5DHVA

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvA00
1MCHA 3GHBL 4G7VL 1IEBB 5TE7H 5E24E 2BNQE 3Q1SH 1MUJA 4JQVA 4RQQB 4L4TB 4APQA 2Y25A 4R2GC 4LAJH 3LOWA 4HUVB 1Q72H 5HVFB 1X6NA 1T5WB 3P4LA 3V5HA 1HE7A 5FDWB 4I77H 3UXFA 4PLKD 3E3QE 1PLGH 3OKMB 3RDTA 1CLYL 3MJ9L 3ARQA 3TIDB 1JPTH 4D0DA 2G5BB 4OCMC 1K8IA 3MZGB 3AM8A 1QSFB 1F6LL 3GI8L 4OT1H 3T3ME 4PG9B 5IK3A 3W2DH 4OF6A 3FT2B 5GS1C 5DHVH 5CHNB 1CG9B 1NMCB 3TJHC 3ES6A 2M8XA 3M8OH 4BH8A 3DROB 1QKZL 2IANA 3WXVH 4BFBD 2X89D 3V4PL 5GGUB 1PDKA 5IG7A 2D7QA 2LABA 2BY2A 3RX8A 4YHLL 2QSCL 1HN1A 1L7TL 3W0WA 5FHAL 1RUKH 1AP2B 4NRYB 1A6PA 4X8JA 1KT2B 1OM3L 4MD0B 3BXNA 2DI7A 2DB8A 1TQBC 4ODSH 5E5UB 3U6RA 3T4YA 5A2FA 5JO5B 1HXYB 3MLRL 3C2SA 3CCHA 4M9OA 1FFNA 3BVNB 5I30L 1UB6A 2E7BA 2Z8VC 1EHLH 5IGXL 3VFVA 4HG4K 2OS7A 5FYKH 3MBEC 1ZA3B 1JYXA 1N8ZA 4LSUH 1UM6L 2QHRH 4MNQE 4PRBB 4JLRB 2A6JB 4OUOA 1TLKA 3LKNB 1KFAH 3WIHA 2BJML 4OUUB 2BX5A 3DX8B 5KAQG 3VXOB 2FATH 4IM8A 1ND0A 2B4CL 5EO1A 5HDBF 4FP8H 3QUMH 3W11D 4OZFG 3F62A 4LCYA 2XKUA 5IEKA 1UFUA 3HTLX 2ZOLB 2XWBB 3ARDA 1F02I 4M7LH 5IESH 3BESR 1BVZA 3ARGD 3QHZL 3WD5L 5C2BH 5INCB 1QQDB 5GRYA 2FD6H 2CDEA 4HSQA 4WU5A 5MEPA 4WTZA 1EJOH 1NAKH 4G8FA 4QRQA 3VI3E 3P4NB 3SDDA 4U1NB 1DBJH 4MSWA 5KW9H 3O3DB 5FGBC 5J12C 4JVUA 2VISB 4EOWL 1J5OL 1D3CA 1E6OL 1R5IA 2NY2B 2HJKB 1FGNH 4PV8A 4JFOB 3RBGA 5FXCH 2FRGP 4Y5XB 1AXTL 1J05A 3D9AL 5L7XH 2ADGB 5GSVB 1GGIH 4HGWA 3MV01 2HN7A 3QUZD 3H42L 4LSQL 2NTSP 2IGFL 5DTFA 3PV6A 5D5MB 3VFRB 5ID1A 3FCTB 1QZ1A 1U3HD 3TBVA 3HZVB 1IEAB 4R4FH 1NFIA 2XWJB 4KQ3L 1KCUH 1AI1L 3PXJA 2IAMB 5SWSB 4UV7L 5B3NA 5FYLD 4ZUWB 2UUDH 1U95A 2O61B 1BZ9A 3VFPA 4X7DC 3P40A 5EBGA 1A6TB 5I8CA 1AH1A 3GDBA 5IKCA 4E41A 2ED8A 4QRRA 5EOCJ 5LWYL 4WTXA 2Z31A 4O00A 1LILA 1HXMA 3O8XB 4L4JA 3U0PB 4G8EA 1P2CB 2UY6A 4QRPB 5DJ2A 3MCKB 4NO0D 4OZ4B 3MLTB 5FOJA 5EU6E 2GSGB 4JZJA 1ZS8B 3TA3A 2H2PD 4FN0A 1DFBL 1MJ8H 2V9QA 2AJXL 4QT5A 3VFOB 5HHME 5KVGL 3RVWD 5KZCD 4OKVB 2NTFA 3T4AB 4Z7UA 3RFZC 5GZNC 3DX6A 3T3MF 5ISZB 4KH2A 2EE6A 3LPFA 4R2GB 5CEZH 1AGFB 3I3BA 3VWKC 2VXUH 3DGCR 5I17B 2DQEH 4NC1E 2XNAB 1FNHA 2P5WE 5SWQB 5BS0E 3QISA 2HKHL 3GSXA 3V0WL 1EUTA 4M7JL 3QUMA 1H15B 5JPNA 4HEME 3FO1A 4NN5B 4ZPVB 4YNYB 3RKDC 2JELH 3HKFA 1EV2E 1Q9KA 4GXUM 2Z93B 3STBA 5C0AB 5CJXA 4U1MB 2HN7B 3I02B 4RAVB 2HT4C 4AEIH 2XICA 5JPMA 5HYFA 1I9EA 3MOAH 4RCAA 3WFCH 2YZ8A 3EJZD 1O7SA 1CXLA 4YAQB 1QYGH 1HQ4B 4Y89A 4S1QH 5CZXC 1YEEL 1TCRB 3B5TA 4HKJA 4I18A 4ODHL 4RISH 1OAZH 1HIMH 4LLDA 3HC0A 5DHVB 3EJJX 5DC4B 5E8DH 2Y9RT 2HRLA 3IJSB 4A6YH 3K2MC 3ZYIA 5CZKA 2VO5A 2H8PB 4X7TB 4AG4H 3CVIL 5ACMA 5CBEA 4NZTL 2PYED 1A7OL 1FN4B 2F53B 4NCC2 3Q6FB 1TQBB 4G8EB 5L6YH 2WWMC 1NCDH 4MA1B 1QR1A 1LO0H 4Q6IC 1BJ8A 5KN5B 3P0YL 3VI3F 2Q3ZA 1DBBH 3KPRD 4OZFH 4OZGB 4ESKA 4L8CB 4OGXL 4XB8A 5JW5A 3ARBA 3CDYA 3VD4A 1XGQB 2HG5B 2MPAL 4IMKC 1JGLH 2PTUA 4XMLH 1LNUA 3NAAH 4GQPH 1OTSD 2GITA 4LSRL 1A5FL 2Q7YA 2CJUL 5D8JL 3D0LB 5F3BA 1CDHA 4ZYKA 3FB5B 1SJVA 4E0RA 4LRNH 5DF0A 4BSWB 5DO2C 3S5LA 1UXWB 1MJ7H 1NQBA 4RX4D 4TYUA 3OKLA 1IFHL 5DI8A 1HSBB 1MI5E 1JHKH 1S7TB 2BSRB 3MRHA 3C5SB 4DK6A 1Z5LB 1VERA 2JB6A 2YOCA 5B8CC 4LBEA 3WNLA 4C58B 3SBWC 3RWCA 3PXHA 5FUZL 3IFPA 4KI1A 4KTDH 1T83A 2CDGA 3LKPB 2J5LC 2Y07L 3UJJH 3TT3L 5DJCB 4X5WA 1BOGB 3HE6A 5IB5B 3C5ZB 2XFXB 4XNYL 1BWMA 1AE6H 1RJYB 1UM5H 2K7QA 4OFYD 5L2KE 4EBQL 1D5ZA 2CKBH 3PQYE 5DRZA 5EOQH 1KJMB 2BVOA 1OQXA 3EOTH 5LQBL 1OB1B 1FFOB 3IDGA 3D2UB 2MFNA 2WQ8A 5DD3H 1PSKL 1OAXL 3KPLB 5C0ND 1SEBA 3RWGB 3P9MA 1V05A 1LE5B 3WFZA 1LEIB 4W4OC 3LKOA 4QF1A 5FCUL 4L8BB 3B2VH 4KMLB 4A6YA 3E6HB 4EN3C 5C86A 3X14B 4Y4HA 1J1PH 2ZUVA 4HWNA 2IF7A 5BOZG 1E6JH 1A0QL 2ZPKL 1GIGL 2CDFA 2P42B 1INDL 2EDDA 5TPWH 2BHUA 3QI9B 2AABL 1U8OA 2QHLA 2OP4L 4KZDH 3ZTJG 1FZMA 1Z6JT 4XCFH 4TSAL 4KAQH 4HLZG 4ODBD 5FUOH 3TP4A 3KPPA 5CGMA 5ADOH 4HHAB 5JUEL 3PUCA 5E2JA 5MEOB 5HHXL 4OZFA 5E6IC 3R8BB 4F7CA 5M95B 2C3HA 4OF8A 1WTGT 3WV0A 2YWZA 2W91A 4IRSD 1ZXQA 1CLOH 4CW1B 5FECA 3DPBA 5I1DA 3SJVA 2P5WD 3IAGC 5GGVH 4ELKB 1AR1C 2OTPA 4MA3B 2DQTL 5DJZB 1ZLSH 2PO6D 1KIRA 2X1XR 2A73A 2KQMA 3G9AB 4O4YL 1G7IB 3GSQB 3MFFA 1U8PB 5C6PB 4AY0A 3T8XB 3HE7C 2QTEA 1U3HA 3P4MB 2XN9D 4LOUD 4YPJA 3A6CL 4EDXA 5HGDB 3RWHA 4NQCE 1M7IB 2L4OA 4ODTH 4P2QA 1SJHA 1U8HA 3REWB 4J6RH 1UCBL 2BZDA 4W6XB 3LZFL 4ZUTB 2V7NB 3D48R 4UIKL 4I0PA 2VTFA 4JQIL 5A2IH 1Q1JH 3DETC 2A6IB 5A43C 4OD3L 2WSKA 3BKJH 3MRFB 3QULA 3MQIA 2W9LA 1FV1B 1T89C 1G7LB 4FQHB 4O02H 3R06A 1WLHA 3RUGA 3ALXA 1LK3H 1I85A 1AKJB 4XCCH 3RL1B 1H5BC 1JV5A 4NO0A 4NP4H 4HULB 4ZTOL 3MRLA 4ZUVA 1UWEH 1WAAA 1H0DA 5IOPA 1D5MA 3HI1B 4HH8A 5F93C 1X4XA 4ZSOE 4GSDH 2X05A 1DQML 1D5IL 5KANI 5IB2B 5F6IC 2FX7H 5CJBA 3TBSB 2NXYB 3QNZB 5CZVH 3EGSA 3UMTA 1WBYA 4KU1A 1I7ZA 1LE9B 2VL5A 1CFTB 4Z77A 5I1HH 5J06A 2W60A 5IFJA 4KXZI 1JGUH 4DN3L 1XAUA 4L4TE 2YD4A 5T1LA 1JNJA 4RIRB 3WHXA 3RPIA 3CU1A 4KZEL 4G6FB 4JY6B 4YDLC 4KMTH 1BD2B 1QG3A 5I76A 2LU3A 2GT9B 3HB3D 1C1EH 4DOHB 3WNNA 2G75B 4X4YA 2R0LH 3MXWH 4CJ0A 2W65B 2DLEA 4Y4FD 1T66D 2AK4E 2YRZA 4HX1A 