5DHVH

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvH00
1X4YA 2VYRE 2LU4A 4D9RD 3H9SE 4A2LA 5GS0H 2VDQH 1WWWX 5ESQA 1V05A 1FNEA 5TF1L 2VISA 3IAGC 1G7MB 1S8DB 1MNUL 1SY6A 4LHUD 4E0RA 5M7QA 4D0BA 3NOIA 4U6XB 5EIIB 1WTGT 5HYJB 1WEJH 3ZTJH 3IDMB 2WW8A 3DVNB 5LXGH 1Q9KA 3Q5TA 5DMKA 2ICES 4Y4KA 1RUPL 1T1WB 5AAWA 1EHLL 4P4KD 3QZWB 2IPKA 4K07A 5EC1A 3CC5B 2MCG1 3VFVA 3RL2A 1YNTB 2AJSL 2QQKL 4Z95H 3I3EA 1SJXA 5C0ND 3B6SB 3QNXB 1LP9F 3I3DA 5IROC 3EGSB 2VDNL 1GGCH 1OPGH 3SJVD 4JKWA 3MRCB 1J05A 4QHUA 5JOEA 4ELKB 1BHGA 2QQQA 1ZHKB 2G75A 5LCVL 4LDLB 3VGHA 2DKSA 1YPZE 3G5ZB 4FHBD 1NFDA 1GZQB 5ANMB 4G9DB 2CMRL 3VFNA 4XRCA 1K8IA 3VXRB 4FQXB 3ULVD 1CFSB 2P44B 1JNLL 1JPGA 4WENB 1WZMA 3H3PH 2O5XL 3REWA 4JFXA 1JWSB 1U8PB 4W4OC 4QTHA 5BQ7B 5LGJA 3RHWF 4E9LA 1KPVB 3ZT7A 5DI8B 3KLHC 3G04B 3EDJA 4WU5A 2GEEA 4FQXC 5I8CB 4Q6YA 1NLBL 4OLZH 1GXEA 4XP5L 4PP2A 2PCPB 1IVLA 1NC4B 2WINA 3WHE1 1YYML 4P59H 2OL3B 5E94A 3CJJA 2ZUYA 3N1FC 3OGOE 5FB8B 2K7QA 4RISH 4HJJL 4AENB 4F8TA 2I9LB 4HG4K 3V52L 1NGWB 4QXWA 4OZFG 1LO5A 1EUTA 1G9NC 2F19L 3CSPA 2NXZD 3QJFA 5KJRL 4DAGH 5F9AC 5IJKC 5BRZB 4HJJH 1RFDH 4UOW0 3VXTA 2GJJA 1MCNA 1PYWB 5H2BB 3SJVB 1TZHB 3FRPG 5DYOB 2FEEL 3TBSB 4KGLA 4U6HB 1RZIB 5T5NF 4KY1L 4FFYL 2E6PA 3BW9A 2AVGA 2MQ0A 1E4WL 4QHMA 2PXYC 4MS8D 3EJYC 3HR5A 1QBBA 4GQ9L 4Z7QF 3ZKXC 5I6XB 2Z92B 4FQXD 3OJMB 5CGMA 3IU3B 2YD8A 3MBEA 3V5KB 3UTSA 1DQQB 4U0RC 1TLKA 3QFJA 2VB5A 2VZUA 4PY8I 4RFEB 4PJAA 1WAAA 5CEXA 5EZJB 1CDUA 4XI5D 3ZKXB 3T2QA 5C08B 1FC1A 3SBWC 2ATKA 5DUPH 1IGTA 1F4WH 4L8BA 3IFOB 1VFBA 4Y19B 5JHDB 4O5LL 1XIWD 4RGMB 3UJJL 1OP3K 1J1PL 1N2RB 2YPLE 2B2XL 5D9SA 3DO7A 3GB7B 3GKWL 4M8QB 3O8XA 1E4XH 2FZ3A 5DZNA 2OJEB 2RBLA 1NFIA 4Z7UE 1EJ6A 5HHOE 4RGMC 2FJHB 2XXCB 1U6AH 1UXSA 4RGOH 4I18B 5DRNB 3W39B 1G7QA 1RULL 5HGAB 2CR6A 1K8DA 1S5HB 3G6JF 2CGRH 3K46A 5CZXD 3IB4A 5BZWB 2BNUB 4K55A 2XN9D 3GK8L 3QHTC 3OXSA 2X5PA 2F53D 3ZDYF 2NY0B 3QNZB 2VXTH 4B53A 2YUXA 3MV9A 2ZUVA 4GBXA 3M45A 4NSKA 1RHHA 4EDWH 4OD3H 4G7VH 5IF0A 1NAMB 1RJYA 4QOKA 5HHVL 3QEUB 4WHCA 2X4UB 4MQ7B 1YEHH 2AXGA 1TIUA 4MB5A 4OZFB 1U8NB 5F88B 5E8PA 3UTTE 4I0PC 4RCAA 2NY0C 4RIRB 2QBWA 5BXFB 2DQUH 3RY5A 4X4ZA 3SE8L 5DVKA 3DECA 12E8L 3SGEH 2AEPL 3MTRA 1FL3B 3GJFH 4PJ5E 1AGBB 5TDNA 3SCMB 3SKMA 5IB3A 1JHKH 3TNNB 1C1EH 5ESVA 3ARGD 3PV6A 5H94B 5AYUH 5FYLE 3SDXE 5J11B 1I8KB 2FECI 4ZUWB 2OZ4A 3S36X 4ZDHA 2OR8A 5DGRA 1C5BH 1UC6A 3MRQA 4TSBH 3U0PB 6FABL 3UBXA 4RAHA 3NBNA 4K8RC 1C5BL 4RAVB 1KFAH 3ZDYE 5HD8D 1G6RA 3IYLW 5C0RH 3IKCB 3RUGA 2AV7A 2FIRT 2X89D 4MSWA 1AXIB 1DLHB 1T21A 3CIQA 3HZKA 4P5KB 3RGVB 2D7TH 5EO1A 4O2EB 1OAXH 1VSCA 4OGAC 4CN6A 4XBEL 3HAEG 3HC0A 3GMNA 4FQCH 4HJGB 4O51A 3MR9B 4U7MA 4Z7NF 2JELL 2OZ4H 5AUMA 4FFZL 4EI6A 3ARYA 1AJ7H 1FO0L 4Z76B 5F6IB 4PGDB 5IEKA 2CIKB 5T1KD 3NA4A 3O9WD 1QFPA 4X6FB 4YDVA 1EV2E 3TZVB 2E9WA 3AB0C 3MRKA 2BOBB 3VG9B 3GZKA 3OJDA 5IIEA 3LHPH 1Z6JT 2L4OA 3I6GA 5EWIL 1R0AH 2B4CH 3JWDC 4JY4B 4X7SH 5TPWL 4YIQA 5JXAL 4JFDB 3B9DA 5EU7C 1JCKA 3F5WA 1TQBB 3K1KC 1MIMH 4HC1H 4V2CB 1TTGA 3CMOL 3V0AC 3EYQD 1JGEA 1HQRA 1UJ3A 5D7SH 3T0EB 5K59F 5FGSA 4DGVH 3Q6GL 2GY5A 1E4XL 1RY7B 2VXUL 3H42L 3MLUH 3QWRA 4LLMA 3LDBC 3SHSA 4QY8A 4K23L 2NY4B 3X14B 4RDQF 3TFKC 1U42A 4L9LA 2NR6C 2WUBL 4P4KA 4JFPB 1H3PL 1M05A 2EYSB 5C0EB 3DTXB 4L1HA 5IMMB 5D1ZC 3SQBA 3FKUS 1CU4L 3O4LE 4RX4A 4PREB 3VXUD 4M7LL 1I1AB 3LKOA 3PWPA 3WUWB 2YR3A 1U8OB 4EDXB 3MV9E 5ITFB 4FQLH 4HUMB 4GBXC 3VI3E 4JO4L 5EN2B 4MJ2A 3BP4B 2I9TA 3P11H 4PJ7F 3WHXA 3CFDB 2APBA 3O45B 4KI5C 5HYJE 3PHQA 4YX2L 2VQTA 4I2XE 3QI9C 1FCCA 4OBRA 3VH8A 5I18H 3KXFE 1ZLWK 1PG7H 1HKLL 1UACL 3NGBB 1BQLH 3S37X 2NXZC 1GL4B 4LEOA 2Q76B 1GZPB 4M1GH 1JGUH 4HIXL 3U46A 1IEAA 5D2NA 4OCRL 5CP7A 5GRUL 25C8H 1WBZA 1GOFA 4RZCA 3GSRA 5I66A 5H8DA 3VDAA 4PG2C 5DR5H 3AS2A 4M43H 2IALB 5J12B 3VFSB 5IBLD 1F3JB 3GK8H 4QHKJ 3T1WA 5D2LE 3MRLA 4JFFB 1EEZB 2ORBL 2CDEA 4MZ2A 4XBPB 2EO1A 4L9DA 5HHQB 2AJ3B 3QO0B 5HGHB 1T5WB 5DJDA 3WIIL 2BNRE 4JO2L 1MIEH 1JGVH 3TBWA 5GXBB 1UB6A 3BZEB 5DJAB 1P5UA 4X4YB 5I1EL 4I9WE 1DQTA 2I24N 1SBSL 3U7YL 3GRWH 1NDGB 5GHWH 2HJKB 3QSKB 4WW1B 3ARGB 3RNQB 5HYSB 3VFUA 3MOAL 3S35H 1PZ5A 4N0FA 2DAVA 2DWEA 4WJ5A 4IOFD 4MD4B 3BPOC 4P2RD 5KS9A 5KSBB 1EEQA 5I1GH 5FFLA 1WFUA 5E2TL 2FGZA 1K5NB 4Z7VF 4WJ5B 5E7BA 4FRWA 2HFFA 1OAZL 4ODXA 4RFOL 2EDRA 1N6QH 4JKPH 2VZTA 1I3RB 3V52H 3C09C 3QIWC 1WCQA 4N1CA 5GSVA 4EUPB 3QRGH 2DQUL 1ZHBA 1ZWIB 3FB7A 5LGHH 4L3CB 2XA8H 4X6EA 2D7OA 2Z8SA 3QXAB 5JO5B 4QNPF 3TYFA 3RIFK 3RRQA 3CK0H 1FVCB 5BJTA 3F7YB 5IVNA 1J0JA 1NCNA 1KB5A 5DFWH 4WFGD 2DYPA 5L0QB 4HFWB 4HZAA 2VL5B 1AGCA 4D3CH 2DM3A 4AJ0A 1BLNA 2GJ6B 4M7LH 4R7DA 4LLAA 2AJZA 4D9QD 1YEFL 5ISZB 3S6CA 4OT1L 2W38A 2A6JB 3LQZB 2A1WL 1MFNA 5FYJD 2V7NA 5FYLH 5CP7B 3M17B 5F1KC 1CLYH 1MY5A 4XPAL 3DBXA 2CO6B 4Z78B 4UT9L 5I1CH 1X44A 1DQJA 2Q1EA 3SY0A 5MENA 4AIZB 2ADFH 2AKRA 1TITA 3GJFK 4GT7A 1D5ZB 3FB6B 2WZPD 3TT1H 3WIFB 2ZSWA 3FMGH 4RGNB 4L4VA 3VXOA 4R8WL 2MSPA 3CSYB 5JLZB 5JR1H 5MEOB 3QWOA 3CXDH 3UTTD 2NY4D 1VKXB 2VN4A 1JGUL 3TT1L 