DZBA 4UAOC 3IFPB 5D4QA 3BIBX 4GUPB 4WUKL 3QIWD 3FQTA 1ZA3B 4S10A 4TUJB 4WWKD 1I1FB 4F80A 1P6AB 2CUIA 5EWIL 1NBQA 3ZDZE 5TQ2L 4TOYH 1TJGL 4PGEA 5C0FA 2Z8VC 2EH7L 4AM0A 4K94H 1IGJB 3RZCB 1TPXC 2HAZA 4ISVB 4M6NL 5IVZA 2QL1A 4HC1L 4QRPA 3VRLE 1H3PH 4MMZC 4KZEH 1DR9A 1QVOB 4H1LH 2W60B 1VFAA 4RAUB 1SJVA 5DEFA 1BREA 4JRXE 2BNQA 3L3KB 3Q5TA 3FT3A 5JDJA 2Z35A 3ZYOA 1T1YA 2QQLH 4PJ5B 4WFFD 5ESVA 4O2EA 5E2UH 1X3DA 2E3VA 4U1MB 3OJDB 4IMLB 4J4PA 2E7HA 5DJ8A 3MROA 3RIAK 1PEZA 2VRAA 1GOFA 4XCNA 4U1NA 1BLNB 1SQ2N 2Z31B 4OZHF 5ESAA 2YMXL 5F1IB 3DMMC 4MWFA 3X14B 3JBG7 3MX0A 1JWMA 1TETL 5IUSA 1MJ8H 2FD6H 4Z9KB 3FO2A 2HJFB 4PJ9B 2YZ1A 4OF8A 5IF0B 3CAFA 3DV4B 4ZPVA 5E2VL 3B5HA 2CRMA 3CFJA 3IAQA 3KYMA 5KVDH 1AD9B 4Y7MA 5CMAB 2X1PA 1IILE 1R24A 4L3CA 1EEUA 1UVQA 4WEBH 2YPVL 4PRNB 5I1DA 3STBA 5D5MB 3QEQB 5MENB 4TULL 1G7PB 3PWVB 4F7EA 2IALB 2VXQH 2J8UB 2H2PC 5HDQL 4EEEA 1ZOXA 2HKFL 5D2LF 5HDOA 1XEDA 1XGQB 5EG6C 1AC6A 2JCCF 4X8XA 5FAAA 4P59H 4FQ1H 4ONOA 4OZIA 1DL7H 4XX1G 4P2RA 3MLXH 4EBQL 1HXYB 1S7QB 4AK1A 4CADB 3I6LD 3ELAT 4OGAD 4DKAA 1LMKA 4R8WH 1JHLH 4ELKB 5IOPA 5LQBH 3MREB 2VR9A 5DQJB 3HZYB 2X4TA 4LCCC 1T66D 1YJDC 3TO4D 5DEZA 1UEYA 3BO8A 5DD1H 1IQDB 4JG1H 1U6AH 4JKLA 4J3XA 5C70A 1A9EB 1NCCH 5DD6B 3FN3A 1KV3A 5D6DC 2APWA 4JZNB 1RUQL 3KDMB 2QADC 2XKNA 3QFJA 5I66B 4XMKH 4D3CL 1UH4A 4BQ6A 3FMGL 1OGAB 3T0WA 3QCVL 3IJSA 2RCSH 4HDIB 5JHDA 3C08L 2RB8A 2EE6A 1S7UA 3TN0D 2DQEL 3FO1B 4OD1H 3MRBB 4U1GB 3QEGL 1EXUB 1RJYA 3PHQA 1VENA 1R3JA 1SVZA 4KHTL 2V2XA 4X80H 3KPRA 2K1MA 3LH2L 5T33L 1QSFD 1KIQB 3QHTC 2AGJL 5C0AE 3CFBB 1RIHL 1HHKA 4O2CB 1FVEA 3VFSA 4MNGB 2XY1A 4DUXA 3GNML 1QO3A 4MCYA 4OZHA 1OVZA 1T83C 2NY4C 4Q9BA 2E7BA 1JFQH 1GGCH 3B6SB 1IAIM 1BQUA 1X7QB 3B2VL 4RGOL 4XRCB 2MKWA 3BUYA 2D7TH 5FK9B 4RRPA 1JMZA 4NN7B 2VO5A 4PJ7F 5GRVK 3S37L 3OAYH 4YAQB 1MCSA 4A2MA 1CFSB 1MRDL 2HT4D 3DX7B 3MJ8A 5CD3A 4NHUB 2ZUTA 1FE8L 3OG4B 2H8PA 4FQQA 4F3FB 3NPSB 4MLSA 1Q38A 3CVIL 5KJRH 2YD3A 4LRIA 1V7NH 4WU7B 5F1KC 2AJXL 4EI6B 1KEGH 2GQHA 1H3GA 4BUGA 3FKUS 5D2LA 4QRTB 3RL1B 4PRDB 2JCCA 4UU9A 3MLZH 4GS7B 5C2UB 1MCFA 5DGQA 2IPKA 1HEZA 4NC1C 4QXUH 3WS6A 3VGFA 1JHKL 2I27N 5D1ZB 5KAQG 1B4JH 1XR8B 5HGBB 5ENWA 1G6RH 5DUBA 3I84A 3KYOB 4XVUC 3DURA 4RMRA 4YHYC 1ZA6B 5KVEL 5GS1B 4HC1A 1KT2A 1MHCA 4MA8L 1KYOJ 5KSAC 1J0HA 4AMKH 3F6LA 2BXZA 1IGIH 1S8DA 3MMEA 4AIZB 1QSEB 4PRHA 3VGAC 4HMEA 4O4YH 5IWLC 4G3YL 3UTTD 3ROLA 2PTTA 1U3ZA 5BZWB 4YDVB 3IDUA 3DMMD 3MBXL 1HQ4A 4G8FA 4K2UL 2A6KA 5C0BA 1K4CB 3V6BR 5EO9B 1FNEA 2D9CA 4JQVA 1IQWL 4KI5C 3WO4C 4GMSL 3WDIA 4R90L 4FTVE 2X4SB 1RZKL 5DLML 3ZE2F 2B39A 5F7NC 4NUJB 2ESVE 5JQ6L 4DEPC 3TC9A 3BUTA 4HMCA 4Y19B 3CSGA 4RMUA 3BSZL 3G9VA 1YA5A 4LBEB 4PJ8C 2H2PD 5AYQA 4EUPH 1N26A 3QDME 5CILH 5DZOA 1MAJA 3QIUC 3BKML 3NCCB 3WBDA 4DZBB 1DVFA 