5DI9A

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 63
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di9A00
3A8TA 4KODA 5C4GB 1DE0A 4URWR 2C99A 3CX6A 4YC7A 4JVLA 3X1DA 1OH7A 2O8CA 1AM4D 1KDTA 3CM0A 2DY1A 2Q0HA 2ZS9A 3ICEA 2VSOA 1G8GA 3U3KA 2ATVA 4A2QA 2NO0A 3R9XA 1U9IC 2RGNC 2P6NA 3GLFB 4EAQA 1JR6A 1DAGA 4QGFA 2C8VA 3O8DA 4HZUB 5B64A 1DAFA 1ZC3A 5FOTA 1COWA 3VNVA 1KI8A 3GLHE 4MKFA 1QDEA 3ETLA 1PJRA 1Q1EA 3P32A 2ODEA 1HA3A 1J2JA 2ZI9A 1U94A 1ELOA 2C95A 2J0VA 2XTMA 2JLSA 2OBNA 3K53A 2C77A 1YR7A 3FGNA 4RD2A 1OKKD 2GKSA 2JJ1D 4TLAA 2IX3A 2HJVA 4Q47A 4ITRC 3QY0A 3QBVA 3PVSA 2GRJA 5J4LA 3U3MA 1Q44A 1W48A 4PAOA 1E2FA 2RGCA 1AIPA 2UVQA 1OF1A 1NVUQ 4MQBA 4PZLA 2R6AA 5E7MA 2BBSA 4CT4B 4KVAA 2GWHA 5FL7D 4R71A 1W46A 4DKXA 2ZXUA 1Z0IA 1A7JA 1E99A 1TEXA 4KFUA 2OAQ1 4US0R 2FSIA 5EUQB 5DH9A 1OXVA 3NG1A 3K70C 3Q85A 1LFDB 1ZM7A 2ZE5A 3W9YA 1EX7A 1CP2A 1EFCA 3GJ7A 4TL8A 4C0HA 1SVMA 4B71A 1HTWA 5IK2D 3MWKA 5E7IA 3THXA 3FHTA 2PH1A 4IOLA 1YZQA 4LGMA 4GPTA 3I72A 2ZRCA 1VECA 4WZBE 1EX6A 1TU4A 5FR1A 1Q3HA 4OJKA 3OHMA 4LHZA 2FJUA 3HU2A 5KSZA 4ZDWA 2I3BA 3Q7QA 2D74A 3LBHA 1E0SA 3BORA 3CB4A 1V5WA 1SXJD 1AS0A 3QG5A 4BZPA 3NTUA 4F4IA 2YWGA 1J8MF 2AXPA 1OT3A 1E9AA 2JLUA 2REXB 2FFAA 2F6RA 4RVCA 1XEXB 3O47A 3B9QA 5KDLA 3U3OA 2CHQA 5TV2A 3QE0A 1AKEA 4CZ2A 3PG5A 2IYQA 5FTLA 4RFSB 4Z1MA 2VF7A 4Q7JB 3TH5A 3LVRE 2VYFA 1XTJA 1G7SA 1ZCBA 1W36C 3NBXX 5J4KA 4BE7B 4AIIA 5GVSA 1IN4A 4RZXA 5BN5A 4R7ZA 2V7QA 3ZS8A 1KNQA 1XZPA 1E2PA 1PVOA 3KXLA 4DLZA 1G19A 2PBRA 3DOFA 2GCPA 1P3JA 1FQJA 1DOAA 3BE4A 3AVWA 1HT2E 2FG5A 3RRMA 1I4DD 1NKTA 3CRQA 2JGNA 5L3QA 4WOPA 4BZQA 1GKUB 1RYFA 1W49A 3TNFA 