5DHVH

Hiv-1 rev ntd dimers with variable crossing angles
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
QEQLVESGGRLVTPGTALTLTCKVSGFSLSGFWLNWVRQAPGKGLEWVGAIYRGSGSEWYASWAKGRFTISDTSTTVTLKLTSPTTEDTATYFCAADTTDNGYFTIWGPGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of HIV-1 Rev Filaments Suggests a Bilateral Model for Rev-RRE Assembly.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Immune system
molecule keywords Anti-Rev Antibody Fab single-chain variable fragment, heavy
total genus 27
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2015-08-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dhvH00
1A1OB 2OTWA 4FRWA 3WN5C 4KI5E 2PXYD 2OR9H 1N2RA 5T3XL 4JM2F 2VXQL 2C3HA 1YEDB 5IQ7L 4E5XB 2I25N 1YEFH 2QKIA 5DJYB 2MCG1 1U41A 2DLFL 5BQ7B 1IM3B 1MJ7H 1FNFA 3QNXB 2BOBA 2EYRA 1H8NA 5A2LH 5KVGH 3OQ3B 4OTXH 4X4XA 4LLDA 2BY0A 4POUB 1LP9B 3TPUA 2MHAB 3FB7B 4LPUA 1R3JA 4LVEA 5DUMH 3SDYL 4K9EC 2IQ9L 1RQ5A 2Y9RT 2B1AH 1ED3A 2QHRH 3HC3L 3LV3B 2XFXB 2GJ6B 5D5MA 1UYWL 5TDOB 4KQ4L 1RZGB 2DTSA 3TCLB 3FONB 4CL7A 1HQRA 4HS6A 1UM4L 2XPGB 3VGEA 5IB5A 3SCMC 3TZVC 4YXKH 1CS6A 3OAUH 1U6AL 2AP2A 1JNLH 3LKQB 3NCMA 1RK0B 4WI8A 1N7ML 1L0QA 3TZVD 2VDNL 3GB7A 1DQMH 1LGVA 4HC1L 4XP5L 4LEOA 5B3JF 1HOCA 1IGJA 1M05B 4G6JH 1J1OH 1RZ8B 4XPTH 2GEEA 2Y6SD 2CIIB 1YQVL 4Y2DD 3CK0L 3AY4C 3MA9L 3OAZH 1TCRA 3PHQA 4Y8AA 2HTLC 5I1LB 2RR3A 2YD2A 4KMTL 1CD1A 2YD8A 5E8EB 2FX8L 1LO0H 2AV1A 1Q8MA 3G5VB 3KPSE 3QZWB 5C07E 4WTZA 3UMTA 3ARSA 4XPFL 4MQXD 3TJEL 1L4IA 1AC0A 1FC1A 1MY7A 3PWJA 4CVUA 1C5CH 5BOZG 2APXA 4LVNB 1NBZA 4AQ1B 2W0FB 1KT2B 3O41A 4D9LL 2PYED 4CADB 4NUJB 1IBGL 4P9ML 4BM7A 5GRVK 1V7NH 4WI3A 3UJIL 1WWBX 4M7KH 3GIZL 5D2LA 4LNVA 1EFXB 2V7HA 3RVWD 3M17A 3RIFF 5JPNA 4PJ5A 1WZMA 2V5YA 3A0OA 2IMNA 3P30L 5F9DC 3SE4A 1DL7H 2OL3A 5HHPA 3HG1A 4YNYA 5BV7B 4UQ2A 2X4SB 3S36H 4MLSA 2GSGB 4I4WB 4ZFGH 4NM4H 5E2TH 1YEFL 1HZHH 2QQLL 3V52H 3K3QA 4F3FB 1AQKH 5HYJB 2GK2A 4M1DL 3VD7A 1QFOA 2CO7B 1TVHA 1YC8A 5KVEL 3WIIH 1N3NA 3K80A 2Y36H 3RWGA 2ORBH 2ZUXA 4M7ZB 4L8CA 4EXKA 1EHLL 3MNZB 3RKPA 1MFCL 2ITCB 3GK8H 1KNOB 2F74A 1J8HD 1A7OH 1Q9WB 2EDLA 3O8XC 1ZHLA 5F44A 4M1GL 4XCFL 2VXTH 2EDJA 3O2VL 2NY5H 3FOMB 4YGAB 4U1NB 3LQMA 4PS4L 2Y4SA 4MJ4A 3BZFA 4DUVA 5LGKA 3D69B 4GT7A 4CMMA 3AMKA 1ETZA 1TQBC 2F53A 1L7IL 1XIWB 5C0AA 1SJHB 4HPYH 4NWTL 4OBRA 1KG0A 2VZVA 1FH5H 3MRKA 3V5HB 1AXTH 5JORA 3HUJA 3CK0H 1NGZB 5ACZB 1TETH 5GGRA 3SOBH 4H26B 4U0RC 4M00A 3O2DH 5DJ6B 4ZSOA 4H1LH 3MXVH 3BPOC 4KKBC 3U4BH 3NFNB 1X5XA 5KJRH 2BNQD 2P1YA 3O3EA 2ZCKL 5CIPA 1A6TB 2AJ3A 1BGXL 4FQXB 1E0OB 2AQ3A 3IU3B 4MQTB 1JE6A 4HKBA 1CGTA 3EJJX 4OTXL 3KYMA 2IH1A 1XF2A 1NCCL 4N8VA 3K1DA 1NCWL 1T1YB 3T1FB 3WNOA 1K5NA 1J12A 3NZHL 4S1QL 3OBAA 2DYPA 5T5FH 3CFJA 4OCYL 5LKNA 5D7JA 2EEDA 4GLRH 5I8OL 4BKLB 3IDXH 5EOCJ 5F3BB 3TVMD 4Y5VB 4DZ8A 3DX9B 1IEHA 3T0DA 3FOLB 1QUNA 4NCDA 5DEZA 3O11A 3SPVB 3EO1B 2OI9B 2MQCA 4C56D 2ZCLL 5DMIL 1CGUA 5DZOA 4E0RA 4NO2B 1BWWA 1E4WH 2CJUL 4MAUH 4IOFD 4Z0BH 2YPKA 5I1EH 2X5PA 5DA4A 5I1IL 3WCYA 1NFKA 4UIKL 4DGVH 3HI5H 4L9LA 2KZWA 1T0MB 3QXDB 3T0BA 2C3WA 2D0FA 3KXFD 3NFPA 1MCSA 3SDDC 4M5ZL 2VABB 1KELH 4PYHA 3TO4C 3D85D 3H9ZA 4PJFE 3UYOD 4NUGH 3FQUB 4YHPB 5FUOL 3ZT5A 3PF2A 1MCDA 5DQJA 4QGTA 5EPMA 1FVCB 4PP2A 1LMKA 4ZFFA 3CUPA 4TUJB 2HWZH 4LCWE 3ISWA 3WLWD 4P5MA 4JDVA 3HR6A 4LKXB 3JWDC 3P3YA 4U2ZA 3C60B 1W72H 4GBXA 4HGKC 1OGTB 3MRRB 1E4JA 5DD3L 5AZ2H 5J7CC 3RZCD 2FJFA 3JV4B 4Y2DB 4DOHB 5HGBA 5KSBB 4OV5B 1KPUB 1KGCE 3WFCL 2BC4B 1C08A 4HSQA 3OAZK 1LHZA 2E8ZA 4U1MA 3RVXD 2PNDA 1S9WB 4LLQB 3VW3H 5IMLA 1MRCL 3P0YH 5DSCB 1FG2B 3TZVB 4K9EH 5ICXB 2O5YH 3DUSA 2EO1A 5FO9A 3ROOA 3L95A 1R3KA 1I4FA 5F3HB 4ORZC 3V5KB 1RUMH 1IAIM 3I6LD 5CBEB 1OGTA 3MRRA 3UJTH 1HQRB 1CDJA 4HD9A 3VXMB 3SDXA 2OBGA 4FZEH 1YDPA 1WTLA 4YDVB 5F7DB 2DQFB 3PGDA 3SDXF 3LSOB 4U1IB 4MXQD 2P8LB 4J3SA 1NC4D 1ZEAL 1ZT1B 4HT1L 4DUXA 5D1XC 1RI8A 2ICEB 1T20B 3TBYA 1FFOA 3SGKC 1JF5A 5F3HA 4O58L 1CDIA 3O9WB 4RFNB 1MFCH 3GK8L 3TP4A 5IF0B 3U0TB 3QWQB 3IDGA 5A16B 1MQKH 2GJZA 2V5TA 2WWKT 3BPCB 3VFGH 4KVCH 1ADQL 4JM4L 2BY2A 1NEZB 1WWWX 3CAFA 2X4OA 2P4AB 3OXSA 4NT6A 3GMQB 4EOWH 2DQEH 2P44B 4KKAD 3TT1L 2R39A 2HYMA 1KEGL 4XGZB 3B8SA 3QIWD 1DEEA 1L7IH 4EN3C 2WM0A 5F1IA 1A7QL 3EW3B 4XCCH 3K8KA 4RGOL 2ICEA 2N56A 3DX9A 4KQ3H 5IFAL 4PV9A 4U7KA 4JFYA 2GITA 2A6DA 1YEJL 3HZMB 4HKXA 1AGEA 2EDNA 8FABA 3LS4L 1QKZL 4AEEA 4IRJD 1PZ5B 2CK0L 3UJJL 1BF8A 3IDJB 3STLA 4BZ1L 2R56H 1QLFA 5JQHC 3MGTA 1XR9B 4LMQE 4LVOB 5CAYB 1WUNT 1EMTH 4QRUB 1GC1H 5IVXB 5DT1H 3SKJL 1NCAL 5HI3C 1FPTH 2O5XL 2GSIB 5E56A 1LEGB 1PZUB 3MLZH 3GUTA 1ZE3C 1B9ZA 3VWKB 3CZJA 1I3RA 1BZ9B 3BKMH 3EOAA 4BUHA 3FRUA 4OCYH 5IW3A 5HPMB 3WXWH 3FFCE 3MO1B 1A4JB 4IRJB 5FHBL 2ILLA 3RP1A 3OKKB 4PJEB 4ZMAT 5FYJU 1DN0A 3ARFB 3VFSB 3WIFB 1MREH 2IADB 4GS7B 4PJBA 4TRPH 1HHGA 3D0VA 5FDWA 3P9MB 1MH5B 4HUUA 4JFOB 2OX5A 1DBKH 2B0SH 5ICZB 5IHZB 1BBJA 1WEJL 3FHAA 4IRSB 2I5YH 4YHZH 5C2BL 4PUBH 1P5UA 2OCFD 3EHBD 4P2OA 3MRQA 4HC1H 4DVRL 4Z7UF 5ISZD 4X6DB 1MCBA 4I77H 4AM0A 2HTKD 1NC4B 4X9HA 4HIEB 4H1LB 4RRPA 1D6EA 4S11A 1U8JA 3ZHKA 3BQUA 