5IQ9B 2J5LB 1AIFB 3RZCB 3V52L 2J6EL 1QSFE 4MD4B 5DLML 3RWIA 5HPMA 5L88H 4X6FB 4J1UB 3BDYL 5DEGA 1TZGH 1F8TH 3GEWB 4JDVB 2VNCA 2X4NA 4ZQKB 3MOBH 3KNBB 5GS2D 4XHJC 3CK0H 4PJ5D 4GMSL 1UH4A 4FMKA 1MVFA 3NCYS 4J3OC 3PQYD 5B22A 1FNSL 4W4NA 4X99B 3MMEA 2CKBB 3T08A 4JPVH 1JRHH 2FSEA 1PX3A 5I1JL 2EYRB 3VI4E 3TYGH 3L5WB 2GJ6E 3OQ3B 2M26A 1F6AA 3AUVA 1WCBB 1JN6A 5DRXA 1UWGL 4FFWD 4NQTA 3VXUD 4EN3B 3X3FL 4HPYH 4F58L 1WT5C 2A9NH 4YXKL 1T5XB 3QAZC 1KNOA 2EZ0C 2HTKC 4RBPK 5C0BB 5MHSE 5IIEA 2FHBA 3VXMD 2FB4H 3TFKC 4WW2A 5EC2A 4P46D 2HFGL 2BHYA 1V7NH 1YA5A 1QRNA 3PWPB 2D0GA 3ZZ1A 1S7QB 5E6IB 4AL8L 4GKZA 4G9FB 3MUY1 4RX4A 4YHML 1VKXA 1FO0H 2GFBB 4OBSA 1YYLL 4ZTPL 1D7FA 1WIOA 2AJSL 5EU3A 3IDXH 4YXHH 4MQ7A 1BIIB 3QEUA 2BSED 3QA3A 5C70A 1AQDA 4O51B 1NEZG 3X13A 1EJ6A 2OI9B 4ENED 5T1MA 5JOEA 5ERWA 1AY1H 4G6JL 4S1DC 4Z0BL 3MRCA 2Y6SD 3KLAB 4G80A 2AXFA 5F9WC 1RV6X 4X6EB 3LSOB 3H6JA 4YXLH 4E42A 2IANE 1J1XH 1R24B 1QLEL 5FOBB 4OLVL 1OAUH 3MLVH 4Y2OA 3L3GA 4NNPL 1AGBB 3DVGA 5CJOL 1U8LB 4LASH 5DMGC 5I1AB 5KS9B 4NFBA 1RUPH 2P4AB 3MLZH 1V3MA 3KXFA 4KK8C 1I7UB 3WJJA 1I75A 3GI9H 2FLRT 3GMPA 4Q9QL 2D03H 5BJTA 1TDQA 4HPOL 4RFNC 43C9A 5BRZB 3B9KC 4R8WH 2ESVA 5C6TL 2F5BL 1H5BB 5EBWA 5GSRA 3QXAA 4JM2A 1R3JA 4P57A 2MSPA 4PS4L 5CAYB 5CIPH 1NCTA 1MRFL 5IMLB 2HLAA 2VZSA 2OSLA 3VGAB 4C56D 4HIIB 3SGEH 3Q1SL 4FQQB 4AZ8A 4JFYB 1DQJA 1Z9OA 2FEDC 2OMNA 3PABA 4QWWD 1RU9L 1KN2L 4JFZL 4PV9A 2LAGB 3DYPA 5CUSL 3SE9H 1RK0B 3HRZB 3I6LE 5D1ZD 3RTQD 4GG8B 3QWOA 1J8HA 4OBRA 3VXPA 3GSOA 5FF6B 5F96H 3IB4A 4UOW0 4MVBC 3NPSC 4ONHA 5ISZE 1T21B 5EU5A 4DTGL 1RQ5A 1JPGA 3VFNA 4A2MA 4FQJL 1LMKA 1P4BL 2UVEA 4PGDB 3GMOA 3WKMH 2UWEA 1PVHA 3P4OB 4U1JB 1A4KA 4L3CA 5B39B 3QXTA 3WL9B 1JTPA 1TJIL 1K2DB 4LPCA 3N1QC 4RA0C 3VI4F 3L3KA 1MWAL 1L7IH 4G6ML 1FO0A 1CR9H 1NCCL 4U6TA 7FABH 4YGVA 5D96C 2F54A 1N59A 4JVWA 1JIBA 3EHBC 1MCSA 2V2XA 3VXTA 3PNWB 4G8IA 4WFFE 1ITBB 1KENL 3FQTA 4NDMB 3FRUB 1QSFD 3K74B 1R3HA 3UYPA 1BQHB 1XF4A 43C9B 1QFOA 3AGVA 3BPOB 5E9DB 3GSUB 1U2HA 3MRKA 5FYKL 4LCCC 1GGTA 4QRRE 1G0XA 4OV5B 1AHWA 1FL3A 3P9LA 2APBA 1OCWH 2YS4A 3D85B 5F9OL 2FX8H 1S7UB 2P5EB 2WIMA 3QEGH 2R2HA 5ICZA 2DQCL 2I60L 1VFBA 2O5ZH 1F3RB 1FZKA 4FZEL 1MCCA 3F5WA 2QR0B 4QOKD 4F9LA 4M7KL 4HJ0C 2AV7A 4K71C 1P1ZB 4C83A 2C3VA 5H35B 1BREA 1JPSL 1AD9A 5C2BL 1RY7B 3Q5TA 4Z7UE 4NPYB 3VRIA 2UZIL 3L7EB 5CIPA 1T7YA 5IW6A 1E4JA 1MCPH 2C4XA 3X12A 4ZUUA 2VLKA 2WAHA 3Q5YA 1QA9B 4PY8J 1DBJL 5B4MD 1EEYA 1NGQH 5GGTL 3NBNA 4PJHA 4HXAL 4XPTL 3W81A 1HHIA 2ZOKB 1IQDA 4PB0L 5IB4A 2EXWC 1OGAA 1BFOB 1FJ1A 2EIZA 3IJYA 3LHPL 5I2IB 4KDVA 2R4RH 3JWNC 5C0GA 1BQLL 1G9NC 4Y4FA 1NGZA 4QHNA 1LQSR 5JOPE 1S5HB 3JTTA 3M07A 4G3YH 3L3OB 3QFDA 1T1WA 4JZOA 3B9VA 4XNXH 5IQ7L 1IAIH 1MQKH 2HAZA 1JZ4A 3VW3L 3MNZA 2NZIA 3WE6A 2AJYL 5IWLA 3QNYB 1DEDA 2NY2D 2EYSB 5GS0H 5EOTB 1S7XA 3GHEL 4OD2B 1LDPL 3ULVE 4JKLA 4N8CH 3H9HA 2FBJH 4D0CA 4P4KA 3O6MH 5T5FH 1FBIL 2CO6B 3S4SA 4RNRA 1UB5A 3EYUH 1P7HL 1CXKA 5DUBB 5J3HD 2E9BA 1A1NA 1U8QB 3T0VA 1SYVA 3B9KB 5FA3A 4E9LA 5E95B 4X80L 2IAMD 1NBVH 5SWSD 4U6XB 3TV3H 2VB5A 3SKNA 4X5XA 3DVFA 5DK2B 3P9WB 1Y18B 3C8KB 1EUUA 4ZD3H 1BWWA 2EXYC 3O8XD 4NCC1 4QRPD 1E4KC 4KPHL 4P2RA 2X1PA 1JYVA 5SV4A 3D25B 1VADA 1BFVL 4PP2A 5GRUH 1QOKA 2OCFD 3JV0A 4HZLA 3LKSA 2VC2H 1JZ8A 1Z3GL 3OAZH 4KKLD 2J8UA 3NPSB 4WNQB 2JELL 1HHKB 2L0DA 5ALBH 5ISZD 4R2GD 4NQEA 5ILTH 5IBUG 4L3AA 4JKPL 5CEZE 2GUOB 1N4XL 3MOAL 3QCUH 1A2YB 5D71L 2BXZA 2JCCB 5HHPA 1OSZB 1NEZA 3RWFB 1ZTXH 3AB0C 1CICA 4FS0A 3I6GB 5HHQA 5D96B 4RISL 5EPMB 3BKCH 2DQDH 4YHPA 2YD1A 3TNMA 3L95B 5C0AD 4XWOC 5K33A 2X4RB 5HVHC 3T65A 4D9LH 4LU5H 3TCXA 3KAAA 3TJHD 3NVQA 2IADB 4BQ9A 3V5KB 4Z7UF 3CSPA 3UTQA 2HT3D 3OKDB 1QFWL 4LCCB 1JI2A 1OTUC 2C7UA 3JWDH 2E5EA 1YEKL 3NTCL 5I8EA 1LO5B 4K8RC 3JWOL 4PRAA 1FYTD 3S9DB 4XZUB 4OFPA 5FK9B 5TH2A 3C5JB 4X6DB 4MA7L 1T2JA 1MCEA 3DMMC 1ZVSA 2F53D 5D7IA 1KC5L 5E5MA 2G2RB 5JR1L 2BVYA 1DVFC 1F00I 1ZGLA 1A3LH 3CFBB 3RTQA 4K71B 5EO0B 1TENA 5D6CB 1TZIB 4RAUB 3SKUD 3OXRA 2Y06H 4I8DA 3A6OA 4G9DA 4V1DA 2ZUSA 4FNLH 3QQ3A 4LLAA 2ZCHH 1UACH 3LMJL 1MCDA 1QBLL 1SMAA 1BZ7A 5DA4A 2OJEA 3MGOA 5AWNL 1CL7H 1RZKC 4MJ6B 1ZMYA 5H8DA 3SJVE 1D5BB 3ULVF 1CFSB 3PWUB 3RAJL 4GAFB 1CGWA 5FYLL 1RD6A 3UJJL 3UPRA 4PPTA 4HS3A 1BZQK 3PL6B 5AZ2L 3H8NA 1U8MB 4WY7L 3WFDH 4HFWA 2OJZH 4HLJA 4PJDA 1BLNA 3G08B 1VESA 3OMZA 5EOQL 1CGSL 3U4AA 1N7MH 2CMRH 4XCNA 3LQZA 4NJ9H 5FA4B 4P2QE 12E8L 3PGCB 5FHBH 5IM7B 3IXAB 4JFXB 3C5ZD 4MXQC 2FJFA 4MA8H 1CDUA 3DV6A 3B5HA 1KF9B 1C08B 4YQXL 2VLJB 3KWWA 4F7MB 1A9EB 2AK1H 5DJ8B 4ZG1A 3ULVD 4PFEA 4JCLA 5ITFA 3RUGE 1DE4A 1VGEL 2X4QA 3MRNB 3D2UD 3NFSL 4BSJA 3HAEG 5C0FB 1XGUB 4YDJB 4YEFA 2VMFA 1RVFH 1VB9A 4L4VD 2FWOA 1YC8A 1WAAE 4YDKL 3LQAH 5I18L 5J1AB 5LGHL 3CJJA 2HVJA 4X0KA 2HRPL 4M6AA 4QOKA 4ORGA 1U58B 3RKPA 5JXAH 3HC3H 3WIIH 1IGFL 1KTLA 4KTEH 1QO3B 4X4XA 3OZ9L 4LLVA 2BVTA 2VDRL 3D3VA 1ZHNB 5D2NA 4U1HA 2VSDA 4QHMA 2AQ2A 2AXHA 5F44A 2MCG1 3S96A 4K3DL 5D2LB 4NNYA 2F15A 4OIBA 4OIIL 3VRJA 5FYJD 1KEGL 1NAMB 3QI9D 4OLZL 5GZOC 3MNVA 