4IOMA 4AK9A 4XJXA 1Z0JA 4LYAA 1J99A 3SQWA 3ZVLA 3ZZUA 1Z0FA 5AJWA 3CRMA 2VBCA 1FZQA 4BPBA 4HDCA 1BYUA 3T1VA 1N0UA 3NDPA 2QQEA 3OIWA 4BZXA 3VAAA 3BS4A 5FH9A 2YWFA 4RD3A 4NL4H 3QIAA 4JJZA 1QHHA 4NTZA 3TVDA 5EXPA 2F9MA 3PUYA 4LJ8A 5EP1A 3RRNA 1TUEA 2ZREA 4POAA 2AWNA 4IKEA 2CHVA 1E1QD 2W2VA 1BKDR 3D3QA 1KDPA 1KI2A 4MRRA 3P4YA 4LJYA 4YQFA 3H0KA 4C30A 2G77B 2G3YA 3ZVRA 3KQNA 4ZKEA 2IWRA 2R65A 1UADA 4ZPXA 3T5GA 3TMKA 3BOSA 3ZIAD 4TT3D 3R7WA 3KTAA 2BMFA 4JBWA 3L8YA 1SZPA 4GRAA 5TDHA 4MYTA 2RHMA 2ZR0A 3AH8A 1MV5A 1DAKA 1NBMD 2O8DA 3THWA 1NY6A 4NHOA 3NWJA 2J7KA 1NF3A 4M9ZA 2IW3A 4C7OB 3CONA 4QG7A 2ATXA 1ESNA 1N5LA 1TX4B 1XCMA 2ZYWX 4XD7A 2WM9B 4ARZB 1ZM2A 3BIFA 3K9HA 3A1SA 1NMXA 3ONWA 1JEEA 1AQYA 1R5OA 2HCBA 4PO1A 1MO5A 1P6XA 4K46A 4GFDA 2QL6A 3U6BA 4HDOB 1Q1ZA 3TQFA 1G5RA 4OQMA 1AS3A 1COWD 3GLGB 3WNBA 2WKRA 4MUBA 5FR2A 4X8HA 2ZR9A 4Q7MB 1FL9A 4OQXA 3UWOA 4DHEA 4JJKA 3U7GA 5DYGA 4B3FX 3U44A 4GL2A 3EG5A 5JCZA 4DDUA 1W1WA 4HB3A 2JLXA 2CK3A 3WMEA 3V4RA 1DAIA 5P21A 4ZCLA 4F4CA 4Q4HA 3ND8A 1NN0A 4HAWA 4FW9A 4PHGA 4PSAA 2ZYUX 4PO8A 1LVGA 1HEIA 2BBOA 2QA5A 3MJHA 3LAWA 4ZDIA 3EPJA 1TQ6A 4JLVA 2GVDC 2Z0MA 1G7RA 2GZHA 3VR2A 1RIFA 1E2IA 1KOFA 1N6LA 3SJZA 1E2KA 1VIYA 2ZI6A 4YMWA 1IQPA 4LHVA 3WYAA 4FWIB 4DIEA 5CITA 1TNDA 1ZUNB 2QTFA 1KO1A 4Q1AA 1WP9A 1QZXA 2J9RA 1E9DA 3C5HA 5F2EA 4DLUA 3GLFA 2UZ3A 4OJQA 2A5GA 1X3SA 4M1OA 1S1CA 1ESMA 1XCPA 3FB4A 5J4VA 1LW7A 4HLDA 1M6NA 4HZUA 4CGZA 2ZS7A 1KSJA 5K8IA 2AD5A 4US1R 3WHKA 2OCBA 4AG6A 2ZVQX 2EFEB 1OFIA 2HCJB 4BLSA 1ZP6A 1D2MA 3JZMA 1XJ0A 3NVAA 2ZU0C 3U7HB 1AZSC 3FTQA 4YMVA 5EP3A 4M4SA 1WXQA 3OEEA 3CF6R 4NDZA 1LV7A 3FKQA 1E9RA 3FOZA 