5DI8B

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8B01
1I8KA 1YDPB 4HK3N 1OSZA 4MCYA 5ERWB 5ISZB 1DQDL 1PLGL 1KG0A 3PHQA 1IGTB 2A74A 1Q9LB 1A14L 4HS6B 4F8QA 2X1XR 1WBYA 2J4WH 3X11B 4TUKL 1TQBC 3IDIA 1M6OA 2HJKA 1M7XA 4U6HA 4XPGH 3ILQD 5IQ7H 1VKXA 2AXFA 2VDMH 4Y2DA 4Z7WA 2B7DT 1JGDB 4WNQA 2ORBL 3ARRA 3BW9B 4DZBB 2W59A 4YDJA 5AUMB 3V7AG 1K2DA 4QHLB 3RY6A 2DWDB 3V4VL 3N9GL 5F7DB 1RJZA 1E6OL 2ATPA 1DBBL 4K8RL 1FH5H 1UYWL 3MGAA 5IR1A 3QH3A 4G9FA 4TUJB 2WINB 4N8VB 4PJ7B 1FIGL 4NQSB 2J8UE 3INUL 1OWWA 5BVJB 5C0AD 2EC9U 1HH9B 1NGZB 2VH5H 4X6DB 1XGTB 3WNNA 4OLXL 3ABZA 4JM2A 3RBGA 3V8CA 3KJ6H 4Z7OF 4NQEA 3PG2A 4LLMB 1YEFH 4I0KA 4FXKB 1WSST 1FFPB 1HQ4A 4QYOA 2C3XA 3HAEH 5D1QB 1C1EL 3GBLA 3ROLA 5K9KB 1B4JL 4W4NA 3TJHD 1CDYA 4YGVA 2AJ3B 1H5BC 3EOYG 5C0RH 1YJDC 3WFBL 2YD5A 2BSTA 4LK4A 5C0EA 3C60A 3O9WC 4MJ2A 1G9EA 2B0SH 5I1CL 3BEWA 1A2YA 3GMQA 4ZTOH 2AI0L 3VXSA 2W65A 4M7LT 1IAII 1NBVH 4GKOA 4E42A 3DHMA 3SDXA 3MODL 3A6CH 2VLJB 3GSRB 2E8ZA 5E5MA 1N5YH 2D31B 1FV1B 3WFCL 4LVNB 4JO1H 1BFOB 3CDFA 3EO1B 2P5WA 3X12B 1YEEL 5L0QC 1R24B 4JM4H 4P3WA 5DJYB 5C08D 1C5DA 2GT9B 2APBA 4JN1H 1RUMH 4XBPB 1P4LA 2H26B 3KPRA 3SPVA 4ZPTB 1XFPA 3FTGA 2CRMA 3QULA 3ZYJA 1P7QB 3SKJH 1X7QB 5C8JA 5T5FL 2JIXB 2ERJB 4PYHA 5IB2B 1TLKA 3JV6B 4UILL 1RUPL 3BESR 1GIGH 1RMFH 1A7QH 4P2OC 4C83B 4P2CG 4TPRH 3STLB 4QOKB 3SOBL 1FZOB 3W9DB 4P5KA 2YN5A 4ACPA 1R3LB 3QCVL 3EJZC 3WLWD 2I9TB 3GBNH 4JY5L 4M1DH 4LCWE 5E1AA 1Y6KR 4FFZH 2MKWA 5GSVA 2DIAA 1TPXC 5J6HA 5DVLA 3UJTL 1NFKA 5KVEL 4HLJA 5D8JL 4OLYH 5TDPB 2GI7A 2E3VA 2VO5A 2PYEA 2ADJA 4Y2DD 3VWJA 5MI0C 3C5SA 1A6WL 4NM4H 1IEAA 3RWEA 1I9RL 2DRUA 3VMNA 3FZUC 3BWUC 5K9JH 4YUEL 1MREH 3PGDA 2YZ1A 5C0GA 1UM5L 3MUGB 3JBG7 3RDTB 2FATH 4NQCE 4XCCH 3T0EB 5MENB 2IBZX 4LL9A 3SQBA 3OTTA 5JW3H 4LPCA 1VADB 2Q6WA 3DV6A 4JO4H 4G9FD 4OFPA 4X6FB 3HNSH 5EORH 3FL7A 4XP1H 1AJ7H 1FLRL 3RWIB 3IFOA 1CL7L 3HNVL 4MA3A 1C7TA 3VXNB 2GIYA 4NKIH 4MNHA 3OKMB 4IJ3C 3DYMA 1U3YA 4JM2D 3ULUC 3MQIA 4NQED 1AH1A 4E9LA 4JPVH 3MLTA 1YY9C 3U9UA 4HBQA 1UC6A 2JB5H 3H9SB 2H8PA 2CLVA 1BBDL 4WFGE 3GHBH 4NN7B 4F7EB 5IB5A 4Z7OE 3VFMB 2EIZB 1DVFA 4O02L 1XF4A 1M4KA 4IOFD 4R8WH 3VXSD 4DZ8B 3ALPA 1EIBA 3S5LB 3WDIA 1SVCP 4JFXA 1KLUA 4MD4B 4QF1A 5TF0A 3WYRA 4ONFH 5TE4H 3VGBA 3GSUB 4OGYL 4JFPA 1EK3A 4E5XA 1MAMH 1NPUA 4HUXA 5DMKB 5TE7H 2D7OA 2P5WD 4I4WB 4EZMA 1SBBA 3M17B 1DN0A 3CC5B 3QZWG 4LSVH 3NN8A 2FJFB 4J4PC 3KPRD 4JVUA 5DRWA 1UB6B 5EUKB 3V0WH 3B9AA 4OZIE 2QQQA 4NCC1 1I7ZA 5IB1B 4WHTA 4ZFZA 1X5XA 3NPZB 2G75A 1A1NB 3TIDB 1NDMB 3CD4A 4WIQA 5CSZB 4P4RA 1O7SA 1VGEH 2NY3D 3ESUF 4JGMA 3MRMA 1QSEA 5DFVD 2BDNH 5HD8D 3S37L 1QR1A 4M6NL 4L8SB 3BH9B 4JG0L 4G8EB 1BZQK 5EFIA 1I3VA 5F9DC 5DURB 3NCYP 1L6XA 1I9EA 4KTDH 2W0KA 4P5TC 5K9QI 3P4NA 4RMVA 3LHPH 3MV01 2ZUTA 5JHLH 1AGDB 1X4YA 4RRPA 5AD0B 5JZ7D 2PYED 2DQTL 1YEIL 2R56H 3VWJD 5CCKH 5ITBH 3VFWA 1GZPA 1X5GA 4AM0B 3TPKA 3UTZB 4PGZA 1OGAB 1T2QL 3BGMB 4AIZA 3HI6L 4NKOA 1VFOA 3MLUH 2WWKT 4PJHB 5FF6A 3VFUA 1XMWA 3V2AR 4K71C 1YEHL 2F19H 2VLRA 4MNQE 2WQ8A 3FOLB 1KJ2L 3GJFH 1U8MA 1G6VK 1BD2A 1MCOH 1X5ZA 3KAAA 3MBEA 5JQ6L 2Y23A 1XF3A 3RI5F 2R2HA 4RQQA 2HJLA 4D8PB 4TVPD 1HKLL 5J6GB 1CIUA 4J3SA 4IHOB 1IZKA 5GRVL 1Z9MA 1EX0A 2NW2B 1RZ8B 3RWCB 4ZPVB 3KPOB 5C7XH 4YHLH 3MJ7A 3P0YL 4MSWA 3B9KA 5E9DE 4R26L 4HF5H 4YDKH 3DV4A 1VERA 3VGGA 3FN0L 5A2FA 1AE6H 4JKWA 4YE4L 4NT6A 4L3CA 1OGTA 4XWOC 2XTJD 4YHKH 4PYGA 1OY3B 3VXPB 1DVFD 4XP5L 5JA9A 5CJ5A 2OL3A 1XIWC 2ICWB 1LD9A 4N8CL 3TYFB 3RY4A 3IS0X 4M62H 5FUCE 3SDDB 3X17A 4EBQL 2XRAL 3CFJA 3C6LB 1ZS8A 4K3GA 2R9HD 4WFHD 5E03A 3QXDB 1JMXA 2J8OA 4FZEH 1CT8A 1X5JA 2KL6A 3I2CH 4QNPF 2NY6C 2E6JA 2ICEA 4NQTA 3VFTA 1H3GA 3BPLC 2DICA 1BJ1J 1T6WA 2BX5A 4F7CA 3EAKA 5IMOB 4O2FB 5HGGS 1QQDA 5ID0A 1CFVH 3DURA 4XRCB 3DIFB 1VFUA 1GVIA 1BEYH 3OAYK 3L3GB 1Z5LA 3OXRA 2F58L 3LQAH 5B22A 4LSRH 3EHBD 3NGBC 4EI5A 5KSBA 1S7QB 3EDEA 1ZVSA 4JFFB 4YLQT 3O0RH 5INCA 4NFDA 2I60L 5I1HH 4R97C 5TDOA 1T7ZA 1ZA3A 4MLSA 4M1CD 4PS4L 1QSED 2AQ1A 4JFOB 2AV7A 1DL7L 3HMWL 2SEBB 1VEPA 2UYLB 4MJIA 3ARGC 1RIUH 2GKIA 2FDBP 2ZUUA 4ELME 1FE8L 2OCFD 2EZ0D 1NDGB 1CD1A 4GMTH 2PR4L 3G5ZB 3GJFA 5C07A 3RWDB 2C9AA 3V4PH 1R3HA 3BPNB 2YPLE 3TF7C 1J0IA 1I3RA 5H35B 1D9KA 4XPAH 3G6AB 5EO9B 2FB4L 5CSBA 1FQ9C 1KEGH 1AR1C 4DW2H 5M95B 4DFHA 2Q7YA 2VLRD 3ULSA 3T0AA 3L95A 4HMCA 3RWJA 4Q9RL 1ZWIB 3MLSH 4IDJH 25C8H 3G9AB 1BD2D 4JQIH 2BERA 1NFDE 3MBED 4QRPA 1C12B 1EERB 2CLRB 3WDJA 3SKNA 3L3KA 4HKXA 4HX1A 4MAUH 3BVNB 5FAAA 2EE6A 4CMHB 1PG7L 4PJCB 3HG1B 3IF1B 3WLBA 5IVOA 2FEDD 3SGEI 3BKCH 1KXVC 3B9KD 4ZNEA 1FNEB 2CKBB 4PP1C 3QCUL 2WUCL 3UMTA 3WJLA 4K23H 4WHYG 1B90A 3LDBB 2DDQH 2QQNL 4LPTA 5DSCB 4OFIA 5F7HA 3MO1B 1AGEA 4KJYB 4PJIE 1LQSR 2DQJH 4KKCD 5GRJH 3GFUA 1WBZA 3QIBB 4RMQA 3SGKA 4CVXB 1V3JA 2XYCA 4YPGB 4QXTB 4ODHL 1A4JB 1YEGL 5KSAB 5H94B 3S36H 2R1WA 3MRBA 3UO1L 1KELH 1Z0MA 3MV7B 3REWB 3VJ6B 2W60A 3AS0A 5ADOH 1A6TA 4K3DH 3TV3L 2B1HH 3LAFA 4C4KT 1QRNB 3H7BB 3N1MC 4GG6A 2V7HB 5C0BE 1Z2KA 1DQMH 4ZOAA 5DQDH 4WI4A 4MNGA 1PX3A 