4OZHB 3PWPE 1TVBA 3GBNL 1EX0A 1YECL 5BOPA 4KK5C 2ENSA 1BBJB 5TQ2L 1S9XA 1Z2KA 3KPMB 1XMWA 1NCBL 1IC5L 5F97E 3B6SA 3B8YA 1AGEB 2GQHA 1N3NB 3CNKA 1PG7L 4M1GL 3EO0B 3L3DA 5IBTL 1FZJA 1BJ1H 4MB5A 2XIDA 4QYOB 3QDMB 4HUWA 2EIBA 1UJ3C 4JGUA 4YHOL 1YNKH 4JHZA 3RKDD 1EAPA 1JGVH 4YUEH 1MSPA 1XFPA 4XAWL 4H0GA 2Z4QA 2HT4D 2QQQA 4K23L 1NCWH 1X5KA 5F7MC 1MPAL 3RP1A 4Z5RB 4U33A 3TC9A 4C59B 3OR7A 3LKRA 5KS9E 3MV9A 1DZBA 4JM4H 1WIPA 1XF3B 1SM3L 2EH7H 2OM5A 4NWUH 1U8KB 3BGAA 5AUMB 3LRSB 3IAQA 5EB9A 2VLLA 1CDYA 1LVEA 1GZQA 3G5XB 4M7LT 3V5DA 2NNAB 5ACZA 5CBAB 2X7LA 3UTSA 3SDCA 1UA6L 5JHDA 1N5YH 2VDNH 2ATPB 1AKJD 4CVXB 2R56H 1A3RL 1NL0L 4E5XA 5CEXA 1DVFB 3REVB 3AMKA 3BPLB 3V79C 5IW1A 3VG0H 4MAYA 2FJHB 4X6CB 5E8PB 1X6LA 1INEH 1ZAGA 3O3BB 3IJHA 2R2BB 2XPGA 4GKSA 5E2VH 1FVDB 1QRNE 1ZVYA 3ESUF 4ELMA 5B38B 1WBZB 3BD4A 2L7JA 5DURB 1T2XA 2NXYD 2CRYA 2FL5B 3I84A 4M1DL 5C07B 4J3WA 3ZTNL 3LN4B 1X5AA 4TVPH 3GBMH 4O5LL 2X09A 3DWTA 4H20L 5F70A 3BP7B 5E4IA 1ZHBA 5EIIA 2ZCKL 2FIRT 5EUKA 3S6CA 4Z0XB 4G6FD 32C2B 3RUGF 5E2UH 5MEQB 1LO2L 1EZVX 1BD2D 1FH5H 3TCLB 3VD9A 1IQWL 3ZKMD 1XGYL 2CUIA 5A2JH 2ARWA 5BMFL 5HYJB 5GGRY 4MB3A 4JFPA 1KIQB 1WAAF 1MCJA 1BVKB 4U1IB 3V6BR 2EC8A 1JRHL 3GK8H 5GS1A 5C1MB 2J8HA 1TTGA 2B5IB 3STZB 3GMRA 2ICEA 5EA0L 1M7DB 1JNNH 2VWEE 1U8JB 4XPAH 2XZCL 3NPZB 3KXFE 3MXVH 4V2BA 5C8JB 4K9EL 3AU1A 3BEVB 4PGEB 3S35H 4OTXH 4NUJA 5I16B 3BAEL 5J9PB 4NRZB 5EDXA 2ESVE 5FM8A 1MCWM 1FYTA 3KPSA 4BELD 4PYHA 2FR4A 3ZT5A 4FQCL 2HJLA 3EYVB 2YC1B 3ARXA 3N9GL 3AXLA 3QFJB 3U46B 1RIHH 2H1PH 3TT1L 3RU8H 2X40A 2DQHH 4CN1A 3QJFA 3MREB 1I1AB 1IM3A 3KYNB 1NBYB 2R0WH 3SPVB 1P4LB 5FM5M 3MBEA 4P2CG 2X70A 1J0HA 3IJHB 1QR4A 4EN3D 4UOJA 3HNVL 1S7VB 1NCAH 4LNRA 4WUKH 1H9VA 4L9LC 5JZ7C 1LEGA 4OGAC 3DSFH 1J8HE 4U1SA 4H8WL 5IROA 1XF5A 2IBZY 3F6IA 5BV7C 3IDXL 3HZYB 4YXHL 5C0BD 4FXGB 4S1SH 1A4JB 3NH7H 4NHCL 5TDNA 4YBQC 1TZHA 4GMTL 2V9RA 3EOYG 3EDFA 1G7HB 5EWIL 4F7EB 4NKOA 4O2CA 1RZ7H 4QHLA 2UWEE 3RWDA 2Q76B 1BPVA 5E6ID 1GCFA 4G9FD 1INQB 5KS9F 3BP4A 3W9EA 3FAXA 4DN4L 4RBPH 3RL2A 5FGBA 4JFDB 4ZODA 2BHZA 3VG9B 4Z7WB 4JB9L 1OAUL 2F54E 2VXQL 1AR1D 3FKUS 2OXGA 2IQAB 1UJ3B 1NMAH 4OFIA 3MROA 1DL7L 2Z35B 4Z7OE 4WJ5A 5HY9B 1RUPL 5JQHC 4ZNCD 4K55A 3P11L 5ICXB 3SKMB 1HHHB 3TN0B 1TVHA 3VXQB 1GOFA 4MQXC 1I8LC 2DQUL 1XGRB 1MRDH 4R7NA 4Y5YC 3ROLA 3HE7D 4NT6A 5BVPL 4TNWK 1BMGA 5JW4M 2VAAA 4WW2F 3UTTB 1KGCE 3GJEA 2LU7A 4NO3A 3GSVA 3DBXB 5KTEH 4MWFB 3MRPB 1IGCL 1FGVL 2ADFL 1HWHB 3NZ8A 4PJGB 2RAMA 4QXWA 4L4VA 4AT6A 4MNHA 2GJJA 4DKFH 4HV8B 3DETD 2P8LB 1JHTB 1FL6B 4MCZB 3HAEA 1S7SA 5ID0B 4ERSL 5IVZB 3KVQA 2VXTL 3MV7A 5BRZD 3VFMA 2HTLD 3MRRA 4HK0A 3D1MC 4RFOL 3NN8B 1AO7B 2NW3A 4LF3B 5ITBL 1CFVL 2Z91B 1MLCB 4QHKJ 4FFZH 1NBQA 3K8KA 3RWJA 3IKCA 3NABL 3HUJA 3FQNB 5I75C 3OAYH 1QBML 4HUMB 5F1SA 5IB1A 1NCNA 1OD7A 3TYFA 1ETZA 4OCRL 4UQ2A 3VFUA 2PTTA 5BZDB 4NM4H 1JWSA 1Z0NA 3DGGB 4XVJL 5DZOA 1HILA 2FH8A 4PJHE 5DJXB 4TRPL 3VDBA 3QCTH 1J1OH 2HH0H 2X4PA 3VWKA 1OGAE 4XPHL 4D2NA 1L7IL 3T09A 3A0OA 1CR9L 1IAIM 1UQSA 4HC1L 1ACZA 3H3BC 5TF1H 4Y2DC 4Y19A 4BKLB 1JWMB 1CFNB 5B39G 4Z8FH 1JUFB 3HI5H 2XTLA 3CXDH 2XKNA 5MP6L 2Q7NA 1BF8A 4Z7NE 3OF6D 3KPNB 3LB6C 4QCIB 5HGHA 2M2DA 4JM2F 3LS4H 4WW1A 4P99A 4PJ8B 1MRCH 4C55A 4XPFH 2YSSA 2X44D 3TO4B 1T7WA 2P8MB 3G5VA 3U7AA 4CDHA 2R29L 2XTJC 4TSCH 5EFIB 5CEYB 1ONQB 3O9WC 1K8DB 4BYHA 1U91B 1GOGA 1BQHG 4LCWB 3LEXA 4OM1L 1ZGLM 5F7EL 3SDYH 5CKGA 4RGNE 4XHJD 3C09C 1OQOA 3ULUH 1FC1A 2BSSB 3MUZ1 2V7HA 4KI5E 1CTOA 2RCSL 5E9DD 4P2OC 4EEEA 2CIKB 2NY6C 4N0FB 2UWEF 2WIIA 5TE6H 4N9GB 4HWBH 4FFYL 1YN7A 4XVTH 5LXGH 1NGXA 4ODVH 3D85D 2D7TH 4IOFC 4Q6IA 5T1DH 5E1AB 3WNOA 2CLZB 2P5ED 3G5ZA 3SE4A 1A7RL 4MX7B 4HT1H 4P2RE 1JF1B 5CLTA 4HBCL 4BK5A 4L9LB 4P23C 3BIAX 3BD3A 5EU4B 3QDGB 4UT7H 4OGYL 1IILE 1U8IA 5BV7B 4Z7OF 3ARVA 4S2SA 1DEEA 2F5AL 1L4IA 5DJYB 4L1DA 1D5XA 3T0EB 2CR6A 4IMKA 3P0GB 3MJ6A 2VZTA 3WIFB 4G3YL 1KIPB 2MHAA 5D70H 1VPOH 3QO0B 3EKCA 5T3XD 1IAIL 1W72H 5CMAB 3LEYH 3EOAB 4PJXA 4HKBA 3TIEA 4ZO7A 4OJFL 4EKXA 5CD5D 2GCYB 1BQUA 3HG1A 1WFTA 4NZJA 4PRPA 5B8CA 2QSQA 3VXSB 4IRZH 4PJBA 3FJTA 2ADJA 1QPXA 3SBWA 1XH3A 3OKOA 2NYYC 4PTUB 2FBJL 4YBHA 5GISL 2DN7A 3FFCB 1YC7A 3MODH 1TETL 5T5FL 5JNYA 3TBWB 4TVSa 4R7DA 1LEKB 4N0UA 2XYCA 5LGJB 2PW2A 4S1DD 1BAFL 3W9DB 1KOAA 3WN5B 1OT2A 1IC7L 3HC4L 4B7LA 1ZHKB 1EEQA 3MRDA 4AIXA 1P7KB 5ECJE 5K93A 4ZDHB 3TV3L 5DFWH 2VYRE 1ZEAH 2VLJE 2JLLA 1KCSH 5DMGD 4L29B 8FABA 3LS5H 4NQUA 5J11B 3RQ3A 4PJHF 5HYSB 4KK8D 1M71B 4D9QE 2N1KA 4UOW1 3CDGA 1E27A 3TVMA 4R0LC 1CIUA 1U92A 4W4OA 5D7IE 3B9KD 5JDSA 2H2SC 4LEOB 1BF2A 1ZA6B 2I9TB 4KKBC 2PXYA 4LLWB 2DRUA 4YHIB 4PRHA 4DVBB 5DDHA 4JO1H 3C60B 4Z7NF 4JKKA 1NFDA 3G04B 4GAYB 3SCMA 2QQLH 5I75B 3G6DL 4V1DE 3CC5A 4QLRA 4XX1G 1MOEA 4HWBA 2IFGA 1TNNA 2FEDD 3ARWA 3T0WA 1KELL 5DWUL 4HJGA 4DGYH 4EVNB 1UM4L 1IAOB 1EH9A 4HUNB 4OZHE 1CXHA 4OM0L 5KANG 3PGDB 1OSPH 2W59A 4LLUB 4UQ3B 3O6LH 1TCMA 2AV1B 4JG1H 5F71A 1L0XA 2QQKH 3U4EB 5DXWA 4JHWH 4PJDE 5I6XB 4PJ7A 1C16B 3QXUA 4HIHB 3V7AE 4KI5F 1VFMA 2MKWA 