2I9TB 4YDIH 3KJ4B 3RWIB 3NTCH 2V2WA 3O4LA 3BH8B 4FZEL 3SGKC 3TO2B 4OZ4A 5FA4A 1KIQB 1LE9A 3IJSB 3SE3C 4J23A 3T04D 5IGXL 3ULUE 1BJ1H 2Z91B 4NFCA 2NNAB 3GSUA 2P5EA 3CLEL 1M05B 1OL0A 1WLHA 7CGTA 5ISZD 1UJ3C 3GSNH 4JRXD 1Q94A 1ZANL 5DRWB 4U1GB 2DIJA 3QQ9C 4PTUA 1J0ZA 4WV1A 5HI3D 4AEHH 3OJVC 3WHE0 1XCTB 1L7TL 3T0EA 4KDVA 3C8KB 1OGAD 4GH7B 1DL7L 4KMTH 1IT9H 3NACH 4EBQH 1KJ3L 3FB5B 3MNVA 1BQSA 2P8MB 5D7KE 3VGGA 1M4KA 1RZGB 2HG5B 4W70A 3T4AA 5T1LB 4YIQB 1UM6H 4QNPE 1F4XL 3FO2B 4FP8H 3P77B 4WHDA 4CBPA 5CINL 5D7SL 1EX0A 4XVUC 5HVFB 3O4LD 5I1AA 2CK0L 3NIGF 4OZIF 2VH5L 3JBG7 2FBJL 5MI0B 3PL6C 5EU6D 5FM5M 2H32A 4PGBA 4X9HA 2PW2B 2ZKHL 4UT6L 4X7TB 4Y2DC 1MCWW 1IEHA 2FR4A 4OF6A 4X6DB 1U92B 5EO1B 2VR5A 4WDIB 4QRQA 2BVYA 1T1XA 3SKNA 1AJ7L 1FO0H 3HE7A 4N68A 1U8MB 4XBGB 5GS0C 4KQ3L 1I9EA 1KEGL 5I75C 1E27B 4P2RE 3T1FB 4TQEL 5EBGA 2FJFB 2V6HA 1OT1A 2GUOB 1EH9A 3D25A 3QDMA 5KANI 4XC3H 3S3JA 5KTEL 5FOJA 5JOPD 2BC4B 2PR4H 4LCIH 2R23A 4YDKH 5DXWA 1FFOA 3IDYC 4K7PH 3WS3A 3RX8A 1OAUH 1CFNA 1EVTC 2EZ0D 4XZUA 2I5YL 4N8VB 3PL6D 1MCJA 3F62A 4H5SA 1PGRB 5CZVH 1AE6L 4M5YH 1FNLA 1OAUL 3GO1H 3WD5L 3UXFA 3HA0A 3Q5YA 3SKMB 5IB3B 2PNDA 3T0VA 3D2UB 3BGMB 2PYEA 1JHLH 4QRUA 4TNVF 3VGAC 2P24A 1H8OA 1NQBA 4MCYA 4RFNC 2HLAA 2AP2A 2HT2C 1DE4B 4DKAA 3HLAA 5EOQH 3HPLB 3OTTA 1VADB 3WJLA 1I9JH 1QFHA 4HUWB 2APFA 2XZZA 4N0YL 4NQTA 3NZHH 3MV9B 5E08H 2VLKE 4X9FA 3EHBC 2ZUWA 3DVGB 3DV4B 4RFNB 4H26A 4KKLC 3IFNL 1ZE3C 4OF5A 1Y6NR 1VFOA 3IDXL 1CTNA 1WZKA 4M6AA 5FHAL 3V6BR 2FEDC 2VSDA 4QRRE 1E4XI 5DRNA 3W39A 4UIMB 4KVNL 5EIQA 4ZFZB 1QLEH 4J3WA 1NGQL 4M93C 2P24B 4PYHA 5E70A 2CDGA 1Z9MA 1VFAB 4Z7NE 5TE6L 1D6EA 1RZ8B 2QR0A 4GUPA 1JNNH 1VFBB 2FSEA 4LSPH 3S3SA 4YLQT 3MLVL 3S34H 1NAKL 5I2IB 2PO6A 3ZHDA 1KN4H 2EDOA 2QLVB 5AZ2L 5HDQH 4L1DA 1MLCB 5K93A 3SCMD 2F54E 3WO4B 1PJ9A 2JF1A 4Y4FA 4O02L 1NBVL 3IU3A 2X41A 2OSLA 5DK2B 2OXGA 1EBAA 4MVBD 3TJEH 3LB6D 1FJ1A 4CKVX 3MRDB 4QHMB 5IFHH 4UDTA 4XGZB 4JRWA 2PYFB 3V0WL 4DVRH 1UENA 3K4DA 5DD5L 3WO4C 5TQ2H 3VXMA 3HZYB 5KVDL 3VA6A 5HYEA 5DYOA 4IHOA 5A2LH 3O2VH 5KN5B 2B5IB 3DRTA 2Y9RT 1CDGA 3SJVA 2NY1C 5IQ9A 3ZYOA 2I26N 1K2DA 4ZFOL 3QQ3A 5FA3A 2VTFA 1DBML 4ZAKA 2P48B 2B5IC 4P46A 5MERA 5TQ0L 2AK4D 1EO8H 1HIML 3DX8B 1F4AA 1BD2B 3RFZC 4JO1L 2YKLH 4HUUA 2A0LD 2B7DT 4G6AC 4GRLD 3FO2A 5F7DA 5JA8B 4IMKA 4NO0D 4CGTA 1JZ7A 1ZANH 4WU5B 4E5XB 4JRYD 2F15A 5J1SC 1NFDE 2PTTA 4LHUA 1ZHNA 3GBMH 5E1AA 4JFOA 1CFQA 4NRYA 4LKXA 2VLRD 1FZJB 1JPGB 3PDDA 4GMTH 5B8CC 4TUKL 2J88L 2KDGA 3QIBA 3BSZH 1U58B 3JV5A 3HRPA 2IH1B 4PJFB 1BEYH 3M07A 4QRPD 5LXGL 2R0KH 4M62L 1X7QA 3BZ4A 3H9SB 4RISL 5CJOL 3KPNB 1BBJA 1Q38A 3ILPB 3IJSA 4LMQE 5DJZA 1H5BC 3EOBA 3P0GB 5EC1B 1JL8A 4UTBL 1HHIB 3UTZB 3QZWA 1I1CA 2A6DB 2X4PA 3I02B 3RWIA 3L3IA 3ZYJA 4HD9A 3P4MB 1QSED 3RI5F 5J57B 1JF1B 4RGNE 1VKXA 3F58H 1A6VH 5J1AA 3TVMC 3DI3B 3HC4L 3DYOA 3GSQB 1D5ZA 4UB0L 2AKRB 1G7MA 4PGJA 4U1HA 4JPIB 1DQJB 3WXVL 1GGIL 3HE6A 4HCRA 1HH6A 2DBLL 1VEPA 4JZOB 4LBEB 3O6MH 1RJLB 1FFNA 4LLQA 4L4VE 1IC7L 4HAGA 4XX1G 3ULSA 2F74A 3LQZA 2IG2H 2A6JA 1A2YB 1JRHH 4NN6C 4GKSB 3SDDA 3BIBX 1KG0A 2RHEA 3BH9B 3C2AL 5ANME 4KJWD 4RMUA 2X6MA 4IOSD 1G6RH 4WUUE 4ZUTB 3MYJB 4Y5VC 1UB5B 1BLNB 1KGCE 3VXRE 2VL5A 4QXGL 3MXVL 4HFWA 1NCCH 3LKRB 1AR2A 4R26H 4P3CL 3RWGA 4HXAH 4AH2A 3F7YA 2A83A 3RVVD 3BAEH 3TYFB 1HXYA 3Q3GB 2Z0BA 1BIIA 3MV01 4ETYA 5F9OH 2OR9H 4DKFH 5LVEA 1D9KB 4FQPA 5CGYC 1S9KC 1NMBH 1VFMA 1MHEA 3GRWL 4XPHH 4U2YA 5C6PB 4UTAH 5I73C 4X98B 1K5NA 2HAZA 4B41A 5B22A 4OZHB 1OF2B 4HHAA 3L7EB 1I7ZA 1FFPB 3WFBH 1S9YB 4RNRA 5C0CB 1JPFA 1KCUH 1PZ5B 4N0FB 4P2OA 1OTTD 4BUHA 4LDOB 1LEGB 3PHSA 3DVIA 2VAAA 1R5IA 4R90L 2WLYA 1AKJB 3QEQD 2HJKA 2A9MH 3IFLL 1NDGA 4WTZA 3C6LC 5GRVK 4G8GA 4LLUA 5DJ0A 2BNQE 5C2UB 4LSTH 4PB0L 4YGVA 3L3DA 4N0UE 3TIEA 3SE4C 1CL7H 3UTPD 3WN5A 1X5IA 3ZHKA 1DBAL 2WNGA 2VH5H 2NY6B 3EYFB 3D48R 5T33L 1KBGL 1S7QA 2CDEB 3C9NA 3WNKA 2ZSVB 43C9B 5GRYA 1MCBA 2PUQT 1KPRA 1LMKA 4Y5XA 5DDHA 1XGQB 2NXYC 3ULVH 5I1KL 4YEFA 5ICYB 5J9PB 2K9UA 2BX5A 1RZ7H 1CTOA 4WFHE 3GSRB 1T7VA 3KYNA 2FWOA 2OTWB 2J1KA 2DQTH 2DTMH 4UILL 3NPZB 3DXAD 1NUFA 1WZ1H 3I85A 4GJTB 4KI1A 3G6JB 1XCQB 5GS3A 1J1XL 1UWEL 4RAUB 3X13A 2YD9A 4Z8FL 2Q6WA 3EDFA 3UPRA 4QHKI 3P4LA 4FQJL 5DMGD 3U4BL 3NIDE 4AT6A 1S7RB 4R4BB 2W60A 1A7OL 3QUXC 4K7FA 3V4UL 1KLFA 1GHFH 1J1OL 5ITFA 1XGYH 4C54A 1QRNA 2Q7NA 4M7ZC 4NFBA 3R06B 3MV8A 3FTGA 1EGJA 1NBQA 4YJZL 4APQC 3MNZB 3PGCA 4WUKH 3GUTA 2CDFB 2VOTA 2YBRB 4EI5D 5T5FL 4KDWA 1KTLA 4F7EA 1HH9B 1A4KB 3S4SA 2EXYD 2ESVE 4M4PA 4G8IB 4ELMF 3STLA 2HLFD 3QJHA 3ARFB 1M7DA 1IC7H 2BMKA 4LLMB 5D5MB 1P5VA 4Y2DD 4ZQKA 4Y8DC 5F9OL 4Y16B 4Z0BL 1BZ7A 1QVOA 1RUMH 2FATH 3N1GC 2EC9U 3KPMA 2QQNH 3G5VB 2OZ4L 4R97C 4AEHL 1DLFH 5EO0A 3HMXH 5C0GA 2HMIC 4WWID 4JY4A 4R26L 3LS4H 5IIEB 1IGJB 1QQDB 2X1QA 1VCAA 1ZK9A 5CKGA 1KGCD 4P48A 4Q9BA 3G5XB 4D0CB 5CEZD 1GRWA 4NZRH 5IFJB 1JTPA 2IANA 2FO4B 2OX5A 3MLRH 5J06A 1YN6A 4EI6B 5AUMB 4Y2DA 1ULVA 3FQWA 5T1MA 1X6LA 2QTEA 5IG7A 5IVXA 3KPLA 4G43A 1WISA 3HG1B 3PL6A 1VHPA 4XCCH 4MYWB 