3A67L 4NC1E 2GK0B 1TETL 2YA1A 1PKQE 2UWEB 1CE1H 4JPIB 5FV1L 4GH7B 4QNPE 4EI5D 1QACA 3T1FB 4XTRC 2D3VA 5SWSE 4WI8A 2CUHA 1L7IL 2X4OB 5JOPE 3FCTA 1CGWA 4BFGA 4X8JB 4LLWB 5IMKB 1Q0YL 4MDIB 3T8XB 3TH4T 2JB6B 5F6IB 3GBMH 2ZWLT 3WS3B 2BNQB 4PJGB 2YPVL 3LKRB 4MJID 5I0ZA 1OAXL 3FHQA 2HN7B 4AENB 5GGRA 1F4YH 4KGLA 1MLCA 1A6UL 1JCKA 3UTTB 3MJ9L 3S35H 2LU3A 1IEBB 5J9PB 2Y6SD 2DKSA 3D85B 3PGCB 5C07D 3KPSA 2APWA 3VE0A 2YWZA 4LSTH 2KH2B 4P2OA 3MV9E 1D9KD 5C0JA 1KFAH 5FO8B 5CEXA 3BP7B 4HPOL 4PUBL 3QA3B 4LSPL 1LWRA 3MV8B 4Z7VA 4UV7L 2L4OA 4MLIA 2R2EA 2X1OA 5ID1A 2X1WL 1JZ5A 4DTGL 4J3XA 4XH2B 4V1DA 1IFHL 1K85A 3EFDL 2CDEB 3WJJC 3U0TB 4QRPD 1NC4B 3C09C 3D39A 4B7LA 2YD8A 4HH9B 1IGML 5I71C 2F54B 3G08A 4HUWB 3GUTA 5F7NC 3QNZB 2DBLL 2KBGA 4K94L 4CADB 4DKAA 2EH8H 3PJSB 2E8YA 4XNYL 3PWJA 1EHAA 4DGIH 3QDGB 1FVDA 4GMSH 4XMPH 2XXMB 5C0NC 2XICA 4X4XB 2J8HA 2HG5B 5ALCH 1MPAL 5AYQA 4I3SH 1EEZA 4ALAL 2GY7B 1VFAA 2IANA 2FO4B 1PKOA 2VN7A 5I73B 4JFEB 2LE9A 4GBXB 3QJFB 1EGJL 3RGHA 3BOVA 1U8PA 5I1DA 2GCYB 1JGVL 3O4LB 4HZLA 2A9MH 3O3AA 5IJKA 3VA6A 4XHQA 4J6RL 5H37G 5C9JA 2OR9L 4NP4L 1JGEA 2VLLA 1LEIA 4LLVB 5E8DH 1D6EB 2PW2A 4ENEC 2R4RH 4MA1B 4M7ZB 1ACYH 3VRLE 3FRPG 3TT1H 5J0BA 3U46B 3BZ4B 4HFUL 4JDTH 4L5FH 2EKSA 4I2XE 1VPOL 4L4VE 5D70H 1IAIH 4S1QL 2PO6C 5FECB 4NOFA 4N5EC 4IM8A 3IDJA 4MQ7A 1BVZA 5D7JA 3QEUB 5HI4D 4OGZA 3IU4H 3QNYB 5E4EB 4PRDA 5CILH 5GZOD 1WFNA 1N3NA 3QUYC 1ZA6B 1BF8A 1RU9H 2BVPA 2VXTL 5HI5C 4RZCB 2IH1A 3S8WA 3RHWK 4AIXA 3MOAH 4DAGL 3VD5A 4YBLB 2NTSP 3MNZA 5IB3A 1D6VH 3I6GA 3SDAB 3LKNB 3KPSD 5IVZB 5IESL 2HRPH 1SMAA 3NCJL 4AT6B 4B41A 3FQNA 4FABH 5DC9B 4P2OD 4M4RA 3JWDL 4WDIB 3C8HA 4F33B 1MRCH 5D7KE 4JFDE 4NNXA 3MXVH 1B0RA 3EJZD 4UDTA 2C1OA 1UG9A 3HZMA 3LV3A 3DGGA 2D4FA 1PAMA 4OM1H 4LOUC 3WEXB 1M7IA 1J7VR 1JNHB 1FYTB 3UTQB 4V1DD 4MB5A 4NGHL 4TN9A 4ERSL 3R0NA 3SE3C 4IEFB 3D39D 4IBLT 3RWGB 4QGYA 2XI9A 1FAKT 3NIDF 4XCNA 3Q6GL 4P4KB 4GUPA 4Z7WF 3GKWH 4JZOA 3FZUD 3D3VE 4ELKA 2PUQT 2MQ3A 1ZANH 2XWBB 4PRBB 3O6MH 1AXSA 2ENYA 4KPHL 5AZEH 5TPWL 1BZ9B 3GSNH 1FVCA 1UB5A 1Q1JL 1J05B 3P11L 2EDDA 4YHIB 1S9VA 1V5JA 4RWHA 1IQDA 1H3XA 3QWQB 2QADC 5HHNB 3I75A 4FQIH 4PY7B 3V5HB 2IAND 5LBSL 3ZE2F 5J1AB 3CAFA 4KJWD 3NH7H 4KKNA 3E3QC 3EO0B 4MD5B 4XCYA 4RISL 3RPIA 3KS0J 4WV1C 1EBPA 4JB9L 2NR6D 5GS1C 5HTSA 3VDAA 4L1DA 3ZDXF 4JM2F 3ULUD 3GSXB 1YYLH 5JHDB 1OWRM 2DJ4A 3QHFL 2B5IB 2CMRL 2X4RB 3Q48A 3ARWA 4QRRE 2VIRA 5IFJB 5CZKA 1UADC 3P2TA 3B83A 3KG5A 3U0WL 1EFXB 1AD0A 5DJ8A 2OJZL 3ZHDA 3RX5A 2P7TA 3PP4H 4BYHA 1CGVA 1HOCA 1XIWA 3TZVC 1A5FL 1KJMA 3QDMB 2FECL 4XMLL 2R0KH 3FQUB 3D0VA 1DLHA 4P23B 2E6PA 5JQHC 3GIVB 3MRRA 3S9DB 1NGXB 3L3OA 3SDXF 1J5OH 5D7JD 5TE6H 5E00B 3CNKA 3R8QA 1MF2H 3OKYA 2VQUA 3RZCA 2Q8BH 4EN3B 1QNZL 4LCYA 4G7VH 1HHIB 1F6AA 4ZUSA 4X7SH 3CZJA 4M6OL 3VFPB 1KTLA 4F58H 1P1ZB 4EDXA 5IT2L 4F7PB 3MYJA 4ZXBC 4OZFG 3EDJA 4LF3A 2GUOB 2DQCH 4OLZH 4WW2F 1T5XA 4AEEA 3BYTA 5BOZG 2ATKB 2RCSH 3BYYA 3QI9C 1NEZA 4XI5C 3TVMC 1AKJA 4JFQB 5C08E 2X09A 3VFNB 4FQJL 2VB5A 4OGXH 1UVQA 1NGQH 3D69A 3JTTB 4DN4L 2Z4QB 2OMNA 2QV2A 2AAVA 5GRUL 1E4JA 2HTLC 3ARGA 3UBXB 1G6RH 2FH8A 4OZHA 3V5KA 4KMQA 3RUGB 5DHVB 2VKXA 5IFHH 2GW5A 1ZHLB 4LVHC 1HN1A 4RGNE 5FYKL 5C0AB 2KQMA 3UDWC 1I8IB 1RZGB 4I5BA 2L0DA 1YEJH 3ZE0F 3ARYA 1G7PA 4PJAE 1TTGA 1JWMB 1YA5A 2G2RB 3SE4C 5CGYC 5B3JF 1AQKH 4M93C 3TT3H 4NFCA 1T5WB 1JWSA 3HAEG 2X4NA 2A6DA 3D25B 5KS9B 2X4SA 3T0XA 3WFDH 3NIDE 3Q1SL 4RFOH 1DLFH 2VDLL 3EOAB 4LHUA 4NJ9H 4QLRA 5BJTB 1HQRB 8CGTA 4UUJB 2A83B 1A7BA 2GJ6E 1GGCH 1MCNA 5HHXL 4UNVA 4HKBB 4KROD 1SJVA 2XQBL 3K3QA 3P0VL 2WLZA 3WFEL 3HPJB 3HI1A 3LQMA 4RA3A 4TULH 2P48B 4HG4J 3HHRB 1V7ML 2E7MA 1S7WB 3VDCA 3O3BB 1DBJH 3UZQA 4Y1AB 4XVJL 2VUOA 5D7LA 4K7PL 3BAEL 4AZ8A 2VSCA 5EC2A 3GJEA 5IBLC 1KNOA 1AIFB 4YC2B 4H5SB 4GS7C 3ZE2E 4P2QD 2A1WH 3VD7A 1OB1B 2OMBA 1IAKB 3MJ8B 4ODSL 4NQXA 3T4YA 1U8KA 5F3HB 2NY2C 4HWBL 2CKNA 4D9LL 3QUXC 4GXUN 3FO1A 1XIWD 2VLKB 3LOWA 5IF0A 3U2SB 2E7BA 1JYXA 1CS6A 1QKZH 4D9QD 5C0DB 4J3TA 3CXHJ 1HINH 4KWUA 1MFDH 3GNML 3CLFH 1ZLUK 4LKCA 3RZCD 4FQPA 3BH8A 1I8KB 4MCYB 1OSZB 4ORGA 3W2DL 4U31A 4JQVC 1NL0H 1KG0B 3PHQB 2A74B 1DEEA 3MNVA 1CR9L 3EGSA 1J18A 1F90H 3ZKMD 1WBYB 1IC5H 3QUZB 4Y19A 5TQ0H 4NNYA 3IDIB 1M6OB 2X4UA 1G6RA 5BMFL 1A02N 5DJDA 1ORSA 5F7KC 4RAUA 4U6HB 2AJUH 3U4BH 1GAFH 4Q0XL 1VKXB 2AXFB 3F5WA 4Y2DB 1AKJD 1A7OH 5DA4A 2E7CA 3CCHA 4Z7WB 2IFFL 5DRNB 3NTCH 4WNQB 1UZ6F 4LU5L 2EDOA 3JV0A 4G43A 2OI9C 1BVLA 2R4SH 4YDJB 5J57B 1K2DB 1UT9A 5D2NE 4N8PA 2DAVA 1DBMH 5T1LA 3ARGD 3M45A 3QCTH 1RJZB 2ATPB 1EEUA 1T3FA 3QH3B 4G9FB 3SJVA 1TVHA 2NYYC 2HLAB 5KSVA 4R2GC 1F8TL 1MY5A 3NIGE 3S4SA 3CIQA 4TOYH 3W0WE 5TQ2L 3LEXA 5F9WB 4JM2B 4CN1A 3ECBA 3O8XC 4NQEB 4U0QB 1BOGA 1I8LC 3ROOA 1MIEL 1T04B 4X5XB 5FGCB 3WNLA 4JFYA 2X41A 4XWGL 3VFOA 4EDWL 1HQ4B 4LCCC 5BVPL 2KUTA 1N64H 1I1AA 2DB8A 3QBTB 4LHUD 3BMWA 4YGVB 3LS4L 5C1MB 1KN2H 3EYFA 3WJJA 1X5YA 2BSTB 5EU5A 5KSUA 2AJZA 5C0EB 5I30L 5BO1L 3C60B 2K3TA 4LEXH 2IAMA 1W0YT 4GT7A 1MLBB 3H3PL 4MMXC 3BEWB 5DQJB 3GMQB 