5DHVA

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
123
structure length
123
Chain Sequence
QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 27
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvA00
1DJSA 3J7HA 2AJSL 5CMAB 2IANE 3T0EE 1OPGL 4OFYA 4RWYH 3CVIL 4KI1A 3RP1A 1G7QB 2XPGA 2DLFH 4V2CB 2NX5E 1T1ZA 1T3FA 1XZ0A 1T0NB 4PRNB 1CXEA 1NKRA 3DBXA 3P4MA 3AMKA 5D96B 2YD2A 4H88H 3SE4C 5DK2A 4ZS6C 5D1ZC 2ESVA 4XBEL 4L4TA 1SJEB 2ZJSL 4ZSOB 12E8H 3T3MF 2IADB 4F7TA 3D9AH 4WW1B 3QR2A 2IAMA 2D7MA 2PTVA 4LCUB 3HS0A 4K8RL 3DVNB 1PY9A 4CRPA 1W8NA 2AV7B 4I3SH 4S1QL 5F3BB 5CD5C 2F9BT 4S0SD 4DN4H 2VXQH 3AY4C 3V4PL 1RJLB 4ZPVB 4PP1C 4MZ3A 5FYLH 4ONOA 1F4XL 4O5LH 4X7EC 1ZWIB 1MAJA 2O5YH 3U36A 5TE6H 5DEGA 3UCRA 4XP4H 1EHAA 2V7NB 5FM5O 1UWXK 4JO3L 4NM4H 3FL7A 4FZEH 1CGYA 3OF6D 5F3HA 2Y5TA 3ARTA 1OY3B 3UJIL 3T1FB 1WWAX 1RPQA 4PJCE 4BFIB 4R2GD 4Y5YA 2OL3B 1T1YB 4LSVL 1UCTA 3LPGA 4PTTB 1MVUA 1HDMB 3MBED 5SWSD 4X6DB 1QSZA 3RJQB 5LGHL 1KLUB 5IG7B 4X4XB 2E9IA 1RV6X 1QBLL 1H3PH 2XWBA 1RD6A 3QDME 3IXTA 2DBJA 5FECB 4JFXA 2AEPH 4MJIB 2R39A 5BJTA 5C09B 3HLAB 1FFOB 3O4OC 5FYJD 1FIEA 1MCNA 1FG2B 2P5WD 3JV0A 4ZO9A 4Y0GA 5EU4A 3VFSB 3QDJB 3PHSA 2AK4E 4GKNA 3LKNB 4HXBL 4G6KL 4C4KT 4M93C 1XF1A 1YN7B 8FABB 3OG4B 1S78D 4NQDE 2A77H 2CK2A 1H15A 1TTGA 3T8XB 3ARDC 4LCIH 2DQEL 3L5WA 2PCPB 3FAWA 3QIBD 1F2QA 5BQ7B 2KQMA 2MQCA 1T4KA 2VZTA 3FB6B 4U1LB 3LKQB 3RWJA 3B5GA 1MWAH 5EO0B 5AD0A 1FZOB 1MHEA 2EXWD 3RWIB 2AABH 1UCBL 2APFA 3QWQB 5HYSA 2GTWB 3MNZB 4U3HA 4E5XA 2BNRE 3DUSB 1IM3A 4XNMA 1A4JA 3BRFA 3S98A 4IM8A 4Q58C 3EOTL 5KS9A 1TPXB 1OGAA 3Q48A 5D6CB 5MEPB 2W9EH 2WV3A 3R0MA 4KK5D 4DVBA 3EYUL 5DUPH 1QFUL 1T0MB 1XGYL 2WIMA 5GQBA 2VABA 4DZBB 4M8QA 2N7BA 3WCYA 1G9NH 1F4WL 1QR1A 5BZDB 2RAMA 4WHTA 4YHNB 3BEVB 2AI0H 3BP6B 2NY5H 5GGTL 1T5XA 3LRSA 3NCBB 3NFNB 2VR4A 4HS8H 1RJYA 3MRCB 1F4HA 5CJ5A 1UB5A 3BRDA 4LBEA 4O2EA 3PP3H 5ISZE 1P4LA 4QRPD 2BNQA 2C1PB 3KPTA 1K8IA 1CFQA 1WBYA 4NJAH 4WTWA 4RX4D 5KSUB 1AQKL 1BQUA 2ATKB 1EO8H 2HG5B 3EJYD 2GK0B 1KTDB 2A6JB 4P2RB 2YWYA 1DE4B 3DPBA 3BZ4B 3MV11 1I85C 2R69H 1U8HB 4ZSOE 3FB8A 4HXAH 4UQ3A 1R3HA 4RAVB 4PJEA 4U1HB 1QFHA 4L8SB 4X6CB 3CZFA 5J8OA 3RU8H 5A2JH 4JANB 3ABZA 2XG5A 1NSNH 3TBTB 1U8NA 1TZGL 1MEXH 1HIML 2BDNL 4WFHE 2CDFB 5T1LB 1S9XB 1C16B 3QBTB 1ODAA 2ARJB 5DD3L 5KVGH 1J0IA 5ANMB 2H26A 4X9GA 5B38G 5B8CC 1D5XA 3H42L 1KJ2H 4Z7WA 4D0CA 4TSCH 1P4IH 2IMNA 1RUQH 4LSSH 1VFAA 3WDJA 2HA1A 3GMQA 5CIPA 3GI9L 3OB0K 2FDBP 4PR5B 4HH9A 2D4DA 4ENEC 3FMGL 1S7XA 1MCHA 3PV7A 4NNXB 3W0WA 2NY7L 5JOPE 3LH2L 3P4OA 4F7CA 1URLA 5J9PB 3MYJA 1DUYA 3PP4L 1BWMA 1AO7A 1FGNL 5DC9B 1CDBA 4UZGA 2YXMA 1FNEA 3DHJA 1ETZB 1NJ9A 5TFSL 1VADB 5BVPL 4OB5H 3LPWA 3RWHB 4FQHB 4C83A 3BUYB 4R4ND 4X6DE 4XGZB 5HHOD 3ARGD 3C5ZD 1RIHL 4LLMB 3NFSH 4AENA 5F9JA 2NY2C 4LHUA 2DL2A 1GC1L 2HT2C 4MJIE 3RY6C 3AY4A 1A6ZA 1A8JH 5A3IC 1D7FA 4XPHH 5C09E 1NPUA 3CCHA 1H5BB 2YN3A 2PO6A 1NGWB 3V6BR 1SVZA 4WEMB 1JHLH 1UM5H 3WXWH 3OGCB 1JFQL 2XQYK 2VQUA 4XP9L 1T22A 3QDJE 1FAIH 4DFHA 4QXGL 1Q9KB 4S2SA 43CAB 4XAKD 3U46A 3MV7A 1X5YA 3RL2A 4MCZA 3MGOA 5IGXL 2FEEI 2J7LA 4Y5VC 3OKKA 3ZL4L 5IKCB 4G43B 1KEGL 1U95A 3SDYH 4U2ZA 5E8PA 1K3ZA 1QA9B 4QY8B 1CGSL 3P4LA 3HFMH 2VZOA 4LQFH 2XRAH 1NL0H 2VLKA 1PYWA 1KSRA 4V1DA 5C0AA 2DLEA 2VOTA 4OFKA 3OAUH 1LO5B 4HUNB 5LWYL 3F5WA 5GGSB 4LQ1A 1FP5A 1MHCA 5CP7B 3TCLB 4U6YA 1HHIB 2VDRL 5I1IH 2OL3H 3RAJL 4NBZB 1IQDB 3BKJL 3OKOA 5DD5H 4QXUH 5I18L 1NGXA 2X1PA 3ZKSD 1RFDH 4LLUB 3MTRA 5DQDL 3SE3A 1FL3B 4NHCL 1HWHB 1UADC 1BX2B 1ZTXL 4H25B 3QNYA 3EO1B 3BMWA 1V7NH 2UY7A 2FO4A 2ITDA 1KEMH 1MCCA 2MQ3A 4Y4FD 4P59L 1N59A 1KLGA 1Z5LB 1F3JB 1OW0C 3KGRA 4G7VH 4OCMC 1RZFH 4KROB 1I3RB 1ZSDA 4RGOH 4CNIB 3R4DA 3E6FB 1ZT1A 3D0VA 1G7PB 1JZ5A 3MUJA 3EOAB 2V5RA 4RFEB 1AHWB 4HMDA 2L7JA 2XA8L 4P2RE 2W0KA 1NCBL 1L0XA 3RGVB 1X5AA 2BMKA 4TUKH 3C6LD 1G7JA 4X7SH 1E4KA 2GSGA 5F93C 3VXRA 4P23B 1A1NA 4ZS7L 2JJSC 4DUWA 2D03H 4NO2A 3B5TA 3IU3B 2YRLA 1DUZA 1INQA 1H8SA 4R26L 3TVMB 1OAUL 4XP6L 4JFQA 4OF3A 4X6CE 2X4PB 4JFDB 4PJ5D 2J8UB 5IB5B 2X7LB 3OX8B 3WKML 4Y4KA 4AM0B 2P5EA 2EICA 2K9UA 1J7VR 5ANME 3UBXA 3K8MA 1U8IA 4GW5B 5D8JH 4HV8A 4CU6A 3MROA 3OXRA 4MAYA 4QHUA 5EOCH 1SYSB 3GHEL 4XPFL 2H32A 3JSSA 5AYUL 4W81A 4QHKI 1CI5A 3AB0C 4PY7B 4JRXA 3NIFF 4JHZA 1DTUA 1XMWA 2OJZH 2K1MA 4BSJA 5C0EB 1CLYH 2G75A 1CGVA 1Q9OB 1QNZH 5J06A 4PV8B 3H3KA 5GRVL 3AREC 4LFHD 1NANH 5HGDB 2DQFB 4UIMB 4TUOA 3KXFE 5MERB 4HAFA 1PZ5B 3Q5OA 1MFBH 1NUFA 4FFVD 1H3XA 1P7QD 2VLME 1SM3H 5HI3D 5IW3A 1YC7A 3WXVH 4YDVB 3QCUH 2AJUH 4M1GH 5FHAH 3DTXB 3QXUA 5CWSA 5J7CC 3KPNB 2J6EA 5L6YH 4JCMA 4KGJA 5B8CA 4P9HH 1JGLL 3QI9B 1GGCH 3OJMB 1AXTL 3C5JA 3HAEA 5JQ6L 1IMHC 4M1DH 3HA0A 4Z7NE 1AGBB 1YQ2A 5ALCL 1FG9C 4FFZL 3T4AB 3V4UL 4FP8L 3QNZA 3SDAA 3BJ91 3U30B 3C09B 4YHOH 5SWQA 2B1HH 4O2CA 4NNYA 1IEHA 2EEDA 1NGZB 4JDVB 2LU3A 3H7LA 3O9WC 2DM3A 1V7ML 3UTPE 3MRPB 3VFOA 3U6RB 1HHKA 4UIKH 4N8VB 5EDXA 4QT5A 4OV6F 1CXIA 3HC3H 4OT1H 4ZUSA 1BZQK 4NQCA 5FA4B 2ZWLT 1I7UA 1ZA3B 1WFUA 3QHZH 4OSUL 5BXFA 3WIIL 3ZLQC 1MF2H 