3I1FA 1L7VC 2OAP1 1II8B 3FMIA 1E1RD 5CIQA 2W2TA 4QBGB 3PEWA 2QM7A 1SXJB 2DFLA 2DYKA 1E69A 1G4UR 2PX0A 2GBLA 3RS0A 3A37A 2ZI5A 2JIZA 4NZYA 2ODWA 2BMDA 1IJEA 3ZH9B 4LBWA 4GZMA 1IXRC 1NVVR 3QKUA 5EXTA 4B47A 1KSHA 3B8HA 2PLFA 3OAAD 4WXPA 3U6KA 1YVDA 5BW8A 2ZJ8A 4KFTA 1X8KA 4TYYA 1XB2A 3ZLJA 4H1VA 4GMDA 2LKCA 1T5LA 1Q3TA 2UZIR 4BFSA 4DCVA 1XD2B 4XIGS 2H92A 3IILA 4MGKR 3N2IA 2QROA 1YKSA 2I1VB 5EP4A 1YZGA 1NLFA 2P6RA 2V7QD 1FUUA 1WA5A 3AF0A 3ASZA 4GZLA 2ZYVX 1CJKC 1VYVA 5SZHB 4RD0A 2PZGA 1R0ZA 3KUDA 3G0HA 2JLWA 3TK1A 1GTVA 1SHZA 3B85A 2MMCA 2CE2X 1YZKA 1KI9A 4YXWA 3W34A 4G5QA 2GK6A 4PXAA 1NJGA 1U81A 1JBKA 1VG0B 2HJGA 1U0HC 3BGWA 3GEHA 3OIUA 3UANA 2WICA 5KNBA 1AZTA 4DZZA 3O8RA 2HF9A 2FFHA 3VTKA 1AKYA 1XEXA 1KAOA 1HQCA 2WPDA 1KSGA 3KB1A 1PLKA 2ZSFA 1XFAA 1XTQA 3MLEA 3TW8B 1VCNA 1YJ5A 2RKOA 2O5VA 4HB4A 4C9BA 4QGHA 3G5UA 4R2HA 1GRQA 1GUAA 2HT6A 3KL4A 4L8GA 3A4MA 4RFSA 1TQ4A 421PA 5BWMA 3PITA 4MGZR 2Q3MA 2FPMA 4NE2A 1S9HA 2RH5A 1XBTA 4L5BA 1Z6TA 3LXRA 1VMAA 3REFA 4NPHA 3QXXA 4ASUD 1G3UA 1MO6A 3IO5A 4OYHA 3Q72A 1YR9A 1SKYE 3CX8A 3F8TA 3W90A 2G1JA 1P2VA 5G3YA 2ZJ5A 4W5JA 2BJVA 3K9GA 1D2NA 3SE0A 1IJFA 2EVWX 1T3LA 3UMSA 1N5KA 1E6CA 3HWSA 4KJZA 4UXJA 3RS5A 1E79A 3PUZA 1G9XA 2XB4A 3C7KA 4F38A 4IFEA 1A2KC 3TBKA 1H8HA 4XD7D 4HUQB 4ZIRB 1E2HA 4LJ4A 4QM7A 2Z4RA 5BYKA 3KKQA 2QQ0A 5DN6A 1W0JA 1TPZA 3OEHD 4R2IA 2V54A 3U7EB 4IRUB 3K0AB 1Z08A 1GOTA 1E94E 4UNPA 4LDJA 2BM0A 3IGFA 4ZV4A 1R2QA 2V1XA 5H68A 5JWHA 3H1TA 1EXMA 2FH5B 5G53C 2C78A 3LY5A 1JNYA 3HR7A 3BRWD 1GRNA 4DBLC 2X19A 4PAMA 2B6HA 2D4HA 2VP6A 4Q9LA 3OE7D 4K8OA 1VTKA 1MO4A 2HV8A 5DGXA 5TB5A 4M21A 2FFQA 3MMPA 3IIMA 1FX0B 