5DI8B

Fc knob-hole heterodimer t366w + t366s/l368a/y407v
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLSCAVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLVSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5di8B01
2VAAB 1D5XA 4U1MB 5CJOH 4JFZL 2NXZD 2VN4A 2VXTL 1K5NA 4HAFA 5CZVH 3UTOA 2H1PL 2ATPA 1FNSL 1EO5A 1IAOA 1KTLB 2C7UB 3IF1A 5HI3C 25C8H 1U8QB 4NRYA 3G9AB 3UJTL 5EU4A 1PZ5B 2DIAA 4LLYA 3VG9C 2R0WH 3I3DA 3EBAA 1R3HB 5BQ7B 1MREH 4I3SL 9CGTA 3WHXA 4PB0H 1MRCH 3UTZA 5D1QD 5D7LE 5TPWL 3LH2H 3RX8A 4AG4H 1JFQL 1OTUC 2IH1B 5DI8A 3C9NA 1N2RA 5DSCB 3T3ME 1MWAA 4LMQI 1M7DA 4G6JH 5IW1B 2W9LA 4GRMB 4ZOCA 2YN5A 2A1WL 1U8OB 1ORSA 1I75A 1JRHL 3WIIL 1YNLH 3HZVA 1UA6L 1RUML 2K1MA 5HHNB 4NQCA 3UDWC 3FB8A 2QQLL 1P7KB 1U8JB 1KLFA 2FIKB 1ZA3A 4FXLA 4HX1B 5C09A 2PR4H 3I50H 5TE6H 3OKOA 3F62A 4HLJA 4QY8A 2ZUUA 1ODAA 5FM5O 2AP2A 3PL6A 3OMZA 3RNQB 2WWKO 5DD6A 5I1KH 4JPIB 2B2XL 4XPHH 2EIEA 3LKOA 5DEFA 3QG6B 3U82B 3D2UA 1QG3A 4MVBD 1SQ2N 1SYSA 5T1MB 1K2DB 3FN3A 3GIZH 2VLKD 5FUOH 1NUDA 1KXQE 4NQDB 1ITBB 4HK0B 4LRIC 3LIZL 5CUSH 5E1HB 1Q8MA 4HS8L 2IGFL 1L9MA 3GSNB 3TT1H 5BVPL 4NNXB 2NY0B 5KVMC 1XFPA 1HXYA 4X4XB 4ELMB 3RVTC 2OSLB 1FAIL 4G42B 3MCLL 4Y4FD 1LGVA 4ZAKB 4X6FA 1AO7E 3IFPB 3RKPA 3ARGC 3HI1B 4RCAA 4TYUA 3T8XA 4BH8B 2GJZA 4D2NA 5HHOB 4CADA 1MJUH 1XIWD 1BQHB 1I8LA 3H8NA 4LEOB 3HR5B 1WTLA 4DVBB 4N0FA 3O9WD 4Y4KD 3ZYZA 5D7LB 1AHWA 4QHUA 2R2BB 5E70A 3QNYB 3S34H 5E24E 3M8OH 1S7TB 4JHAH 3D48R 4MD4B 5DWUL 1OGAD 4AM0A 2YMXL 3PWNA 4KU1A 4YNYA 3BP5A 3GZKA 1MVFA 1LHZA 2NNAA 1XGRA 4JY4B 5DJ6A 3CLEL 3LQZA 2PYEA 3C6SB 4WV1C 2BC4A 4J1UA 2O61B 3W39B 1CDGA 3MGTB 4X6EB 1PG7X 4G6FD 4RGMC 3OGCB 3OHXB 2HFGH 3ME0A 5AYQA 2AAVA 3TV3L 5C0AB 2CLRA 5EU3A 5JIPA 1S7XA 3AU1B 3MV7B 4FXGB 3B43A 3TJHD 5DVKA 3O6KH 1GOGA 3CH1B 5CJBA 4M7ZC 1A2YA 1MJ7H 5DQDL 3VH8B 4U1LB 2Q8BH 1MNUH 3HNTL 4R7DA 3N85H 1KXVC 3ZDZF 5C86A 2B5IC 3WDJA 1B2WH 4EDWH 5HPMA 4FTVD 3CSBA 4Z77B 3QWRA 3FJTA 4LL9A 1H3GA 5EIIA 1DDHA 1CG9B 1MHPH 2ZG3A 3DXAA 3OTTA 3RP1A 5LGJB 5CILL 1DUYA 2JTDA 4FHBD 5L88H 1G7PB 3WNPA 1HYSC 1K4CB 5IMOA 1NBZA 3RZCD 5C0CE 4YDLC 4GUPA 4IRJA 4IS6B 4JZOA 5BV7B 2J5LB 3RGVA 2ZCKH 3EGSB 3ES6A 3QIBD 4U6YA 1KG0B 2F58L 3EDEA 3CDGB 3EYUL 4KKAC 3HI6L 5IIEB 3KYMB 1CGSL 4OCMC 3W11C 3KXFD 2Q1EA 2A6IA 3QAZC 1YEJH 3KPNA 3BDXA 1P1ZA 3AMLA 3SCMA 4NPYB 5KSVB 3ELAT 3EOYG 4ODHL 2EKJA 3DO7B 4ZD3H 1BFOA 1DQML 3RA7L 3X12B 4L8CA 4LLMA 3QFDA 4F7MB 2P7TB 4GG6F 4XPTL 4GXVL 4M48H 2FBJL 5IBUG 1KENH 1OAYH 1B90A 2ZUTA 1PYWB 1T83C 1RD6A 3MXVH 4QOKD 2PO6A 2YUVA 2OLDA 1HH9B 4JREB 4G6ML 4P4KD 4R6UA 4Y2DA 4TSBH 2GFBB 4P2RE 1BWMA 3WSQL 1DCLA 3UTSD 3QULA 4QNPF 5TF0A 35C8L 5JR1H 1PG7H 2AJSL 1JGEB 1OTTD 5F7NC 4OLEA 4PJIF 4ORGB 1JN6A 4RX4D 1HE7A 3QCUH 3VFPB 4YR6B 1WZKA 2VABA 3MLVH 1HH6A 4UI2A 4FS0A 3IFOA 3LS5H 3MLUH 3PP3K 3ZL4H 2GQHA 3H3PL 1NQBA 5C0JB 2YD5A 3P0VL 4U1IA 2W0FB 3X17A 4ZUVB 1GPOH 3IETB 3I6GA 5HHME 1R3LB 3PWPE 4WUUE 4GW5A 1EGJH 2VLRA 3WFEH 3P9WB 2GAZB 3FAXA 2OL3B 4OCSH 1BFTA 1OAKL 3EYVB 3LHPH 3L3OB 4Z95H 4MD5B 5C0CB 1U6AH 5E6ZA 4M5YL 5C0DA 3UAJC 3SY0A 4MMZC 4LASL 4IIQC 4U1KB 1I9EA 5D72H 3H9SE 4RA0C 3P30L 4JFED 3ZLQC 5CWSA 3EJJX 3CFEA 4PJCF 3SGKA 5E08L 1HINH 5KZCD 3IAPA 4YX2L 2AEPL 4PRHD 4P5TC 4WO4B 3H6JA 5H2BB 3TWCH 2VE6A 3WFDH 4WW2B 5C0BB 2P8LA 3SE4A 1MCKA 3F12A 5LQBL 2JB5H 1TJGL 5FO7A 1U58A 4BUHA 4F58H 2R2CA 3MLYH 1ADQH 5D1ZC 4P5KB 1D6VL 1Q9OB 4YDJA 5DURD 4JGMA 3HAEH 1YEIH 4XWOD 4HV8A 3EFFB 3KPRE 3RWCB 3SDAD 3SGEI 2HTLC 1KNOB 4L4VD 1NPUA 4P2RB 1KN2H 3QXUA 3CVIL 4HBCL 1AGCA 1NC2D 1N5AA 1GIGH 1W0YT 4OZFB 4TVSa 4LCYA 1OP9A 5DJCB 4X83A 1TJHL 3MRGB 3GO1L 1I9RL 1XGPB 2EXYD 2E5EA 4RNRB 3DNKA 3HZMB 1YECL 2YPLB 4ODXA 3QFJE 1VFMA 1F3RB 1VESA 1VHPA 3K4AA 4X7EC 1JWUA 4OIIL 1R5IB 2EKSA 2BDNL 4YFLF 3SKUD 1NAKL 3CXDH 5DZNA 4MX7A 3TA3D 2AABL 1TPXC 1S5HA 2ARJA 2QTEA 3P4LA 2UZIH 4HXAH 1IFHH 3MRFA 4YUEH 4BFIA 1J8HE 1LP9F 2EIBA 3WHE1 5IW6B 5JW3L 4NKIH 3UTTA 3P40A 5F89A 2E6QA 1PX3A 5HHMB 1A7PH 4WUUB 1NAML 5TDNA 4D0BB 1DLHB 5F70A 3RIFK 1XR9B 3TCLB 1OWWA 5F6IB 2FX9L 1BJ8A 2A0LD 3HPJA 3T4AB 3D9AH 2HT3D 4QTHA 1HI6B 4OZHF 5ACZB 1D9KD 1G6VK 2EEBA 3PWUB 4G8FA 3JV0A 2G2RB 1V3KA 2VL5A 4JDVA 2R39A 2B0SH 1HHHA 3SDYL 1CGXA 2ZG1A 3H9SB 3HPLB 4N8CL 3QO1B 4M4PA 3SE8H 2ZSVB 5HGDB 1F4AA 1SYVB 2JJWA 3WNLA 5JW5A 4FOMA 2OS7A 2DYPA 3QWOA 3SJVB 4HKZB 2AJVL 5F7MC 1IKNA 2IFGA 3ZDYE 3UCRA 5GQBA 2FEEL 4ZAKC 1ZTXH 1YC8A 5E2WL 5IF0B 4NUGL 1RUKL 1BVZA 1S9XA 1UVQB 2APVA 2DWEB 3KPRB 3DMMD 5LBSL 1INEL 3OKKA 4GSDL 1KIQA 4GOSA 4QRQB 1FO0H 5DD1H 1LEIB 2VXQL 5CHNB 4M6NL 3CK0L 3N1MC 1XF3A 2XFXA 1YEEH 3HNSH 4JQVC 3NCCB 5F7KC 2R2HA 4UDUB 5ESVA 1CBVH 3DVNB 4WHTB 5JOPD 4N0CC 3KPSB 4WENB 3RZWA 5FB8B 2BSSB 1Q9KB 1KUMA 2W0LA 2X89D 1ZLSH 4Q97A 3QFJB 4JZJA 1AXSA 5D7SL 1NANH 3G9VA 4G5ZL 3U1SH 4LCCA 1M1SA 4MJID 4FQLL 4H88L 4OAWB 4ONFH 1TDQA 4BZ2L 3CSPA 4MZ3A 4K7PX 2QJDA 3CMOH 1JGUL 4JRYE 4TSCL 3SKNB 4HF5L 5FHBH 1WCBB 2KZWA 1VACB 3RDTA 2R4RH 1MEXH 2ZUQB 5D2NB 3Q0HA 4G8IB 2EICA 4MJ5B 1RY7B 1JZ5A 4TQEH 5IG7B 5EZLA 4KROB 4LVEA 