4I4WA 3RVXC 1IGIH 2FECL 3VGHA 4R7DB 2AXGA 1W72A 1F4YH 4I0KA 4JFQB 3HE7A 1N6QH 4IS6B 4L1HA 1BQSA 4L8DB 2NXZC 4MXWH 3V6FB 1S9VA 4JRXA 1GC1H 1S8DA 3EHBD 3MUGA 3O9WB 1CDCA 5FO8A 4Q9BA 4TUOB 1J0IA 3GJFK 3HZKB 5GJTH 4LMQI 3MLSH 3C09B 4Q7DA 5EUOB 3CLEL 1MFCL 2ADIA 3R1GH 1P6AB 1NGPL 1YJDL 4P2OB 2V17L 4JPWH 3QEQA 3HMXH 3L1OH 2NY6B 4XBGB 5I9QB 1AJ7H 4LPUA 3G5YB 3ZKXC 4XP4L 1BGXH 1KJ2B 4NHUB 2DTML 3D3VE 5GJSL 4PJAB 1UZ6E 1NJ9B 5IVXA 2XOTA 4Q9RL 3KJ4C 3NZHL 2ZCHL 5J7CC 3ME0A 4U0RC 1A7PH 2IPKB 1Y0LB 4NNXA 3ZT6A 3U9PH 1R3LA 5TDPB 3O3EB 2XACC 3I2CL 2WUCH 4HJ0D 2BC4B 4WCYH 2BDNH 1R3IH 3QDJB 1ODAA 1OAQH 4JZNA 1OF2B 1WGOA 4YX2H 2OJZL 5E08L 2NY5C 4LARH 1OLLA 4JN1L 2BP3A 1ACYL 3EDJA 5C07E 3IDUA 1JL8A 1PYWA 4OLXH 1MAMH 2P8PA 1FZOB 2BCKA 5DJ0B 3T1FB 5DYOB 2GTZA 5IHZB 2VABA 2Q8BH 5GRXG 4LEXL 4H5SA 5CINL 2Z92B 4JAMA 1V7ML 4JDZA 2OQJA 3L5JA 5H94B 3F7YA 4NQDB 1IKFH 5FKAA 2B1AL 5KG9A 3LIZL 1FPTL 3PL6D 1MFEH 2WP3O 4IHOA 4OLYH 4PJFA 1DBML 2OL3B 4EI6B 3CU7A 5D7IF 1FL5A 5DC9B 3QXDA 1YPZB 3DIFB 4GRMB 4FXKA 3D39B 5I15H 1HSAB 4Z95H 2XZQL 1LK2A 1QFWI 4AM0A 4PIRF 3MV9E 3OJMB 4JHAL 4UTAL 2FHFA 1JYNA 2EDWA 3OR6A 4KRLB 1RUQL 3KG5A 3PGFH 4XGZA 4NO2A 1PKOA 3OKKA 5F88B 3MUHL 1R3KA 3ILPA 3UDWC 3ROOB 2WUBL 1XGTB 1FLTX 1NPUA 4IRJB 2VLJD 2IALA 4WEBL 3UTSE 1HWGB 5JHDE 5JW3L 5F9JB 3C8HA 3BKYL 1XZ0B 1X7QA 2D7PA 3EYSH 4OZHF 3ZKND 2VDOL 1ZGLP 1JGEA 2H45A 3PWLA 1CT8B 4LSVL 5J89A 1CDIA 2WMPA 5DUPH 3QH3A 4NZRL 3U9UA 1J0YA 1WT5A 4XVSH 3UX9B 4QRSB 4D3CH 4PGBA 5IMOA 2EDRA 4N0RA 2FCBA 4PJDF 4Q0XL 5TDOB 4WHDA 2R1XA 1FLRH 3SDXA 2CIIB 4LHQB 1I1YB 3UTPE 1HHJA 3HA0A 2AJ3B 4ELME 2EXYD 3V0VA 5KVEL 2AVGA 5L8JB 2V2TA 3VFWB 2ZNWA 2PR4L 2VSCA 4M00A 4UTBH 3OX8A 2X1OA 4BZ1H 2R8SH 1G84A 3H3PH 4M4RA 4OV6F 1M05B 5J6GB 2DYPA 2K1MA 2IFFH 4WU7A 4KXZH 4ETQB 4AIZA 5HJ3B 3ZLQC 3V6OC 5J0BA 1NLDL 3O11B 4LIQH 2VLRD 4YUEL 4AEEA 1CD1B 1KB5H 1QSVA 2I5YL 4DGVH 5HGAB 2GJZB 2V5MA 2Y7QA 4OB5H 1JGDB 3VXNA 1EO7A 1A8JH 2FJGB 5AZEH 3X17A 3QDMD 1ZWIA 2FZ3B 1EMTH 2NXZB 4JFEB 4UT6L 1UZ6F 5DEFB 2RGSA 2BOCA 5T5NG 4R96B 1GH7A 1CE6B 3IRPX 5DRNA 5GGQH 2NY0C 4XPGL 1T0MB 4XMPH 4Y16C 4L8SC 1K3ZA 4XRCA 3UTTE 4XWOD 1SY6L 1VENA 3PDOA 3UJTH 1DCLA 3KPSE 2X9YA 4ZFGL 2R56L 3B9AA 4EUPB 2CLRB 1LO3L 1JGEB 4YWGH 3NCMA 3PHOA 5C0IA 4IOIB 5DJAA 3H0TB 1CQKA 2IH3A 3W82A 4GG6B 3RY6A 3OKEB 2W0FB 1WQVT 4CN4A 3CVHH 3ZKXB 3DUSA 4RGOL 1BBDH 5E2VL 3F58H 3KLHC 3MJ8A 3BO8B 4ORZC 3FO9B 4U6VH 1CF8H 3U0WH 1Q0XL 5BVJB 3K3QA 5I1GH 2WWKO 4U0RB 4B53A 5DQDH 5E8EA 3VA2C 2JK5B 4XNUH 2Y23A 2NX5B 3INUH 1DVFD 5J4MA 4LCIH 1CFQA 4H26B 1LP9A 1CD8A 1S7RA 5GXBB 3K4AA 1I7TA 1U2CA 4JY5L 4NQSB 4RMUA 4LPVA 3VH8A 5GRJH 5CP3H 4YDVB 3S36H 2E3VA 4JR9L 3J8F7 3BHBB 3M17B 3GIZL 5F1NA 5DURD 1FVEA 4H1LG 1FG2B 4M7ZC 5K9KB 3CFCL 4YDIL 1M6OA 3PWVA 5C07D 4XMKH 3SGJC 1I3RB 1U93A 5ESVA 5I8OL 3GK8L 4P5TA 4UINL 2A6KA 3V4VH 1DSFH 1WVZA 2GAZB 4TVPE 3VGDA 4F7TB 5I1CL 2ICWJ 1EHXA 3FOMB 1VEMA 4NQVB 4F15C 3OPZL 5HHNB 3T0BA 1KCVL 1YY9D 4M02A 3H9ZA 5TF0A 1VACA 4XWGH 1MH5B 4FQ1H 1FFPB 3EZ8A 5D7KD 5CKAA 2BVQA 5HYJD 4P5KB 1KB5A 2O5YL 5H2BB 5KSUB 4IDJH 3QRFM 1CTNA 1B0GA 4KHXH 5BO1L 4FQLH 4FZ8L 4HDIA 5FYJL 3GSRB 1J0ZA 3VWJB 3FB6B 4K7FA 2F8XC 3KLSA 4ZXBC 4UU9A 4GAGH 2APTA 3IVKA 1ZHLB 3FONA 2N56A 3BGFB 1HQRA 3WFEH 3NA9L 4G8GB 4OF3A 3MV7E 1NCAL 3IXTB 1ADQL 4WUKL 4U3HA 4OCXH 3QIUA 4NSKA 1F4WH 1R5WA 3KDMA 3U1SH 2QSTA 4YHYC 2DLHA 5KSAB 5IVOA 5A3IC 2B0SL 4XP6L 4DZ8A 4PJCA 3QFJD 3HUJE 5CSZA 3V9FA 4M6NH 3RZWA 3JTSA 2VN4A 3VXRA 5J8OA 4UB0H 2DQJH 1I1AD 4RRPG 4XP1H 5D93C 3L3JA 1KTKE 3KPOB 1QSEB 3T3PE 4BH7A 1J87A 3QQNA 3U7YL 2R2EB 2YXMA 5F1NB 3HNSH 4GKNA 4M43L 4TSBL 4H0IA 4G6KL 4NKMB 1KJVB 5DHYA 1EEZA 4RDQF 5L8LB 2VL4A 4I2XA 3UEZA 4ONGH 5I1EL 1T1ZA 4J12A 3O45A 5EC1A 3IS1X 3PHQA 5EBMA 4YPGB 2A1WL 5CP3A 5TE4L 43CAB 4NYLA 2ITCB 3IFNH 1Q0YH 4K3EL 4P48A 5CP7A 5E2TH 1KJ3H 3GRWH 1F4XL 4JFDD 3RI5F 4NBYB 3NFPA 2LTQB 5KTEL 3QJHA 4PUBL 4GXUN 4KY1L 2GIYA 3GSNA 3S98A 4R90H 1B4JL 5FEBA 3MRMB 3FTGA 4P3CH 2W1NA 1G7QA 4I5BA 2NY0B 4K8RH 4U3XA 1RZ8B 3TN0D 2WV3A 2R23B 4Y16B 4CNIB 4P9MH 4EI5C 1VA9A 2XXMB 4HGKC 1T22B 5MENB 2ARJA 3W39A 2EE3A 1QNZL 2ORBH 1D6VL 4CJ1A 1JP5A 4QRUB 4Y1AB 1QLFA 4G5ZL 4KKLC 4K3JL 3ARFC 2CSPA 3I85A 2WINB 3IDMA 2XWTB 2F8VA 3TBTB 3C2AH 5DS8B 3ZL4L 4LQFH 2E8YA 1I4FB 4KUCD 4HUXB 3E6FA 3JV5A 4JG0L 3KYMB 5CILH 5D1XC 1BM3L 2E8ZA 1BFSA 3LVEA 3B9DA 4JDTH 5FM5O 3MLXL 3O6FA 4QY8B 4GRLC 1QFUH 3CVHB 4WI8A 35C8L 4JCMA 4HUUB 1E4KA 2H3NB 4HIJA 3GHBH 5ACLA 4Z78A 1AO7D 3GMLB 4G7VH 2Q8AL 2HFFB 3E3QC 4NJAL 4H1LH 1I7RB 3C08L 4WWKA 1SEQH 4LPYA 3ECBB 4G7YL 5AD0B 4M8QB 3CXDL 4ZOEA 2H41A 3FT4B 3GMMA 4WI4A 3EJZC 4PJXE 3L7FB 4XNZC 4LRIA 1KCRL 4EQ3A 3B9EA 3K8MA 4R26L 2VLRA 3O41B 1G7MB 2ZSWB 1K3IA 3EOBA 3HG1E 4PJ9C 1U42A 2DWEB 2YPKA 2C1PB 1CLYH 3MJ9H 1DQDL 3O4LB 3T0XA 4PRPE 4ISVA 1ZT1A 4PJBE 1T2QH 5JIHA 4F15B 4JRYB 2A74B 2BVPB 3GI8H 4N0UE 1PFCA 2PYFB 4XXCC 5D9SA 4MNGA 4FG6C 2D7OA 4M5YH 1Q9LB 3DRQA 1N0LA 1QKZH 2VDML 2BNUA 2YPLB 5E00A 2WBJC 3HUJF 3V4PH 3RY5A 3QB7C 1Z0MA 4MYWB 2Q20A 3BISA 