1PX4A 3VXSB 2W65B 3LEVL 1CICC 4PG9A 3WXVH 5D7LD 1FYHB 4FQ2H 4E42B 3SDXB 1UXSA 4FN0A 4DK6A 1IGYA 4PP1D 5E5MB 1I7RA 5L9DH 4TVPE 4BH7B 1T66D 3BXNA 2P5WB 2JJTC 2VZOA 5TFSH 2X70A 1RK1A 3TO4C 1NEUA 4YWGL 5LGJA 1P4LB 3KPRB 3SPVB 7CGTA 4GAFB 3FTGB 4F3FA 3CXDH 5C8JB 3KLHC 4LSUH 3RI5K 2FBJH 1OLZA 1MFBH 2FD6L 4XC3L 4JRYB 4S1RH 3THMH 2XZCH 3NA9H 2H32H 2NY3B 4KAQH 4LASL 3S98A 4KHXH 4UINH 5DD1H 4P5KB 2R29H 5J56B 4MS8D 3HZKA 1CZ8H 2KZWA 1YY8A 5E1AB 1NLDH 1HWHB 5GSVB 5J6HB 4Y19D 2Z8SA 3QIWC 2NMSA 5EOQL 3VXRE 2DQGH 5DUPL 1GZQB 4N9OB 5KSBF 2PYEB 2ADJB 4XTRD 2PO6A 5CBEA 3C5SB 4F8TA 3TEUA 4IMKC 2ZUQB 3FFDA 3RWEB 4LVEA 4WUUA 1A7NH 4RAVA 4C58B 3RTQC 4PGJA 3PGDB 5C0GB 3MLZL 4KFZC 1U8NA 1F02I 4DKEH 3ARBC 3QUYA 5T1LD 4A2MA 4MXVE 1RZIB 4KMLB 5C09E 2Q6WB 3DV6B 3C08H 4E41E 3SJVD 1TMCB 4R90L 3HAEB 1G0XA 4WI5A 4Q9QH 5KZCD 2VUYA 5F6HI 5MENE 3IFOB 4KVCL 4MA3B 4Q97A 1RULL 1UWGH 4MNHB 5J06A 3IDMA 1MRFH 2YD9A 4YDLC 3GI8L 2W9EH 1RZJH 1FFOB 3QWOA 4YIQA 2IMMA 4KQ3H 3MA9L 3CMOL 3MLTB 3G5VA 1ZHKA 3VFVA 4EXPX 5C2UB 3GRWH 1MCSA 1WWBX 1Z9SA 1U42A 1I1AD 1VHPA 2H8PB 5LGHL 1KJ3H 4M1GH 2XTJB 1AO7A 4TSBH 5GHWL 3HUJE 4WFED 5IB5B 4W6WB 2IAMD 1WF5A 2IGFL 3M8OH 4TYUA 5KW9H 1DVFB 3WIHL 5DTFA 1XF4B 3GI9H 1WIOA 3ZHKA 5C86A 4WEUD 5FYLE 4F80A 4Y8DC 4GXVH 1KLUB 4QF1B 3S3PA 1F3DH 1BD2E 1T2JA 4JFPB 1UWEH 4E5XB 4MJ4A 3PF2A 2P8PA 1FAIL 1NSNH 1KB9K 4HUXB 5FK9B 2P5EA 1KPUA 3HS0A 4TSAH 3H3BC 3U36A 2H32A 1HKFA 5ETUA 4ZO7A 5IKCA 2Z91A 5B4MC 5J1SC 1DN0B 3HRPA 3NN8B 3HTLX 1N6VA 2RAMA 2EXYC 1KC5H 3IAPA 5DRWB 1KPVA 3BSZH 5L6YH 2J88H 1I7ZB 4WHTB 2EDJA 5IFAH 1NJ9A 4ZFZB 4WV1A 5I16A 2G75B 3QPXH 1AY1L 2OTUA 5MEQA 3S96A 4L4JA 4NZDA 4GKNA 2DQDH 4GSDH 5T3XH 1FL6A 2XG5A 3MRMB 4OF3A 1QSEB 4XCFH 2IJ0C 5HGAA 1WZLA 2YC1A 4OLUH 3UC0L 4GG6F 4ENED 5EFIB 2NTFA 1MHEA 4N0RA 1WGOA 4HWZA 1HNFA 1IC4H 5I1GH 3SCMA 4KI5C 4KKBC 1OP9A 3P4NB 4JJ5A 1TCMA 3IJHA 2RR3A 5T1KA 2DOCA 1HNGA 2PO6D 4AJ0A 5LQBL 4WUUD 3VFWB 1GZPB 1ONQA 3LKSA 4U49A 1S7RA 4XVTL 3KPPA 2CQVA 3V6ZA 5IEHA 2LAGB 4HULB 1XEDA 4X7TA 3SGDH 4AIZB 1EAPA 2ZJSL 4LSQL 5FF6B 1FN4A 5D1XB 3AROA 3VFUB 3MBXH 2NQCA 2XWTA 2NXYD 2VLRB 3QUYD 3VH8A 4KDTA 1W72A 1RFDH 1H3WM 5HI5D 3MRIA 1JPTH 1U8MB 4KVNH 3Q3GA 5T1DH 3MRDA 4NZUL 1YQ2A 3QHZH 1XF3B 1A7PH 2XV6B 4PRIE 2R2HB 4NDMA 2HJLB 4RQQB 2BXYA 1EJOH 3QI9A 4YHZH 3ISWA 1CLOL 3MYZA 3DI3B 3TVMA 1D5IL 1IQWL 4RBPH 3T2PA 3B9KB 2A9NL 4Q6IA 1C8PA 3VCLA 5DDHA 5FUZH 1I1CA 2BHYA 4Z7VF 3WUWA 2Y4SA 5HDOA 1YECH 5DZNA 4X7EC 4NT6B 4L3CB 1FIEA 2ADFH 1OGTB 3AMLA 5EULV 2P8LA 1AO7D 1CF8L 3EYSH 1OOAA 1I3UA 5JA8B 3UDWA 1LD9B 1QFUL 4Z76A 4JLRA 1MHPH 1T03L 1S8DA 3HE6B 5F9AC 2MCPH 1OAQH 1G7MA 3I84A 1X4ZA 3ES6A 3D9AL 3CFJB 1KGCE 3RFZC 1ZS8B 4CL7A 1NAKL 1CT8B 5IP4A 2P5ED 4QRPE 4EQ3A 1LP9A 4MJ5A 3VFTB 4I8DA 4JDVA 3UJIL 1MHCA 3GDBA 4BUGA 1NGWA 4F7CB 4Z7NF 2QADD 2YR3A 1QQDB 5DEGB 1A3RH 4LP5A 5ID0B 4EUPA 3IDXH 3DURB 5DD5H 1IT9H 2D03H 3IFNL 2XPGB 1LEGA 2NY4C 3OXRB 1U6AH 2BVTA 3K2UH 3BQUA 4M5YH 4EI5B 5KSBB 1ZVSB 5INCB 4HUUA 3WIIH 3IFLH 2I5YL 4LAQH 3L5XL 1IJ9A 2PTTA 1FLTX 3DMMC 5TDOB 4UT7L 1ZA3B 3ULUF 1FRGL 1QLEL 2P4AB 4MJ6A 4MXWH 5HHOE 1CFBA 2AV7B 3B5TA 5C6PB 5D7IA 4PLNC 4ZTPL 1CBVL 1BX2A 4MJIB 5IG7A 2XG4A 4Y4FA 5I1IL 2R2CA 4U1GB 5E4IA 5E6IA 1CD1B 1UKSA 3SCMD 4OLVH 3V8OA 1FFNA 5E8NA 2YXFA 1LE5A 3GMOA 3GJFB 4FG6C 5C07B 2V5TA 1ZTXH 3WO4B 4P57A 1R3HB 1HXYA 5T1KD 4KHTH 1PD6A 2WIIA 2DQEL 3O2VL 4OAWB 1ZGLA 4WI2A 3VXOA 1I3RB 5I2IA 4HT1L 5DA0B 4I0PC 1E4XI 5MERA 4GG6E 1I9JH 4OSUL 4YQXL 1F00I 2Q7YB 3RKPA 3T2NH 5I18H 3LPFA 3L95B 1UJ3C 5T3ZH 5EOCJ 4OKDA 4B5EA 2K7QA 2VISA 4QTHA 5CJOH 3UAJD 1ADQH 3AMKA 3FFCB 4B50A 2DQUL 1HILB 4ZAKC 3L3IA 3QI9D 4PB9H 3SKNB 5I9QC 4HKXB 4HX1B 1MI5E 1OT2A 5A2LH 2DJSA 3EJYC 4P2YA 1WT5C 4JY6A 4LDEB 3SDCA 3TVMD 3P4LA 4LIQL 1Q9WA 5IWLA 2H2PD 1WAAA 1HHJA 3WLBB 2IFGA 4K7PY 2HP4A 1AXTL 2NY0C 4RFEB 5EZIL 4YXKH 4WEBL 1BVKA 5FM5O 5GS0C 4MWFA 2HTLD 1QD0A 3IKKA 2HWZH 4P59L 4MA8H 3ZE1F 4U1SB 4XPHL 1WBZB 1L0YA 4G6AD 5K33A 4UI2A 1RUQH 1C16A 4QXGH 4WUKH 1BREA 4HWEH 1KIQA 4XXDA 3ZZ1A 2CIKA 2R1WB 1Q0XH 5CGYD 3DUUB 1G7JA 5INDA 1V3MA 4O51A 1S78D 2W60B 3MUHL 4V1DE 2J4WL 4I48A 4AYFA 1QG3A 5HVGB 2NY5C 4PRHA 4O9HH 5FO7B 5FHBL 4NSKA 5T3XD 4ZQKA 1MJJA 2J2ZA 3QP3A 4XPGL 5IQ7L 5BS0E 4LDOB 1JF6A 2VDML 5E8PB 2VZ1A 4DVBA 5I75B 4MNGB 2PTUA 3OAYH 1B9ZA 5IBTH 2VNCA 2YD3A 1UWXK 1X3DA 2DBJA 4UOJA 4OJFH 5CD3A 1VDGA 3BQUD 4PJDE 4DUWA 1RIVH 1U91A 5C9KA 1S7VA 1JRHI 1CYGA 2OJEA 3FCTB 3VXUA 3UYPA 3H42H 1MOEA 4QRSA 5GGVH 2EYTA 1FH5L 3BPOB 5GRYA 1RI8A 1JZ2A 2CGRH 3FO9B 3I6KA 3SKMA 2V5MA 3TO4A 4Y4FD 4ODBD 5J4MA 5GGRB 2HJFA 4IS6A 5E6ID 1VGKA 2NY2D 4HDIA 3HI5H 5F96L 2VH5L 4KK6D 1F4AA 4PTTB 4U1IA 1SEQH 6CGTA 3KPSB 5M7QA 1DQTA 3KJ6L 1TJGH 4L3EE 3V4UH 3ZT5A 1QYGH 1PW3A 5E56A 1ADQA 1YEFL 1YMMA 2Y5TB 1NKRA 2XOTA 5C0JB 5KVFH 1YEDA 5CEXB 1QSFE 3VGEA 1Y18A 1OPGH 1MEXH 2J7LA 4FFYH 1N0LA 4Z7VB 1IVLA 4Z77A 1NEZG 4KH2A 2R2EB 3CU7A 5HVHB 4ZDHA 2B0SL 3ARZA 4XX1E 4ZTOL 3WNMA 3U7YH 3KJ4B 1S9KC 4KTEH 1NBVL 1BJ8A 3D39B 3MV11 4WWKC 1CXIA 4RGMB 3A6CL 