4S10A 3C8KA 3B8SA 1T22B 4P57B 1NMBH 1C7SA 2YSSA 4PJ8B 4EVNB 1TQBB 1LDPH 1FL3A 1FZJA 4G7YL 5I15L 3T2NL 3LOWA 5JNYB 12E8L 4ETQA 4HFWA 2WAHA 3VXTA 3IU3A 4D3CL 43CAA 1N6QL 1J11A 4PG2A 1IM3A 3FO1A 5HGGS 4OKDA 5ITBH 1ZLWK 2ATKA 1W8OA 2I60L 4N9GB 1K85A 3ARPA 4ONOA 5GRZA 3BSZL 5FUZL 1WWWX 2W9EH 3DVFA 5ANMB 1FSKC 2KPNA 4HCRH 4JFQA 2VLKA 1IAIH 1Z5LB 4HZLA 4GAGH 3ILQC 5C3TA 4F57L 4XMPL 2IFFH 4BELD 1KEML 3EO1B 5FK9B 1F42A 3WE6B 2YBRA 5DRNB 1C1EL 4X4YA 5I19L 1FZKA 2VXUL 3MRRA 1L9NA 1E4WL 5F21B 4CNIB 1WITA 3S98A 3WIHA 1YYLL 2O5XH 2R1WA 2ZSWB 2D03L 2ADGA 1UB5B 3KPTA 4HC1A 1WFOA 4H5SB 5E03A 5F6HI 3G6AB 3ARDB 2CLZB 3AREB 5I73C 1JK8A 5T3ZL 5LGHL 1UH2A 3U48A 3P11H 4K9EL 1QSFD 2IH3B 3MNWB 2PW2B 4GXUN 4U6XB 1XIWA 3MLSH 1QR1B 1R5VA 4JRYB 2Z9TA 4R4BA 1CFTA 2AV7B 3O9WA 1OSPH 4Y4KA 3O6FC 3CDFA 4OCLC 2P4AB 4OZ4B 4QWWD 1E4XI 4HHAA 1QLEH 1JHTA 5KAQF 5BOPA 3IFNL 4B7IA 4QRRE 1YQ2A 1H5BC 4EI5C 2D31A 4DUXA 1EO8H 1OGAA 2EDJA 2VDML 4HAGA 2J12B 4JFYB 4XMLL 4YHMH 3ECBB 1RIVH 2OP4L 3VFGH 1VADA 3RNKB 5A2FA 2QR0B 3L3IB 3NTCH 3Q1SL 4IHOB 5IVNA 2YRZA 3B2UD 1UJ3A 3TJEL 2BXYA 4PJHA 3LKNA 1NUFA 1FNGA 2V5RA 5GGQL 3KJ6L 3VGAC 2DLFH 3RWIB 1CS6A 2EZ0C 4LSQH 2Z8WC 1LNUA 1MUJA 1U8MA 2RJMA 1G7MB 3O2WL 3K2UL 5F3BA 2CD0A 5KVFH 2Y36L 4I13B 4O51B 1WBYA 5K9QI 4UIKH 1CICD 3QUKA 3BW9B 3IYLW 3QHFH 3WL9B 4XNYL 4K71C 4HUUA 4TPRL 1HNGA 3T0DA 2ITDB 4Y5XC 2F8VA 5LWYH 3G5ZB 1ED3A 2GEEA 4G8EB 5L2KE 1UB6A 3HZYA 2KZ1B 2YD8A 3GSVB 1EEYB 4FTVA 2FSEB 1CE1H 4NQUA 4WWKB 4MA3B 3Q48A 3DHJA 2CR6A 1BBDL 2CIIB 5ID0A 5MERB 4PJDA 1LEGB 5HDBF 4HIXH 1NAMA 1U2CA 2R2EB 3BO8B 5IV2B 3RZCA 4LCWD 5ICYA 2X09A 2WP3O 3R1GH 5KVDH 5GGVH 1BFSA 5EU5A 3QIBA 1NFDF 1A1NA 3NFNA 5F8QC 5E8PA 1FN4B 43C9A 7FABH 3MV9E 3VH8G 4H25B 1DBBH 1AGDA 2LQRA 1CLZH 2LVEA 5DC0A 1FZMB 4G9FA 5AYUL 4PY7B 4A6YB 5J6GA 4KRLB 5DK2A 3KXFA 3T09A 5EOCL 4QRRB 4ZG1A 4ZTOH 4KRNA 5DMIH 3MRKB 1UXWA 2AKRA 1E4KC 2ADJB 2CMRL 1FFPB 4PYHA 5CKGA 3HS0A 3RVUD 5CBEB 4HDIA 1J1PH 1EEZA 3EYFA 2PYFB 2AJUH 4YPJA 1NJ9B 1A9EA 2JLLA 2K7PA 2XG5A 4HGMA 3MFFA 1A5FL 2P49B 4QOKA 1PJ9A 3H42L 5JHLH 1HHIA 4JG1H 4MSWB 3QUYD 4S0TD 5FM8A 5FYJL 4KKLC 4P4KA 1UZ6F 2GT9A 4PRAB 4X8JB 5A1AA 6FABL 3UTSA 4NZUH 3ARFB 5JA8B 3X3GH 1T2QL 4YE4L 3OG6B 3MRLB 4KAQH 5KTEL 3V6ZA 4WFGD 2MCPH 4RX4A 4D0CB 2VZSA 2F19H 4ZPTA 1FVCA 4X7DC 3DIFB 4JY6B 4PV8A 4P59H 2YD6A 5I1IL 2QQNL 4KKCD 4FP8H 4ZUUA 2P8MA 4Q9QL 1ZLUH 1I3RA 3QNXB 5MEOA 3TCXA 3VG0L 5L2KB 4P2QB 2BVOB 4UQ3A 1WBXB 3P2TA 1NMAH 5CMAA 4M62H 3KPLB 3ARBD 4OLXL 1MF2H 2X4NB 4AENB 5E5RB 2FB4L 3DSNA 4HLZH 4WW1A 2H9GB 3RWDA 2B20A 3BKCH 4CMMB 1KFAL 3VXUA 3WO4C 4GRLB 3IDYB 4EUPB 1T1XA 3B9DA 4I0PC 4X0KA 3CVHH 3MV9B 1F11B 1G6RB 3S3PA 4KMQA 2J4WL 5FYLE 3L5WB 1RJLA 1TIUA 1CD1A 1RJZA 1FFOB 3UYRL 4JFEA 4M7LH 5HJ3A 5HYJE 1WCQA 3VXRE 1XF4B 1BZ9B 3W81A 3K3QA 4OF8A 5HY9B 1KB9J 5MHSE 3BP6A 4JDZA 4YBLB 4PRHA 4M61A 5KSAB 3T0ED 1ZT7A 1N0LA 4OFVA 3STZB 3WFZA 1DFBL 4KHXH 2VLME 3HNVL 2G9HB 1KJMB 1VKXA 1LO5A 3N1FC 4LPVA 2NY4B 2J6EA 2DM7A 4UAOC 3LZFH 2APXA 4XRCB 2FZ3B 2YRPA 4XWGL 5CS7A 3SDAA 3OJDB 1B0GB 4XI5C 1OAXL 5JMOC 1F3DJ 4JFFA 4L4VA 4Q74A 4NN6C 3FQWB 1NC2A 3FMGH 2YD7A 5KVEL 2K7QA 2DBJA 1BVKB 4KK9C 3UZVB 4NZRH 1IRAY 1SY6L 1MFNA 5HD8C 2Z91A 5FA3A 5T3XE 4NKMA 2XG4A 5HI4C 4PJ8C 1INDL 4E41E 1Q0YH 2BOCA 4WHYH 5HI3D 3QNZB 3LDBB 4FN0A 1P2CA 4G6AC 4NWUL 4F15B 3BEVA 3UYPA 2CSPA 4G8GE 2CK0H 1KPRA 1V7MH 2RR3A 1CIUA 1QBBA 1JPFA 1OTUD 2WWKT 4Z7UF 1CQYA 4MXVE 4PUBL 3SEPA 4ZXBB 1CXLA 2J1KA 3IRZA 5IOPB 1NBYB 2X40A 4OLZH 3V5HA 1DE4B 4LLVB 2QV2A 1RULH 1KTKE 2Z35A 3GSQA 2B1HH 2DIJA 4KVCL 3GMQB 1D9KA 5FYKL 2VISB 1MAKA 4J3SA 3CX2A 5I1DA 1NGYA 1CLYL 4FQIH 3TVMC 3VRLE 4PLJC 4NQXB 4F2MA 4XBGB 5HYJB 2VXSL 2EH8H 3VXRB 4AQOA 5E94B 3GJFH 3IDNB 4NN5B 3BGMA 4QXGH 2R9HC 2EDXA 3JVGC 1NDGB 3VD5A 5F6HJ 4HIHB 4FFWC 3QISA 1FRGL 1MRDH 1T1WA 3LKRB 3L3HB 5DUBA 4XZUA 4DFIA 4IRSC 1UWGH 1QPPA 1KLGB 3AREC 3BD5A 3BJ91 4HWZA 3RAJH 5I8OL 4XCYB 4P23B 2NY3C 5IEHB 4KY1H 3DMMA 2OZ4L 1M05A 4NKQB 4Z0XA 2GSGB 5B39A 1UCTA 3MO1A 1H15A 2HFFA 1W72L 2DQGH 3NFPA 4F7CA 3OR6B 4OZIF 4QXWA 1MCWM 2DOCA 3VXQA 4L8SB 3GUTA 1FQ9C 1N8ZB 1XGUA 2WSKA 3UP1A 5A3IC 4PGCA 5JHDB 3RVTD 3SBWA 4EQ2A 4F7PA 1A7QH 1UM6L 2X89A 1NGWB 1A7OL 5DJ0B 4LSUH 1U93A 1K8DB 2UZYB 1B0RB 2ICWB 4E5XB 3SPVB 3ARGD 3E2HC 5IVOA 4E41B 2G75A 2A77H 4UT7L 4XVTH 1PW3A 2X4RB 4MJIA 1Z9LA 4BSJA 3HRZA 4D9RD 3U9PH 4G8GB 2QHRL 4NQSA 4OI9A 3DTXA 4N90D 2H45A 1QPXA 4O2CA 1GGIL 3QR2A 3SGEH 2IAND 1EXUB 3V0WH 1X5XA 5DTFA 1CFQA 4M43H 1BX2B 1FIGL 1UXSB 3HUJE 2VUYA 4HS3B 4I4WB 2RQ8A 4EI6B 5FDWB 5BJTB 1RFDL 4Z7NF 5EA0H 1QNZH 2EDFA 1JZ7A 1FGVH 3IJHB 1EFQA 1CK0H 1OQXA 3O2VL 4ONHB 3NCYP 4MNHA 1E6JL 3G6JB 5F1NB 1N64L 2MQ3A 2PTVA 4ONGH 3SDXE 4LRNH 1TZIA 1C12B 2LU3A 5GS1A 1FORL 4JQXC 4HUMB 1T4KB 1OARL 2NPLX 3RUGF 5JQ6L 3FB5A 3CFBB 3KG5A 4NCDA 3O3EA 4NHUA 1A6WH 3W2DL 3VFVA 5IB2B 4M6MH 1IGMH 3B8YA 4N8VA 3LD8C 4IOIA 4ODUA 3KDMB 1CD9B 4AIZB 4FABL 1MFAL 3WN5B 4YXHH 3S5LG 3W9EA 2Z93B 2ICWJ 4RAVB 4YXLH 2GY7B 4RSVA 4MAYC 3DV6B 3P9LA 3FOLA 5IR1A 1OAQL 5LAXA 2FYYA 