4YHLH 1TTFA 4LKCB 1G0YR 2QSCH 1FRGL 1MREL 1L7TH 4WFEE 5C3TA 5FHAH 4ZXBB 1G9MC 4J2XA 3T3PF 1NBZA 4XTRD 5ICYB 1F2XK 5JXEC 2ICWB 1ED3A 4LCWD 1OM3H 3RGVB 1IGYB 1OAKL 3VCLA 4HW6A 4HT1L 3MLRH 3E6FB 2R9HC 1OTSC 4FQIL 5I30H 1DUYA 5IGXH 3ULUE 1YEFL 1B0WA 4YHYB 3GMNA 3I6KB 4PRHE 1BECA 3DMMA 1UM6H 3LDBB 4PJAE 3QIBC 2BJMH 4QXTB 4U1GB 2JIXA 1G7PB 3DX9A 4WENB 4HIEA 1ROWA 3CPLA 3GZKA 2YXFA 5HYQA 4TULL 3JZ7A 2WM0A 4LHUA 1S7WA 4JPKL 5MERA 5JZ7D 4WUUB 4OGAD 1UJTA 4TTDC 3BP6B 3QDGD 2FO4B 1BVLB 3QHZH 3WD5H 4HMCA 4D8PB 3T0ED 5K9OA 1NC4B 1C12B 3QQ4B 4U49A 4BSVB 1BHGA 1A1MA 4YHNA 1XIWB 2VITB 1ZT1B 4H1LA 2YD6A 4MQSB 5FDYA 3BZ4A 4KMQA 2H9GA 4HKXB 5F1KC 4EOWH 1E6OH 2D31A 5DZNA 3H7BA 3BIKB 2I07A 3ZHKA 2YEZA 3HPJB 2CRZA 2V5YA 2LAAA 3LN5B 2AERT 1ZLVK 3MFGB 1AXTH 2A38A 3D9AH 4OQTH 1XF2B 2G5RA 2DAVA 3MRQA 3H42H 2VIRB 5D72H 4LSQH 2IGFH 4N0YL 3VXSD 3MJ9A 3ULSA 1DDHA 2P7TA 1YMMB 2NZ9D 3Q3GA 1KBGL 2BOBA 3BOVA 1YPZE 2DL9A 3FFCD 3GUTB 2O5XL 4U7MA 3D39E 4FQXB 4KRMB 4HS6A 4R4BA 5LKNA 5KSVA 3LD8C 4KQ3H 4MQXD 1AI1H 5EIQA 2H26A 3SOBL 4CN6A 4EI5B 1C5DA 2QKIA 4JY4A 3QZWA 4WI2A 4F7PA 2HA1A 3IFLL 1B6DA 3PP4L 1DTUA 4TUJB 3B3IB 3QEQE 3ARFB 1DUYB 5LWYH 3ZO0A 2XA8L 4XCYB 1T0PB 4K9EC 4MJ2A 1QRKA 1UZ8B 4PJXF 4GBXC 4PP1D 2BNQB 3BUYB 4IRSC 4RZCB 5D1XB 3O2VH 4NC1C 1G7JB 5DQJB 2Q6WA 4GRLB 1DFBH 2JJSC 5I8KL 5DMJB 2AJXH 1DN0A 5HHOA 4JO3L 1NUDA 5KVGH 5SV3A 4RRPA 4OLWL 3WYRA 2A83B 3G6AB 3GMQA 3C60D 1DJSA 1HYRC 4LOUC 2HKHH 4H8WC 3F7VB 3V0WH 1T1XA 4XNZB 6FABL 1CGTA 4HBQA 3L6FB 3B2UD 4BM7A 2VXSL 3E8UL 5ETUB 4CMHC 4PJ9B 5C0EB 5IHUL 5E1HB 4NRXA 5GGRB 1I9IL 5EUOF 1TVDA 1F11B 3MRQB 4Y2DD 4XNQA 4PJFE 3DUHA 3M1BA 3UCRA 2X4OA 2BRRL 4R3SA 4TQEL 4P4RB 4DAGL 3FQUB 3FMGH 4B41A 2CLVB 3LB6D 3ULUF 5J1TC 5DD5L 1H3PL 1HNGA 2VXVL 1T7ZA 1YEEH 3QUXC 4JFEE 4U4BA 5FB8A 2WBJB 4ODHH 4YR6A 4JY4B 3HS0A 4PJAF 4DKAA 3KYAA 3U36B 1RZIA 4PJEA 2C1OB 4XPBL 4M4PA 4OQTA 4YIQA 4LLQA 5F6HJ 4HFUL 2XTJD 1YDPB 5C0JA 4F9PA 1VFAA 3O9WD 1RUAL 5I1LA 4NZTH 1A7OH 4MNQB 5T3XL 2R4SL 5CGYC 1WWBX 2J3SA 3QYCA 2VRAA 3VE0B 2VQTA 3OB8A 3NCCB 1FIGL 2G9HB 4GG6E 4ONFL 3U9PL 1GJIA 2HFEA 4Q9CA 4YO0A 3P0YH 2WUCL 3GB7A 4S0SD 4JO4L 3ARPA 4P2OD 2K9UA 3UZVB 5HHOB 3ULUD 5T3ZD 2NY6D 3GIVA 3QIBB 3AVEA 3HB3C 3KYOB 1M7XA 2AEPL 4OGXH 1D9KC 3MLWL 1T0NA 3O2DL 1F58L 4KK9D 4IOFD 1SBSL 4M61A 2MPAH 1A1OA 3QUYC 4OLXL 1MCLA 1T66C 2NX5E 1MAML 3QIWB 3DX7A 3TPUB 4OCLC 1A5FH 1V3KA 4KVNL 1LGVA 2CJUH 4OFKA 4IDLA 5D8JH 1UVQB 1WZKA 1YPZF 3UZQA 2V2WB 3QDJD 4OF0A 1JFQH 1IFHH 2WZPD 2FECI 4OLYL 4OAWA 1IAKA 4Y4KC 3LPWA 3BWAA 2DOCA 4DWHA 4GW4A 2ILLA 5FUZH 3P0VL 2Y07H 4BFEA 3TT3H 1YEIL 1E28B 2DM3A 4XNYH 1U8NA 2LU4A 5HGBB 1LD9A 4NQDD 3LEVL 4WTWA 4I48B 2BSTA 3TNNA 4ETYA 4Y5VB 5ANMA 1I1FA 4FFWC 1HH6B 4EBQH 2PW1A 2NYYD 3EIFA 4OD1L 4UDTB 5LQBH 4P3WA 3U4BL 1D6EA 2VDLL 1N6UA 3FO0L 3IDNA 1PSKH 1OAXH 4RFEB 4P5MB 2Q87A 5FKPA 3MA7A 3BE1L 4F3FA 5EU6B 5LVEA 3V7MA 3PWNB 3MJ7B 4D0BA 2NY4C 1QSZA 4XH2B 5LJYH 1GSMA 1JZ6A 4P46C 1ES0B 4ODWA 1NH6A 3U30B 4ONOA 5HHMB 5FCUH 4GBXB 3CUPA 5DQ9A 3B5GA 4WO4A 3BIBX 1S9WA 5HHVL 3K1KC 4S1RL 4MCYA 4GW5A 3DARA 1IL1B 1A0QH 2ZPKH 1GIGH 2E27L 1FVCA 3BQUB 1INDH 2AABH 5BS0B 3H3PL 1A9BB 3FAWA 4IIQC 1HINL 4KKBD 3A6BL 4TSAH 4PJFF 1AGDB 1AC0A 1EFXB 4WDIB 5EO9B 1QSEE 4ZFOA 4BQ8A 2Y6SC 5D7JB 5HHXH 2X4SA 3FO2A 4QTHA 2ITDB 4WFGE 5EZLB 4JJ5A 4W81A 5IBLD 1WZLA 4P59L 4TOYL 4LGPB 3ARSA 4MJIA 3ZKQD 1EGJH 2EDJA 3SDAB 5FO7B 2PCPA 1IGML 5GGSA 4GAJL 1MF2L 4HK3N 3HCVB 4O4YH 4J4PA 1CFBA 4L9DA 1PZUB 2EDLA 3DXAA 1PY9A 4NGHL 1Z9LA 3BMVA 3EJYD 4LIQE 4GG6F 3A6CH 3K2UH 3B83A 1RHHA 3WS3B 4H25B 3HPLA 1DBAL 2RFXA 3QUXB 1I8LA 2AJZB 4FTVA 4CADB 5BQ7B 1UCBH 2H6PB 2R39A 3LZFH 4Y5YA 2B1HL 3WNMA 2I24N 1Q94B 4UIKH 3IDIB 2R1YA 4JQIH 5BXFA 2NXZD 3BRFA 3NGBC 1X5GA 4OD3H 4ODUA 1A6ZB 2EEBA 1OD9A 3GKWL 1BBDL 3WS6A 4OGZA 4I0CC 4EUPG 4F33A 2J88L 1O0VA 5I1GL 3CZFA 3SN6N 1MHEA 3VMOA 4OIAA 4ZTOH 4L3EA 2UV3A 2BNRA 5C2UB 1OPGL 4YFDB 2DLFL 1DQMH 5DJDA 1D5IH 2VE6B 1A6AB 3OGCB 4LLYB 4KDTC 4B50A 5FAAA 3VXRE 1S78C 3STLA 1G9NL 3WFBL 4BQBA 1GGYA 3CFDA 4NFDA 3MO1B 4PJIB 1PKQA 1F42A 1WWAX 5IV2B 1ZT4B 1MI5B 2Z8WC 2HVKA 1BX2B 3QUYB 1YYML 1MLBB 3GJFB 2QADB 4DN3H 3MTRA 5C0DA 4MJ5A 1SYSA 2DIBA 2NX5D 3GSNL 4PREA 4I2XE 4HS8H 4KZEH 1I3VA 4FABL 1JPFB 3F65A 1NGYA 1QVOA 3WSQH 1QHOA 3H9SA 4RAHA 4GOSA 4R6UA 1KPRB 2YBRA 4Y2DA 2F58L 4Y4KB 4OFVA 2IH1A 5I71B 4PY7A 5D7LD 1FCCA 3AY4C 3O4LE 4K94C 2WW8A 2OTUA 3NFNA 2PETA 4LLMA 4KQ4L 3V52H 1EGJA 1FFQA 2J6EH 4JRYE 2OBGA 3BEWB 3BDYH 4KJYB 4QRTB 2J1KA 5E8NA 1XR9A 1K4CB 3P73A 3C6LA 5D7SL 3CFKA 4GMSH 4N5UA 4EXKA 4GS7B 3PHSA 4ZAKA 1FNSH 4I3RL 4DUWA 4Z76A 4HWZA 4U6YA 1V8HA 2E6PA 4OI9A 3SGKC 3FQXA 5FYKU 5I1JH 2WLYA 3U1SL 3EFFB 5HVGB 2NY4B 4L5FH 1PQZB 5IJVB 1NAML 1CGYA 5C08A 3SQOL 3S97C 5LAXB 5JIKA 1UWGH 3MACL 1P7QB 1K5NA 4JQVC 4APQC 3EO1B 3MGTA 4IJ3B 5F3HB 4XP1L 1I8IA 3X3FH 5BZWA 1CGUA 4F58H 4PRNB 1EO5A 3BN9C 1W0VB 3JV6A 4YXKH 4JFFA 3ARYA 4G8GD 1PZ5A 5T1KB 3P77B 4HQQL 5CD3B 4LKXA 5DSCB 5KSAD 4P23A 2OK0L 2HFGH 3RX5A 4AENA 4B5EA 1FNAA 4XT1C 1IM9A 5I66B 