3QDHA 2CIIB 3G08B 3DSNA 4W4OC 5MI0B 1JV5A 3SDCD 4CNIA 3GUTB 1EHLH 4JO1L 1FGNH 5LVEA 2RBLA 3TBSA 4OCRH 1Y0LA 1UXWA 1F4XH 4JN1L 4MQTB 5KANI 1RUML 3PWJB 3IDNA 1XR8A 3E1F1 4A6YH 1FVDB 3ARBA 5DEFA 5GZND 3SKJL 1E6JH 1JPFA 4LARH 4WGVB 4OZHF 2BJMH 1Z9LA 3SO3C 4ZMAT 2E9JA 4KY1H 2NYYD 2EDEA 1EEZB 4YEFA 1GIGL 1RMFL 1QEWA 1A7QL 1VFAB 2IANB 1IGIH 3M07A 4TPRL 1ETZA 4APQA 3TP4A 1U8PB 5I1DB 1ES0B 5HBBA 4HZLB 1HCVA 3GBNL 1BFVH 1WITA 2E5EA 4M1DL 3O3AB 4HIHA 4FFZL 5C6TH 3KYOA 1BP3B 4PRHD 3NZ8A 2W07A 3DECA 1JGEB 2CRZA 2VLLB 1LEIB 4OLYL 2PW2B 4ZO6A 2FNBA 3NPSB 5HDBF 1DCLA 1NCNA 4NM4L 3E2HB 2DKUA 3KYNA 5K9JL 3PWLA 4O2CA 3V0VA 4NQUA 1WK0A 1MREL 3GGWB 3W39A 4NN5B 2UZIH 3L3HA 1C7SA 2AJVH 2FATL 1FZMA 1OTSC 2HYMA 4XCCL 1CXKA 3IDJB 2H1PH 5TF1H 4MQ7B 4JZNA 5D7JB 3VXUD 5JW3L 1JTOA 3QEQE 4Y5XB 4XPTH 2MJWA 1NBYA 2ZOLA 3TH3T 4JO4L 4PJEE 1P4IH 4MXQD 4PRDB 5C0CD 5EORL 5FOBA 4XP1L 4I13B 1N3NB 1BBJA 5FYJH 1CXLA 3TO4D 3H0TA 2VXQL 2BVPB 2IH1B 4NKIL 3MNZB 3ZDZE 5IB3B 1B88A 3I6GB 1XH3B 2BC4A 3KLHD 4JPVL 2X4PA 4P2QE 1YMMD 4FQQA 1N2RA 3BP5A 1U2CA 1R3JA 2JB5L 3PXJA 4Z0XA 2YBRA 4N1EA 4NKQB 4NNXB 3MLVH 3L1OH 1EHXA 1KUMA 3GHBL 3UP1A 4UDTB 2C1OB 3HZMB 2AQ2A 3LV3B 3VGAB 1SJXA 5K9QG 5I74C 1SQ2N 3O45A 4R8WL 3KLSA 3DXAE 3S37X 4A6YA 4TQEH 5SWZA 4ONFL 5EN2A 5TE4L 2DM4A 1DFBH 3EBAA 4MAYC 4XCNB 1MAML 3L3JB 4GUPB 2M2DA 4DGYL 4ELKB 1KTKE 1KLGA 1AXSB 4LBEA 4LSVL 1NMAH 1FVCB 1NUGA 4NHCH 4EJ1C 1UB5B 5EDXA 3OPZH 3ARBD 3V0WL 1S9VB 1JTPA 3TN0C 1OM3H 4X9FA 1NCWH 1IQDB 3K4ZA 2AK1H 1CQYA 1RY7B 5KVMC 2AJSH 5TGBA 1VCAA 4KROB 2VXUH 1WWCA 4YHMH 1LEKA 1EBAA 1VGEL 4UV4H 3W9EB 4XCYB 3RPIB 4APQD 4YEEA 4DOHE 4R0LA 3OL2A 4BSVA 3CVHA 5DJXA 3MGOA 4H8WC 2HFGH 3W81A 4U7MA 3P77A 4KTDL 2VIRB 1PY9A 3LHPL 1ZK9A 5DS8B 4JKKA 1RHHA 1ZKAA 2C4FU 2R56L 4ZSOA 1AD0B 3VWKC 5CCKL 5ITBL 3NCEB 1RZKC 5DJ8B 2V7NA 4D9RD 3ZT7A 4BELD 3TPUB 2P7TB 3D6GA 1HOCB 1XIWB 5IROC 1KJMB 3GSOA 3RL1A 3W5MA 2X6MA 1SY6A 3D0VB 2XN9A 3MLUL 3P9LA 2Z31A 1IAIM 1XCTA 2FJGA 4X6CA 2EIEA 4YNYA 1INDH 5HDBE 2QHRH 4BZ2H 2YZ8A 3RZCB 1CTNA 4LFHD 4LCYB 1MCOL 2ZG2A 4RFNB 4ZUSB 1U3HC 4I18C 5EA0H 4YDIH 1KTLB 1WICA 5EBLA 3FO0H 1HHGB 4PJ8C 3LN4B 4WTWA 1N4XH 1U36A 3S88H 4LF3B 4YFLI 1J9CT 1AC6A 43CAB 1CLCA 5LKNA 1T5XB 5C7XL 4L4TA 3RGVA 5IQ9A 4YHLL 4H1LH 3KPMA 4ZFOA 1RUKH 2VQTA 4CBPA 1NEZB 3RJQB 4HF5L 4N1CA 1AKJB 4YDKL 1TVBA 3EKCA 3VXQB 1R3KA 2RFXB 5KN5A 3OG6B 3DMMA 5HJ3B 1AE6L 4NN6B 4M7LH 5JO5A 3O3DA 5AZ2L 3HRZA 1UVQB 2BCKA 3D69B 4YHKL 1JPGA 2PYFB 4RA0C 4KJQD 4M4PA 2D9CA 1QO3A 2PTVA 4OZHB 4R3SA 5F9JA 3V5KB 3V52H 4KQ4L 1A9EA 4PPTA 4P9HC 4M62L 5DRXA 3EOTH 4JHAH 1UKQA 1G9MH 3QO0A 4WRLA 5SWZD 2DLFH 5J11B 4X99A 3P73A 4FQXA 4O4YH 2CRYA 4I5BB 2P46B 2QQKH 3I2CL 3MA7B 1G7PB 2B4CH 5E99H 5JW4M 3BT2H 2VZTA 1HIMH 1UA6L 5GJSH 2HT2C 3RVVC 1JWSB 3O4OB 4D0DA 1Q38A 1CFVL 2A6DB 3K2MC 4JPKH 2X4SB 2R1YA 1BEYL 1CQKA 3CH8A 3LQAL 5CP3H 3QWRA 2YRLA 4LSRL 2J8UA 3O0RL 1D5XA 3DNKA 5D5MF 5I1HL 1OW0C 1AI1H 1UCBH 1BFSA 2WWMC 5I76A 1KENH 2GTWA 3ULVC 1XF5A 1MCEA 5D7LB 5LAXB 1RIHH 4HFWA 2V9RA 1L7TH 1LO0H 2R0ZH 3QDAA 1RIUL 1PG7X 5EC2B 3OAUH 3F6LA 5ACZA 1H3UA 1M7DA 3GJEB 3SJVE 1XGPA 5DUBB 3DVFA 4XVUC 1A9BA 4GRLB 5ANMB 3TNNA 2OP4H 4O00A 1S7XA 2E27H 3V4PL 3MRFA 4NQXB 4FMFA 2ITDA 3T4YB 1U8KB 4HHAB 5IVXE 5LGKA 1CDHA 1LMKA 4N0UB 3FB8A 2X4TA 3FO1B 4DKFH 1KEGL 1QFWH 5IF0B 2XN9D 3GJFK 3F7VA 4DW2L 2LU4A 2Z31D 4H1LA 2K7PA 1YMHA 1P4BH 1ZLWK 3QJHA 3HE7A 3MLSL 4LKCB 4IDJL 4FTVA 3BH8B 25C8L 3G9VA 2DMBA 4JQIL 3BGAA 1YC8A 4ORGB 1ZEAH 1OAUL 3C5ZC 4JO3L 4BSWA 1DEEB 5DK2A 3MNVB 3IVKA 3EGSB 4MAUL 1GC1H 4YX2H 3UTPE 1MIMH 4F7MA 3PQYE 4Y19B 4NNYB 1I7UB 4M7KH 2X4UB 1G6RB 1FG9C 4L4TD 1CFTA 4YPJA 5DJDB 3RGVD 5ADPH 4RAUB 3BKCL 4NQDA 2LTQC 3RU8H 4HJGA 3CCHB 1OAYL 4K23L 1MCPH 3DMMD 5ICZA 2VWEC 4X98A 3GSQA 5CEYA 2DDQL 4G43B 1DUZA 2JF1A 4RMUA 4KK5C 4LCWA 3QFJE 5CJXA 1QBAA 2VE6A 1N26A 2DQJL 2HVJA 4ZS6D 5SV4A 4U33A 5T1LB 5DD6A 1L0QA 3OR7A 5L2JA 1T3FB 4JFHD 5F7UA 4FG6D 5KSVB 1JPSH 1KELL 2AXGB 5D2LE 3O6LH 4FQXD 5KZCB 2DM3A 2ZCHH 3RVTD 3S4SB 4K3DL 1E4XH 2O5ZH 4NWTL 4RDQG 2B1HL 3LEXB 4PTUA 3HB3D 5GGTA 3RBSA 3T65A 4ZFGH 4NQCA 2ZCLH 3Q5TA 3ECBB 1BOGB 4D3CH 3DLQR 1HHKA 3ROOB 3GK8L 5F97E 5DQDL 2AGJL 3VFOB 4K8RC 1CE1L 4OZGF 1I1AB 2VDPH 2DTSA 3QWRD 3BRFA 4G42A 4X5LA 2CDFA 4UQ3A 3DETC 3EYFB 2Q1EA 5EU5B 5HXMA 5KSUB 2AJZB 2A6JA 4PJBF 2X10A 2NXZC 2IAMB 2GSIA 4TSCH 1U0QA 2GQHA 4DEPC 2DN7A 3WUWG 4ZOBA 3FQXA 1CFSA 4PG9B 3GBML 5BRZE 2H6PA 5ICYA 3O6FB 3BP4B 3G5YA 2JE8A 1UXSB 5FA3B 3BDYH 5DMIL 5I8KH 1F4YL 1IGYB 1I7RB 3S35L 5D5ME 3TA3C 4OQTL 3BXNB 2X70B 2WBJB 2MTPA 1RK1B 3VFSA 4PR5A 5B38A 4LSTL 3MLYH 5LGJB 4IRJC 4F3FB 4LEOA 2NY1B 1F97A 3LRHA 1KFAL 15C8H 4P5MA 3B4NA 1U58A 5J12B 5CJBA 3VG9B 4U1MB 3KPNA 3HE7D 3NA4A 1LO3H 3O3EB 1KCKA 4FTVD 5D96B 1S7TA 1LP9F 5GS3A 1NCTA 3HZKB 1MAKA 3I9GL 1YY8B 2OTWA 5HI3C 3G6DH 2C4XA 5F7EL 4OZIA 1T0NB 4R4FH 5CJQH 5HPOA 2EH8L 4MHHG 1JRHH 3TBYA 4NQDD 2PO6B 5CBEB 4DGIL 3CFBB 4WUUB 2RB8A 4GMSL 4RAVB 4XMPL 4OLEA 4YXHH 1RV6X 3JWNC 3HPLA 4WI6A 5ALCL 1MQKL 2ZSVA 1U8NB 