2HVKB 4Z7OF 2Y07H 4APQD 4U0RB 4UBDC 1UXSB 2VXTL 4X7FC 2R2HA 3OTTA 2R1YA 2ZUYA 1RURL 3AM8C 4RAUA 1LK3H 1RZGA 2H2SC 3O2VH 3KWWA 5DI8B 4Z0BH 5EA0H 1F02I 1DZBA 1CBVH 1YECL 2R56H 1MY5A 2E27H 4OZHF 1LO2L 3JVGA 5E8DL 4PUBH 1PAMA 4OD2B 2CRZA 3UTQA 2VDKL 2IPKB 3MRFA 2BXYA 2IH1A 3JZ7A 1OARL 4TUJA 5EU5B 4Y5VA 1IT9L 3SGDH 3TEUA 5HDOA 3D3VA 4BQ8A 4G6JH 4NQED 3SKOA 4AZ8A 1KGCD 4PV9A 3VE0A 2EIZB 4XC3L 1KB9K 3QFJA 3PJSA 4HCRH 3R1GH 2AJYL 1AXSA 3DETC 2P24B 2VLRA 1YA5A 2VE6B 2DQHH 2YKLH 3STZB 3GDBA 1VERA 3K2UL 4NO3A 5HDBE 5TGBA 2FYYB 4GAJH 3GNML 3FQUB 1QRNB 5MI0C 5FOBB 2XNAB 3VW3H 5L2KA 3OJDA 5EBLA 1AKJD 4NT6B 2FL5B 3IAPA 2MHAB 3EHBC 1S7VA 2HFEA 2EEBA 2J8UE 5CGYD 3BAEL 5HXMA 4P0DA 5E9DD 5ESVB 5EU3A 1EZVY 4HUVB 4W6XB 4YFEA 3QUMA 4RMVA 5CKAA 3P4NA 2YK1L 3GSQA 2GTZB 4WI4A 4D2NA 1BQHG 1CICC 3LQMA 3CFJB 1AIFB 4EN3B 3MODL 1OW0A 2DTSA 4XMPH 3GMPA 5GJSH 1DBJH 1J8HD 3GI8L 1Y6MR 2QHRH 4WHYG 3S5LG 2NLJA 4QKXB 5E6ZA 3FZUD 1WLHA 3GMOB 2GUOB 4TVPE 1NEUA 2GCYA 5C9KA 2IG2L 5LJYH 3OPZH 1EAPB 1XGTA 2XZCL 3U7YL 4AH2A 1NMCB 3LDBC 2OK0H 1UG9A 3F7VB 1GAFL 3VFNA 5JR1H 1YDPB 2P49B 4IRJD 2JJSA 4WWID 5IB1A 5KSBF 2YD5A 4YE4H 3MGTB 3A67H 4J3WA 3SGJC 2DLTA 1R3LA 5I8KH 1M1SA 5FUOH 3GMRB 4K3EH 3GIZH 4M6AA 4XCYA 3F7YA 4HMCA 4PLKC 4P4KC 4WFFD 1NAKH 3HI5H 4G3YL 5H94B 3OMZA 1ORQB 9CGTA 1EJ6A 4JRWA 3ES6B 5IEKA 3EKCA 4IMLA 1CD1B 2AJVL 4OCYL 3MRLB 1U58B 4DEPB 2Q7YA 4G80A 2Q6WA 3V4VH 4LDOB 1FH5H 5GZOC 5DR5L 4CVWA 3LN4A 4XNXH 4BKLB 4XWOD 3DXAD 4JHBA 3Q1SL 2MTPA 4DOHB 1NDGA 5HYSG 4ZQKA 3NN8A 1GSMA 1IZKA 4LAJH 3ZE1F 1M7DB 3OB0H 2APBA 5CJQH 3FQTA 4ZFFB 3D39D 4LP4A 3WE6A 3VWJA 5FV1L 1S3KH 4LLWB 2O5ZL 3KPOA 3SHSA 3WIFB 2YPVL 2Y7QB 3C2AL 1I9RH 2YPLB 4DCQB 2CGRH 3OSKA 2MCPH 3U1SH 3OKNB 3QIUB 2O61B 3DI2B 2CIIB 1R5VB 2Q86A 4RZCA 1AR1C 4I4WB 4TVPH 3QHFH 1YY8B 3RWCB 2BY1A 2NY4C 2VNCA 1T6WA 1HCVA 2NY6B 4HJ0C 3MLYH 2FGZA 3HZVA 2NW3A 4F8QA 5TH2A 2VO5A 1I1AC 3WMSA 4NUJB 3E8UL 3TA3D 1EDQA 1ND0A 1S7WB 2J3SA 3L5HA 4U7SA 2HWZL 3IJSB 5ESQA 1FO0A 3FO0L 4RISH 3X11B 2NTSP 2ICWI 3O9WA 5F6IC 4NSKB 4PBWD 5HYEA 4K23H 1MCOH 1MFDH 4CADB 5TF0A 1HN1A 4G6FB 4AEHL 4BSWB 4HF5L 1D9KC 2CDGA 3X3FL 1TJHL 3QEQA 4P2OA 4U49A 1MSPA 4LSTH 4PRIA 3RA7H 3JWDH 1TQBB 1OAKH 4J3UA 4HUMB 1JP5A 4YX2L 1HE7A 5FGRA 1C5BL 1WIPA 2Z93B 1T21B 2VISA 1FAKT 1QRNE 3WIHH 3AM8A 1JGUL 2HRPL 1A6VH 4JEGB 4LKXB 2Q8AH 3QQ3A 5GGRY 4K7FB 3TO4D 1FSKC 4OZGB 2VITB 3HG1D 4DKEL 5FM4A 5HVGB 4XP5H 4HS3B 4JG0H 3FQRB 1A47A 4IHOA 3EYFA 2VKWA 3BOVA 3RZCD 5I19H 2Q76A 3E1F1 1ITCA 3QAZB 1DLHB 3QEUA 1J0YA 4DAGL 5AWNL 3N1PC 4JFYA 4QTIL 1E4JA 3B83A 3GSRA 3I85A 5GSRB 4G42B 2ZCKL 1T03L 1KN2L 1WQVT 2CLZA 3VI3F 1W0WB 3ULVF 2FO1A 5F7LB 5J1AB 1ZLVK 5D2LB 3ULUE 3QQ9D 4FQ1L 5I76B 2X4RB 2AJZB 3CMOL 1HCFX 2E6QA 4P2QB 1K8DB 4Z5RA 4IRSD 4J3OC 4FQJL 1XGPA 4X4ZA 1LQSR 4Q6IC 4OKDA 4U6VH 4MA1B 5IB3B 5C0FB 2H8PA 4IDJL 1IQWL 4RGNB 4KRPD 3V0VB 2XN9D 3IB4A 1EFXB 3ROLA 2YA1A 3PWPD 2DYPA 1H9VA 4WW2B 4PJ9B 4PG9B 5ITBH 1A7RL 4N0CC 1JPSL 2I07A 1GRWA 4KI5E 4MB5A 3KJ4C 2OTPA 3OXSB 3LB6C 1CICA 1ZHKB 3ULVD 4JPVH 1DN0B 4NWTH 3PWLA 3VDAA 1CLCA 2XQBL 3TV3H 4I0PD 1BVLA 1MLBB 2QHLA 3BP4B 1EGJH 4JG1H 5I1DB 4NWUL 2Y06H 3ZHKA 3JTSB 3W9DA 3QSKB 4DOHE 1J8KA 1LD9B 4CL7A 3GSUB 3KPQB 1LP9A 5IW1B 2DTMH 3GM8A 4Q6YA 2A1WH 3C5SA 3HNSH 3VFWB 3BD3A 3RVUD 1N6QL 2YPLE 1IGCL 3G6JB 4FTVD 5INDA 4C59B 3GKWH 4XVUD 3O6FB 2FB4L 3TPUB 4UNVA 1T7WA 4PLOB 3HNTL 1ZANL 3OB8A 1ORSB 3BN9D 3MXWL 3FT3A 1MRCH 4NO5A 1Q0XH 5DT1L 3HI6L 3GIVA 5BW7C 4G8FB 1X5JA 4K55A 1SY6A 1CR9L 3ECBB 4D0BA 5IQ7L 1CXLA 4R4FH 1QO3A 2H2PD 1TLKA 5BS0B 1VFUA 3IDXL 1G7HB 3OKLB 5LCVH 2V5YA 3BPNB 3RDTD 3E0GA 4JFPA 1C1EL 4AIXA 4MB3A 5CEZE 2NY3B 5DTFA 1I9IH 2AKRA 4LVOC 1ZHNB 1TVBA 4GW4B 5DJ2A 4EI5B 1N5YL 3CFCL 4JB9L 1SEBB 3D25B 3H3PL 5D72H 4OFPA 5FGBC 5I1AA 5GHWL 2X89A 4ZXBD 1PKQA 3JTTA 5LGJA 4H1LG 1HINL 1W72A 2F53D 2CDEA 4EQ2A 3FFDB 5F21B 1OTSC 2QQNL 1XR8B 2X70A 3P9LB 2WUBL 5T33H 2FX9H 2DQDL 3N50A 3QQ4B 3BQUD 5GISL 4K71B 4DFIA 2FX7L 1P84J 1RHHA 4HS6B 4I8DA 4OTXL 4HFUH 2YPKB 1MCPH 4Q74A 4XX1G 4TN9A 5T1KD 1NEZB 1OAQL 2ICWB 4OZGE 1TTUA 1ES0A 2C3GA 4JFZL 4R7NB 5JXAL 1I1AA 5FO7B 3RJDA 5GGVL 3BP5A 2YD1A 3X14A 4KK9D 1UJ3B 3DX6B 4KMTH 1OP3K 1YEFH 3A6CH 3FFCA 4XH2A 4GQPH 1NFKA 3ARQA 1YYMH 5JTWA 4NIKB 1BZ7B 3DO7B 5FUCE 1I8KA 1TXKA 1T6VN 4N90E 1BBDL 1KTLA 1DR9A 5D2LE 1G9EA 1EA9C 3M45A 4GT7A 4P2QE 1DVFB 4PGZA 1ACYL 3QUKA 1T1WA 3QUYB 4ZOEA 1TIUA 2QQKH 3E6HA 4JY5H 4KVNL 2DWEA 2NXYC 4X5WA 3VD4A 1FVCA 5DRZB 3QA3B 5JDJA 4D8PB 2YBRA 5DJAB 4RGNE 1VPOH 3B6SB 1F8TH 3N1MC 4L29A 4G8GA 3PL6D 3S88H 5D1XC 4CKVX 2LQRA 1HHGA 2ED9A 2HTLD 1QR4A 1QHPA 4M7ZC 1GGBL 5DDHB 3JBG7 5E5RB 5IIEB 3EYVB 1G6RA 1IGIL 4LIQL 5FGSA 3CVHB 1OSZA 3QCTL 4Q9RH 3MV9D 2DMBA 2HKHH 3U9PL 3MLWH 4EIGB 4YUEH 4JKLA 1MJ7L 1VFBB 4OLVL 3RWDA 3I50H 5D1QC 1A6AA 3R06A 3B2VH 1AE6H 4YWGH 3O0RH 4LSRL 2A6KA 1QEWA 2O5XL 3IDJA 3WSQL 2GJ6E 4OFYD 4MA8H 5GGUA 4F7EA 1FLRL 3OAZK 2DLIA 4J7RA 4GRMB 3DROB 3G6JE 1F42A 3IGAB 4S0TD 2NXZC 4Q6IA 1E4XI 2XZQH 3O3EA 4WI2A 3OKYA 4NNPL 1HSBA 2B1AL 2Y25A 4XXCC 4PJHF 