3OKDA 4PJCA 4JANA 3ARZA 5C07D 4XP6L 3VWKA 3RL1A 4LLUA 4JY5H 3ZKMC 1EBPA 3BYTA 4LVNB 5BMFL 5CEZL 3B6SA 3FONA 1ZMYA 5D7IE 3TO2A 1J8KA 5AZEH 4WCYL 1HYSD 5EU7C 3BD3A 3ILPB 3I84A 4ALAH 1AR2A 3WS3A 5J12C 4DKEH 1YEFL 2JELH 4U2YA 5DQJA 3S5LA 1D5MA 1QSFA 4F7EA 2GUOA 4KKAD 2CO7B 5DGRA 4BQ8A 3W11D 3UPRB 3CMGA 3ARFC 4Z0BH 2YXMA 1BGXL 3FO0H 3ZKXB 1LE9A 4AT6B 1H3PL 2KH2B 2DI9A 2P44B 3DI3B 1Q72L 5JA9A 4JPVH 3TT3L 2VLJD 3UJJH 2BNRE 1ZV5A 4MS8C 3VFNB 1WZ1H 3BPNB 3ULVE 4P2OB 3SDXB 3D25A 2Y6SC 3LKSB 1LP9A 2E6PA 5I30L 3KYNB 5K9OA 3MA7A 3QI9B 2XZCH 2VMFA 3L7EA 4Z5RA 2BSTA 3FHQA 4OTXL 3RWHB 2EYSA 5GSRB 4NQTA 1SMOA 1KCSH 2VAJA 3D39B 4KGJA 2YD4A 4GRLC 2DIBA 3QDMD 1YPZF 5CBAA 1F3DH 3I6LD 4Z18A 4ZDHB 3H3BC 1CICA 4X9IA 3EAKA 3S8WA 1C5BH 3QDGE 2V2WA 2DBLH 2ZP0T 1BOGB 3P77B 4XH2A 4R26H 4LSRL 1G7LB 4BJLA 1MFEH 3SE3C 5D7IB 1WV7T 3TZVB 1C7TA 4KRPB 5IFHH 1XAUA 5IQ7H 3AAZA 1J5OH 4OJFH 3UAJD 2XPGA 4LCWA 3V4UL 1BD2E 1IL1B 4EUPH 3VD9A 3AM8A 1U95A 4EN3B 4S1QH 1X9QA 3QUZA 4Q9RL 4XGZB 4OF0A 3MROA 3RUGB 4PS4H 5H35A 2RGSA 3NABL 5HYQB 4HUXB 4YZFF 3GEWB 3O2DL 4P5TD 4R3SB 3WLWC 6CGTA 4N9OB 3LEVL 4JKMA 1IGJB 2BNRB 3EOAB 5I6XB 3VFMB 3VXNA 4KI1A 4HGKC 3CNKA 3HMXH 1FFNA 2FJHB 3V4PH 5D1ZD 4ODSL 1R3IH 1QBAA 2OBGA 2DQHH 5C0RH 5DJ8B 2HTLD 5AG9A 3H9HB 3OAZK 1NCAH 4O2EB 1KB5L 3MR9B 3V2AR 4B41A 2OK0H 3P4NA 3QUYA 1XF2B 1CDCA 1S7WB 4A2LA 4ZXBC 2F8OA 4ZO7A 1JTOA 3DRQB 2E7LC 2VDPL 2SEBA 1TFHA 4X7SH 5H37H 2L7UA 4M6OH 2PTTA 1E4XH 2XKNA 4D8PA 1Q38A 1XGQB 3S6CA 4BZ1H 3P0YL 1VDGA 1QQDA 4MDJB 4CW1A 4EBQL 2H3NA 5EZJA 2R8SH 2H6PA 3UTPD 1JI1A 2A74A 4ODTH 4Y19E 3QDGB 1JRHI 2D7TH 2Z92A 3FQTB 1LDSA 1DQJA 2DLEA 4GKOA 5CSGA 3FT3B 3OAYK 3GM0A 3HC0B 4PJAE 3GGWB 1R5WB 4WI4A 1DN0A 3ARBA 3BUYB 2VSDA 3HI5L 3VWJB 1DEEA 2OYPA 2FHFA 3M1BA 3MX0A 4U6HB 3SQOH 3VXPA 3FRUB 3TM6A 3CLFH 3NIFF 2IALB 3U2SA 4Z7VE 2W1NA 1BIHA 1GAFL 3CSYA 4I9WD 4GLRI 4PJXA 1SHMA 1LO3H 5FYLH 4TNWF 5IVZA 1IZJA 3NMEA 1S7SB 4P3DA 4JLRA 4JFXB 1PQZB 2NTFA 3Q3GA 5ERWA 4I18C 4DCQB 3BKJL 4K3DL 1YMMA 5GRWA 4PJGF 1T89C 4M8VA 4CBPA 3X3FL 1JGLH 2JIXA 4NKDA 1S7RB 2FHCA 5D2LA 3T0EA 5FGSA 4ZAKD 1KYOJ 3LS4L 4X7TB 3PNWA 4XVSH 3SO3B 3GMRB 3KLSA 3GI9H 4IRZL 1NGPL 2EH7L 4O2FB 1AKJD 5DJYB 4ZUWB 3VGEA 1A0QH 1FCGA 4L9DA 4Z7WE 4YEFA 2BNQB 1WC7B 1X5IA 5L2JB 1CFBA 5D7LD 1TLKA 5EO0A 3O6LL 3VFUB 1GGCL 2VDOL 3ZT5A 4N0CD 4C56E 1IQDA 4YGVA 1F4WL 2CXKA 1PVHA 1IEBB 5JXAH 5D96C 3JWOC 4R0LA 4LHUB 1MFDL 4IMKC 2VQTA 4JJ5B 5ACMA 3S88L 3AB0C 1BIIB 2H26B 4Y5YB 1BJ1J 5JIKA 3STLA 4Y5VC 3U46B 1JNJA 3I6KB 4NC1E 1MHHA 2HLAA 4Y19B 5HGHB 4NDMB 3B3IB 4XNXL 3KJ4C 5J4MA 4PJAB 3BWAA 1HILA 3NGBB 5I1GH 1P4BH 3LEXB 3PWJA 2FWOB 1EPFA 1G7QA 3OPZL 5T1LB 3MOBL 1IGFH 3LKQA 1CGYA 3WJJC 1A1MA 3JWOH 3LSOA 8FABA 4Z7VB 5DFTA 3MJ9H 2FJFB 3QPXH 1J7VR 4PG9B 1WLHA 5GGUA 5IP4A 32C2B 1BVLB 1P5UA 2P5WE 4PRBB 4X5XA 5JPNA 5TDPB 5CFHA 1CLCA 5GJSL 3V5DA 3OG4B 5J9PA 1U0QA 1X6LA 5C08D 3CU1A 2O5ZH 5HHQA 2RHEA 3OB0H 4LVNC 4XNQB 2YR3A 5F7DB 1A7RL 1AO7D 5KW9H 1P7QB 3O4LD 4HXAL 4PJFF 3ULSB 3Q5YA 2L7JA 1OW0C 2XZZA 5T1KD 3DX8A 3MNZB 1YJDL 3DX6A 3WFHB 5I8CA 1IM9B 1QEWA 2IBZY 5SWZB 5DRXB 5DS8B 4KQ4L 3VXSE 5I76B 3ILQD 1I1YA 1IARB 1AGBA 3V7MA 5E2VH 4RISH 2G60H 4LRIA 4S2SA 4NO5B 4QRTB 2XKUA 3D0VA 1CCZA 2ESVD 4C56B 3TBSA 4PV9A 3ZKXC 2BMKB 2DLHA 4U4BA 5C71A 3JV6B 3S35X 5A16B 3OZ9H 2ICCA 1ZHKA 5EU6E 5I1JL 1T03L 2VIRB 4GW1B 2R4SL 3ARGA 4LFHG 4G7VL 5DVOA 4G43B 5EZOH 2ADIA 2K3TA 1A1OA 1AD9B 1YN7A 3RTQB 3LRGA 2IQAA 5IHZA 3B9KB 3O6FD 1UWXH 4FFZH 1VCAA 4NRZB 5C0GB 2XT1B 1XT5A 4ZNCD 3ULUE 1JGDB 5HXMA 4EI5D 1RUQL 4YHKL 5D9SA 2VL4A 3CX5K 3MACH 1RAMA 2OXHA 3GSNL 3PGCB 3T65B 2Y06L 4NKOB 5IMLB 1XGYL 1P84K 2P5WB 3HLAB 5AEAA 1K6QL 3C87A 5EWIH 4MAUH 5ETUA 1YY9C 2ZUXA 5I16B 3THMH 1RU9L 4WV1A 4WY7H 5F1OB 1LE5B 1E4JA 2EDHA 5EORH 5HI5C 2J8UE 1WFUA 2EZ0D 4JM4H 3VGBA 3KWWA 1MIEH 2WP3T 2KBGA 4WEBH 5F44A 1QBLH 2V2TA 1F4YL 4H1LB 5E6IA 3GBML 5IB4B 4GRWH 2X5PA 2VH5L 4YHYC 2VTFA 3GNML 2BY0A 3F7YB 1P6AB 4EN3C 4GJTB 3O0RL 1F90L 3VI4E 1JL8A 3R4DA 3GMOA 1P4LA 5ICXB 3MLZL 3EDFA 1G9EA 3E6HB 3W9DB 1F3JA 5JDSB 4R96B 3U30C 3GBLA 5C07A 1YN6B 3G08A 3I75A 5I74C 3GJEA 4LOUC 3T4YA 1A9BB 4GG8A 4PJEF 1OVZA 4CVUA 4M9PA 3GIVB 4JN2B 5EU6B 5SX5K 3M45A 5CLTA 5J13C 2RAMA 3V52H 3EYSL 5HYSA 3V7AG 1RURL 3SKJH 4UOJA 4FXKA 1ZT1A 4DK6A 1DQDL 4NOFA 1R3KA 1GZQB 1KF9B 1MFCL 1HXMA 1RIHL 1O7SA 3R0MA 4H26A 5ENWB 4J2XA 2C1OB 1CDJA 4P2RD 4OI8A 2GITB 2VDRH 3UYOD 3DSFL 2Q3ZA 5L8JB 4QXTA 4QHMB 4YHLL 3EOTL 1CFVL 1IC7H 5KS9A 1ORQB 3O3UN 4UNTA 2X9WA 1ZHLB 3CUPA 4QCIA 3V5KA 4F3FB 3BPCA 1DBAH 1GYAA 2BY3A 2GTZA 3PL6C 4JO4H 5TGBA 2VLJA 1MWAH 1QRKA 4E42A 1FLRL 5IB3A 3O3BB 1MQKL 5IT2H 2W9DL 1MCNA 2D7MA 3HRPA 5CEYB 1T83A 1QKZL 2D7OA 4LPXA 5EBGA 3PWPD 4KKLD 3OKNB 2J8UB 3D85B 5T5FL 1I1AB 4Z7UA 5MI0C 3F6LA 5BV7L 3IVKB 1JV5A 1EGJA 1ITCA 4LHJB 1U36A 1YNKL 3G6DL 4NGHH 5EBWB 4OM0L 4CN6A 3MYJB 3DUUB 4MNGA 4H0HB 3QEQB 1P5VA 1DUZB 3BZFB 3KPPA 1ZLVK 2E6JA 3HAEG 2B1AL 2IAMB 4K7PL 2WBJB 4HQQH 3E8UL 3T0BA 4L9LB 1A6AB 3TBTB 1IC1A 4YBHA 1EJOH 3MRNB 1S7VA 2X4PA 5CGTA 4J3UA 3VGGA 