2ZZUT 3FQWB 3BZEB 2YPVL 1QSED 4XCEA 4WUUE 5H37H 4JN2A 2NY2C 1Z9SA 3J7HA 5J1SC 2DMBA 4KJWD 1YYLH 4ZTPH 2AJSH 3WEXA 3MNWA 1CS6A 4NKIH 4N5EC 5E0QA 4DZBA 1V3LA 4NQCB 3UBXB 3WUWB 1RK1A 3SKJL 1YNTA 2I9LA 4DKEL 2E9JA 5J3HC 4JVPA 4MNGE 1GZPB 2FYYA 5FCSH 2ZSVA 1I9RL 2B39A 3AS3A 4P9ML 1X5LA 4XXDB 2DWDB 1ZT7B 1KCKA 4MZ3A 1QLEH 5DMKA 5E5RB 2JB5L 1FNFA 4OLVH 4KTYA 4NNPH 5CJOH 1YMME 5DMIH 2JJUA 2RBLA 3UTZB 2R1WA 2Z9TA 5IB3A 3MR9A 1VGKA 1JWUB 2J6EA 3O8XC 4JQXA 2HJFB 2IMNA 1OWWA 3IFOB 3FT3B 4OZIA 4Q9QH 4ZSOB 4M8VA 4HPOH 1G6RA 4U7SA 2H32H 2NY0D 5A16B 1AXSB 2ICES 5KSBB 4Y16D 2VKWA 4ZFFB 3JV4A 5C6TH 2F5BH 5MEND 1VCAA 5DFVD 3QG7L 4CU7A 1MNUL 1QFUL 3AREB 2AJUL 4PS4H 4Y1AD 1RZKL 5CWSA 4R0LA 3IF1B 1MRFH 4UIMB 1A22B 2ZUTA 4X98A 1YQ2A 1SEQL 3QR2A 5D1QA 1RU9H 1KN2H 3WNPA 1HH9B 4JFZH 3KLHD 3UYRL 5CUSH 5DUMH 5JTWA 4MLIA 3SDDC 3T2NH 3MRGA 4ODXB 4LFHD 2XRAL 2YHGA 3VFGL 5FO9B 4LP5A 3DTXA 4X6BA 1Q8MA 3T2OA 4NN5C 2EKSA 3TZVB 3UYOD 4BFGA 3TH3T 5F9AC 4DTGH 2AK4B 5EN2A 1SJEA 4FQJH 5DVKA 5MI0C 5IEHA 1HKLL 3RNQB 1T2QL 4WHTA 1JK8B 1P4BH 1T4KB 1TMCB 4PGJA 3V95A 4BFIA 4MDJA 1QHPA 3FB7B 2CH8A 3S37L 1TJIH 1FFRA 2P46B 4M5YL 4Q2ZB 4YGAB 1MWAH 3IGAB 4G6MH 2F74A 1NCCH 4F37K 3DV4B 2HT3C 5HVWA 3O4LD 1KPUB 4F2MB 1KENH 5IJKA 1B6UA 4LVEA 1NUFA 3L9RA 3QEHB 2GJ6B 1MHHB 4O9HL 2YR3A 4CUCA 5IB3B 5SWZA 1Y6MR 1JNHA 2Z31C 1S9YB 2EDNA 2GTWB 3CXHK 3F12B 3MRJB 3FB8A 5INDA 5C9JA 5IVNA 1KB9K 3FFDB 3VFSA 4MA1C 4NKDA 3T77A 1WF5A 5DJ6A 4JZJC 2YPLD 3TA3C 3TLRA 2AKRA 2DIAA 4X7SL 2N7BA 1Q9OB 5TGBB 1AFVL 2KZWA 3MZTA 5F9OH 2KBGA 4ZXBD 4ZPTA 2OX5A 2SEBA 5ELIA 4WFHE 2X4UA 4K7PX 3W5NA 2DQCH 1MUJB 4APQB 1CDGA 4YHKL 3RGVD 2I60H 2XY2A 4HXBL 4CVWA 4FZEH 2H32A 4HMDA 4N8VG 1OT1A 3PJSA 2Q1EA 4HK3J 4M7KH 3GGWA 3V5HB 5HHOE 5DD6A 3I9GH 1JPSH 1EBPA 2R69L 1PW3A 3GKZA 5A3ID 1TIUA 1YEJL 1RSFA 2YK1L 2UZIH 1VFOA 3RDTB 2XI9A 3CFJA 3QWQB 3CFIC 1K9TA 4GRWB 1YMHA 1IT9L 4XAKD 4D0DB 5GGTH 5CJXC 3VFTA 1K8IB 1NC2A 4HXAH 4XPTH 5BCAA 4PB0H 5IK3B 3Q6GL 5L2JA 3LHPH 3QO1A 1PG7W 5C09A 3H3KA 1BQLH 3C6SA 3SKOA 3ES6B 4OQTL 5D7LA 4FHBD 1NDMA 3C5ZC 4BH8B 2BMKA 1HEZA 2IANB 1NMBH 3OJDA 5D72L 2OXHA 1XCTA 2HLFC 1KEML 5IG7B 1NC4D 5IQ7H 1RZJC 3ULVC 3VW3H 1XIWD 4GO6B 3W0WB 4X9HA 5CSBA 2EDQA 2AJYH 4CL7A 4PLNC 4X8JB 3MA9L 4NM8L 1OTTC 3BXNB 3U6RB 4PRIA 3T4YB 2P24A 3GHEH 3HLAA 5K9QG 5DRWA 3RPKA 3CCHB 1LDPH 1MWAA 1FFNB 4PJEE 3OAZK 1YQVL 1UB6B 2W07A 5JA9A 1F3JA 1F90L 3VFVB 5M94B 4TUKL 3CLFL 1FBIH 1C8PA 4EJ1C 1N8ZB 5IFHL 3IU3A 4FQXD 3K46A 1KG0A 5EORL 4TNWF 2R0ZH 3O2VL 3UDWA 4EI5D 4X80H 1RURL 1ND0B 5EO1B 4U31A 3QI9C 3S3JA 1ZLVH 4XI5C 4YEEA 1JI1A 5JORA 4Z9KB 3MV8A 1EVTC 1IC1A 4LCYB 1X5FA 1YEGL 5IEKB 3QUKA 3ELAT 1CVRA 4MAUL 2APXA 3ARFD 3ARDB 5EZJA 1OP3K 2Q3AA 1F3DH 2CDEB 4WU5B 4KPHH 3LV3A 2BNQD 5MEPB 3IYLW 4G8FB 4QRQB 5D1XD 3EYQC 2J2ZA 1BFVH 3SDDB 3NIFE 1RZFL 4MJ4A 4MSWB 1PJ9A 5EIVA 1DLHA 1QEWA 4GRLD 4P3DA 5CJQL 1Z3GH 1R5IB 4O2FA 4PV8B 1T83C 2FX9L 5A2LH 1P9MC 1J05B 3HE6C 5MI0B 4YJZL 4HGWB 4WV1A 1Y6NR 5DTFB 1A6UL 1W2KT 4TPRL 4JKPH 3PV6B 2BXYA 5ID1B 3S8WA 1KUMA 1N4XH 4JEGB 3TBVB 4J3SA 3FMGL 4LDOB 1VHPA 5D71H 4EXPX 1NFIB 2EEDA 5GGTA 5C0CA 3RWEA 2NCMA 2J4WL 1WUNT 4PJ9D 4KROC 4DCQA 1U95B 1BZ9B 5EZIL 1WISA 3VFPB 5IHLB 5I8CB 3BSZL 5IKCB 2UYLA 4E41B 2ATKA 4QRRB 3ZE0E 4LL9A 1J86A 3X11A 5F7DA 2Z31B 4OKDA 1WC7A 2QL1A 3UO1L 1HXMB 2X5PA 2C5DC 1CU4L 3I75A 1OGTA 1IEHA 4FG6D 3ZE2E 4Y4HC 5DJ2B 3O4OB 4LAQL 1WBXA 3RJQB 2Q86A 5JA8B 4L8SA 4JZJB 2WBJD 3TA3B 1QFWH 1NDGA 4ZFOL 2ZJSL 1YEKH 5BV7L 3FN3A 3NTCH 4QT5B 5JOFA 3JWOH 2NTFB 1DN2A 2NXYC 4Z7UB 5JXED 3DX6B 1HI6A 3RIAK 2D3VA 4MNQD 5F8RC 4MA7H 3V6ZA 1NLBL 3EZJB 1KC5H 1N0XL 4JANA 2IBGA 5JR1H 2JE8A 1JHLL 3VRLE 4J8RA 2R9HD 3GSXB 3QWRD 3VGEA 1O7VA 4IOSD 3DRTA 2KQNA 3QUMB 2MCPL 1RJZA 5ENWA 1FAKT 3JBG7 3TBYA 5JPNB 3FO1B 4URTB 4PJIE 3ZKMC 1JFQL 3U7WL 4LSPL 1AQKL 3QIBD 2FGWL 1Q9KB 3RNKA 3VGBA 3LMJH 3D0VA 1QBLH 3IETA 5AWNH 5JPMB 4FRWA 2VH5L 5B21A 4PJEF 5I74C 4F57L 1P5VA 4GFTB 3MCLL 3P30L 3QIWD 4HGMA 3RAJH 5FYLH 4RMQA 5DGQA 4XBPA 2CK2A 3RZCC 1T7VA 2E6QA 1FAIL 4TTDD 5AZ2H 1IGJA 2X89A 4HKJB 4WY7H 4I18B 2ZUUA 4LLDB 4PD4J 3HC0B 2BFVL 3L3HA 4I0PC 3QNXA 1RZGA 2VERN 4GXVH 1CGSH 3DXAE 1H8OA 4NO5A 3TJEL 1NSNL 3LKQA 3E2HB 2C4FT 2VLME 1IGTA 5CBEB 4DVRL 1DLFL 3FRPG 12E8H 2V9TA 1EXUA 2DMKA 4FTVE 4JPIA 3CH1A 5L9DL 1QR1B 2CQVA 4TNVK 1H3TA 1T1YA 4YQXH 2X1QA 1FDLH 5J6HA 2VQ1A 2AS5M 1T03L 3NIFF 2A9ML 4UV4L 3OJVC 4UDUA 1VGEH 1XR8A 3AAZA 5HTSA 5JW5B 3NFSH 3ARBB 5JW4N 3BKML 5KJRL 3DVNA 4EDWL 2E9IA 3V4UL 4YDKH 5I18H 5EU6D 5LGHH 2BNRE 3HR5A 1F2QA 2HRPH 5HXMA 1LNUB 2GITB 2OR9L 1IGFH 2Q7YB 5DK0A 1CXIA 3OZ9H 2VDRH 3ARGA 2FGZA 5HHMD 4GLRI 5F3BB 2E7MA 4ZYKB 4N8VA 4GBXD 4E0RB 1UGNA 3SE8L 5IMMA 3S88L 3L3IA 1PKQE 3S5LB 4NQXA 4K3DH 3OKLB 2HMID 5DI8B 3EUUA 5C9KA 3MRHB 4OIIH 1KEGH 3BQUD 1EPFA 1EGJL 2JB6B 4OLZH 4MDIA 5BS0D 3UP1A 2DIJA 3RA7L 2I26N 1I8KA 4LBEB 3RWCB 2EDEA 3RI5K 3IFPB 2CDGB 2OI9C 3ZE0F 4D9RE 1ORSA 4NZUH 3GBNH 3VJ6A 1YECH 4X5WB 1EFXD 5TQ2H 3WHE0 3HE6B 3H9SE 3QUZA 1NCBH 5ESAA 1KN4H 4KK6C 3ZE2F 1IC5H 