5ITFB 1KB5B 2KPNA 2ESVD 4KJQD 4L4TD 1M6OA 1LO3L 5J13C 5E24E 3QXDA 2Z4QA 4YHZH 2WIIB 3O3UN 3ARBD 1GXEA 5JIPA 5CEXA 4JDTH 1FDLL 3P11L 5TE7H 3SEPA 5BS0E 5HI5D 4NYLA 5GS0H 1AP2A 4XBPB 2CKBA 1LO0L 4CDHA 1A7BA 4B0MM 5ADPH 2OX5A 1N8ZB 1AGDB 2BC4A 2P7TA 4R2GB 3VA2C 4YBLC 1X4XA 2Z8WC 3MBEB 5SWSB 1J05B 1UYWH 1N2RB 1II4E 3F7PC 2AJSH 3FO1B 4NBYB 1YEJL 3ZE2E 1OPGH 3QH3B 3RVXD 3CVIH 1IGMH 3K46A 3OG6B 5GRVK 4UDTA 3VXUA 3GO1L 1MCIA 4JJHA 4F7PB 3J8F7 3DI3B 1IJ9A 2LVEA 4GKZB 1MCQA 5DQJA 4AL8L 4KZDL 2FJGB 4XZUA 1UVQB 4PG2A 4XBEH 4LNVA 2P5WB 3DVIA 2Y36L 3UROR 3BD5A 1WZMA 4KDVA 5E94B 2AJXL 5GJTH 4IBLT 4RQQA 2JELL 3U0PA 1QBBA 5FYKE 3R0NA 2CLVB 4K8RH 3PDOB 3VXTA 1I1YB 1MCFA 3DX8A 1GYAA 2BERA 3TYGL 3F58H 4S1QH 5DVOA 1WZ1H 3QIBB 1F6FB 1CK0L 5D93B 4XWGL 1MUJB 1MHHB 1FVEB 4AQOA 3I6GB 4JREC 4LF3B 1F4XH 1KPVB 1NAMA 4RSVA 4NPYA 2HFGL 1ZE3C 4JPKL 2APXA 3CFKB 3TO2B 4JO3H 4OZIA 1CFSA 2HJFB 5E0QA 2VJXA 2F54A 3UZQA 3NCEB 4J3VA 3UJIH 1GHFL 2WBKA 3O41B 3QNXB 4KPHH 4F3FA 2YSSA 1TJIH 4QHNB 1MJ8L 4LSVH 5KOMC 4HX1A 5IFHH 4DZ8A 4GRLD 5SX5H 5L0QB 4KRNA 1U8PA 1G0XA 3VDBA 5LGHH 1EX0A 1B0GB 5IF0A 1QBLH 5C0BD 1OGAD 4QRPB 1QSEA 5FKPB 2OMBA 2IH3A 1OP5K 3G08B 1FE8L 1WBXA 1N64H 1FVDA 4LGSB 5I1CH 3RRQA 2R1XA 1R24B 4ODVL 4PJEF 2X4TA 3MRRB 1ZT7A 1JHKL 5C8JB 2OYPA 1IKNC 5GS2D 5ACLA 4D0DA 3IS0X 3WUZA 5BMFL 2AS5M 2EYSA 5F72S 2NW2B 2VUYA 4L9LC 3FB5B 1KCKA 1TZHA 4BH8A 3K2MC 3L3KA 4XHJD 2DQEH 1XCQA 2XWJA 4JJ5A 1ZLVH 3NCJL 5J11C 1AFVH 4YGVA 1L7TL 5DD0L 3ARWA 1U8JB 3NVQA 3IAQA 3W9EB 3ARPA 4D3CL 1CDHA 2DI9A 4Y16D 2ZOLB 1A3LL 5EIQA 5C2UB 4ELKA 3T0XA 1A14L 3HUJF 3EOTH 4Z7VA 3BH8A 3EYUH 1QFUH 3T3ME 2ZSVB 1XGYH 4WFGD 5KZCD 4G8EB 5IVXF 3MRHB 2ZOKB 3LSOB 1F4WH 5D1QA 5EORL 5FO8A 4EI6B 3CDGB 1CE6A 2PETA 2FWOA 5SWSE 2R15A 5HHOB 3IVKB 3ARGB 3C5ZB 4PLJC 4DJMA 2OI9B 3Q3GB 5CHNA 2OXHA 4ODBD 3CVHH 3W0WD 3BO8A 3QWOA 5B4MC 3ALWA 4MZ2A 5H37H 2MPAL 1U3JA 3V8CA 3AS3A 5EBWB 3UTOA 4ZS6D 5D1ZD 1NGYA 1FJ1A 1G9ML 3DVGB 5FYJE 5JXEC 4YBQC 3MUHL 4GRWF 1IZJA 1BFOA 2P5WE 5DA0B 5MENA 4QRTB 3UJTL 1EXUA 4JY6B 3PUCA 3VFMA 4YAQA 5ENWA 4ODHL 5CILH 4Z76B 5I74B 1F3DJ 5CD5D 5DXWA 3I6LD 5CSZB 4GMSL 4MJ6B 2AEWA 3SKJL 1HI6A 1HIMH 1KB5H 2BDNH 3N1FC 2EDQA 4PP1D 5SV3A 5LKNA 5DD3H 5E8OB 5E00B 1Y6KR 1XGUB 5GRUH 3RKDC 1XGQA 2AEQL 5C6WH 4R96A 1IGYA 3VH8G 3GRWH 4JKWA 3GI9H 4LMQI 5AUMA 3MRNA 5MEOA 3I75A 4AJ0A 3FMGH 3MRBB 4HC1L 4YIQB 3DO3A 1R3KA 2NY7H 1CDJA 3LH2H 1U8MB 4RAHA 3B9VA 2E9JA 2CIKA 5F9OL 5BVJA 1T7VA 3PP4H 1FGNH 3LKPA 5FF6B 3BPLC 1K9TA 5J6HA 1JL8A 4P2CG 4XCFL 2VLKD 2DWDA 4V1DD 1Z9MA 4UOW1 5C0AD 1S9VA 5C6TL 3DX7A 2LTQC 4BFGA 4E41D 1RIHH 3I3DA 3O6LL 3IFLL 4Y4FB 3FTGA 3O2WL 3QYCA 5ETUA 5GS0C 1BM3L 4QRPE 2BNUB 1MI5A 1GC1H 1U91B 1Q0YL 3RI5K 2J2ZA 4U7MA 1U3HC 2GITA 4HHAA 3G5VB 3HI1A 2NR6C 4M6OL 3KYKL 5EC2A 3C6LB 5IK3A 4I18B 1OP3H 4XP9H 3WFEL 3CX5K 4QXGH 5LXGL 3HZKA 4R3SA 3EDDA 4EUPA 1PVHA 5IVZB 1T20B 5F7MC 3ARDD 2YZ1A 1WC7A 1KCRL 4JAMB 5IGXH 1S5IL 3NPSB 3WNLA 4PJ5B 5D4QA 2RFXB 4WV1C 2I27N 1ZGLA 1CGXA 3WUWB 1D5BA 1EEYA 3U9UB 3PXHA 1YEIL 2A6IB 1I1FB 3T04D 3KPRD 4UMGA 5LWYH 4LASL 3GSVB 3IFNL 4K8RC 4ORGA 1Y18B 4P5KA 1I7ZB 3UEZA 1A1MA 2X9YA 3BYYA 2VDRH 3RAJH 3L3IB 1WV7T 4QRUA 3BKJH 2OQJA 4ALAL 3LIZL 2Z31C 2R8SL 5I18H 1T83C 1NCDL 4X4YB 5DQDH 2D7TH 3QEHA 4NHCH 4FZ8L 1A6WL 1ZTXH 2IFFL 3L7FA 3MLVL 4L9LA 5E5MB 3BH9A 5HHOE 1Z9SA 1P7QB 2ADFL 2DAVA 1F97A 1AGFB 4JFED 4KV5F 1NGQL 4JRXD 3O3BB 5ACZA 3QB7C 2X4QA 1VENA 4O2FB 3TZVC 1S7QA 3M1BB 1J1OL 3M07A 3MOBL 4UNUA 2HVJB 3C9NA 2Q20A 5GGRA 2YC1A 3UTTD 1FZMA 2PR4H 2D2OA 5CBAB 3T77A 3F12B 2DMCA 3Q2CA 3PV6B 2VXUH 1T66D 5ID1B 1DQJB 1WBZB 2VN7A 2BVPA 1U8LB 2VZ1A 4PTUA 4LLYA 4R26H 4XAKE 1OAUH 4XP6H 4NCC1 4Z77A 3RVVC 1R5IA 3LQAL 5FHBL 4WI7A 43C9A 2P48B 4L3AA 3EYQC 4FXKA 3CDYA 4PRHD 2X05A 1JYNA 3CDCA 3VXMA 1ZVYA 2AJ3B 1S7TB 3BKYL 4APQB 2YEZA 5HGAA 2FZ3A 4NDMA 4R8WL 2YD6A 4MLIA 4ENED 4XPFH 3PGFH 1UA6L 5AYUH 1SMOA 4OKVA 1C5CL 2ITCA 4MD5A 3ESVF 4PJBA 1QSVA 1ZK9A 2ICEA 3ZYIA 3WO4B 2EEAA 3LRGA 5GGSY 5ICZB 2G5RA 5JXEA 2NY0C 5IB4A 4HKBB 3IJYA 2NNAB 4H8WL 4LCWA 4F15B 3O45A 2NY2D 3QCVL 4OCXL 3O8XC 1U2HA 2HT2D 5FXCH 2BVOA 3P0VL 5HYQA 3D18A 5A3ID 3KPPB 2YN5A 4NQEB 4LP5A 1PBYA 1K2DA 1T7ZA 1JWSA 1AGEB 3TT1L 5DJ0A 1JGLH 3R8QA 1AXTH 5H35B 5JQ6H 1QSFA 2EDOA 2BVQB 3B3IA 3VG0L 5ALCH 3BGFC 4I77L 1S7RB 2H9GA 3BDXA 3PABB 3QG6B 2FJHA 2FGWL 1FQ9C 3D3VD 2C3VB 3EJJX 1V7MH 2FR4B 4XNQA 2ZG1A 4PJ5E 2AVGA 4JR9L 4A6YA 4KTDH 1H3GA 5E9DB 1J11A 2W0FB 2EYTA 3H7BA 4YO0B 5EFIA 2FLRT 4U1GC 3WIIH 5GRJL 2ADIB 2EYRA 3MRDB 3AAZA 1HHHA 5DJZA 1QLFA 4RGMC 4UUJB 2VXTH 3UP1A 2I5YL 3GBML 1GGTA 1J8HB 3KLHC 1RURH 4QYOB 1MCJA 5FYLD 3BEWA 1U3HA 2FATL 3FQNB 1EEZB 1XR9B 5DHYA 3BPOB 1OP5H 1I3VA 5KG9B 3OZ9L 4QTHB 5E8DH 4PP2A 2JJVA 4ODTH 3DGGA 2VDKH 3KYMA 4Q2ZB 4IIQC 4IRJB 1MCWM 3WNOA 2XG4A 1OARH 4HFWB 3U83A 1I1CA 1ZEAL 2CO7B 1QBAA 5EZLA 1IT9H 1P1ZA 2D31A 3RX7A 4KKNA 1KJ3L 1MELA 4X80L 4AT6A 5IBUG 1AGCB 4XPAL 1K4DB 2AXGB 2AJYH 3LKOA 3ARSA 3RKPA 4RFOL 2W60A 3NIFE 1FGVL 3K2UH 1PLGL 4X5LA 1OD7A 4TQEL 3GSXA 1UXWB 3GNMH 2J6EL 2DIBA 1GC1C 