5DHVH

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
b'QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvH00
4DFIA 4CVUA 4NKOB 4M93B 1G7LB 1H9VA 1JNNH 3QIUD 3O6ML 2JCCB 3QXAB 1W72A 5JMRA 2HJFB 4Z0XB 3IDMA 5CAYB 4X4ME 1JPTL 4YUEL 5D7IE 2A6JB 1AR1D 2W9DL 4JGUA 2JB6A 1QSFE 3LKRA 3D39B 4PP1C 1T7WA 1FORL 3FMGH 1OAKH 1C1EL 1MI5B 5FOBA 2R39A 3DETD 3N85H 3S37L 3FT4A 1TXKA 2X4PA 2YUXA 3IDMB 3VG9C 1X5YA 2YSSA 4MAYD 5MHSD 4YE4L 3L6FA 2AJ3B 1KB5L 1RK1A 4LVOB 5H94A 5JXEC 3KJ4B 2BX5A 2Q6WA 5FOBB 1FJ1B 1LD9B 3A67H 2OSLA 3VD7A 2QADC 3OTTA 1UM5H 2X4PB 3QWQB 2IWGA 4PJHE 1XEDA 3WDIA 4OZHE 3ZKQD 2F5AL 1RK1B 2HH0H 2YRLA 3PDDA 5D9SA 4LMQE 3BKJH 5LGHH 5FUZL 4Z7VB 1E0OB 2BXYA 4YHKL 4OAWA 3D0VB 4OCYH 3VA6A 3LB6D 5D9SB 4KMLB 3EOYG 2GIYA 4OKVA 2HFEA 5EORH 3CVHH 3QP3A 1KPUA 2GAZA 2X6MA 5JQ6L 1H3GA 3SEPA 2DIJA 3RZCA 4JAMA 1KCSH 2XKNB 1UXSA 4ZD3L 1RZJH 1ZLUK 5CINH 3ZE1E 1KNOA 4FNLH 2J2ZA 3OB8A 3F8UB 2DB8A 4CU8A 1UH4A 4OKVB 1M7IB 2DQCL 2HFEB 1KPUB 2GAZB 3ZKNC 1EGJH 3MGOA 2HTLD 3H0TA 3LQAL 5EU3A 2DDQH 3QUMB 3RZCB 4JAMB 3VFRA 1BF8A 2P5WE 4MGXA 1UXSB 3LS4L 1MAJA 3P4NB 1KNOB 1M7XA 1VACA 3BEWA 3Q6FA 2W59A 1IGYA 4QT5A 4EUPG 1I4FA 2DQHH 5EUOA 3CFCL 2VLJA 3WS3A 1YEDA 3H0TB 5EU3B 1NCBH 3VDAA 3VFRB 2Y36H 3NA9H 3BEWB 4QT5B 1VACB 5BV7H 2DYPA 5E2WL 5E6YA 3IKKA 2IH1A 3HC4L 4P9MH 1IC7L 4QY8A 4PY8J 1UENA 3C6LB 2VLJB 1YEDB 3O3BA 2XKUA 3KYNB 3D39D 3GJFA 4HWBL 4NJ9L 3PWNA 3V8CA 2DYPB 1TQCC 3MUY1 1I9JH 1MRFL 4P2OA 5CBAB 1CDHA 4QY8B 2D7NA 4P2YA 3OKOB 3O3BB 4PGDA 4JKPH 5K9JH 3P0VL 3HE6B 3IDJA 1GZQB 2VXQL 4S1QH 3K81A 4XGZA 3PWNB 4YPGA 4HIJB 5T5FL 5GS1B 4ORGA 4JHWL 3T8XA 3EDFA 4PGDB 3CFEA 3OV6A 1JGEA 4HAGA 4F37F 2IFFL 3JVGC 3FFCA 3HZVA 1NBYA 4YPGB 4U6XA 5ERWA 1ZTXL 4LCUB 3UROR 2HT3D 1WAAA 3T8XB 5LWYH 4C56E 3QEQB 1IC1A 2BRRH 1SJHB 2ZUTA 1JGEB 4KK9D 4TVPH 3KPQA 5IW6A 4GXUN 4P5KB 3FFCB 4LAJH 1NBYB 4JVUA 1U8NB 4U6XB 1XT5A 1CDBA 2EE2A 4Q74A 1TMCB 4K94L 2FGZA 3GNML 4OF3A 5F1NB 3KNBB 4W81A 4DEPB 2FX9H 2OS7A 5E6IC 1UGNA 3G6AB 5DD5L 1T4KA 5DJ0A 4J3SA 5FKPB 4JFQB 3DHMA 3MNWA 4LCIL 3REVA 1EZVX 4XNXH 2KQMA 1ZWIB 4WENB 3RZCD 3LKOA 4PJXA 3GSVA 4PJCA 3WFCH 1WFTA 2PTTA 3NPSB 4OLVL 2DQGH 1T4KB 2BNQE 5DJ0B 3RKDC 3MNWB 1OSZA 1V7MH 1ZLSH 4N0YH 3O6KH 2ICCA 2IFGA 4QOKE 1Y0LA 4BK4A 1KEGL 1BQLL 5KS9A 4MHHG 3GSVB 3GRWL 3FO0H 1H3UA 2P45B 2PTTB 4POZD 12E8L 4UV7L 5EWIL 3QQNA 4BK5A 1E6JH 2HT2C 4FZEL 3EAKA 3BP4B 1OSZB 2X4SB 2VLJD 1Y0LB 4ZXBA 5KS9B 4WHYH 4RAUB 3U6RB 2KBGA 5SWZE 3OQ3B 4JY5L 1PDKA 5D6CA 4JZJC 1U3HA 2D7OA 2DYPD 3EDEA 4JJ5B 3EYOA 4GG6B 3C8KA 5ID0A 1AO7A 4PJGA 4OZFH 2C1PB 2WNGA 3GDBA 2W0PA 3QUMH 4ZXBB 4RGMC 4M1GL 4WRLA 1SBSL 1OM3L 1U3HB 1XIWA 4I3RH 1YNKL 5ID0B 1U93A 3PGDA 1CU4H 3I75A 4FFVD 5TQ2L 1NMBL 1V3KA 5CCKH 3BDYH 3NAAL 4AL8H 4PFEA 2MCPH 1PW3A 4NBYB 1FNSH 4CDHA 4X5XA 1KCKA 4M6NH 1OP3H 1U93B 4MXWL 3PGDB 3QJFB 3BYYA 3CX5K 2ENYA 4IOIA 3BSZL 2VTFA 3WUWB 3FFCD 1PZUB 5EOCJ 1FLRL 3QPQC 2ZSVA 5L0QB 4DKEL 4NUJA 2D03H 1A7PL 4FQIL 3MCLH 4TUKL 2CGRH 4IOIB 5MENA 4X9HA 5JR1H 2NY5C 1KJVA 4LPXA 4Z95H 4R96A 4NUJB 1F4XL 2DLGA 3FAWA 1FL6B 2XWJA 1EMTL 3UDWA 3WNLA 1JL8A 3RTQC 4E5XA 3SDCC 5MENB 1ZANL 2FEEI 1H3TA 1PX3A 5J3HD 3SDXB 4R96B 3WYRA 3F58L 5D5MB 2NY1B 3FQRB 1AC6A 3ARTA 4PRPE 4EEEA 3U4BH 4MNQA 2IANA 3R4DA 4E5XB 2DS4A 4PP2A 3LN5B 1TQBC 1MELA 2I9TB 3RIFK 3M07A 3MCG1 2WP3O 1U8IB 1HOCA 5E4EC 1MJ8L 4L8BB 4OGZA 5DS8A 4HFWA 3SE9H 2O5YL 4XP6L 1IZKA 4PB0L 4MNQB 2V7NB 1HHIB 3VW3H 2B0SL 2EEDA 1Z9MA 2H3NA 1N5YL 3W5NA 2XFXA 5JW3H 2AERT 3BGAA 1A9EA 1FO0L 4HH8A 4ZXBD 2NW2B 3BJ91 2Y25A 4OZGF 1FAIH 5E2VH 4FQLL 2EH8H 1U3HD 1G7HA 5CGYD 5CD3A 5IFHL 4N0UA 3HB3C 2H3NB 3FN3A 3BWAB 4ONFH 2XFXB 8FABB 2DTMH 5T3XE 2L7UA 3V6OE 5ALCH 2VMFA 1OP5H 1M71A 4UIKH 1UKSA 7CGTA 3T65A 2DJUA 4OLUH 5DMIH 3OJDA 1G7HB 2XNAA 1XIWD 3NBNA 4FNLL 2ESVE 1BFVL 2FWOA 2V5MA 4W70A 4M6AA 2C4FT 1M71B 2O26U 3I84A 5LAXA 1K2DA 3HZYB 3MV7E 5HI3D 5AYUH 4KQ3L 2XXCB 2XNAB 3U36B 3ULVF 5BJTB 5KVDL 3P0GB 4JRXE 3QH3A 1GOHA 1MIML 3E2HC 2GYSA 4EOWH 2AV1B 3U1SL 3IU3B 4NNPL 1F13A 4KI5D 4NN5B 3WXVH 1IQDB 5JOPE 4GO6B 5DVNA 4RMRA 1AE6H 5K9KA 2Z31A 4HBQA 3VRLF 3QH3B 2IBZX 2R0LH 3BRDA 5GJTH 4DWHA 2W38A 3Q48A 5MEND 3QZWA 1PKQA 3LEXB 3RA7H 5B38G 3MUZ1 4NKDA 4LNRA 5CZVL 1NFIA 2XA8L 1FH5H 4FXKA 5K9KB 2Z31B 1BGXH 4GW1A 3QRGH 1SJXA 1FBIL 2NY1D 2IMMA 1L7IL 1ORSB 3TT3L 4PLKD 5DFVC 1G7PB 4Y5YC 5D7LB 1MQKH 1PKQB 5HVHB 2CLVA 4XMLL 5LGJA 4NKDB 3MLWH 5JORA 1M1SA 3H6JA 1QOKA 3WMSA 3SKJH 4GW1B 3P30H 3WNMA 4GBXC 1QACA 2IAND 4MNQD 3SDDC 4JKKA 1UEMA 4LVNB 5GGVY 2LTQC 3F7VB 1QSZA 2CLVB 1F2XK 2ZCLH 3BIAX 3VH8G 3WXWH 2ID5A 3IKCA 4OCWH 1OSPH 4HIXL 2QSCH 1AD0A 2NY0D 2Z8WC 4IRSC 3RHWF 2E9WA 1ZOXA 2DL2A 2DBJA 2ZZUT 2EYRA 3KLHC 1K4DA 1W72L 5DD1L 1B4JL 5CMAA 5T3ZE 1AD0B 5KVMC 1FE8H 4ODUA 3KPRA 2HLAA 3IDUA 1VFBA 5GGRA 3X3GL 2VXVH 3SCMC 3O2VH 2EYRB 4GMSH 3KPNA 2KZ1B 5CMAB 1NGZA 4L4TB 5F89A 1L6XA 1INQA 2VZTA 3O3DA 3NN8B 1KCLA 5JHDA 1CL7L 3L5XL 1INDH 1G7QA 2HLAB 5I1KL 3UPRA 1MFEL 3KPNB 4N8CL 2OMNA 3O6KL 1RI8A 1AGCA 1A6ZA 1YY8A 1YJDL 4DKFL 5H8DA 2BSTB 