1MQKL 1IGYA 5EOCL 5CJXC 4WTZG 1R5VB 1ZHLA 3EOTL 5IMOB 1URLA 4PRAB 4JANA 3TBVA 1T21B 2ICWA 5T33H 3MA9L 4D94A 3PDOA 5D96C 4BFBD 4MXVE 4OLXL 4TUOA 5HI4D 2XRAL 5E6ID 5FM5O 5C09B 1LEIB 1KB9K 3VMPA 1G7JB 1AQDA 2F5BH 3FO1A 1B6DA 5GGRY 3T0EE 4BZYA 4OB5L 3S88H 4JPWL 3VFRA 2R56L 4X6BB 4ZUWA 2FX9L 3OR7A 5DJXA 4K3EL 3PV6B 3RTQD 1MEXH 1A14H 3TNNA 4RMVA 1FAKT 1DQMH 3L3GA 4KV5E 5F7UA 1HIMH 4LARL 1HN1A 5EU6A 3MJ6A 4Z8FH 4F7CB 1V7ML 1LWRA 1T0NB 1CE6A 1YZZA 1ZVSA 2RFXA 4RIRA 2NY2C 1IAKA 2BSTA 3O9WA 5DS8B 1U8NA 4J3OC 2XZQL 2AXGB 4U1MA 4U1JA 3EO1A 5AZEL 4QOKB 1U6AL 3QZWG 1UM5H 3M8OH 1UA6H 2G2RB 5E8DL 1RHHB 4MLIA 1FZOB 1MCQA 3QNZA 1RVFL 1DBKH 1RUQL 2A73A 4GW1A 4NWTL 3IU4H 3FCTB 3VGEA 4ETQB 3V7AG 4JJ5B 2VAJA 4FS0A 2KKQA 2DBJA 5JXAH 3KXFB 2ZP0T 2XY1A 3DIFB 5JORB 3RX7A 2HT4D 4S2SA 4CADA 1G7QB 2XFXA 4I18A 2R2HB 4OF0A 1MRCL 1PY9A 4MVBC 3LKPB 5F8RC 1AIFA 1KJ2H 1XMWA 4XPGL 4N90E 1U93B 3L3KB 1M7IA 4G5ZH 2VLMD 3ZYIA 5I1HL 1MCHA 4P3CH 4Y19A 1BMGA 1JV5A 1R5WB 3RWEA 4YAQB 5FUOL 3U9PH 5GS0L 2VLKD 1N3NA 4OF3A 5TE6H 5C08A 4UT7L 1T7WA 3GSVB 1IQWH 3FHAA 2BSRA 7FABL 4NQSB 4I9WD 4GQPH 5GGTA 3UYRH 4GW1B 4TYUA 1DQQA 4KVCH 4NN5B 2HJLB 2G2RA 3SBWA 3KYMA 2K7PA 5FECA 3HR5B 4KK5D 3EO1B 4ONFH 2R0ZL 4NKOB 3O9WB 5DS8A 4JY6B 5ESAA 4ENEC 5DHXB 1ZLSL 2CPCA 2ED9A 5J11C 1AQKH 3MSPA 3VFPA 1R3LB 3L1OH 3WS6C 1PYWA 5H2BA 5KAQF 2PXYA 4PS4L 3BXNA 2ZJSL 3DURB 4L3EE 5TGBB 2DLGA 3MFFA 3QJFB 3W81A 2E9JA 3FB8B 1FIEA 1UZ8B 4DN4L 2MPAH 4MDIB 4OD1L 4JVUA 2V2TA 4YHLL 3L3JA 3WXWH 4P4RA 1UQSA 4OGZA 4M48H 1FZKB 3FT2B 5JHLH 1F4YH 5CEYA 4L4TE 4P23A 2CXKA 4TPRL 1M7XA 4K3HA 1CDBA 1KEMH 2WINB 3DETC 2AQ1A 3I2CL 5AG8A 4UIKL 1CGSH 4XAKD 4LCCC 2EIZB 1NSNL 5I19H 3QCUL 2BFVH 2GJZB 1FG2A 4IBLT 1DN0B 1GGBH 4JFXB 3UZVB 3IETA 5IMOA 3D18A 2CH8A 3N85L 1N0XH 2ERJC 4WGVB 1CFSA 3KLHD 4OLXH 1OD9A 3CFBA 5EUOF 4NCC1 2Q3ZA 4FQ1L 5INDB 1C5DB 3A6OA 5DVLA 2VXSH 5C07B 1CG9B 5F9WC 5IG7B 5IVXB 2VL4A 4YHNA 3FQWB 1GZQA 1KTKE 4GAYB 1Q1JL 4YQXL 4PG2A 4Y16D 5HYSG 4ZS6D 2VITA 1B0GB 3OF6D 4WW2B 4JN2B 1PLGL 4EIZC 2BVOB 3DROB 1PKQA 3VXME 5IFJA 5IBTH 3MRCA 3HZMB 1CFVH 1QLRB 3I9GH 3B6SA 3QNXA 5ENWA 4EKXA 2D7QA 5F9WB 3SKJL 3MROA 5H37H 4OLYL 4OM1L 3VFVB 2EDJA 1ACYH 2GFBB 1IL1B 2JB5L 4DGYH 2YD3A 5DSCA 4HUKB 4CNIA 1IM9B 5DD0L 1BJMA 4HF5H 3U36A 2R4RH 2CD0A 1ZXQA 5HHOD 5DMKB 3QI9A 4PJ7A 1FL5B 1UH3A 4K23H 4BZ2H 4JDTL 3IDMA 2UY7A 4BFGA 4U6XA 5EIIA 5HYJA 1G7LB 1M7DB 5IVZB 3QJHB 4NWTH 4Y1AA 2VLRA 1BVZA 5F7EL 2IAMA 2HFEB 3CFEA 1FNEB 5F9DC 5CSZB 4F2MB 3OKDB 3OKMA 4LVNC 2BNRD 3BZDA 4QOKD 2A0LC 2C9AA 3B2VH 5HY9B 1S9WB 1YMMA 4IDJH 4WI8A 4DVBB 1I7RA 2ICEB 3V6ZB 3FFDA 1FNFA 1G1YA 3C5ZB 3U30B 1QRNB 1OTSD 4UBDD 3B2VL 3EYOA 4OCXH 5L6YL 2X40A 2CKNA 2AV1A 4ERSL 5J1TC 5D7KD 3D0LB 1HI6A 2A6IA 2NXZB 2ZCHH 2CR3A 2OL3H 4XTRD 1UG9A 4OFYD 1Q0YH 3LEYH 1UWXH 2J2ZA 1KLGB 1T1YB 2LQRA 3ARTA 4NCDA 5L2JB 2CUHA 3RVXD 5HYQB 1MJ7L 1A1NA 3ZSSA 4N0YH 2LAGB 5JQ6H 5LKNA 3LZFL 4WHTB 4Y5YC 4R2GC 3INUL 5C9KA 4I13B 2XWJA 4PJAF 4LEXH 3FO9B 1IILE 3W0WE 3VU2A 1RJZB 1RSFA 1YPZF 1BQHB 4BSVA 4R0LC 4MCZA 4UV7H 3MRNB 4Y5YB 1CZ8L 2J8OA 4DFIA 2BVQB 5LAXA 4PD4K 3B8SA 1MUJA 4KU1A 1F90L 4ODVL 1D9KC 1EDQA 1UEYA 5EORL 4X6DE 5IJVB 1S7XB 3PWJA 3EYFA 3QEHA 2AXFA 4GG6B 5I73B 1MREH 2VXQH 4ODBD 1C16B 4JFHD 2GTZA 1TTFA 4OKVA 1R24A 2WIIB 4WEBH 3IAQA 4P2RB 1YEKH 5FDWA 3IT8D 1FDLH 3E6HA 2IQ9H 1YDPA 2C26A 4JFQB 2R2EA 3FQNA 3HB3D 1X5AA 4M4RA 3MOQA 3DYPA 3HCVB 4XI5C 4AM0B 2KBGA 4OFIA 1ND0B 4QXTB 2OK0H 1S9YA 1A5FL 5F1IB 1BGXL 3L7EA 5IVOA 4HK0B 4K7PL 4ZXBB 5C6TL 3P9LB 2XA3A 1CWVA 3VFMB 1ZLWH 4G6JL 1TVBB 5T1KA 4YFLI 3MJ7B 3OF6A 4PJGF 4JEGB 5D7JB 5LGKA 3V4VL 2XZCL 3CDGA 4UDUA 3D3VE 3BT2H 4GKNA 4XNMB 4GAFB 1HZHH 4NC1C 1TXKA 3C60D 4ZXBC 3IXTB 1T80A 2Q7YB 2R8SH 2BJML 2BSSB 5FDYA 5D7JC 3E1F1 4I0PA 1S3KL 2X89A 5DUMH 5D2NE 1CXEA 3D85A 3EO9L 5FKPA 1GGBL 5DJYA 3RWGB 1S7WB 2X9XA 3HUJA 3ZE0E 3ZKNC 5GZND 5E6IB 1K3IA 2SEBA 3L3HA 4ZODA 3JV6B 4QHLB 3WE6B 5JIIA 3HE6D 1H8SA 3Q0HA 1MJUH 5HHPB 1JFQH 3TV3H 3UJTH 5JMOC 3CX5K 3CZFA 4IOIB 4NO2A 3BH9A 4GKSA 1CLOH 3RA7L 1T66C 4ZNEE 5F7KC 4XC3L 3KLDA 3MV7A 4UQ2A 12E8H 1FFNB 1HCVA 1OLZA 1RJLA 4XNQA 2HJFA 4H8WC 3BPLB 3SO3B 1QP1A 4WY7H 4JPIA 4PRDA 1SVZA 5D7JD 4BSJA 1JRHL 5FIEA 1MF2L 3GRWA 3VD9A 2P8LB 4LSUH 4K94H 4G3YH 3NTCL 5EZIH 3BJ91 1DTUA 4HIIB 1SJEB 1SM3L 4S1DD 4YHYC 5HGGS 3VXNA 3V5HB 1XF3A 5E2JA 4Q9RH 4EI5A 2X4PB 3I02A 3MBEC 5JPMA 3BD4A 4M6NH 2HT2D 5TE7L 5BOPA 3VI4F 3P0VH 2J6EL 2P5WB 4WEMB 2DRUA 1AGFA 4KKNA 3TA3B 1JNHB 1NGYB 2LVEA 2PXYD 4MS8C 2ORBH 4UV4H 1DP0A 1W8OA 4NQUA 1Z9OA 4HMEA 4CW1A 2E6JA 3TJHD 1YMHA 1U58A 1IQDB 4U4BA 4PGEB 2NTSP 3O3BB 5DK3A 1KC5L 1G7IB 4K71B 1CGSL 4I5BB 4YDLB 2EYTA 2OQJB 4NO0A 3ULVC 3HZVB 3QFDA 4H25A 5IW3A 5MEQB 3N1PC 1UCTA 1BD2E 4NDMA 4CAGA 3ZE0F 3O6KH 4YHLH 5F21B 2YK1H 4IDJL 1ZHNB 5E1AB 3QFJD 3ROOA 4YHMH 4P46D 4WI6A 1T89A 2A9ML 3IFLH 4E5XA 4EZMA 5FK9B 4X4XB 4C56E 5F7DB 1FGNH 4MA8H 4O2CB 4KHTL 2OQJA 3AC0A 4NO0B 4X0KB 5EU5B 1DBJL 3L5JA 4PBVC 2HVJB 3TWCL 3O3BA 1BD2A 4H20H 4GRWF 1E28A 4UQ3A 5D96B 4B7IA 2RJMA 