1FHGA 4S11A 1NMAH 5DJ8B 4KAQL 3DXAB 1Y0LA 1KENL 2WINB 4OV5B 5KSBB 5TPWL 5I2IA 4L3EA 1CFTB 1MPAH 1T83A 2JJTA 3VGHA 5EZOL 3BAEH 4U6HA 4PJGA 2PYFB 3D39B 4YR6A 1IEBA 1INDH 3G6AA 4YPGB 1Q94A 1JNLH 2YK1H 2GQHA 3NTCL 3IXAA 5MEQA 4FA8A 1KB9J 5FDWB 5E2VL 3SKNA 5SX4I 4DW2L 3GMLB 3FN0L 2IQAA 2BZDA 4KY1L 3MODH 3FOLB 5DRXB 4AEEA 4OLXL 5HJ3A 3TBSA 3GI8H 4H20L 3TZVA 3IDUA 1EVTC 2WZPD 1FC2D 3S37L 3VWKB 1QQDB 3ARED 3TWCL 4PGBB 1A2YA 5D2NB 2V17L 1XCTA 3VJ6B 2IG2H 5IMLB 5EN2B 2P8LA 3P73A 3U7YH 2D7NA 1HQRB 1GAFH 3TA3B 3L9RA 4IS6A 3BWAA 1F11A 3C8KB 2BP3A 3IDGB 4XXDA 4ONHA 4Z7OE 3T0EA 4P57A 1J18A 2PW2A 4NQEE 1NQBA 1KGCE 4NZDA 4LMQE 4G3YH 2NX5A 1S9YB 3IJHA 4KK8C 4F2MA 2F5BL 5B38B 1UQSA 5F1NA 2AJVH 5EO9A 1X9QA 4OCYH 5JIKA 1WTLA 4P4RA 3MLTB 3V6OC 1RIUL 4OZHE 3O9WD 4IJ3C 2ZUVA 5DR5H 3RWEB 2BVTA 1R5WA 5HYFA 1JF1B 3Q1SH 2Z92B 2GJZA 3TO4B 3AU1A 1RZKC 1T1XA 3B9KA 1TNNA 3HG1B 1BGXL 1MH5A 3QEQD 1VA9A 4JO1L 4PRID 5E9DE 3ZKXB 4UBDD 3DIFA 2O5ZH 2VLLA 3DUUB 4GSDL 1NC4A 1A7OL 1AC6A 3RZCB 3IU4L 5I16B 2XQYG 1E27A 2XACC 5T3XL 1N3NA 5CP3H 1U8OA 1BOGA 2H2SD 5BZWA 3MRMB 5EG6C 3DMMA 2BNRD 5I8CB 4GXVL 1J8HE 2HLAA 3QUML 1DCLA 4TULL 1CG9B 3GMMA 2HJLB 1ZT4A 3EOBA 4MMZC 4LPUA 4YZFF 3S34L 1WIUA 2X09A 3UPRA 5DEZA 3QUXC 3VD9A 3KYNA 4PJCA 3HMXA 4N9OB 4LLDA 3WD5L 2EKSB 2VYRE 3EDEA 2L0DA 4E42A 2HWZH 5DJYA 3FO0H 1M4KA 5ERWA 2R23A 1A02N 4KRPB 2W1NA 3KS0H 2XN9B 2EDEA 3BUTA 2E6PA 3PWPB 3DETD 4HF5H 4WFFE 4AEIL 2BCKB 3X3FH 4LPCA 1TJHH 1VEOA 1TITA 3QPXL 2HRLA 4W4OC 3W82A 3LQZA 4YX2H 3C60D 3PHOA 1C5BH 5IB2B 1LP9F 4I0PB 2GI7A 2P43B 4KVCH 1JGUH 4I5BB 2HRPH 3EHBD 1IE5A 4XTRC 4M03A 4UV7H 4NQDA 1HQ4B 3DXAE 2DYPD 1WTGT 4MQ7B 2M8XA 3VG9B 4XCEB 4PD4J 2N1KA 5KSBE 4DKEH 3ZKQD 4MJ5B 1MVFA 2DQJL 1M7XA 3D39E 5TDNA 4LOUC 2BFVL 5FEBA 2WM0A 6FABL 1CICD 5HPMA 4LNRA 4J12A 4FTVB 3IDMA 2EH7L 2OTUA 1BJMA 1IM9D 4EOWH 4WJ5A 2ATPB 4QNPF 4DAGH 1DQLL 1WCBB 1LDSA 3DURB 5AWNH 4MD0B 5GS1A 1VGKB 4R4BB 5INCB 3CZJA 4QTIH 4ZYKB 4H5SA 1NBYA 2HMIC 1AD9B 2OR9L 2ZCKH 3WLBB 1KN2H 4M6ML 4G6AC 1T03H 3D87B 1NFDA 1AD0A 3P0YL 5D2NE 4HWZA 5BO1L 2QQLL 3TBWB 4NHUA 4FQ1H 3CMOH 3ZE1E 4EVNB 4F7MA 3GMNB 2CR6A 3RDTB 1INEL 4TPRH 4FQJH 4CVZB 2YR3A 4PJ8D 1RK0A 4IDJH 4PLKD 2V2XB 3MRKB 4P4KD 1IQWH 2Z8SA 1B4RA 4I0KA 2EC9T 2CO6B 1R6VA 3U4EB 2ZG3A 1G7QA 3BZEA 2NYYC 1R3JB 1A7RH 1KT2B 4JHWL 1JPSH 5FB8A 4GQ9L 3IDNB 3NABH 4ZXBB 4LCCB 4G9DB 4PRNA 2BOBB 1FO0L 2F53B 5GZOD 4LLQB 1CU4L 5JORB 1GH7A 3REWB 4QOKA 2QJDA 2XQBH 3BQUB 4ZSOA 2DKMA 1DQMH 1OAYH 2F19L 2IADA 4XCCH 3MUGB 5D6DC 5F9WC 3V5HA 4WW1A 3ZHLA 1JF5A 5CZVL 5J12B 5JW4N 4Q9BA 4LCUA 4ZUVB 3RVTC 1D6VH 5T1KB 2AV7A 2X89D 3HG1E 1WFNA 4ISVB 3U2SB 3WS6A 3WFHB 4S1SL 4GBXC 3B8YA 4ZPVA 1N6QH 2OR8A 1MCWW 1IGCH 2AK1L 3WN5B 1HXMB 3W2DL 1AR1D 2FB4H 1U9KA 1ZWIA 5L8LB 4CMMB 2NY4D 1CIUA 1ZANH 3PF2A 3EYSH 1TZIA 2LFGA 4HJ0D 3HE7D 3MXWH 5ABDE 3HI6H 1CR9H 4UT9L 5IQ7H 1I1AD 1MJUH 3HZMB 1KC5L 4QRRD 3S3SA 4G9FD 1KIPB 1WITA 3IDXH 2ZZUT 1T1YA 3V6OA 1HDMA 1C1EH 4X6DA 3TBVB 3ARFC 4UOW0 1ACZA 1KLUA 1QPXA 3AFLA 3FFCD 3M17B 1MQ8A 4X4XA 5FA3B 2YUWA 3CPLB 5GRYA 1D9KD 3BN3B 5ICYB 2XN9E 3QP3A 4LLVB 5FECA 3PL6B 4KUZH 5JDSB 1N5YH 1MCLA 3PWPE 3CFCH 4JB9H 3UX9B 3H3PH 3ORJA 1KOAA 5C09A 3IRPX 3HLAA 3QFDB 1FFOA 1HINH 2HKFL 3GHBH 4CW1B 2QQNH 1CIDA 2WUBH 2DQDH 4OZ4B 1FG2A 3VI3E 2Y6SC 3H0TB 5GISH 3T4YB 3ULVE 3VFSA 3MV9B 4OTXH 5EUKB 1YN7A 8FABA 4LIQE 3JWNC 5K9JL 1UH2A 3GSOB 4G8GD 4X6EA 1RSFA 3RVWC 1OAQH 2VQTA 1HNGA 1WVZA 5JXAH 4U1LA 3LKQA 5J56B 4WFED 5EO0A 4KHTL 5GGVH 5TQ2L 2NQCA 3LKRB 5T3ZL 4YXLL 3OR6A 3WHE1 1YZZA 1G84A 4FTVE 1UC6A 1T3FB 2GTWA 4HUUB 4NZRH 4CBPA 3IT8D 3DBXB 4WNQA 4KQ4L 2ESVB 4N1CA 4L4TB 3WDIA 4LVNB 3ZDYF 1CE1L 5D6CA 5DHVB 2D0HA 2C3XA 4F7TB 3ARBB 4BQ6A 4DZBA 4CMHB 4YHNA 3BEVA 3BP6A 4X9BA 2JJUA 1IC5L 1ACYH 2DQTH 3NFNA 3MRIB 3MRCA 2YUZA 3FAXA 1A21A 3BKML 1SY6L 3CUPB 3IRZA 5FK9B 2C1PA 1JTOA 3U36B 5GSVB 5KVEH 4YQXH 1BP3B 2KKQA 5D7LA 2R0LL 4PJHB 4Y8AA 3LB6D 3H9YA 1RUPL 1GGBH 1KTDA 3O11B 3ET9F 3V5KB 1Z2KA 2A6JA 3FKUS 4P2RA 2F53E 1DE4A 1BQHB 1F4YL 3VRLE 1ULVA 4LIQH 2ZKHL 2E5EA 5FKAA 1MRDH 3QCTH 4NQXB 3KNBA 4CU8A 4Y5YB 1ZA6B 5EU6A 3EO0B 3O3AB 1MJ7H 4RAVA 4MXWH 5F71A 4OLVH 1ED3A 5FV2A 3VGGA 1T7YA 3S5LB 1T2XA 2WBJC 4MXQC 4L8SA 4NZTH 4X6CA 3U48A 1W72L 3V52H 4LSRH 3TBTA 3SDDC 2O5XH 3WSQH 5T1LA 2CDFA 5J6GB 4M7LT 1C16A 3IXTB 2CPCA 2ARJA 1FLRH 2XFXA 4M7JL 4TNWK 4QGTA 5ANMA 2OLDA 1KIQB 4JKMA 1V3JA 5IP4A 5HVHC 1REIA 4FG6C 1PW3A 4NNPH 2B1AH 1TNMA 5GIRB 1GJIA 2BRQA 4GG6F 1EERB 4TSBH 5IJKC 5JHLL 4FQXC 1LO3H 1JK8B 4NNXA 5EO1A 3M8OL 5E6YA 5J9PA 3V79C 3U0WH 5TE4L 3UPCA 2JJWA 4M48L 3EO9L 1FDLH 1H15B 1I8MB 1T04B 2P1YA 2X4NA 1ETZA 3GJFB 5IHBA 1VADA 5E2JA 2EZ0C 1LO0H 3I3EA 4M4PA 1PX3A 2R0ZL 5D6DA 3RWJB 4FQHA 1MHEB 1RUML 1H3UA 3ZKNC 3ZDXF 1FNAA 3L6FB 5HYSB 4E5XB 4GRLB 3VMPA 1UB6B 2COQA 1A4JB 3GBLA 3PHQA 1OTSD 3CH8A 4GBXA 3B2UC 5C0BB 1OGAB 2VIRB 4TSAL 1YEJH 1QPPA 1H5BA 5LVEA 4O9HL 4U6XB 3MXVL 4UT6L 2VABB 4YHIB 3AS0A 1FL5B 3LD8B 4YH6A 3WNNA 4OZFA 3MV9E 4HUKB 4AL8H 4XB7A 4PBVC 4L8BB 4KZDH 1T5XB 3FT4B 4XP1L 5F7WC 2ICCA 