1INQB 3CIQA 4Z76A 5TDNA 1E6JL 3O3DB 5JPMA 1P7KA 3K2MC 1G7QB 4A6YA 4DN3H 3UPRB 5EU5A 3IDGB 1AGCB 3R8BB 1A6ZB 4OZGE 1YY8B 3CXDL 5D2NB 1T3FB 3MBEC 4Z76B 5TDNB 5FXCH 3PWPA 2H6PA 1P7KB 2Z31D 1Z5LB 3UEZA 4L1HA 3I50L 3IS0X 2EDJA 5FO7B 4Q9RL 3S7GA 3ME0A 1CFQB 3OMZA 4F15C 1GZPA 2YPLA 2H6PB 4MJIA 1JF6A 5E99H 4ZODA 5HHPB 4ENED 5MEOA 4K3EL 1MVUB 3ROLB 3WEXA 3DX8A 3TF7C 4P0DA 2EXYD 1M4KA 2I07A 2ICWI 1JHTB 1R24A 4MA8L 4FQJL 3ULVE 1R3KA 1EO5A 3LDBB 5E8DH 1PBYA 1QFWI 5FB8A 4XPBL 5MEOB 4U33A 1KUMA 1IAKA 3VE0A 5M95B 3WEXB 3DX8B 3RI5K 1TCRB 1VEMA 2M2DA 1F45A 1R24B 2CKBA 4LGSB 5C0AE 1BZ7A 5C2BH 1FNGA 1R3KB 3D5OF 3INUL 2C1OA 5A3ID 5HVGB 5FGRA 1S7QB 3VRLE 1IAKB 5MEQA 2GCYA 5I8EB 4EDWL 2ZOLB 4UOW0 1BZ7B 1ZVSA 4ODTL 5F7EL 1FNGB 4E41A 1Q0XL 1EJOH 2C1OB 2NXYB 4MAUH 3DV6B 1RAMA 4LSSH 1B0GB 3HS0B 5HGAA 3EIFA 5BS0B 4S1RH 3RL2A 3TYGH 3EYQC 4XCCL 1H8SA 3KPRD 1QYGL 2BOBA 1ZVSB 4KK8D 3AY4A 1P4IL 1DQQA 3DECA 3NFPB 5F1OB 5HGAB 2GTZA 1HILA 3RL2B 1OAZH 4LASH 2BOBB 2XQBL 5JHDD 1A6WL 2CKNA 1RZ8A 2AQ1A 1JCKA 4OLXL 4S0TD 5LXGH 5C8JA 1W8NA 3HRZA 2GTZB 4WUKH 4Y2DC 1DANU 4TRPL 3LEVL 1N4XL 4P9HL 2BP3A 1I7TA 4L8SA 1KC5H 1UZ8A 2BC4A 3MJ7B 1RZ8B 5L7XL 4R26L 5SWQA 2EXWC 1K8IA 3CFDA 4BSJA 3HRZB 1DFBL 1PSKL 3D87B 1QSVA 4M5YH 5IQ7H 1IARB 3GSRA 4DQOH 5E2VL 5HHME 3PWPD 3A0OA 3ES6A 4L8SB 2W91A 1LMKA 1UZ8B 1Z2KA 2BC4B 4GSDH 5ITFB 3VI3F 5IROC 3X12B 5SWQB 1K8IB 3CFDB 4GRWB 4OBSA 5EZOH 1E27B 5F96H 1AHWA 5C6TL 4Y5XC 5EN2A 3GSRB 3FCTA 2YPLD 2NR6D 1MREH 4OUOA 4XPTH 3ES6B 4LLDA 4ODVL 3OAYH 2DMKA 1NCDH 3SDAA 3AAZB 3ULUC 4JM2F 1CE6A 1JNJA 2W9EL 4YDVA 4C59B 2NMSA 1AHWB 4HF5L 1EEZA 5TF0A 4KK5C 4KKNA 4LLDB 1SMAA 3EJZD 1DBBL 1HSBB 3QDAA 3KPTA 5C0CE 3SDAB 4PUBH 2R4SL 1T22A 1BFOA 1CE6B 1A3QA 1S7TA 1OGAB 4X6BA 3VMPA 3WXVL 4G6KL 2VSCA 4DZBB 1MH5A 2DQIH 5F88A 1LEKA 4HFUH 2NXYD 4PJFF 1MAMH 2GJ6A 1JNLH 1TVDA 2R0KH 4FFYH 1T22B 3VDCA 5GJTL 1VFMA 1S7TB 4HS8H 1IZJA 2Z92B 5DRNB 4DVRH 2ADGA 4NQEA 2JELL 2P4AB 1II4E 2XZCL 2ZSWA 3P11H 4E41D 2FBJH 5F88B 3TV3H 1LEKB 1EHNA 4KJWD 2GJ6B 2GTWA 1BGXL 3GBML 1KIPA 4W4OC 2A1WH 1WZLA 3ARVA 2VXSH 4MQTB 4M8QB 1TZGH 2D7TL 4QHNA 3UJJL 2ADGB 2AQ3A 4HUWA 1G0DA 3QWRA 2ZSWB 4OLZL 1HSAA 4RMQA 5EOQH 4U7MA 3RU8L 1ADQA 1OP9A 1XCTA 2X9WA 4FFWC 4CMMA 2CUMA 2NYYD 1GC1H 3LV3A 4ZAKA 3I2CL 3MXWH 2EECA 1PY9A 3KPPA 3JWDC 2OMBA 2Q76A 4UDUA 3LH2H 5FF6B 1G9ML 1T1XA 1XCTB 1ZHBB 1FNEB 3ARGA 4CMMB 4AY0A 4F7EA 4LCCC 4NNXA 3R1GL 1LDPH 3LV3B 4ZAKB 3TT1H 3QUZC 4OFPA 1HWHB 4B41A 1XH3A 2Q76B 1T1XB 2R4RH 4PG9A 1G1YA 3MJ6A 3HI6H 1I8IA 3ZYIA 2IEPA 4LVHC 3IF1B 4F7EB 2CMRL 4OCSH 5GZNC 3Q0HA 4WIQA 4NZJA 5C0DA 1T7VA 5FYKH 3C5ZC 4LSUL 4PG9B 2ZG2A 1T2QL 1I8IB 4U6VL 5FM4A 5FGBC 3OBAA 5DVMA 3PV7A 1I8LA 1YMMA 5DZOA 5F93C 3SDAD 3HMXA 2FECL 3GSUA 4KJPD 2VOTA 1KTDB 4M5ZH 4JFDA 4N0CC 4JANA 1YMMB 4M6OH 4PG2A 2XY2A 2OXHA 3B8YA 1UEYA 4GRWH 1WICA 5A1AA 1S7SA 1I7ZA 3GSUB 4JN1L 3HC0A 4PBXA 1IBGL 2MPAH 3HNVH 1VPOL 3OKYA 4KWUA 4RAVA 2GJ6D 1SYVA 2HKHL 4S1SL 1RUAH 3VI3E 1RFDH 5JXEA 2DI9A 1IT9L 2GK2A 1S7SB 1I7ZB 4NQED 3BPLB 4RDQF 1XGQA 3NOIA 4NZRH 3VG9B 4JM4L 4RAVB 3L5JA 4NBXB 4PGCA 1I1AA 4I3SH 4DGYL 5I8CA 5E99L 3B5TA 1EUTA 4MB3A 2UWEA 3QQ4B 3QWRD 4HEPG 3NZ8A 3X11A 4P5TA 3FQTB 1QHOA 1ZA6A 5IG7B 1MHPL 4PGCB 1EFXA 1I1AB 3KR3H 5I8CB 1TJHH 2DQJL 2GHWB 1FRGL 1A6VH 4ZAKD 4Y7MA 3T4YA 2UWEB 3X11B 2XRAH 1ZA6B 4PJFE 1I8KB 5GGSA 3U0PA 1ZK9A 3IFLH 5SWSE 2NY6D 4LLVB 4X9IA 5HJ3A 3DXAE 4ZOAA 2FRGP 2AJXH 2DBLL 3ARGD 2BDNL 4ZS6C 4C55A 4YXKH 1IM3A 5KG9B 1MWAA 2FB4L 1UKTA 4H1LA 5F8RC 5HJ3B 5E94A 5F9OH 3MACL 3PV6A 4O02H 5C92A 1OAYL 4K3JL 4S1RL 2XN9B 4IRJC 3VGFA 1BEYL 1P1ZA 3VFOA 4NQCA 2WV3A 2HKFL 1MWAB 4ISVA 4H1LB 2H45A 2HTKD 1S5IL 4P5MA 1FIEA 1MCQA 1OAZL 2NTSP 5F3HB 1NCAL 1YMMD 4LASL 5DEZA 1P1ZB 3VFOB 1OPGH 4NQCB 4RFNC 5GRVK 4AEFA 4OD3H 5FYLD 4N1CA 1FG9C 1UB5B 1VERA 4JN2A 4LK4A 5CSGA 3TWCL 1N6QL 2GUOB 1HQ4A 3RPIA 4P5MB 4C54A 1XGPA 5CEZE 4JFDD 4JDZB 4K23H 3V4UL 3IVKA 2FO4A 4JN2B 5JTWA 1OL0A 3RPIB 1TQCB 2HLFD 4OKDA 4OLYL 3S96B 5IQ7L 5D1ZC 3GFUA 4JQVA 4HUXA 4DQOL 2Z8RA 3IVKB 2FO4B 3VXSE 4K8RH 5JXED 2JJSC 3JVGA 3ARDA 3FO9A 3MRKA 1CGVA 4X7SL 4DW2H 3EYVB 2ADFL 4RNRA 1CDIA 4LFHG 1W0WA 1U8KB 4NDMA 1I1AD 1IKFL 2XOTA 4OGYL 4WUUB 2WMPA 4YBQC 4BJLA 3LD8C 1BREA 3IRZA 3WLBA 1QUNA 4FQQA 2WBJC 4P5TD 5FEBA 2V9RA 5BZDB 4NDMB 1EFXD 3MRIA 4H0IA 1EHAA 4A6YL 2FX8L 1E4WL 3QPXH 5AZEL 3MGAA 1FFOA 1T80A 2ED9A 3QO0A 1FZJB 1F4AA 2APWA 3DRTA 5AZ2L 5I30L 1HHKA 3MRIB 3SHSA 5E6IB 3Q3GA 1JRHH 1T0NB 2JKXA 4JE4B 3KLAA 4MS8D 1FVCA 4M6ML 4JHAH 3THML 2YEZA 1CDYA 5CLWA 1FFOB 4WHCA 3VWKC 3P11L 5JHLH 1XGYH 3NIGF 1RUPH 4ODWA 1HHGB 1HHKB 4WW2C 3TESA 4MNGA 3Q3GB 1Y18A 3WDHA 4QHLB 4S2SB 1CK0H 4NN7B 1M7DA 2AVGA 4TULL 2A1WL 3KLAB 1FVCB 4OTXH 1LO4H 1NLBH 4NQCD 1Y6KR 1ITBB 4ODWB 2Q3AA 4I48A 1OCWL 4MNGB 3ARXA 1Y18B 3VD3A 1MQ8A 1M7DB 1J8HE 4PRIA 5ICYB 1UA6L 1Q1JH 4G9DB 2CKBL 5TE4L 3GB7A 1T5XA 5HD8C 2PO6C 4JZJB 2UV3A 1JMXA 3DUSB 5C0NC 4RFOH 5TFSL 1IGML 4Y0GA 2XZAL 4PRIB 3OJVC 3GB7B 4RGMB 2ZNXA 1NAMH 2A6IB 3BP5A 3K74B 2LQRA 3IYLW 1JWUB 5C2UB 4HKZA 