4L8SA 4Y4HC 1RUPH 5I15H 2DDQH 1AJ7H 1VFUA 3FQTB 1E6JH 4PJ7A 4L3EA 1F3DH 1A3RH 4NHCL 1XCTA 4G5ZH 4WI7A 4TSBH 4XVSH 5DQ9B 1UXWA 4U1HA 5EZJB 5F89A 4WHYH 2W0FA 5F7LB 4PGEB 3C8DA 3HCVA 1E4WH 4N0UA 2E27L 3TT1H 4AM0B 4W4NA 4YQXL 2OMBA 3MOBH 4X4MA 4X8JA 2G60L 5TFSH 5D9SA 4IRJA 2BVYA 5IVZB 3ILQC 2OR7A 3SDDC 5TDOB 4QRPB 5JXEC 3SGJA 1NLDH 5CLTA 4DKEH 4OJFH 4GKNA 2QADD 5F8QC 2Q87A 5IVNA 4NFBA 2AEQH 1MFEH 4PJIF 2Z35B 1T1YB 3ESVF 2MTPA 1AHWC 1GGIH 1JWSA 5ESVB 3SKOA 4O2EB 5DMJB 1N5AA 3MLPA 1N6QL 1ZGLP 1GC1H 2ID5A 1MHPL 4CL7A 2J4WL 1IBGL 2EDTA 3AB0C 1F58L 1HH6A 1A6TB 4LDOB 5DJ8B 4OI7A 3QUZC 5FYLL 3IRPX 1FG2A 4XH2A 5EUKA 3QG7H 4U1NB 4MQXD 2DQDL 4KZDL 5BS0A 5ESAB 2FO1A 4MWFB 1JWMB 3L6FB 4ONGH 3FO2B 6FABH 1ZGLM 4ZPVB 4HWNA 2NY4D 3KYMB 1WBZA 1M7DA 3RGVB 1I9IL 4JAMA 3M8OL 4WCYH 1UVQB 4ZUSA 5CD5C 5DJDB 2BDNH 4XTRC 1CICC 4TSAL 2AXHA 3MO1A 5I1DB 3JWOH 3SQOL 5B8CB 3NCFB 4KV5F 2ZCKL 5GGRB 5BW7C 4JB9L 5DEGA 2CGRH 1EVUA 2EIZA 4PG2A 4HHAA 3RWEA 3KLSA 3SJVA 3FRPG 5IMMA 5E6ZA 2OL3H 1RMFH 1FIGH 2EH8L 4OZIB 4P2RB 4PJ9C 2JB5L 3FQXB 3ZDXF 1MPAL 1UM6H 4BH8B 1TJIL 1OAXL 3RTQB 3O3AB 5EUOB 1K8IA 4AG4H 1TNNA 4L4JA 1CD8A 2XOTA 3ARSA 2UUDH 3FB6B 2VH5H 1JNLH 5LWYH 2M8XA 2X4QA 1F3RB 5IOPB 2X4TB 4FHBD 3BO8B 2VLKE 1Q1JH 1RPQA 1A1MB 2CDEA 4XVUD 3SDXF 1WEJH 4CRPA 2FBJL 4BSWA 2FHBA 1KCVL 4JFEE 3QFJB 3CFDA 2CDFA 4ELME 4N5EC 4UQ2A 3D39E 1FZOA 1MEXH 1DCLA 1S9YA 4XXDA 1ZTXH 4FRWA 1HYRC 3IJSB 4LVNC 4GRLC 5JHDB 3JTTA 2H45A 1GGTA 5HYJD 1S3KL 4M02A 1MCJA 3SKMA 1S7UB 3KS0H 4M1GH 3GJFH 1ZS8A 1A22B 3RY5A 5I8KL 2JKXA 2W07A 1RJYB 3SE4C 1I7UA 3MOAL 5E1AA 1R3JB 4ERSH 2V2XB 3QBTB 4FQ2L 4OLUL 2AQ3A 3E0GA 4LHQB 2IPUG 4NJ9H 5KSBE 5DVKA 1XF2A 3UMTA 4KI5D 1HHKB 4M5ZH 4WW1B 3VFSB 1PSKL 1L4IA 2B20A 4G7YL 1RZGB 1QO3B 4L9DA 4LARL 4MCYB 1FNAA 4OZHB 1CBVH 4KJYA 2P24A 3HNVL 5TPWH 2BNRA 1MFNA 3BUYB 3D2UA 1A3LL 3EAKA 2VDRL 4JFXA 4QGYA 4OLEA 2QHRH 2ZKHL 4PJ8D 5CP7A 4LCYA 1GCFA 1WCBB 4B0MM 1Z3GH 2VKXA 5EU3A 5CD3B 3QIUD 4MXWH 1SMOA 5E6IC 4KFZC 1GIGL 3DI2B 4Y4HD 4AENA 2H8PB 4FQQB 5ICZA 4WV1C 5J7CC 3TBYB 4NQTA 1J05A 3P4NB 4Z7OE 3GRWH 4M03A 4PJBF 3U7YL 1X6LA 1EVTC 5DK3A 2ZWLT 2MCPH 3GBML 1R3HA 4G6AC 5D2LB 3BGFB 2JCCB 4FQXC 1NCBH 4BZ1L 1EAPA 4I13B 1SEQH 2IPKB 3PV6A 2R69L 1HEZB 5I1GH 3ILQD 4JHAL 5F3HA 1T22A 3SDDD 1AP2A 5JXED 1DFBH 1AGEA 4WTZA 2VJXA 3HE6C 1Z0NA 1BBDL 1OP5H 1WT5C 4GSDL 4O58L 3KPPA 1T04A 1A7OL 1RU9H 5GJSH 4HS8L 3NPSC 5DUBB 5JUEH 3S8WA 2Q8BL 4JFFA 1ITCA 3WFHA 3LEVL 1NCNA 1KT2B 1MHCB 2EIDA 4JHWH 1EHLL 1JPST 4HS6A 2XKUA 3B8SA 3QDJE 4UT6L 1S8DB 3MMEB 3ARBA 3QUZD 3U36A 4PRHB 2PO6A 3SDXA 4HIJA 4ZNCD 5IQ7H 1HINL 1BJ1H 1YEIH 4RBPH 3V5DA 4GS7C 4I5BA 1CDHA 4NZUH 4UILL 3UYPA 3O2WL 1HQ4B 4G8FB 12E8H 2A6KB 4EN3A 1IEAB 5C0BB 3EZJB 1A4KB 4IMKC 1GGUA 4Y4KA 4HUVA 1F4WH 4Y5VA 3PWPE 2J6EH 4NZRL 1UB6A 