3DVFA 4R90L 2VAAB 3T0WA 2Y36H 4N0FB 1UB5B 5HHQB 4X7TA 1XF5A 5HHXL 1P4LB 4G43A 2AJXH 3N9GL 1G6RL 1QSED 5ACMA 2JELH 4CJ1A 4DGVL 1WBYB 4O00A 3KPSD 3BYTA 2CK0L 3QIWC 1FV1B 3TYGH 1LE9A 3ARFA 3L95B 3C8HA 1CK0H 3UYOD 2VDOL 3JV6A 4XWGH 3HC4H 1B6DA 1LO5A 5GGSA 1A9BA 2ESVE 4Z7VF 4L4TE 2H3NB 4Y16B 3FB8B 2EDHA 3TCLA 5KSAC 1R3HB 1FFNA 2HFGH 1HHIA 4JPKH 4PJEB 1BECA 1IQDA 4HK3J 1I75A 1C5DB 4KMQA 1M7IB 4MNGB 3CZFB 3GSNB 4MJ2A 3MGAA 2NXYD 4LLUA 4AG4L 3BZDA 2V9RA 1FL3A 5KZCB 3V7MA 1HOCB 1Q9WB 1MCEA 1BX2A 4WO4C 4H25A 3EO1A 2H26B 2LV4A 1MJ8H 5D1XD 4B7IA 1V8HA 4D0CB 3MFFB 1Z5LA 3STLB 4PJFF 4GG8A 1VFAB 1I3RA 4CNIA 2R4SL 1WK0A 3E6FA 2ERJC 4PJHE 2CKBL 3GZKA 4WU7A 3MNWB 1WWCA 3S4SA 2ZUUA 4C56D 3W0WB 1AHWA 3P4OB 3MNVB 1QFOA 5F89B 3RFZC 3ULUC 4BELD 1X44A 4YXKH 3HUJB 5D1ZB 4ODVH 1FNEB 5JA8B 5JO5B 1JHKH 3IDYC 3IU3A 3TVMA 4MS8C 1YEEL 2HH0L 5IVXB 4NC1E 5BMFH 4JFDA 4AYFA 1QG3A 2J8UA 4J4PC 4AENB 3P30L 2ICES 2X7LA 3K3QA 4YDIL 4Y7MA 4AM0A 2NXZD 3I3BA 1F58L 4BSVB 4PJDA 4LVHC 4GW5A 5C0RL 1ZLUH 4CJ0A 3JV5A 4JQXA 1SYSA 3NCJH 3PDDA 1L7TH 5DD0H 5F7YC 2Q1EA 4D3CH 3PWUB 5C0CD 2WBWB 1NCNA 2XXCB 1CDUA 4S2SB 1A3LH 1KG0A 3U46B 3VRIB 3H8NA 5C0EA 1A14H 1CDIA 1DSFL 4MCZB 4GRWB 1K6QL 4D9RD 5EOTB 4PV8A 5FAAA 5DQ9B 4P5TC 4B53A 1U95B 5HGDA 2DQFA 4UIMA 1JVKA 3ZYJA 1IEAB 1NAML 3LZFL 5IVOA 1YMHA 4OF5A 1HH9A 1JPFB 4FQQB 2WBJA 5IFJA 5EORH 2VLKB 1PYWB 4YDVA 2IPUK 1IL1B 4V1DB 5C0AB 3DTXA 1AR2A 2E7BA 4ZD3L 2YUVA 3BE1H 4E41B 1MHCB 1DLFL 5EIIB 2IC2A 5C0BE 1OGAE 1WUNT 3ZTNL 4U6YB 1SEQL 3SKMA 3DUHA 3MLRL 2MPAH 3O4OB 3OKOB 1AGBA 1ZLSL 4F80A 2QSQA 4L4VA 4X6FB 3T4AA 3VI4F 3CMGA 4BQBA 1UKSA 5IJKA 3NIDF 4FQXA 1G9MH 2A6DA 1JRHL 3VGAC 2MJWA 5JHDA 1WT5C 4QEGA 4JDVA 1JNHA 3QUZD 3QNYB 4M93B 5HYJA 1EH9A 3MRPA 1KLGB 2J5LC 4ODHH 4N8VA 3F7QA 3ARDB 1FYHB 5C70A 1U0QA 5FA4A 2V2TB 4GMSH 4LCYA 4Z0XA 1NUDA 3D0VB 3SKJH 5LQBL 1PFCA 4HIXL 4PLNC 1UXSA 1A6TB 5ILTH 2BMKB 2AEQH 5GS3A 2GSGB 5DI8A 3TNMB 2WLZA 3KPRB 4ONGL 4PJEE 4H1LB 4X8JA 4Q0XL 5ICXA 1U8QB 4MNGE 1CWVA 1CZ8L 1VEPA 5BRZD 2R0KL 2DD8L 5F9OH 1NC2A 4WFGE 1U92A 2IPKA 2XKNA 5F88A 4JM2B 3QAZC 4M9PA 5HY9A 1YYLH 3LRHA 2XA3A 4HV8B 3MROB 3OXRB 1B4JH 2YWZA 4K7PL 3P77B 5E8EA 2Q3ZA 3U4BL 2H32B 5C6TH 2X41A 2ADJA 3O6LH 5EPMB 3IFLH 5F9AC 2BJML 3QIWA 4JFEB 4B5EA 1BM3H 1LEIB 4JRXB 2DMKA 3SDXA 2P24A 3W0WE 4L4JA 2VE6A 2DICA 4ZAKC 1QVOA 3FHQA 4FFYL 3STZA 4Z7UA 2DN7A 5I66B 4BUHA 3JV4A 3QZWA 3I6KB 4X4ME 1SJVA 2FYYA 5CJOL 3HUJE 5GS2H 3FQUA 3UTTB 3NZ8B 5FOBA 4Y5XC 2XNAA 1MJJB 1A0QL 4TUOB 3FRPG 5KSAA 2YRZA 4PJIA 4NT6A 5IVXE 2FL5A 2MHAA 3WFEH 5LXGH 2E6JA 3ZT7A 1SHMA 1DP0A 1V3MA 4LPXA 5ESVA 5AG9A 4HUVA 1OVZA 1KCRH 1YJDL 3I6LE 1S5IH 4MVBC 5EU7C 4WO4A 2GTZA 2GW5A 4P99A 4PYGA 5B8CB 1HYSC 4PRHB 4HKZB 3C5JB 1E0OB 5E6IC 3VFGL 3LEXA 5SWZD 3CFJA 4EN3A 3C6SB 1OLLA 5I73C 4PJBF 2GKIA 5CUSL 1YEIH 3TFKC 1CFVL 3DJ9A 1JWMA 4O2CB 4NNYB 4LASH 3GMOA 2N4IA 2GUOA 5HHPB 2BHUA 4JFHD 4GRWE 3FT2B 1EUTA 1EAPA 4LHJB 2EH8H 4XNZC 1I7RB 2CMRH 1WWBX 4ZUSB 4ALAH 4OD3H 1YDPA 2R8SH 1I7UB 3VXMD 1PKOA 1EO7A 1U42A 1OCWL 4U1SB 1NCDH 3MGTA 5CIPH 5JA9A 3NA4A 4PLJD 1MAMH 5C07D 2VLKE 4FZ8H 3GMRA 1A6WH 2B2XL 2IFFH 4V1DE 3MLVH 5C0AE 1IILE 2NY2B 4E41E 1EHLL 2IWGA 3IDIB 3BMVA 4UQ2A 1NGQH 3KWWB 5F6HJ 1QFWL 5EWIL 1CD1A 1J1OH 3MOBH 1F6AB 3MRLA 5L88L 5JXED 1SQ2N 4YBQD 1BOYA 5E99L 1HZHL 4L8DB 4YHLL 1E4WH 4I3GA 4BKLA 2C4FT 1AJ7L 1YC8A 5FYKU 1ONQB 1M7DA 4EDXA 4EI5C 4ZFFA 4Y5VB 4CVUA 4P5TA 5CZXC 5DSCB 3D3VB 1FIGH 5FHBH 5DK0B 3WIFA 4PV9B 1CL7L 2Y7QA 2YPLA 4MAUL 4DCQA 2A83A 5IQ9A 3MJ7B 4M6NH 1XT5A 3RKDD 3OKNA 3QIUA 2O61A 2UYLA 1GL4B 2CIIA 1R5VA 4YC2C 5AAMA 4I4WA 1SBBA 4NO3B 1PQZB 4GMTL 4DK6A 3BKYH 3VGDA 1YQVL 4GRWH 4R8WH 1N0XL 3MLPA 5CSGA 3OGOE 1UA6H 1F3RB 4FNLL 3KPRE 3MRJB 3OJDB 5EBLB 1C5CH 2VWEC 4ODWB 4XPTL 2Y9RT 5SV4A 5IW6A 3OR7B 2HFEB 1KV3A 4NUJA 1J1XL 2BY3A 2YZ8A 1P9MC 1S7WA 5EOQH 1WT5A 3IJSA 3P4NB 2B5IC 4C4KO 5JW3L 1DQTA 5F1OB 3WFCL 2QL1A 3S7GA 5BV7L 5ID0B 4XX1E 4H8WH 4CADA 5GS0D 5GRZA 4MXVF 4BSWA 1KPUA 4OCXH 2D3VA 1MAKA 3P0VH 1IAMA 3I84A 4JFEE 5DS8B 2BVYA 4JRXE 4YHML 5T5FL 3B9AA 1U3HD 4Z7QF 2W07A 5LG1A 1IAOB 2D0GA 1K4CB 3X13B 2GCYB 2NR6D 3TT1H 1W2KT 3VXNB 2Z93A 1T21A 1XGTB 3T09A 3UTTE 5TQ0L 4U1NB 3V7AG 3SDCC 1SVCP 4LKXA 3VG0H 4K7FA 1EZVX 4I77H 5CJ8A 1A4KB 4OZGA 2VITA 4PJGF 2VDLL 3MYZA 4N5EC 4WUUD 5KVDL 3EYOB 5CFHA 2FGWH 3FQRA 5IMKA 3F7YB 3TESA 1FPTL 2RB8A 1G0DA 3OJVC 2RGSA 4JR9H 1DLHA 1DBKL 1G9MC 4KV5E 4PRHE 4OIBA 5IEKB 2FHFA 2PN5A 4NRZA 3VXOB 5JW4Q 4H1LH 3LN9A 2Q6WB 4K8RD 5CBEB 1O5DT 1JGVH 3AB0B 4HW6A 4G42A 4HIJA 3PG2A 1KUMA 4HGMA 1W0WA 2I5YH 3GBMH 3V9FA 4ZAKA 4M00A 3NN8B 1MWAB 2BY2A 5J1AA 2Z8RA 2V2WB 1V3KA 2Z31D 4L3ED 5D2LA 5I1JH 3MLXL 5I76A 2X4RA 2AJZA 3GM0A 4FMFA 3WE6B 3AREB 5I15L 2FATH 3OJ2C 4Y5XA 2X4OA 3QO1B 2RR3A 3QISA 2XZAL 2QLVB 3OZ9H 2DQIL 2H32H 3FO2A 5C0FA 3BZFB 5GGQH 4KMLB 3SGEH 3BIKA 4G6MH 1VGEL 2C7UA 3QRGL 4I2XA 5DJXB 1ZS8A 4HIHA 4OZFG 3BW9A 2MMXA 1QLRB 4PG9A 4PJ9A 4WW2A 5DURD 3TZVD 1ZEAH 2B0SL 3MA9L 4Y4HC 1FNSH 3TH2T 1LO4L 1KJ3H 3OXSA 4X80H 4J3SA 4M5ZL 4TTGA 1P7HL 1NH6A 1ZHKA 