4WDIB 4E0RA 1KIRB 5K9JL 3WD5L 4ZFGL 3FT2A 3U4BH 5GGRY 3JWDC 5DJ2B 1IC4H 5DK0A 1II4E 2AK4E 1BM3L 2E9IA 3BP7B 1BJ1H 5E8EA 1EHAA 4XP9H 3SDCB 5FO9A 4OSUH 2FATH 1ADQA 1A6VH 5J1AB 1KBGH 3GHEH 3W0WE 3A67H 4OF6A 4I0PD 2JJSC 3WUWB 2FEEI 4YXKH 1U8HA 2CUHA 2XZAH 3BQUC 4IIQA 5GRUL 2I24N 3LQAL 4DQOL 4UDTB 2HWZL 5C9JA 5DHXB 4KI5E 2FGWH 4X9HA 1FLTX 4KTEH 3UTQA 4P5TA 3SOBL 3JWDH 1H0DA 5FOBB 1BAFH 1CIDA 5TFSH 5DGQA 3PHOA 4JFOB 4HG4J 1QFOA 4LQFL 4N0UE 2BFVH 3F58H 1OGTB 2F5BH 1KTLA 2C7UA 5D1ZA 1T0NB 5BXFA 4Y88A 3MRDA 1PZ5A 1J8HD 1L7IH 2OL3L 4Q9CA 4XI5D 1R3HA 4R97B 4ERSH 4OFPA 4JKKA 4K3EH 3NPSC 1PAMA 2AV1B 3E6FA 2IH1A 5E4EB 3SGJC 4NM4H 4LSSH 4LEXH 1LMKA 3C6LB 4JHWH 1EV2E 2VDLL 4KK9D 1U91B 5AD0A 4PRPE 4LSTH 4LARH 4GRMA 1YUHB 4JFHD 2V5SA 2FIRT 5HD8D 2GJ6D 1JHLH 4R9HA 3GMLB 4EJ1C 1KT2A 3W82A 5HHNA 5HI4D 4PJ8D 1MAJA 5IVXF 1WF5A 4IRJC 3UO1H 3JV5A 1U8JA 3PQYB 3J8F7 4G6AD 2N7AA 1YEHL 5FXCH 4YHZH 4XBEL 4PJ9C 4HX1A 2ED9A 4JKPL 4ELKA 1RZ7H 1X5LA 3BRDA 2P46B 3LPFA 2AK4B 1DEDA 3HA0A 1OP5H 3F65A 3RNQA 1X5YA 1XCTB 2AI0L 3MJ6A 5C0FB 3W0WB 4HIIA 4CU7A 1CGUA 3BDYH 3DBXB 5D70H 2F54E 1P4IH 4DN4L 2DN7A 3R8QA 2YD9A 2MTPA 4PLJD 3MODH 4OFYD 2DLGA 4PP2A 1T04B 5EC2B 4AZ8A 1ZHBB 2R9HD 1A6ZB 1FVDB 5FCUL 4HXBH 2FR4B 1RIUL 4Y2DC 4FFWD 4EQ3A 4ELMA 3O6MH 4R4FL 4N0UB 3RFZC 1MJJA 3A0OA 4IRSD 4ZAKA 3KVQA 4QHNB 2APTA 2PW1B 3ARED 3IFPA 4MCZA 3MOAH 1T7VA 1I7RB 2NY3D 4NC1C 1AKJA 1NGZA 2WV3A 1U92A 2ORBL 2IG2H 1A6TA 3LRSB 5CEXA 3ZYJA 4LEOA 4JRYD 4Z9KB 2ZG2A 3B9KC 3OGOE 5FF6A 5D7LA 4M93C 3L6FA 2R2BA 4GMSL 4L4JA 4RBPK 4YHIB 3AFLA 2XWTA 5EUOE 2EO9A 5IROC 4YDVA 1S7TA 5BRZB 5A3ID 1T5WB 1X44A 2CGRH 3QIUC 3SE9H 1ZGLB 5ABDE 3K1DA 1CDIA 4UB0H 3MBXH 4PGBB 5DEGA 5E8OB 2BNUA 2AXFB 1A3LH 3JUYA 3RHWK 3VCLA 4ODWB 3QEHA 2WIIB 1R3JA 1FGNH 4FMFA 1DSFH 3FZUC 2O61A 3MRBA 3W39A 5C3LD 3MGTA 2BRRH 4PRDA 2MKLC 1ZS8A 5DHYB 1W2KT 3OX8B 3D69B 4JFZH 3SGKC 2QLVB 3TIDB 2VXTH 2FL5A 2H1PH 1FNSH 1SM3L 2XZQL 1SJEB 4Q6IC 3UJTH 1YPZA 5H94A 3LN4B 1D5BB 4I3SH 4U1LA 2MQ0A 1RI8A 4HCRA 3VXMD 2CIKB 4X6CF 5TPWH 3R06B 1JFQH 4LGSB 1QHPA 4LPWA 1M71A 3KPQB 4U7KA 5D4QA 4Z77A 4BZYA 2QSTA 2DKSA 3V4VL 3S4SG 2A1WH 1J0ZA 5C08A 4I3GA 1AIFA 2CUIA 1C16A 1JRHH 3WIIH 5FA4B 1UA6H 1RUMH 1AO7A 3O4LA 1G7PA 5TQ0L 5FYJU 4I0CC 2QQLH 5T1KA 3E0GA 5D7JC 3IDXL 1S8DB 4YFEA 4DEPC 4MAYD 1CU4L 1ULVA 4G80B 5EUOB 2DLTA 5IIEA 3B9AA 4GLRH 4NBZB 2ESVA 3ZDXE 2BSRA 3PHQA 3ZYOA 2B2XH 3ZKMD 5E7FA 1E27B 3ZHLA 3CCHB 2FH8A 3DETC 3X12A 4CU6A 3LIZH 4Y16C 4HS8H 5DYOB 5I1AB 2IGFH 2XWBB 3LN5A 1EMTL 5BVPH 1RUAL 1KN4L 3UBXB 3QEUB 2XKSA 1F00I 1UWGL 3V0VB 1KIUA 3NA9L 5MP6L 5DLML 1KCKA 2F53E 3O6FA 1FAIH 1HIML 3ARFD 3MCLH 4X98B 4BKLB 1HYRC 1QA9B 2VITB 1T0MB 2HN7B 2NY2B 5DQ9B 2ITCB 3FRPG 5K59F 5A40E 5GGSB 4RFNC 2DAVA 1H5BA 4QHLB 4EI5A 3T0VA 5T3ZE 1KPUA 3RJDA 4MS8D 4QF1B 3BHBB 4K8RL 4GKNB 2F15A 4L9LC 5C0EB 2Q86A 3RWJA 5EUKB 5L2KD 4M1CC 4POUB 2Y6SD 4DGYL 2W0FA 4YQXL 4ZUVA 3MGAA 1XCQB 3H7BA 5I75C 2NY6C 5DWUH 4DFHA 2L4OA 1R3LA 2DQFA 3MRPB 4LLWB 2YMXH 4D94A 1EVUA 4WHDA 2FH6A 2LVCA 2OL3A 1J88A 4QRUB 4LKCA 5HGAB 1D3CA 3U7YL 2CKNA 4JZJC 3F7VB 2GI7A 2V17L 3CLEH 1SBBA 4GRLD 3L3DA 3MV9D 5DMYA 4PJ5E 3BVNB 4U1KA 3SDDB 4NZTL 4OT1L 4JPKL 5EO1B 2Y1VA 1ZLUK 2BERA 4Y5XA 1J9CT 3TV3H 1QNZL 2F74B 5H2BA 4LSVL 1OSZB 5LCVL 3RDTC 5C9KA 1IQWL 5DQDH 5L6YL 1KELL 2Y5EA 3HNTH 4X6CB 2VLLB 5ALBL 4WI2A 4P5KA 3K74B 1JTTA 1CGVA 3DUSB 4DZ8B 3ZSSA 3EFFA 2O93L 1ETZB 1NCWL 2VQ1B 2CKBB 1TNMA 2D9CA 4P2RA 3U6RB 3HB3C 4HGWB 3IKKA 1WWBX 5CILH 4OZFA 1I8IB 2MJWA 2X4SB 5FKPB 5JW4R 3AXLB 1WZMA 3WLWD 4HLZG 4RNRA 3MMEB 4ZYKB 3AY4C 3VE0A 2YUZA 2F58H 1E4KA 4NYLB 4M00A 2FX8L 5DMKB 3QUXC 3EYUH 1CE6B 3D87B 1NCNA 3FFCD 3IGAB 2E9WA 4FZ8L 1CGSH 4I5BB 4QTIL 4L3EE 5IW6A 3NIDE 4EEEA 1IGIL 3PWPA 4D0BA 3RWEB 5HVGB 5IMMB 1DLHA 2ZCHL 4ZXBD 4ODHH 4ALAL 4YIQA 3GSWA 4NNPL 5E95B 4MQSB 4GT7A 1DQMH 3RA7H 3T4AA 2MPAL 3ROLA 4XPTH 4GXVH 1AD0B 4WI9A 2FBJH 3PWUA 2X9XA 4Q2ZA 1J05A 4GRWF 3EYQC 1MELA 1VFUA 4A6YL 2IADB 4Y1AE 3H9SA 5FYLD 1NCDL 3AC0A 4G6MH 2R56L 5DHVB 5FYJE 3HPLA 4OFKA 4WI7A 3VXRD 3WSQH 1T5XA 3QO1A 35C8H 3BIKB 2AJSH 3WNOA 4AL8L 5MHSD 4TTDC 1SYVA 3VDBA 2EC9T 1O0VA 4KV5F 3WMSA 4NN7B 4LNRA 4C59B 1MI5E 3L3JA 4HKZA 1KEGL 2VC2L 2VLMD 3TH3T 2NW2B 1P69B 3JZ7A 3H3PH 4PJFA 1W0WB 5B38B 5E1AB 5IF0A 2QKIA 3RWGB 4TUJB 2UVFA 3KPRA 5E9DD 4PJ7E 5ICZB 1DP0A 4P46B 5FO8A 3ZO0A 5MEQB 3D3VE 4QRSB 5TJWK 4I0PA 4X4ME 2VDKL 3MUGA 1FE8L 5BZDA 5I18L 1RK1A 1OAKH 3DVNA 4WI6A 1MHCB 1S9WB 5DUPL 5F7WC 4LKXB 1ERNA 1OM3L 5FB8A 2BVPB 2BSSA 3PHSA 3TBVB 3QFJA 4M5YH 5IQ9B 5IB1A 1EFXB 3QXAB 4Q58C 1C5BL 3C5SB 2VR9A 4LASH 1S3KL 1T2JA 4E41D 4M5ZL 5C70A 4HUKB 1Z3GL 1HEZA 3KNBB 4M7KL 3P30H 5F72S 1CZ8L 5C6WH 2LTQB 1INQB 4J6RL 1QO3A 2VQUA 3PWLB 5E08H 4G8GD 1J8HA 4YX2H 2AEPH 4Z76B 2BHZA 1A4KB 4NQVB 3CFDB 1WCBA 1BWWA 5CSZA 4X5LA 5LQBH 1TJGH 4G8IA 2A38A 4EDXB 1G6RL 3LPWA 1D6VH 1K8IA 5GS3A 4D9QE 2YXFA 2GJ6A 4Y1AB 5DXWA 2WZPD 3TGXA 3PGDB 5D5ME 4PJ8A 4EVNA 2A6KB 3CVIH 3K8LA 5IM7A 2EE6A 4XC1L 4FA8A 1UYWL 3MREA 1TJHH 1ZWIB 3IDIB 3GO1H 1I9RH 1MI5B 1CTOA 