5HHME 1JCKA 3P4MA 3HZKA 2Y06L 4X83A 2XWBA 3T0VA 4OT1L 5CD5D 1NCDL 1RQ5A 4XTRD 1KJMA 1CICD 4XNUH 3CX5K 2XZQH 3NCJH 4NNXA 5A16A 3HZVA 4X7DC 1MAKA 1CR9L 2AXGB 4LPXA 2EDRA 4ODHH 3L95B 2JJTA 2O93L 3P40A 4OQTL 1H8OA 4YHKH 2FZ3A 2CUHA 3BMVA 4XWGL 2FH8A 1FFOA 4L8SB 5I2IB 5EA0L 2PTUA 5GS0C 4PJ9D 5EU5A 2R23A 1F11A 1UADC 3VFGL 4PJ7B 5L88L 3NCMA 1XCTB 4MJ6A 4POUB 2CJUH 2DIJA 2E6JA 1UXWB 4U1HB 1V3JA 1VKXA 1H15B 3U1SH 4YX2H 4I2XA 4XVTL 2GY5A 3HCVB 1G9ML 3EYOA 3R06A 4KAQH 4N0UB 5H94B 3IU4L 2OTUA 5DRWA 1LP9E 1OAQH 4R26L 5L2KB 1BIIA 4PJBA 4Q9QH 4X8JB 4K3JL 5D9SB 4IRJB 5AAWA 2VDQH 3MTRA 3CD4A 2AAVA 2ICWI 3JVGA 1YN7A 1A6WH 2BHUA 4KTDL 4F8TA 4X7FC 2MQCA 4NO2A 1YNTA 4GKNB 1RK0A 4N5ED 1A7QH 3W9DA 4HGKC 1CFVH 2K3TA 1EFQA 4YWGH 1MQKH 3EFDL 4GAGH 1JWSB 4GRLD 1LEGA 3SKOB 1JYXA 1N5AB 4H26A 5FUCC 4D9LL 1UG9A 1FSKB 1MFAH 4FQCL 1G9NC 4XAKE 7FABL 1Z9SA 2VISB 1PDKA 3LQZA 3PGCA 3CVHA 1X4ZA 1W72H 1C08A 2X4NA 3G04A 3OF6A 1YYMH 1FG2B 1UCBL 3ARTA 1YQ2A 4XH2B 5EUKB 3R0NA 4PGCA 5BS0B 1YNLL 3U4AA 2YHGA 5TF1L 5F1OB 3ECBA 4M62H 4DKDC 3GBNH 5HTSA 4Y89A 4NKDA 2JB6A 1MRFL 4GKSA 1SVCP 4HCRH 4TVPE 4QNPF 4FZEL 3F12A 3S35X 5TE4L 4U33A 1M7DB 1MY5A 5D6CA 1IKFH 1Z0MA 1N0LA 3OX8A 5T3XL 4ZUSB 5CJXA 3I02B 5GIRA 1L7IL 4P46B 3U0WL 5IEHA 4R2GB 4JO3H 2XZAL 4ETQA 2WLYA 3ARGC 2Q76A 5IQ9B 5E6ID 4U0RB 3GMRA 5DEGB 1P4IL 3HRZA 2EIZB 2IH1A 5C92A 4HHAB 3RWEB 3SJVB 5IMMB 1TZGH 3MJGX 1FZJA 4D9RD 3FHQA 4DOHE 4FXKA 4MA7L 4X6EA 3KAAA 4DGIL 4G6AD 1JGUH 3G5YB 4HBCL 4XPBH 4FQXD 4P0DA 1K8IB 5E8DH 5D8JH 1U8MA 1H3WM 3HE6D 5DA0B 4PB0H 1N0XH 5E4EC 5GSRB 3EFFA 4Q2ZB 1UCTA 5CJOH 2CDEB 4I77L 3GSUA 5JMOC 1RULH 2A6IA 4J23A 4BSWB 4CMMB 4G6ML 3CFDB 2CDFB 3SN6N 5CWSA 3EDFA 1FZOB 3RIAF 1S9YB 4XXDB 3I6KA 3ULVH 3PE9A 4DN3L 3BZ4A 3JTTB 3SKMB 1ZS8B 2B7DT 4PJIB 4BH7B 2HRLA 3W82A 2GJJA 1I7UB 3OR6A 3QUKA 3WHE1 1WISA 1FVDA 4D2NA 3QH3A 1S9WA 2Q8AH 1CGUA 3CU7A 4MJ5A 4NJAL 1K6QL 2IH3A 2C7UB 1IT9H 2UVFA 5E8EA 1XF2B 3A0OA 5EOQL 3GIZH 5IVXA 3S36L 3RUGF 1GGBH 4OF3A 3LSOA 2PETA 4PD4J 2J88H 4WFFE 3DO7A 1BVKA 4TQEL 4KJYB 3FO0H 3RRQA 2P24B 2AEWA 2YN5A 2BNRB 5GRVL 3D2UB 2Z8RA 4JFXB 3WYRA 4XAWH 4HKXA 3GHBH 2B1HH 3LPGA 4OLXL 4LCYB 1EGJA 2P7TB 5DUPL 3MUJA 5FGCB 4TTGA 5EU3B 2R8SH 1I8LC 4AENB 2DI7A 5GS0D 3MRMA 5ICZB 5JO5A 4AT6A 2CKBH 1J05B 3BX7C 4OQTA 3KPOB 4JKPH 1ZVSA 3I50H 3O0RH 2UWEA 3RI5K 1CE1L 1EBPA 3T2NH 5DD3H 1CDIA 3DOSA 1IL1A 1R3HB 3GDBA 1YEFL 4K9EC 3SO3B 1EAPB 1FAIH 4LEXH 2QR0A 5F3HB 1VA9A 1T22B 5K9KB 4NQCA 3UP1A 1BFSA 1AP2B 5DR5L 4CDHA 1AGEB 3LAFA 1BZ7A 2CMRL 2VL4A 4NBYB 2XTJB 1T04B 3KPPB 1CQYA 2PTVA 3K8KA 5CJBA 5GRJH 3MRDA 5IROA 4JFFB 3WFHB 1NGYA 3B9EA 1IM9D 4HS6B 3ARBB 3VW3H 3T0EA 1AO7A 2PO6B 3DNKA 3MRKA 3SDXB 4HIJB 3X17A 2X9XA 3VRJA 2EO9A 3I6LE 3NZ8A 1A21A 2AXJA 5E00B 3V5DB 3MLWL 3LIZH 4I5BB 1DBKH 4KKNA 