5FYJU 3LHPL 3DYPA 5KANI 1DN0A 4LARH 4XPAH 5D5MF 1MLBA 3BP4A 4J23A 4RFOH 4AMKL 5I1DA 1FGVH 3FONB 1ND0B 1PLGH 3A6OA 3K7UA 4TQEH 3JTSA 3OHXB 1FCCA 5ECJE 5ESQB 1JGDA 3QDGA 3RVVD 2BRRL 2J6EH 3KPQA 2G5BA 2AV1B 3O9WB 4KAQH 4RNRB 5I6XC 3TH3T 2WNGA 2AXJA 3D3VE 1KENH 4KXZH 1OWWA 1OAZL 3HAEH 2EIBA 5HVFB 5TPWH 1JYVA 4HZLA 3RY5A 3G6JA 1FN4A 3LY6A 5EZOH 5JW5B 1Z3GL 3QEQB 3O6FA 3X3GL 4OLYL 4PRIB 1BAFL 3GJEA 3NTCH 1PG7L 3MJ9A 2D7OA 3O4LD 5E2VH 5JIHA 1A5FL 3DV4B 2R1WB 4DW2H 3FN0H 1NANI 2BSRB 1GOGA 3ECBA 2K3TA 4F37K 4GAGL 4OLXH 3G9AB 4NRYB 4A6YL 2BNRB 5BS0A 3LKSB 1G7HA 3S37H 5FFLA 1KJ2B 3OKLA 2YD7A 5FYLE 3HE6C 2NY0D 3TWCH 3ZE0E 5F7HA 2V17H 3D0LA 3FCTB 1DBBL 3S4SG 3IFPB 1TVHB 3RQ3A 2VZ3A 3O8XD 4Z8FL 3T08A 2X4SB 3MCKA 2WANA 1ZHNA 4EI5A 4GW4A 3O6ML 3OKMA 4KZEL 4M61B 2F58L 3D25A 4EDWL 2OSLB 3G04B 4JFYB 1A1OA 2IFGA 4PGCA 2ZPKL 3GSRB 4OF8A 4PYHA 2XXMB 4CN4A 3P9LA 1XR8A 1QFWM 1BFVH 4NM8H 1AC0A 2YPKA 4M3JA 2AW2A 2E9BA 3QJHB 5D7IF 3RIAK 5MI0B 2CLRB 4UTBL 3C60B 1CFNA 3VH8B 1RIUH 4O58H 2ICWA 5E70A 2EC9U 3CU7A 2DM2A 1U93B 1J1PL 4JO2H 3ROLB 2DYPB 2O26U 5FO7A 1W0VB 5I30L 2ZNXA 1P9MA 3MV8D 4K94L 3CIQA 5HGGS 1BGXH 1UJ3A 5I8EB 3VXQB 1XF3B 3DX6A 4JO1H 4EEEA 2X4UA 2B39A 1OQOA 5HI4C 2JLLA 1MRFL 3EJYC 1A7OH 1CICB 3WFZA 3IU4H 5JW4M 5T3XH 12E8L 2OS7A 1IM9B 1H8OA 1BVLB 4JPIA 3KLHD 4NFBA 1BZ7A 1NFDF 1BQSA 3LQAC 3DO7A 5TDOB 2PO6C 2Z35A 4JDZA 4GXVH 1ERNA 3W9DB 3FQXB 4TULH 4NJ9H 1LP9B 5T5NG 2FX8L 3S34H 1ZGLM 4R0LC 2UZXB 3LDBB 3SGDI 2JCCF 3SDCA 4HDIA 4MSWB 4JHAL 2J88L 1JTPA 3ME0A 5DRZA 5INDB 1MHPL 4D8PA 5DJAA 3WD5H 5B39G 4ZUTB 4JZOA 3B6SA 3SJVD 2MOVA 4KH2A 4WI8A 3N1GC 4PJ8B 2FH8A 4P4KB 4NO5B 5DDHA 3MJ6A 2D7QA 5IIEA 1T5WB 4IOIA 4AEIH 3WEXA 3SCMC 1JYWA 3QPXH 2F8XC 1I3GL 2ZCLH 3K1KC 3B5HA 4H8WC 1B0RA 1TVDA 1VFBA 2OJEA 4JFPB 1G6VK 2WMPA 3V6FA 3MJGX 2VQ1B 5DTFB 5E4IA 2CSPA 5C2BL 1PG7X 5DJ2B 3SE3C 2D9CA 3BJLA 4F9PA 5I1AB 1FLTX 4GRMA 3DROA 2DQJH 3IGAA 1S7SA 3QEQE 1PKQB 4OLZH 4PRIE 2BFVH 2W9DL 6FABH 5F97E 4QOKD 4AIZB 1KBGL 2EH7H 3BGMA 4HC1A 5DD6B 4U6TA 5CLTA 2WIIA 3S96B 2NY4B 4Y4HA 3CU1A 4XRCA 3HE7B 2I26N 3G5YB 3P0GB 1ES0B 1BFTA 1YNTA 1E4KC 1U41A 4XBPA 4CGTA 1BD2D 1I1AB 2EDFA 4QRRB 3T2OA 4G9FB 3BP5B 1IGJB 1N8ZA 1AGDA 1F45A 2QADC 2EDLA 4PPTA 1INEH 2EDRA 5F6IB 3K80A 3MBEA 1NCTA 3QZWG 3DRQA 1TCMA 3RWFB 5HBBA 4Y4KC 3FFCB 1N2RA 5IHLB 5IM7A 3CH1B 3FO1A 4V2BA 1LHZA 5I8OL 1D9KB 5EUOF 3QH3A 4MAYC 1BIIB 5BCAA 3HMXL 2XZZA 2FECI 4J8RB 4JHWH 4GQ9H 4GKZA 2C1OA 1KTLB 4WDIA 4P3CH 1FO0H 1PJ9A 3D85D 2FJGA 2NY5L 1CU4H 4YZFE 1T1WB 1UVQA 3E6HB 5KW9L 2DWEB 1J10A 1FSKB 5E94A 5CZVH 3KJ6L 4NJAL 4G8GB 3HE6A 4EKXA 1I1YA 4MD4B 5TF1L 3UXFA 2JB6B 3QIBA 4K9EC 4S1SH 1RMFL 5DLML 4A2LA 1MHHA 3I6GA 2AK1H 4LF3A 3S3PA 3H9ZA 1VKXB 4UTAL 4OIIL 4Y8DC 4HXAL 4E0RB 2DQGL 3SN6N 1JUFB 3EZJB 3RWDB 3CFKA 4TNVK 3TO2A 3V0WH 4ZFOL 2HFTA 4NN5C 3QUXD 1NLDL 1NSNL 1LP9E 3MRGB 5FOJA 3SDAC 1KC5H 4F7EB 3O41A 5JZ7C 3QNXA 4U1MB 5DFWH 5EZJB 3BGAA 4QHNA 3VXSD 4Q6IB 1IAIL 1RUQL 1KYOK 5LAXB 1B0GA 2HN7B 3KXFB 2FNBA 1M6OB 4GO6B 1EO5A 3QXDB 1OF2B 4MA3A 3NH7L 5AZ2L 3I9GL 4QNPE 1ZOXA 5CEXB 3G08A 3KJ4B 2E9WA 3K4DA 1IKFL 2KZ1B 4P9ML 1R24A 5C0DB 3K8LA 3AGVA 2RIKA 1OTUC 4XTRD 1JJUA 2P7TB 2NW2A 4ZUWA 1GPOL 3JVGC 3P2TA 2UUDK 3BXNB 5CJBA 4FFVC 4RRPA 5K9JH 2HT4C 4R0LA 1A6UL 1OSPL 4LOUD 5IJVA 5D7LD 3LPFA 1PKQE 1HXYB 4J1UA 2X9WA 4KHTH 4UDTB 1UM5L 5T3ZH 5CSBA 3WXWL 3W9EA 2PW1B 4WHDA 2BVUA 5DQJB 5EU6D 2GFBA 2F74B 2ZOLA 5FCUH 4R7DB 4XZUB 4G6AD 3ROOA 4KJPC 1G1CA 4LAQL 5IBUB 1MCKA 3SCMA 4G8EA 3RY4A 4MX7A 1T0PB 3MRHA 2ZOKA 4QRRE 5DZOA 1QFWI 3LSOA 4LHQB 5IVNA 4G9FE 3VXTB 5A2LH 3DX8B 4H0HB 4NBXB 1SJHB 1KPRB 1X6NA 4HBQA 3CDGA 4XAWL 4ZMAT 1RVFL 5I1EH 2VDML 5HHOA 3IVKA 3OAUL 3BKMH 4LVOB 1SY6H 3FFCE 3Q3GA 3RL1B 5F7EL 4NPYB 2NYYD 1OLZA 3QG7L 3LEYL 5C1MB 1JV5B 2IQ9H 5CGMA 3ILQC 4GG6B 4QXUL 2CUIA 5EBWA 1RUPH 4O02H 2J1KA 3NCFB 3DVGA 1OHQA 4HPYH 1F4YH 4YHKL 4W6WB 2ZKHH 2R29L 1RZKL 3I02B 3HRZB 4F3FB 4QRTA 2PKDA 2YSSB 2A9ML 1KEML 1KN4L 4JN1L 4HX1B 3RVTD 4Z76A 1YNLL 1U8PB 4G8GE 5CSZA 1W72H 3PGCA 2AP2A 3QJFA 4MJ6A 4Y89A 1QD0A 4GBXD 4X98B 1QSEB 4OCRH 3KPSB 4M7JH 3IFOA 5B21A 2X44D 1YEDB 5E00A 1ZGLP 4WFEE 1UWGL 1XGUA 1NLBL 3LN5A 3T1WA 3DV6A 4EQ3A 4HSQA 5LBSH 2D03L 2BSTA 3BESR 5E5UB 5EZIL 5JHLH 4D0DB 2A0LC 2X2YA 3GGWA 3QWRD 4YIQA 2EYSB 4J3XA 4OFDA 3M8OH 1U8MA 1H8NA 1I3UA 4N0UB 5KTEH 3S35L 5DJCB 5TE4H 4M48H 4BH8B 3EO9H 1RJZB 2VSCA 5CGYC 5FF6A 3DECA 5D70L 5D8JL 3ARFD 5JOFA 2NXYB 3CLEL 2XWJB 4TOYH 1V3LA 4QO1A 2R0ZH 1I7TB 1RZJC 3VWJC 4ZDHA 1AY1L 4Y4FA 5D1XB 4M7ZB 1XH3A 2Y23A 5L2JB 1CTOA 1U91A 5AAWA 2OTWA 4NZUL 3GK8H 4MMXC 1A9EB 1CLYL 4BH7A 4BUGA 4JGMA 3TYFB 4TSAH 3FZUC 3GBNL 4GW1B 2Y6SD 3ZDYE 4P5MA 4C56B 4HKJA 3ARYA 4O9HH 2WW8A 3G5VA 3BPOC 4UT6H 1WZLA 2P45B 3C6LA 2PTTB 4I18A 4C58B 2V7HB 4OUOA 2J4WL 4KDWA 3RVWD 4XP1H 2RCSL 3QCUL 4PJDF 2FWOB 2R2EA 4QXTA 4JGUA 4JAMA 5A16A 5HHXH 2VDQH 4QHLB 5CHNB 4PJ5A 4OCSL 1G6RH 4QWWC 2RFXA 4P9HL 4DGVH 1YPZA 1GGCL 1WIOA 5JLZB 3BO8B 2NXZB 3QWOB 4QGYA 1NDMB 4PJFB 3WUWA 1Q9LB 1UWXH 2VDPL 3UAJC 1VDGA 5KN5A 3KR3L 1NGYB 