2NZ9C 4LCWD 2MHAA 3DTXA 1WFUA 3E8UH 4MD0A 4ZO9A 5D1ZC 5D7IF 2NXYB 3JXAA 3E3QE 5J8OA 2DJUA 4Y4KC 3OKEA 2YSSA 4PJ5E 1WLHA 1Q9OA 2A9ML 5EIIA 3MRHA 3TM6A 1C5CH 2PXYC 3IDMB 1LO5A 5FKPA 5DD3H 3F7YB 4XCEA 4DCQB 2HT3D 4NQCD 4POZD 1ACYL 4MNQA 2L7UA 4Z78B 2J5LC 4NKDA 3TT1L 3G5VB 1ZHKB 3JVGA 4FQHA 1QPPA 3VFVB 4L5FL 2NY7H 2R1XA 4JDTL 4TUOA 3TBWA 3I85A 5KVGH 5D70L 1IAIL 4P46C 1ORQB 4F9LA 3MUZ1 1AO7B 1WFOA 2VR5A 1MUJA 2AABH 1P6FA 4MAYA 3ZSSA 3IU4L 3X13A 2JJSC 4F15B 2HMID 2VN4A 1JZ8A 5CILL 3ZLQC 1F11A 4OZGE 1WAAF 5E9DA 1TQCB 3SE8H 5CEZE 1RU9L 4AIOA 1GSMA 1CDIA 3ALXA 4EVNA 2P8PB 2BOBA 2P5EB 3MOAL 2GJZA 3U36B 4PJBE 4OCSH 3KDMA 2H32B 5ETUB 1D6VL 5IKCB 2Z91B 4WFGD 2HRPL 2F8VA 1RURL 5F9OH 3SGJA 4ISVB 4FABL 2Y9RT 1KPVB 4HKZA 5GXBB 4ZFFA 2UUDH 1F3DJ 1NJ9B 1MRCL 4WV1B 1JI1A 5IIEA 2E7LC 1F3RB 2OTUB 5MEQB 1DDHA 1FL5B 4OCYH 3ZTNH 4NC0B 3NFPA 4GKNB 3LB6D 4OM1L 5H2BB 1FL6B 5A2IH 1IM9A 5GJTH 4M00A 5IV2A 1T7WA 3CFKA 3PIQA 5CFHA 1N6QH 4OF5A 5HGAB 3B43A 5CINH 2YC1B 1OQOA 4QWWC 2NTFB 1MHEB 3OJ2C 2QTEA 4P2RE 1KCSH 2YN3A 4HWZB 1FZKA 2HH0H 3K4AA 3SCMB 2ILLA 3HR5A 3BEVA 4JHBA 1ZANL 4JJ5B 5IROA 3HC3H 3O6ML 3IJHB 5AZEL 5T1KB 3GSNL 3OX8A 4XXCA 1GOHA 1A3LH 4B0MM 1ONQB 3LKSB 3OHXA 3V6ZB 5IEHB 3BZEA 4M3KB 2BFVH 4X7TB 1AHWA 3CH1A 3OR6A 4FQIL 2W0FA 3EOBA 1EAPB 1FN4B 4ELMA 2C4FT 2XWTB 4JN2A 1ZVHA 3MRIB 4FQCH 2QSCH 4KMTL 2W92A 4LPVA 4F9PC 1T1WA 2YPLA 3QI9B 5CZXD 3U7AA 1YYLL 3TVMB 5DVNA 2DQFA 5B8CC 1K5NA 2H2SD 5KOMC 1PEZA 1R5VA 4Q6IB 4MNQD 5F44A 5A43C 3VCLB 2MCG1 6FABH 1SVZA 5I17A 3OJDB 5J13C 3WUWB 1ZT4A 1NFDA 3PP4L 4YHNA 1M71A 4NIKB 1WZMA 1MJ8H 4LLYA 4NC2B 5MEOA 4XNZC 2P8LB 4Z7QF 4OD2A 1GGIH 2FZ3B 1J5OL 1H0DA 5TE6L 4MAYD 1DE4B 1MF2L 3F62A 2DYPA 4Z76B 1G1YA 1KACB 4JLRB 1S8DB 4X8XA 4GQ9H 4LQFH 1DQDH 4G7VL 1G7MB 4OF7A 3ES6B 4X7SL 5E9DD 1K8IB 1UQSA 1WTGT 4F58L 2ZUYA 5CLWA 4MCZA 3HFML 3U6RB 1LP9B 2DQCL 4OLZL 1HYSC 2NZIA 2EDTA 4JDVB 4YXLL 4PJIA 1MHCB 1HHHA 3C5JA 1KBGH 1NGWB 2RCSL 4JZJC 1T22A 1N7MH 1TNMA 1LEGB 1MSPA 2KPNA 1PZ5A 4QEGA 2GY5A 3BQUB 2UY6A 4HUUB 1BLNA 3VFRA 4LQ1A 2NPLX 2PTTB 1JHLH 2C3WA 2PF6A 4LRIC 2I9LB 5EBMA 2YHGA 5IJVA 1IM9D 4K7PX 4MJ6B 5IFHL 5D7IB 1T0PB 2PCPA 2B2XH 5F1NA 5C0BA 1Z6JT 5IG7B 4Y4FB 5IK3A 1IAOA 3QUKA 5JPMA 1EVTC 1KCLA 1PKQA 5E6IB 1YEJL 3TNMA 1KYOK 5HDQH 5DD0H 4PJFF 1FFNB 3CX5J 5E8NB 1J0JA 1M1SA 3GMOB 5ECJE 5IUSA 1LE5B 5SWQA 4S0SD 4P57B 5SWSA 3EO9H 1MRDH 1HXYB 1AQKL 4XPBH 3TT3L 2ZUSA 2WIIB 4GAGL 1ZGLB 1A6ZA 1INEH 5GRZA 3VXOB 4YBQC 3NABH 3WFDL 5MERB 4JANA 3UXFA 5FFLA 1DLFL 4CDGC 4TNWF 4NJ9L 4WO4A 3CSPA 3ZMRA 3C5ZA 3K74B 4NZJA 4JGJA 1V8HA 4TULL 3K8LA 2YA0A 1B6DA 4PJ8D 1DBJL 3BDXA 5GGUB 1KJVA 4QTHB 4LLQA 4Y88A 1JZ4A 2YPLD 3GM0A 3L3IB 1WC7A 2I07A 4XZUA 2A77L 4IMLA 3DRQA 2QEJA 1ZGLM 3MV9A 3BRGC 4JDZA 4JY6B 5C0CE 3SDCB 4YHYB 2HTKD 4HAGA 4O2EA 1Q9WB 1D5MA 5EZOH 2A1WL 4X6BB 3FT4A 4C59B 3ILPA 2C3VA 3EUUA 1SJEA 3MRJA 4NO3A 1BVKB 5I1AA 4MWFB 3MZGB 3Q2CA 4HK0B 3VDBA 5D71H 5FB8A 2JCCE 1QKZL 2GEEA 3G6JE 3ELAT 1CGUA 1HINL 2CJUL 1MFDL 5D1QC 3CLFL 2DYPD 2Y36L 1C16B 1CD8A 4NYLB 1NAMH 1KIQB 4XXDB 1A4KA 1NL0L 3RY5A 2CIKB 4LCUA 1JHKH 1G7JB 3VD4A 5INDB 3FB5A 4O51B 5E7FA 3RVVD 1F90L 3K80A 4LHQB 3WHE0 2HLFD 1IC5L 4I48B 3UTSE 5E2TH 4PRHB 4U6VH 5HYIA 5TQ0L 5KVEH 4NSKB 5ACLA 4N90E 3VXTA 1QPXA 1MJJB 2AJUL 5HVWA 3U4BL 1GAFL 1A7OL 4DVBB 1HE7A 1T83A 3NTCL 5T1MA 5DR5H 4ZG1A 5F8QC 1FNHA 1LO2H 1NLBL 5CD3B 1J8HB 2R4SL 1RZ7H 1U91B 1S7VB 4KUCF 2OJEB 4XVSH 1P5UA 1DBML 4PV9B 2EEBA 1I1FA 2ERJC 3QCTL 3VXUB 3VRIB 1MVFA 5F3BA 4QRSB 4Y2OA 2EYTB 3BN9D 2A6IA 3I6KB 3SKMB 4XNMA 5C0BD 4Q2ZB 2XKUA 4FZ8H 1PGRB 2D9QB 2HJFB 1EJ6A 4IS6B 5KAQG 1VGKB 4IRJA 4TOYL 1U92A 4HDIB 4I2XA 4UIKH 4HGWA 3RVWD 5SWSD 4WWID 3AXLA 5JOPD 4HIIA 1X9QA 1G9NH 5EUOF 4ZUUA 4X6CF 5HHQA 1UZ8A 1N64L 1YEDB 4ETQA 4YFDB 1WCQA 1U8LA 4WGWB 3CDCA 4WO4D 1VFMA 2DLEA 4LSDA 1Y18B 1KN2L 4PJFE 3C5ZD 4FFWC 5DK3A 3ARUA 4Z77B 5A3IC 4ZDHB 2J1KA 5IHZB 4KJPD 3RDTC 3P9WB 2LABA 2FECI 3BIAX 3T0EC 1ZMYA 3KR3H 3WXVL 3TO2A 1ULVA 4FQ2L 4H88H 5JPNA 4OGYH 3HZYA 4MZ3A 3MV9D 1JV5B 4CNIB 4PV8A 5L9DL 1CG9A 1PSKL 2BNRA 4Y5VA 2H9GA 5BV7H 4YJZL 4JREB 3TBSB 4JFDA 1Y0LB 1G7IA 3ZDYF 1UXWB 3AM8C 2FHCA 3O81A 1XR8B 3AUVA 5DEFB 3CXDL 1JPFB 2XKSA 5HHME 1MJ7H 2EDWA 4U2YA 4LSUL 1ODAA 3B6SA 2FBJL 5C0IA 5DJ2A 2V2TA 1MFBL 2CLZA 1U8JA 1IC7H 2IQAA 1NGYA 4NKMA 5HPMA 2ITCA 1QEWB 4S1RL 3THML 2XZCL 3NA9L 5F1SA 4HBCH 3IXAA 1I4FB 1ETZB 4KHXL 4UINL 3D3VA 3AVEA 4APQB 5DD1L 3CLEL 4K94C 4Z95H 4NN7C 3D5OF 4PG2A 3WXWH 3MLXH 1CZ8L 4HJ0D 2JK5A 1NLDL 4LRNH 3FAXA 3KYOB 4KI5E 1P7KB 2G5BA 4JPWH 5DO2C 5FHAH 3W5NA 3BO8A 2DQGL 2FL5A 3GEWB 3UYOD 1LDPH 4P46A 1YEIH 5FCUH 1D5ZB 4J3WA 2J8UF 3DETD 3LRSA 2IQ9H 4LNRA 1A7NL 2BSSB 3KYNB 1UWXH 4O2CB 4QHUA 3V0VB 5DJ6A 5HY9A 2R0LH 3HI6H 2YEZA 3W39B 2JJSA 3L3HB 1G7LB 4PFEA 2YPKA 1FZMB 1AGBA 4DKEL 3E6HA 5ESVA 3AREA 5HVFB 1FPTH 4JZNB 2YKLH 1NBYB 2ZOLB 5BW7A 4QRRA 4WU5A 1H8OA 1L0XA 3PWVA 1C08A 4RWYH 5J7CC 5HHPA 3ARFA 1JUFA 5FOBB 1PJ9A 4Q9QL 2EKJA 1BBJB 3H0TB 3QQ9C 5EU6E 4H1LG 4IRJD 1UWGL 2NCMA 1MRFL 4L8SC 