1BX2A 1FLTX 1JPFA 1W2KT 3UC0H 3QT2A 4JGUA 4EN3B 1J12A 4Y4KB 2BNQD 4HUVB 3OV6A 4RX4A 4HIHA 2VDOH 1JRHH 1HHHB 2BOCB 4FXLA 1WFOA 4RWYL 1UB6B 1NBVH 3HZKB 4XC3L 2XWBB 2ZJSL 2IMNA 1EHNA 3E6FB 1KJMB 2WP3T 3QDHA 3QULA 2VUOA 5A16B 5EU6E 3ARGD 3RUGA 3V6ZA 5JZ7C 4U49A 1UH3A 1TQCC 3I75A 4JO4H 1U42A 1FNSH 1MNUH 5JPMA 4LSVL 2FZ3B 1D5IH 5I6XC 1FFOB 3HC4H 1X5AA 5EU5B 2R23B 1AY1L 1F11B 1YPZA 3O9WC 2EEBA 4MJ6B 4MLIA 3RA7H 4XP9H 1VKXB 2IBBA 2EZ0C 1R5WA 1F6FB 2NX5D 4XMPH 4I2XB 5IT2L 2C1PA 3EYOB 3L7FA 3PWJB 2A6JA 2AJUH 3R06B 1VFOA 4C56D 3L1OL 4NKOA 2OTUB 5DRWB 2ADFL 1BIIB 4PJBB 5I1CH 4BQBA 4PJCB 5I1JL 5BOPA 1J1PH 3QXWA 2XKSA 3QEUA 5CZKA 3MQIA 1A7PH 4JREB 2XA8L 5H2BA 1YN7B 3NMEA 2MKLC 4LMQI 4H8WC 1JNJA 1YNTB 1LDPL 2D9QB 3HS0B 1RK0B 3W9DB 4JDTL 1DVFC 2YBRA 4L8SC 4PJFE 4P2RD 4N8CH 1RUAH 4YNYA 1L6ZA 1LEGB 4HH9A 1ZVYA 3LOWA 1P1ZA 4H26B 3BPNC 4ZFOL 3QHFH 5T1LD 1NMAL 5C6TL 4LNRA 3LQZB 3PGCB 4X7SL 5DT1H 1C08B 2X4NB 5T1KD 3G04B 5AYUH 3OL2A 4XPHH 5DD5H 2I26N 5EO0A 3L3IA 1A0QH 2ARJA 2EDEA 2H32A 4NQED 3ECBB 1SJEA 3QWRD 1WTLA 4P3CL 1X5ZA 3LRGA 5INCA 3EJZC 5GGSA 4NKDB 3UPCA 2JB6B 3ULUL 3MBEB 1LE9A 2N4IA 4CDGC 3F12B 4ORZC 3VI3F 1MAML 4HPYH 4WTZG 1U8LA 5D6CB 1QLEL 1FNGB 1OWRM 3VG9B 1X5LA 5D7LD 2VLRD 5GIRB 1EMTH 1X6NA 5IEHB 4ETQB 5LBSL 3IS0X 1CGWA 1NMBH 2WQRA 3UTTE 2CKNA 4HT1L 1CDGA 3KPRD 5D7SL 5JW4R 2AK1H 3GMRB 3VGDA 4ZFFA 3HRZB 5KBNC 4NOBA 1CL7H 1A4JA 2IH1B 4X9HA 5JA9A 1MI5D 2ZCHH 3RX7A 1FZJB 5DRNA 2JIXD 5I0ZA 3V0AC 4CAGA 2XFXA 1SBBA 3P11H 3O4LD 4FXKB 1MFBL 4X6EB 4EKXA 5JPNA 3IDXH 3LKSA 3LDBC 3OKKB 1ACZA 3EOBA 2DICA 1INEL 4OCXH 1U8MB 4NKIH 3D0VA 1IFHL 1BFVH 2YUVA 3QNYA 5GGVL 1CF8H 1H0DB 3VXMA 5T1DH 1N3NA 4PG2C 1X44A 2Y6SC 3GSUB 2A6IB 1DQJB 5EOCH 3WHE0 5SWZD 2BK8A 1IGYA 3LN5A 5CWSB 3MV7A 2D03H 1FIEA 3I9GL 3I6KB 4Z18A 2P5ED 4HJ0C 3BZ4B 4KVNL 3QZWA 2E9BA 3LKOA 4CKVX 4ZSOA 1EZVY 4M7ZC 2CLRA 2IEPA 4N0CC 1C5BL 4PJEF 1T3FB 3OR6B 2CQVA 5IB4A 3VWJA 1F00I 3ZKXC 3QH3B 4JHBA 1S9WB 1XGYL 4MJ5B 3MGOB 2IH3B 4J2XA 1EZVX 4FQJL 3WFEH 4F58L 5LGHL 3ULUF 4P2QD 4R97C 1NGWA 4GG8B 1NCWH 1QFUL 1OCWL 3LSOB 3HMXH 4UT9L 5ITBL 1XT5A 5L8LB 3DHJA 1I3GH 5DK2A 1BVKB 3RL2A 4QF1A 2DLFH 4U6YA 3W5NA 4XBEH 5JZ7D 1VB9A 2WWKT 4X6DF 4HKXB 4LLDA 3BN9C 3JV4A 2HFFA 4M7LL 4QRSA 3ALWA 5FUOH 3ES6A 3DECA 3QRGH 1AI1L 4H5SA 1ZT1A 3KHQA 5C9KA 5C0BD 2XV6B 5J6HA 4ZFZA 4UOJA 5HHXH 4GJTB 4Z7QE 3MRMB 2H1PH 1Q9WA 2DQHH 4AT6B 3O9WD 3KPSA 3JV5A 5JXAL 3NGBC 1N4XH 1CLYL 4KDTC 3BZEA 1QFPA 1ZVSB 1OW0A 3VGHA 1J0KA 1RZJC 2EZ0D 3GI9H 1VPOL 1GH7A 3NIFE 1IL1B 4LIQE 3OGCA 2F15A 2NY7H 2EECA 1CGTA 4GO6B 2I24N 4EDWL 2QR0B 5EDXA 5HHOD 4QRRA 3CC5A 5FCUH 4MAUL 4MB3A 4WGWB 4NQCB 1FL6B 1CXLA 4KVCL 5C3LD 3IYLW 1JF5A 1BZ7B 2UYLA 4JPIB 1OTTC 2FJGA 4DGVH 5EU4B 3MV8D 5DUMH 3QWQB 1DVFD 4HK3J 5GGTL 1OSPH 4L3ED 1UWEH 1FLRH 