2X42A 3QBTB 1JHLL 1MI5A 3MBEB 3QUML 4ZS7L 3PWPB 3NFPB 1DLFH 1IC1A 3NVQA 5FO7B 3QPQC 2LV4A 2XQYG 4GBXD 5DQ9B 3RDTB 3VFVA 1YYLH 4UILL 4E42A 2JJUA 1FRGH 2O5ZL 3UTPD 1HE7A 3CUPB 32C2A 4J7RA 5DA0B 1YY9D 5HYJE 1JRHI 3QQ4B 4IDJH 3RI5F 5IESL 3GMPB 4DKDC 2PCPA 2XA8H 1EV2E 1JZ6A 4TOYH 4FFYH 1LEKB 5SWQB 1B6DA 4TPRL 3F7YA 3T8XA 3SKNB 4P9HC 3RWEA 1DQJA 3H9SA 4OF3A 1HKLL 3DXAA 5GS1B 1GHFL 4OZIF 3VRLE 4WJ5B 4NBZB 7FABL 4LLAA 2DDQH 2JLLA 5IBUB 4PJIB 2C1OB 4GMSL 4DW2H 4NFCA 4U05A 3QDJA 3HHRB 1NAMB 1T1XA 5J4MA 4LCYB 4I5BB 4MVBD 5DSCA 5E03A 3MYZA 4A6YH 2A1WL 2NLJB 2A83B 3BMWA 3K81A 4NKDA 3ZYOA 4X9GA 3N0PB 5DVKA 3EJZD 1UJTA 3D85B 3GSUB 5KG9B 5C0RH 4F80A 2GITB 4RA3A 1EJ6A 1C16A 2M26A 4WW1B 5C07D 5HYSG 2X09A 3EYVA 1OCWH 1UENA 4MA7H 5IR1B 4KMTH 1LO2H 3QIBD 4JPWH 1I8LC 4HWBL 1BZ7A 1KIUA 4O58H 1BM3H 2NXYB 3HE7C 4OD1L 2BNQA 5CILH 1OAXL 1RUKL 1GGIL 25C8H 4W4OA 1A7OL 4YUEL 3GI9H 1VDGA 4Y1AD 1DQTA 3C8KA 5K9QI 3VRLF 5C08B 2NZIA 3NABH 1BX2A 3UPRB 3TN0C 4JANB 1YQ2A 1MCIA 1SJEA 3FO1B 4YQXL 4B50A 3V6FA 3ME0A 2OLDA 5C0DA 5CEZL 4LKCB 3JWDL 3L3DA 3D3VE 4OD3L 1XIWA 1HQ4B 3U9UB 4P23D 3QUZC 2FEEI 4JCLA 5KBNC 3CDCA 1GYAA 3AVEA 3WE6A 1R3JB 3BVNA 4MNHB 3RJDA 4H0IA 2OQJA 1WBZA 3WL9B 5ETUB 4PV9B 5DRNA 4R4BB 5IK3A 1F4XL 4JRYB 1NANI 1G7JB 3CSBA 4Z5RA 2EDEA 5ANME 3L3IB 3BDXA 5SWSE 2D31A 3UBXB 1T83C 1I1AC 2VDPH 4CNIA 3PGCA 3VE0A 4LHJB 2DTMH 4XVUD 3U83A 3PDGA 5C0DB 2NZ9D 3RGVB 2DBLH 2H2SD 5CZVL 4XVUC 3HMXL 2YD3A 3QIUD 5D1ZC 4O02L 5IMOA 2WBWB 1G7MA 5D2LF 4L8DB 3C87A 4JO2L 4KKLC 3ULVD 4E9LA 2VXVH 4WWKC 5FOJA 5E5MB 1T7YA 3WO4B 1F8TL 1CYGA 5F7WC 1HH6A 1U8NB 5E24E 4FZ8H 4XRCA 3FT2B 2OYPA 5HXMA 4YHIB 2VH5L 4NKMB 3VFMB 5CGTA 2X05A 5BVPL 4OGYH 3LS5H 1L6ZA 1HXYA 4HHAB 3CXHJ 1UJ3B 2MKWA 1UC6A 2YD5A 4PLJC 4POYA 3GMPA 4R4NC 4UNTA 1XIWD 3DROB 2F58L 2MFNA 2Y1VA 5FYJD 3GBMH 4DVRH 4J8RA 2FBOJ 5E5MA 4DAGH 4HAGA 4PGEA 1ZVHA 5C3TA 2YUZA 3CX5K 2P8PB 3U36B 1WF5A 2EH7H 2MCPL 2Y6SC 5KSVB 3IDIB 2R8SL 2A9NL 1TQCB 4L29A 1JPSH 4PJ5E 4IIQB 4XPBH 1U93A 3QIBA 4OCXH 4X98A 3ZTJG 3O6LL 4PIRF 2RHEA 1U8PA 2EE2A 1IRAY 3F7PC 2VZ3A 3DSNA 1BHGA 3RGHA 3CPLA 5I73B 4HIHB 4UZGA 4XNXH 5ID0A 3UC0H 1BOYA 1OAKL 4BUGA 2YD9A 2Z8SA 1K5NB 3W5NA 4OB5L 1IEAB 5DJXA 1GHFH 5E7FA 2DM4A 3VXUE 2EEAA 4WFHE 4JAMA 1BVLB 4PJ7E 3QDMD 5DVNA 5I73C 1VSCA 1GGBH 5JOPD 2HJKA 5FCSH 5EFIB 5FCUH 3Q6FB 4FQPA 5C08E 3T4YB 4JPVL 4KRMB 4XNQB 2QHLA 4YDIL 2D9CA 2P45B 4K7PX 1XEDA 4XHJD 2CLZA 2FX9L 3DNKA 4DN4L 1JYXA 5E1AB 3RVXC 4OAWA 4Y4KB 4P2CG 3WMSA 5KSAC 2E7BA 5IFJB 2HN7A 3ULUL 4X4XB 5IOPB 4UOW1 1PQZA 2F53B 3GMLB 3G5YA 4LFHG 1AO7B 3D85A 5KG9A 4QWWC 2FATL 4P9HL 4QT5A 3OHXA 4NSKB 4PGDB 5EORL 3CVIH 4ZOEA 5JUEH 1WSST 3QT2A 2JF1A 3KPPB 5C70A 4KJQC 2VLJD 3RNKB 2Z8RA 3QI9A 4KGLA 3RI5K 4J3TA 3LS5L 2C26A 3SGEI 2IFGA 1RV6X 3VI4F 1U8HB 4YXKL 2A6JA 5B38A 4GSDL 4ELMF 2AW2A 1NCTA 3KXFE 3L6FA 3AXLB 4F15C 3BKJH 1WC7A 4L8BB 3QCUL 3VRIB 3QDME 5F7EH 3L3JB 2A6IB 1KACB 3DRTB 4XPTL 2DQIH 1LO4L 3UYPA 2FZ3B 3TESA 3P0YL 3S35X 3B2VH 5ACZA 1XZ0A 4U6VH 3T65A 2QQNH 3EDJA 4K7FB 5E2VH 1QKZH 5GGUB 5E94B 4X80H 4JRXE 4Y4HC 1JHKH 3FRPG 3DIFB 3PGFH 5IB1A 5IQ9B 2YD4A 4ZS6D 4KZDL 2XTJE 1A6WH 3VFOB 4OZIB 2I9TA 5FV1L 3KWWA 5DVMA 3B9EA 3VGAC 3QZWG 2RQ8A 3NA9H 2ATPA 3C5JB 3IDNA 4ALAL 3FHQA 3PP3K 4Z7OE 1FGVL 2R69H 3ARUA 1FNLA 1P9MA 1RMFH 3GSXB 2P7TB 2GKIA 4G9FE 4UMGA 3V0VA 3P4NB 3DI2B 4JB9H 1DBJH 4GXUN 2HRLA 3FKUS 3LKSB 2OP4L 2LE9A 4MA3A 5D8JL 2LTQB 2MMXA 5BS0E 1G7MB 4R0LC 1AHWC 1LE5A 1C5BH 2CDEB 5GGVY 1QVOA 2ADGA 3VGFA 1JWMA 4NKIL 4JLRA 3WDJA 3TBWA 2EDOA 3I3EA 2ZUTA 3VFPB 2AAVA 3NCYP 1Q0YL 4JY4B 1CLOL 3G5VA 1FIGH 2M2DA 5IVNA 1JGEB 1QBBA 1A2YA 4C83A 4F7CA 1A4KA 3HPJA 2C7UA 4L9LC 2I5YL 3U7AA 4J2XA 3OJ2C 5C6TL 1KIQA 2EXWC 4HH8A 4R96A 2P8LA 4U3XA 4UV4H 5GJTL 2OJEB 4EKXA 4DOHE 2D7PA 5GGSA 1RHFA 3QEGH 2WSKA 4XC1L 4OZFG 1OTUD 3PNWB 3QULA 4U1HB 3VXUA 5IW6A 2R56L 4N0FA 1S7TA 5DJ0B 3U4EB 1ZHBB 3KPSD 4F7PB 3AAZB 3T2OA 2VLKD 5FO9B 5BMFL 1I3VA 2BRRH 2B1HL 4YHOH 5FUZH 3LEYL 4IBLT 4XXCC 4WUKH 2HTKC 1FAKT 3I2CL 3S9DB 4EIZC 3DMMD 4Z8FH 1C08B 4FFYL 4D9QD 4OB5H 1E27A 1T2QH 5FA4A 1GIGL 3WEXB 2ED9A 4QRSB 1DDHB 2H1PL 3D2UB 1TIUA 2NY3D 3F58H 3O4OC 1MNUL 4OGAC 3BQUB 2BSSA 2PYEA 3MRCB 1FL6B 1FE8L 1HHHA 2V17L 3GSNL 4UTAH 5EPMB 3L1OH 3DYOA 3O3EB 3U0TA 1I7UA 1J7VR 4L4VD 4LDOB 5C0BA 3E6FA 1UB6A 3QEQD 1YEKH 3DX8B 2AJSL 3C8DA 2NX5B 3CX2A 4ZYKB 4M1CC 3LKQA 4OCSH 3TA3D 3GSOA 4JKPH 3LQAL 3VH8A 5B4MD 3TC9A 1A9EB 1ZA6B 4DVBA 1I7TA 1N6UA 4S1SH 2Q8BL 2PO6D 2VLKA 4WFFE 3HR5A 4MXQC 2CLVB 4LCWB 5E1AA 3S96B 5DR5L 4NJ9L 4FABL 1N64H 1F58L 1LWRA 5IR1A 1FV1B 4OZFB 5DO2D 2ADJB 1IGYA 5DYOA 3VD4A 5DF0A 5IJKA 3AB0B 4O2CA 5SWSB 4M61B 1T21B 5HHVL 1BQUA 2IANA 2FGWL 4NZRH 4HFWB 3QXDA 4O9HL 5GRVL 3X3FL 3TGXA 4H0HB 1L7TH 4B7IA 4NNPH 1EO8H 5D71H 2E5EA 4G8IA 3CFEB 3EFDH 1RIVL 3F5WB 3HNVL 4GQ9L 4BH8B 3FQNB 4E41A 4YEEA 3W39B 2ESVD 3OKDA 2VN4A 2BY1A 1SVCP 5J1AB 3QISA 4GKSA 3HRZA 4I3RL 4MDJB 4L9DA 4YX2H 4MZ3A 2H32A 1UH3A 1UM5L 5I1AA 4YFLI 4MAYA 5HVHC 2DMBA 3MRJB 4ONOA 3MV01 3QFJB 1XF1A 2J1KA 1F4YH 1MHEA 5IT2L 2YPLB 2DQCL 1QFPA 5C3LD 4LSVH 5DLMH 4Y2DC 1CLYH 4M48H 4PYGA 