3IUYA 4Q7KA 3SYKA 3TR5A 1I2DA 5TMPA 2Z5FA 3P20A 2FMXA 3DL0A 4B3GA 4PC7A 4LHXA 3TUZC 4NCHA 3DHWC 3CRRA 4OQFA 5LB4A 4TMKA 5FPYA 2NZ8A 4MDFA 4C7OA 4V0LA 5JI2E 4PANA 3A6PC 3B1VA 4ARZA 1FMLA 2B8WA 2QMEA 1W2GA 2J7PA 2GXQA 2QP4A 4AD8A 2ZU6A 3UKDA 4LHYA 4QJ4A 3AF3A 4P4SB 3DM5A 3VKWA 4BLQA 5FOUA 1KI3A 4BASA 3CKLA 2ANCA 1W5SA 2XNDA 2OE2A 3X1ZA 2ZSDA 1E9EA 5KSOA 4Q4AB 3KQUA 3EIQA 5EE0A 3U2QA 4ON9A 4DVGA 1GVNB 3TRFA 2BWJA 3B5JA 4G5RA 2D2FA 1MR3F 2BKEA 2OXRA 3MSXA 2O8BB 3BB3A 2VPPA 5KYKA 3JVUA 4P4UA 2ZUDA 2IS1A 2IYXA 2G83A 4URYR 4CEIB 4Q4JB 1OB2A 1WMSA 1ZNXA 3HJNA 1I4TD 1OHHD 3W8NA 1SHKA 1OYWA 2IYVA 1AK2A 2BKUA 3ADKA 1R0XA 4HAYA 3AM1A 4DUGD 4PQFA 1P75A 1QHNA 2ZR7A 4B73A 2VQSA 4I81A 3L0OA 4PC1A 1AS2A 3LBIA 1Z83A 3RS7A 1WDTA 4A82A 3FE2A 3DZ8A 3VQTA 3AKDA 4MRNA 4OI1A 3I73A 1UBFA 3VR6A 2GA8A 4WZAE 1TMKA 3QPWA 4FMCB 2V9PA 3IIJA 1ZD1A 5CJPA 3K0FB 3GEIA 1F2TB 1CEEA 3DKVA 1UJ2A 2GK7A 4KU4A 8OHMA 2OM2A 2IYLD 2QGNA 4CT5A 5JLJA 1NLZA 2OLKA 1AQUA 1VHLA 1JEDA 2O8FB 1Z63A 1VYUA 2OFWA 5CLQA 5EE5B 1FMJA 2KB0A 5CK5A 4F7WA 4HAXA 4YXWD 2CXXA 4RZUA 2NOAA 3FFAA 5TXGA 3AUYA 4V0NA 4TYPA 1JECA 1JR3D 2H7VA 3RRYA 5L8VA 2Z83A 4LYHA 3AF1A 5DI9A 1II8A 2QMOA 2JASA 3E70C 2J5XA 2B7BA 1U8YA 1SXJA 1BOFA 2OHFA 4FMBB 4V0ME 4KLZA 5LDDC 3UXMA 2V55B 3REGA 2A30A 1ETUA 1W44A 2F1RA 4G01B 2PX3A 4M1MA 4ABYA 4BFUA 3QF4B 4PC2A 4L9SA 4US2R 1D9XA 3EZ6A 1R7RA 2FOLA 3CRW1 4DDTA 4IDNA 2BHRA 5FI1B 1WBBA 1XD2A 2CE7A 4EKDA 4I1OA 2AD1A 2EFGA 2QG6A 4CIDA 1LF0A 4RJLA 2XITA 1G7CA 2XZPA 3IPXA 5CLLA 4ZI2A 1P72A 1XXHE 4DSUA 4CEHB 5F98A 1GKYA 1QHYA 4KBGA 5CDFA 2NGRA 2A5YB 3SJAA 3LO5A 5KDOA 3VFDA 2J0QA 4F91B 1XEWX 3CW2A 2ZRKA 