1JTOA 5F72S 1X5XA 4Y7MA 1D5ZB 2CO7B 5DRZB 1PG7H 4M1GH 3S34L 1N5AA 5IBTH 2BVOB 3IDJA 5E03A 3K2UL 3IDGB 3X3GL 3SDAD 1K85A 4YHOH 1SEBB 4UUJA 4KROB 5D4QA 1NUGA 2XT1B 3P9MB 5T3ZL 4XAWH 4K23H 3LKOB 5I1IL 1KJ2L 4QF1B 3VRLF 4LDEB 2HTLC 5DA0B 4WGVB 1MPAH 4A6YB 3JUYA 1YY8A 4Y4HB 4NN6C 3OXSA 3QUXD 1ORQA 1SM3H 4PJIF 4UBDC 2CDFB 1U8OB 3VGAC 5C08E 3D87B 2QQNL 2WLZA 4WW2C 1FZMB 3BH8A 5KSBE 1T3FA 4JKMA 1UA6H 3KPPB 1OWRM 3QHFH 4JFFE 2DJUA 4OZFB 5CGYD 4F7CB 1A3RH 3D18A 1NL0H 2YUXA 2HKFL 4KDWA 5FECB 2APFA 3N06B 5I1DB 3SJVB 3KPQA 4HS8L 3BRDA 3EFDL 3ABZA 5TFSL 3WSQL 1TQCB 1KIRB 2A6DA 3ZDXE 2A73B 1D9KD 4WHYG 5E8OA 2OL3L 3MFFB 5J57B 1ZANL 4LCUA 4M1DH 1MI5D 1YNLL 3QUYD 2UZXB 2JKXA 1U3HB 3ZTNH 5I74B 4BK4A 2QADD 1KTDA 4O5LH 5JDJA 4H20H 1KPVA 4EDXB 3RWHB 4G43A 2ZCKH 4P2QB 1SJHB 1WEJH 3LCYA 4QHUA 1U8HB 1LDSA 1LO2H 1G6RL 3CFEA 1IQWH 4MMZC 4I0PB 2VWEC 1XGYH 4RMWA 5BMFH 5E99L 3UPAA 4UI2A 1YEDA 4ACPA 3QULB 5L2KD 4Y4KD 1ZV5A 3KGRA 3SE3C 2PYEA 5KVFL 5F1IA 3RUGB 3R06B 3BPOC 1HHGA 2J12B 1JV5B 4NO0B 1AGCA 4JM2C 4L5FL 5EA0H 4RMSA 3BZFA 3MRLB 2GEEA 4ZUVB 2X4TA 2XZCH 1MFBH 4UNTA 5IOPB 1H0DB 1D5MB 3FQRA 3MYJA 4K9EH 1MIEH 4N90E 1RULH 4J3VA 4I3GA 4OZIE 4ZFZA 1XT5A 3BAEH 4AH2A 4CGTA 3KPRA 3ZTJH 5KZCB 3PWJA 4HLZH 4FQCH 3EGSB 1WBYB 2EC9T 3N9GH 1I7ZB 1OLZA 3CSYA 1YUHA 2VL5B 3TT1H 4Z77B 4GKOA 3ARTA 2YD5A 2W60B 5IFJB 2NY4D 4U1KA 5DT1L 5K9JL 4R4ND 1IBGH 5T1LB 3ETBF 3WHXB 1RUML 3RPIB 3ZYOA 1P7QD 3HNVH 5I76B 4PY8I 5CD5C 2QV2A 3U2SA 3F7PC 4H8WH 3O3AA 3WLBA 5I73B 5T1KD 4X4YB 4NKIL 3EDKA 4NHCH 2OLDA 4MD5A 4W6WB 4GMTH 3BH9A 4GRWE 5EWIH 4HX1B 1RJLA 1H3VA 3BW9A 3RWIB 5HPMB 4AYFA 5KBNC 2NW2A 5DEGB 4D9RD 1M4KA 4OFYA 2X4NB 3BP5A 4JJHA 3I50L 3RVVD 3UBXG 3WUWG 4DN4H 1FNGA 1SMOA 3LRGA 4JB9H 4PR5A 4XNMA 1LHZA 2VXQH 2YD3A 2DM7A 3MMEB 3DUUA 3NCEB 5KSBF 1DL7H 5DMIL 2G60L 3THMH 4NQCD 3WUZA 2FSEB 2OYPA 3OAYK 3P11H 1MHCA 3W0WE 4DUVA 5F89A 2YRLA 5SWZE 1F6AB 2DQUH 1JN6B 3RBSA 3BD5A 5DRXB 4UMGA 5BVPH 5AG8A 3KLDA 1CLZL 1DBKL 1KLUA 2OTWA 3GNML 3QCVL 5DVMA 4NN6B 4M48L 1IGCH 1FGVH 2ADFH 4CVZA 4DEPB 1KNOB 1CE1L 3QBTB 3MRBA 2XXCB 5IIEB 3KS0J 3ZDXF 2DKMA 4WW2B 4PB9L 2UVFA 5EC2B 2HFTA 4ERSH 1RIVL 4ZO6A 3GM8A 2VXTH 5AYQA 5DUML 1QRNB 2E7CA 2XA3A 4N0CD 3T2NL 2NY5L 2ZUYA 1BFTA 2NY1B 4GKZB 1UXSA 4RFOH 4IRSA 5ITBH 1CFVH 3ARED 3JUZA 1VKXB 3KS0H 1C7TA 5C92A 1B0RA 3NABH 3S7GA 2PNDA 4I9WE 5EU3B 5JQ6L 2P5WA 1QBMH 1TITA 4MQ7B 4JO2L 4OCRH 2KPNA 3QEUB 3QA3B 1AQDB 4L4TD 2LV4A 1S78D 2X42A 3X13B 2PO6A 3WO3B 4PRDA 4XVJH 1FCGA 5T1MB 5GS2H 5ERWB 4TRPH 1XCQA 3MRCB 1TJHL 4C4KO 4G80B 4XPHH 3DO7A 3WDJA 2AXFB 5IWLC 5C09E 2XN9A 2HWZL 4HC1H 5E94A 4E42B 4R97C 4NCDA 3BYTA 3TZVD 4OZIF 2CUHA 2AK4D 3L3GB 5MP6H 5L0QC 3DVGB 3GO1L 4P4KC 4YFEA 4KC3B 3KYKL 3QPXH 1A3QA 3HNTL 3KXFB 3GMPB 1Q9WA 3U0TA 2GSIA 4HH9A 5BJTB 4RGNC 1SVCP 4PRIE 1OARL 2ESVB 1YN6A 4KI5C 2R29H 2DQFA 3OKYA 5EBWB 3QXAB 5GSRB 4E41E 4JM2B 1R3JB 4P57B 5EBLA 2VZ1A 1ZLWH 4OM1H 5DR5L 1KCLA 5F7EH 1HDMA 2HLAB 5T33L 2OSLB 2GJ6D 3KJ6L 3HFML 1AD0A 1DQJB 2YKLL 2DQGL 4N90D 3PABB 4RGMB 3S3PA 3DI2B 3VU2A 3CXHJ 4PV9B 2RCSH 4UNUA 4ZUSA 1OW0C 3MV8E 4GRWF 3QRGL 4GUPA 1KB9J 4LSDA 3QWOB 1J8HB 3I9GL 3UROR 3VXPB 3GSOB 3H7LA 4HG4J 5FYKE 4FFYH 5MHSD 4ONHB 4KUZL 1B90A 3LH2L 5EU5B 1JPGB 1A7RH 5EU7E 3VFNB 4G42A 3NACL 4APQD 3EYOA 4HBCH 3GMOB 3MRIA 2UWEB 4YC2C 4ALAL 1A6WL 4CMMA 1A4KB 1D9KA 3BN9D 4L3CB 4H0HB 4OGYH 4JFHE 1K4DA 2F5AH 3HZMA 2ID5A 3F6LA 3L3KB 4HKZA 4KVCL 3PL6C 1CICC 1NMBL 1FO0B 1A21A 1MJJA 4YGVB 1HYSC 1C5BL 1N59B 1QLRA 2F54B 3GSWA 4HZAA 3RDTD 2V2XB 1NGWA 3VXTB 1FSKB 4G8IB 1IC4L 2YMXL 3FQTB 5IMKA 5IP4A 4OJFH 3WJLC 5E4EB 3TO2A 5JLZA 3RHWK 4PJ5A 2JF1A 3FN0L 5TJWK 4DW2L 1R3HB 5L2KA 3D69A 2NLJA 3PQYA 3FOLA 1XF4B 4JRWA 4N5ED 2IAND 4HC1A 5GISH 3MRKB 5GS0C 1MQ8A 1TETH 1N64L 2DQFB 1BP3B 5CJ5A 1P69B 3WFHA 5IF0A 5FV2A 1ZK9A 1AHWB 1FL3B 2OZ4L 1GGBL 3P9LB 3ZKNC 1BAFH 1MVUA 1QFWM 4YE4L 3SHSA 1IC7H 3BGMA 3HC4H 3VXUA 2DDQL 2R2HB 2R0ZL 5ICZB 2DD8L 5K59E 1DUZA 1UKQA 2VDPH 5ESQA 1VFBB 4U1LA 4U05A 3CDCA 5IR1A 1FZKB 2FIKA 1ZOXA 3VA6A 3F5WB 4IMLA 3DJ9A 2AV7B 4C83B 3VXMA 2C3VB 4KKAC 2FDBP 1AD9B 2RJMA 4P46A 4O2EA 3VRIB 5CIPB 5IW6B 3X12B 3WDIA 4ZUUB 2VLKB 1A7NL 2EYTA 1EEYB 3BPCA 4U6HA 3BI9X 4PJHB 4ZS7L 2DLIA 1U9KA 4LMQE 2CD0A 1EERB 1HHIB 4XB7A 1IQDB 3I6LD 5IB4B 1OGAB 1XGPA 1FJ1B 2EIZB 3IJYB 4YFLF 3SY0A 4UILL 4GW1A 1T04A 3G6DH 5C0GB 3ARDD 4Y4FB 2GK0A 4IIQA 4QO1A 1NGZB 1UH2A 4QHNB 5J13B 3QG6A 3JVGC 3JTTB 9CGTA 4OCSL 4JZOB 3GSWB 1T1WB 3QFDB 1KELH 5DWUH 2D7NA 2WBWB 2BK8A 3SDDD 1UM4H 1I8MA 3MNZB 1EZVY 3WE6B 4OM0H 2XQYG 2MWCA 1U3JA 4K94H 1A7BA 3PIQA 2VZUA 3VMPA 3EYFA 3CMOL 4PTTA 4R97B 1UEYA 1CI5A 4OLEA 1S7XB 2IJ0C 1OP3H 2L7UA 2AI0L 1HK6A 5L0QB 5GIRA 2K7PA 2NMSA 3H9HB 4D0CB 4P4KB 4OSUL 1FNEA 4J7RA 3OKNA 1CBVL 3S4SB 2F19L 4WFFD 4RNRB 4ZOCA 1UB5B 3UJIL 1AR2A 5CLWA 1HOCA 2DM2A 3MLYL 1A1NB 4RGNB 3OHXA 4Z7VA 1SYVB 5FA3B 4BZYA 1T80A 3BT2L 1N2RA 3DSNA 3A67L 4FQ2L 4X5XB 3SKNB 2EIEA 4PYGA 1KV3A 1NCUA 1ZSDA 5AYUL 4QRRD 1CGXA 4C56A 4Z6AT 1J8KA 2Z31D 3OBAA 1SBBA 3CLEH 1MFCH 2JJWA 