2W9EL 3WE6A 1RZJL 3K46A 2BC4B 3IGAA 4KQ3L 2UY7A 5DK0A 2E7LA 2X4PB 4J1UB 4CMMA 4FQQB 1N2RB 3NACH 1YQVH 3BP5B 3GRWL 3N1FC 1WFTA 3ZT6A 1R3JB 1ITCA 2FIKA 1NANI 3QXWA 4Z0XB 4DUXA 2YBRB 1CFNA 5T5NG 1KJ3L 1KB5H 2V17H 5GPRA 4GRWE 5HYJD 4M1GL 4TSBL 2MMXA 4K3EL 3M8OL 5HI3D 2VDNH 1XGUA 1JZ7A 3LKPA 3O45B 4YH6A 4A6YB 3GI9L 1H15A 5EUOE 5T5NF 4X6CE 4Y89A 2GSGA 2XRAH 5E95B 5SWZB 2ZPKH 4GXVL 5EN2B 2YRPA 1EVUA 3U4EA 1UWEL 5CLTA 4AMKH 1IKFH 1NSNL 1BF2A 3M1BB 4TSAL 2EYRB 2BNRD 3JWDC 1DBKH 4G8IA 2OZ4H 4K3HA 4JFDD 1CXHA 1KLGB 1S9WA 4HH8A 4K3JH 4U3HA 1UEMA 3AAZB 8FABA 3LKOA 1WQVT 2VDOH 5E5RB 5EBWA 5CBAA 1Q72H 5JXAL 1KC5L 4J3OC 3BSZL 2FX9H 5ITFA 4PGEA 5L6YL 2J88L 1QOKA 2BY3A 2R23B 1Y6NR 5IFAL 3BD3A 3QEGH 3GMNA 5TGBB 3QPXL 2VDKH 4K2UH 3F58H 2DQHH 3ZDYE 1Q9KA 1EO5A 2IPKA 1G0YR 2DQDL 1S5HA 4GSDL 4PJAA 4GLRI 3D3VD 5HYEA 5B8CA 1LO4H 4R0LB 4OLUL 5DJXB 1A1MA 3C2AL 4NO2A 4BKLB 4JFHE 1JFQH 5DJ0B 5I1GL 2YXMA 1KJ2A 3SDDC 1KCRH 3C6LC 2GJ6A 3BJLA 4K9EH 1JMZA 1AP2A 4P46D 4M6AA 5JOFA 4ZSOB 2EDNA 4C56E 4ZUVA 2V7NB 1TITA 2FB4H 4J3VA 1QVOB 2OSLA 3RL1B 3GSOB 4PIRF 2XN9B 5MHSE 3P9LB 2Z31B 4W68A 3MBXL 1XCTB 2FJGB 4EIGB 3ARED 5CJ8A 1OSPH 2BOCA 1RFDL 1QA9A 1JPTL 4KVNL 4QRRD 5T1DL 4LCIH 2NNAA 3QHZL 1A7PL 3QQ4A 3ARFD 4KV5E 3U82B 1EJOL 4G8GE 5EBLB 4YHZL 1KB5A 4JZJA 1A47A 1I3GH 2CUMA 3QUMH 2Q76A 1E4KC 5E0QA 4L4TB 3RGVB 5IQ9B 4ZFOB 4ZO8A 4DKDC 3SKOA 3QDJE 1MVUA 4TVPH 1P6AB 3MCKA 2NX5A 5FUZL 1TVBB 4B53A 1N6UA 1SM3H 1R3KB 5HDLA 1CU4H 4BFBD 1JWUA 3DMMB 4OCXH 5KN5B 1YECL 2H3NA 4LRIA 2VL5B 4IIQA 2F53E 3BPNC 1C5BH 3HRZB 2ADFL 1BWMA 5F71A 2BCKB 1JPGB 4LP4A 3EYSL 4PJXA 1NMBH 2ARWA 2OZ4A 3O2DH 5F9JB 1QO3B 4R3SB 5D93C 5EU7C 2DMKA 1A9EB 5AWNH 4OZIF 5DRXB 5ISZA 1OAQL 2MCPL 4X99B 1MH5A 1TZIA 3P73B 4FQXB 4FTVE 4BQBA 2DM7A 4ZODA 1J1PH 12E8H 1CGTA 3MCG1 1YEKL 4WW2A 5D2NA 5C3LD 4OB5H 3OKDA 5F8RC 4D0DB 4CMHC 3IDXL 4PREA 5DD5L 1IT9L 4CVUA 3CUPA 1FC2D 1TETH 2D03L 2R1YB 3WHE1 4JO2H 2Z8VC 4NQDE 3SEPA 1U6AL 3K2UL 4Y5YA 1T7XA 4RGND 2J8UB 3R4DA 1D5XB 3WIIL 1L7IH 4HS3A 4LAQL 1JIBA 4LLAA 2ED7A 1Q94A 3W0WA 5I9QB 2COQA 2BHZA 3LDBC 5I76B 3IYLW 2GTWB 2ESVE 1XF5B 2E9IA 4S1DC 3DGCR 4NQSA 4HFWB 1AGCA 3FO2A 4PJ9B 3QIBC 2MNUA 4BJLA 5ACZB 1ZSDA 1M7DB 1XGPB 1OQXA 1I85A 2EEDA 1FJ1A 1G1CA 2Y7QB 3QG7H 1VENA 3T04D 1KEMH 5KSAC 5TH2B 1XGTA 2VAJA 2WWKO 1A9BB 4HS8H 3ZKND 2GJ6D 1ZTXL 1S7XB 3MRPA 3MRFB 4KHTL 4FFVD 4LLMA 2ITDB 1A6PA 4XNXH 4NRYA 3B5GA 3MX0A 3OXSA 4OF8A 5I8CB 3ARPA 1I9JL 2X4TB 5GSRA 5C70A 1A22B 3QUMA 3QQNA 4JR9H 3F7VB 4H1LB 1T80A 1YMHB 3T2NL 5I18L 3QJHB 3CJJA 2AS5M 3HE7B 2V5SA 3VGFA 5T3ZL 3T77A 4BZ1H 4CN6A 3LIZH 5CJOL 1ADQL 1DTUA 4RBPK 5DK2B 2FIRT 4PB9L 3X3FL 3IVKB 5E94A 3QPQC 4OI7A 3O2DA 5FYLH 5GGSB 2DBLH 5KOVC 4F7MB 3EO1A 3LEYH 3U7WH 3OKNA 4K94H 5F6IC 1EV2E 5DJYA 5E24E 1PEWA 3DPBA 5F88A 2F8XC 5DLMH 2NX5D 1B2WH 2D0FA 4HJGB 4ZPTA 4YXKL 1A64A 1QBBA 1P7QA 4X98B 3GSQB 5CEYB 2HWZL 1G7QA 3D1MC 4Y16A 4LCWB 5CP7B 4MA8L 4ALAH 2VE6B 2HVJB 4IRSA 5A1AA 4PRPE 1MY7A 4M9PA 3ZKSD 5L2KE 3JWOH 5FGBA 1EGJH 3OR7B 4BA8A 3W9DA 1RUQL 4WUKL 4QXGL 3VXRA 4HWEL 5ISZD 1M05A 3SHSA 3KHQA 1Q0XL 3MNWA 2BY1A 1BWWA 3MOQA 4RMWA 3DX8B 4WW1A 4OD3H 1J0HA 1MCWM 3Q6FB 4O9HL 4PTUB 3T3PF 3HLAA 2OL3H 3T65B 1CLYH 2O26U 4NQCB 2X5PA 2FBOJ 5ABDE 1HHKB 5IMMA 2JJUA 1QHOA 4HV8A 1ZLVK 5C09A 1DSFH 5L8JB 3QFDA 4ELMF 5IBTL 1VPOH 4E41A 3EDFA 4OJFL 1YNKH 2MSPA 4S1QH 3RDTA 1RIVL 5E2VH 2CDFB 2JJWA 4UQ3B 4R7DA 1KF9B 2P42B 5MENA 2A6JB 2H45A 1JYVA 3K81A 1ZT1A 2ICWJ 5E1HB 3W0WD 2LAAA 3H42L 5GGVL 5KANG 1SYSA 4X6FA 2XWJB 1MNUH 3V0AC 2B8OT 4KZEL 2V5RA 3FQXB 1CFSB 3R06A 3RWIA 2H6PB 3RL2A 5ICYB 5I73C 2VJXA 3G5YB 3V6OE 3AM8A 1J1XH 4GBXC 4KXZI 4HIEB 4DAGH 5E08H 4JRXE 1NGPH 3HI5L 3OKMA 2X7LA 1SEQL 1NFDF 1TJGL 3VFSB 3V4UL 4PR5B 1QYGL 3HUJA 5B38B 4R4NC 5IVNA 1MCJA 2VABA 4KC3B 3BGFB 4OFYA 5D6CB 2VTFA 4LEOB 3JWDH 5KVFL 4QHNA 4JQXA 2F8OA 5GRWA 5JW4R 4MA1C 4M7ZC 4P5MB 1OPGL 1U58B 1MEXL 2JKXA 4QTIH 2IADA 4FFYL 1MCHA 1ZLWH 2WMPA 1QFWM 3KPNB 5I15H 2Q20A 3NAAL 3U7YL 1CGYA 1S7TB 2EE2A 4KTEL 1YNLH 4PJIF 4NFBA 2OTWB 3ARTA 3P30H 4ZYKA 5E4EC 3SY0A 3LKQA 1EHLL 4I1NB 4OZIB 4DJMA 4I4WA 3HC0A 1FGNL 2PNDA 4MYWB 2HFEA 2ICES 3EFFA 1EGJA 4OCRL 4FNLH 1F4XL 1PYWA 3C6SA 2EE9A 3TBYB 2FJFA 3ULVF 5F7MC 4YBLC 5EUKA 1UB6A 4A6YL 1P7QD 2EXWD 1E6JL 3OKOA 3SDAC 4LARL 4AL8H 1RK0A 3HPLB 1TJIH 2ZSVB 4Y16D 2MHAB 4MD0B 2YUXA 4KY1L 4IRSD 4G6MH 5DVMA 4KGJA 1IGIL 5BZDB 5J3HD 4C4KO 1U41A 4G80B 1QFOA 3OKEB 3VXRD 2YSSB 1REIA 5EIIB 2FO1A 3MRHB 4LMQI 4L8SA 1BFVL 1OTUC 3V7MA 1KXQE 5C6TL 1RZFH 3BP6A 1A7RH 2VZVA 2FLBT 3D2UA 1ZE3C 4X4YA 1LO5B 3DO3A 1BQSA 3CZFA 1IAMA 4HW6A 4XCEB 3WCYA 3BZFA 5GIRB 3AB0C 4P4KC 4MNQB 4NKDB 4FFWD 1J1OH 2WUBH 5C09D 4AM0A 4FQHB 2R1XB 2GFBA 4TUOB 3TBWB 5A3ID 4E41D 4PRIA 4XPFL 3TBVB 4XMLH 1CI5A 2YK1H 2Y07H 3FB6B 3IETA 3RDTD 3T3PE 3MR9A 4G6JH 4PJHA 2UZIL 2AJVL 5SX4I 4Z5RB 5MEND 4GXUM 4XBGA 1MUJB 2H1PL 4AEIH 2IC2A 5TF1L 1YJDH 3STBA 4KKAC 4MAYB 5JIPA 1TFHA 3X13B 4ONGH 4X4ME 1P4IL 5BQ7A 2APFA 1F11B 5E9DB 2V9QA 5FYJL 1P84J 3RWCA 2E7HA 2GJZB 4ZPVA 