1S9VB 1YECH 1MCSA 3AGVA 1CR9L 5AG8A 2HJLA 4KDTC 4XXCC 4AYFA 4KDWA 3GRWL 4OIIH 2BDNH 2KL6A 3O45B 4XP4L 4XCCL 5IFJB 1NAKH 2PN5A 4S1DC 2AABH 3NZHL 3QH3A 4PJ7B 3VJ6A 4EZMA 3CFKB 2C4FU 1FFQA 3D3VB 1KLUA 4KVNL 5JW3H 2WM0A 5F1IA 3MNVA 2OR9L 4BUGA 5IMKA 1HSBB 1NAMH 3MJ8A 4UZGA 3TIEA 3EO1A 2HT4C 2YC1A 5FK9A 2FX9H 3F8UB 4OFYA 3WE6A 1BZQK 3FB7A 4FNLL 1DBKL 2IPKB 3D6GA 3ZZ1A 5BO1L 2BHYA 5EOCJ 3JVGA 3ZHDA 1NC4D 1ND0A 3CDYA 3CZFA 3DYOA 4PJEA 3ALXA 4FQHB 2HFTA 4POZC 3FFDA 3FQUB 3SDYH 1I7TA 5A2JH 4IRSA 4ODBD 4H5SA 4PTTA 4AJ0A 3WS6C 3AREA 4N8CH 1H3VA 3INUL 4XCEA 2W65A 3TH2T 2VUOA 3KPMB 3MNWA 3U79A 5HSFA 2PW2A 4U6XA 3MUHL 1QR1A 4JRYA 3N1GC 2AJVH 3PXHA 4LHQB 2H2SC 2NY2C 2HJKB 3TYGL 1EZVX 4Y2OA 5GIRA 5E2WH 5F7FA 4NUGH 1RUKH 3WLBA 5LBSH 4BFEA 1INEH 4GSDH 1DZBA 4U1GC 3RNKA 3NZ8B 3TPKA 3ZE0F 4M6NH 3ZE1F 3CK0H 3O8XB 2YS4A 3VFRA 3IF1B 2FX7L 4PJBE 1LO0L 5EU4B 4O58L 4LLYB 3IB4A 2FNBA 1MCQA 4OB5L 4HWEL 4O4YL 3WHXB 1RMFL 1AP2A 3OQ3B 2ZUVA 4ZFFB 4PTUA 3BIAX 3I2CL 4LDLB 3C9NB 1N2RB 2O5YL 5D7SH 3QDJE 5DI8B 3D0LB 3RY6C 2H32H 4G5ZH 4I2XE 1G7MA 4WUKL 1M7DB 4NCC2 4YAQB 1HHGB 3FO9A 4FQLH 4H88H 2C1PA 1ORSB 3HZVB 4BZ2H 3SDDC 4IM8A 3QQ9C 4NQCB 3BW9A 5EIQA 3WL9A 3VXMA 1JGUH 4TSCH 3JTSB 4HF5H 2VDNL 1IGTB 3G04A 1YY9D 1UACL 4NM8L 5T3XL 2PYEE 4G8EA 1ZA3B 3VU2A 4JQXA 1EEYA 5C09B 5HI5D 3L95A 4WJ5B 5FDYA 3MJ7A 4TUKL 1ZKAA 4W81A 4LVOB 4UINH 4L8BB 1LEGA 5DD6B 1X7QB 5CJ8A 2R2EA 5DEFB 4CJ0A 3LKOB 3IDMB 5T5NF 3B2VL 3FQXA 4G7YH 5I15H 3T2NH 12E8H 1F4HA 1SYSB 5ITFA 4EN3D 4MXWL 4XNUL 4D3CH 5KVGL 4MAYA 1N6QH 1FZMA 5IGXL 4NSKA 3ZHKA 3L5HA 1NH6A 1FNAA 4AIOA 2I60H 4QRRA 4PLKC 5I71C 3FL7A 4LOUD 3T77A 1HXYB 2X44D 1FCCA 2EDEA 5DZOA 1MCWW 4K9EC 2UYLB 5E2UL 3BSZH 5FUZH 2HRLA 3FN0H 1FFPA 4Z7QF 5ESAB 2WQRA 1MRFL 3QSKB 2M8XA 2A0LC 4YC2B 1A47A 4X6FB 4HD9A 4F57H 4NRXB 4XMPH 3T8XB 4PJBB 2AW2A 4J4PC 2GJZB 1KEMH 1C1EH 4P3WA 4CADB 5I19H 4BM7A 2VXUH 2E9JA 2MHAA 1E4WH 5EC1B 1AHWB 4YK4C 4PRAA 1L4IA 1YYLH 4X8JA 5E5MA 3ARFA 2D03H 4LPCA 5CEZE 2Q7NA 4M3JA 3MRLA 2YPKA 5T3ZH 1QTYT 5LGHH 2VDQL 3TN0C 3UC0L 3PWNB 4K9EH 3BP5B 3PL6D 5E7BA 2CRIA 3L5JA 5EB9A 2NNAB 4EXKA 1G84A 3QNXA 5DT1L 2DL2A 3LQZB 2PYEB 5L2KA 3S3SA 3GMPB 2AJYL 2E7BA 3IFNH 4J1UB 4HKJB 4R7NA 3UBXG 3N1PC 1FFRA 4F33B 1WBXA 2VDMH 3KPLA 3QG7L 1CXKA 2OP4H 1NBVL 5CP7B 2H9GA 3Q1SH 5EU3B 1BD2D 5DEZA 4GRLA 3CFCL 4EUPA 5GGQH 4CVZA 1A2YB 3MV9A 3KJ6H 4NNYA 2GSIB 5FECB 4R7DB 1UEYA 1OT1A 4WU7A 3OSKA 4XPGL 2ZOLB 4OGAC 1XF4A 5HPMB 4I1NB 3O2WH 1Q94B 3K2UH 4TVPL 2PXYB 2X4TA 5AZ2L 2Y36H 5EIIB 1DDHB 3DXAB 5J1SC 3K7UA 3SE3A 5J8OA 2G9HA 1KJMA 4N1HB 1OD9A 3HMXA 2XQYK 4XNYH 5IMOB 3U83A 2VR5A 1WFNA 4TPRH 2VZ3A 2BSED 2LTQC 3MRMA 4ZUSA 3HC3L 3N50A 4HFUL 1TVHB 3BQUD 4JHBA 1KGCE 1J10A 1NCBL 4Y8AA 2PTUA 1BBDH 2ID5A 4L29A 5GS1C 4UT9L 2A6IB 2XQYG 3KHOA 3MPCA 3C60C 1XMWA 3A6BL 4LHUD 3SCMB 1NL0L 4OCXL 1SBSL 4Y7MA 3L5IA 4DZBA 4AMKL 1BFOB 1I7ZA 2EC8A 4U7MA 4V2CB 4MQ7A 4LLMB 3QFDB 5JOFA 2V2XA 4QO1A 3FCTA 5AYUH 4OZGF 4LAJH 5K9QG 3MRJB 1HWHB 4WFEE 4NJ9L 1FBIL 5EOCH 3S35L 3ZE2E 3SKOA 3Q5OA 2R1YB 4PYGA 2AJZB 1Q9LA 1RJYB 4ZXBA 3QULB 2CMRH 3VWKC 1NBYA 5GGTL 1OLZA 4GO6B 1YC7A 2HA1A 1DE4A 2E7LA 4JM2C 1JN6B 4WTZA 3RI5F 4DGVL 3FO2A 4L1HA 3GMQA 4LQ1A 2WBWB 3F5WB 2VISA 2VABB 4FFYL 1A5FH 2DQEL 2YPVL 1HH6B 1FJ1A 3G5YA 3H42H 3X13A 1LD9A 3IFOB 3BRFA 5FYJH 4IRJD 2QSVA 5IBUB 4NQXA 5B22A 3EZ8A 3VXRA 1A64A 5E94A 3L3GB 6FABH 5JPMA 1T2QH 3IDNA 4JO4L 5DK3A 4YE4H 4PJ9D 2NY7L 3QA3A 5EH1A 1C5DA 5ADPL 5KTEH 3ULVL 2XWJA 1J0JA 3KGRA 2Z31C 2I26N 4GW5B 1IBGL 1QFWM 2CDEA 2VLRB 2CDGA 3LKRA 4UUJA 5DMGC 2M2DA 4QWWC 4OCRL 5I1IH 5J89A 2QQNH 5EBMB 1WEJL 5F7LB 4Q9QH 2FECI 3JWNC 3HKFA 4XCYA 3VG0H 3OKLA 3P73A 5E9DA 1RZJL 4KTDL 2QADB 3F6IA 2GSGA 1AGEB 4K7FA 2Z0BA 2A9NL 4OLXH 4I18A 2V9TA 5IFAL 3FN9A 3TPUB 1N8ZA 2FB4H 2D3VA 1DL7L 1T89A 4HPOL 3QHTC 5L0QB 3FAWA 4KPHL 1KFAH 1TQCC 5LXGL 2VE6B 4U31A 5DJ0A 4QRPD 3ARWA 2WNGA 1K8DA 2P8LB 4H0IA 1BREA 3F12B 2ICWA 3L7FA 3SPVA 3O8XC 3WDHA 4E41A 2J4WH 4JO3L 5F1KC 4AH2A 3UYRH 3HCVA 1UG9A 4BK5A 4Q9BA 4HV8B 4PRNB 2X4RA 4RAUA 4LCUA 5CZXC 4G8GA 2GY5A 3B9KD 4OSUL 1AGCB 1DFBH 5D1XB 1N5AB 3HNVH 4LCYB 1MHEA 1YYML 2ENYA 4NBYB 3C8HA 4K7PY 3RGHA 3QIUD 4HS3A 4ODXB 2XN9E 5I66A 4EI6A 3MJ9A 4IMKA 4XWGH 5BJTA 1JWUB 1M7IB 4ENEC 1OAXH 2FGWL 1IE5A 2EKSB 4Y4HC 2NXYB 4PB9L 4KH2A 4Y5VA 4MX7B 4ONHA 2DTSA 1HDMA 4B0MM 3AM8C 1JMZA 2ARJB 3FZUD 1B9ZA 4BFIB 4FRWA 5KVEH 1QOKA 3DX7A 1TXKA 3UTTB 3NIGF 3QUZC 1T4KA 4FQJL 5F89B 5TDNB 3WIFB 1SY6H 3CSGA 3PABA 3GSRA 3F7QA 4K2UL 5EPMB 1G7HA 5BCAA 2JJUA 1INDH 4QTHB 4FQQA 3WJJA 4AIZA 4FQ1L 4NWUH 3WN5A 2W07A 4G8FB 4HT1L 3VXSD 2PKDA 1ZA6A 4I48B 2FLRT 1P9MC 4RGNC 1CFSA 2R23A 3DV6A 1NKOA 3TC9A 3B5GA 2WWMC 4PUBH 4P9ML 1S7UA 2KQNA 5DJDA 4XVJL 2X4UB 4LLQA 4LF3B 4QHKI 2BJML 4DWHA 4KVCH 1QBML 1NC4A 5FYKH 2W38A 5DJZA 1CLYH 4PBXA 1JUFA 3T0AA 2DD8L 3GDBA 1OW0A 4X6DE 4YLQT 2VXSH 5JLZA 1S9XB 5D7JD 2OJEA 3OKKB 1FH5L 3KYKL 1KIQB 2MOVA 2DMCA 1NGXB 2DMKA 1GH7A 3SKMA 1XF3B 2XFXB 2VLKE 5A2IH 1FRGH 1EUTA 5IJVA 4FFVC 3ULUD 4PJHF 4OD2A 5ESVB 1PD6A 1J0IA 4XP1L 