1DEEB 3H7LA 4JFYA 4NP4L 4GBXC 4GG6F 1MJUL 3TNMB 3BMWA 1DQML 3U30B 1AO7B 3VRJB 2ED8A 2GY7B 3U7AA 3NZ8B 4Y4FC 4NC1E 2OTWB 4Z95L 4PY7A 1BX2B 2Y9RT 4NWTL 3QCTL 4CN6A 2YA2A 4ZFOA 1JPFB 4MJIA 4P23A 4BYHA 1M6OA 2YR3A 3CU1A 4W81A 3EJZD 3SO5A 3WLBA 5F7HA 1RD6A 3SDAB 3E8UH 1XR9A 4PJEA 1OHQA 2VDKL 3OPZL 1MH5A 4NZDA 3WKMH 4S1RH 4JFDD 1BFTA 1RUQH 5EIVA 1UZ8A 1BQLH 3N9GH 1FO0L 3QULB 5J13B 3E6HA 4Z7NF 2OJZL 1RVFL 3RUGB 3V6ZB 2BSSA 3GSVA 4S1SL 3WIIL 5HYJE 1JYWA 2V5RA 4WUUA 4JG0L 4OGZA 2ZUYA 2FATL 4KUCD 3I75B 1YEHL 4ALAH 3ZKSD 4OCSL 2YC1A 4KUZH 4LRNL 4X6DA 1DBML 3RNKA 1KC5L 4N8VA 3U2SA 1ADQL 4KI5E 2ENYA 4Y5VC 2Y23A 5FHAL 3CMOH 1R5WB 2DQIL 3DSFH 4U6XA 4HEME 4AEFA 1HI6A 2WSKA 3GNMH 4K3EH 3RGHA 3BDBA 2EXWC 1HKLH 2C1PB 4M6OL 43C9B 2A6JB 4NKOB 2VZSA 1MSPA 4BKLB 4XX1E 3L5XL 1QFWI 2WIIB 1I9EA 1NLBH 3QEUB 4L3AA 1F13A 2Y6SD 5MERA 3H42L 4JZJA 3SJVD 5IW3A 1MRDH 1T0MA 2QKIA 1NJ9A 4UNUA 3OMZA 3TA3A 1N7ML 2YBRB 2X7LA 4HJ0D 2I5YH 4HH9B 4NT6A 4X4XA 3JTSA 3T1WA 4N0CD 1HHGA 3GSQA 4OZGE 4MSWA 3V7MA 4LNRB 5CINL 3PDDA 2LV4A 2X4OA 3TP4A 4GT7A 3V7AE 1V3LA 1FYTA 2VN4A 5EO0B 2ARJB 3DROA 2H32B 1DBJL 2I60H 3BW9A 4Y5XA 3X13A 3TJHC 4GG6A 4PRAA 2V2WA 3IB4A 1I8KA 1SJEB 4F37F 3WUZA 4O02H 3MRQA 3U6RA 1E4KA 2P8PA 3PL6B 5INCB 3Q0HA 2ZUQB 2OXHA 3BT2H 3CXDH 1LE9B 4XPTH 1S7XA 3HG1A 5C6PB 4NN6C 3C8KA 4RA0C 1U8LB 4QCIA 4UQ3B 1UKQA 3BN9D 4XCYA 1JZ5A 5DJAA 4ENEC 3P3YA 4M48L 1OLLA 5HDBE 3QXVA 2R0ZL 1S7WA 4G3YH 1RFDH 2B5IC 4ZFFB 4JGMA 1A4JB 2V7NA 1YEDA 5HGGS 3EGSA 3IVKA 9CGTA 2YUWA 4KJWC 4HJGA 4HFUH 5DRNB 5ELIA 2XFXB 4KROC 5C07A 4K3GA 4X6FB 5DD0H 2IQAA 2C1OA 4PJ5E 1QFHA 1YEEL 2XWTA 5JPNB 3QPXL 3P77B 4DAGL 5K9JH 3LKSB 1OSZA 4M93C 3EDDA 5A2FA 1RZKH 4K7PX 5CJXC 2D7QA 2W9EH 3D0VB 1YC7A 2LTQB 1FORH 3GGWB 1QNZL 3ESUF 3QNYB 3TF7C 1OTTD 5CEXA 4HIXL 4I18C 1ZT7A 5HHVL 3VXMB 3BSZH 4I9WD 1YEJL 1N3NB 3AS2A 5KW9L 5JR1L 3FN9A 2BSED 3KHOA 1A6AA 2XN9D 4Q97A 1IGYB 1J0ZA 3BGMA 1SEBA 2VDLH 4GBXD 4JE4B 1EPFA 4OF5A 2YA1A 1D6EA 3QZWB 3CMGA 5E2WH 4APQA 4QHNA 1HQRA 4ZSOB 4Y4FD 2EYRA 2CLRB 5I19H 2JJSA 1JI2A 2DL9A 2BJML 2R29H 1QOKA 4ODUA 3MXVH 1OP3K 4LSPL 5IB4B 4FQLH 2F54A 1DBBH 35C8L 2K7PA 4WFED 5TH2A 2ED7A 3L3HA 1FAKT 2FH6A 3K4DA 3NA9H 1KTKE 3MYJA 4FG6C 1YEGH 2E5EA 3NPZB 2CIKB 2J5LC 4RWHA 3L5JA 3UJIH 1N64L 4MS8C 2RR3A 4L4TA 5DK2B 1JPSH 1J8KA 5JHLH 4QF1B 1CD0A 4U6YB 1TJHL 3D48R 1UKSA 4QY8A 4KRPC 1B0RA 1C1EH 1EIBA 1FG9C 3JV4B 4LLDB 3GB7A 4OAWA 3BOVA 5F9OH 3PXJA 4QRSB 3GSOA 4TUKL 4X5XA 2PCPA 1FO0A 4Q74A 1UC6A 4H5SB 4ZUTA 1ZT1B 4JPWL 1EA9C 2V5SA 4UB0L 1I1CA 4ZFZB 2V5MA 1NCAH 2AJYL 4KZDH 2EE2A 1KTLA 1Q9WB 4IJ3B 2PR4L 3KPSB 3W81A 4FFWC 4L9LC 4Z7WF 1QLFA 4M4PA 1A64A 5KG9B 2YPKB 3DYOA 4V2CB 2OK0H 4LU5H 1EUUA 2EXWD 4N0RA 1CLZL 2B2XL 3UTQB 1VACB 3OGCB 4YO0B 4RFOL 1ADQA 1TTGA 4PLNC 5B4MC 1UGNA 2ZUXA 