3DO3A 2FIKA 2WWMD 3VFUB 4KK9D 2J88H 3ARGB 3OB8A 3GMQA 5IROC 4MHHI 4R2GB 3K7UA 5HJ3B 1FDLL 3ES6A 2W9LA 5F88A 4X6EB 5I30L 5BZDB 4WFED 3V7MA 1TDQA 1NMCC 4U33A 5E9DE 3DBXA 3G08B 3KYOB 1OSPH 5SV3A 2IF7A 3MRFA 4J1UB 1UYWH 2X1QA 4H8WL 1WLHA 3CFBA 5ICXA 3BIBX 3PIQA 3WFDH 4ESKA 1KNOA 1S7QA 2VLMD 1KBGL 5CUSL 2X4PB 4HK0B 3WFBL 3PL6C 2DLTA 3HI5L 3LKOB 1GGUA 3WLBA 4KI1A 4XP5H 1JGEA 4BK5A 1NCNA 1RFDH 1A02N 3U0PA 3JWOL 1EVTC 1KB5B 3TO2B 3HE7A 5JW5B 5DDHA 3JTSA 5DZLA 3RZCA 1XT5A 4DQOL 3EYUL 4U6YB 4PLJD 1ZLSH 3QO1A 3OAYK 3IETA 1OARH 4K3JL 4FQ1H 3Q1SL 2X4OB 3VGDA 3W11C 5CSGA 5DQJB 1H8SA 4MA1B 1MQ8A 1MJ7L 1X6NA 5C08A 4QO1A 3GNMH 2BERA 3LEYH 1BPVA 1HDMB 3UDWA 2F19H 4JANA 1K4DA 2ICWA 2VLRB 4URTB 4NO5A 1QO3A 3LHPH 1FN4B 3U2SB 5GZND 3PJSA 1WZ1L 3L3DB 4JN1L 4Q74A 4HKZA 2IPUK 2ZOKB 4DTGH 4KK6C 4KKNA 4GRMA 4O00A 2Z31B 5EC2A 4X5XB 1T83A 1P7HL 1RZIB 1FNSH 3QJHA 5ERWB 3VFWB 5F7HA 3B8YA 1EUUA 2J8UE 4WENB 2HP4A 1GGCH 3OPZH 2GFBB 4V1DB 1JWMB 5EOCH 3DUSB 5JW3H 1P1ZB 1PAMA 2PO6A 4WGWB 3A6OA 2NY4B 5E8DL 1FO0B 3CFCH 2R2BB 4HUXB 3VA6A 3RIFK 2BNUB 4OM0L 4R2GC 2V5MA 5DHYA 1F00I 2AEPH 4HUMB 5E1HB 5MEND 4KJYB 1XGPA 4O4YH 4HT1H 2DYPD 4KROB 4XNMB 5EOTA 2VWEC 4D8PA 5HDQL 3MJ7A 3JV0A 2R1XA 2J6EA 5E2JA 4BK4A 4YHML 5I8EA 4NJ9H 1EFXD 1EHLH 1H3WM 3HUJE 3ZL4L 3HC3H 1A7RH 1RZGA 3PP3H 2XTJB 4WHYH 4NQXB 5F6HI 2X9WA 5JOPE 2A77L 4K3HA 1BBDL 5E6ID 1CXLA 1MHHA 1IGYB 3WHXA 1VPOL 3CDGB 2QSCH 4ZUUB 2VAJA 1FORH 1X5JA 3TPUB 3LD8B 1GOGA 1DJSA 4LK4A 3AMLA 3GHEH 1PSKH 4P57A 5CIPH 3QO0A 2AK4A 4LCCB 2B39A 1E28A 1C5DA 4P49A 1IGCH 3KLSA 4HWUA 4L4TE 3GFUA 4JO3H 4DEPB 3QA3A 3RNQA 4LDLB 5SWZB 4EVNA 1DTUA 1KFAL 1FZJA 3IF1B 4MCYA 1YEIH 3FTGA 4OI9A 4PJCF 1ZHLB 5MI0C 3P2TA 1MWAA 5GSRA 5DD0H 3BZ4A 3LD8C 3IT8D 4XNUL 2R4RH 1MLBB 4O51A 4NC1C 1HHKA 2W65A 3LKPB 4P0DA 5HVFB 1GC1L 3MRCA 4MAYB 4Z7VF 1CXEA 1QBMH 4Q7DA 1I8KB 4MA1C 1JK8A 2BNQE 2N4IA 4LHUA 4KPHH 4IDJL 1CXHA 3H9YA 4PGJA 3TBTB 1T5WB 1S7UA 5FYLL 5TF1H 5HGHB 2CUMA 2WBJC 2GYSA 3IU4H 1IAIL 5C9JA 4QRTB 2J4WH 3LZFH 1J5OL 2EH8H 3BSZH 5JA9A 1OP3K 1JJUA 2BHUA 5BZWA 2AGJH 3HPLB 1A8JH 3DYMA 3QDHA 1ND0A 4X83A 4ZSOB 5BW7A 1MREL 3MRNB 3FRPA 4D0DA 5D2NA 2GQHA 1NBVL 1K85A 1NC2B 3WFHA 1HEZB 5KW9L 4ODXA 1CD0A 1JGDA 2DMCA 3MOQA 2NW3A 4QRRD 4IOSD 4LRIA 5EBWA 2ATKB 2BNRD 4D94A 3U30B 3VWJD 5EC2B 2PXYB 1I3RB 2I60L 1SY6H 4JHAL 4P2RE 1MCNA 4AY0A 3TIEA 1QHOA 1PG7H 2EE9A 1SJXA 1JHKL 3OR6B 5D7KD 4KDTC 1F45A 1HH6B 5E4EC 2DLHA 4I2XB 4QHKJ 4QCIB 4OFYA 4RWYL 1CVRA 2R0ZL 3HLAB 1YYLL 1LE9A 4O2EA 2VQ1A 3S37H 2BNUA 3B2UC 4N0YL 1NJ9B 4HQQH 2A77H 2IBZY 4GAGL 4NRXB 3EGSA 1ZVSB 2H8PB 3VXSA 3NFSL 4P5TA 4FMFA 4YBHA 3TO4D 2X40A 3BUYA 4MJ6B 4WWID 1N5AA 4Z8FL 1NFDB 1BAFL 2C3VB 2P46B 3WFCH 3IFOB 3WD5L 2WIIB 3BGAA 5CEYB 4Y5XC 1NMCB 1VADA 4UTBH 3NIFE 4HBCL 4MJID 4FFZL 3HUJB 4QLRA 5FYKH 2FHCA 1FBIL 4F7EA 5C0BD 3PHQB 4ONFL 3QQNA 1N4XL 3HG1B 1RU9L 5EU6D 1JYWA 1FIGL 3WJLA 2DWEA 1EEUA 2HVKB 3JTTB 2GUOB 2FRGP 4R0LB 3HCVB 3WJJA 1H3XA 1ETZB 1JNHA 4HPOH 5DJ0A 4GXUM 2XZAH 3C08L 4FQJL 4MMXC 3WS6A 3CFCL 3PWNA 1LP9A 2FYYA 1OD9A 2WUBL 3HZVA 1KELL 1T66C 5EBLB 5L2KA 3N9GH 4YC2B 4RX4D 3ARBB 5I0ZA 1OW0C 2DL9A 3B9KC 3JUZA 1DQQB 2G2RB 3ARGC 3PWPE 4Y4KD 3T09A 3ZDYE 2PXYC 3V2AR 2XNAB 4WFGD 1INQB 4ODVH 1W0VA 5CJOL 3ZSTA 3C8HA 4OD2B 3PXHA 2CDGA 3W82A 1CN4A 1H3GA 4R4BA 5IK3B 4JRXB 3VMPA 4D9RD 3MRGB 1G6RB 5C0CB 3SE9H 3JXAA 1ORSA 3TBTA 5AZEH 3WO3B 2EDYA 4M93B 3FB5A 1TTFA 3UO1H 4QHUB 4DWHA 5HVHB 2X70B 3GSUA 4PRHB 1CTNA 4U1MB 4IMKA 1MCEA 3MLPA 3L3OB 5EU6A 1AE6L 1QSFB 1KCVH 3PQYE 5T1LB 1DANU 3GO1H 3ARPA 3MV11 4RMRA 3OKDB 5CZXD 1MJ8H 5F72S 2Z4QB 2C4FT 3ZTJH 4GS7C 5C0CD 3DURA 4KTEH 1KENH 5C09A 3DVGB 3WFHB 1B0RA 1RZKL 1KCKA 1IGFL 1A22B 4GKOA 3O41B 5SWSA 1F6AB 4P5TD 4RGMB 5D7JC 2GT9B 3MNVA 3CLEL 1H9VA 5F7DA 4P99A 4C57C 5IHLB 1J0YA 3LSOA 1KCSL 1LP9E 3MLSL 4UT6H 5D7JD 4NKOA 3RUGA 3PDDA 4L8SB 5DD1H 2F8XC 2EXYC 3MRHB 5HYSA 4APQC 4M8VA 1F8TH 1FL3B 3ARDB 4U6HA 1WC7B 2IAMB 3HAEB 4L8BA 4LBEA 3U48A 1BQSA 1KIRA 2EH8L 2A6IA 3NACH 3MLXH 4YBLB 4PY7A 4XNZC 4LAQL 3GSNB 3S5LB 5DVLA 3WS6C 3OGCA 3VXNA 5KTEL 4EQ2A 3CFBB 4GQPH 5ELIA 1H5BB 5EU5B 5FCUL 5C0BB 4YXHH 3DX7A 1MCLA 2EDKA 3UP1A 5TQ2L 4WNQA 2XG5A 4Z18A 4EDXA 3TN0B 3ARXA 3G5YB 4LSUL 3T8XB 5GZOD 1HN1A 1F6FB 4HZLB 2R1YB 1TXKA 1FGNL 3MV7E 5FFLA 5F96H 1U8MB 5CHNB 4H1LG 3MUGA 4EI5C 1TZHB 4Z0XA 3DARA 4K23L 4TUJA 4YFEA 1U8IB 4NQVB 3MLUL 4P3DB 5DQDL 2R0WL 3HE6A 5DTFB 2D0GA 3FTGB 5IEKB 1AJ7H 2EDTA 1HKFA 4PB0L 4X7SL 1XH3B 2YZ1A 4EOWL 1BOGA 1CF8L 1JNNL 5L2KB 4QYOA 3K4AA 4NO0B 4UB0H 3DX8A 1MOEA 4GAJH 3MFFA 5EU4B 2VDMH 3S3JA 4YDLB 5GS0L 4PJFA 4UT7H 3ZYIA 1WJ3A 2JB6B 4M02A 2P5WE 5J9PB 1SJVA 4FFZH 4R4FL 5BS0D 4L8SC 3P4MA 3BKYH 1XGTA 5ILTL 3O11B 5MEQA 4PJDB 4LU5L 1JPGA 5ESQA 3RHWK 3H3BC 1S7RB 5E8OA 2Z8WC 5KN5A 4R7DA 2Q86B 1AFVH 4K8RC 5LAXB 5C08D 5IROA 3H3PL 1DEEB 5DJZA 5JW4N 4FQJH 3G6JA 2XTJC 4PY8I 5KANG 1TZIA 1TJIL 1I9IL 1XGQB 2V9TA 5C0RL 1H5BC 2R2BA 4HUXA 4MXVE 4K7PY 2WZPD 1QSFE 1PVHA 4BA8A 4D0BB 3IFLL 4NC0B 3QFDA 4PJAF 5EIIB 5KVDH 4OBSA 5F1KC 1N5YL 3FQTA 3E2HC 2EE3A 1EFXA 1F13A 2OP4H 5D5ME 5EBLA 1N8ZB 2F54A 5FA3B 3QXTA 