2YWYA 4M61A 3PP4H 4S11A 1BPVA 3QQ3B 3BHBA 3TT3L 2VDKL 3QEGH 1OSZA 3CVIL 1JHTA 3TA3A 1J0HA 3MGAA 3E8UH 5SX5K 3B9KB 3MCLL 3DRTB 1SQ2N 5F1SA 1MREL 2A77H 2AJUH 5E8EB 4NJAH 3DSFL 3MRRB 5ICXB 4PB0H 5JPMB 5FYKU 2XWTA 3VXMB 5HGBA 5FYJH 3VXNB 2NY0D 1A6WH 1KCVH 5EBMA 5IQ7H 4KKAD 1UKQA 4F3FA 3AS0A 1UADC 4KGJA 3SKOB 2XNAA 3GSWA 4NNPL 4OZIB 3OB8A 4F33A 1KJ2L 5DJCB 3JZ7A 2YN5A 5FXCH 1HSAB 3GM0A 5BW7C 2PO6B 3O2WL 3ZE1F 2DQIH 4ZUSA 5KW9L 2EH7L 2UWEA 2AS5M 1U8KB 3NFSL 4JQXA 4YNYA 1RZ8A 2QR0B 2YPVL 4OFDA 1ZMYA 5C09D 2EH8H 5D6DA 3WJJC 4IOIA 1I8IA 1UZ6F 4S1QL 2XPGA 3U4EB 3JV6A 1O5DT 2KQMA 1FNSH 1VENA 5IK3A 2D7MA 5E6IA 1B0WA 1QSFE 4E41D 5JXED 4HC1L 1EHNA 2D03L 1RHFA 1JNNL 1K4CA 2GCYA 2JCCB 1S7WA 4S1SL 1IGFL 5GZOC 3CU1A 5DJYB 2YPLA 4OTXL 1A3QA 1MRFH 4XHJD 5I17A 1J5OH 1CD9B 2XG4A 3SDDD 1H3XA 1XGYL 4M93B 1ORSA 2VN7A 3DV4A 3F8UB 1A7BA 1SEQH 4Y4KD 3QUZB 3UJTL 1QLEL 3HNSL 3TP4A 3HS0A 3U48A 3HPLA 3O3DA 4FXKA 4JGJA 3WKML 3O3EB 4FQJH 3D0VB 4YK4B 5A40E 1W2KT 2A6KB 4ORZC 5T3XH 3VWKD 3TBYB 1A6PA 4F80A 3PF2A 1JBJA 2Z31A 3D2UA 3T8XB 5F1IA 2VZSA 3C60A 4KAQL 3Q1SL 3U9UB 3O0RH 2YPLD 3QDME 5DVOA 3MLSL 3HN3A 5E2TH 4H5SB 4MMZC 1A7PH 5KAQG 1UWXK 2R2EB 2C1PA 4XZUB 4JFQA 3L1OL 3QAZC 1CFNB 4FQIL 5C0CE 3RAJL 3K1DA 4U1SA 1UXWA 3H7BA 1INEH 2AJVH 1X9QA 3TIDA 1UYWH 2PW1A 1S7UB 1RZKH 4LQFL 3KNBB 3GFUA 2BCKB 1ETZB 4U49A 3CGTA 3PXJA 4IRSC 4WFFE 4GG6E 3DMMD 5AEAA 3ZDZE 1LO3H 4XP4L 2BNQB 1FRGL 1MI5E 3S5LA 5GIRA 2BRRL 3OKLB 1JZ2A 3S35X 3QUYB 4MNGE 3DRQB 2YHGA 1A21A 2J4WH 2LE9A 4TULL 1F58H 2VERN 5D2LA 2EE2A 4PRPA 5C08D 4X7TA 1BQHA 1J0YA 4LSVL 4FFWC 3BRDA 1LK2A 1XGPA 4ALAH 4HW6A 5J56B 3IDNB 3RBGA 5GGSA 1KJ2A 1A1MA 4JM2F 1YJDC 5K33A 4ZUVA 1F11A 4BZ1H 2B1AH 4YHML 4PTTB 1A3RH 1EBPA 1NGXB 1PAMA 3W0WA 2VZVA 2IANE 3ARDD 4PJGB 1MFCH 3T4AB 1HI6B 2A6IB 4AG4L 1Q9LA 1GAFH 3MNVB 3D0LA 3FB5A 1A6ZB 4OD2B 4OSUL 5IB5A 2BXYA 2X4QA 4TUKH 2DQFB 4KQ3H 2NY4C 1UH4A 4MXWH 2UUDK 3C8KA 1ACYL 1KYOK 3PWNB 3QWRD 5TE4H 4Y1AE 2VQ1B 3BFOA 1Z9SA 1IBGH 2DLEA 4MNQB 1U8JA 1T83C 3PGDB 4UT9H 3LRSB 1S9WA 4P2OD 4TOYL 5CP3A 5HY9A 5I1CL 3HNVH 4YDJB 2XRAH 1SHMA 2XWBB 4AYFA 3VRJB 3D39D 3CFEB 5DMIL 3H3KA 3O2WH 4LCUA 4DQOL 1D5MB 2NYYC 3UYPA 3L5IA 2Z91A 3N1QC 4KRPC 4YE4H 1CIDA 1DUYA 5D7IB 3CUPA 1MHCB 4L4JA 4PRHD 3PP4L 4OZ4B 3HRZB 2WBJB 5HHNB 2VXVL 3MLXH 3U36B 2V2WB 1ES0B 5T3XE 4NQDE 3MA7A 3MOBL 5D5ME 2R1WA 5HHVH 1PG7W 1B88A 3DXAE 1F6AA 3K4ZA 4PJ9C 4Z7QE 5A2KH 1IL1A 1NKRA 3QPXL 1KIRB 1CICB 1EERB 3L95B 2GFBA 2CLZA 3MLRL 3PV7A 4V1DD 4XMPH 5EA0H 5D1QA 1LDPL 5DA0B 3MV7D 1J12A 3P0YL 3Q1SH 4LSQH 4PY8J 3ET9F 1QLRA 1A47A 2BVOA 2R39A 2VO5A 3DROA 5IMLA 4KV5F 4YDIL 3NIFF 2W0FB 2VITB 4ODTH 4WI3A 1TJHH 2YUWA 3IJYB 1T4KA 2ZCLH 5ECJE 1FV1B 1HHHB 1TVHA 4L8DB 3M17A 2XN9E 4LPCA 2I60L 1AKJD 3NGBC 2NCMA 2WUCH 4G80A 1DR9A 1ZLVK 1T1ZA 3H7LA 4FABL 1JZ3A 5F7WC 2H32H 3IETB 5IM7A 1NCBL 2GKIA 4Z7OE 1J5OL 2HKFH 2VSCA 5I8EB 2ZUQB 2C7UA 3WDHA 3H9HB 1JRHI 1AGCB 4HWZA 2YN3A 2YA1A 5EIVA 2IADA 2VDLH 2CK0H 3WCYA 3S3PA 5E2WH 5CS7A 2ZUQC 3ALXA 4TVPE 1FZKA 4PRPE 3O3AA 5EUKA 3T4YA 1UQSB 2DQHL 2C3HA 5C09E 2XTJE 5D71H 3MFFB 5HPMA 2O61B 4UMGA 3QXVA 5GSVB 2WV3A 5TGBA 1OSPL 2D31B 3P3YA 4K94C 5GZNC 4I3RH 5DQJB 2OP4H 5B39B 2KQNA 4PYGA 1UVQA 5DK0B 3T2NH 5C2BL 4IRZL 4U1LA 3ARSA 3UX9B 2N56A 2VLJE 5IB4A 3FN0L 1L6XA 3GSNB 1MHPL 2DWEB 3QIWD 4O58L 2X4NB 3VFUB 4M3JA 1JHLL 5HHMB 4MQSB 2Z35B 4V1DA 3F65A 4OZGB 1C7TA 4NM4H 1INQA 3TLRA 3RVXC 4A6YL 3UTPE 4KZEH 5TE4L 1QSEA 2JJTC 3RGVD 4P59L 3EAKA 4FFYH 4L8SA 5KS9E 1BFOA 1RK0B 2CK2A 4P49A 5B3JE 5MP6H 3EZ8A 4KHTH 4NQSA 5C0FA 2BSRB 1UB6B 2LTQC 2I5YH 3C09B 5GGSY 1FO0A 3BZEA 3VRLE 5FGCB 4IRJA 4XPGH 1HNFA 1T5WA 3EYSH 3MLWH 1U3HA 4ELME 4YAQA 4JHZA 1JV5B 1MFCL 3RWEB 4Y89A 5KJRH 4IIQC 4F37K 4JE4B 1M7IB 4WI5A 2UZIH 3VFSA 2XN9A 3IDIB 5HJ3B 1ZTXL 5JPNB 2YD1A 4LRIC 1AIFB 4LP4A 4WW2F 3EYUL 4FNLH 7FABH 4IIQB 5IW6B 4NGHL 1DQDL 2EDHA 3ROLB 3HNVL 1ED3B 4S2SB 4CADB 3HMXA 1OTUC 3QNYB 3DIFA 2N7AA 4JVWA 4G8EB 5IR1B 1YNKH 1GPOL 4S0TD 1MCOH 1GZPA 2EIBA 1HDMA 5E9DE 3AY4A 2K3TA 5BV7H 1ACZA 4ETQA 5ETUB 2JIXB 5FYLL 3ZE2F 3BQUD 1IJ9A 4HAFA 4ODHL 3OX8B 1A6AB 2Z8RA 1OHQA 3VH8B 1FZOA 2VLLA 1K85A 2Y5TA 4YBLC 4LF3A 2FBJH 4M7ZB 1WC7B 4GRLA 1WQVT 1YMMD 4NUJB 1V7NH 4MB3A 3WHXB 3CFJA 2OYPA 4ZUUA 1FIGL 1HQ4A 3BD3A 2GSGA 4I8DA 3WLWD 1U9KA 4GXUM 1A3RL 4IRJD 4YZFE 5DWUL 2V7HB 1UM6L 4HMDA 3UZQA 3VJ6A 3WEXA 5EU6B 4ZPTA 2Y7QB 2O5ZL 3JVGC 1DBKL 3L3GB 3MLPA 2PN5A 3ZDXF 2WANA 4XXDA 2PETA 3BDYH 3KJ4C 1NL0H 5E8OB 3DTXA 4HULB 2EYSA 2JJUA 2GY7B 3V79C 5ERWB 4EEEA 4P4KB 5D93B 4I1NB 4JQIH 4WRLA 3QULA 4JM4H 4L3EB 2Z9TA 5F3HB 2OI9C 3O6KL 3AU1B 1DQLL 5FYKH 4E41B 5F7YC 4JM4L 4TUOB 1ZA6A 4JRYE 1FHGA 1IKNA 3GI8H 5D93C 4XMPL 4PJCA 3WLBB 3PDGA 1KC5H 5FF6A 2DI8A 2QHRL 5C92A 2CKBL 3MRHB 3OQ3B 4HUVA 2EEDA 4P9HH 4GW4B 5T3XD 3F5WB 1ZHLB 4GXUN 4XMLH 1VA9A 4HKBA 5GQBA 2VKWA 5HVHC 3PL6B 2ARWA 4BSWB 1D5XA 3CVHL 2DB8A 1X5GA 1DN2A 3KDMB 2ADJA 3TZVA 3GM8A 4YDVB 5I0ZA 4PRHB 3S37L 4KRMB 4M7KL 2FO4A 2FB4L 2YA0A 2YD2A 3G5XA 1A3LH 3TH4T 1QLFB 3NCYP 2DD8H 3MR9A 