3M8OH 3CC5B 4QRRB 4LIQH 1ETZA 3MLUL 3Q3GA 3VXRD 2X44D 1NC4A 1OAYH 5I1EH 2UYLB 1HZHH 3HTLX 3Q6GH 5CSBA 5F8RC 4E5XA 2WP3O 1RURH 4HPOL 4H0IA 4QOKA 5LJYH 1O5DT 2DB8A 4D8PB 3HAEA 4D9RE 1KELL 1Q0YL 4JFYB 4MVBC 3UPRA 5BVJA 3HRPA 2CXKA 5SX4I 3NAAL 1MPAH 3RWCA 4XNYL 4NKMB 2IGFL 1JNNH 1XFPA 3EYSL 2UUDK 4EI5A 5DMYA 3MCLH 3ZDYF 4PY7B 3MSPA 5KZCD 1ZGLA 3TJHD 4ZFOB 4MJIB 4N9OB 4HGWA 4P23B 3S34L 1QBMH 4YBQC 1DE4A 4YC2B 1M6OB 1MWAL 3WLBB 3WIHL 1T7VA 4XPGL 2AV1A 3T3MF 2LU4A 1XR9B 3DVIA 4ZOAA 2BOBA 1T7YA 4AL8L 5F9WB 1UZ8B 1MCQA 4NQDA 3ZT7A 2DMKA 4ENED 3O2VL 3E6HB 5CZXC 3T0EC 1MQ8A 3STZB 1J87A 2BSSB 3GSVB 5M94B 3OF6D 4NO0A 4WUUB 4MA3A 1QSVA 3V95A 1F4XH 2UY6A 3FFCB 5I8KH 2JJUA 1TQBC 1CXFA 2W9LA 4KJWD 3RI5F 1P7KB 1IGTA 2B8OT 4PJDE 2YC1B 1OAUH 4FQ2H 4FFVC 4MHHG 4KROD 3SOBL 4N8VB 3U2SB 2A9ML 3RU8H 2ICES 2NY1C 4ZS6C 5BO1L 2R4SL 4ZS7H 3RWGA 2DQJH 5ADOL 4U6XB 1HI6B 4UINL 4LARH 1BD2A 4BJLA 3D85A 3MJ9L 1NMCB 2KPNA 3HNVH 4Z7WA 2EKSA 3REWA 3G6DL 1A3LH 3WV0A 5GRWA 3MRHA 3N0PB 5FIEA 2ZKHH 3KYAA 3FB7A 5MERB 4YHML 1T0MB 2BMKB 2QKIB 1SBSH 4JO1L 4LPYA 1NJ9B 1RIVL 3RVTC 3TA3B 5BMFL 5B21A 1RJLA 1NSNL 1NANI 4G6FB 4I4WA 1PY4A 3JZ7A 1UJ3A 2LE9A 4NT6B 1F3DJ 4X4XB 5HYQA 2GJ6D 3JTSB 4P2CG 4HWBL 2V17L 3P9MA 1HHGB 1CDYA 3PP4L 1A7NL 4MSWB 3QUYB 3BEWB 4YXLL 1I7ZA 3GBMH 3H3PL 1R3LB 3OWEA 3VD4A 3L3DA 1U8HB 2E7LC 3DROB 3N85L 4ZXBA 4Y5XB 3X13B 4GG6B 4PRAB 3KGRA 3MV9D 1CU4L 1I8KB 4FG6D 3WL9A 1S9VA 4I3RL 3MLYH 4U3HA 2NLJB 2YKLH 3MRQB 3BEVA 3LEYH 3MUGB 2P8PB 3U6RB 2PUQT 2W1NA 3KYKL 4MS8D 4O58H 2R4RH 1NFKA 4NGHL 1S7XB 2NR6C 3HG1B 5EZIL 3W2DL 1A47A 3D25A 4O51A 5FUCE 3AREC 4J3SA 3O3UN 4KRPD 2OMNA 5IMKA 1FFNB 2DBLL 2QSQA 4XCYB 1E4XI 4U6VH 4UT6H 5DJAB 1YNKL 4BSVA 4MD0A 4Y2DA 4RBPK 3WS3A 4GH7B 1K3IA 3DXAA 5T5NF 1S7WB 2B4CL 2C3VA 3KPNA 5IHUL 2W65A 3BPLB 5GGUA 1YEDB 3EGSB 2I25N 4ZNEA 1FPTL 4FFWD 1T6VN 1KCSH 1PLGL 4HJGB 1C8PA 1JTTA 1O0VA 3KPLA 5ID0A 1RIUH 2BNQE 5C07B 5BV7C 3ZO0A 3UZEA 4YDLB 2OS7A 2IQAB 2EKJA 2C1OB 3B9VA 4OQ1A 4ODVH 3INUL 3VI4F 2Y07L 4PR5A 1EV2E 2HFEA 2F19H 5B4MD 2F8OA 3CK0L 1MREL 3EJJX 1KN2L 4FOMA 3J8F7 5EIQA 3CLEL 3BKJH 4R3SA 4R7DA 1ZT7B 4K3DH 4IHOA 1Y0LA 4WI6A 3DETC 3P4OA 1HH9A 1A6AB 4PJHF 4X6BA 4MVBD 3OXSA 4Y1AD 3BGMB 1SEBB 1Z5LA 4TOYL 4KH2A 3ARFA 4WO4B 1U3HC 2GKIA 1D6EB 4DWHA 3C60C 1SHMA 5E9DA 1YECH 4K94L 4QHNB 2YXMA 3AY4A 5FO7A 2MQ0A 2VXSH 3ZE1F 4UNVA 2VERN 4NQXA 4ODUB 4C56E 4N8VG 1H3PL 1X5GA 4KZEL 2F54B 4YBQD 2W0KA 3BIKA 3EJYC 4DQOH 3L5IA 4LFHD 4M8QA 1F8TH 2FIKA 2QQLL 5LAXA 3MYJB 3QDGD 5E2UL 5I0DA 4UTAH 4P2RE 2CK2A 5AEAA 3GMLA 4FABH 3CZFA 1MWAA 1A2YA 1XCQA 4FNLH 3WIHA 1RZ7H 5CZXD 1NAKH 2A73A 3T0ED 3BI9X 4QY8B 4X99A 4J3TA 3BJLA 4WW2F 5DJ2A 4OAWB 3GB7B 1PW3A 3PQYD 4K8RC 1OPGH 3KS0J 4X5XB 4QTHA 1FO0B 1MJ8L 2FD6L 3G5XA 3VWJC 5FA3A 4FFVD 4XXCA 4IOIA 