5LCVH 1NUNB 1HHJA 5FOBA 4Q0XL 3NN8A 4Y88A 2VLME 3O3UN 3C5ZB 4LSPL 4JFFB 4L1DA 5JPMB 2YXMA 5FYJL 1OTSC 2F19L 4ETQA 4PB9H 2E8YA 5ESAB 4TOYL 1C16B 4M7LH 3OV6A 2GAZB 1R5WB 3LQZB 3V95A 5F7EL 3QCUH 5CGMA 5HHNA 1YDPB 3ZZ1A 1B2WL 1T03L 2GTZA 1K2DB 1YNKH 4TSBH 4MJ6A 4KUCD 2QQNL 4PJCE 5MHSE 3V0WL 4ZUWB 3RVTC 3TZVA 1J10A 4UBDC 5AAWA 1D9KC 3IETB 2C1OA 4RGNE 4XPHH 4IOFC 3IFNH 1I9RL 3IJYB 3ZKQD 5BV7C 1RK0A 1AR2A 2D31B 5DUPL 2LAGB 4OQTL 1KJ2L 4BH7B 1W0WB 4Y19A 4GBXB 3T4AB 4UT6L 1NLBL 1ZOXA 4L3CB 1K2DA 1EEZB 5BZDA 1CGSH 1VHPA 3IDNB 4JB9L 4P46C 1BQLL 1FZMB 2MPAL 3NGBB 1BFVH 1QHPA 5DHXB 4PJ9A 1IAII 4M7JH 1FVEB 3U7YL 1EJOH 5F7LB 3Q3GA 3MLXL 5IOPA 1OAUH 5EUOB 3GMMA 3CJJA 3BQUD 4NKIH 3KNBA 3W0WD 1EEYA 1I1AD 1QSZA 4PP2B 4RQQA 2WAHA 2V17H 3MODH 3PABB 3WNPA 5BQ7A 5I1EL 2D4DA 4JR9L 3RL1A 7CGTA 1AP2B 8CGTA 4P4RA 3UCRA 2J8UF 2A73B 4QTHA 1FORL 2AEWA 3EDEA 3KPRA 1B4JH 4Z95H 1P69B 3RWIA 3O6FC 3QUXC 4TUKH 2DJUA 1UADC 3F7RA 1GPOL 3U79A 2R2HB 1R3HA 5IWLC 4JHZA 4OKDA 4OZHA 3HFMH 2AJZA 4TULH 1Q72L 1VGKB 1X9QA 1U3HB 4GG8A 4XTRD 4P48A 4EQ3A 1GH7A 3G6JF 4OCLC 3AGVA 5C6WH 3TIEB 2D7TH 2G9HB 4PJBF 3X14B 2NPLX 4NRZB 3MRMA 1CBVH 4N8CL 1A1MB 2YBRB 4OCXL 4JRYE 1KC5H 4U1GC 2CUHA 2IPKB 2EYSB 4LP5A 5A3ID 2B1HH 3ZKXB 4LSSL 4M6OL 4G3YL 4RSVA 1CR9L 1F02I 4U1KB 1XMWA 4G8FB 1PKQE 1MFAH 3F5WA 5GRZA 4XWOD 3FB6A 5TJWK 3ZDZE 4NPYB 3EYFA 4NQCB 1HEZA 4I1NB 3H9SB 4JFZL 4ZTPH 4PJFF 4LCCA 4P4KA 4XBGA 2E27H 5KSVA 5HGDB 3NIFF 5CEZH 4WV1C 1NBYB 4NO0A 1A64A 4JO4H 3BDYL 5E5RB 5D5MB 1J1XL 5FXCH 3QUZA 3L7FA 1SEBA 3W2DH 4KRNA 3CDYA 4KK6D 1D6EB 3SJVD 4X6FB 3M07A 2ZUSA 4QRUA 1AR1C 3IJSA 3SDAB 3PG2A 1CG9A 3MCLL 5EZLA 2QR0B 4IS6B 2F58H 2E3VA 4MS8C 4NJAL 4OFPA 4PV8B 3I75A 1ZTXH 2FSEA 4HPOL 4XNYH 2AJSH 3R4DA 1FCGA 3D69A 5M94B 4NFBA 5L2KD 3ARYA 3KPSA 2A0LC 3VFRB 4DN4H 4Z7UB 2YEZB 3ZYZA 1IMHC 3CU7A 3MCKB 4LLWA 1OAQH 3MLRH 4KV5E 1VEOA 4R8WH 1OB1A 4WI9A 4X8JA 2DLEA 3MBXH 2WINA 4RGNB 4RMQA 2NNAA 3Q6FA 2G2RA 5E9DA 3B9VA 4PRDB 1MFDL 2EYTA 3T08A 5JOEA 2FGWH 3EYSL 1M4KA 3VXMD 1ZHBA 4GAGH 1H3PH 2R15A 1YMMB 4LVHB 3LH2L 1XCQB 5DXWA 2D4FA 1IGMH 3O81A 4PB9L 3OAYH 3SDCC 5L6YL 1TVHB 3ZDXE 3MRKB 3BPLB 3HZYA 1G7IB 3UJIH 4ZAKA 2R23A 2A2QT 1MCQA 5C8JB 4XP6L 4HPYL 3QEQE 3LV3A 3FQWA 3EO0A 3BW9B 4QY8A 1CFBA 1BZ9A 1QRNB 2EIBA 3D39B 2Q7YA 4O5LH 1BJ1J 2GK0B 3DVNA 4PP1D 5JDSB 1N0LA 3MUHL 5T1DH 4L4JA 3MREA 5LBSH 4DQOH 4WHTB 1IEBB 3A6BL 4MX7A 5C71A 1QLEH 4FQHB 1ODAA 1ZHKB 1YN6B 1PY4A 2IEPA 4LSVL 3R8BB 2ADIB 5IEHA 2B2XH 3BMVA 3MLWH 1R6VA 5KVEH 4P5TB 5IMMB 1EERB 2DMKA 4N0UA 4NM8H 3N85H 3VXOB 3UTTD 3MA7B 3X14A 1EJOL 4C4KO 4M7JL 4ACPA 5GS2H 3C5ZC 5FKPA 4MX7B 1J05A 1R5VA 2WUCH 4Z77B 4H8WH 5JHLL 1JFQL 3NTCH 5HHOA 1TZGL 2GJ6E 5D7SL 5DEGA 1CXFA 4TVPL 1XF4A 4XCFH 4JM2D 3DMMC 5EBGA 2Y7QA 4LGPB 2ZPKL 3C5ZA 4NNYB 2YMXL 2AKRA 5B3NA 4EN3B 3RX5A 4U1JB 3EDDA 4QHLB 3BZDA 1AE6H 3RU8H 3TVMB 2OI9C 2R1WA 4HXBL 5M7QA 4KXZH 3GJEA 3DMMB 5T33H 1F2QA 4MGXA 1R3IL 4PREB 5TDNA 2HH0L 4LP4A 2I26N 2BJMH 4MD4B 3UAJD 3ARRA 5CINL 3VMNA 4M7ZC 3BJ91 5A2JH 2DKUA 3MV9E 1G7JA 4E42B 3UAJC 2J8OA 1E6JH 2C4XA 2Y72A 3LDBB 1MFBH 3S88L 1G9MH 4XPAL 3HG1E 3SO3B 2JIXD 2Q87A 1OF2B 2YUWA 4U4BA 4KTYA 4JFHE 3VH8B 5JOFB 3L6FB 4RX4A 2N1KA 2C3VA 3OHXB 4NSKA 2HKHH 4TPRH 2VUYA 3LN4A 3NMEA 4C55A 2VDRH 5TE4H 3GBNH 3V7AG 3QH3B 3PXJA 3PHOB 3LQAC 5ISZE 4PJIA 4EVNB 1LDSA 3TO4A 1OVZA 3IAQA 3QHFH 5ENWA 1T5XA 4YAQA 2ENSA 1G6RH 3OKOB 4PPTA 2Q8AH 4NZTH 3NIGF 4C59B 2P5ED 4JGMA 4Y4FA 5DTFA 1RK1A 2A1WH 1INEH 2ADFH 5HI4D 5J3HD 3QRGL 3RWHB 4PJEF 1JI1A 3QQ4A 5DRZB 1U42A 5C0CE 2ZG2A 2ZG1A 3I9GL 1NUFA 1FLTX 2PR4H 1JGLL 3S4SG 3FRUB 3IJHA 4OUUB 4DVBB 4LRNL 5DJDA 3RA7H 3KYNB 1QRNE 2VLJA 4Q6IA 4GW1A 4HLJA 3TBSB 5T1MB 4S0TD 4QXUH 3SDYH 4HS8L 2VB5A 5DQDH 5KOMC 1BIIA 1ES0A 3RL2A 3FT2A 1JZ2A 3U4EA 3OX8B 3V6ZB 4DKFH 2F15A 4JVUA 4CN6A 3RWCB 3QDJB 4Y4KC 3VXNB 3O3AB 4X7SH 1IE5A 2X4TB 1IC5L 1BLNB 3MRQB 4JN2A 4QRRB 1Y0LB 3V79C 4WW2C 4GW4B 3FN9A 4PRAA 2P8MA 1X7QA 4OGXL 5FUCC 4JFQB 4M7LL 3TH2T 1MWAL 1EEQA 1CXKA 4LVOC 3EFDL 5HYEA 4OD3H 3SCMB 3QDGE 1T5WA 3BXNA 1CE1L 1KCRL 3MJ7B 2ADJA 3SDAC 3MRHA 1U93B 3KPNA 2MCPH 3KJ6H 5IM7B 5GHWL 3VFPA 4DCQB 4NUGL 3QEGL 4XC1H 1HK6A 3A6CH 4X7FC 3RBGA 1FE8H 4UQ3A 4XZUA 4UTAL 2XWJB 4OLUH 2IMMA 3P0VH 5BXFB 4IIQA 1E4XH 4J4PA 2W0KA 5EIQA 5CSZA 4KHXH 5KSBF 3MXWH 5T3XH 3AAZA 3ZSSA 2IG2L 1F6AA 4JY5L 4KHTH 5MERA 5E7BA 1LEIA 1DBAL 5IG7B 2NTSP 4M9OA 3TVMA 1YC7A 3WBDA 4ZUTB 3W9EB 2J88L 3R8QA 3VXTB 4PJXF 5GGSB 4CU8A 3SO3C 4AZ8A 3L3GB 2HTLD 4MSWA 3KPRD 5EIIA 2X9YA 1A3LH 1JHTA 1OLLA 2HT2D 1AD9A 1YZZA 2VO5A 4FZ8L 3GJFK 5DS8B 5SX4I 5CEZE 2KDGA 1X44A 3MV7B 1U8MA 5CHNA 4BYHA 3KPMA 5C1MB 1LQSR 3D6GA 5D1QC 4F7EB 4JHWL 5CLTA 2VR4A 1N4XH 4Y16A 2FEDD 3MJ8A 1S78C 4YHNA 1A4KB 4PRID 3UBXA 4WNQB 1U8PB 5KS9F 3STZA 4B7LA 1SYSA 1W8OA 5E8NA 4IJ3C 2OK0L 3WNLA 1S9WA 2KZ1B 1IAKA 2VKXA 4L3EE 5DJAB 4GMTH 5LGJA 3U1SH 3FB8A 1YEJH 4GOSA 3W0WA 3KLHC 3O3DB 5DFVC 1FL5A 4LRNH 1GVIA 1JPFA 5DUBA 1IAOB 3P4NA 4P9HH 2CK0H 2A9NH 3CFKB 1U8OB 1FL3A 3EYUH 3QJHB 2XKUA 3VFWA 4KY1L 4NQTA 5KS9A 1XF3B 3EJZC 1ZANL 2VLLB 5JDSA 1QBLL 5IGXH 1W72A 2AI0L 4PRPB 4W6YB 