1J1XL 1KJ3L 2FO1A 1GL4B 1BOYA 1H3TA 4HUWA 4GS7B 3HUJA 5I8OH 3QCTL 3MRQA 2XN9B 5ID1B 3HE7B 4IJ3B 5B4MC 4OQ1A 3DETD 2OZ4H 2NXZB 3CD4A 2FBOJ 3RIAF 2R0LL 3VRIA 3IT8D 3TNNB 1W72H 4Y16D 4J3OC 1U3HB 1U8LA 3SDXA 1CGTA 1T6WA 3LKSA 3D85D 1UQSA 3AS1A 5I1HL 5DRWA 1UM6H 1MQ8A 3PDDA 5DMJB 1A7OH 5D1QB 4BA8A 1G0DA 4O02L 3HE6C 3TO4C 4UT7H 2XTJE 5EZLB 3C8KB 3HFML 1NMCC 1IC5L 2UVEA 2WBKA 4ZDHA 5HPOA 4PJDF 2QHRH 1MCJA 1L0YA 2YSSB 3HZKB 4L5FL 1QZ1A 4M1CD 4JVWA 2I5YL 1GGIH 4NC2B 1FZJB 1MY5A 4ETQB 3PDOA 4HFWB 2MNUA 2NY6D 3VXTB 2PXYC 4TNVF 1VFAA 3IU3B 4NQDE 1FIGH 43CAB 1IM3B 2IQ9H 3FO1B 3IFLL 2V5YA 4I77L 1RFDH 5I9QC 3TEUA 1FGNL 2ATKB 3MLTA 2AGJL 4X6DB 5KSUA 4Z7OE 5A2LH 4NO2A 4P99A 3O2VH 4XNMA 4H8WL 1E6JH 1N64H 4DTGL 1IL1A 1SJHA 5GGTA 1FORH 2MFNA 3U7WL 4EN3A 4KMTL 4JFQB 1X5AA 2VLKB 3I3EA 4XGZA 4CGTA 3ESUF 1OARH 5JQ6H 3CAFA 1RZGB 4HUXA 5HHOE 2YBRB 4ESKA 4X4YB 1BQLL 2HVKB 3W2DH 1FZKB 1T3FB 4R3SA 3MRRB 4FTVE 1F6LL 3RDTD 4KUCD 4FABH 1MFAH 2R1WB 1E28A 4BFGA 4LAQL 3HMWL 2ADGB 3Q6GL 4Y4FB 3CC5A 3KR3L 1JK8B 5IBTL 1OAQH 4ISVB 2DJUA 5HDQL 1AC6A 2B7DT 1V5JA 4ZMAT 5DJ8A 3PGFL 4XP6H 3VMOA 2AJ3A 1XIWB 3MR9A 1FP5A 1J1OL 1R5VB 4R4BB 3T1FA 1CFTB 3HB3D 1XF2A 4OGZA 1TZHB 3O9WB 4Y4KB 5B8CC 5BMFH 3I02B 5CEZH 1BQSA 2Y7QB 4HHAB 4L3AA 4WCYH 4GMTL 3BESR 4P3CL 5GRXG 4PLOB 2XTJB 2D31B 4B50A 1WAAE 4UV4L 2YK1L 5HHVL 1JPSL 2NY5L 4MJ6A 1G7IA 1D6EA 1YEFH 3ZTNL 4HEPG 1BBJB 4HKXB 4LGPB 4MB3A 1VADB 3QUXD 5C0AE 4U1JA 2GCYB 3MV7E 2CR3A 5ESQB 2R0ZH 5IKCA 1UJ3B 3LKNB 3FB6B 1BGXH 1H3PH 2A83A 1UM5L 4LVHC 3FT3A 2BP3A 3PUCA 1GGTA 2AK4D 3GGWA 3O81A 4ACPA 1Q72H 4TULL 3TT3H 4RWYL 2WUCL 2EYRB 1LNUB 1MUJB 3BUYA 3VWJA 1CF8L 1RHHA 2CRYA 3QIWC 3W0WD 1HHJB 3KS0J 1D7FA 3EYQD 1BD2A 4XX1G 2DM3A 1BFVL 4HJ0C 2DICA 1B4RA 1R24B 5I30H 3ULUL 1RHFA 1JP5A 1NFIB 4HH9A 1OD7A 4MYWB 1S7SA 4HUUB 4LLDB 4OTXH 4JFXA 5F3HA 2EDQA 4UNUA 4R2GB 4TTDD 1ED3B 1UB6B 3HZYB 4FTVB 3S36X 2DM2A 2BZDA 3B83A 1SJXA 3L5XL 1D5ZB 5EOQL 1JNLL 1MIML 3UZQA 5ID0B 4J3XA 3JSSA 4L8DA 2AJXH 1CN4A 2B8OT 4WFFD 4ZUWA 3EKCA 5DJYA 1U8NB 1T1YB 3IXTA 2EC9U 5ICYB 3ZSTA 2A73B 3TH4T 5FGBC 4KJWC 1AE6L 2E3VA 3QIBB 4U3XA 1A1NB 2JCCF 3H9YA 3NFNB 5E8PB 2JJSA 1I3UA 43C9B 1BQUA 5HVHB 5L2JA 1JZ3A 3BQUA 5I8KL 4LSRH 1AGDB 5D1XC 4YO0B 1JNNL 5J6GB 5DK2B 4PRPD 3TESA 2ADFL 4BQ9A 2ZZUT 4LHUA 4JVPA 3PP3H 3V4UH 1UXWB 3L9RA 1LO2L 2VRAA 4LDOB 2H26A 3GSUA 3HS0B 3L3KA 1NGQL 3CPLA 4HDIB 5E6IC 4Q9RH 1EEZB 3EYFB 3U46A 1A9EB 3VI3F 3NABH 3I6KA 2R1XA 3IDGA 1JF1B 4Y19A 3MFFB 3O2DH 2QL1A 2Z4QA 4PREA 3RKDD 2KUTA 4WWID 4ZFZA 1MVUA 3LEVH 5JTWA 4P4KB 3LEXA 2GT9B 5ALCL 4UIMA 2D7NA 2YHGA 5FGCB 2FWOA 4O5LL 2VB5A 3SGJA 2G5RA 4XPAL 3ZTJH 4ODSH 3V6ZB 2WIMA 2F54D 3HR6A 5T5NG 1BZ7B 4Z7VA 2YZ8A 3BXNA 2FJFA 1FVCB 4PV8B 3MBEC 1X6NA 1KB5H 4ZUUB 1MH5A 4QHKJ 1AJ7L 4YFDB 4GQ9L 1I3RB 4GBXB 4I0KA 1CFNA 4JCMA 2VDPH 4BYHA 5F9DC 3WUZA 4PJ9A 3FT4A 3O3AA 4UQ3B 4G9FD 3QQNA 4F9LC 3BZ4A 5CMAB 3P0YH 1RSFA 2Q7YA 2N1KA 2ZJSL 2EIDA 1ZEAL 4EBQH 2APBA 4C83B 3RWDB 4S1DD 5DFWH 4Z7WA 2JK5A 3WFHA 4S1RL 1U3YA 5C0BE 2UV3A 4X0KB 3PIQA 5DS8A 3S97C 5C6TL 4LLAA 4CJ1A 5I76A 3B9VA 4PD4K 1YNTA 4NQED 1RJLB 1WWCA 3M17A 1CD1B 2HT4D 1RJZB 4QRTA 4JFEB 3ZDZE 5IHUL 2NW3B 1Q1JL 3HI5H 1K3IA 1KJ2B 3BP6B 3W5NA 4JDZB 4JR9L 2ZUWA 4M61B 3HE7C 4POZD 5FHAL 2NTSP 3QJFA 4OLUL 2A6JB 4QRPA 1GAFH 2CLVA 1LO5B 1EVTC 2VIRA 4GW1A 1CXIA 4NO0D 1U3HC 5L8KB 4G43A 5T1DL 2FRGP 2YPLE 3QHZL 4JFDE 3BKJH 4K3DH 4L1DA 5DURB 3LQMA 1I1FA 2D2OA 3HG1E 3NH7L 4YH6A 3X3FH 3B9KA 3O3DA 3VFWB 2BOBA 4CMHC 3DGCR 3D18A 5C0GA 2H2SD 2NY2D 4K3GA 4KTYA 5IROA 1NC2B 3LS4H 5C8JA 2IPTL 4IRZH 1NGPH 2EH7H 2B4CL 4YFLI 3PGCA 3QIUA 1IGYB 5FA3B 3T65A 3U9UA 2J2ZA 4NKMB 4ZUTA 2P5WA 1RVFL 3VXUD 4GG6E 2BOCB 4KC3B 3O6LH 1GGCH 3DLQR 2VDOH 3RBSA 3TA3B 3ARSA 3BEVB 3BP4B 1QP1A 1F4WH 4MLSA 3C09C 4NWTL 4NZJA 4HBQA 1R0AL 1MFDH 4QNPE 3S88H 5E2TL 3V5HB 5J3HC 4H1LA 4PJIE 4JM2F 4UTAL 1JPST 2I27N 3GSQB 2P48B 3SJVE 2FO4B 4Q6IA 1ACYL 3F7YA 1D9KB 1GGBL 3WHE0 2OI9B 3SDDD 5JO5A 4XNXH 3QQ9D 3VXSA 2W59A 5I1DB 3KAAA 1UZ8A 1NGYB 1H3UA 1PSKL 2HFEA 3OPZH 4LPUA 3MOBH 4AEEA 3BGMB 4JFFD 1UENA 1LQSR 4CDHA 4EIZC 1JGVL 1YJDC 4HMEA 5IHLB 4JPWL 3GIVA 1T1WB 4XBPB 5DUBB 4XZUB 3AUVA 3UPCA 3KPSE 3FKUS 4HWZB 3GBNL 4ODVL 4JFDB 3IDJB 3RI5K 2WUBL 5D7JA 5EN2B 5GJSH 3HG1B 4Z0XB 1M05B 5ENWA 2C1OA 5IEKA 3MV8D 2F53D 2HFFB 2VOTA 5B3JF 1CL7L 3NFPB 4Q6YA 3H0TB 5ISZE 4F7CB 2H8PB 1A7RH 3MUY1 4QHMA 4JAMA 3C5ZB 4PLKD 3GUTB 3V6FA 1XGUB 3KS0H 3FOMA 1ORQA 2XTJC 5T3ZD 3OXRA 1YJDH 4F7PB 2DJ4A 1ZHLA 4F3FA 2IBBA 1T1ZA 1ZT4B 1DLFL 3BMWA 5D2NE 4KQ4H 3QXDA 4F37F 3P9MA 1MCHA 4GG6B 2G75B 1XF1A 5FGRA 4J4PD 3PP4L 4Y16A 1C5CL 4OZGA 5CEYA 2XA8H 2DQUL 2EDBA 2NCMA 3U4EA 3ZMRA 2J8UA 4NQSB 3D85A 3DX9A 1I1AA 1HQRA 4K23L 4O2CB 1ZLWH 5TDOB 5I1JH 1ZHNB 4RZCB 1T03H 5E0QA 4X9BA 2NY0C 4PJIB 3DUUA 3QQ4A 3QQ3A 5DTFB 2R4SH 3EO9L 4G7VH 4UNVA 3TN0D 4AEHL 4PJ5D 3BPLB 4BH7B 1RZ8A 1UKTA 4MB5A 1I3GL 4M1DL 4DN3L 3BH9A 1TCRA 4L9LA 5D71L 4MNHB 4WDIA 1N6VA 5SV4A 1F8TH 1TZIB 5BZWA 3TBWA 5ANME 1LP9E 1RUQH 2NX5E 4YHKH 4ZS7L 5DJ2A 2IF7A 2WLYA 1JWMA 3GSNH 