4XPFH 3OKOA 1D6VL 4LEOA 5I73C 3OBAA 3SKNA 3MOQA 1UEMA 1KTLB 4QEGA 2NY1D 2UZIH 4ZS6D 5KVDL 1BHGA 1QLFB 3QFJE 3HPLB 1D5XA 4WEBL 1WFNA 4S0SD 5SWQA 4CNIB 3ROOA 5SWSD 2VZ3A 1U8IA 2DWDB 4ZODA 3IXTB 3ME0A 2CRYA 5D7LE 1VFMA 2VLRE 1K2DA 5DSCA 2VXQL 1ETZB 3Q3GB 1QFOA 3VFVA 2NYYC 2CUMA 2J8OA 2G5BA 4OI9A 3KPRE 3JV0A 3MJ9A 1PFCA 4FQ1L 3RVTD 1DL7L 1C7SA 2DM4A 4E5XB 3MLXL 1MI5E 4QOKB 1AC0A 4U7KA 2FWOA 4P5MB 3HAEB 4KC3B 2EDBA 3O4LE 3S4SB 3UPRB 5BVJB 1LQSR 2G9HB 3F65A 1OAZH 2NY0C 3TH4T 4R8WL 1JHTA 4DN4H 5MI0C 5LQBL 2OSLA 3O3EA 4EI5B 4PJHA 2HG5A 4OD3H 1ZGLB 4HWBA 4JG1L 5DD1L 1U6AL 5DDHA 1IEBA 4CJ1A 5FFLA 1B3JA 1NCCL 2BERA 3E1F1 4U7MA 3MPCA 1DE4B 2XPGA 4XMKL 5DC0A 3C5SA 3KJ6H 2BVOB 4NYLA 2RCSL 5SWZE 2BOBB 3ARED 2VLLA 1WUNT 3CFEB 4C4KT 4YK4C 2P5EE 1TXKA 5FDWA 3H9SA 2ICCA 2BY1A 5B3JF 2NXYC 5D2LE 3BFOA 2FIRT 4X80L 4HF5H 4PP2A 1XGPA 4NO0B 4MA3B 5KVFH 1JUFB 1XGUA 2FDBP 1BJ1J 3T1FA 3BISA 4MD4B 3W0WA 1CFQA 1JGEA 4KJQC 4Z0XA 1D5ZB 1M71A 5C9JB 4YC2C 3WDJA 5IBUB 4PLJC 4WW2A 5CUSH 5CKAA 2V7HA 4P2QE 1LK3H 4X4YA 2ERJB 4Z7VE 1FL5A 5J57B 4RAVB 1JFQL 1GGCL 1PKQA 3RWGB 1Z9LA 4GXUM 5F9WC 2D7TL 2VTFA 1BD2B 1ED3A 3D85B 1INQA 4YDKH 3U4BH 4MNQD 3GMPA 3ULUC 3MA7B 3S88H 2YS4A 4Z7WB 2EKSB 4M8VA 4PFEA 5E7BA 3LQAH 3MRHB 3FCTA 1BEYH 4OV5A 1AR2A 3DETD 1A7RH 3FB7B 3GK8H 2A6DA 1U8NA 4U05A 2DJ4A 2FECI 1MIMH 5C0BE 5C0CA 5KJRL 3OXRA 1V7NL 3R1GH 1KEGL 4DUVA 1U3HD 3C60D 4WI8A 4I4WB 1LO4H 3WIFA 1UJ3B 4J3OC 5GS0H 3MLZL 3DRTB 3P9MB 4QXUL 1I7ZB 1NDGA 3T2QA 2RAMA 3WN5A 2WINA 3BKYH 1B4JL 3EJYD 1NMCC 3MFGB 5HHOE 1WCQA 4ZXBB 1G6RL 3OR7A 2AJSH 1F45A 4JZJC 3WL9B 1S9VB 5HDLA 1AFVH 3BEVB 4H1LA 3CXHK 3TA3C 4G9FD 4AMKL 3MV7D 4HWEH 4MB4A 1IGIL 4OI8A 4L3EE 1DN2A 3D25B 4O51B 4RMQA 3ZLQC 4O4YL 5IMKB 3H0TB 4P9HH 3U7WH 3QXAA 3ARXA 4K8RD 4BSVB 4MD0B 4Y2DB 4NN5C 4N0UE 3WS3B 5F93C 1KTRL 4X4ME 3VWJD 3L5WA 3LMJH 3IDYC 5L0QC 4YHZH 3KPNB 4JVUA 2W65B 4XCEA 4TRPH 1UWGH 4OD2A 1UB5A 1T5XA 4PY8J 5CBEA 2NY6B 5KVGH 5ID0B 2C3HA 1E4KC 5IIEA 3LPFA 3L3GA 2VDNL 4KMQA 4JFDE 2PYEB 4F9LA 4PR5B 4RISL 2HFEB 3GMNA 4PB9H 4IIQB 5C0DA 3MNVA 4BFIA 1VGEH 2NYYD 5IVOA 2HRPH 5CILL 1MCBA 5F7KC 3S98A 2IFGA 1DBAH 4R7DB 3RIFK 1RUPL 4IHOB 5I15L 1Y0LB 1AJ7L 1E6JL 2EDJA 1A3RL 3P4OB 4G5ZL 4P5TA 2HYMA 4TSBL 5H8DA 4YEFA 1HH9B 4XVSL 1AKJA 3OKDB 3UBXG 1Z5LB 3ARFB 4UMGA 3THMH 2NY0D 3MJ7B 1E4WL 5E9DB 3TT1L 2DRUA 1PGRB 5CEYA 3MOBL 4LLAA 5FO7B 3RWJA 1PZUB 4M7KL 4NQXB 4YZFE 4QRRD 1G0YR 1NLDL 4MXVF 4DKEL 4OJFL 32C2A 5IHBA 1ZHKA 2AEQL 4M8QB 1MFEL 2AABL 2FIKB 3SJVE 1WGOA 5LAXB 2WUBL 3KR3H 3MV01 1GGIL 4X6CE 2CIIA 1VFBA 2MHAA 1GC1L 1FRGH 1ZLUK 3TIEB 3GMLB 3CZFB 1MWAB 5AZ2H 1XCQB 2UZXB 2NXYD 3VFTA 2A73B 4APQC 2GYSA 1FVCA 3QG7L 4X99B 1G7IA 4WNQA 5DJ2B 1T20A 1WZLA 3ZTJG 4UTBH 3G5XB 1BECA 2VR4A 4ONGL 5FA3B 1H3XA 4LEOB 3MRGA 6FABL 3LV3A 4PLJD 