1NCAH 1VFMA 4U1IA 2VDLL 2ZUQC 4FTVD 3SKMB 4D0CA 1A3QA 3CMGA 2DWEB 4Q58C 3T2NH 3QDJD 5I15L 4Q9QH 3KDMB 1EGJH 3QIBC 4MB4A 3TT1H 4F8TA 3CFDB 1IBGH 4KTDL 1JBJA 1JZ5A 4RAUB 3OG6B 4G6AC 1F3DH 2EICA 2E27L 3CVHB 5TE4L 1U8OA 4JVWA 3DX6B 1SVZA 4RCAA 2E7LC 2APBA 3BN3B 2ADGB 1KIPA 5JW4Q 5I1AB 5C0BE 4KMQA 1PW3A 1KPRB 3HPLA 1D9KB 3ESVF 2PUQT 2X7LB 3BRGC 2Z93A 3MYJB 2FD6L 2BMKB 4K3GA 3S36L 4RISL 5FGBA 3BP6A 5DRWA 4LLYA 1WV7T 1HZHL 1XGRB 3HTLX 4G6FB 4WW1A 2EYSA 4Z7QE 1ZA3A 2ATPB 3C5JA 5IVOA 3UTQA 1QBAA 3O8XB 2W59A 2XN9E 4F9PC 4WHCA 5B39G 2R29L 4Y1AA 1RMFL 2QSVA 1P4LA 3I3BA 3ARED 5E99L 1RURL 5C0AE 2ATKA 3PGDB 4TN9A 5TDOA 3QIUC 1D5ZA 2L4OA 4AH2B 3TV3H 3UTPE 1JN6B 2P24A 4OZFA 3GSWB 2BK8A 1AHWB 5I8OH 4AENB 4Y4HD 1KLGA 5ISZA 4YDKL 3B4NA 3MOBH 3L9RA 4KJWC 3VMOA 4MD4A 1EO7A 2HVJA 4APQB 5BS0A 5EFIA 3LDBC 2BFVL 5D70L 2K1MA 1BBDH 5D6CB 3ILQC 2NY2D 3L3KB 5IESH 2A73A 4Y16C 5C9KA 1OP5K 1VEPA 1UQSB 1MCHA 4GSDH 1MIEH 3IXAB 4UIKH 3T3PF 4IRSC 4X5LA 5LQBH 4YQXH 4MD0B 5HHQB 4NQEA 2YD6A 2VL5B 3GSWA 5JORB 4LSTL 4WW2A 1QEWB 1DCLA 2ITDA 1IGTB 1U3HC 1FZMA 1A7NH 4PGDA 4FFVD 1FNSL 4MMZC 1VADB 3LN5A 5EO9B 4MDIA 2MSPA 1UZ8B 4UNVA 1HXYB 3ZT7A 5T3ZL 2P47B 4OLUL 1KSRA 4B53A 4NJAH 1NUGA 3MXWL 5CWSA 1U8LB 2VNCA 4NKDB 1KJ3H 1KCLA 2O26U 3MRGA 3HZKB 4OZGB 3DGCR 2VDLH 1VKXA 2ZCKH 1WIPA 3PP4L 1J8HE 4JPKL 4N8VG 1EXUA 4KGJA 5D1XB 4LQFL 2XKNB 2QV2A 4MB5A 4HCRH 1FFQA 4LSRL 1T0NA 4P2OC 2HG5A 3NZHH 3U7WH 4LPWA 5FF6A 1OP9A 1FNHA 1S5HB 1VGEL 1FG9C 1FNEB 2DBJA 3FO9A 4Z7VB 4JDTH 2GTZB 2DQJL 5GSVA 1MJUH 5CZKA 1PY9A 3AM8A 5DMIH 5D1QA 1ZGLA 4K71B 4KKAC 1G0DA 3NAAL 3QUYD 1U3ZA 2ZP0T 1Q94B 3LH2H 5KSAB 3RUGF 3PWLB 2JCCE 2XICA 2Q6WA 3GIVB 2J5LB 5EIVA 1FN4A 3P73A 5M95B 3PUCA 4FQCH 4TUOB 1YNLH 5J6GB 3TLRA 3OXRB 5B8CA 1CFQA 2UYLB 4R26L 4NHUA 3ZKND 1J0IA 3IFOA 2FLRT 4XRCB 4JFYB 1A21A 5SWSD 1QSEE 4PJAB 3ELAT 4EI6A 4XXDA 1KXQE 4FXKB 1NC4A 4OLWH 3WJJC 3VXRA 1AQDA 4HAFA 1DSFH 3IDJA 3GMOB 3STLB 5IHBA 4XMPL 3BIKA 4DZBB 5FK9A 5FKAA 1SM3L 4L3AA 3SY0A 2PO6B 3WV0A 1T1WB 5H37G 25C8L 2BSSB 5D96B 1A3RH 4KJQD 4R7NB 2B2XL 2KBGA 2GAZA 4LSDA 4IRZL 3OKYA 5FECA 4PGEB 5L8KB 3BP4A 2YA2A 1JMZA 5D1XD 3VXOA 3I50H 3WLBB 2HKHL 4BQ8A 4I0KA 1VFAA 5GXBB 3EAKA 3RKDD 3BW9A 1M05A 3GBNL 1D7FA 3IDYB 1R5IA 2JJVA 3DIFA 3HI6L 3L5WA 4XP9L 3DMMA 1DEDA 3OSKA 1UM4H 2Z0BA 5GGQL 3GRWA 3UPRA 4RFOH 5CBEA 4M5YL 3MV8A 5DJ8A 1R0AH 2BSTA 1G6RL 2VAAB 2NX5E 3U46B 3SBWC 4PD4J 2BCKA 3I84A 1RIHL 5C92A 2DQFA 4ZS6C 1J0JA 1IZJA 4OZ4A 1X4XA 2CMRL 1CFVH 4KRPC 3KPQA 4LASH 1K3ZA 3TNMA 1G7IA 4Y1AE 1I9JL 3QI9B 3WL9A 5KVDL 4UNUA 4HZLA 5L0QC 3CSYA 4APQD 3GJFA 4JY4A 4XPGH 1BFOA 4XBPA 4Y19E 2GIYA 2OJZL 4XMKH 5HY9A 4CVZA 4JCMA 1JK8B 5JQ6H 4KK5D 1I8IB 3X3GH 5FB8B 5JIKA 1C5CL 5L88L 3ZE0E 4ZTOH 3O4LB 1NJ9A 4OZ4B 2XKNA 5MP6H 3SE9L 5K9OA 1N2RB 3X3FH 2NQCA 4PS4H 5AYQA 5B3JE 2Z31C 3BAEH 5F7YC 4LSQL 4HX1B 4UDUB 2NTFA 4LNRA 3HI1B 3QQ3B 4QYOB 1CFNB 1NGQH 4I77L 5IIEB 3IS0X 5HJ3A 3SDCA 3V4UL 4IHOB 3DVNB 5F88B 4U6TA 4XI5D 1KEMH 1JHLH 4ZS7H 5GHWH 4QRQB 4RMUA 5BRZA 3BESR 4M6NL 1N6QH 2XFXA 2DS4A 5D1ZA 5IW1B 1XGYL 4I0PB 3QZWA 1BF2A 4WTZG 2G75A 5AEAA 3F7VB 3V52L 3SKJH 1IQWH 4NQXA 4OV6F 3CLEH 4OZIE 4M6OH 5FUCE 1N0XH 1CICA 3ULVH 1MVUA 5J06A 3TIDA 1OTUC 1HWHB 2IQAB 1P9MC 4QF1A 3FL7A 4Y5VA 3THMH 2ID5A 3UC0L 2F8VA 1W0WA 4BH8A 3HE7D 1HOCB 3BKML 4JFQA 4XVTH 4NRYA 4N68A 2EKSA 4HUWA 5BZWB 4V2CB 1VGKA 3IDXL 3UTSA 3DPBA 4FG6D 2DQJH 2OTUA 4G80A 3JTSB 3CLFL 4AH2A 3OX8A 3K4ZA 1HHIB 1FYHB 3VXRE 1CLCA 1CTOA 5J12B 3LCYA 2BVQB 4LRIC 4OFKA 1FZJB 3LIZH 4GUPB 4MCYB 3S5LG 1I1FB 3BIAX 1MVUB 4YXHL 3M8OL 3NIDF 1IQDA 3BD4A 4Z95L 1HHKB 2W65B 3GSRB 3LKPA 4RQQB 1YNLL 3QI9D 3RDTC 4Z78B 3ZO0A 1YECH 2XWTA 2O61B 5SX5K 3SDXE 4NRYB 4LAJH 15C8L 2HT2C 3IJHB 3RWFA 1T22B 4ENEC 1T89A 4F9PA 3W9EA 4N5EC 3IYLW 2R2HA 4OZHF 3W9DA 3REWA 1YPZA 3IF1A 1PX3A 1DLFL 4ZG1A 5F9WC 3B5GA 3L5HA 1OARL 3VFNB 3T4YA 2E7MA 3SGJC 2AXGB 3L5XL 5CSZB 1ORQA 3V6OC 4UILH 1EHXA 4KJPC 4K2UL 1UB6B 1MFDH 3CU1A 5FYKD 3ZYJA 2AVGA 4HC1A 3VRJA 2VQUA 4Z78A 5JA8B 2AABL 4HEME 2VXTL 2VE6B 1GZPA 3K4DA 1S7VB 3O4OB 1XGUA 2ED8A 1MRFL 2XRAH 1WITA 2ZUYA 3EOTL 3FB5B 1RZJC 5IHUH 1QR4A 2F5AH 2WP3O 3EFFA 3QQ9D 3LN4B 4GLRI 4S1QH 5HTSA 3IFPB 1A7PH 1U8NA 4NN7C 2GCYB 3D0LB 1WFOA 3LKNA 1HYRC 3P9LA 1Z9OA 3E8UH 1AXSB 3F58L 2CIKB 3LRSA 1FAIL 2RGSA 3BN9D 5I1JH 2GJ6D 3OGCB 1UJ3C 5E6IC 3TH3T 5AG9A 3A6BH 2B7DT 4BSWB 2ADIA 2VE6A 3R06A 2R4RL 2HT4C 1E6OH 2X7LA 3VXQA 4CN1A 2A6KA 5EZIL 5E8NB 4FTVE 1LE9B 5DJ8B 4QTHB 3GKWL 3HS0B 2VLRA 3U46A 4NQDD 3T77A 2YSSB 1FGVH 2X4SA 4I3GA 3RPIB 4H8WC 5HPOA 1FFOB 1CL7I 3DRQB 2R4SL 2Y06H 1KB9K 4YO0B 1GZQB 1IFHH 1PJ9A 4R8WL 1T04A 4I8DA 2AXFB 1A6AA 3MUZ1 5DEGB 1G9NC 2B4CC 5FYJE 2IFFH 3BO8B 4BJLA 2BVOA 3MOBL 3CLFH 1T7WA 4MA8H 5DJCB 4N90E 4GKNB 3FFCA 1MSPA 5JMRA 1ORSB 2EO9A 3L95B 3DXAD 2VSDA 4JG1H 4ONHB 5DD3H 5F7MC 5FDYA 5ICYB 5L6YH 4X5WA 1AKJB 4NNYA 2XN9A 1U8QB 1U2HA 2BMKA 4L5FL 5CJXA 3BKCL 1D5XB 1RHHB 1S9YB 2APWA 4EI5B 4L4TB 1WISA 1UXSA 5K9OB 4AIOA 3D9AL 4WY7H 4Z7VE 1LK3L 2FR4B 4DFIA 3D2UA 3ZKMD 5I16B 3QFJE 4LPYA 2GI7A 5FUOH 3MROB 2ZUVA 3O6FD 3QUXD 5C0GB 1S7RA 2GTWB 