3KPOA 1A1OA 3KDMB 1WBXA 3LS5H 4JVWA 4TNWK 3MROA 5IW6A 4QGTA 5JXEC 2B5IC 5JIKA 4OFYD 2XACC 4HKZB 2IBGA 2XTLA 4ZFFB 2O93L 1NCAH 1WEJH 5FYLD 5IIEB 5FKAB 3MLVL 3L1OL 1DDHB 4NJAL 3KNBA 1HZHH 1QFHA 2VITA 3NFPB 3MACH 4XHJD 3T0DA 4ZFOL 1IM9B 5C92A 4P23C 3PIQB 5F1IA 5IGXH 3EYQC 3RVXD 3W11C 4TQEL 3C6LA 5DT1H 1MWAH 3MFGB 4P9ML 3VGDA 1DFBL 3QXDA 4EN3C 2D0GA 2RQ8A 4XT1C 3HR5B 1FBIH 3BEVB 4S0TD 3QQ3A 1EZVX 1NMAL 3OX8B 2OTPA 4NHCL 4XRCA 3OPZL 3RAJH 5FXCH 3OHXB 3SBWC 5HHOA 1OM3L 4H20H 3BZEB 2AK1L 2M8XA 4ZD3H 1BGXL 2AJSL 1AHWB 2DQIH 3CH1B 4NNPH 4OTXH 3ZYZA 2W0FB 4CVZB 3EOBB 2VXUL 4PRAA 4YHML 1T1XB 1BIHA 3PP3H 4ELMB 3VRLF 2CK2A 3ULVE 5ILTL 4UV4L 4FRWA 5C0FB 3PWNA 1ZXQA 4XVJH 1E4KA 5KVDH 2QQLH 1T4KA 1T1WB 2YPLB 3FOMA 4YFLF 2HFGL 1DN2A 3BKMH 1H5BA 3D2UD 2CR6A 2DQFB 5EZJB 4J7RA 3MCLH 3VXME 1NANH 1K5NB 4UIMA 3O9WA 3EW3B 5JUEH 3FB7A 1FDLH 2Q3AA 3ULUH 1HSAA 5I17B 5EO9A 5ELIA 1NFDB 4EOWL 1M71B 4PRID 1CXEA 3U9PH 3B3IA 4LLYB 2ZKHH 5MEOB 3QIUC 1CFQA 2PW1B 1MI5A 1BM3H 1P69B 4OD2B 4P0DA 4Z9KB 1INDL 1ZWIA 3TJHC 2DYPB 3W2DH 5I6XB 3HA0A 2Y06H 1GOFA 2FH6A 1C12A 5EA0L 4UQ2A 4YDIL 1MFEH 3FO0L 4U1KB 4H0GA 1N4XL 1GHFH 3S88L 2BK8A 4PJIB 4DN3H 1HHHB 5A16A 3C5JB 3AU1A 2UVFA 4YC2C 2ARJQ 1QBLL 1OP3K 1T22B 2VWEE 1MWAA 4GLRH 1NFIA 3MRLB 1PZ5B 4M5ZH 4M7LL 3MO1A 4PGCA 2X05A 3MUY1 3OKLA 3B8YA 1KGCD 1BLNB 4CGTA 1OVZA 4HWUA 4OFDA 2IMNA 4OUUA 2JELH 2VC2H 3QIBA 5ICXB 1MHHA 4PBWD 3V52L 5EBMB 5IJVB 3QZWA 1A4JA 5H94A 3EOTL 4JHAL 5HGHA 1G9ML 5BS0A 2CO6B 2DLFL 3C6LD 2B39A 1XGQA 5C0BB 5F1NB 3UBXG 5IK3B 4O4YL 1IAOB 1T7VA 3QUKB 2QQKL 1KCVH 1PKQB 3TNMB 1CTOA 2B4CL 3OF6A 3LD8B 3WD5H 1T1YB 4PJDA 2OXGA 2FHBA 5E99L 1QRNA 5SWQB 1U93A 3BT2L 1IGFH 5SWSB 1HIML 3LVEA 1A6ZB 3QUZC 1J0YA 4JPKL 2FYYB 3O6KH 4JANB 5HHOD 1HH6A 1XAUA 3MSPA 2IPUK 4OD1H 3GSWB 4WO4B 4Y2DC 3C5ZB 4X83A 3JUZA 1E28A 1NCDH 1AI1L 1UCBL 2FEEI 3WFZA 1KENL 2FGWH 4MDIA 1EAJA 3RY6C 4JJHA 2JB6A 1WWAX 4L3EA 1KJVB 5EU4A 3WS3A 4PJGA 1RPQA 1RIHL 1L7TL 2R0ZL 1WC7B 2I07B 4XZUB 3OAUL 4IMLB 3DRQB 3MV9B 4JDZB 3TESA 4LLUA 1X5LA 2I24N 4O2EB 2AVGA 2CXKA 3D85A 3PGCA 4QXUH 1QSFA 1ROWA 3FT4B 2OP4L 2E27L 3O9WD 2C3VB 1SJEB 3MRJB 1ZVYA 4NO3B 2YUVA 5I1AB 3BI9X 5F9WC 4JM2C 3WL9A 4DKFL 4LSSH 5FO8A 5FB8B 1QFWL 2HAZA 3ARDC 1MI5D 1Z9OA 2APXA 4Z7UE 1P4BL 5HYJE 3S36X 4UTBH 3TWCH 1ZEAL 4J4PA 1A4KB 3DVNA 3JZ7A 3C60C 4LCUB 5FO9A 3V79C 2ZP0T 2F54A 3FB5B 4YX2L 1GC1L 3HC4H 4IOFC 1YN6A 1MIML 1FVEB 5SX5H 1JN6A 4U1JA 4M7KL 4CADA 5KTEH 3VXTB 5ADPL 5DUPH 1PVHA 3IJYA 4K07A 2C26A 5AG8A 2BNRE 3RU8L 3I6LE 1MAJA 5T1MB 4POYA 1MCPL 3QAZC 1JNJA 3H3KA 3PABA 4PJAF 5IEKB 3IDYB 1SHMA 1V3KA 5IHUH 3KVQA 4X0KB 4S1DD 2DD8H 3KXFE 3T2OA 1I1FB 3QIBD 1O7VA 3CFIC 4GBXA 4P5TA 1U3JA 3TYGH 5F3BB 5IOPB 1ND0A 1F3JA 3IFPB 1JGUL 4AY0A 1J8HE 3CDYA 1IRAY 2A6IB 2QR0A 5BS0D 1JPSL 2B20A 4XNMB 3FN3A 4HEME 3O6LL 2NY3C 3S35X 4QHKJ 1E4XL 2O5ZL 4IRJB 4I2XB 4L4VB 5HD8C 3B9VA 1XF2A 4NHUA 2BRRH 3OF6D 4Z0BH 3P4OA 1D6EA 3IDGA 1QRND 1TTUA 4CN4A 4ZFGL 4I9WE 2JJVA 3KPLA 2A0LC 4N68A 5M94B 3A0OA 4HIIB 3QEQA 1S9YB 3BZ4A 3BE1H 5DVKA 4ZUUB 4J8RB 3GMPA 3OJVC 3T2QA 4PJEA 5HHQB 2BNUA 2D7TH 4ETQB 2VDPL 5T3ZE 3LMJH 3MGTA 4GAJH 5FCSH 2ZUQC 2X9WA 1R0AH 4TSCL 3KLAB 1VSCA 4ODVH 3QPQD 3GM8A 2EDHA 5FOJA 3T3ME 4L3ED 3TO2B 1YY9D 4OBRA 5F1KC 4P2QA 5CWSA 5JPNB 3KPQA 3BDYL 4G9DA 3B2VH 5I8KL 1LK3H 3EZJB 2XQYG 4PV8B 3T0WA 1CG9B 4Y5VB 3PL6C 3D85D 2H9GB 4PY8J 1QSFD 3SDAA 4JFDB 1G7IB 2V5YA 2OR7A 5SV3A 1NAMB 1MCKA 3MLYL 1S3KH 4F57H 2WP3T 4PJXF 3HCVA 3DXAA 3DHJA 15C8L 2O61B 1AC0A 3B6SB 5EB9A 5C0IB 2V2TB 1AY1H 2CLZB 1U8JB 2IQAB 1CGSH 4NKMB 2ITCB 4KRPC 4ODXA 3PDOA 3IXAB 3P4MA 1LO3L 3D3VB 3VA2C 2XTJC 1ZHBB 2F9BT 4J4PD 2QL1A 4PGDA 3UC0H 3ZYOA 4CDHA 1DVFC 2F54D 3G6DL 2ZNWA 1MCFA 2G5BB 2VXVL 3PWPE 3IB4A 1DBAH 2W0PA 2R0WH 3BO8B 4R4FL 2R9HC 3KS0H 3D87B 5GISH 3STZA 1JRHL 4P46B 2UZYB 4LNRB 3NIGF 1V7NH 1KPRA 5MEPB 5DJ6B 2MQ0A 4KRMB 2XFXA 5HY9B 4WHDA 4NZRH 4YHPA 5C2BH 4FOMA 2V2WB 3E8UL 3N06B 4KXZH 3E6HB 5J1AA 5ESVB 1YPZE 2CKBL 3AREB 3FQTA 4GBXD 4P5TD 3H7LA 4QRRB 4WU5B 1NC2A 3PWVB 3RIAF 2ZG3A 5HHPB 3ARFB 1JUFB 1UGNA 4TNVF 5E8EB 1T7YA 4M1CC 4DFIA 1C5CL 4ONOA 4OCLC 3CFDA 5FEBA 3WIHA 5DD3L 2AK4E 5FA4B 5IFJA 3UX9B 2R15A 2QSVA 5DK0B 1ZLSH 2EZ0C 2CDGA 2Q87A 2Y25A 3QEQD 3AY4C 4CMMB 2NY7L 2HKFH 1X5IA 4GG8A 5KVGL 2FIKB 2HVKA 3BPCA 3FQUA 1CFNB 3R8BB 3IXTA 5BV7B 3GIVA 2AXJA 4JAMA 2AABL 5E00A 4JRWA 3GMRA 2YWYA 2H41A 1XGUB 1T03H 3LKPB 4MA7H 2V2XA 5EWIH 4LVOC 1H15B 1G84A 5D1XC 2GSGB 4U1NA 3SE8L 1OLLA 3U4EB 2ZSWB 5C08B 3IAQA 3WKNA 4XWOD 4XNUH 4U3CA 4G8IB 1D5BA 2R39A 1QFPA 3SDAD 3BKJH 4JFZH 1S9WB 1DP0A 8FABB 5J1TC 3QHTC 5F9OL 4MQXC 1J0ZA 5EBWB 5CBAB 4NRXA 4RMRA 1CDUA 3DXAD 3DUSA 5ITFB 2GHWB 4PGEB 3B9KC 2NX5E 3OZ9L 1JK8A 1W2KT 3GMNB 4RGNB 1QLRA 4OCYL 1ZHNA 2NY6D 3ZTNL 1Q9KB 1T0MA 5DJZA 2IPKB 3PNWA 4GKZA 4JKPH 5FYKU 1S5HB 4PJAB 3RUGA 4PJXE 2DL2A 5GJTL 3MLPA 3RA7H 4Q9BA 5B8CB 1N6QL 5JIIA 1CBVH 4HLZH 3WMSA 2HJKB 1A1MB 1I8IA 4YK4B 5F1OB 4NO2B 5ISZE 4HEPG 1KCSL 4MXVF 3HE6C 2HH0L 3SQOH 4D0BA 1JWMA 3IS1X 3WUZA 2I25N 