3CFIC 5FO8A 5I75B 4TRPH 5DQ9B 1IKNC 3LEVL 3MRBB 2DS4A 1MRDH 4OV5A 2VXUH 3H42H 5CBEA 5JUEL 4PUBL 4MJ6B 4MSWB 4P23D 3MRHA 4EOWL 2LV4A 3HPJA 4PLOB 3P30L 4PJCB 3QDMD 3QDJA 4NBXB 5ICZB 4HMCA 1XAUA 1HILA 3H9SD 4NBYB 2DF3A 2YOCA 2R69L 4MAUH 4E41A 4U7SA 5C0BE 3ARFA 4PJ8D 3QG6B 2DICA 4DTGH 3QHFH 5F3HA 4WHYG 5EA0L 3S4SB 2DKMA 2PF6A 3T2NL 1I8KA 1CT8B 4MA3B 2FJGB 3GUTB 5ESVB 1FCGA 1QNZL 4JKMA 2WWKT 2ATPB 3D9AL 4R7NA 2AK1H 4ZPTB 4JG1L 3ULVL 2ITDA 1OWRM 4I4WB 1VERA 1HYSD 5KVEL 2V7HA 1UT9A 4FA8A 1BQUA 3SDXA 1AO7B 4XX1E 1WIOA 2DIAA 5C86A 1HHKA 3X12B 3MLZH 3X13B 1KPUA 4M5ZH 1A6AA 2O5ZH 4BQ8A 1XCQA 4YXKH 3VGAB 3MUJA 4P2CG 3BUYB 3IDGB 3MLXL 4LRIA 5C0IA 1CZ8H 1MJ8H 3I3BA 5EOTB 1K8DB 3CSBA 3KR3L 1KT2A 5DMYA 1OGTB 5IW6A 5H35B 2OTWA 4IIQA 3OJ2C 1G9NH 3HC4H 2FH8A 1F4YL 1TCRA 3INUH 1OAQH 4KTDL 4IRJC 3LMJH 3GSOA 3DO7B 1FBIL 4X8JB 1NUGA 4XNUL 2VABA 2ZSVA 1EFXA 1TJGH 3MBED 3U7WL 4MMXC 5JHDA 4XVTL 3AAZA 4P99A 4L8BB 3VCLA 4YX2H 4YBHA 4Y19D 1FLTX 3GMQB 3L3DB 3VFTA 4FNLL 4LGRB 5DJ0B 1DUZB 4JRXE 4RFEA 4OCNC 4X99B 4OI9A 1A7RL 1OGAA 1HEZA 2MKWA 5FCUL 1INQB 4PJXE 1R5IB 2X05A 2Z92A 5D6CB 4V1DB 1L6ZA 4GRMA 4TVPH 3CCHB 3BE1L 2V2XA 4B50A 4G3YL 1BM3H 2FX8L 5M95B 1DEDA 2ZZUT 4OIIL 4G8GD 5IB4B 3QXTA 3C6SB 2A9NL 5FAAA 1OF2A 5CEZL 4PG9A 2DDQL 5DHYB 3QEQA 2IWGA 2GT9A 3KYKL 4F15C 3VXTB 2NXYD 4OCWL 4KZDL 1CDJA 5TF0A 3AREC 3B83A 4LU5H 1I1YA 1NGWA 2A74A 2J4WL 4RA0C 4C55A 5EUOE 1C12A 4HF5L 1U8IB 3D3VD 5ELIA 1HXYB 4MA1B 2VLJB 4ZPVA 1BOGB 5TFSH 2Y25A 1J8HB 4IRZH 5E94B 5BZDB 1QA9B 4GKOA 1OM3L 4KUZL 1KIPA 4QTIL 1NFDF 3FQRA 3LKRA 4OZGE 2FX9H 3RY6A 4J3VA 1I7UA 3O6ML 2B1AL 3PQYA 2DN7A 5LGJB 4QTHB 5CZVL 5MEND 2ENYA 3F7PC 4EVNB 4QRTA 4ODWB 1EK3A 2XTLA 3LN5A 5HI5C 3QDHA 4FFZH 1KIUA 1S7TA 2OXHA 3DX7A 3SDAB 4G9DA 1GGTA 3SDXF 2XZQH 1HZHL 5D1QC 5IESH 3QRGL 1T4KB 1HH6B 3FRPA 1SJVA 6CGTA 4TTDD 1DJSA 2F9BT 1CLOL 3RA7H 5CBAA 1TTUA 4QHUB 1VFUA 5IHZA 4EI5C 1XF1A 3TO4C 1F3DJ 1Z0NA 3IU4L 1A5FH 1TQCC 3RL2B 4NC2B 2VDMH 2DM7A 4KJPD 4NQDA 3M1BB 2VRAA 3EJZD 5DJ8B 1CICA 1KIRA 3DHMA 1JF1A 4U6VH 3MRPB 5E9DB 4WGWB 3HAEA 1KCSH 3N50A 4LAQH 5IT2H 4AMKH 3MRPA 1AD0B 5E9DA 3TN0C 3HRZA 1LE5A 3E2HB 5I1EH 4GAJL 2Y36L 4LVNB 3K8MA 4LHUG 2BY2A 1DUYB 2VE6A 5GRZA 5T5FH 1DLFL 1TNMA 2JTDA 1OTTC 1T83A 3QDGE 5JXEC 4E0RB 1S8DA 3TN0B 1IRAY 4NP4L 1TJIH 4AY0A 1DVFD 3MV8E 3U1SL 2XWBA 2CRIA 4RWHA 4FFVC 1WEJL 2G5RA 5I0DA 4U1NB 3U1SH 2APXA 4WWKB 3MV9D 4NUGH 1ZVHA 4G6MH 3DX7B 2MNUA 3REVA 5DURB 4QRPA 4NKIH 3B9AA 4LKXB 2Y72A 4XTRC 1H0DB 3VXPB 4HWEL 5IB5B 5T1DL 3PQYB 3SQOH 3UP1A 5DHVB 3MLYL 1IGCH 3X11A 3OB0H 2UVFA 5D1XB 1H8NA 3DOSA 3V5DB 3A6CH 3NH7H 3B2UC 1D6VH 3K2UH 4NRZB 4D8PA 4Y4HC 1QBML 2BXZA 3LKSA 2ZOKA 4PJFF 1P7QA 5I1GL 2LU3A 1KJ3H 1Q8MA 1QFWL 3QCVL 2EDTA 3GBLA 3MRJB 1P4BL 1NMCB 4YBQC 1I9RL 1C12B 4JPVH 1BFSA 3FQUA 5IWLA 3MCLH 3SGJC 2EE3A 3BE1H 4HUXB 2IQ9L 4LKCA 3LV3B 4MZ3A 3GNMH 3LCYA 3T3PE 5DLMH 3KYOA 2O5XH 3KPRE 2RB8A 1EAJA 4QTIH 2W9EL 3V8OA 2YKLL 4IHOB 5KN5A 1J11A 1DFBH 4M1DL 3HZYA 4LCWD 4PG9B 5JDSB 4PS4H 1T5XA 5GIRB 2Q8AL 2PYFA 3KVQA 3UC0L 4XGZA 2V2XB 4RQQA 2EDQA 2CUMA 4NYLA 3V9FA 1F4XH 1NGZA 3MFGB 2BCKA 1S7VB 5L7XL 2NY6C 4Y4FB 3SDCD 1FYHB 4K3JH 4PJIA 5AWNL 5MHSE 3ZL4L 4JM2A 1V3KA 4QYOB 4U2ZA 1HINL 1UXWB 5KOVC 1DUZA 1HHGA 5GJTH 1N4XL 2ED7A 2NXYB 1IFHH 4FOMA 4PJCE 5I2IA 1JK8B 2H8PB 2CLRA 1WGOA 2FSEB 1V3LA 2KH2B 3HKFA 1N4XH 1KN2L 2HWZH 3UTTA 4GUPB 1OGAE 2VABB 1RU9L 2Z31B 1IC5H 4N5EC 2R9HC 4R96B 4BZ1L 1XF2B 1NCUA 4OLUL 3RKPA 1B2WL 5FYJL 3NCFB 1V8HA 2EKJA 3O3EA 2ZG1A 3S4SG 5J13B 3R1GH 4IJ3C 3NMEA 3K81A 4LPVA 4HBQA 3I50L 3D69A 2YD7A 5I71C 5GZOD 1EPFA 4P57B 2YRLA 3L5XH 3T0AA 1QSFB 3CVIH 3TYGL 1TCMA 1IEBA 2PTUA 5IV2B 3DVGA 4Z5RA 1AHWB 1NCAH 5GRJH 4F57H 4QF1B 4IJ3B 1AO7E 1CXHA 3BZFA 1CGUA 2X42A 4H0GA 5B21A 5DHVH 1MJJA 1K4CB 2IFGA 3LPWA 4HK3J 2ICCA 3PWLB 3BKYL 4LSUL 5J6HB 3OR6B 4MCYB 4ZTPH 4HV8A 2X9WA 5IVXF 5DQDL 5F96H 3RWJB 1AHWC 1FSKB 2IBBA 4PB9L 1BZQK 3U4EA 4XWGL 2XPGB 5DJ2B 5DEFA 1JWMA 5EH1A 1AI1H 3VRIB 3UZEA 4TN9A 1IAOA 3E6FB 5E8NB 4QWWD 2UWEB 3CZJA 4O2FB 2HTLD 2WBKA 4L4TD 3QXUA 1FFOB 3WIHL 1LO4H 2HLFC 4F33B 4K9EH 3NPSC 3QG6A 4CDGC 1SM3H 4QGYA 4PJEB 3VRLF 2FJFA 5DR5L 3RDTB 4TSBL 5MEPA 1FC2D 4G6KH 4KTEH 4IDLA 2AQ2A 3S7GA 5EZOH 4JRXB 1DEEB 4G8FB 2YZ1A 4OV5B 4WO4B 3RI5K 2YMXL 5D7LE 1CXIA 1EGJH 3CDYA 4K71C 4KK6C 3BGFC 5E56A 3BHBB 5C8JB 1FPTH 4NBZB 2YMXH 4M61B 1MQKH 4MHHG 2GITA 3BKJL 2ZCKL 4ZD3H 4W6XB 3U0WL 1QHPA 5DD3H 1YEEL 2AERT 1E0OB 3F6LA 3SE9H 5E6YA 2XIDA 2XZAL 3P77A 5EU5A 1TZIB 2OTUA 4LCCA 5EU7E 1SBBA 3ZKSD 4HKBB 4JHWL 1WVZA 4GBXD 1OT2A 1KV3A 1BJ1J 5EUOB 4U1KB 4OD1H 4LPWA 3KPSA 4NHCH 5L2KA 1QSZA 3FQXB 1D9KD 1MAKA 2WLZA 5F70A 1FNGA 1CIUA 1RK1A 2BHUA 4NKIL 2FGWL 1SY6H 1ZA6B 1L0QA 3ZL4H 1GC1C 2EH8L 1BFTA 5DURD 3GBNH 5DC9B 3AXLB 2I07B 3QULB 2BFVL 2X7LB 2ZPKH 4P9ML 5CD3B 2DI7A 1QBLL 1TETH 1H15B 3BP5B 2NYYD 4I0CC 4JRYA 5FUCC 2NNAA 3GSUB 3BOVA 2VXTL 3PWPD 4KC3B 43CAB 1LE9B 3L6FB 4TPRH 3FQTB 3TO2A 3HI1B 4K3EH 3BH8A 5DMJB 1CLZH 2HVKA 5KSVA 3QIUB 3T2OA 4HWUA 5BVPH 5D7IE 4ZUUB 2XKNA 3EYSL 