2XPGA 3RQ3A 4AG4H 2JIXB 3VD9A 1JL8A 4EBQH 1MAKA 4GO6B 2YRLA 3LKOA 4AYFA 1LEKA 4XHQA 4ERSL 4I0PA 3FQRA 4KPHL 1CK0L 1NC2A 2M8XA 2X4TA 1IAMA 1MRFH 3MFFB 1MJJB 1JGDB 1G7PB 1DQLL 1X4YA 5I8KH 4GG6F 5CIPB 6FABH 1UEMA 3G6DH 1F5WA 3D3VD 1TNNA 4G43B 3RNQB 1S5HA 2IQ9H 3O3BB 3QAZC 2Q3ZA 1GGYA 2W9DH 1MHCA 2M1KA 3QFJA 1UACL 5IMLB 2NY2B 3P11H 3DHMA 4HS3A 4WUUA 1Q1JL 1JZ8A 2GUOA 3ZDXF 5HGGS 4X6CB 3RTQA 1ED3B 2K7PA 1YUHB 5JR1H 2JJSC 5J1TC 1SYSB 2CPCA 4HIEA 2GHWB 4YBQC 2BSED 2YMXH 5E6ZA 2HJFB 4G8IB 3GBML 3RWHA 3C60A 2XZCL 5FGRA 1F3JB 2YN3A 4QGYA 1TJIH 1H3VA 2PR4L 3EDFA 4YC2C 5I8EB 1H15B 4PJDA 4AQOA 4N8PA 4GG8B 4ONGH 4G6FD 5C07A 4ZXBD 2BZDA 1IKFL 4EI6B 1MRDH 4OD2A 1PG7L 4XWGH 4PJ9D 4FQ1L 1CG9B 1RZJL 4F7MA 5L7XL 1CDCA 3T04D 2V2WB 4WHTA 2NYYD 3WS3B 4XCYA 4AL8L 2E9BA 3OMZA 1S7TB 5HDOA 3UYRH 5FGSA 3TYFA 3SKNA 43C9A 1I7TB 1CDYA 1MFAL 1U3JA 1UXWA 1DQDH 1NFDE 3JV6B 4UIMA 2FBJH 3BH9A 1LNUB 3GIVA 5TDPA 4OCWH 1HI6B 1KJVB 5JIHA 5DK2A 1QRND 3EYFB 3U9PH 4P2QA 4JN1H 1OSPL 4WU7B 4UTBL 1FVEA 5DEFA 3RHWF 4L4VE 5KSAD 4OUUA 3H9HB 1AGEB 1MAJA 3KJ6L 3WSQH 2J6EH 5H35A 1OPGL 2EYTB 2MJWA 4N0RA 3SDDB 3DVGA 43CAA 5IJKC 3BP6B 3D39D 2H9GB 4MCZA 1I1RA 1ZA3B 4K8RH 3MXVL 2QQLH 2W07A 1DUZB 1K6QL 3BPLC 4LARL 3PE9A 1ZLVK 1MLCB 4M1DH 1R3HB 1NGWB 1QYGL 5ESVB 3ULVE 1NAMH 4IMLA 1V3JA 3KLDA 4RNRA 1I7RB 4J3VA 3OB0K 3WUWB 3OGOE 3QEQA 2ERJC 5IVZA 3C5SA 4U49A 1GCFA 5DVOA 1K8IB 3HB3C 1YN7B 2IC2A 3LN9A 4K3JH 1YPZE 3QAZB 2MOVA 1W0VB 3HMXA 5TFSL 3DECA 2VDOH 3T3PE 2JB5L 2Z9TA 4RGND 1VCAA 2IADA 3TNNA 2AXFA 3QSKB 5BVJB 4K3EL 4CVXA 1N59A 5BV7H 4F7TA 5J56B 4ODWA 3VU2A 1HQ4A 4FHBD 2GY5A 2VQTA 4KH2A 4PRHE 3MRPB 3UROR 3QXWA 5AWNL 3QA3B 4Q2ZA 2SEBB 3SJVB 3F12A 4LSQH 1YEGL 4P4KB 4XBGB 3PQYB 1RUPL 1YNTA 2MQ3A 4HMCA 3HI1A 2HJLB 4CUCA 1LEGA 3ZE2E 4NQSA 3GO1L 5KZCB 2CD0A 1KEML 4ONGL 5GGQH 2Q7YB 4HUVA 5T1DL 1UCBH 3PGCB 3FQXA 4RMWA 1VEMA 4D9QE 4KY1H 2VLJE 2P42B 4ODWB 4OJFL 4OZGA 5HVGB 1OAZL 2BSRB 3HC0B 3L3HA 1RZFH 3FN0L 3CSPA 3U0PB 1H0DB 4YGVA 3MZGB 4RIRB 1CR9H 3GSXA 1NFDA 4PG9A 4Z7UE 4EIGB 3RY4A 5JNYB 4H25A 4UB0L 5HI5C 2E7HA 1RUQL 4HWBA 3MLRL 4Z7NF 4N0UB 5B8CC 4G7YH 2YRPA 4YDJA 4NNXA 2JB6A 3VI4E 1GAFL 4N1CA 1EX0A 5GPRA 3TYGL 4UV7H 1HHJB 5FOBB 1MNUH 2ZCHH 4EJ1C 5T1KA 4YEFA 5DGQA 1OSZA 2DI8A 5FYLE 1VPOH 4J8RB 2BVPA 2PTTB 5TH2B 4MAYD 1NFIA 1T0PB 5CP3H 4UI2A 4PR5A 4TUOA 2FO4B 5IG7A 5D9SA 2W0LA 3IB4A 3BT2L 5C6TH 2FHBA 5EG6C 4X7DC 1D5BA 4XCNA 4E41D 4JKMA 1NMAH 4NZUH 1AHWA 2F53E 3EO0B 4JFDA 4QY8B 4L3CA 5KAQF 2VN7A 4RAHA 1R3LA 1NCBH 3EYVB 5FA3A 3MA9H 1Z5LB 2CSPA 3BXNB 3HNSH 4GJTB 4D0DB 4AEIH 4WUUE 3ZTNL 3W0WB 1XGYH 5L0QB 5GIRB 1BM3L 1JPFB 5DUBB 1WT5C 1UKTA 4PRDA 3LB6C 5IGXL 2Z35B 4E5XA 1HCFX 3CZFA 3GM8A 3S37L 4WEUD 4HJJL 3QYCA 1S7SB 4I5BA 2CGRH 3C6SA 2Z93B 3MYJA 4LLVB 1E4KA 5EZOL 1IGML 3B9KD 5EU4A 4U3HA 3NFNA 4QF1B 4PJFB 2VXVL 1UA6L 4LCCC 1SYVA 4PBWD 3LZFL 3DWTA 1DDHA 2VDRL 3LPFA 5T1MA 4FXGB 1FZOA 4F58L 3P4MB 2H1PH 3RIAF 2BY3A 4NC1E 1F97A 1OD7A 3F65A 3DTXB 5TE7L 2D03L 5BVJA 3KNBB 3DVFA 3LN5B 5EO9A 2DI9A 2R2EA 3LEXB 3MV7D 2FECL 2N7BA 4HEPG 5IW1A 3QUMA 2FSEB 2J8UB 3QEHA 1IM3A 2H32H 3QNXA 3OJDB 5ADOL 1C5DB 2VYRE 3ALPA 4Z9KB 3B6SA 15C8H 2PETA 1JGLH 3T4AA 4LQFH 2I60H 1TVBA 4G9FB 4JJ5A 2HLFC 2EH7L 4HCRL 4PJHB 2BVTA 4JQVA 3UTOA 1RURH 3QIWC 3MR9A 4S1RL 4JQIL 3W11D 2J4WL 4ELMB 5IM7A 2F9BT 4KJYA 2Y5EA 3CVIL 2ICES 2VISA 4CVZB 4YDKH 3VCLB 2QADB 1J0ZA 5FB8A 5CJ5A 1QFWL 1WZLA 4PBVC 4QHUA 5J3HC 1NDGB 3DUHA 4QRPA 2CDFB 4FOMA 2X44D 3ULSA 5JNYA 4AT6B 2DQEL 2XRAL 1LD9B 1W2KT 4MJ5B 1NBVH 5DD6A 4MJIE 1Y0LA 5FGCE 1EK3A 4PGZA 5KW9H 4NKOB 3O8XA 4I4WA 2FH6A 2GSGA 3UTTB 3G6AA 4NN6B 2VDQH 1ZSDA 4OI7A 2HFTA 4L1HA 2C1PA 5F6IB 3ESUF 4P2QD 1UXSB 3BD3A 1RAMA 1VFOA 3QDMA 2NW2B 4K07A 1BJ8A 3V6ZA 4LKCA 2KQMA 2W60B 4PGBB 3OG4B 1W8NA 2AJXL 1RPQA 4NQSB 1DN2A 3IFNL 3OB0H 2Y5TA 3V0AC 4K3DL 5EO1A 4B0MM 2D3VA 1KC5L 4PLKD 5IT2H 1V3KA 5D93C 3J7HA 5EWIH 1KJ2H 5MERB 5I1CH 3VXSD 5K9JL 4ALAH 3G5XA 4PJDF 4CMHB 1NBZB 5FM8A 3F6IA 5C7XH 3WFEH 3FQRB 3RX8A 3EJYD 1ZEAH 3D5OF 2DM7A 2K3TA 1X5AA 1M71B 4QRSA 4MWFA 1UA6H 1U91B 1DBJL 5D2NC 1J05B 3V6BR 2G60H 3QH3A 3RVUD 2OQJB 2ZSVA 1NSNH 1I7UB 2DDQL 4FG6C 5F8RC 1U2CA 5I16A 1AQDB 3C6SB 4JHWH 1OGAA 3K2UL 5ALCH 5DFWH 3QHFL 2DD8L 4DZBA 3MRIA 3ZHLA 2GJZB 3BPCA 2YPLD 1R0AL 1RZKC 1BLNA 4JN2B 5CFHA 3QRFM 4HLZH 3AB0C 2UWEB 4FQHA 3TCXA 1QSVA 3VJ6B 3AFLA 1GPOH 3NCYS 1J8HA 3QFJD 3C08H 1A7QH 3MGAA 5B39A 4G5ZH 3GRWH 2HAZA 4F3FA 1KB5A 3RWDA 3D9AH 1NMAL 5DRXA 4BZ2L 4UV4L 1VENA 4POZD 4WDIA 3H0TB 4M3JA 3QDGA 4U1LB 4GW1B 4DGYL 5IEKA 4XCNB 1T04B 4QTIH 1WWAX 5HHME 2IANB 1JPST 2VITA 3JSSA 3HCVA 4KVNH 3CX5J 5K33A 3D25B 4NYLA 4S0SD 1WAAE 3M17B 5JPNB 3S8WA 5CILL 1QBLH 4ETQB 1L9MA 2VLLA 5DRZA 1GJIA 1CL7H 4RWHA 4WWKB 1AJ7L 5BO1L 2K9UA 2ERJB 2X4NB 4HJJH 2NXZC 1PKOA 3VDBA 4NUJA 2RAMA 5EUKA 2NXZD 5DFTA 3R0NA 2LAAA 2FH8A 2VDML 3QDGD 4N0CD 3CXHK 5F9OL 5D72L 4ZNEA 1VFBA 4KI5F 2R23B 1X5FA 1T2QL 5H2BA 5CD3B 1RULL 1C1EL 4JZNB 5C0JB 5FKPB 3RWFB 4ZOCA 1NLDH 5EZJB 4UQ3B 4E0RB 1MUJB 2XWBA 1V8HA 4HUNB 3T0ED 2X4UB 1DBBH 3H3KA 2OZ4A 3BYTA 4FFVC 1NCDH 2NX5D 3T0EC 1JV5A 2YPLE 5F70A 