2GJ6B 5SX4H 1AP2B 3QIUA 4ZUVB 1A3LL 2BHUA 5D72H 3P9MA 1Z3GH 3GB7A 2CO7B 1LVEA 2P8MA 4KKAD 4RRPG 2BFVL 1BMGA 4OSUH 3BKYH 1SBSL 4RCAA 4DGVH 5IR1B 4M6MH 4A2LA 1R5IA 2XZQH 2BOCB 3DX6A 1JI2A 3MLRH 5FYJE 4EI5C 5EIVA 4FQCL 4GJTB 1FNGA 1NC2D 2NNAB 4ORZC 4Y1AA 3TGXA 2QSCL 4EKXA 4HUNB 2AP2A 2G5RA 3DO7A 32C2A 5IVXA 1KB5B 3HUJF 3U30C 4PJ7E 1I1RA 4H5SA 5HGDA 5L7XH 1AR1D 2EO9A 2Q76B 5DFWH 1NQBA 1TVDA 4NRZA 3SKOB 1FO0H 4QYOB 3ROLB 1MVUB 5F3HA 4ODTH 4X6DE 2Z92A 3MCKB 6FABL 1K8DA 1JWUB 3WO4C 2H3NB 3MOBH 2VLKA 4IIQB 4P59H 5K59F 4G6KH 4GOSA 1SJHA 2AEPH 2HFTA 1A2YB 4JHZA 3UPRA 1YN7A 4KKLC 3W11D 3NCYS 1GGIL 3SGEH 3PQYA 1VACA 4GQ9L 4LQFL 4U1HA 1F45A 1OAKH 1MH5B 1TZIB 5I66A 2F5BH 1C5DB 2O5YH 2D7MA 3QUZA 5DUMH 5FHBH 2F5AH 1AFVH 2E6QA 3FRUA 2VLJE 4OZFH 5I8OH 4WW2B 3QFJA 1KBGL 3QULB 4JG1H 5D2NB 2KQNA 4BQ9A 5CKAA 3OKDB 3QRGH 2BVOA 2UUDK 4PREB 1N7ML 3GIZH 5DRNA 3U83A 3CUPB 1F4WH 1UM4H 4Y5YB 4AQOA 4UNTA 1JF1A 4NZTH 5D2LA 1EO8H 4HS3B 3WJLC 2G60L 5EOTA 1JHLL 1Q94B 3W0WB 2EDLA 4K7FA 2P24A 2HLAA 1A3QA 5GGSY 3N0PB 2B2XL 4QOKE 1AGCB 3FO2B 4HIJA 4WI9A 3SGKC 4QRTA 1ZSDB 1H9VA 5F96H 1FJ1B 1JL8A 1NMCB 1OAZH 5DD0L 3VWJB 3LQAC 5HDQL 1IEAB 3EO9L 1QTYT 1XF1A 1MRDL 3MRPB 4U05A 4XPBL 1UJTA 2AJXH 1T04A 3QIUD 4X5XA 4PJHF 4NRYB 1INEL 3ARDA 3OXSB 4UT6H 1MFNA 3NABL 1F5WA 2MQCA 3T1WA 3QXVA 5I19H 5GSRB 2AKRA 5BRZA 1FGVH 3QUMB 4RGOL 5I75C 3U1SH 1FO0A 1II4E 5D5MA 1MLBA 1X6NA 5DQJA 2DMCA 1UACH 3T77B 3T0EE 2OXHA 4Y1AD 5FUOH 4Z8FH 4NO5A 3JV5A 1GXEA 5HI4C 3BPOC 4HWNA 5E94B 3ZHLA 2X9YA 5J89A 4BH7A 1W72H 5GZOC 2IALA 3OKNB 5EZOL 5CEZH 4JHWH 3U9UB 4H26A 5F88B 2HKHH 2XY1A 2CLVB 3NOIA 1FCCA 3SE3A 1K4DA 3RP1A 1G7QB 2VLKD 5D71L 2RIKA 1IMHC 3ARSA 4Y16B 4OZFA 4IRSB 2D2OA 4JRYA 2GJJA 3H9SE 3UTPD 4U4BA 3PV6A 4X5WA 4JFXB 3BMVA 1IZJA 3PQYD 2A38A 5I1KH 3VXRB 1K6QL 1NAML 1M05B 1FCGA 4WENB 3MNWB 1OF2A 5HVHC 1JHKL 1N8ZA 4PD4J 5K59E 3DOSA 2BSED 4MGXA 4PLOB 4WW1B 5C0ND 2VYRE 4NPYA 2FR4A 4EIZC 3QUZD 3KJ4C 2AV1A 5E2TL 4U6VL 3HLAB 4X9BA 3QFJD 4RGMC 1GZQA 3RX7A 4N0CC 2EDFA 5IMMB 4HV8B 5C09B 3QFDB 5DR5L 4FP8H 4E41B 5GS1A 4OV5A 4PJ5A 1LO2L 4P4RB 1XGYH 3VI4F 1RZ7L 4OF0A 2DIBA 4R7DB 4CW1A 2B1AH 4XVSL 1RZIA 5D6DC 1ZT1B 1QR1B 4EUPH 4G5ZL 1SYSB 1FG2A 2V9TA 3HAEA 3PL6A 5I1JH 3R06B 3X3GH 2EECA 4U0RB 3RL2B 4LPWA 4ODWA 4FZ8L 2VXQH 4KJWC 5I1EL 1IE5A 4AG4H 3WV0A 4LGSB 3TZVA 4NUGH 2NR6C 2AEWA 3GO1H 4UIKL 1LK2A 2X7LB 3AS3A 1JTTA 3N1GC 5K9OA 4N5ED 3K8MA 1FFOA 4FQLH 4L1HA 3HUJB 1PBYA 2D7NA 3DARA 4KUZH 2GITA 3V7AE 5IJKC 3DVIA 1NBZA 1QSVA 3ARDD 2VABB 1G9NL 4NKOB 3PGFH 4CVWA 3OSKA 3SN6N 4QHNB 1QBMH 3NPSC 5D7SH 4OZGA 5BRZD 4ZXBA 2GAZA 2IADB 3E2HC 1BD2B 3MBEB 1PZUB 3C60D 1OGAE 4PJBA 4PJHE 4NN5C 4L9LC 3QYCA 5HGBA 4ODUA 2I27N 4PJCF 5DHYA 3RKDC 5GQBA 1T1ZA 3KR3L 1BIIA 5ALBH 4H88L 5D7JC 4Y5XC 2N4IA 4HC1L 4OBSA 4D0CA 4ZYKB 5FDWA 3SY0B 3MJ7B 3LKQB 5FK9A 4MSWB 1U8OA 3HC0B 4DGYH 5BV7L 2HFEB 3DV4B 3EFFB 5CUSH 1JPST 3C6SB 1PYWB 1DZBA 4LOUD 1TNNA 3OKOB 1MJ7L 2CK0H 1RK0B 3FQWA 2OL3B 1H8SA 2IG2H 1IC7L 3CX5K 3MTRA 2BY2A 4JRYD 3BUTA 1CDJA 4P2RA 2HA1A 2J6EH 1R6VA 4HBCL 5EO1A 3SE4A 1MJUH 2A6KA 4HXAH 4Z95L 1N59A 5CKGA 3WXWL 4PJDF 3VGAC 2ICEB 3MLXL 2DF3A 4LRNL 2A0LD 1RHFA 3BP6B 4JPWL 3AY4A 4NWUH 3D2UB 5BXFA 35C8L 5FHAL 5MP6H 4XAWH 4X4YB 2A2QT 2UWEF 3CZFB 3BZFB 3LRGA 1LDPL 2AERT 1Z5LB 5FCUL 1ZLVH 2IQ9L 3I3EA 2GFBB 4NM8H 4PJ5D 4PRIB 1PG7W 2O5XH 5DJAA 1FP5A 2R0LL 3LCYA 3IETB 5CP7A 5CMAA 3MR9B 3K7UA 4S1SH 5D1XA 1J0KA 4XBGB 3MREA 4PJGF 2D4DA 3I3DA 1FPTL 1NCCH 4JFFE 2YKLL 1KCUL 2YMXH 4UT9H 1IGCH 4XX1G 5DGQA 4RWYL 4KROC 1KXTB 3PL6D 4F37F 5BQ7B 2IPTL 3KYAA 1JP5A 2EDRA 3VI4E 3QUXA 5LXGH 5EPMA 3TZVD 1GPOH 3S34H 3OB0H 3L5WA 4UZGA 4OIBA 4R9HA 1A1OB 1WBXB 4O5LL 3MROB 1D9KB 5IW6B 2XNAA 5CIPH 2K9UA 4MX7A 3PWUA 3NACL 1YQVL 4KRPD 4JQVA 3A6BH 3BJ91 3KHOA 3NFSH 5AZ2H 3ULSB 4WTZA 3RWJB 2V17L 1KB5L 1KN4H 1ZV5A 2HT4C 5CEZD 1YYMH 4ZXBD 3O2WH 3KNBB 1TQBB 2VITB 5EU7E 4QRPB 3WIFA 2VDNL 7FABH 4P48A 1EEYA 4KQ4H 3L3KB 3HE6A 1EDQA 2EEAA 3ZTJH 4XI5D 1XCQA 2YD6A 5F1IB 4DVRH 2ZPKL 2Z93A 1FHGA 4OT1H 2BXZA 3RZCC 2VKWA 5DHXB 1IKFL 4AMKL 3Q0HA 2CUIA 4RFNC 1DBKL 2J6EA 3Q5OA 3HZVA 2OZ4L 4K3JL 3BUYA 3J7HA 3QQ3B 1UA6H 4CUCA 4XP9H 4MVBC 3ZKMC 2A73A 5DEGA 4PJCE 2VDOL 3HG1E 4Y0GA 5HSFA 1KT2A 1AGEB 1Q72L 4WFFE 2XPGA 2FX9L 5HHOB 2VR9A 3MLWH 5DZLA 4YBHA 3QEGL 5FYKE 2XY2A 3CDGA 3QISA 2VDKL 2Y72A 5FDYA 4K2UL 4PRAB 5LG1A 3F58L 2DQHL 5BZWA 1IBGH 4XBEH 4P99A 4P2RD 2DI7A 3MRBB 4NN6C 3F7QA 5IMLA 3O8XA 3PWNB 1I8LA 1LO4L 1A6TB 1K4CA 1T4KB 3FOMB 4LCCA 4C57C 5EO0A 5IW3A 1JFQL 4GG6B 1H5BB 3MV7E 1F13A 1KCRL 5J11C 5DXWA 4UIMB 4PJEF 5EOCH 5T33H 4K9EL 2AEQH 3O9WB 1ACZA 4E0RA 1GGUA 4OAWA 1FZJA 3FB7B 4P49A 1HSAB 2Z35A 1QRNE 4MDJA 1CICA 4L9DA 1TZHA 4WI3A 5D93B 3TC9A 2KZ1B 3B3IB 3ZDZF 1MCWW 3O4OC 5IBLD 1CFQB 5D1XD 2UWEE 2AW2A 4TRPH 1MI5B 1I9IH 5C0CA 2JJTA 5CIPA 5L0QB 4OCNC 3KGRA 1OSPL 2AQ3A 2P45B 3F7PC 4LCIL 5GRVK 1OAUH 1BPVA 1MLCB 3FFCA 4JO3H 4UQ2B 1HILA 3QUXD 3TCLA 1A6VH 1RVFH 3B9DA 1T89C 3VE0B 2VLME 4MQXD 5DWUH 2BNQE 2EH7H 1I3GL 4PJGE 4GRMA 3QUML