3MLWL 4HIIA 4PJ5A 2Z8WC 2AJXH 1WC7A 3QWOB 1QKZH 5MEOA 2R1XB 2Y5TB 2VLLB 3W9EB 2ZSWB 3OPZH 4D2NA 2ZCHL 3TVMD 3IGAA 4NPYA 3FB6A 2I60H 2PTVA 3JWDL 2KUTA 3QI9D 1D6VL 3K2UL 4WEUD 1NANI 2VWEC 2YPKB 4NO3A 2W9DH 1BEYL 4MDJB 5IR1A 1QUNA 3QNYA 3ROLA 3V2AR 3TO4A 4YE4L 2EDNA 5E99H 4G9FB 1CK0L 1H3VA 4Q9CA 5J89A 1UM4H 4AQOA 4Z7WB 4CJ1A 1BZ9A 1B4JL 5CIPH 2AJZB 2XN9B 5HHPA 4JKLA 3GHBL 3QUMA 1NLBH 5I9QB 1W0WB 4LPUA 3SN6N 3QBTB 2NX5E 3GMPB 3VXUB 4NGHH 4PJ8C 4P2QA 4JHBA 5J4MA 4YFLF 3CFCL 1Z0MA 5TH2A 3OL2A 3WFEH 2FEDD 5JW4R 3VA2C 1IAIM 4LDEB 4WFED 4X9GA 1VGEL 5KG9B 1ZHBB 1KNOA 1N64H 5J3HD 1T6WA 4UDUB 3D87B 1CF8L 1BWWA 3ZSTA 3WDJA 3HC3H 1ITBB 3QA3A 3VFMA 2FH6A 2BHYA 4HGWB 5JW5A 3AREA 1P4BH 5E5UB 4KKCC 1AC6A 3BEWB 4OFYA 1IKFH 4AM0A 2C3GA 4HIXH 4RBPK 1S5IL 5C0AB 4AG4H 3MUGA 1YEDA 1Z9LA 3ARGA 4WW1A 1K4DA 2IGFL 4JKPL 1IGCL 3W2DH 3T4YB 3O3AB 4P2RA 3FN0H 3HE7D 3VXSE 4OZGF 2DMBA 4OKVB 2APTA 3WNNA 1S9VB 3QUYC 2IADB 5GISL 4XC1H 1GH7A 2XQBH 3MACH 3U6RB 1I3UA 3DUHA 2AJ3A 3K74B 3QEHB 3DYMA 4JO3H 1TETL 4MAYA 1DVFA 3D39B 1AFVL 3KPRA 2C7UB 2CRMA 3QQNA 4HGKC 4JFFA 4B7LA 5I8EA 1ZT4A 1F3JA 4OQTH 1P7QD 5IM7B 3VWJC 3LPFA 1A3LL 4BFEA 1SBSH 4Y5YA 3HG1D 2F58L 2X4OB 1R3HA 1RJZA 1TVHB 3FOLB 2VDPH 4L8DA 1W8NA 4XCNA 1FV1A 4KI5D 3U46B 1MAJA 3CVHH 1IZJA 4UZGA 2Q76A 3OKOB 4YPGB 5JOFB 1FYTB 5J0BA 3VD5A 4GQ9H 2HYMA 3DX6A 1TQBC 3QDAA 4PV9A 4OQTA 4JG1H 5GGQH 2DM4A 1AXTL 5DA4A 4XXCC 1JGDA 3SEPA 3HTLX 1OARH 3V4UH 5D1QB 4J12A 4Z6AT 3L95A 3L3OB 3MRFB 2I25N 4W6YB 1F6AB 1WAAF 1CN4A 1PQZB 35C8L 3EFDH 3MA7B 1PVHA 4U1IB 1N26A 2IPUG 3ULUC 2B0SL 1W0VB 1W0YT 2IAMC 3DXAA 3MUY1 3PWPB 1I7RB 2ICEA 1LD9A 1PG7L 4DVBA 1YMMB 3CXHK 3C5SA 4PREA 2P5EE 2FCBA 2NR6D 1D5MA 4TVPD 4LCUB 4JFPA 2BY0A 4XPFH 4L9LB 3GI8L 1CCZA 4JFYB 1UWGH 2VLRB 3QUXA 1E6JL 3DGCR 1HSBA 2BRQA 2VQ1A 5CZKA 3DARA 2WQ8A 4Q6IB 3QI9B 4JQIL 4PJ7B 3TEUA 4U1IA 4U33A 4HDIB 1IM9A 4HKZA 1FNSL 4UILH 4RMTA 4CNIB 3B43A 3T0BA 4RMSA 3C5ZC 3I6GB 3U30C 3BDXA 5LCVH 4Z0BH 4Q2ZB 4F7TB 1PDKA 3EJJX 3BO8B 32C2A 3F7RA 3HZMA 1PZUB 1PKQB 3EKCA 5LG1A 1FYTA 1T04A 1KJ2B 2J7LA 2RCSH 5KSUB 1B6UA 3IDNA 2QEJA 4TSAH 4OIIH 1F8TL 5CFHA 3MRIB 4PRHE 4LIQL 4HXBH 1BECA 5FEBA 5BMFH 3CFBB 4XPBH 4NN7B 4XNXH 3VW3H 3AGVA 4GRWE 1QO3B 2GSIA 4P0DA 3SKUD 1YY8A 3HFMH 2B4CC 3OKLA 3TN0D 4MXVF 4F7PA 1J8KA 3S5LB 1WK0A 4MAYB 1G6RB 3S97C 1RZKC 4MLSA 4OFVA 5E2VL 3T65A 3UPAA 3RDTD 1M1SA 4RAVA 3NAAL 2M26A 4XVTH 1F90H 2ENSA 4L3AA 1S9VA 4LPXA 1NDMA 4I77H 4DAGL 1DQLH 1RV6X 3MRQB 4UINH 3FT2A 1F00I 1RU9H 4U1SB 3THMH 4XCFL 2C3VA 3AS1A 4HLJA 1J0IA 3BXNB 1TDQA 1V5JA 3FJTA 4QXUL 1BJ8A 1FL3A 5TDNB 3HI6H 5JW5B 4HSQA 3VFPB 3P4NB 5DJ6A 1KB9J 1ZA3B 3TBYA 1XR8A 4EN3B 3NCJL 5ESAB 3PWUB 2AXJA 5F97E 4K3GA 4YXKL 2E8ZA 3EO9H 2EDBA 3HI5L 2VR4A 1CD1B 3O3DB 1RJYB 1KNOB 5H37G 5IF0B 5C08E 3P0VL 4GBXB 3OAYH 5GPRA 3IS0X 3SOBL 2FHFA 1CL7L 5JHDE 1J10A 2X09A 3GSVA 4LCYA 2YPLB 2R29L 1KCSL 4G7YH 1HOCA 1N3NB 2GCYB 3SDYH 1HXMB 3RIAF 5HGAA 2OBGA 5ALBH 4DN3L 1T22A 4QKXB 1UXSB 4BQ6A 2FJHA 5EBLB 3QCTL 4NT6A 3CK0L 4A6YB 1JP5A 3QRFM 1NFIB 4ODSL 3U4BH 4AIXA 4DZ8A 1I8IB 4Z7WA 5CWSB 5D9SB 1VGKB 1IQWL 3BP6A 4GG8A 5E6IC 1YC8A 1U8KA 5FYJU 1IGFH 3DO3A 1ZSDB 4P3WA 4M6MH 5IB1A 4ZUSB 4XP1L 1IGTB 1KXTB 2ATKB 5K9JH 4OUUB 4WI2A 2CJUH 5IQ7L 5J12C 4JJ5A 5FUZL 3N1MC 3IS1X 5EZJA 2NY5H 5JOPE 2IMMA 3QFJB 2QADC 3GSWB 2IG2L 2XNAB 4CVXB 2BY1A 4H1LH 4WY7L 1U8QA 3BN3B 2NX5B 3EDDA 1TJHL 5HPOA 4PJ5B 1ZKAA 2E7CA 4RX4D 5EBMB 4NCC2 4YWGH 4L8SC 2ADIA 5KVFL 2JJTA 1IAKB 1JIBA 3DI2B 2W65B 5I8KL 3ZHLA 1T0NA 4OAWB 3T0DA 4F7CA 3FQTA 1IKFL 2IJ0C 1O7VA 2DWDB 43CAA 1PY4A 1DBJH 1JHTB 3C5ZD 5CINH 3GJEA 4NOFA 5EZOL 5ACLA 4KHXH 4Q9QH 4C56A 3KLAB 4ODVH 4H0HB 3MOAH 2NY1D 4P5TB 5B8CA 4AENA 2X7LA 2I07A 4BQCA 2V5MA 3UTQB 3AXLA 1IT9L 2YC1B 3NACL 5E1HB 3QHZH 3QIWB 4PJHB 5HI3C 2PCPA 2EEAA 3LQAC 1EIBA 4PRBA 5FHBL 1FNGB 3DX9A 5DUBB 3FQXA 3KPSB 5L2KB 3ARQA 4Q58C 4U1KA 1G9ML 2ICWB 3LH2L 1JWSA 1U8PA 4FTVB 4NDMB 1Y0LA 4LCWE 4XNZC 5L7XH 1R5VA 1KTRL 4X7DC 4TUJB 4DEPB 3QFDB 4H25B 4YXLH 3TNMA 1A22B 1RPQA 1TZIA 1JYXA 4ALAL 3KPLB 1JN6A 2APWA 4XP5H 4PGEA 2ZUXA 1IQDA 4OI7A 1CE1H 3MO1B 3QEQE 2EXWC 2H6PA 2ADGA 1U3ZA 5C0NC 1WF5A 4D0CA 5FO9B 2IBZX 4N1HB 4PFEA 2DQCL 1FGVH 5DMGC 2P5WA 3VH8G 1YECL 5DD1H 2H45A 1MNUH 4H8WL 2GW5A 4GMSL 3KPMB 2QSVA 4Y4KB 1OCWL 1QVOB 4Y16A 5MEPB 3MPCA 2DQGL 4JCLA 1TJIL 2NTFB 2PO6C 3NZHL 5D5MA 1YEJL 2BMKB 5E4EC 3RBSA 1I8MA 3QIUC 2EDYA 1UM4L 2VISB 3QUKB 4GXVH 4K7PX 1CGVA 1L7IL 4XAKE 4NRXA 1MJ8L 3PGCB 1NC4D 1JPTL 5MENE 3IJHA 1RZKL 4LQFH 3UTOA 4NQVB 3MV8B 4O9HH 4PJBE 4JR9L 2FLRT 1A4JB 3VXQB 5DJ2A 2BDNL 1M71B 2A38A 2EC8A 5AYUL 4PJCF 4Y0GA 4AT6B 3BIAX 3I6KA 1SEQL 1JWUB 2IQAA 3OR6A 4LSPL 1B90A 2R0KL 4M62H 2D4DA 3PWLA 5JHLL 4XP1H 2NY2D 4BFIA 1B0RA 2FL5A 1LDSA 3BZFB 1AXSA 3PQYE 4KDTA 1UKSA 4Z5RB 4KJYA 1XH3A 3MRMB 4UOJA 3NAAH 4I0PB 4HS6B 1GVIA 1IAIH 1RMFH 2Q7YA 2W0LA 4QEGA 5IBUG 1G9MC 1LNUA 1CBVH 3RZCA 2FATL 3JTTB 5JDJA 3IVKA 3VG0H 4JZJA 2R4SL 3IFNH 2XG5A 5D71L 5D7JA 5FYKL 5JIHA 2NQCA 3GIVA 4R96A 5ICYA 1N64L 1PBYA 1Q1JH 4TQEH 