3GJEA 5BO1L 3FL7A 1HINL 4OCSL 3HTLX 3G6JF 4DAGH 5DMKA 1IM9A 4AENB 1C08A 2B1AH 1KG0A 3ARDD 2WP3T 1BD2B 3BP5B 4LPUA 1WWBX 3V6BR 4N8VA 4HKZB 1DN0B 2A74B 2CUHA 3CX5J 1WGOA 1IM9B 4NRYA 1C08B 1FVEB 1KG0B 2ZG1A 4JKLA 4YHIA 1BBJB 3GEWB 4N8VB 1JFQH 3OXRA 1MLBB 4G42A 3T0EE 2Y7QA 3J8F7 3BKYH 4BSWA 5E6ID 5IKCA 1X5HA 1IEBA 3CC5A 4YHIB 5FHAL 1RMFH 3UZEA 4OCLC 3MLTB 1KTLA 1UWEL 1MJ7L 4KDVA 3OXRB 4J4PC 5I1GH 3BP6A 2R2EA 1JTTA 2Y7QB 1YEGH 3LEYL 5IVZA 3LSOA 4QEGA 1FYTA 5HBBA 1KXQE 1UC6A 2ZCKH 3RKDD 3CC5B 1IEBB 4AEEA 1IGFL 4TQEL 5B8CA 3L3GA 1A7QL 3ULSA 1ZA3B 4TOYH 4NZRL 3BP6B 3WDJA 1FYTB 2MOVA 1IGCH 3VXNA 2AEQL 1D9KA 3P9LA 2Q20A 1IVLA 1OWRM 3LHPL 3UTSB 1JPSL 1Q38A 3RNKB 2AKRB 3QG6A 3WL9A 1A7NH 5DURD 1CYGA 1QSEA 3NIFF 4LIQL 3DROA 4HWZA 2DLFH 4RMTA 1D9KB 3CDGB 3P9LB 4LDEB 1K4CA 3CDCA 4PRID 2Q87A 3WL9B 4JHZA 4HXAH 5GISL 3H7BA 3GBLA 4YBHA 3QNXA 1DEEA 3DROB 4GUPB 1E4KA 4HWZB 3BZ4A 4ZNEE 1KJ3L 4HSQA 3FRPA 4HUNB 1Z3GL 2BSED 1GGIH 5I1DA 1N64L 3NVQA 4J3OC 4JY6B 4EXKA 4UILH 4LKCA 1N5AB 3NIGE 3QNXB 1F3DJ 1BD2D 4LPWA 1DEEB 1P5VA 3BZ4B 3SKNB 2BNRA 3OG6B 4P2RB 1SY6A 4JPWH 2ZUVA 3MX0A 1YNLL 2EDRA 3B9AA 4FS0A 1DQMH 2W60A 5CJ8A 3LRHA 1IM9D 2MFNA 2X7LA 2OK0L 4LKCB 2OI9C 3RWCA 2BNUA 3BO8A 2YD5A 1GAFL 3OAUL 4KVNL 3NCYP 3BGMA 4WWKC 4Y4HC 2XWBB 1ADQL 3ET9F 1BF2A 2NPLX 1A6UH 3MV9A 4K9EL 4GRLC 35C8H 5ESQA 1AGEB 5EC2A 1N8ZB 1YEJH 5LCVL 3RWCB 2BNUB 3BO8B 4OD3L 1U95A 4R4BB 1MNUL 1U8HB 1LP9A 4X80L 3QCTH 2R15A 2Q7YA 4HV8A 3MV9B 3U82B 3DYOA 4YAQA 1CDJA 5ESQB 4LHQB 4K23L 5TH2A 5BVPH 4OCXL 2AJZA 3B6SA 15C8H 2J88H 1MCOH 1RHHB 3NACL 5EOTA 4QRUA 4L4VB 1DN2A 4QYOA 3Q1SL 3VXME 5GS0C 4EN3A 4YAQB 3X3FH 3G6JE 5MP6L 3ARWA 5TH2B 5GGQL 1FYTD 1B2WH 5ISZB 2AJZB 2EDBA 3B6SB 4U05A 5HGDB 5HYSB 3IT8D 1I1FA 5GSRB 5DK0A 5EOTB 2F53B 4QRUB 5I19L 3ZKMD 3TBWA 3ILPA 1QRNA 1JNHA 2DJ4A 3NCJL 4HAFA 5D6DC 4KKLC 4G6FD 5HYQA 1O7VA 1D9KD 1RJZB 5FYLL 1TJIH 5A43C 3HMXL 1I1FB 1CD9B 4MWFB 5DK0B 3Q6GL 5AAMA 4MJ5B 3NABH 1U6AH 5FHBL 3ILPB 1YEIH 2QQNH 1QRNB 4D3CH 4UAOC 1D6EA 2DD8H 3HAEG 2VDKL 5DR5L 4Z7WB 4JR9L 3UTPD 2JJTC 4IRSB 5GSVB 4RISL 4UT9H 4PPTA 4KU1A 1KEML 3C6SA 4U1HA 4YR6A 3SCMA 4KPHL 4NHUB 3V6OC 5F3BB 1RZFL 5E8NA 3OHXA 1KN4L 5DQDL 3V95A 3DRQB 1D6EB 1WEJH 5ACLA 4G8GA 3SCMB 4JFOA 4U1HB 2VXUH 3E3QE 5E8NB 1GGYA 4OGAD 3OHXB 2J4WH 1W0VB 2HMIC 4U0QB 5EOCH 5J6GB 2BNRD 4Y88A 3VFMA 2LU4A 1NLBL 2FH6A 2VZSA 4KUCF 3NIFE 2FCBA 1FZKA 4CVZB 3QUYC 4WGWB 1UM4L 3BQUA 3VFMB 4ZSOE 3BPNB 4LHUB 3MV9D 4KKAC 3BAEL 2VDLL 1L7TH 1VFUA 1Z9LA 2JB5L 3LPFA 1LVEA 4ONHB 1FZKB 3DLQR 5I73C 4UDTA 1DTUA 4JRYA 1T6WA 3ARYA 3BQUB 2DKUA 2IH3B 5CEYB 3J7HA 4DN4L 3HZMA 3V0WH 3ZT6A 3JV6B 2BJML 3TIEA 1RU9H 4UTAL 3DJ9A 2FGWH 4XPHL 3A6OA 5HGBA 5HHQA 2D0GA 1X3DA 3S6CA 4UDTB 1MWAL 3C8HA 1CZ8L 3WD5L 5LQBH 3HZMB 5TPWL 4EN3D 2AK4A 3LZFH 3UJTL 3WFEH 5HGBB 5HHQB 3GK8L 2WLZA 3M45A 4PRNB 3JTSA 3PDOA 2DKSA 1IC5H 2Q86A 3BKCH 2AK4B 1QRND 3W2DH 5L8LB 4HPYH 4JFEB 4YHLL 1T5WB 4L3CA 2Q3ZA 5AYQA 1CE1L 3JTSB 3B9DA 5KVFH 3PDOB 3CD4A 2AP2A 3K3QA 2DL9A 5KOMC 1FDLL 3E8UL 2Q86B 5EU7E 3DTXA 4PJDF 3ISWA 5JOFA 5IFAH 5CD5D 1QVOA 4OCMC 4L3CB 3BPCA 5T33H 4OIIH 2ZCHL 1CL7I 3OPZL 3FHAA 3SCMD 4XPGH 4X5LA 3RAJH 3HI5L 3DIFB 5F6HI 1JPST 5JOFB 2BSSA 4J6RL 1QVOB 3V0AC 2FX7L 4GJTB 1YEGL 3UYRH 3ARFA 3C87A 3MLUH 3BPCB 2EZ0D 1NLDL 2ZCKL 4MSWB 5L2KA 2YRPA 4G8GD 4KKBC 2F54A 4HS6A 5TE7H 3PP3K 1EDQA 2CH8A 5ECJE 3FT3A 4Y2DA 4TOYL 2BSSB 1F4WH 1DBMH 3ARFB 4ALAH 2VN7A 3MRQA 4PJAA 3BOVA 5IGXH 4U6TA 5BZWA 3QCUH 1E4XL 4LU5L 2J8UF 4WEUD 4PRDA 4YHNA 5J89A 2F54B 4HS6B 2VE6A 1J0JA 3WBDA 4NKIH 1HXMB 4YDKH 5C0GB 3FT3B 4N0RA 4PY7A 1O5DT 4Y2DB 2UZXB 1UCBL 1T1WA 5CS7A 1FSKC 4XVSH 3GMNA 3MRQB 4PJAB 3BQUD 4U1NA 2QQKL 5IB3B 2WWMC 3ZYOA 1KBGH 4YHNB 4PRDB 2Y6SC 2VE6B 3L1OH 5D1XC 3VD9A 5I18H 4HH9B 3SGJC 3QDMB 1T1WB 4JRYD 4OT1L 1NDGA 5DWUH 4B0MM 4U1NB 5ENWB 3PWVA 4FXGB 3U9UA 2FEDC 3AM8C 3K1DA 5IBLC 3V0VB 4CVWA 4G8FA 4IOSD 3RWJA 2YD9A 5CBEB 4N5EC 4E0RA 2F58L 1NDGB 1OAXH 2BVOA 3GSNH 3ULVC 1WBZA 5F1IA 4Y4FA 3U9UB 2P49B 2AK4D 1QPPA 4GT7A 5A16B 3MNZA 4G8FB 1DQML 1Q94A 1G7MB 3RWJB 3EO9L 5KVEL 4JFZL 4HLJA 3QISA 2AABH 2CRMA 2C3GA 4NPYA 4JB9H 2GJZA 3VGAB 3SE3C 1UVQA 5CJQH 3WO4C 4G6JL 2N1KA 1WZKA 3MNZB 4A2MA 3TCLB 5L8KB 4KY1L 4X6CB 3GUTA 4TSCH 3UBXA 2X9YA 2NY4D 5DJXB 3DVIA 5D2LF 4DOHE 1UVQB 4Q0XH 4FQXA 1QO3A 2FO1A 3BKML 5ESVB 1IAOA 3EYQD 3TJEH 2YD3A 3HUJB 3UBXB 2FL5A 3WIHH 3DOSA 4FXLA 3PE9A 4LAQH 3MXVH 1QQDB 4FQXB 3VMNA 1QO3B 3O2DA 3ARFD 2V7HA 1IAOB 2A9NH 2CXKA 5CILH 1F3JA 1H3VA 2FL5B 2F54D 1HWGB 3M17A 4Z7OF 2OTWA 4Y2DD 5DT1L 4RGOL 1RD6A 5IWLC 5GGUA 5DHVH 5HSFA 3C08L 5FM5O 1F3JB 2NY5L 1S9VA 2EDNA 4PYGA 5DD0L 2CIKB 3SDYH 5EU6E 3TYFA 4PJDE 2VZVA 2OTWB 3KPMA 3SGEI 1TDQA 2SEBB 5IESL 1P4BH 5GGUB 2QQNL 1FNAA 4LCCB 4JFHD 3N1PC 2AGJH 4MYWB 1JGVL 1DL7L 5K93A 1S9VB 3QUZB 4TSAH 3JV4A 4D9RE 3GMRB 4NOFA 1EXUA 3C5ZA 1J11A 2WW8A 4WI7A 1YN6A 3KPMB 4HXBH 5C07A 5MEPA 4HJJL 4JJHA 3C2AH 4LVHB 5SX4I 5J8OA 3OXSA 4M62H 5INDA 5IHBA 5B22A 3WFDH 1HK6A 3QUXC 3I3DA 1NDMA 5LG1A 4OZIF 3C5ZB 3OX8A 1SEQL 3U7YH 