4HWNA 3RI5F 2VDOH 1I1FA 4P2OC 5J13B 2B1HL 3O2DA 4U1KB 3GSVA 1U3YA 3L1OH 1Y18A 4IRZL 5C0CB 4OGXL 2H6PB 4FQIL 5ESAA 1QZ1A 1PX4A 3H6JA 3L3IA 4ODSL 2I60L 3HC3L 1S7UB 3QPQC 4P46C 1CVSC 1HSAA 4Y2DC 1HI6B 3EUUA 4AG4H 3EZ8A 5T5NF 3SO3C 4YBLB 3H9HA 5JW4R 1IAIM 3HPLA 1AGFA 5JPMB 1UWEH 3H9SD 4Z6AT 2ZSWB 4K7PY 3B8SA 4Z0BL 5I75C 3GKZA 3M1BA 2R56L 2R4SH 2HVJA 3MRNB 4PGDB 2CKBH 4N0YL 5MEOB 3I75B 4GG6E 3VWKC 1R3KB 3HR5A 3UJJL 5CBAA 4CN1A 1S9KC 1RZIA 2JIXD 1OOAA 3QHTC 5K9KA 2WBJD 4MXQD 1DQJA 1WBZA 2YS4A 3L3HA 4XVTL 2OBGA 3SDDD 3TNNB 1YEEH 2HH0H 3QUZB 2GSIB 3GB7B 5C9JA 4AEFA 2R0WH 4N68A 4KHXL 3ZDXE 1QSEE 4YDIH 2DRUA 3KPSE 4Z78B 1F58H 2DQHL 3DSFL 4YEEA 4FG6D 5DK3A 4JGJA 5D71L 3I2CH 2AJ3A 1B2WL 4L4VD 5C0RH 3EGSA 3S35X 4JREB 1MLCB 4I1NB 2GITB 4FQXD 5JHDD 1F6LL 3VW3L 3W11C 1CFBA 4WCYL 5IK3B 2HFFA 5HYJD 3FB7B 4N1EA 1UACL 1SYVB 1F3DH 3HZKB 2BVEA 3MO1B 4N0UE 3A6BL 4LSDA 2ARJQ 5ICZA 1DSFH 4M4RA 1K6QH 15C8L 2EZ0D 2EDKA 1TQCC 5BRZB 3KPLB 2AQ2A 4HKBA 3UTZA 1XGRA 1K3IA 1MREL 2NNAA 2RHEA 3ZKND 5IFAL 4PJAA 1NAMH 3WO3B 1OGTB 3DRTA 3LS4L 1D5BB 3L3JA 1SJXA 3SDXF 2QHRL 1FNLA 4M62L 2QTEA 1IAKB 3B2UD 1NGPL 4Z7UF 4ZD3H 1E28A 4NQEA 1O7VA 1DLFH 2Y72A 1QKZL 1T80A 1AGEA 4P5KB 2YRPA 2EIDA 2M2DA 4Z7VE 2W92A 1SEQH 4Y19A 4C56E 3VCLB 4PJIF 1NC2D 3MLRH 1UFUA 2EE6A 1ZLSH 4HLZG 4PJXF 1G7MB 1S5HB 1N0LA 2YD9A 3A67L 1JRHH 3PABA 3QEHB 3D1MC 5FUOL 3L7FB 4L9LB 2JKXA 3BH9B 5IUSA 4HKXA 5DEFB 3HI5L 3QIWD 4YHPB 2QQQA 4UDUA 4P48A 4RBPK 4BM7A 2ARWA 1UEYA 2X4QB 4YO0A 4PJFE 1UENA 3KPMA 5J11B 3ARRA 2ADIA 5LQBH 3CFBB 5E2UL 1BBJB 4FOMA 4HIXH 1FZMB 3DNKA 5SWZB 3ULVC 2QV2A 4XNXL 5KSAD 2QEJA 2C4FU 2Y1VA 1B6UA 2EDNA 1J8HA 3P40A 1N7MH 2N7AA 4NUGL 4QYOA 4ZO6A 5MENE 5C0CE 5JUEL 2BVPB 3HCVB 4PTUB 4ONGH 5A40E 4X99B 4Q0XH 1D5IH 1KJVB 4Z77B 2FJFB 5DRNB 1EEZA 1XR9A 5KG9A 4D9RE 1HH6A 2CJUL 4WO4D 2B20A 43C9B 2FIRT 1OB1A 2DD8H 1CQKA 4Q2ZA 3EJZC 1EBAA 5ELIA 5HGHA 3VXMB 1OAXL 4IDLA 5E8NB 3WYRA 4YDJB 5F96H 4ODXB 5A2FA 5C07B 4PD4K 5C08A 3HKFA 4OF7A 4K7PH 4OKVB 4ZOAA 2BJMH 4DVRL 1AGCA 2KBGA 1K4DA 4PJBB 2IPTL 2ICEB 5DWUL 3CK0L 4U0QB 2EDYA 2E7MA 3RGHA 3ZDZF 2NPLX 5CJOH 4MS8D 1H3TA 1DN2A 3RDTC 1DBML 1N6VA 3IJYB 4UV4L 4NOBA 5DJ8A 3V0AC 4NKIL 4J4PD 3DXAA 1CXFA 1YEGL 3VFRB 3O45B 4OV5A 2P44B 3T0BA 3QDHA 3NGBC 4P46A 2BVOB 5HYQB 1QLEL 4NC2B 2KL6A 5HHVL 2PYFA 3D39A 3RA7L 4Y2DA 3JWDL 1OAKL 4YPGA 1FCGA 1X3DA 4XCNA 4OM1L 5GRWA 1JWSB 4XVJH 4Y1AD 2VTFA 5L7XL 5FDWA 2IJ0C 2H45A 5F8RC 4BK4A 3GMLA 4ZTPL 3FOLA 5DRXA 4M43L 4NO0D 4U1IB 4JQVC 5CUSH 1CFVH 1L7IL 3VI4E 2H9GB 4XMLL 1JF6A 3VWKA 3VXPB 3NIDE 1QQDA 4P5TD 2PXYC 3PIQB 5D2NA 1LK2A 2OMNA 3CX2A 3VJ6A 2IEPA 4XNQB 5BRZE 4WI5A 4ZFZA 3BPLB 3RHWK 1HQRA 1CGUA 2EYTB 3TA3A 3H7BB 1XF4B 5D7JC 3S97C 4LHUG 5DUBB 5EFIB 1OCWH 1RJCA 3C8KA 4M9OA 2LTQB 1DQDH 2MNUA 1HHHB 5HTSA 2FEEL 2B2XH 4GXUN 3P3YA 2ZUQB 2VZVA 3E3QC 3QEGL 1S9YA 4NN6B 4L3CB 1QFWH 3BEWB 3NACL 2OR7A 4ODUB 5EWIH 3KAAA 4M1CC 1JZ7A 1U3HB 5L88H 3E2HC 3MLTA 1CLZH 4PRBA 4PP2B 1HZHH 1A3RH 2EO9A 1CGTA 4YHLH 1M71A 5JMRA 5I9QC 3RWEA 1TCRA 1JF1A 4PRDA 1KLFA 1AJ7H 4LPYA 3TO4A 1FYTD 3MUZ1 2FIKA 3WS3A 4POYA 3HG1A 5JNYA 4WUUB 4EXPX 4ZUUA 1DDHA 4PJ7A 4EBQL 2RJMA 4UILL 3WHXB 1UKQA 4WV1B 3DUUA 4AT6B 2GJ6B 4NWTL 1KCSL 3BKCL 4JG1L 3MRMA 4K2UL 3PP3K 5SWZE 4EUPH 4ELMF 4GMTH 4LU5L 4U3XA 1P69B 1YQVH 1N0XH 3NIGF 1CT8B 2Q8BH 1CG9A 3WJLA 2HJLA 4ZOBA 4XPTH 1XF2B 3L3OB 4JFHE 4PG2C 1AQDB 3VRLF 2Z31B 4HWEL 4L3EB 4K3DL 2QSTA 4U6HB 4PJGB 3GKWL 3BWUC 2EKSA 1J1XH 1IEBB 1Q94B 4U4BA 3VXME 3LV3B 5JW3H 4DUVA 3WFCH 3IXAB 5BV7H 5I1KL 1IGTA 4OUUB 5C07E 2XN9A 3ULUL 1Z6JT 2ORBL 4OLEA 3GFUA 4R4FL 5DURB 2PTUA 1G7LB 1RK1A 5HJ3B 3TZVB 4ZAKD 2BCKA 5F70A 3UTSD 3C87A 1ADQH 4JZJC 4PJBE 5A2KH 5CD3B 3O6KL 1KXQE 5T5FH 3RTQC 3L5XL 4X5XB 2AXHA 4WWKC 1A2YB 3MRQB 1XCTB 2LE9A 1QTYT 4PS4L 2MKWA 5IB2A 4I0PA 1C12A 1XIWD 5TQ0H 2VL5B 4MDIB 4AIOA 3TBYB 5CLWA 1HQ4A 3RUGA 3VFPB 3PNWB 4A2MA 4XCEA 5D72L 5CINL 3UDWC 4MVBD 3UBXG 2VDLH 1EPFA 4MJ5A 5KVDH 2ILLA 3RX8A 4LKCB 1HYSD 1WISA 2PW2B 4HUWB 5E6ID 3ZKMC 1FPTH 2EDTA 5T33L 5E2WL 4BK5A 1BQLL 4MNQD 1WSST 4FTVA 3IJHB 3MCLL 1DBKH 3RVXC 5DVMA 4C54A 3TFKD 1WCBA 5HDQL 2QBWA 5EO9B 3DURA 4UINL 4JFOA 4P4RB 5INCA 3ISWA 1GGUA 3QDGD 4ZYKA 3O4LB 5D5MB 2O93L 1N6UA 3W5NA 1E6JH 2C5DC 2GJZB 3AU1B 1T1XB 2ID5A 3MLXH 2VLJA 1MH5B 4NKMB 4EVNA 2NY0B 3GMNA 3RDTA 1PGRB 5I15H 1PD6A 3PWJB 4Y88A 2XZAH 1YEFL 3DIFB 4CVZA 3X12B 4UT7H 2DQIH 5EC1A 2V2XA 2XKUA 2ZUXA 3O8XB 1N3NB 5HHNB 1BOGB 5BZWB 1UZ6F 3Q6FB 3HAEG 3PWVB 3KLAB 1R3JA 3BPCA 1KT2A 2B0SH 4JRYA 3U0TB 3IDNA 3MA9H 4LCCA 2BOBA 2Q7NA 1LO4H 5CEZL 2F53A 3EOBB 3TJHC 5DMKB 3PQYA 4LLQA 5I17B 4P3DA 4JY5L 3BQUA 5T1MA 4U1JB 4M7KL 4JQVA 3MUGA 1H0DA 2F5AL 1CVRA 4LLDB 4G7YH 1VPOL 5KJRL 2IPUG 4EI5D 3MLUH 2PYEA 1NCCH 1UM4L 5CZXD 4E42B 2PXYA 4ZUVA 2AGJL 3BP7A 5T1KA 2BRRH 2AQ1A 1QHOA 3MR9B 1LEKA 4ISVA 4WUUE 1FBIL 2AQ3A 1YY9C 3NZHL 1OAZH 2VR5A 3MV8B 1LGVA 5D7JA 2DQCL 2JE8A 4MXVE 3WN5A 1Z3GH 3X3GH 4U1GB 2G60L 4OLYH 1J86A 4YUEL 4CMMA 2RBLA 3LD8C 5IROC 1RQ5A 4D94A 4Z7QE 4HAGA 1PG7H 1NBZA 3CSYB 4NN7C 3L5IA 3B2VL 4QXWA 