5IR1A 3SKNB 1T1WA 4TUOA 3V0WH 4PIRF 4LSSH 4Q7DA 1L9NA 5D2NC 4WCYL 4WFHD 3QHZH 5CJQH 2BDNL 3VCLB 4FMFA 2YD6A 4LCIL 3O4OC 1NGQH 3JWOL 1NFDA 3ROOB 3ULUD 4JM2A 1U8IB 2F58H 4UDTA 4GOSA 2CGRL 3N1PC 5DSCB 4K7PH 4QTIH 3PABA 3VFVB 5T3ZD 4MHHI 2FX7H 3PP3H 2BXYA 2OL3L 1RMFL 3QUXA 4YBLB 5HVHB 3EYQC 2XTLA 1UM6L 2FWOB 4HSQA 3IKKA 4CMHC 1J5OH 2ZUSA 2G2RA 1QP1A 3O8XA 1W8OA 4UIKH 1A14H 1EFXD 5L7XH 5DA4A 2JELH 2VH5L 1JNLL 5LWYL 1Q9OA 1EHXA 2BNRE 5D1QD 3WHXA 2OSLB 4P48A 3UO1H 4PJHB 3UYOD 4X9GA 4D0DA 4L29A 3HLAA 4K9EH 4PBWD 2HG5B 1Q1JL 2YD1A 5DWUH 4C55A 5DDHB 1IEBB 2EEDA 3VRLF 1WEJL 4BFGA 5DURD 1MEXL 3L7EA 4I9WE 2P5WB 2X1WL 2BVQA 5FB8A 3C5SB 1ZTXL 1FNHA 4NYLB 5F72S 1I1AA 1G6RA 5KOMC 4DFHA 1FH5H 2XN9E 4ZO6A 1A1NB 2VLLB 4DZ8A 1U8OA 3DUSA 2JTDA 4M1GL 1N59A 5FDWB 2XA3A 4NM8H 3NBNA 3HC0B 1N5YH 1U91A 3C2AH 4ERSL 3IFLH 4PP2B 1XGPB 4G8GA 3KYNA 3C6SA 1XGUB 4NJ9L 1FYTD 1J8HD 1C5BH 4UUJB 3T1FB 3N1FC 1CFQB 1R6VA 3TCXA 4XGZA 4H25B 1P4BH 1JGEB 4M5ZL 4WFEE 3U9PH 4QHUA 4Z0XB 1M71B 5EBGA 2YRPA 5D1XC 1CGXA 1IE5A 1P5UA 4WW2B 2V7HB 1CBVL 3UTSA 4F58H 5F6IB 1L6XA 4MD5A 3NN8A 4LVHB 5LGHH 5ICXA 5HYSA 5GRUH 1KPUA 1FL5B 3V6FA 1PKQB 5TPWL 2ZG2A 4WFGD 3IF1A 3WXWL 4AQOA 3BE1H 4L4VD 2QHRL 3QQ4A 2DQTH 1Z3GL 3GMPB 3SDXE 1ZXQA 1EX0A 4MXWL 1ITBB 4IOFC 1YY9C 1QFWH 3G6AA 4Q9RH 2E9WA 3FCTB 4OV5B 2A6DB 2BY2A 2YUZA 2FJFA 3TFKC 5GGSY 2EDDA 5C0CB 4EUPA 4GRMB 1CGSH 3OXRB 4PJGE 1U8KA 1KUMA 2IAMB 2MCPL 4OFIA 2R56H 3QO0A 5CP3H 3ARDA 4WDIA 4RZCA 4XP4H 2ZOKB 1NCBL 1SEQL 2M26A 4RMSA 1I1RA 5I1GL 4H88H 2JK5A 1PVHA 1DFBL 1NDGB 5KSUA 2HFGH 4XVJH 1IZJA 3WN5B 2WINB 4ZQKA 3C6LB 4Z5RA 1T1XA 2GSGB 5T5NG 2W59A 1GZQA 4RGMC 4Q6YA 5JDSA 1H3VA 1JI1A 3VXRE 1RU9L 5GJSL 1WICA 5JUEL 3MXWH 4OSUH 1WZKA 4H1LB 3HI6H 2AV7A 4JHWL 3OB0K 3BJ91 3ARZA 4IRSC 2H2SC 1LHZA 4H8WH 5GGTH 4OFDA 5IQ7L 1IVLA 4APQD 4OB5H 3O3BA 1YEIL 3EBAA 3D18A 5IV2A 1H8NA 1IAKA 2PW2A 3QXAB 2R0WH 1BBJA 4NZUL 2RFXA 2I9TB 1SM3H 12E8L 3VGGA 1KEMH 5IHZA 2HVJA 4KJPC 5DJYB 3REVA 1FHGA 3OKMA 5FYJH 4XCEB 1OARH 4YHNA 1F4WL 4CW1A 1T5XB 2J6EL 5CBEB 1G7MA 3H3KA 4JFHD 4FTVD 4XHJC 1GHFL 5GHWH 3V2AR 4XNUL 4L4TD 2VIRA 2XZQL 3L3GB 2FGWH 3NCJL 1AGCA 3KPMA 2VDKH 1KENL 3F8UB 2Z4QA 3GMNB 2ICEB 4ODHL 3NFPA 3OQ3B 5C0DB 3MNVB 5GGQH 4LAJH 4BFIB 4PJXE 4Y2DC 5C0GA 3WKNA 2A9NH 4YHKL 4K7FB 4HULB 2Y25A 2XQBH 3EYQD 1MCDA 4NPYB 4P5TB 5A2IH 1CK0L 2CJUL 1AKJB 3U1SL 2X1XR 5K9OA 1IKNA 3VXOA 5EULV 4J6RH 4YX2L 2OL3A 1JTOA 2NTFA 3P73A 3BD3A 1BP3B 5F9DC 4LPCA 2Q6WA 4KAQL 3EO9H 4F7TA 1IAII 1OAQL 4F9PC 5CEYB 3W9EB 3RWJB 2HFTA 4PTTA 2VDQL 4J12A 1LVEA 1NKOA 1H9VA 4V1DA 3DBXA 1NC4D 1ZMYA 32C2B 2ADGA 4M61A 1ZHKB 1A7QL 3HE7C 1YUHA 3B9KC 3RKPA 1CFVL 4YWGL 1MQKL 4GAGL 2CIIB 2PW1A 1VFBB 2MHAB 5EOCJ 1MFAL 5IB1A 2IJ0C 5H37G 5DJXA 2O26U 1QRND 1OD9A 1W72L 3A6OA 3VFTB 5A43C 3D3VA