5L9DL 3V6OE 3B4NA 2XY2A 3BDBA 1SEQL 3N9GL 5EFIA 2Y06H 1DJSA 4LU5L 4KDVA 1XGYH 1K6QH 1OT2A 1S78C 2G5BA 5MENE 5KG9A 4OZHE 4N8VB 4XB8A 4IOIB 2X42A 3ARVA 1Z0MA 4ODUB 1RU9H 1FDLL 3WUWA 1YA5A 3AS0A 4HSQA 3W9EB 5ISZB 3P9LB 5GZOC 4W4OC 5IR1B 5LAXB 4OGAD 2FYYB 1ACZA 3DURB 4PJCB 1YZZA 3RL1B 4HUVA 1AGFA 4LLUB 1F4YH 2EDDA 1YQVL 3GBMH 3G5XA 4LCIL 5FOBA 1FG9C 2VH5H 1CGWA 3GNMH 4R4NC 3MXWL 1FNFA 3B6SB 3FONB 5JOEA 3O0RH 1F90H 3ZYIA 1QUNA 3GSXB 5TF1L 3WNKA 2DQIL 3ZKSD 3MLZH 4OQTL 4WFHD 1C08A 4PP1C 4OV6F 4L3ED 2MQCA 4RMRA 5GSVA 5DQJB 2AEQL 1F97A 3S5LB 3CGTA 4UINL 2V9QA 2DI7A 4F7EB 1MCCA 2AV1A 2P47B 4KK5C 4CVXA 3O11B 1CLOL 3EYSH 3C60D 5CZKA 3BGFB 1RURH 1E0OB 1GHFL 2MMXA 3C6LA 2YZ1A 3HC4L 5TE7L 3EJZC 1U91A 1Q9WB 1DQDH 2D4FA 5GXBB 2E8YA 1MFCH 3QUMB 4Y1AD 1RIHH 3AY4A 5FYJD 2CDFB 3KPOB 3QUXA 2FEDC 4KJYB 4G9DB 5BV7C 3DSFH 2J5LC 4W70A 4D9LL 2W92A 4YHLH 5I8EB 3C5JB 1U8PA 3FN0L 3EOTH 1CFVH 1A7NL 1LP9B 2NX5B 5DD5L 3MA7B 1MI5D 4PJXF 1KOAA 3L7EB 4Z5RB 2BSTB 4N1CA 4RFOL 2AK4A 1RJCA 3QO0A 7CGTA 3VWKD 4NFCA 2B39A 1B4JL 4JM2D 2XOTA 5JIIA 1FLRH 5INDB 1MQKH 2W9DH 2DQCL 2CKBL 5MENB 3T2OA 4OZHB 4D0DA 3W0WA 3D3VD 5CIPB 1QKZH 3NCFB 4TSAL 5D2LF 5CBAB 2BVUA 3OJVC 2HKHL 2OM5A 4APQB 1Z9MA 1ONQB 1WSST 5T5FH 2VZVA 3RIAK 1CDYA 5JORA 5BV7H 3CFJA 4URTB 3RBGA 1AI1L 3D1MC 1YNKH 3G6DH 1JBJA 5C2BL 4OM0H 4BSVB 3OKEA 4JREC 1A6ZA 3IS1X 2V2WB 5DR5L 1AXTL 1HHKB 3VFSB 2Z31D 4XH2B 1UADC 4DUVA 5DMGD 1KCRL 3GSOB 2DM4A 2B1AH 5LVEA 4K7PH 1MCPL 3E8UH 3X14B 3LQAC 4S0SD 3VDAA 1HQ4A 2H2PC 5D8JL 4OKVA 4IDJL 5K9JH 3WD5H 2DQTL 1VFBB 1WTGT 4ZFGH 1MCFA 4U0QB 2I9TB 2C3XA 3MROB 1UT9A 5H35B 1BM3H 5EULV 3NACL 1IVLA 1TVBA 4ZTPL 4Z78A 1SEBA 3RY5A 1KJ2H 4PRPA 3GHBL 3QJHA 3ET9F 2UZXB 1TNNA 3U0TA 3T0EE 3VXNB 3O8XD 1X4YA 5E8OA 5GRUH 1FFNB 1EBAA 3LQAH 4DQOH 4ODWA 3DI2B 2HWZH 5CZXD 1GOFA 3MV11 3SOBH 1I8MA 2HVJB 3EOBA 3OX8A 4HWBL 3H7LA 3TIDA 3OAUL 2AQ2A 4LQFH 4PGEA 1I3VA 1V3JA 1X5KA 4X5WB 3TYFA 4MHHG 4P2QE 4WO4C 4LSDA 1SJEA 2PTTB 1DQQB 2XKNB 4WW2C 2F54A 4D8PB 1JWSA 3MRCA 2OL3H 1QR4A 4ENED 1QQDB 3LN4A 1D5BA 1AC0A 4Y4HD 2VZUA 4CW1B 1SVCP 4C4KO 5EZJB 1QRNE 3BKYL 3RRQA 1GXEA 2LU4A 3KPQA 2A74B 2Z92B 3QUZD 2VDLH 2C3VA 5FYKD 4KDTA 4XXCA 1DN0B 3ARBB 4GAYA 4Q7DA 5B21A 2ICWI 4GAFB 1DEEB 1MY7A 4NJAL 2EE9A 1H9VA 2AERT 2N7BA 2Z8RA 3N1QC 4WEUD 1YEHH 3B9EA 3QRFM 4RRPG 3CSYB 4XBEH 1KTDB 4GKSB 4JB9L 4RGND 4JKPH 4JRXE 5IVZB 1MCOL 1S7QA 2Y5TA 2WWMD 4G80A 4JLRB 4NQEA 1KIPA 1HNFA 2NTFB 4XXDA 3TNMB 1KTRL 3K2MC 5KSBF 1NLDL 2OTWA 2AI0H 4NKDB 1TTFA 5F6IC 2FJGA 5D2LB 3T0EB 1ZANL 4OZFH 4DN4H 2QSQA 2VXVL 4KXZI 2ICES 3NN8A 1X5JA 5HDBE 2OJZL 3WS6A 4NO0A 5I1AA 2XWBA 5DD3L 2CRZA 4R90L 3IJSA 5BVJA 4MCYB 4RRPA 3ORJA 1JIBA 1NFDE 5EBLA 4MA1B 3QXWA 5FCUH 1RIUH 5EO0B 3QDJD 4R4FH 4FFVD 5ILTL 2X1PA 1QA9A 4YWGL 2HN7A 5KN5A 5DQ9A 2H32A 4O9HL 1IQDB 2QBWA 1N7ML 3IXAA 4YGVB 5GGSA 2AXHA 5DJAB 3NVQA 4R0LB 2ORBH 5B4MD 2HG5B 3BHBA 3P0GB 5C0EA 3T08A 1ZAGA 1QRNB 2Q8AL 5EUKA 2VZ1A 3STLB 4WEMB 5JW4N 4GMSH 4Z6AT 2E9BA 4CN1A 3VG9B 1UCBL 3WXVL 5FIEA 1MCEA 3A6OA 1F13A 4ZS6C 3BWAB 3NOIA 1RZIA 1UC6A 1UZ6E 2R69L 3PWJB 4YPGA 4N90E 4K94C 3RY6A 1YMMD 1G7QB 3HE6D 3T3PF 1HSAA 5HVWA 3TO4D 5E8NB 2JIXD 2IANE 3LKQB 4IDLA 5F8RC 3JV4B 1A1MB 3U36A 3LSOB 8FABB 4HIJB 4BQBA 2GTWB 3BVNA 3FQNB 4OGYL 4KK8C 4JRXB 3SDDA 5C6PB 2F5AL 3JXAA 1F2QA 1JPGB 3OL2A 5JPNB 3EZJB 2UUDK 1O5DT 2KDGA 4NT6A 2CRMA 2PXYD 4W6XB 1SM3H 3V5DB 2F74A 2J88L 5J9PB 2ZOKA 2XZQH 2UWEF 3RL2B 1OSZA 5HHQB 3NAAL 2ZUQC 3MCKA 2W60A 5D2NC 1NEZA 5KS9F 2VLLA 3BE1L 4RMQA 3DX8B 4P48A 1AFVL 4KROC 5JHDE 3DX6B 3VFOB 1QLRB 5I8CB 5JZ7C 1QEWB 1NFDB 2JCCA 1ETZA 1G7JA 2CKBA 1I1YB 1TQBC 3RIFF 1VPOL 1JF5A 3MV8A 3U6RA 3V4VH 2F53A 2L0DA 5FV1L 1W0VA 3DOSA 4DAGL 1AR1C 4DOHB 5CEZD 1ZVYA 3LMJL 5GGRA 1I8IA 5FKPA 3D0VB 4M9OA 3AXLA 4X9GA 3TBSB 4PV9B 5A2KH 5TQ0H 3MMEA 1ZHKB 4UOW1 3DGGA 1F45A 3IDXH 3QZWA 1DVFB 2V7NB 1MAML 3OF6D 3BN9C 1CU4H 2EDRA 5DVMA 3IGAA 2XYCA 4J4PA 2NMSA 1YN7B 4KGLA 4I5BA 1TETL 3S96B 1DBJL 2IQAB 2Q76B 2M26A 3H2WA 5B39G 3RWEA 5IMMA 1WFTA 3V6OC 3WEXB 3G6JE 4K8RC 3S37X 3BEWA 2IANB 1IAIM 2DS4A 2X1XR 1AD0A 2R0KL 3WNNA 4OI7A 3TN0A 1EMTH 4PJ5A 5F7YC 4XHJC 1RUAH 1EA9C 1KN4H 4HKBA 3RX5A 4UU9B 2F9BT 3V7AE 1P53A 4APQC 3NA9H 3ARDC 5DHVA 4C58B 5MP6H 5DLMH 5FV2A 1HIMH 5ETUB 2HTKC 1TZGL 3MGOA 1WZLA 4WV1B 1SVZA 1I1CA 5CINL 5GS0L 4RGMB 4Z7UE 4LIQL 1KPVB 3KWWB 4UILL 4K8RH 2D0FA 4HULB 4J8RB 2V2TB 2GIYA 3QIWD 2YD1A 5B38A 4MNGE 1XZ0A 5L8LB 2V7HA 3UEZA 1C8PA 5CIPH 4YHPA 4HJ0D 4DGYH 4YQXH 1KGCD 5MEQA 4I3RL 2Q20A 4M7ZB 4QRSA 2EYTA 1S5IL 3QDME 3QB7C 1GRWA 3GMOB 1P4LB 4LSPL 5DDHA 3I6LE 1N3NA 3OKMA 3MLXL 1F3JB 4JQIL 2B5IB 4LP4A 3U4AA 3UMTA 3PV6A 1MHCA 1S9WA 3GI8L 4LKXA 5C07B 3G08B 3I75B 3U7YH 3GJEB 2V17H 1IAMA 5J6HA 5IQ9A 3VGHA 5FFLA 4FQ2L 5HYIA 1ZGLP 4KFZC 3C5SA 3ISWA 1GZPA 5HYSB 4PR5A 1OTSC 1U8KA 4NZTH 3DO3A 2QQKL 4OT1H 3WKNA 1CTNA 3KNBA 4FXKB 4JPKH 1NSNL 1KCUL 1ZT1B 4YDLB 1R3KB 1INQA 4KJWD 4N8VG 3PWLA 2IQ9L 4RIRB 4L3EA 4FZEL 1QSVA 2CUMA 4OLVL 1QFPA 4Z76A 3ARTA 4TVPE 4QEGA 4LSVH 5D1XD 5LCVH 3REWB 4QXTB 4OZIE 