4GRWH 3JXAA 1ZT7B 4JGMA 1GOGA 3H8NA 5GJTL 1LVEA 5EZLA 3QDJD 4X5XA 3E3QE 3AFLA 1HHGB 2R0WH 4OM1H 4P2OC 5FYLD 1R24B 2H2SD 1GGUA 3RVUD 4JPKH 1S7VA 3RKDD 1C16A 1AKJA 1BGXH 3LPGA 4IRSA 4M5YL 5D5MF 1LEGA 4F37F 5JIPA 4YQXH 2MQCA 4DUVA 1S7XA 1JPFB 4P2OB 1JMZA 1R3KB 5CJOH 3RUGF 2ZCKH 3K2MC 4IS6B 4RNRB 2FYYB 2ZCLL 5C0CA 3LS5H 1FGVL 1QFWI 5IFAH 4R3SB 4S1RL 1DBMH 4WU7B 3WFDH 2BVQA 4UINL 3HI5H 4X98A 3KYOB 4MA1C 3I75B 3UTSD 1IAII 2AK4E 5HTSA 3GMLA 4RDQG 2GTWA 3VG9C 1A7NL 5CJ8A 3RZCB 3PG2A 5HDOA 3IF1B 2CSPA 3QH3A 1WBYB 1YYLH 3DUUB 3Q6FA 3O2DA 4OD3L 5GJSL 4WHTA 5IEHA 1GAFL 4KQ4L 4GSDH 4FQLL 4NRZA 2FL5B 4D8PB 2WWMD 3DUSA 5M94B 4WUUA 4BFIB 3N0PB 4W4NA 3VFOB 3V5DA 4DFHA 1KB5L 5JIKA 3RNKB 5SWSB 1JWUA 2IQAB 4E42A 4JO1H 1FYTD 2H41A 1KCLA 3C2SA 5DGQA 4UUJA 1KG0B 2WIMA 3QPXH 1JPSH 1MJ7H 1U2HA 3OBAA 4NQVA 5AWNH 3CVHA 3AROA 1U36A 4U1NA 3GBML 5K9JL 1FVEB 2VC2H 2E7LA 1FNAA 2CXGA 4KRPB 4MJ5A 2MCPH 4POYA 2WMPA 2RR3A 1I1AC 5EO9B 5D6DC 3WJJA 2RQ8A 5C0BD 3QUKA 5T1DH 3SQOL 2IAMB 1U2CA 3PHOA 4FQHB 3RVVC 3WIHA 3JUYA 3L9RA 1MVUA 1J9CT 5IVZA 3N9GH 1Q72H 2VE6B 3V6OE 3OHXA 2DYPD 1H5BA 1HKFA 4YC2B 5I16A 3TVMB 3ZDZF 1YY9C 4CL7A 1XZ0A 3ALPA 3L3IB 2YXMA 3UPCA 3CH1A 1CL7I 2A6DA 3HAEB 3WFHA 5DSCB 3UTZA 4NKMA 5DJ8A 4ZD3L 3M1BA 1ADQA 3QIBC 1JHKL 1P7KB 1ZEAH 5IHZB 3RGHA 5KSAC 2QJDA 2Z4QB 2MPAL 4LCWA 4YWGL 1MLBA 4JN2A 4NZUL 4WW2A 2QSCH 4KRLB 5C0DB 2IH1A 3NABH 4JHWH 1MPAL 5D4QA 1QEWA 3V8CA 1CG9A 4LLWA 2V17H 3DLQR 3NFPA 4I3SL 3D18B 4QRTB 1FGNL 1Y0LB 4MA8L 5K9QG 3EFFA 1GOHA 3HNTL 1YPZB 1MCFA 1QFWM 1TJGL 2PTTB 2GJZA 3B2UD 4LHUB 1I8LA 4BH7A 4PJHE 3P9WB 4P46C 5KSBF 2D7TL 3DX9B 4YHKH 4PRBB 4S1RH 4DZBA 4X5WA 1NAML 3HHRB 3ULUL 1KIPB 3P30H 4FQ1H 3QIWA 1CXLA 1QA9A 3MV8D 1OLLA 1VPOL 5T3ZH 3SJVE 3KPSE 4NHCL 1ZAGA 2VLJA 4ZPVB 5L2KE 2IBGA 1ZV5A 5KSAD 1KFAL 4FTVE 4C4KO 3LEXA 2V2TB 4TSCL 5SWQA 3KLAA 1I1YB 4F58H 3FB8A 3QCUH 1K3ZA 1CLCA 3T0ED 3GJEB 4PJBF 3ZKMC 1Z3GH 2X4TA 2GT9B 2O5YH 5KZCB 3FAWA 2DWDA 4URTB 1U95A 1S3KH 3QEQB 1WBXB 2HRLA 4OLEA 1N7ML 3TF7C 1FZMB 2W07A 1RFDL 3C6SA 3S37H 5GGUB 4NKOA 2DOCA 4HIJA 3KJ6H 5JA9A 3GHEH 1FJ1B 3CCHA 4LU5L 4MX7B 1U8QB 3KS0H 5CZXC 4MD0A 1E4WH 4XMLL 4EN3C 4CVXA 4X99A 2XZAH 1MLCA 4YXLL 4BELD 2AQ3A 3BESR 1KUMA 3Q5OA 4KUCF 4PP1C 4XWOC 1UGNA 2BHZA 1AY1L 9CGTA 4NQDD 1ZSDA 3AAZB 1IC5L 2YK1L 4QRRA 3QPQC 4GG8B 4ENED 2VZOA 4CUCA 4CMHC 1VGKA 3OKKB 4P5MB 4X80L 2WK2A 4X9IA 4UB0H 2FLBT 1DBAH 1WZ1L 1RULH 1TCRB 1LK3L 1EAPA 2NW3A 3CLEH 1YA5A 5ACMA 1RIHL 3LKPA 1NLDH 4G9FE 4LVOB 4ODHH 1T22B 2QQNL 4ODSH 4Y19E 2XFXB 1A8JH 4CMHB 3QXDB 1KT2B 5KANG 2OTPA 4KTEL 4AMKL 3D1MC 4YBLB 3PP3H 4XP9H 4PJBB 2YXFA 3U7WH 1CLYL 4XPAH 1YEIH 2DQEH 4HLZH 3BUYA 3IDGA 4HPOH 5ITBH 3FCTA 4JREC 4XHJC 4J8RA 4Z7UB 2JB6B 2A73B 3IDJB 5HHOB 1KPUB 2VDML 3TO4D 2EDKA 3BIKA 5CJQL 1LEKA 2P8PA 2E7BA 2NY3B 4JO2H 4HJ0D 1ADQL 2GQHA 1B3JA 3OXRA 5B4MD 5J3HC 3QUXD 4ODTL 2ZWLT 4U1MB 1F02I 3PWUA 3SDXB 2QADB 1ZVSB 5BCAA 4QRUB 4ZTOL 1ZA3A 2PYEB 4XCCL 1UWGL 3BGMA 3TC9A 3RP1A 4P4KC 4JM2D 4BQ9A 5DFVD 3LAFA 4JAMA 3KPOB 4M9PA 2JE8A 4Z95L 3H0TA 4OF8A 5EC2B 4OLVL 3ARBB 2F54B 4OGXL 4X8XA 5FO7A 4Q0XL 5SWZA 5DJXB 5DRZB 4MA3A 1OQOA 3OR7B 1S9XA 2AABH 4JQVC 4N9GA 1T7ZA 3H2WA 1YC7A 2R23B 4N1EA 3TJEL 3QDJE 1G7JA 1K6QH 3HE7C 2GHWB 3VI4E 1RD6A 3VFGL 3ARBC 3D25B 3HMXL 3PUCA 5CILL 3T1FA 4BYHA 4IRSD 2L7UA 2QSQA 2VLME 3BN9C 5I74B 3G5YA 3O6FD 5E2VH 1U8MA 3N06B 3HE7B 4CVZA 4MJ6A 4WDIA 1BX2A 3ILQC 5F72S 3TBVB 4PJDF 4O4YL 4JANB 4RBPH 2D0FA 1EZVY 2GSIB 1U92A 2VLJD 4OCWH 5KTEH 1E4KC 3MODL 1N6UA 5EU4B 4PRNA 3C6LD 1WV7T 3MRIA 5IMKB 1E4KA 4NNXB 2ZOLB 4OCYH 1VEOA 1YEFH 5CJXA 1D5IH 4MQXD 4R0LA 1KELL 2OMBA 4X7SL 5TPWH 3B3IB 2ADJB 1QBLH 4N0CD 1KOAA 4Q2ZA 1IGJA 4LIQE 4G6JH 4K8RD 5I19L 1CFVL 1GCFA 1MH5B 4WNQB 4WV1C 1F4WL 1GJIA 1XGRA 3G5VA 2Y06L 4DGVL 1VACB 1YYLL 2EE6A 1I9JL 4JDVB 5BS0A 5D7LA 3WSQL 2P4AB 1MIML 4ZQKB 1EHLH 4HKJB 4ZSOA 4KROB 4JB9H 1P1ZA 5AD0A 2G5BB 1EHAA 5E9DD 5I76B 3PWPE 1FVDA 5T1LD 1KXVC 1WCBB 3UAJC 2YBRA 2P5EB 4XPTL 5E4EB 2A77L 2CDFA 4OBSA 3C5SB 4PLJD 3QQ4B 4I2XB 1KIQA 1W0VA 4I3GA 5A1AA 3WEXB 3VJ6B 4OCSH 1MFBL 2QV2A 1O7SA 4RRPA 2VMFA 5A3IC 2QKIB 3VFWB 4R4BA 4LSQL 3GMMB 4KI5E 2CLVA 3ARFD 3CFJB 1G7HA 3MRFA 5B3JF 4PJHF 4PJ7E 1OP3H 3RJQB 4X4ME 3UPRB 4MA7L 1GC1L 3VXOB 5GS1A 4G9FD 5JQHC 3G6JA 1OTUD 4KZDH 2B2XH 1P4LA 4AIZA 2RIKA 2XXMB 3NFSH 3WD5H 4FABH 3ZLQC 5SV4A 3U0TB 5INCB 4IM8A 5KVDH 1B4JH 1LO4L 1NCTA 4GLRI 2X4OA 5L6YH 4N5UA 3T3PF 2F53B 2RCSL 4I0PD 1Q9OA 1C08A 1GGYA 3D3VA 1BVKA 1TENA 4R4FL 5B38A 3C9NB 1JJUA 4M00A 2DI9A 2PO6D 4GLRH 3X3FH 4O4YH 2DYPB 1Z5LA 5CLTA 1KB5B 2C4FU 4IRJB 1MFEL 3TIEB 3MLVH 2BY3A 5KSBE 3MJGX 4GW5B 2VIRB 5TDPB 4UTAL 1FQ9C 1FNHA 5F9JA 3ARBD 3ULVF 1QSVA 5DLML 4CU7A 1Y6KR 3MGTB 3SE4A 2X70B 3MLTB 5C0AA 4XNYL 2APVA 3CDCA 3SDAD 2X4NA 5JZ7C 1I3RA 4LIQH 4QT5A 1QBAA 2FB4H 3MMEB 1KCKA 3EIFA 3BEWA 1RURH 3HB3C 1FFPA 3AREB 2J88H 4U1LB 5F71A 1JZ8A 4OZHA 2YZ8A 4MD4A 1OARL 1KYOJ 5B39A 3ETBF 1MOEA 4JPWH 1ORQB 3RTQB 4NC1E 3WL9A 4TSCH 3WS6A 3RNQA 4HWBH 2JJSA 1CVSC 1N6QL 4X5LA 2XI9A 3FO0H 