3T3MF 3VFOA 5DMYA 1MH5A 3RWJA 1MCPH 3U4BL 4LCIH 4U1SB 5I1CL 4GRWF 1RIUL 3ULVF 1IC7H 5T5NG 1JZ7A 1CT8A 5E6IA 1MLCA 4U7SA 2BVEA 1GZPB 1D9KD 2R29H 2VL5A 3UZEA 2P7TA 4HJ0C 3P77A 2Q7NA 4PREA 1CLZL 1HI6A 1MHPL 3NPSB 4R90L 2R0KL 4G9FA 4JJ5B 3WUWG 1URLA 1NGPH 4QNPF 4JFFE 2BVUA 3E6HB 1A7RL 2XOTA 2AEIT 4OFDA 1UB5A 1L0XA 4HIJB 5EZLB 4YE4L 1S7WB 4PG2A 3RAJH 3G6JB 2X89A 4F37K 1CLOH 2BHYA 3OAUL 3VGHA 1KF9B 1VKXB 3QUYC 2QSCL 2FNBA 1KUMA 2Q1EA 3BAEL 4ZQKA 3MCG1 3X11B 2VDQL 4LFHD 5F21B 3IKKA 1P7QD 1FNGB 5J57B 4XP6H 2VWEE 4JJHA 1XF2B 1H15A 1I3UA 5T1KD 5D7IB 3UXFA 3MV8E 4Q97A 4BELD 3V0WH 4LU5H 2JJWA 3RFZC 1YEIL 3O45A 1YEDA 1HCVA 5GRJL 1RJCA 4QOKD 4J4PC 2OTUB 4G80B 4XHJC 3QXUA 2CDEA 2F5BL 3DX7B 4ZD3L 3NZ8A 5HYQA 2ZSWA 4MCZB 2HKFH 3UTZB 3IDGB 5A16A 1GL4B 2DQCH 2QQKL 5C0ND 3M1BB 4MNQE 4FQLH 1N0XL 2VDKH 4Z5RB 4MZ2A 3QEHB 3I2CH 1CF8H 1JNNH 3S36X 5C0NC 4WO4C 3QCTH 4PBXA 4Z7NE 2ITDB 1KG0B 1NFDF 2Z31A 1CDUA 4XWOC 5ACLA 1U8IA 4NQVA 4P3DA 5F7NC 2KPNA 2X4RA 3WDIA 5EA0L 3TNMB 4LLMA 3VWJC 4HS3B 4WUUB 1X5GA 5INDB 5JIPA 5HHPB 5AD0B 3KPRB 4JRWA 2ZKHH 5IBTH 2VL4A 2XQBL 8FABB 3VXUB 2LQRA 2X2YA 4KDTA 3V5KA 5D6CA 1KBGH 3NCCB 5C0GA 1J9CT 1ZGLM 5DURD 3AC0A 1C12A 2J8HA 3FB6B 3VWJB 1OW0A 1LVEA 1A47A 3S37X 5JZ7D 3NCBB 3OR7A 3ZDYF 3KS0J 4LEXH 1ZK9A 1YEHH 1AR1D 1KCUL 1W0YT 5F93C 4OKVA 5IB4B 2HMIC 4U0QB 3EIFA 3GMRB 3PWVA 4TSCL 5I1KL 2GCYA 3D0LA 2Q76A 1M7IB 2AJVL 1EGJA 1KJ3L 1KB5H 3BISA 3GI8L 4CMHC 5H94B 5I1LA 4I18A 4HG4K 5T3ZD 4KRPD 4UQ2B 4ZPVA 3VFTA 2BSRA 3HC0A 5D93B 3UBXG 2XT1B 2BNRA 4I0PC 1AGFA 4X5WB 1U8QA 3UTSE 4HFUH 4ZOBA 2FO4A 4Z6AT 3CVHA 3SDCD 1QA9B 3IAPA 4JFDD 4X6DE 2Q3AA 3OTTA 5ERWA 1CE6A 5GGRB 1MAML 4JZOB 3MREB 2F53D 5GS1A 1N6VA 4FQ2H 5I71B 5C0EB 2E6QA 2P5WB 3B2VL 1RVFH 1XCTB 5CEXA 4LF3B 1P6FA 4HH9A 5J89A 4ZPVB 3CCHA 4Y0GA 5JLZA 4XZUB 4PJDE 5KSAA 1IARB 5SWZD 4NZTL 5I66A 1BD2A 1M6OA 4G6ML 1D6VH 4XNYL 4LHUG 1KJ2A 1BQHB 1SQ2N 5DLML 4LCIL 4QOKE 2CXKA 2Z91B 3PV7A 3VRIA 1BGXH 1U8KB 2MQ0A 4CRPA 2CIIA 1YQVH 2P8MB 1V5JA 3FB8B 2HG5B 1TCRB 3N9GL 4ZNEE 1HNFA 1FP5A 3QCVL 3KPMB 4CBPA 4Z7WE 5GGTH 2DYPB 1JTOA 3JVGC 2EDFA 4M6ML 2FX8H 1FO0H 1AD9B 3FJTA 5CGYD 4ELMA 1NGPL 4WJ5A 2VAAA 1YEEH 2NXZB 4N5UA 3WXVH 4JEGB 1T2XA 1LK2B 2FJGB 4P23A 1RZIA 3RAJL 3QPQD 2APFA 4HWEL 5CUSH 1BP3B 1BJMA 1XH3A 2VXUL 5FO8B 5MENB 4BZYA 1LDPL 4H20L 2EXYD 1T0MA 4GXVH 1MEXL 5DC9B 1AO7E 1XGUB 5BW7C 1IZKA 3FB7A 3TFKD 1KTKE 3JWOC 1NDMA 3L3GA 1IEAA 2ARJQ 5D6DA 1MJ8L 4C4KT 4GRWH 2HJKB 4EXPX 1IKFH 1HWGB 1E4XL 2FEDC 3FN3A 3H2WA 1DSFL 4M1CD 1YN7A 2OMNA 5JXEA 4KZDH 3ECBB 1UWXH 2Z31D 5E2WH 5KOVC 1JZ4A 4HDIA 4ENED 2HRPH 2O5ZH 3CMOH 3IGAB 3CH1B 3WJLC 1TZIB 1XGQA 2CRYA 3VG0H 2XWTB 2O61A 3WFEL 5HYFA 3EYQD 3IDYC 1ONQA 4JREC 3SPVA 1F3JA 3SGJA 2EC9T 3MRMB 4FXGA 1DQJB 1HSBA 1NUDA 4DFHA 3C6LD 3CSYB 2YR3A 1T1YA 3T1FA 5ID1A 4S2SB 4XPGL 1Q1JH 4UT9L 3NTCL 1Q94A 5TQ0H 2YC1B 2CKBL 4X9FA 4O2FB 4J3UA 2X10A 1WICA 3Q5YA 2DKMA 1MCOL 5IVXE 2Z35A 1UQSA 2LU4A 3GJEB 4JKKA 4G42A 4DGVL 4X7TA 1NBYA 2GSIA 4P4RB 5IUSA 3MLTA 5DMGD 5D4QA 3RWIB 5C0EA 3U0WL 1G7PA 3SDCB 2I9LA 3BFOA 1Z5LA 4AIZA 2EKJA 3H7LA 2Q8BH 5I1DB 3K46A 3NGBC 5JW4M 2RCSL 3G9AB 3C2SA 4UU9A 5MEPB 2EDHA 1A6VH 2D7NA 4KFZC 4DK3A 3HE6B 1KLUA 1JN6A 3L7EA 4NHCL 4DK6A 1XF4B 4GRMB 4YWGH 1OQXA 1QLEL 2W91A 4A2LA 3NCJL 4HK3N 2H26A 3CH8A 4D9RE 3I85A 4NKMA 3H6JA 3VFMA 3LAFA 3SE8L 1QBML 5JOFA 3BP5B 3FMGL 2EE6A 2BOBB 4ZPTA 2BFVH 3QEUA 1OSZB 2DBLL 3UTZA 3MJ9H 2QADD 4Q6IC 3V7AE 2NXYD 4FS0A 1EO8L 3OWEA 3INUL 3RX7A 3EYOA 4TNWF 3CFIC 4NQEB 1A5FL 1T03H 1JIBA 2G60L 1VFBB 3DUUB 5SWZE 5D96C 3T0EA 4ZO9A 3BH8B 5FM5O 1MIML 1MRCH 3QNYA 5SX5H 3I6GB 4NN5C 2O5YL 3WSQL 4PJ5B 5CMAA 5DRNB 3LRSB 3DVIA 1AC6A 1G1CA 2NY2C 4XB8A 3L9RB 4Y16D 2EDXA 1CQKA 1DVFB 2Y23A 4NC2B 1KN2H 5EZIH 3CXDL 1I1CA 1WBXB 3GKWH 3RU8L 1F90L 4FQQA 1J11A 3EOAB 4M5ZH 3SDXB 1Q38A 1ZLWH 3O0RL 1NLBH 3T0XA 3MC0A 1TTUA 5DD5H 4NO5B 4CDHA 2AS5M 3GUTB 4LSRH 1KIQB 2V7HB 3WO4C 2FECI 3N85L 2ZOKA 3UPAA 2Y06L 3GSOB 2VRAA 3TV3L 2DOCA 4QHNA 4ZUSB 3VXPB 1JI2A 1N64L 4FABH 1FO0L 2AV1B 1D5MA 1OT2A 3MRJA 3AU1B 1U36A 3UZVB 1MJUL 2QKIB 4L3ED 4NP4L 3WUWA 3C8KB 4PGBA 5J1SC 1R5IB 4JM4H 1OGAB 1VFUA 4KVCL 4PRIE 1U0QA 4P59H 1PG7W 4QXTB 2W0FA 3MRDA 4QHKI 5GZNC 2WLZA 2FX7L 4NZJA 4ONHA 1EZVX 5KSBA 2A6DB 4DUWA 3BP4B 3MBEC 1AKJA 1EVUA 4KMLB 4H20H 4KWUA 3D2UD 4RIRA 2XZQL 5D7LE 2J5LC 3UDWC 2HLAA 3MBED 1WGOA 1RJZB 3TH4T 1IC4L 3QXAB 3QEQB 1MUJA 4MNHA 2D7QA 3GMOA 5A43C 4L4VB 5C0JA 4MDIB 2KL6A 3BQUC 2BVOB 4LPXA 4YJZL 2AK1L 4F57H 2FB4L 4UUJB 3LOWA 3HNSL 4PJBB 3QHZH 2NY0D 3WN5A 3GZKA 2EZ0C 1PLGH 2V5RA 4M8QB 4WI6A 2VXQH 1ZGLB 2EIZA 4DJMA 4ZFGL 3VXTA 4F2MB 4X9IA 2Q20A 1CVSC 2V2TB 5IMKA 1RY7B 5L9DH 5F89B 3VG0L 4X0KB 2Q6WB 1TENA 3IXTA 1S9XA 3OJVC 5IHUL 2WK2A 4P5KB 2R4SH 3PQYA 2H3NB 4F33B 3VGGA 3ZKMC 2ZOLA 5SWQA 2BX5A 1BFVL 2MPAH 3ARGA 2GJ6A 3GIZH 4CGTA 1V05A 2IPTL 5EU6B 1RUAL 3VWKD 1BECA 5L8LB 1MIMH 3S96A 1Y6MR 2CIKA 1JGVH 4JQVC 4I3SL 3FOLA 3DTXA 2DQDH 4WRLA 4MJIB 2QL1A 4WFFD 2AQ1A 1MCOH 4G6AD 1NEZG 3ARQA 4JZJA 3BPOB 3CD4A 5TGBA 5ALBL 1INEL 2VDNH 5HYQB 2DICA 4N8VB 5JIIA 1CDHA 5KSBE 5E8DH 2NTFB 3DI3B 3S7GA 