1E79D 1ZD9A 3KJGA 3T06B 1OFUX 2WSSD 1H8HD 1FFHA 1F2UB 2AK3A 1II9A 2ZRIA 3OIVA 3MWJA 3L0SA 3SYNA 4KHZA 4XTCS 2FFBA 2HUPA 1I2MA 1PV4A 2WJJA 3LW7A 5FTKA 3QKSA 4W7SA 3K0SA 2ECKA 4WXRA 4EJSB 1GDDA 1PUJA 4KV9A 3P4XA 4D25A 1GAJA 3ZVMA 1P4SA 3FMPB 3O8BA 1S3SA 4JLPA 3B78A 2BCGY 1YHNA 2CL0X 1JPJA 3SHFA 5AUNB 1AGRA 1LF5A 4WAUA 2XB2A 2YC4C 3EZ9A 1E1QA 2XZOA 2G0NA 2J0SA 1C1YA 2GZDA 4AYXA 4ACAA 2LCFA 4MA4A 4B3CA 2IS4A 3H2YA 1PUIA 5BN3A 4AKIA 4QKQA 1UDWA 3DM9B 2WJYA 1S0UA 3ZIAA 2KJQA 4TT3A 3ZVNA 3IHWA 1MABB 4AC9A 4RZ3A 1VG1A 1D2EA 5GJWC 3QPUA 3PENA 2XX3A 4OHXA 2GF9A 2ZRNA 4I4LA 5HCIA 1PZNA 3MD0A 2IYWA 3CUEF 3CH4B 1D9ZA 2VHQA 2VHTA 5UKDA 2GVZC 2IL1A 2QENA 3AUXA 3I4LA 4QNMA 4AG5A 3NBZC 4HUQA 4ZIRA 4LWZA 3GLIE 2J7PD 4PAQA 1HUQA 3U3RA 4AWXA 4WBSA 5B2ZA 5ELXA 4FCWA 2OCYC 2QBYB 1IBRA 4URVR 1W0KA 2IXEA 2PZEA 2QM8A 3K0AA 1Z07A 1E2DA 2OFOA 2O52A 2XNDD 1NL3A 3WYGA 3VKGA 1RJ9B 5LD2B 1X1SA 4TLCA 1ZINA 1KK1A 1S1MA 2ZI3A 4RKFA 3IHLA 2BCJQ 4MRSA 4PSVA 4KSCA 4GMXA 1EK0A 2O0JA 4KVGA 3U61B 2ZSEA 3HR8A 2ZRFA 2OG2A 1IN8A 1CR2A 2ZETA 4B33A 4TYNA 2EYQA 4IVQA 2IWHA 1CRQA 2YHSA 4BGDA 3DMNA 3CNNA 4PPFA 1FX0A 4UNSA 2OLJA 1OJLA 3H84A 2NQ2C 4HAZA 3NKVA 4C0BA 4RY2A 1A5TA 2G1KA 3NC0C 4CEJB 2NO6A 4NCNA 4NKRA 1L4YA 2GJAA 1Z0DA 2A9KA 4DRZA 4IVPA 4LBZA 1N6KA 4BFWA 1VG9B 3AP1A 3SI7A 2W83A 3HYTA 3KKMA 1R0WA 2AFIE 2OBMA 2AFHE 2W00A 4GOXA 4ESHA 4BLPA 2KSQA 4LSGA 3ECCA 1U90A 4ZO4A 2JLRA 1TF7A 4Q4AA 3EX7C 2O8DB 1GL6A 4PHTA 4A6XA 5CYPA 5F9FA 2VO1A 3GJ8A 1T4GA 3K0EA 4A1FA 1VKJA 4EUNA 1KI1A 4LY6A 4A2PA 5KNCA 4C4PA 5J4YA 3AKEA 1MRNA 1MO3A 1XCGB 2Q9AA 2O8BA 1KO5A 1YU9A 1YZTA 1ZNWA 2VHCA 1E98A 4KFSA 3VR1A 1M7HA 