2YXFA 1JGLH 3OXSB 5INDB 5HDBF 4KK5D 4POYA 3NPZB 1Q72L 2J8UE 4Y4FD 2X4UA 4R3SA 2OBGA 1J10A 3MLYL 2I26N 1NDMB 3OX8B 4FFZL 5KAQG 3IFNL 3FTGA 4G9FA 4JG1L 1IE5A 5A2IH 4MJ2A 3O3EB 1S9WA 4MXQC 1FHGA 3GIVA 4ZUUB 4NT6B 3EO1B 2X4UB 5A2KH 1KN2H 4NGHH 4I2XE 4OGXL 3IAPA 4G9FB 1GCFA 1NCWL 3GIVB 4CMHB 4PJBB 3WLWC 1M05A 4FQXD 1A2YA 2ARJA 5EZIH 4Y19A 3ULUH 2Z9TA 4NN6B 1ZVHA 3RGHA 5HGHA 2OR9H 4UIMA 4ODHH 1ZT1B 3QWOB 3VDBA 1A2YB 3VFWA 4FFWD 2ARJB 5FYKE 1SY6L 4GW4B 4Y19B 4DGIH 4XB8A 5HGHB 4YQXL 1HZHH 4UIMB 2C3VB 1NEZB 3SKOA 4Y1AE 5F7WC 4P3WA 1UWGH 3I6KA 4UMGA 3ABZA 2B8OT 3VFWB 3P9MA 3VRIA 3QJHB 1YEEL 3RKPA 1CGSH 5E2TH 3LKNB 1IEHA 4GAFB 3SKOB 5D2LE 3QDGE 1L6ZA 2VQ1B 5HPMA 3I6KB 2WK2A 5GGVH 1IAIH 3ZHDA 1A7RH 1D5BA 3P9MB 4JRWA 4MX7A 4YXLL 5HDQH 1QEWB 5GZND 4U0RB 1HH9B 1UJ3C 2MMXA 2X1PA 4OQ1A 1GL4B 5HPMB 2R0ZL 1BVLA 4ZS7L 2FECI 3C5ZD 1R0AL 2XG4A 3KXFE 4HC1H 4MX7B 4GMTH 4ZTOL 1V7NH 2VUOA 4IRJB 4PJEA 1A3RL 2OTPA 3WFHA 4U1MA 1HKFA 1MJJA 3S8WA 1BVLB 3MLRL 1MFBH 4PS4H 3PWUA 1WTGT 3I85A 4PJEB 2YKLL 2CK0H 3QDJE 4RFNB 3WFHB 1S7VA 1MJJB 1CXFA 3H9SB 2V6HA 1J87A 2HA1A 5HYIA 1NANI 5FECA 4G9FD 4YDKL 5FFLA 3P4LA 1VEPA 3PWUB 4QRPE 2CXGA 5D1ZA 1BAFL 4ZQKA 5D7IB 1S7VB 3QXDA 1QSFB 3OKNA 1S8DA 3UC0H 5I71B 3U2SA 4BZ1H 5E24E 4N90D 2CDFA 5HHVH 1QFOA 4X6DF 5FECB 5FGCB 5DSCA 1FCCA 4HT1H 3PQYE 3FB8A 4HGMA 1P2CA 1RIUH 1OTTC 5D1ZB 1QKZH 1P53A 5CLTA 2FR4A 1FVDB 4JG0H 5DJDA 4FABH 4Q9QL 4O9HH 3OKNB 1S8DB 4OZIE 4Y19D 3MA9L 4PR5B 4KUZH 4JM2C 5DSCB 2IPUK 5HDBE 4JEGB 4GQ9L 1N3NA 1QFPA 5C0RH 1MCCA 4PJHB 3ZTNL 2EKSA 2W9LA 2BK8A 3NGBC 4OCRL 4OZHB 5DJDB 4MA7H 1QLEH 3O8XC 5KSVA 3LD8B 1ZLWK 2FATH 1XF2A 1AJ7L 2WBJB 2DQDH 4KROC 4H0GA 2EKSB 3D0LA 4HKJB 3CVIL 4TN9A 2GEEA 3FO1A 5M7QA 1K6QH 5L6YL 5KSVB 2YK1H 4KI1A 5KAQF 2DAVA 3ZDXF 1GIGL 3VWKA 1B6UA 1DQJB 4WW2A 1I9EA 2AEWA 4V2BA 3D1MC 3SO3C 2W0FA 5DUPH 3NH7H 4IIQC 2H32H 4IRJD 5HHOE 3I9GH 5I66A 4C58B 5CUSL 3G6DL 4X4XB 3VWKB 4LF3A 1TZHB 4QRSB 3G08A 2P5WB 4WW2B 3ZE0F 3GMMB 4CW1A 5KJRH 2YMXL 2W0FB 4UBDC 5I8OL 1BQUA 2DQUH 3QFJA 4OJFL 4NM4H 3MRGA 2I9LA 1ORQA 9CGTA 4LF3B 4F57H 3MRCA 3G08B 3U0WH 5DA0B 5GHWL 1C5DA 4CW1B 3RUGF 2Y23A 1R5IA 1IGTB 5B21A 4R7DB 3G9VA 2WIIA 1FFNB 2I25N 1C16A 3VXUE 3CH1A 1ORQB 4KHXH 5IT2L 4PGEA 4MB4A 5L88L 3MRCB 3RY6C 4PJ5E 3E6HB 3PABA 3CDYA 1PG7W 5DGQA 1TCMA 5H37H 1YPZF 3WNKA 4XC3H 1YN7B 4NWTH 2RFXB 3B4NA 4YPJA 5D1ZD 1C16B 1KCRL 4WFHD 1G7JA 4GKOA 1XF1A 1KT2A 3PABB 4AEIL 2Z4QA 4XXCA 3K8KA 1RZJC 3RX5A 1NSNL 3DWTA 2B20A 4PIRF 3FQXB 4IBLT 3GM0A 1G7JB 1NFDA 4WU7B 2R56H 1U9KA 4UQ3A 3HC3L 1KT2B 3VFNA 1SVCP 4YBQD 2UUDH 2P5EE 1J12A 2PUQT 3BWUC 4EXPX 4MJ6A 3SN6N 5HHNA 3DV4A 5GRJL 3A6BH 3AXLA 4C56B 5FK9A 4KRPD 4MD5B 4XWGH 3EKCA 3VFNB 1T0PB 1VENA 1REIA 2V2XB 3H9HB 2QR0A 4MJ6B 4XC1H 5JW5B 3MRHA 3NCCB 1MLCB 3AXLB 5E5UB 5C86A 4O58L 3WFZA 1UCTA 2IQ9L 3BVNA 4XP9H 2BNQA 4X6DE 5ILTL 1LK3H 2APXA 3PHOB 1KCUL 4POUB 4YHPB 1S9YB 5JQHC 3OB0K 2QR0B 2HG5A 1XGTA 4R0LC 3LKQA 3VWKD 1YYLH 5AUMA 4YX2L 4UB0H 2IGFL 2EDOA 1FPTL 4U2ZA 1T21B 3BVNB 4KVCH 2BNQB 2OCFD 1D5IH 4X4YB 2XY1A 3ARRA 3BE1H 5F1KC 2HG5B 3DSFH 4QOKB 3UAJD 2NW3B 1QFHA 5AUMB 3IDXH 3TN0C 1NQBA 4PJ9C 5SWZA 1CT8A 1CGTA 3OWEA 2B1HL 5B39A 4KKCD 3QFJD 4MQSB 2JCCF 3CXHJ 5K9QG 7FABH 1JYVA 1KACB 1HZHL 4PJ7A 1U8LA 1F4YH 1MFCL 4UZGA 3B2VL 5GRVL 5SWZB 1CT8B 4LPVA 1CD1A 4O2FA 1K3ZA 4GH7B 5B39B 5I1IH 3S34L 2PR4H 2XICA 3ZDXE 3TO4A 1H3WM 1Z6JT 1A6TA 5GJSL 1EEYB 4L29A 1N2RA 3MODL 5E2UL 2JK5A 1CD1B 1ZLVK 4O2FB 3WO3B 3VG0L 1A7RL 5HDQL 1BLNA 3GSQA 1MHHB 5BW7C 4UV4H 5TF1L 1MIEL 1RY7B 2QJDA 4APQC 1NAKH 2PW1A 3ZE0E 5I1HL 4I18C 3L7EA 4L29B 5IHUL 4DTGL 1N2RB 2EC9U 5IMOA 3LKSA 3GZKA 2FD6H 2FIKA 2ZPKH 3O2DL 2WWKO 4HPOH 2JJVA 4RBPH 3MUJA 2OI9B 5EPMA 2PW1B 4PB9L 3JWDL 3L7EB 4GS7B 3RUGE 5IMOB 3LKSB 1TZIA 4WWKB 4Y4HB 5IVXA 2FIKB 1Q9OA 1C8PA 3VFTB 4GRLB 2GJJA 3T0EC 2I5YL 4QHKI 4KDTC 4BH7B 5EPMB 4DKAA 4H88H 3WUZA 3PDGA 4G8EA 1TZIB 1YPZE 3B5HA 1J1XL 1NCCL 2QTEA 4J4PD 3BD5A 4CJ0A 1LK2A 3LN4A 4M1DH 4PRPA 1DQLH 5MHSE 3GI9H 2BNQD 4QGYA 3TBVA 1BECA 3GIZL 1X7QA 4G8EB 1UWXH 2Y4SA 2ZKHL 1O0VA 4OM0H 1UZ6E 2XPGA 3F62A 4NJAH 5IF0B 3QEGH 3H3KA 5E9DE 1S7UB 1JP5A 3LN4B 3UO1H 2PTUA 3P4OA 4PRPB 4LCYB 2P7TA 1AXTH 2D0HA 4QNPF 5IHZA 3TBVB 4QRQA 1E4JA 2XT1B 2FSEB 2O5XL 3UP1A 4LLWB 4KAQH 5CKAA 5EUOF 2QL1A 2DQEL 3P4OB 3DI2B 5SWZD 2ICEA 1KCVH 2P7TB 2UZIL 4MA7L 4M48L 5T1DL 1TNMA 4MDJA 2LU7A 3RVUC 1KGCD 4EI5C 4K7PL 1TLKA 4UAOB 1CVSC 1G9NH 2ICEB 2R8SL 3RWEA 4L3EA 4F7CA 2YK1L 2WZPD 2ESVA 5HYFA 5IP4A 2OTUB 1HCVA 3TO4D 5ADOH 2OZ4H 4AQOA 5I1JH 2XQYK 1BQHA 2COQA 3O4LA 2F9BT 3M8OH 3RWEB 3QAZB 4F7CB 3CFKA 4N8PA 1N6VA 2ESVB 1FN4A 4ODSH 4XP1H 1TVHA 3H42H 4WTZA 5CP3A 2YD7A 3GBNH 4XNUL 1D5XA 1WFUA 1GGUA 2HP4A 4YWGL 3H3PL 3MV7B 1BQHB 5JUEH 4NWUL 4Y4HD 4NO5A 3DSNA 1I85C 3PL6A 5ACZB 1U42A 3BD3A 3CFKB 1RIHL 4JRXB 5IMLA 1ZSDA 1FN4B 2DQUL 5EUKA 1H3PL 1TVHB 3EYUH 4YHYC 1J86A 3UTTE 5LVEA 1AFVL 2R29H 3QFDA 4D0BA 4KK6C 1FNHA 3D39E 4UINL 4O00A 1JZ7A 4NO5B 4QLRA 3PL6B 2WUBL 5IMLB 5D7JC 4QHMB 5EUKB 3ZTJH 2R0WH 4CADB 1RUKH 5IHLB 3QFDB 