2UY7A 1W0WA 3C9NA 3VDCA 1NGPH 5JIPA 4P2RB 1YJDH 4Y8AA 3ZHLA 3BPLC 4AMKL 4Q6YA 1VADB 5D1ZA 2AJVL 2OR8A 2V17H 4PP2B 1DQQA 1QPPA 3TA3D 2YN5A 3DO3A 4HZLB 3LKSB 1NEUA 4XP4H 3G6JA 3P2TA 2ED9A 2DTMH 2J8UB 5GJSH 5FUCC 3T0DA 1IEBA 1OP9A 4Q9RH 2YA2A 3NZHH 5FYKD 1CXEA 4RQQA 4L4TA 2DF3A 4KDTA 4NQEB 3VDAA 4HUVA 1E4WL 4YC2B 1MCOL 3I2CH 1T5WA 5HHPB 5JIIA 5FDWA 1NEZB 3MLUL 1CICB 5HHQB 1YY9C 3OKMA 5E08H 4YHPB 4GXVL 4JN1H 5JOPD 1ACYH 5K59F 1IE5A 3TIDA 5JMRA 3TNMB 5IFAL 2G5BA 1EO8L 1QSFA 4LEXH 5CINH 4PG9A 1V7MH 3NIGE 3T65B 3FT2A 4QXUL 1CG9A 5CHNA 2VZOA 2B5IC 4NUGL 5FYLE 3DROA 3AY4A 3ZHDA 2B1AH 3LIZH 1FPTH 2N4IA 2W0LA 3UTQB 1DBMH 1SVZA 2HLFD 1FDLL 2C7UB 5C7XL 2YUWA 5I8EB 2CPCA 5F7HA 4PRAB 3WO4C 1AP2A 2XZQH 5TH2B 4NRYA 4OFDA 3D5OF 1KT2A 4JHAH 3KHOA 1OTTD 4MD0A 6CGTA 4UTAH 1ZVSB 5D7IB 5E5MB 5JO5A 1HXYA 1RUQH 3V0AC 3N1GC 1L9NA 3BVNA 4M6OL 1I1AC 1ZGLB 4HJJL 3RTQB 3SGKA 2WUBH 3PP3H 4GQ9L 2AGJL 4MAYC 1GGUA 3OXRB 1ZA3A 4WEBH 1R0AL 1PX4A 2I27N 3LQAC 1QFPA 4G9DB 1H3XA 5JW3H 4V1DB 4NIKB 3BKYH 4HCRA 4PRBA 5TQ0L 4JLRA 2A6JA 2VDOH 3QQ3B 3LKNA 4OUUA 3DX8A 1WZ1L 3ARBD 4LSVH 3VXOA 1BZ7B 4NZRH 2OJEB 3MGOB 4XI5D 1BJ1J 1YEHL 1GHFL 1SJXA 4Q0XH 3S5LG 1VEPA 4NZUL 2ZOLA 3UPRB 2XWBA 4HS3B 5KVEH 1KN4L 5INCA 1QQDA 4EIZC 2DQIL 2PR4H 1MCNA 4HFWB 1EFQA 3HMWL 4M1CC 2E6JA 1BLNB 4PJDB 3EYQD 3P4NA 4U1NA 3O3DA 5CEZD 3LPGA 4DQOL 3VG9C 2VISA 4XCNB 3LQZB 2HJKA 4BZ2H 3TH2T 4RWYL 4JFOA 4Y5XA 1NLDH 4X7CC 3TN0C 3HE6D 2ADGA 5GSVA 2FJFB 1G9ML 2I5YH 3DV6B 5D5MA 3VFRA 3KWWB 3FCTA 1WJ3A 3HZVA 1IEAA 2PYEE 2A2QT 5ITFB 4DFHA 4F8QA 1DE4B 5KAQF 2X4QB 2XWJA 3E1F1 4PG2A 4UT6H 5I1KL 2IAMA 5SWSA 2DLGA 4ZUWA 2FWOB 4KROD 2HVJB 4X0KB 2O61A 1JPST 3ARUA 4XPGH 1A6TA 1IRAY 4QOKB 4RMVA 4ORGB 3KPRE 4POYA 1KTLB 1MFAH 1SY6H 4X4XB 4LLVB 3O8XA 3U0PA 3D3VB 3QHFL 1MFDL 5D2NB 1P2CA 4U1HB 4QHMB 4QRPA 4ZFGH 4Y4HD 3MCKA 4OZ4A 3S96B 3OB0K 2DICA 1LO3H 3MLTA 4NNYB 2GSGA 5IROC 3EBAA 1ZS8A 3VRJB 1RFDL 4QHKI 5CCKH 4LSTL 4RGOH 3MNVB 3VFOA 1JMXA 25C8H 1TVBB 1MCQA 2WNGA 4OKVA 1Q0XH 1RIUL 3T4AA 1FE8L 1S9XB 3NIGF 5ISZA 15C8H 1AGFA 3B6SB 5I17A 3UTOA 2XNAA 5SWQA 3L3DB 1GXEA 1FZJB 4JY5H 3OTTA 3SJVD 1WEJL 4HUWB 1H15A 3UAJC 1RMFL 4JR9H 4M62L 3ILQC 3GIZH 4ZPVA 4YNYA 1RZJH 1EAPB 3ULVH 2Z93A 2PUQT 2IPUG 3K81A 5C0AA 4PJ8C 4U1MA 4I3SL 3I02A 4RAVA 2Z4QB 3CFCH 4YDIH 5FGCE 3TO4C 1UEMA 3TPKA 5I8OH 3OG6B 4UINH 1T6VN 3WXWL 5I1CH 4YAQA 3OR7B 1HQ4A 2VDQL 3LKRB 3RZCD 3MV9B 5HI3D 3N1FC 4P2QD 4XTRC 3OPZH 3HAEH 1TCRA 1MFBL 3EDEA 1KCVH 5AAWA 1UENA 5DHVA 1MIEL 1RULL 4I0PD 2VLLB 3V5DB 1J12A 1GZQB 3IJSA 5ACZB 2X7LB 2O5YH 2H8PA 3WO4B 4X7TA 3UTSB 3SDCB 2EH8L 5JHDB 2IPTH 5BO1H 2IG2L 4FZ8H 5FYJH 1FN4A 2F53A 3Q6FA 4E5XB 5CEXB 4N68A 4N9OB 1I3GL 5IW1B 1IBGL 3N85L 3VD7A 2ZKHL 2ARJQ 4MAYB 4X4MA 1PY4A 3KR3L 4YK4B 5KN5A 5EOCH 3NA9H 2XPGB 3BX7C 4GKSB 1UCTA 4OZGA 2VDKL 1ADQH 4L8CA 4ELMB 1E4XL 1SY6A 4XBEL 2NR6C 3WHE1 1XGQA 2B0SH 4XP6H 1EVUA 1MJUL 3T0EC 2HG5A 4YHZL 5LCVL 1I3UA 2Z8SA 2LQRA 4KGJA 4A2LA 1Z9MA 5T1LD 1ZHBB 5EIIB 4C57C 5EUKB 5IBUB 4LSSH 3D0LA 3OSKA 3PWPD 3FB5A 4BSWA 1UXWA 3U7YH 1HSBA 4M43H 4TSBH 1S7TA 2BSRA 5KVMC 3C5SA 1Z5LA 2XN9E 4JFPB 1CZ8L 4G6KH 4CU6A 5I1EH 2NZ9C 5JW4R 1N6VA 3THML 5GS1B 5IT2L 3LKPA 2EDXA 4OCYL 3GMRB 5DJCA 4QGTA 1BOGA 2ICEB 5HDQL 3RVUD 3C5ZA 5IB5A 2XFXA 2A1WH 5TE4H 5GHWL 1RJYA 4KK6D 4H88L 3WN5C 4K3EH 1IMHC 3AU1B 4HF5L 4NUJB 1KJMA 1F4XH 2VZ3A 1OB1A 1FFOA 3AFLA 3D2UA 1FYTB 4K7PL 3KPSB 4PUBH 4KY1H 3VMNA 2FR4B 5CJ8A 2HJLB 5LBSL 2KDGA 1B4JH 3KPLA 3SQBA 3AXLB 4PP1C 4X83A 2FO1A 5J11C 3RWGA 1IVLA 4KHTL 3QJFB 1P84K 1IM3B 3QXVA 1LE5A 1LEIA 4P9HL 1QNZH 1A14L 3MBEB 4MB4A 3SE4C 2X70B 1D6VH 1GPOL 4L8BA 3MBXL 3E6HA 3X14A 1HNFA 4G5ZH 4LNRB 4K3JH 1LEGB 1IAMA 1S5IL 3C60C 2RHEA 3EW3B 2MKLC 4U1SB 5DHXB 1XF5B 4UBDD 1KACB 1FC2D 2YRPA 3ZL4H 3QI9A 1DANU 2MJWA 4JG0H 5TDNB 1TZHB 2VLKE 2MQCA 1BM3H 4NKOB 2W92A 3TWCL 4O2CB 3MLXH 3IU4L 1U6AL 3B2UC 1CYGA 4QHLB 1K6QL 1P4IL 4HHAA 1QRND 3RWDB 2WP3T 35C8H 5MEOA 1ADQA 2NY1D 4POUB 3BP4B 2Q8AH 4CW1A 3W9EB 1KULA 4NJAH 3RL2B 2VQUA 3MX0A 5F1OB 1KLFA 3C08H 1CWVA 5J12B 2E7LC 4G7YH 4ELKA 4R9HA 2AEQL 4MA3A 3MROB 5I6XC 2X6MA 1WTLA 4WJ5B 5DJZA 4CKVX 1KCRH 1JMZA 3R8QA 1MIML 1P9MA 3EAKA 3QPXL 4R26H 2IMMA 5F7KC 4K2UL 1G7IA 1TVHB 3GSQA 4AK1A 4U3CA 1B2WL 1U8PA 4R7NB 4PJ5E 4X9GA 3T8XA 3ROLB 4NT6B 1VFUA 1DQDH 4XC1L 3P4MA 2VAAB 3GJEB 4NO3B 5HGDA 3GSVB 3VGGA 1M7IA 2FHCA 2XKSA 3ZDZE 3REWA 3NZ8B 4ZUTA 3OJ2C 1DP0A 2V7NA 4L4VB 4AT6B 1CK0L 4MNHB 2W9EL 4NWTL 2A6IA 3KXFD 3QP3A 5C0RL 3MRFA 3HAEB 1S7SB 4TN9A 2AQ1A 3VXUE 2VDMH 3TVMC 1OAYL 1FV1A 1MCFA 1G7LA 4FQHA 3MV7B 3VFMB 3MRRB 2ESVD 4HK0B 1AKJA 5JHLL 3RL1A 3ULUC 1FRGH 1J18A 1MREH 2PXYC 3GBLA 5I9QC 2NW3B 4JM2D 2AEIT 4N1CA 3LY6A 3VXME 4DUXA 3RWJB 3IKCB 4KK9C 5EG6C 3HUJB 3SCMC 2V5TA 3HI1A 5IB1B 1UYWH 2Z8RA 1OAKH 4JE4B 3TYFB 1ETZB 4UQ2B 3VFUB 2PTTB 4KRPC 5IB2A 1JWSB 4FQIH 1ZE3C 3TBSA 1HILB 3QNZA 2GKIA 1YEFH 4POZC 2X4PB 4O58L 2P49B 3VWKB 2J8UE 1LE9A 1CFTA 1J8HD 2UZYB 1UQSB 2EDYA 5DD1L 4Y19B 4RIRA 4NQEE 4OI8A 3SO5A 5GRZA 4BJLA 1WV7T 2XKNB 4JY6A 1BD2A