5GISL 3N1GC 3W39A 2BC4A 5IFJA 1C7TA 4XAKD 4U31A 5C0AD 3MV9D 3MQIA 5A2KH 2E7CA 1YEHL 1TVBB 4BFEA 5K59E 3MNWB 4L3EB 5D7IA 3J8F7 3MLYH 4PJHA 3FQNA 2EDQA 3MMEB 4QXUL 3VXUD 4JPWL 1MRDL 1U91A 3OKNA 5A40E 2V9QA 4MB3A 4IJ3B 2H45A 2W92A 2XQYK 3HB3D 5IQ9A 1N26A 3KVQA 3P9MA 4QXWA 3GI9L 2AI0H 5KJRL 2DWDB 5JQ6L 4YPGA 3DROA 1HNGA 4OSUL 3QUMB 1XR9A 2R0LL 4ORGA 4ZO8A 3KPLA 1AGDA 1NCWH 3DV4B 4FNLH 1WT5A 2E6JA 1IQDB 1FHGA 3C5ZD 5T5FL 3JV6A 4UIMB 1MPAL 3BPNC 1CFNA 2HMID 3SO5A 4DTGL 3KJ4C 3VI3F 7FABH 4WI5A 5DRXB 4FQ2L 1KLGB 2NW2A 1IM9B 5HHOD 4U6VL 5HHXL 3P30H 4W68A 4XP4L 4WI2A 3D1MC 3BP7B 3QJFA 2FLBT 4PJXB 4M5YH 2D2OA 2BRQA 3HZKA 1KTLA 4NT6B 1UKSA 1O0VA 3L5IA 1D5XA 1RHHA 4EI5A 4RISH 5IB3A 3BYYA 1Q9OB 5C0IB 5I9QB 2DTML 1BBJB 4Q9RL 4MQ7A 1GC1C 1CICB 4JFEE 1YY8B 5KVGL 1FGNH 2JELL 3OKEA 3RUGB 1ZHNA 1E4KC 4X7CC 1XAUA 3THML 2VXSL 5EUOA 1NANH 3QCVH 1LO2L 4FFWC 1KIPB 4LLUA 1L0YA 4OIIL 1UJ3A 1KPRA 2AJYH 1RZJH 1IL1A 4G8EB 4YUEH 4X6CA 2P5WA 3ZDZF 1QFWH 4HHAA 5HI5D 2DQDL 5AYUH 3DURB 5ICYA 4P59L 4X0KA 3FT3B 5ALCL 4ZSOE 5MP6L 1P53A 3C6LB 1V7MH 2DKSA 1N7MH 4HX1A 4UDUA 2BP3A 3VXQB 4J3WA 4Q2ZB 1RIVH 1RUPH 1IGCL 3LRHA 3VD5A 2YPVH 1IC4H 2DQHH 4ODSH 1A0QH 3BJLA 2IH3B 5HVWA 5E9DD 5GGUA 3QUKB 2J6EL 1FZOB 4XVSL 5TE6H 4GMSH 4W4NA 5HD8C 2JIXA 3QHZL 2OR9L 5DMKA 1NDGA 2FDBP 4JLRB 5CMAB 5I66B 4ETYA 5E2WL 3EDKA 4XGZA 4YHOL 3S4SB 4XPAH 3LMJH 3QPXH 2VMFA 1SBSH 4LVNC 1HINL 3OF6D 3BE1H 1MCRA 5D2LB 2I27N 1YMHA 1V7NL 1FYTA 3TA3C 4XC3H 4QNPE 2DJ4A 4YHLH 3Q6GL 5IFHH 2ARJA 5C0FB 2YD7A 3AS2A 2IAMD 1YPZB 3E8UL 3ARDD 3G5ZB 5F7FA 5D7SH 4YNYB 4OLXH 5BVPH 2C3GA 2IPUG 2Y7QB 4RFEB 5IB1B 3S3PA 2BNQB 3DGGB 3CDGA 32C2B 2Q8AL 3WKML 5CSBA 3C09B 5DK2B 1DR9A 3FO0L 4G5ZL 3V4PL 2FHFA 1YMHB 5D7IE 5JO5B 1QP1A 1BD2E 1EAPA 1K3IA 2VABA 4G6JL 4X7TB 1TPXB 3T77B 1FNEA 1KV3A 1V3MA 2JELH 3BIKB 3HRZB 2AK4E 2Y36L 5KAQG 1U58A 2YWZA 4OLWL 3QIUB 1F4XH 3PWJB 4PJGE 4AEIL 5T1LD 3L3IA 5H94A 5F97E 4MNQB 2R0ZH 1E6JL 2A6JB 3K0WA 3SEPA 3E0GA 3S88H 2HLFD 5FYKE 3TWCH 1G0YR 1I1FA 5J6GA 5CCKL 3WUZA 4EUPH 5FYJH 3X11A 3IKCA 4X4YB 1P4LB 3QEUB 5D7LA 5H8DA 3S35H 4WGVB 1IT9L 3PWUB 4HK0A 4XNXL 5IBLD 1L6XA 5DZNA 5HBBA 1OAKH 5LXGL 4JFZH 4HIIA 4ORGB 1A6ZB 3PDOA 2LTQC 5D72H 1MPAH 4TSAH 2XYCA 2X1PA 3MR9B 4KQ3L 4AMKL 1LO4H 4QRQA 3JUYA 3GSVB 5GSVB 3N1MC 1I9EA 3MRFB 4OCRL 4KQ4H 2CLVA 2HFEB 4LCWA 4YX2L 3CCHB 5JLZB 2AXJA 1ZT7B 4KRPB 3MOAH 4JKWA 4J6RH 4K7PL 4Z7OF 1I8MA 5HI3D 4H26A 4PJCA 1YJDL 1DL7L 4PJHF 1EO5A 2F5BH 1UVQB 5CJQH 4M61A 3DSFL 1JWUA 3QRGH 1X5HA 1B90A 2PCPB 2J8UA 2C5DC 4OLZH 2ADFL 1CIDA 2FJGA 4P23B 5DHVB 1RIHH 1E4XI 2X4QB 2FX9H 2VDKL 4PRHA 4HMEA 4QEGA 4TULL 1Y18B 3S6CA 3MNZA 3L3OA 3GJFH 2YK1L 3RWJB 5DD1L 3QUMH 2FATH 4MQ7B 1UZ8A 5DC4B 5HHOB 3VG9C 3A67H 2D7TL 4Y1AB 3WNKA 1PQZB 3ZL4H 1SEQH 1XF3A 3ARFA 3VFSA 2F54E 3FZUC 3O4LE 4W70A 3MROA 3D0VB 2NMSA 4W4OC 1QFHA 4H88H 3EJYC 4N0YH 4YZFF 3RTQB 1FVDB 3QIBB 4LOUC 3KS0H 5B38G 1BVZA 1YUHA 1EDQA 2FX7H 3WKMH 2FL5A 3QP3A 1CFTA 4YR6A 3AS1A 2H9GA 5KZCD 4X6BB 3I6KB 3BKCH 3RVUC 1WZ1H 1CFSB 5HYSB 1KCVL 4P4KD 2VTFA 1MJJA 3BWUC 1IGIH 2DF3A 1AXTL 5FM5M 4ZQKB 3U1SL 2KKQA 3QULB 4YBLC 3JBG7 3L5WB 1HSAB 3WHE1 5TE7H 4X5XA 4TVSa 2CK2A 2YXFA 4WUUD 2DLIA 3F7VA 2LABA 3GHBL 9CGTA 4HGMA 3MGOA 1Q0XL 1YY9C 2NY6D 1G7HB 3STBA 2V7NA 1KN4H 3JTTA 4ZUVB 5DK0A 3MV9B 3HRPA 2BNRB 4EUPG 4QRPE 1RJYB 2VIRA 4JFEA 4LHQB 1A2YB 4C83B 4F7CB 2HKFL 5DT1L 1S3KH 3CXDH 1QFUL 1R24B 4POZC 2PYFB 1QZ1A 2B5IB 1NC2D 3RVVD 4LIQE 4JFHD 4NCC1 2AEPL 3MTRA 5IIEA 1I1YA 4R9HA 3TT3L 4XVJH 5I8CB 1LE5B 3CVHH 4RNRB 1WFTA 1CT8B 1OM3L 4MXWH 3B3IA 1CU4L 4G6KH 3HC4H 5J1AA 1DQQA 4A2MA 5CLWA 4N0CC 2EZ0D 5FKAB 3PL6A 3SY0B 3BDYH 4X99B 3V0VB 4PJ7A 4JPIB 3VD3A 3AU1A 4KKBD 1ZLVH 4PLKC 4XMLH 3C6LC 3NH7H 4YHNB 3PWVB 2CRZA 2BOCA 5KTEH 1P7QB 3RVWC 2PYFA 1A7BA 1ZGLP 3GMMB 4LMQI 4DEPC 3HMWH 4PUBL 5JDJA 5ALBH 1M6OB 3FO0H 1KGCD 3DGGA 1ZT1A 4KAQL 4JKPL 1BQHG 5IEHB 3RY5A 4G7VH 3TJHC 2NY0B 1XZ0B 1KCUH 1LNUA 3U4AA 2VLKB 4RRPG 3MV8B 4MA7L 2W60A 3LY6A 3VXPA 4PJIE 1UWGL 1QFWM 4QTIL 2R0WH 3MACL 4Y89A 4XWGL 3SKOA 3VFVB 3OKNB 4LVHC 3I6GA 5K9KA 4OZIA 3L5XH 2UVEA 1YMME 2IWGA 1IKNA 1J18A 1RD6A 2ZSWB 4X4ZA 2R69L 3JVGA 2UUDH 2ZNXA 4NRXA 1LO3L 3S35L 1S9VA 1BREA 5E6IB 4MQSB 2GW5A 4HV8B 5I2IA 3DO7B 5C9JB 3KPNB 3BGMB 3VI3E 4TSAL 1OWRM 3D39E 1CD1B 4HBQA 4RZCA 5E8EA 3ZHDA 5GGRY 2UZIL 3WE6B 5JHLH 3OKOA 5C09E 2BVQA 4RGMC 4Y5YA 4WWKD 5EZJA 2WINB 3NN8B 1H5BA 1DBBL 2NZ9C 1IVLA 1HXMA 2DIJA 2FCBA 4PD4K 2H2SC 3BP7A 1SJEB 3FO1A 3S5LA 5CP7B 3RZCC 5TQ2H 3NOIA 4XNQA 1J88A 3SDAA 1YPZF 5DUPH 4I9WD 3VWKA 5K9JH 1CFQB 3P4LA 3D3VB 3IVKB 4N9GB 4NHUB 1BIIB 1ES0B 5I6XC 2PKDA 5CKGA 5B22A 3O3BA 1REIA 3REWB 2HN7B 1I7ZB 2W38A 3IU4L 1AGDB 1BVLA 4LPCA 1HYSD 5DK0B 4KC3B 2OJEA 4R4ND 4JHBA 2UY6A 5GRUH 3L7FB 4IRJA 3SQBA 4NN5B 3WDHA 4O2FA 5TFSH 1OAXH 1RUKH 4X6FA 1CD8A 5AG8A 12E8L 3E6HA 4UUJA 3WXVL 3MUJA 1G9ML 4WO4D 3TYGH 1RJLB 3KYAA 1UB5B 3LIZL 1O5DT 4Q6YA 3X12A 2DD8H 3SCMA 3CPLB 5DC0A 4GAJL 2DQTL 1X5YA 1WQVT 1QR1B 5D2LE 5B39B 5D71L 1CDGA 1MWAH 2ENYA 5DJXB 3WD5H 3UTSB 5E2UL 1XGPB 1F4HA 4R3SA 5CD3A 4PRNB 5IFAH 3R1GH 4HXBH 1T7VA 4R4FH 4MA3B