4M7KL 4D0BB 3CNKA 4NNYA 3GHBL 4ZPVB 3CFJB 5AG8A 4U6YA 1QFUL 5FYJL 3WHE1 5LKNA 2YD6A 4RIRA 4JO1H 2I60H 4XC3L 3W0WA 4Z7NF 1GPOH 2OL3B 3QXUA 4PRPD 4MJ4A 3BEVA 4IJ3C 1BFTA 4PJXF 4PJCF 2F5BL 4XVUD 4YFEA 3DURA 5D8JH 4RIRB 4ZUWA 5IK3A 4OM1H 4KKLD 3RVWD 3NA4A 3ECBA 5KS9F 2ICWJ 2B5IC 1JGUH 4HQQL 1L9MA 1YC7A 1NMCB 2VISA 4EUPB 5IK3B 3QRFM 1HKLH 1P5UA 1BP3B 3QZWG 1EV2E 1FNFA 4LARL 4LSTL 5FCUL 5TE6L 4TNVF 4LVEA 3ZDZE 1LO3L 4CN4A 3O6FA 5CJXA 1CR9H 1UG9A 5T3XD 5GS0H 4PJGF 1HHJA 2F8OA 2OP4H 1XAUA 3MA7A 1F3DH 1BX2A 2RCSL 4L3ED 3DHJA 1MHEB 4XP9L 2ESVD 3FRUB 3O6FB 1KTRL 2X4TA 1BBDH 1XGRB 3EOTH 3HPLA 3E3QC 5IJKC 4UT7L 3I02A 3FHQA 4WFGE 2HFTA 3MV7D 4Z77B 1U2HA 4UB0L 3MA7B 3O4LD 4QNPE 4JDVA 3RWFA 1BX2B 1DBAH 4YO0A 4XBPB 1RUQH 4FQ1H 3R06A 1HI6A 1H3XA 3IU4H 5C9KA 4WO4C 4L8CA 3UPCA 3HPLB 5AD0A 4YGAB 5CJOH 1JZ2A 5EUOE 1CFBA 2AJVH 1T89C 2Q8BH 4PV8A 1CLYL 4OZGA 1PEWA 1U91B 4KI5F 3PL6D 4LEOB 5JOPD 4YO0B 3RJDA 2CJUL 4PD4J 2QKIA 4L8CB 1J1PH 3CSPA 5AD0B 5D1XA 4N9GA 3X17A 5DTFA 3QCVL 4M3JA 4NZUL 3SGJA 4PV8B 4OZGB 1FSKB 1EAPA 3V52L 3E0GA 2AJUH 2DM4A 1AGFB 3CLFH 1BOYA 5D1XB 3ZSTA 4N9GB 5DTFB 1ZEAH 1YQVH 4FOMA 3W11C 4QO1A 3MLXL 1UH3A 3NFNA 4XP5L 1NMAH 5L9DL 1A4KB 4BM7A 2IQAB 4U1GB 1MCRA 3W0WD 3REWA 2A77H 1OP3K 4ZFOA 3BZFB 4OQTA 25C8H 4NHCH 4WFEE 4ONGH 2IC2A 3SE3A 3FFCE 3RNQB 2ZPKL 3MBXH 3PJSA 5IFJA 3AB0C 3REWB 4WDIA 4BSVA 1QTYT 4M9PA 1EEQA 2LVEA 3WNPA 3D85A 5C0AB 2VLRE 4LSDA 3VCLB 4M7LH 5F9JA 3WO4B 3MLSH 3Q5YA 5D71L 5EU4A 4Z78A 1SMOA 4H26A 1G0YR 5EU7C 4RA0C 3V2AR 2OL3H 1CF8L 4WDIB 3OSKA 5GRZA 1WZ1H 2K1MA 1J18A 4P57B 4XPAH 3MLVH 3NTCL 3KLSA 3O6FD 2PYFA 3BFOA 3QG7L 1R5VA 3DVNA 4OD2A 4Z7NE 2MHAB 2A2QT 4PJXE 3P77A 4PJCE 1E4XI 4KKBD 4Z8FH 4O4YH 4AIOA 2J12B 4HJGA 4EUPH 4KZEL 5FO8B 1R5VB 3DVNB 5DQJB 1X4YA 3T0AA 1VGEH 4LBEA 4CBPA 3P77B 3TH3T 1HIML 3DYPA 4HZAA 3S4SA 4OF0A 3DBXA 1NCUA 5T3ZH 1J9CT 3QHZH 4LBEB 3AGVA 2IPTL 2H2SD 4DCQA 3RGVC 2ITCA 2R1XA 2Y6SD 1GGCL 2HFFB 1AO7E 5D1XD 4PJGE 3MLPA 4FQCL 5GRUL 5E1AA 2DTSA 4PRHA 4WHDA 5HHMB 2X05A 2ITCB 1T0MA 2FEDD 2R1XB 1CQKA 4ELKB 3TJHC 2V5SA 2CLZA 5F7NC 5DJ8A 5ADOL 4P59L 1IFHH 3OR6B 1RJLA 5E1AB 4QXGL 4PRHB 3M8OL 5EFIA 3OG4B 2VXTL 4NM8L 1J0KA 4W6YB 2AXGA 1T0MB 2APTA 2NX5A 3P0YH 1T83C 4X0KA 5C0CA 1DP0A 1NGWA 4JQIH 3PXJA 1S9KC 3U9PL 3D25A 1LGVA 2JLLA 4KI5E 5EFIB 5DEGA 2XTJE 3ESVF 1QZ1A 2NX5B 5DC9B 2N56A 3MREA 2Y5TA 4X0KB 1RZ7L 5C0CB 3JUYA 2HRLA 4XNQA 3TH2T 1IQWH 3D85D 1Q9KB 3CLEL 3PP4L 3STZA 3OGCA 1INEH 5CKGA 1S9XA 4XXDB 2OJEA 5KTEH 4K3DH 3B9KC 1I7UA 2EEBA 3MREB 3HZKB 2PW2A 4ODXB 4DGVH 5SV3A 4MQ7B 2VLME 2A73A 3STZB 1IC4H 2W1NA 1IL1A 3D2UA 5INCA 3ULVH 5C6PB 3MRNA 1S9XB 1BM3L 1ZGLM 1I3RA 4GAGL 3T77A 1I7UB 5E4IA 2PW2B 1YEKH 1TJGL 3MQIA 3EJYD 4YJZL 4MNQE 2IANE 1SM3H 2YPVH 2ICES 4UUJA 3D2UB 5INCB 1CXHA 5T1LB 3MRNB 4LOUC 4H8WL 5CSBA 1YEHH 2W92A 4IDJH 1PLGL 1I3RB 3T77B 2XZQH 5E5MB 3GMLA 3FQWB 3SKUD 1U0QA 4UUJB 1YECL 1CDGA 1MF2L 3G5ZA 5EBMB 5IB4A 3AREA 5BXFA 4JO2L 3TBYB 1OARH 3AU1B 3WNNA 3CGTA 4QWWD 3CK0L 3T2PA 2F19H 1A22B 3GMLB 3SKMA 3TFKC 1WBYA 1X5LA 5IIEA 1JGDA 1H15A 4LLMA 4N0UE 4G7VH 1DBKH 3R0NA 1CLOL 2GY7B 4ELMA 1BJ8A 5FO9B 1PVHA 1F00I 1CXKA 4LLQA 3CUPA 2E8YA 4PRHD 1I1YA 3SKMB 3TZVC 4WY7H 1ERNA 2HT4C 1UJ3B 1VDGA 1YYML 3KYKL 3AS1A 4LPCA 1C5CH 3JSSA 1JGDB 1WWCA 3QHTC 5F8QC 3WFBL 3I3BA 2QQLH 3PF2A 3MV8A 4BELD 3OAZK 1OTUD 3FN0H 4YDJB 5J06A 1MEXH 5JLZA 4OZ4A 4P4KC 2NX5D 2H9GA 3IU4L 1T1ZA 2AI0H 5C0CD 4JFFE 4RX4A 4KTEL 4YHZL 1ZGLP 3TP4A 1ZKAA 2XACC 4NQDA 1T03H 1TENA 2BHZA 1H0DA 3L5WB 1J5OL 4G6ML 2Q7NA 5JLZB 3QA3B 4OZ4B 1L4IA 1MJUH 2GSIA 2QBWA 2H9GB 3MMEB 1QA9A 4BQBA 2OJZL 4QRTB 4AG4H 5T3XL 1OAUL 1F42A 2D31A 4J1UB 2Y5EA 3VH8B 4NQDB 2VSDA 4UI2A 4R2GD 1PKQE 2BFVL 1NUFA 2D9CA 5GS2D 1U3ZA 2ORBH 3GSOB 5I15L 5J13C 2GSIB 1LQSR 3M1BA 1QBML 1QA9B 4JM2A 4IOFC 2PN5A 1DANT 2W65B 1JJUA 3D2UD 2FJHA 5T1LD 3B2UC 3EYSH 4RWYL 4UNVA 3MOAH 4JM2B 4WI8A 4P46C 4XX1G 3GHEH 1QBLL 4R90L 1BJ1J 5C1MB 2FJHB 4H5SA 2IJ0C 3NGBB 1AXSA 5J1TC 1OW0C 3MRFA 3L95A 3O8XB 2C4XA 3DXAA 4D0DA 4AT6B 2BZDA 2LU3A 4L8DB 1EO8H 1J0IA 3FQNB 2YBRA 1I9IL 1K8DB 4H5SB 2Y07L 1EHLL 3ARED 2AEPL 4PJFB 1LDSA 3MO1A 5SWSB 3MRFB 4Y4KC 3QIBA 4LSVL 3QQ3A 1VCAA 3DXAB 4D0DB 2IALB 3FB5B 2OL3L 1I3VA 1NGPL 4FQHB 3BDXA 4K2UL 2VDMH 4NZTL 1A4JA 1ES0A 2DWEA 2R2BA 2X4OB 3KPRE 2R2HA 4YXHL 3RVVD 1NFKA 4RMWA 2NY3C 5EBGA 4JO3H 3MOBL 2VDOH 3CX2A 3GO1L 1T20B 4MVBC 3SO3B 1F11B 2VAAA 5DJCA 1KFAL 1AGDA 4IIQB 1C5BH 1MCNA 4FQ2L 3SPVA 2NY7H 4YFDB 2BCKA 1ES0B 2DWEB 2R2BB 2R2HB 5JHDE 4QXTA 2G75A 3MV8D 2VDNH 1P7QA 4O5LL 1BVKA 4X7FC 5KSUA 4HUMB 1LO0L 5BVJA 2VH5L 4BKLA 4ZTPH 3DMMC 1ETZB 1X5FA 3S35L 1NC4A 1EK3A 1ZS8B 3T2OA 3SOBH 4ODBD 2G75B 4KGLA 4QXTB 4FQPA 4RX4D 1BVKB 3GMPA 4NQDD 5KSUB 1A47A 4G5ZL 4QXUL 1QR1A 4X7TA 3CVHA 4BKLB 4AH2A 3T1WA 3K1KC 2A9MH 1NC4B 4ZMAT 1X5GA 4H1LG 3PWPE 3VFVA 1JTPA 4MD0A 3BH8A 3HA0A 4OV6F 3U30C 3CAFA 4M1CD 1RZIB 2GFBB 5DZNA 5FOJA 4XVTH 5FUOH 2X4NB 1QR1B 4XPFH 1A9BA 1U41A 1ROWA 3LQAC 4AH2B 1EGJA 1G6RB 5FA3A 2YPLE 3BRFA 5KZCB 3VFVB 4MJIE 4LRIA 1JYWA 1F90H 