1BIIB 4JFEB 3TPUA 3WMSA 1EFQA 4F15B 1I8LC 3K80A 4LHJB 3RTQC 1NAMH 1N7MH 3ULUH 4M1DH 2FD6H 3RJDA 5I6XC 5IFHL 1HWHB 3HAEH 1NCDL 3N85H 3TCXA 1Z5LB 1AO7D 4PV8B 2ERJB 1EZVX 2HKHL 4XBPA 5C07D 3V95A 3QUMB 1EEZA 4GKZB 2AGJH 1IMHC 1C08B 2IALA 3B5GA 1Q9OB 4LLVA 4PGCA 2F53A 4WW2C 3EYQC 5ID0A 1KN4L 2H2PC 2FGWH 1AD9A 4LASL 3T09A 2F74B 3WDIA 4RZCB 1IGIH 3ULSB 4ZMAT 2FDBP 4HPYH 4ERSH 1NANH 4LCIL 4LLQB 3L5HA 3Q2CA 2UZIL 4QRPE 4MDJA 1RIVL 2B4CL 1WICA 3KJ6L 4X9BA 5F3BB 4L5FH 4QWWC 3FAXA 2P42B 1V7NL 2AK1L 3WYRA 1MFDL 3C2AH 4U3HA 4NQEE 5T5NG 2W59A 1MHHB 1I9RH 4JPVL 3PHQB 3STBA 2PKDA 5ALBL 2NY5L 3ZKQD 3S9DB 2VDOH 4PPTA 3OAYK 3NCYS 2BSED 2R1WB 4NN5C 4KJQD 2MHAB 1FN4B 4S1SH 5I1LB 1MHCA 5ALCH 3CUPB 4L9LC 1CI5A 1GC1H 1I1AA 3ILPA 3MLSH 2P7TA 1H15A 3BP5A 2EDEA 1ZLVH 5HHXH 4N0CC 2PYEE 3SCMC 4PJFA 4OCSL 3T0XA 1CICD 4KXZH 4DKEL 3BPCB 1G84A 4K94L 4LNVA 3RY4A 4A2MA 2DBLH 1JF6A 4HQQH 4MNQA 1L7IH 1VGEH 4XMKL 2DLHA 4LLDA 5GGTH 3WBDA 1ZS8B 1CFQB 4NRYB 5E00A 1EO8L 4GG6F 3DVFA 1Q0XL 2X44D 4M48L 3LZFH 1X5FA 3CNKA 3T3ME 4JFDA 1I85C 1J8HD 2P5ED 1MFBH 4OZHF 3ULUD 3WV0A 1NGXA 3HNTH 3BYTA 4ZUVB 3Q6GH 5C2BH 2UYLB 4X6FA 1W72A 3OKEA 3F12B 5MERB 1TFHA 4P46B 4OLZL 2CIKA 4IMKC 5LWYH 3FN3A 4KRNA 4NZTH 5FA3B 3W11C 1JYVA 3BD5A 5IMKA 5L8LB 1IAIL 1RMFL 3FOMA 5C8JA 1CQYA 4NHUB 4R4FH 5DEZA 2HN7A 2H9GB 3K0WA 4KKBD 3RKDC 5IQ9B 1U8HB 1NMCC 4O2EA 4ZG1A 4BKLA 5ACZA 5E5MB 4KUZH 3ZTNH 1FFQA 3OAUL 4LEXL 4LRNH 4HH9A 1H3WM 4G8FA 1DEEA 5BRZE 1L0YA 5HYIA 2AV7B 1F13A 3AB0B 1C8PA 4FQQB 4UDTB 4J7RA 3IKCA 3MRDA 5HDBF 5D1QD 4LGPB 5E5RB 3K8LA 3LIZH 5IHBA 3SO5A 5I1KH 3UJJH 3U0PA 5J7CC 1C7SA 1NEZB 2B1HH 1I9IH 5DD0H 1KULA 2DJ4A 1BAFL 1LK3H 3VE0B 5H94A 2FIKB 3W11D 4OCYL 5JW4M 1CGXA 3H0TB 5EC2A 5CHNA 4HG4J 4KK5C 3VWKC 5D72L 2MWCA 3C60B 3FT4A 3T8XA 2X9YA 2F8XC 3EOAA 5C0JA 1ZT1A 3O3UN 5E95B 1XF5A 1WJ3A 4YPJA 4CRPA 5F88A 2VLKA 1Q0YL 1RUQH 3LEYL 4OZFA 2X4UA 4MQ7A 3MCKB 2ITCA 3CLFL 1CXFA 4FXKB 1KJVA 3IRPX 3QEUA 4C56D 3HS0B 3GIZH 3CMOH 1LEKB 3ARDB 5EPMB 3BKYH 3X3GL 3LSOA 4QF1A 2JB6A 1YJDL 3IDJA 2R1YA 4J8RB 4JDTH 3VMNA 3OXSB 1P9MC 2ARJB 4P57A 1FSKC 1H9VA 2BNUA 3LSOB 5BZWA 2EDWA 1CR9H 4TTDC 5C0AD 4HUWA 1S5HA 5I71B 1G0DA 3HLAB 3QXDA 1KJVB 1DE4A 3FONA 4Y4FD 2VLKB 4OLVH 2NW3B 1EAPB 4O9HL 5B3NA 2Z8VC 3EOAB 3BPLC 5L8JB 1MWAB 4OIBA 5HSFA 4YNYB 1GGCL 1YNKL 4JN1H 1N2RA 1CDCA 1FL6B 2R0WL 4MWFB 5I30L 3UTTB 5FV1L 4NP4H 3EO0B 4QRRB 4JGUA 5CHNB 1X4ZA 2XT1B 2V5SA 2FIKA 4N8VA 1YN7A 4QO1A 1XIWB 1F4HA 4LASH 4Y16C 4Y2OA 5BV7C 5CEXB 3VWKA 4JM2B 4QYOA 2XQYG 3KPRD 3EOTH 4MAYD 2R15A 4R97B 3DGGB 3WN5C 4POUB 3DMMA 1UYWL 4DKFL 4F3FB 1OPGL 4RQQB 4J3UA 4K3DL 5IJKA 3MRGA 5FOBA 1NCDH 1T5XB 4YUEH 1NCWH 2DLFH 4HCRL 2XQBL 4DUXA 4J6RH 5GGUA 2XWTB 4KVCL 4OCRH 3TBSA 5DC4B 5LBSH 3BKJH 5E8EA 2JIXD 4BKLB 1TZHA 5ACZB 3G9VA 1XGUB 4HEME 2H9GA 3QYCA 4H88L 5BRZA 4Q9RL 1T03L 4RMRA 4O58H 2PW2A 5JMRA 1SEBB 5EULV 2H32B 4PGBB 4WHYH 5F7FA 3UBXI 1QACA 3F12A 3ZT6A 3VG0L 1E28B 3MQIA 3OKEB 1W72B 4S10A 4ZYKB 1P7QB 3MACL 2OP4L 4F7MB 5MP6L 1F3DH 3BGFB 1BVLA 4YHPB 5D8JL 5GGVH 3TH2T 3O4OB 3E8UL 3NCBB 4X5WB 2WWMC 4PLJC 4DEPC 5GGQL 3G04A 5AAMA 3UDWC 3LN4B 2DQDL 1KPVA 3CSGA 2IGFH 4JFEE 4LOUD 4R4NC 3OMZA 3O2DL 3RVTD 3VD7A 4HPYL 5T3ZE 1H3PH 5MEQA 5SWZE 3NFPB 5GRVL 4WV1B 4WWKA 4LLWB 3D5OF 4YHKL 4PTUB 3BPCA 1B2WH 5DRWA 1NFDB 3V4VH 5C0DA 3MLUL 2BVEA 1J05B 4U6VL 1GSMA 2NY2B 1P7KA 1YECH 2E6QA 4HZLB 1NGYA 2D0GA 1YNTA 4OT1H 4Y4KC 1OM3H 2D3VA 4LVHC 1AGFB 1CK0H 1N8ZB 3R0MA 1KB5H 3BMWA 1FN4A 4PJFE 2MHAA 3WFHB 3O4LB 1KTDB 4JFED 1OP9A 3VGFA 3ZYZA 1XF3B 3QDGA 1ZEAL 1UFUA 1Q9KB 3TVMA 5HDBE 1MCOL 2BOCB 1MF2H 3W9DA 4XWGH 4L4VB 4PJ9D 5C7XH 2VJXA 4JFZL 5FYKE 2E7LC 2H1PL 1G0YR 3L9RB 2B39A 1D3CA 4GOSA 4DK3A 3KGRA 4LFHD 4OUOA 1OAKL 5F3BA 3SY0B 4ZOCA 3DBXB 2CRYA 4Z78A 5I1IL 4ZFGL 4U3CA 2XY2A 4WO4D 1EO7A 1FVEA 1BQLL 2V7NB 5DUPL 1CGTA 4NFDA 4ZFOB 2X10A 4N8CL 3W0WD 3OKYA 3S36L 1F8TH 1QG3A 3TBTA 2G60H 5GRWA 5ID0B 3J7HA 4N8PA 1YQVH 4JLRB 4PJ8B 4LLVB 3B9VA 4PJAE 3RX5A 4QHLA 5CGTA 3WE6A 1UM5L 3M8OL 4GKZA 1LO2L 2JCCF 4N90D 3PABA 4KTYA 2SEBB 2Y07H 4OB5H 5F93C 3RNKA 2GK2A 3WO3B 3FQRB 3RU8H 4KPHL 1KJMA 2YD6A 3DUSB 2O93L 4TULH 5FYKD 2V9TA 4JFFE 2DMKA 5BZDA 2EZ0C 3G6AA 5HYFA 5JO5A 4BJLA 4KK9C 3UDWA 2H26A 1EA9C 4L3CA 5GGTL 5C0RL 1MRCH 1AR1C 4ACPA 3IF1A 1ZWIA 3FB7B 5FM4A 5ILTL 1RUML 2GTWB 4EUPA 4JN1L 1ZGLP 4GKNB 4XNMA 4LAQL 2CIIB 4Y7MA 3RTQA 4ODXB 3GMOB 4ZAKC 2VNCA 5DHYA 3MJ7A 1AE6H 3KPPB 3RAJH 4R3SA 2JJSC 2V9RA 4HGMA 4HK0A 2FYYA 2DTSA 1VEMA 3MJ8A 4N0RA 4KFZC 1IGML 4QT5B 1MCIA 2ZG2A 4PLKC 5HYSA 3MGTA 5D6CA 4NZUH 1XT5A 3BDBA 2W9EH 1YDPB 1RI8A 4IRSB 5FYJE 2B0SH 1HEZB 3T2PA 4GW5A 5KVMC 4D0DA 4OZHE 2CRZA 1A1OA 1A7QL 5F6HI 3T3MF 4X4YA 1NCBH 4H1LG 4IMLA 3RIAK 3DMMC 5EZLB 3RGVC 4Z77B 4XPFL 5HGHA 4MQXC 3VI3F 3QO0A 4I3RL 5JUEH 1WT5A 3QP3A 4TVSa 1EFXB 5TF1H 5FCSH 5B38B 3MRLB 1BVKB 1P69B 3D3VB 4G7YL 3SDYL 3IFPA 4XH2A 3EUUA 5IBTL 2ZKHH 4JB9L 1MCWM 1L9NA 1VDGA 3EZJB 3TZVD 1NEZG 3CH8A 1OGTA 1YUHB 1X5JA 3UYRL 3JTTA 3IVKB 5D2NB 3MGOB 5EOTA 1Y18A 1LNUB 1N5YH 3G08A 5SWSD