1YMMA 1YJDC 4GAGH 5D7IB 3HZMA 1I8IB 4A6YH 1HK6A 3ILPB 4BZYA 1IRAY 5A1AA 1MCSA 2YOCA 5H2BA 4YDLC 5E1AB 2IAMD 4L3EE 5B22A 1O0VA 2VERN 3FJTA 1OQXA 1AI1L 1EAJA 4PJGE 1ITBB 3O81A 3EFDL 4XHJC 1DBBH 4IIQB 3AC0A 3M17A 4LNRB 5FA3A 4BZ2L 1J12A 4RA0C 3CPLA 3WFDL 3IDMB 1UGNA 5DJ6B 3FHAA 3RPIB 4Z8FH 4ZFGL 4FHBD 3SJVB 5JDSA 4M8VA 3PL6A 3O6MH 4KZEH 2F58H 4EDWH 4Y16C 3MA7B 1ZVSB 3QFDA 3QO0B 1NBYB 4XBGA 2W65A 5EBMB 1QOKA 1NFDB 1AD0B 4OZ4A 2IBBA 3SDCD 4HWZB 3H0TA 5DMGC 3T4YA 3NCYP 1LMKA 3U79A 2NMSA 2F8VA 2IBGA 5FO9B 1GIGL 2APTA 3ZO0A 4ETQA 4N5ED 3GSOA 2JCCB 5HVWA 1RK0B 4HGWB 5E4EC 2NY1C 3SO5A 1J1PH 2ZJSH 4KK6C 2IALB 1IGML 2HJKB 5I30H 3LKRA 3BZEB 4K94H 3HTLX 5FB8B 3FQWB 4HWBA 4HUUA 1TJGL 3EIFA 1FRGL 3AUVA 1MRFH 3AMLA 1CCZA 3UYPA 1L9NA 3CLFL 4QOKB 5J0BA 3V4PH 5DHVA 3CD4A 3O4LE 5D5ME 5C3LD 4OLWL 2A9NL 5GJTL 3V5HB 4JZJA 5KS9F 2I9TA 3ARBA 2OZ4A 3RTQA 3RNKB 4WWKA 2BHZA 1RU9L 3F58L 2FX8H 4NKDB 1WZ1L 1IARB 1BD2B 3MJ9L 3MRIA 4JHAH 2J88H 1JZ2A 1VCAA 3CUPA 1I9JL 1MHPH 5JIIA 4LPTA 1FORL 5FK9A 3MMEB 3UDWA 5GSVA 2BSED 1TETL 5HYIA 4Y4HD 4PREB 1TZIB 4PJHA 4JLRA 3O11A 3V5KA 2AEIT 1BQHA 3RIFK 4N8PA 4NQXA 5BV7C 4KPHL 1I3GH 1TJIL 1Q38A 1ZA6A 4OGZA 3WNPA 3EO0A 3O3AA 3D85B 5IFHL 2AXFB 4IJ3B 3S5LA 3UO1L 3G5XB 4AQ1B 1D6EA 4GH7B 4XC1L 5IHZA 4JVUA 5GRXG 5J6GA 5C2BH 1YUHA 4LSUL 4I3RL 2B4CC 2BNQD 4G6KH 4HXBH 3MV8E 1N64L 1KIQA 5I1CL 1BREA 1OT1A 1JTTA 3D2UA 5KSVB 1MFAL 2W9DH 3MPCA 4XNUL 4Z7WF 5EUOB 2XKSA 4GKSB 5GIRA 3ZT5A 3ARXA 4BYHA 1U6AL 1KBGH 5FYKL 4QRSB 1JK8A 3AXLA 4OAWA 1UH4A 4X0KA 1UCBH 4ZPTA 4X6EB 3HE6D 5D7IE 1LDPL 4HUXA 5KBNC 1I8MA 3QUXB 5HGBB 1JGEA 1T04A 1W8OA 3V5DB 4K3JL 3GJFA 4QCIB 2QR0A 1GZQB 5C7XL 4BFBD 2SEBB 2C26A 1HYRC 4KTEL 1AFVL 4XNYL 1DBAL 3T3PF 1K5NB 1Z9OA 4TNWF 2VDNL 3OR6B 1IVLA 4WEBL 3L6FA 3VXSB 4GRLA 5I1LB 3SJVE 1UB6A 1JMXA 4WNQB 1MFNA 1RUAL 5L8JB 5GGTH 4JM4L 1LE5A 5A2IH 4NQUA 5C0BA 2VIRA 5I8OH 1Q72L 3HMXH 4U6XA 1NFDE 2VXVL 4YHIA 1FL5A 5IROA 2FHBA 1AQKH 2F8OA 4L8BA 1MIEL 3FT4A 1FL6A 4RIRB 4JM2C 1AO7D 4HULB 2VAAA 5KW9H 4N0FA 1DQQB 1DL7L 5HHQA 2JCCE 4XT1C 1RZ8A 1I1RA 1LEGA 3LEVL 3CVHL 3KJ6H 1NCWL 1WCQA 2NTFA 3TPKA 5HI4D 5D7LB 1FV1A 5TF1H 2K7PA 3L95A 4LHUD 3LAFA 1RMFH 4FXGA 3BVNB 2VN4A 2C9AA 5DLMH 3VD5A 2W0PA 1TZGH 5FCSH 3L3DA 4DK3A 5FKAB 5JMOC 4QOKE 2PO6D 4UTAH 2H3NA 3KNBB 3TP4A 4Y16A 4OIIH 3IYLW 2V5TA 5EU6B 2DQGH 4DKAA 5CILL 1ED3B 3H42H 5DUML 1C5DA 4MDJA 1T66C 1M7IA 1VACB 1YNKL 4MNGA 3GSNA 5C0GA 1Z0MA 1NLDH 3MV7D 1KB5L 5FDYA 4ZNEE 2FD6L 4LEOB 1HOCA 2CH8A 1BD2E 1Q9WA 2XFXB 1BLNB 2VL4A 1BVKB 2LVCA 5GRUL 1IAIH 5HHMD 3MFFA 2ED8A 3STLA 4FQ2L 3GRWL 5TFSH 3MREB 4DKFL 4RFNC 5BVPH 2ADGB 4H26A 4QF1B 3MNWA 5EO1B 4OCWL 3VGEA 4HJGB 3NH7H 3G5ZA 3TH4T 3ZYOA 3SCMD 5AZ2H 3BSZL 4X83A 3MNVA 3I9GH 5F6HI 5F89A 5ADOL 4MCYA 5EH1A 5FM5M 1WAAA 4LSPL 4X4MA 3SE4A 4G8IA 2VAJA 2UWEA 1IKFH 3HUJA 4P9MH 5D1ZA 1BMGA 2X4NB 3V6OE 5JO5A 2IBZX 1J5OL 1UT9A 1ZKAA 2XY1A 1KTRL 3NOIA 5F9WB 1PDKA 3T65A 5IVXA 4W6YB 1T2JA 1GPOH 3L3GB 1WFTA 1JFQH 2Z8VC 4OQ1A 1GZPB 5CCKL 4BSVA 1A6UH 1OSPH 1NBQA 3PHQB 5FYJL 3EFFB 1BEYL 4GBXB 1KYOJ 4U33A 3CXDL 4S1RL 1ZHBB 3MLZL 4JZNB 3ZL4H 1KEGH 5EUOE 3QXAA 3DLQR 3V6ZA 1FNGB 1D5MA 3GSWB 3KYAA 3PWUA 4NRXA 4OZFB 4O51B 3REVA 1CGSH 5TDPA 5J4MA 3IAGC 4KC3B 4DN3L 3VRIA 2NZIA 3VXRD 4K94C 5EOTA 5IV2B 4X7TB 1XF5B 5DQ9A 4LAQH 4Y2OA 1FNFA 4PGEA 1IEAA 2FEDC 4Z18A 2QADD 3D48R 3MV01 4PGJA 4HQQL 1JPFA 4FQQA 1LE9B 4OM0L 3ARFB 4Y4KD 2P5ED 5IWLC 3VXSE 3S6CA 2E7CA 2JJTC 4XAWH 1IL1A 7FABL 3JV6B 1RVFH 5C86A 1IGFL 5DZLA 2VDMH 4OGYL 4E41A 4Q9CA 1A9BB 4MAYD 4OI9A 5F7EH 5EIIA 3OWEA 2XTJC 3MOAL 4YK4C 2BK8A 2FSEB 2R2BA 1FFNB 3QG7H 3LEYH 2UZIL 4NC0B 4P59H 5DRWB 2D9QB 4YNYB 3EDFA 3D69B 4X6FA 1ZV5A 1BPVA 3O3DA 2DOCA 2D7TL 4YHKH 5J3HC 3VD3A 2R29H 1RZKH 3OAZH 5DFVC 2A9MH 1G1YA 1KN4H 2XA8H 4JN1H 1NCBH 1YPZF 2X6MA 1YNLH 3ARDA 1G7IB 3MCG1 4GG8B 2BX5A 4X7DC 2V2TA 4OCNC 2EDDA 4ZS7H 5D7LE 3SBWC 4WU7B 2G2RA 3S4SB 5IMMA 4MNHB 3INUL 3LMJL 2PR4L 1A6TA 3MBXL 3T0EC 1UWGH 1BZ9A 1NLBH 3IETB 3WKMH 2LABA 3FRUB 2VXUL 2Z91A 4PRAA 4O4YL 3TNMA 4YHYC 1NFIA 5EU6E 5AG8A 3KPRA 4H1LA 1KTKE 3TCXA 5EZIH 3SDAD 3GHEH 1U8QA 5I71C 5JZ7D 2QKIA 4HPOL 3ZTJG 4BFEA 2VH5L 3S35H 4NQSB 3NFPB 4CU7A 4J2XA 4M5YL 4PJDB 3WV0A 1Z0NA 4JFFA 3V7AE 4JM2A 4KKLC 1LNUB 5D70H 3TN0C 5HSFA 3CLEH 4X6BB 4NQCD 1JNJA 2BOCB 3B9KC 2ENSA 3P77A 4WHCA 1CDGA 4LDLB 3PGFL 5GZNC 1HILA 5EPMA 1AY1H 3VFUB 4GLRI 1P2CB 3DX9A 4JFEA 3H9SB 5C0NC 1LEIA 1KCVL 3EDJA 2C4XA 1KG0B 4NZUH 5FM8A 5I66A 1E4XL 3I6KA 1I85A 3GBNH 3DMMC 1OTUD 4LEXL 3UTTA 4Z9KB 3NZ8A 1MJJA 1D5ZB 3SPVB 2FBJL 1YMHB 1HH9B 2BXZA 2JIXB 4RMWA 2WBJB 2HT4D 2OCFD 5IFJB 2J4WH 2EDJA 4X9IA 2RCSH 3SDDB 4FFZH 2P8MA 4OZHB 4URTB 1KCUL 3MC0A 3V4UH 5IOPA 4FP8H 1CXHA 4X8XA 3ZE0F 1G9NC 4ACPA 4OCSH 1F4AA 1NCAL 1AKJB 2NY5C 4KJYB 4PRHA 4HKZA 4Z95L 5DJDA 3HPJB 3SKMB 5HVHB 1M05A 4OQTA 3QFJD 5B39B 1GOHA 4F33A 3BISA 2VDPH 5D9SA 1OM3L 3GUTA 3C6SA 4L4VB 2I9LB 2VLRD 3KR3H 4UAOC 4FQXB 2A6DB 4KJPD 4OSUH 5JHDB 4UU9B 4DQOL 3VMNA 1JNHB 2OM5A 5HHPA 4JN2A 4IRZH 4N8CL 4OGXH 5HYJB 3FT2A 1JZ3A 4FQIH 5L2KD