1ACYH 4MD0B 4JM2D 4R7NB 2YD1A 4HG4K 3HE7C 4YDIH 5CIPH 4IMKA 1A9BB 1T04B 3E1F1 2LVCA 1GH7A 5ID1A 4WJ5B 5EB9A 4I0PC 5DEFA 4W6XB 3V7MA 3V6ZA 3QI9C 5JIHA 2CDEA 1YY9D 3MRPB 4LSQH 4FZ8H 4R97C 5DVLA 4M00A 3TVMC 1LEGA 4UT6L 5SWSD 4Z9KB 5I16A 3OJMB 5ID1B 3DXAD 1BOGA 1ZAGA 1AC0A 2R23A 1OTSC 3V6ZB 5JW4R 3GMOB 5BV7B 3FB7B 1K3IA 1SJEA 3C5SB 4E41E 1TETH 5ICXB 5I16B 2IAMC 4AK1A 4C83A 1U8JB 3QT2A 2R23B 1S7XB 3IXTA 1SVZA 2ZUSA 4DGVL 1SJEB 4PJ9A 4JDTH 4X4ZA 1AY1H 4ZDHB 4C83B 4K8RC 2WWKT 3IXTB 1J8HA 3D9AH 4ZFOL 3OF6A 4OQTL 2HJFA 4Z0XA 3WJLA 4JQXC 2YUVA 1YQ2A 5EULV 3CSYB 3SGKC 4PJ9B 1UACL 1P7QD 4G80B 2HRPL 2CD0A 1MI5A 3QQ9D 1J8HB 3RX8A 5ALBH 4UTBL 1NC4D 2VYRE 2MJWA 2E6QA 2NY2D 2ZJSL 4WFFE 5HHXL 3ZL4L 4LPTA 2UZYB 2AJ3A 5D7KD 2ED8A 4J3VA 2BMKA 1MCPL 4BZ2H 3NCFB 1FJ1A 1KPVB 1LD9A 1VFAB 1KF9B 3IAQA 3MRRA 4PLJD 3SQOL 5I1EH 4JGMA 5HPOA 5KZCD 1DSFL 4I18A 3QNYB 1BIHA 2BMKB 5H35A 3D18A 1HXYA 3JV5A 3TPUA 4Z7VA 3MRRB 4APQB 4J8RA 4I18B 1MVFA 1KYOK 2QQLL 3CJJA 4LEXH 3D0VA 4MDIA 5H35B 1IAIM 3D18B 1HXYB 3TIDA 5CEZH 6FABH 3TPUB 3FN0L 4KDTA 3SBWC 4LIQE 4J8RB 3UJIL 3QXWA 4XBEL 3WKML 2XKNA 4ESKA 3WSQL 4MDIB 5I6XC 1JIBA 2NXZD 3KS0J 3KPOB 3AUVA 3KJ6L 1M7IA 3TIDB 4OZFA 3WIIL 3BXNB 4I1NB 1G6RH 4U6HB 3BISA 5FCSH 3QUMA 2GJ6E 3OKEA 3P4NA 1OAQL 3RVTC 4FN0A 4ZG1A 5AG9A 3HNTH 2CRIA 5A2LH 4NQEE 4LSRH 3ILQC 4OZFB 3NZHL 2AJSH 4N1EA 2HWZL 2VZUA 5F9WC 4OF7A 4XVJL 1OGTA 4LSPL 4N8VG 3OKEB 1ND0B 4PTTA 5F97E 4TSBL 1NPUA 3EOBB 1LE9A 4ERSH 4U1JA 2X09A 3F7RA 3BI9X 2FH8A 5FM5M 2DI8A 3C6LA 1EVTC 4PJ9D 5I8KH 2VDRH 3KYNA 5JW4M 1OGTB 2UVFA 5D72H 5DF0A 1IGJA 1UM6H 3IXAB 4PTTB 1S3KL 5EZJB 1J8HD 3RIFF 3OF6D 3UBXI 1LE9B 5CBAA 4U1JB 2CSPA 1K5NB 3BH9B 2R9HC 3OKOA 2A6KB 3RIAF 4TVPD 3HE6A 1IGJB 3B3IA 1MI5D 1GZQA 1B9ZA 4QXWA 3R8QA 4HIJA 1EO8L 5GS1A 2C26A 4EI5B 4TNWK 2FIRT 3KPSA 2PXYC 3FQUA 2BOCB 4G7YH 4F58L 3B3IB 3U7WL 2DRUA 3MLZH 1BWWA 1OY3B 4XCNA 4LCUA 1LO2H 1YZZA 4APQD 3V5DB 1KXVC 4QHUA 2DIAA 4PGZA 3QEQA 5IBTH 3KPSB 1FGVH 3FQUB 5C7XL 1SJHA 4OB5L 1I85A 2BVEA 3N9GL 4P5KA 3VXQB 5AWNH 1U8NA 4XCNB 3O6LL 3DX9A 2NY7L 5KOVC 1YMME 4QHUB 2NZ9D 5F1NA 4I77L 4D94A 1A1OA 3KNBA 5FYLE 4KXZI 1IKNA 1VFOA 3PGFH 3G6AA 4HK0B 5D70H 2X89A 5FKPA 4JFQA 3QIUC 4YHYB 1G1CA 1GHFH 4XX1E 3S36H 1ZWIA 1RULL 5HDLA 1SBBA 3DX9B 4ACPA 4JFDE 5A2FA 1UADC 4FTVE 3V4VL 4XMKH 3O2WL 1HN1A 1A1OB 3HKFA 3FRPG 4EBQL 4F7TA 4G3YH 1JPGB 4D9LL 4EDXA 5D7JB 1P84K 3DETC 2F8VA 5JDSA 2Y06L 5L8JB 1B0RB 2XA3A 4ZFGH 4U1SA 5J12C 4QRRA 4GLRI 4F7TB 4EDXB 3BP4A 1QRKA 3VXMB 2X4SA 5C9JA 1FFRA 5JDSB 4XPFL 3G6JB 1PYWA 4HD9A 5JXAL 4IJ3B 1A7OL 2E9BA 3NCYS 4RAUA 1IGIL 4WHTB 3U6RA 4U1SB 4Q97A 5JA9A 4QRRB 4JJ5A 1MRDL 4GG6A 3VD5A 5C9JB 2C1PA 3C6LD 3G04B 1PYWB 4AIZA 3OKLA 1YA5A 2B5IB 2Z93A 4MD4A 4YBLB 2AK1H 4BH8B 4XAWL 5JA8B 1CBVL 4EI5D 2F8XC 4AIZB 5JIPA 1RZGA 3OKLB 1DBJH 5DI8A 1H5BC 3HE6D 2Z93B 4MD4B 2ATKA 1R3JB 1I9RH 5DYOB 3GI8L 5I75B 1CTOA 3EHBC 2XYCA 4BFEA 5BMFH 2DQTH 5IJKA 5GGTH 4MA1C 3LIZL 2PKDA 4GAJL 4GXVH 2HTLC 3KPSD 5HDOA 3QJFA 1RZGB 5DI8B 3WUWA 2ATKB 5D93C 3BGFB 1R3IL 4OLWH 3FONA 3S88L 5IVNA 4TPRH 1ZE3C 4YHMH 2Q1EA 1E6OH 4NQXA 5F6HJ 3QEQD 1A14H 3L3IB 2OXGA 5JZ7C 2XWTA 1P6FA 3V9FA 1UYWH 3QHFL 4M93C 1KENH 4WO4B 4HCRH 4F9PA 3T2NL 4PV9B 1MCJA 3FONB 2EE3A 5D7SH 5DFTA 1MSPA 5H2BA 3G5YB 4I3GA 5C3TA 1FL6A 4KK6D 4NQXB 4WGVB 5DC4B 2ICWB 2H1PH 2QSVA 3IGAA 1JHKL 2XWTB 4AIXA 1QNZH 1Q0YH 2X89D 5E03A 5EBWB 4HWEH 4KZDH 2HFGH 3SDXA 3PHSA 4LCWE 1JNNL 2R69H 2BVYA 5D5MA 1OB1B 4KHTH 5H2BB 1F6LL 4X8JB 3FQRA 4LVOC 3IGAB 3KJ4C 3DNKA 3FMGL 3LN5A 1OAKL 2I9TA 4HIIB 5IV2B 1U8IA 3N85L 1UXWA 4L8BA 1ZT4B 2E7MA 4QRRD 1GRWA 2V7NA 2YWZA 2JF1A 1HHIA 4HIHB 2LFGA 4JKMA 1J05B 3K4ZA 1OD7A 1Q9WA 5MERB 3A67L 4XP4H 2HT3C 1UXWB 1X5AA 2NW2A 1UM5L 3IJSB 3RIAK 1MFDH 1RUMH 4KK9C 4LEXL 1VA9A 1CIUA 2HH0L 4R8WH 1ACZA 1S78D 3BWAA 4PREA 3AB0B 3BKJL 5LGHL 1Q9WB 8FABA 1JI2A 4XNYH 3W39B 1J0YA 3S36X 3G5XB 3RI5F 3SE4A 3HFMH 4FG6C 1MCWW 5CHNA 1EJ6A 4OCYL 1NCTA 4HKBA 4PREB 3VGBA 2IADA 3CVHL 5EORL 3MGTA 3RZCC 2A0LD 5DD3H 4I5BA 1RPQA 1F97A 1KLGA 1N0XH 1KCSL 4LMQI 4Y16C 4WEBH 3HZYA 3TA3C 1RZJL 3SY0A 5CINL 5CHNB 3U36A 5BJTA 2RR3A 4HKBB 1AQKH 1EO7A 2EH7H 4XHJD 5T5NG 3UTQA 2IADB 3MGTB 1KELH 1EGJL 1TTGA 5HVFB 4I5BB 2AV1A 3IU3A 1KLGB 2DDQL 4TUJA 4MNGE 4KMTH 2ZUQC 1IQDA 1MAKA 3SY0B 1EH9A 3UTZA 5KW9H 5CJ5A 4GAYB 2DQHL 3UTQB 1A3LH 4P23A 1NCBL 3OKMB 4TUJB 1MRCH 1BHGA 3LEXA 2Y36L 3NA9L 2APVA 4ZUTB 3UTZB 3KVQA 1P4LB 5BV7L 2UYLB 4P9ML 4H20H 5LJYH 5TGBA 1ORSA 2GITA 4JFXA 4P23B 4M4PA 1G7PA 5D7LA 3RGVB 4TUOB 1F6AB 1LP9F 4P2OC 4DZ8B 2EDTA 3BIBX 1R5WA 1I9JL 2DF3A 2VN4A 5TGBB 4FFVC 2GITB 4JFXB 1OQXA 4JKPL 5K9JL 1JN6A 1I3GH 3F7VA 2B4CH 4S1QL 4JO4H 1R5WB 3OZ9H 3FKUS 1YMHA 4QCIA 3MJ9H 4IHOA 1JN6B 5I1CH 3BIKA 1QFWH 4LDLB 4XI5C 4GW5A 5EIIB 4BQ6A 2X4RB 4WCYH 5EC1A 1YMHB 4QCIB 5MI0C 2P47B 1XCQA 5LWYL 4P9HC 4IHOB 4DJMA 2BRRL 4TVPL 1AKJA 1KLUA 1W2KT 2IMNA 3BIKB 5ITBH 1CLZH 4GW5B 1BZ9B 3ARUA 5EO9B 5EC1B 4R4ND 3CFIC 1XCQB 2CK2A 1MFAH 4XMKL 1Q9LA 4L4TA 1F5WA 2FX9L 3MJ8A 1AKJB 4DOHB 1KLUB 3NN8A 5DUBB 