2HH0L 2NLJB 1IQWH 1LEKB 4JFPA 5L6YH 1KELH 5JQHC 1L6XA 3QAZB 5KS9B 2X1WL 3C60A 5ALBH 4WWKC 3MYZA 4NP4L 3BPCB 2XY1A 2GTZB 4Y1AA 3MCG1 5TGBB 1NCWH 5E6ID 5FKAA 3EW3B 3RPIA 3PGDA 3G5VA 4E42B 5IB3B 3FTGA 2QSCL 3D39E 1FC2D 1OP3K 4JEGB 4L3CA 3BPOB 5EZIL 1ZWIA 1EH9A 3TBYA 5K9KA 1MI5A 1T20A 4NC0B 1S9VA 1FYTE 4Z7UB 4WNQA 3VFTA 2MWCA 3CH8A 1PZUB 1KCVL 2FX8H 3SQBA 1MLBB 4JM2A 4MNGB 1FL6A 3CX5J 2ED8A 1WBZA 3U7AA 4FZ8H 3VRJA 3KPPB 4ELMF 4XAWL 4PY8I 3D3VA 3MBED 4QTIH 3H9ZA 3K1KC 3QDMB 4Z7NE 5SX4I 1IGIH 1P84J 1VGEL 1HSBA 4AY0A 2ZCHH 4F37K 1S7VB 2X4PB 4NNPH 3CXHK 4E0RB 1UM4L 3UTPE 1U42A 2MPAH 2WINA 1T6VN 4OV5B 5HYEA 1IT9L 3F7PC 4CN4A 2Z31A 2R0ZL 5DK0B 3RUGE 4H20L 2YKLL 4A6YH 3T3MF 3FQUA 3T0XA 5F9OL 1NCDH 3Q5TA 2W91A 5E8EB 1AQKL 5FO9B 2R56H 3BN3B 3OAZH 3HAEB 2BY1A 4JG0L 3DROA 4U0RB 4AL8H 1JPTL 4IIQB 2HRPL 4OCYL 1NKRA 3WKML 1W8NA 3VDCA 1KEGH 2VC2H 4XPBL 1BPVA 2RFXA 4OZIB 3K4ZA 2HJKA 4NHCL 5F96L 3JTTA 4P5TB 4ZSOA 2XN9D 3F7RA 4MWFA 2DB8A 3HE7D 2ICEA 2VZTA 4MD0A 1I1RA 5ADOL 4NUJA 3PHOB 4HK3J 4ZPVA 5C7XL 3NZ8A 5D5MA 3DYPA 3O8XA 1U3HD 3RWFA 4NCC1 2VDKH 1J0HA 5D1ZB 1FE8H 5BXFB 3MRDB 3IDYC 5I18H 5D6CA 5DUPH 3OAYH 1OM3H 1MPAH 2CJUL 1JNHA 2AJXL 4RA3A 1FYTB 5F7EL 1N5YL 3HN3A 2OTUA 1SY6A 2RIKA 3ETBF 3E6FB 4ZFFA 4KZDL 4OD3L 4M7JL 3D0LA 1YY8A 2Y72A 1S3KH 1WQVT 4P2YA 4M5ZH 1JTPA 4YAQA 1Z3GH 4M7KH 4YBLC 1HHGA 1M6OA 5AD0B 5KSAC 1EJ6A 1CZ8H 1I8KA 3DVGB 4J6RH 3IAQA 5CJQL 4HIEA 1KT2B 4HUNB 4P49A 5E56A 2NY4C 2YA1A 4Y4HA 1BMGA 3JTSA 1IGTA 4MDIB 4C54A 1OQOA 4BQ6A 1HOCB 3WV0A 1TPXB 3NCMA 1G6RH 1N59B 4TN9A 4WJ5A 4Z8FL 1CD8A 4ELKB 2XNAA 4QXUL 3NCJL 4JHZA 3X11A 5J3HD 4L8BA 1T21A 2DTML 1IKFL 1X7QA 3C08H 1JI2A 2YN3A 3IDMA 1X5GA 4HIIB 1MOEA 1YEDB 3LKPA 4XC1H 1YPZE 1UYWH 3W5MA 4GAJL 1EHLL 2V5TA 1FO0B 2DWDB 1P9MA 3BD4A 2D0HA 1QHOA 3GMMA 1CR9H 3LDBC 1OPGL 4F15C 2BNQE 3GRWH 4PP2B 4XP4H 3IU4L 4XCCH 3K8MA 1F6AB 2IMMA 3NZHH 2UYLA 4K55A 3K0WA 5C08E 4YHNB 1DVFC 5ESAA 1MJJB 2OZ4A 4KVNH 2OR9H 4I8DA 3DJ9A 2LE9A 4V1DE 2OQJB 3O4LE 4MCZB 1W72A 5F7UA 1EAPA 4NRXA 3MQIA 1SMAA 4PJBA 4WU5A 1CI5A 1AKJB 1NGZB 1U8IA 1U92B 4GW4B 1A6TB 4FNLH 3SN6N 1DBKH 3S36L 3WBDA 5CEXB 3PDGA 5BO1H 3S7GA 5C1MB 4HPYL 5FF6B 5EC1A 5GZNC 1FVEB 3L6FB 2YUWA 3QDJA 2XWTB 5EIVA 3BZEB 4YDVB 1FYHB 4I2XA 4NN5C 1F02I 4PIRF 3R0NA 4YZFE 1F4XL 1YEKL 2XTJD 1QSEE 2D7QA 2ESVE 2HLFC 3INUH 3KYOA 2BVTA 3EUUA 3ROOA 4NBXB 5C0NC 3RY4A 3OXSB 5DEGB 2BNUB 1IGCL 1QVOB 3VCLB 5SV3A 1A3RL 1I9IL 3QEHB 4P23C 4OF7A 4XHQA 5I1EL 1R3JB 3GMPA 3TYGH 4NQDD 4HKJA 3MRBB 5MEPB 4F33A 4PGDA 3CJJA 4PRDB 4HW6A 1ZS8B 3QDAA 1FV1A 2FL5B 2NY0D 4L8SC 5CP7A 5DFVC 1G9ML 2HMIC 1XR8A 3HE6A 5KAQG 3TO4A 1QLFA 2E7HA 2FX7H 3TP4A 5IWLC 4X7CC 1LO0H 4O58H 1YPZB 4WW2F 4TOYL 5H94B 4JZNB 3OJ2C 4OB5H 2JB6A 4HWEH 4O4YH 4LMQE 4WVRA 5DRZB 1RMFH 2GSIA 5FECA 5IJKC 5HHOD 1U9KA 1NDMA 3KYAA 1HZHL 3I2CH 4R2GD 2ZOLA 2O5YH 5C92A 4HJGB 4W68A 1M71B 2RCSL 3QBTB 1Q94A 3BH8B 2P5EE 4WUKH 5SWZE 2PXYA 4ZFOB 2DKMA 2P8PA 5C08B 1AIFB 1C16B 5AUMA 5I1LA 2WMPA 4V1DB 1AO7B 3O4LB 1S78D 2VDNH 3L1OL 1UACH 5T1KB 3DHMA 4NM8H 5T3XH 5CGMA 2BHUA 3NIFE 1TVHA 1FSKB 5GZOD 4AQ1B 3GKWL 4TUKH 2IEPA 4N0YL 1QSEB 2ESVB 4PJGE 2BSRB 3PHQB 2C4FT 3S4SB 3T04D 3B2VH 4R4ND 2MSPA 3Q2CA 5I1CH 5C0AD 4MXWH 1I7UA 4XNUH 3NPZB 3BIBX 1OAUL 3MV7D 2H41A 5KVGH 3OF6A 4PP1D 5I73B 5IGXH 3BMVA 3LN5B 4LP5A 2M1KA 3WN5C 1PEWA 3BPOC 4KXZH 3MRJA 2Z8VC 1BLNA 3DRTA 4U1SA 2R1YA 2AJZA 4XC3L 2EDKA 1RJYA 2XXCB 4KK5D 3O6FB 5E2UH 4PY8J 5B8CA 1MRFH 5INCA 2ERJB 5F9JA 3EJZD 1IEAA 4UTBL 5SWSE 3Q6FB 1H5BB 4EI5B 3BJLA 4QT5A 1KPUB 3F5WA 1NCTA 3T2QA 1I4FA 2FEDD 1DQLL 2Q86B 4GBXD 3RWJB 4XCNA 2ENSA 3L3GA 3WIHL 2P5EB 3H7BB 4HC1L 1QYGH 3VGAB 5CD3B 2VDQH 5SX5H 3UC0H 2DQFB 1BEYL 3I9GL 2XA8L 4JN1L 2Y07L 1CVSC 5DVNA 2DJSA 5EBMA 4FG6C 4MA8L 2EO1A 4LKCB 3P4OA 3QIWA 4HS6B 5DT1H 4GKZB 2E27L 3L3DB 4U0RC 4M1GL 1B3JA 2AJYH 3BPNC 1UKQA 1AGEA 2PUQT 5BS0E 2CH8A 1I9JL 1X3DA 4XP5L 4K71B 3GB7B 4P2OC 4XCFL 4YDKL 3QG7H 4Y5XB 1NBVH 5KSBA 3TPUA 4PJGB 3QI9C 2AQ3A 2XICA 5DUMH 2FGZA 3ZTJG 4RQQA 3CFCH 2D9QB 1F8TL 1YDPA 2GK0B 4PJFE 1FC1A 2YA0A 1N26A 2H2PD 4P9HL 4XPGH 1XF5A 5FGBA 4PRNA 5GS2H 2AVGA 1OF2B 2JE8A 3O2DA 4LBEA 4TVPH 5AZ2H 3PE9A 3FQRB 3GMNA 4OCWL 5D1XA 3MLWL 1A21A 1XH3A 1CXHA 1J12A 4DVRL 1A14L 2C26A 1CT8B 4QGYA 1GVIA 4FQXB 2XQBL 5SWSB 1ZLVH 4HH8A 4MNQE 2VKWA 3ZDYF 2X4OA 3HC3H 4C4KT 4HFUH 3VE0B 3TZVC 2X1OA 3ZT6A 1M7IA 4KRPC 3VXOA 1KB5A 5C0CD 1FZOA 5HYSG 1K9TA 3QEQE 1NCBH 4UT9H 4X6BB 3MRHB 1WVZA 1A4JB 1UEMA 3A6BH 3V9FA 4HMCA 3PWPB 3WIFA 1NL0H 3GK8L 4OCXH 1SBSH 2EIZA 3QRGL 2A2QT 4YIQB 1QFWL 5EPMA 3GSWB 4AMKH 3MRIA 4WO4D 4OLYL 5HHPB 4GXUM 1X5FA 3ROLB 3ALPA 4Q2ZB 2NYYC 4DGIL 1J05B 5C0BD 1LILA 3SGDI 2GYSA 1H8SA 3OJMB 5GGSY 5I6XC 4AK1A 4JFHE 4NJ9H 1FBIH 2ARJQ 2GJ6E 1FPTH 4I48A 5TQ2L 2NY1B 3MBEA 3S35H 3CVHB 4FQPA 4NO3A 5BS0B 3ULVC 4KZEL 3IJYA 2J8OA 4OUUB 1T5XB 2I9LB 3QYCA 1GGYA 5D6DA 4XPFL 3EYOA 3BI9X 5GGTH 4RMVA 2P24A 2X4UA 1XGTA 4LF3A 4DGVH 4LNRB 2UWEA 3TFKC 4OF3A 1PBYA 3L3JB 4F9LA 1ZXQA 4FFYH 2DQEH 3BZDA 1P6FA 1RZJC 2YPVH 5A43C 3MFGB 4PJFB 1Z2KA 2YPLD