2C3HA 2P8LB 5J3HC 3B9KB 4HGKC 1A64A 1P9MA 1F8TH 2ADJB 1CXIA 4XNXL 3ZO0A 2L0DA 3MUHL 1JF5A 5FAAA 1FYTE 5I1AA 1Q9LB 4BQCA 1NGQH 3SGDI 2BSTA 3WFCL 3MJ8B 4CNIB 3PGCA 2DQGL 2FEEL 3FT2B 2DOCA 1OF2B 1V7ML 1ZLSL 5ADPH 3EFDH 4C4KO 2APFA 3IDGA 3R0MA 4N0YL 4J7RA 2VR5A 1QD0A 2O5ZH 1F3RB 3UCRA 5GGRY 4NUGH 5I1AB 3EZ8A 5D2NA 1WUNT 2A6DA 3V4PH 1T3FA 2RHEA 3FO0L 3LKPB 2W07A 4XMPH 3PGCB 3GGWA 2H8PB 4CN6A 3GKWH 1Z5LA 2J1KA 1WWAX 3UBXG 4J12A 1QSEE 4XWOC 4P23D 5IEKA 5FO7A 43CAA 4RAHA 2A6DB 3UTPE 2AK1L 3EUUA 5CGYC 1CFQA 1W0YT 5EU6B 4NP4H 3GGWB 5EA0H 4ZO8A 5HHPA 2Z91A 2BY0A 2G2RA 4JVPA 1MVUA 3ROLA 4DUXA 4R4FH 2V17H 5IEKB 5D7LD 3QUML 1JHTA 3AMLA 43CAB 1GGBH 1KJ2H 3N1MC 1XIWC 4FMKA 1U2CA 4OD1H 1FNLA 4I3RL 4KTYA 3VI4F 4EQ2A 4P3DA 5GGTL 2Z91B 1S7WA 4M7JH 2G2RB 4KQ4H 1CU4L 2G60H 4JZNB 3TZVB 3BMWA 1TCRA 4P3CH 2P8MB 4P4KA 4Q9CA 2BNRE 5CCKL 5DO2C 1JMZA 3BDYL 3D3VE 4KTDH 2O93L 4AEHH 4AL8L 2MCPL 1FNSL 4X9BA 4KUCD 2O61B 4P3DB 1S7QA 4NC0B 2HVKB 1S7WB 4M6NL 3ARQA 5I8EA 3QEHA 5T5NF 2ZOLA 4EJ1C 4KI5C 5D96C 1FZOB 4M61B 4JPKH 3DI3B 2J8UB 2XTJC 1UYWL 4P4KB 3SE8H 1G9MC 3MV9E 3MNVA 1FGNH 5T1MB 2D03L 3EFFA 3DV6A 1B0GA 3HS0A 2M1KA 4OUUA 5BS0A 3LS5H 4WI3A 3MCLL 3QEHB 2CGRL 1AKJD 1QNZL 1FC1A 2CDGB 4XNMA 1DUZA 5JR1L 1LP9E 1F58H 4Z95L 2AXHA 5SX5K 3MNVB 1LE5A 3EFFB 1A5FH 3NFPA 5JIIA 3G5VA 3UDWC 5EIVA 4OUUB 4L4TD 4PLKC 5ACMA 1T1YB 3HAEB 4F7MB 4XNMB 4GXUM 1DUZB 4CL7A 1AXIB 2VLKE 5F7FA 5KVGH 4GFTB 1LE5B 3VFSA 4P46A 4YHOH 5KBNC 3G5VB 2RJMA 4Z6AT 1OLZA 4QTIH 4IDLA 4Y1AA 3U4BL 4LOUD 2X1XR 1XR8B 1T66C 4ZUVA 3VFGH 3BYTA 3MJ7A 3VFSB 4P46B 2V5RA 2EE6A 8CGTA 2VO5A 1CLCA 3SE9L 2NY0C 2YN3A 4FMFA 4Y1AB 1JWMA 4PJAF 1Y6MR 4NRXB 4ZUVB 3VW3L 4KRMB 1H8OA 5IVOA 3BX7C 5ITFA 5JW3L 3X12A 3TFKD 1I1RA 4NIKB 4Q2ZB 1E27A 1L0YA 4HK3N 1JWMB 5D2LB 1FAIL 4B50A 4RSVA 3DO7B 4JREC 2EH8L 3EDKA 3N50A 4Y4KB 3KXFA 4ONFL 3AAZA 5JO5B 2DTML 3DX6B 3RRQA 3KHOA 5ALCL 5TQ0H 3LMJH 4UIKL 2BXZA 1WISA 1KB5B 2NY3B 1YEFH 3JTTA 4OLUL 5DMIL 2IG2H 5KANI 2VIRA 4G8GE 1DLFH 1PG7H 3KXFB 1HSBA 3EW3B 3V5KB 2WUCH 1OGAA 2J6EH 3QDJA 4P4KD 2DKMA 4DZBA 5HYJE 1I1CA 5DJYA 5AYUL 3JTTB 5DMGC 2VIRB 1LEIB 4BUGA 3UYOD 3PXHA 4M43H 1KJMA 1D6VH 2DM3A 3DMMB 4EOWL 5DRNA 1N7MH 1A6PA 2Z92A 3DUUA 3QDJB 4HUUA 3K2UH 4I4WA 1ZV5A 5DJYB 1VSCA 3NIDF 1UB6B 3KDMB 3STLA 1AE6L 3WHXA 5BS0D 1KJMB 3PQYA 1DVFA 1V3LA 4M8QA 4QRPB 2R0LL 4JRYE 3DUUB 4HUUB 4I4WB 5I0DA 3RA7L 3ZT7A 4OZIA 3U30B 4IOFD 1YNTB 2E9IA 3STLB 1FH5L 4D9QD 3HNSH 3QRGL 3WHXB 3PQYB 4ZYKB 1DVFB 2EXYC 5BOPA 3O0RH 1MQKL 5FYKD 3A6CH 4L5FH 4OZIB 3RVXC 4P46D 3MLWL 2AK4E 5FF6A 3QI9A 4HG4J 1XF4B 3SKJL 1NUNB 2NLJA 2BY2A 2R2CA 1ZHBA 3P30L 2ED7A 3TO2A 1FNEA 4C57C 2N7AA 4Y1AD 3F7PC 1JHLH 3NFSH 3O41A 4I0PB 2ZCLL 3RWIB 4MQXC 5AAWA 3QI9B 2NLJB 3WXWL 4WCYL 4OCWL 1S5HB 3TO2B 1OSPL 2QHRH 2QSCL 3IF1A 4R97B 5JW4N 2RB8A 4U4BA 3TVMB 3HAEH 4Y4KD 3BT2H 3O41B 3CDFA 5DUMH 1CLZL 2VDQH 1TTUA 4MMZC 1OQOA 4YGVB 1QLFB 1CQYA 2N7BA 4HBCH 2NY3D 1FE8L 4W6WB 1WJ3A 4KK8C 2IAMB 2P44B 3ARBC 3KXFD 1T7ZA 1WT5A 5E2JA 5F7DB 4D8PA 2VXVL 3O2VL 4GMSL 5HHOB 1X5ZA 1KTDA 2XXMB 4HX1B 3HI1A 1WK0A 5L2KE 3SGKA 1IAMA 3CCHB 3P9WB 3QNZB 5CP7B 3Q5TA 1INDL 3O6MH 1MHCA 4D8PB 3TPKA 3OJ2C 5I9QB 3DMMD 3VXUA 3P73A 2EEAA 1OGAD 3MYJA 1JPTH 3GMQB 3QDJD 4YUEH 2W9DH 2X42A 3HI1B 2W0KA 3L5HA 4PJ5A 3DVGA 1FORH 4HJ0D 1C1EH 1J7VR 1QBAA 1MHCB 4DN3L 3S37H 1J88A 3RY5A 1Z9OA 3VXUB 3P73B 4WVRA 3MYJB 4YE4H 3VMOA 1KB5H 4PJ5B 3DVGB 1FZMA 5F1SA 1JK8B 4YIQB 4Y8DC 1EIBA 3PQYD 1DVFD 3KYOB 2V17L 3QQ4A 2CO6B 3MCKB 1GGBL 1KB9K 3FQTA 2F5AH 5IG7A 1FZMB 2PETA 5ANMA 2P8PA 1XF3A 1PG7X 5FUZH 1BJ1H 3I3EA 4YHKH 4MLSA 2QADB 3LPWA 5HI4D 4PRAB 4I0PD 1KYOJ 3V7AG 1I8KA 4F2MA 4U1LB 5E8DL 3F7QA 3QI9D 4LLVA 3EJZC 1CFVH 2P5EB 2EDFA 5ANMB 2P8PB 1XF3B 5JQ6H 5EO0B 4XCYB 3JWOC 4BQ9A 5B3NA 3NIDE 4ZD3H 5C2BL 5KG9A 2NXYC 4F2MB 3ZKXC 4X6DA 2P43B 1J0ZA 5I6XB 3O45A 4X9GA 3T2QA 2DQCH 3O3AA 5CSZB 5EH1A 3LQAH 4O2CA 2XN9A 3ROOA 5DRZB 1VADB 3BUYB 4QHKJ 3LS4H 3WV0A 3ARPA 4KJWC 1NAMA 4X6DB 1EJOL 3O45B 4MAUL 4KMQA 3O3AB 3IDNB 1MCIA 3CFCH 4LSSL 5GGSY 3IJHA 1PEZA 4AQ1B 4O2CB 3TYGL 3ROOB 5F3HA 3AY4C 4K8RD 2RGSA 2FHCA 1NAMB 1UB5A 5E2WH 3KHQA 3HC4H 2GUOA 1IC7H 2BVPB 2VUYA 3IJHB 5IJVA 2D4DA 3H8NA 4PJEF 4JDZA 3PIQB 4HWBH 4NJ9H 3K7UA 1T7XA 4WI9A 3IJYA 2EIZA 1XR9B 3VXUD 1VHPA 3STBA 5LXGL 4TTGA 4WUKL 3S96A 5IJVB 4NQUA 4PJ5D 3P0VH 4PP1D 2VXQH 5E8EB 2Y1VA 1KC5L 5T5FH 3IJYB 2EIZB 4EZMA 5C6WH 4ZNCD 4JHWH 1VGKB 4M5YL 3EYVA 2PXYB 3CH8A 3BP7A 2IFFH 4XBGA 1U8KA 2RAMA 1ZTXH 4NSKA 4GSDL 4WUUA 5C07E 5EZOL 2QADD 1AHWC 2XZZA 5F96L 1V3JA 4RMUA 3BP7B 5BZDA 4XBGB 5E8PA 3QIWC 5B39G 1MREL 4XPTL 3F12A 5F7LB 4NSKB 3IFPB 1NCDL 1MY5A 1SEBA 1LO5A 4KJPC 1UT9A 3GNMH 5C0BA 1FZJA 5DD5H 3RUGB 5E8PB 4LCIH 1YPZA 1J1OH 2E7CA 4U1IA 3F12B 5E6IA 4B5EA 4HLZG 1T0NA 3QIUB 1SEBB 4V1DA 1LO5B 1Y6NR 1FFQA 1FO0B 4PUBL 2X4QA 2DLTA 3S37X 5C0BB 4OLVH 2DQIL 4I9WE 4IMLA 1HHGA 3SJVA 4HFUL 1YPZB 4DK3A 1MAML 4U1IB 1JNLL 1JYNA 4J23A 3OB0H 4QHLA 4S2SA 1AD9B 4V1DB 2R0KL 4FFYL 3HR5A 2X4QB 2XN9D 5E9DA 3ZKND 1BQLH 3QXTA 1KEGH 4HS8L 3ARSA 4DVRL 3GRWH 4YC2C 3MFGB 12E8H 4UV7H 5EWIH 4WW2F 5J12B 2FBJL 4IMLB 4FZEH 3TV3L 3SJVB 3C2SA 4Y19E 4ZOBA 2D4FA 3FO2B 1MPAH 2HAZA 3HR5B 5ICYA 5E9DB 2VXSL 1TZGL 2LE9A 4G9DA 2PYEE 2XG5A 2VJXA 4OF5A 4LHJB 1MCHA 5EOQL 4EVNA 4JZJA 4M02A 5GZOC 3DUSA 4K9EC 2R9HD 1KOAA 4M1GH 1GC1L 1SBSH 4OV5A 3MXWL 4Z0BH 1OM3H 2A6IA 2NY6C 1YNKH 4EVNB 3LH2L 4PGBB 1JWUA 4JCMA 3HLAA 3ARGC 4GKZA 3VGHA 2YWYA 3RBSA 5TQ2H 1NMBH 4CVXB 5C70A 1LDPL 1Z0MA 4AENA 1H5BB 5IW1A 4YK4C 3TT1L 4OV5B 5FYJE 3NAAH 1BD2A 4FRWA 4LLUA 1I8MA 2R4RL 1GJIA 4MXWH 3HI6L 3HLAB 4GKZB 4MA1B 1DN0A 2A74A 4CKVX 1DLHB 3ARZA 4JPIA 3BSZH 1NBZA 3ZMRA 5IW1B 3BDBA 1FLRH 1FVEA 3QXVA 5D93B 5FYKL 4DKEH 4WUUD 1A7PH 5KANG 5B4MC 4LLUB 1BBJA 5L2JB 1I8MB 2HTKC 1PAMA 4FQIH 3UTTA 3Q2CA 1EFQA 4TUKH 1MLBA 1NFDF 4JPIB 1NBZB 1F4XH 2EDWA 3KS0H 4NCC2 3VXOB 3MLTA 3UTTB 5C0BD 1EMTH 3QYCA 4Z18A 4M5ZL 4PG2C 2E6JA 1CG9B 1ZANH 4XZUB 3RTQA 3EZJB 4M6OL 3SDCA 4LP4A 2XI9A 4I0CC 5FGCE 3F58H 4V1DD 1W72B 3BPLC 2HLFC 2V9QA 4LL9A 5EG6C 1ZA3A 1BQHG 4WFHE 4XHQA 2JB6B 2MPAL 3LKRB 3HNVL 3EYFA 3SJVD 3RTQB 1G9NC 3SDCB 1N6UA 1RUAL 4JY4A 1RFDL 4WTZG 6CGTA 3UTSA 1MJ8H 3RNKA 2AKRA 2J8OA 5E9DD 3FT4B 1MCFA 5I2IA 2O5YH 4XP6H 4PB0H 2YSSB 5DMJB 2Q8AH 3L6FB 3EYFB 1I1AC 5H94B 1EAJA 2B0SH 2HT2D 4NYLA 1N5YH 3CDGA 4I3SL 4JY4B 2Q6WB 1TQBB 2UUDK 5J1AA 1FO0H 2OSLB 2VWEE 5E4EB 5I2IB 3LRGA 4P5TC 4M8VA 2DI7A 4FQLH 3GSXA 4OF6A 2ENSA 5IFHH 4GUPA 4NYLB 1ZGLA 4XCFH 1CFVL 3KR3L 1TJHL 1X5JA 5J1AB 3CFBA 1A6VL 1HNGA 4PJ7F 4JY6A 4URTB 2XRAL 4OAWB 1N5AA 2DJSA 2EC9T 4Y16A 3BHBA 3GSXB 3TA3A 3EHBD 3IFLL 1WFOA 1ZGLB 3SKNA 1BFVH 4OSUH 4MS8C 4P2RA 2AJXL 2XV6B 4JCLA 4YXKL 3CFBB 2YZ1A 1N59A 4KQ3H 4Y16B 3BHBB 5KVDH 3TA3B 3RWHA 2XWBA 5FKAA 5F9OL 1MIMH 1AIFA 4RGNE 3MGOB 4O02L 3U1SH 1AGEA 4NNPH 2VL4A 1N8ZA 5JZ7D 3BN9C 3C8DA 1N59B 4K3HA 3D69A 3Q6FB 2ZUQB 4OFYA 4R4BA 1IGYB 3QPQD 1U8HA 3RWHB 3QFJE 1I4FB 5FKAB 3UTTD 4YDLC 1AIFB 5EUOB 2EDEA 3WS3B 3E2HB 1OPGL 5CGMA 2J5LC 2FNBA 3D69B 4JLRA 5CZVH 2XA8H 5IVXF 3V7AE 1RHHA 2IH1B 1FBIH 5IM7A 3ALXA 2V2WA 4L4VA 1L7IH 3TT3H 4UOW1 3GJFB 4NQSA 3RTQD 5ISZA 3SDCD 4Y5YA 4XMLH 1FC2D 4JLRB 5HGDA 5HYSA 5GSRA 2JJUA 1BMGA 4P2OB 4OI7A 2F53A 5IM7B 2V2WB 4GBXA 4JQVC 1HYSC 3SDDA 4NQSB 1LNUA 3MOQA 3IDJB 4Y5YB 3ARDC 4OFKA 1PX4A 5DK3A 4K8RL 1RJZA 1BQSA 4XGZB 1NL0H 1OHQA 3UTSD 4D0CA 4C4KT 4MWFA 3ZZ1A 1JZ5A 4MJ5A 2CLRA 4ORGB 4HIXH 5EO1A 1FP5A 4DW2L 4GBXB 1NFDE 3CFEB 5IUSA 4RBPK 2VAJA 3K4DA 3SDDB 2VLRA 1LNUB 3S97C 4IRZH 5J56B 1NGXA 4Z7WA 2LTQB 3HZVB 4IRSA 4ETQA 5ERWB 5GSVA 4D0CB 1W72H 2EDLA 5DD1H 1B4JH 2UY6A 2CLRB 4NHUA 5EO1B 4KJQC 4UNUA 5F3BA 5MI0B 5BOZG 2X1WL 2VLRB 3KPQB 5IW6B 3KPLA 4FG6D 2X1QA 3DRQA 1NGXB 1J1OL 4ETQB 3HB3D 3X3GH 5T1KA 4YFLI 2B39A 1KIQA 3QPXL 4Y16D 4Y5VC 2X41A 3N1QC 5C08E 3KPLB 3TA3D 3ZT5A 4E42A 1W0VA 1CL7H 3L5XH 5J6GA 1PZ5A 5I1KH 4NN7C 1UWXK 3REVB 5T1KB 1JRHL 1MFEH 4P2RD 1HQRA 4N8CH 4WFGD 1KIQB 3LKOB 4JHAL 3F6LA 4NRZA 4PJXB 1YJDH 4DKFH 4PJCB 5E00A 4CVZA 5JHLL 1XGYL 5KSBA 4E42B 5IB2A 1RUPL 1PZ5B 3GSNA 4S1DC 4LHUA 1HQRB 4F33A 1CK0L 5E70A 1MPAL 5I17A 4KDWA 3BZDA 4OTXL 1LO4L 3CXDH 4NRZB 2WM0A 5E00B 3B8SA 4ONHA 4OFYD 4YZFF 5KSBB 5IB2B 3MBEA 1JPFA 3GSNB 5CEYA 2IH3A 3I50H 4F33B 3JV6A 3RJQB 4Q9RH 5I17B 4PJ7E 1Q1JL 1KGCE 2ARWA 4HZLA 3ORJA 4Z0BL 5D6CB 3MBEB 1JPFB 3EYOB 4P2OD 3C8KB 1AO7B 4PJGB 4K3EH 4L4VD 4RFOL 3T0DA 4X5WA 3RDTC 5K59F 4MA8H 5DFVD 5ISZD 1EVUA 4HZLB 4PRNA 3AS2A 4FQJH 1HNFA 1NAML 1XIWB 3WIHA 2X44D 4F15B 1T7YA 4XPBH 2F53D 2EDKA 3K8MA 2K9UA 4GBXD 2HJKA 2IPUG 4X5WB 4WFED 3I75B 5FGSA 1IRAY 3SDDD 4JFEA 4OBRA 2V9TA 1T5WA 3UXFA 4DAGL 3S4SG 2B1AL 3INUH 4XI5D 4X5XB 2HYMA 5C09E 3NCEB 2VRAA 2HJKB 4IS6A 4EDWH 4WI5A 5DA4A 1G84A 2VLRD 3GJFH 1WTLA 5C0EA 5DHVA 4ODTH 5F7EH 5D96B 4IRSD 2BERA 5IVXE 2XTJB 5E1HB 1Q0XH 1VB9A 2ZSVB 3ALPA 2D3VA 1WV7T 2YUWA 3KLHD 3B9VA 3CSGA 3DIFA 1JFQL 4IS6B 2HVJA 4XCCH 1QYGH 5C0EB 5DHVB 4BQ8A 1A8JH 1KJVB 1X9QA 3BKYL 5T1KD 4MSWA 1P4IH 1WZMA 1RMFL 1N0LA 2XWJB 4BFBD 1U8OA 2HVJB 5I1GL 1SHMA 5CGTA 2XQBH 4PJIF 1A6WH 5B8CC 4OLXH 2RQ8A 1MCLA 2XKSA 5JW4Q 5FV1L 3ZKMC 4TRPH 3LEVH 1HXMA 1D5MA 1U8OB 2DMBA 5C0GA 2IANB 1N4XH 4P9HH 2Q8AL 5HXMA 4PP2B 1D9KC 4F80A 1MCBA 1IGCL 5IB3A 4LHUD 5L7XH 2LAAA 1HOCB 4R26H 4DVBA 4XWOD 1A7NL 1DFBH 1PSKH 4HFWB 5DS8B 1G6VK 1D5MB 4HH9A 2NY0B 3QDMA 1L9NA 4P99A 3MBED 5JMOC 5F6IC 4HULB 5ENWA 1AO7D 2DLFL 4FXGA 4M3KB 4XCFL 4DVBB 1A9EB 5IROA 3V0VA 3SGEH 4M4RA 4HXAL 5C6TH 5CBEA 4F37K 2BHYA 1E4KC 4Y5XA 4L3EE 5CD3B 4ODVH 4N0UB 4JREB 2EO9A 5AEAA 4OSUL 1GGIL 2W9EH 5A16A 4TVSa 5IMKA 4OGAC 1G7MA 4HF5H 5SX4H 3O4LE 4UILL 4QTHA 3T65B 4Y5XB 2GQHA 3OJDB 1U8MA 1M6OA 5DO2D 4YLQT 1BJMA 1EBAA 4YEFA 1DBBH 4JFFA 1NBVH 4NKMA 2FWOB 4HMEA 2R4SH 4JPWL 5ETUA 3AS0A 1KXTB 5IMKB 4JFED 3TCLA 2ARJQ 5LAXB 4G6KH 1K2DB 4OCNC 4YZFE 4X6CA 2XTJD 4QTHB 5DJXA 1U8MB 1M6OB 2NTFA 4LRNH 4WW1A 4JFFB 4Q7DA 4NKMB 5F7HA 4V2CB 2YD2A 1A6UL 5ETUB 1B4RA 35C8L 3FN9A 2AAVA 5ESVA 2JELH 2XZCH 1YEJL 3HUJA 1B6DA 2NTFB 4WW1B 2ILLA 5F21B 3GBMH 1QQDA 3QCTL 2VLMD 2D7TH 4W4OA 3UJJH 5K59E 2OYPA 3QZWB 5BVPL 4OLZH 3MRDA 5BRZE 2VZOA