3I3SR 5JS8A 4GT1A 2WJGA 1EFUA 4JT2A 4XWKA 2ZUCA 4CEIA 621PA 2D2EA 4Q4JA 5KSPA 4AURA 4UNQA 5F9HA 2GBLC 1XMIA 1E1RA 2CLSA 4EIWA 4JT4A 4WW0A 3RWMB 4KCGA 2HLDA 3AVUA 4S35A 4X8OA 2ODNA 4HZIA 5KDDA 1KI4A 4PZZA 4Q9IA 2YV5A 3GFPA 1XWIA 1QG2A 2CL7X 3OAAA 3BWDD 1GFIA 4W5HA 1Q1QA 2BIFA 2Q3HA 2AK2A 2WJVA 4B3BA 2CLCX 4JIMA 1S4QA 1NI3A 5JHGB 2F9LA 3BH7A 3KDSE 2IUUA 4QHSA 1E2MA 1YE8A 3SFZA 5IHPA 4G1UC 3K1JA 3TGPA 2F1JA 3BXZA 4DCNA 3QNUA 3T61A 2CDNA 3K0FA 2YKGA 1F2TA 5LBIA 4MKHA 2JDID 4QGAA 3NBFA 4UNRA 3QKTA 4D80A 1QBKC 2DB3A 3UIEA 3RS4A 4HAVA 4OHVA 2O8FA 3TQCA 5FTJA 1DO2A 3ZQ6A 3BC1A 2O8EB 1YZUA 2VL7A 1CRPA 1MH1A 3RS3A 2QRZA 4FXPA 4LC1A 1OW3B 5KHOC 3GJ0A 2K5UA 1UPTA 3CO5A 3GFOA 3MJRA 1JJ7A 2ZRAA 4NU0A 1DBSA 2ZITA 3AB3A 4LUCA 2IA5A 2C98A 2GAOA 3SOPA 3V00A 1XDBA 2W6JA 4YDSA 2HF8A 3TIFA 3WP1B 2AKYA 3I8SA 2GZAA 1VIAA 4TSFA 5C46F 2R6FA 2VP9A 4B2IA 3W6NA 4Q1CA 3QF4A 2ZSAA 1ZYUA 2IYSA 2ZJYA 2AR7A 1KK3A 1W47A 1NNEA 3LLMA 3UG7A 1JQLB 1GKIA 3B1YA 1XMJA 1IN6A 3H4MA 3WBJA 3AVQA 2FA9A 4H9GA 3MCAA 4ASUA 4TYWA 4EFNA 4QBIA 3TVTA 4MGIR 1E9CA 2CCGA 1EFRD 2FGKA 3KB2A 1NBME 2F3RA 3K0CA 3PEUA 3PR1A 2ZJBA 5HE9A 1EESA 4ZCMA 3A1TA 1YZNA 2JATA 4DSOA 3CF0A 1M7BA 1T5IA 2B21A 4FN5A 5DIFA 5AJXA 4BFYA 2ZRPA 4HAUA 4I1UA 3QXHA 1S9DA 4DB4A 1ZVQA 1NIPA 1F2UA 5FI0B 2W0MA 5HZKA 1R6BX 2WWHA 3BB4A 1J7KA 2NG1A 4G5OA 1OIWA 1RYHA 1C9KA 4P0TA 4NYMQ 3NBYC 1QF9A 5FOVA 2V1UA 5AJZA 2B8TA 4FMDF 2QAGB 1W0KD 2JEOA 2RGBA 2XAUA 3OEHA 5GVRA 2IS6A 1G3RA 4RZ2A 4JBYA 5C1BA 1TUIA 1WBDA 4D4KA 3BFXA 4TWZA 3WRXC 2Q9BA 1NG1A 3LX8A 5GJVC 5FBWB 3C4JA 2P3SA 4LOAA 4F93B 2V6JA 4XTRA 2J1LA 4Q21A 3W3AA 3CH5A 2GXUA 2V6IA 3OE7A 1ANKA 4QJ3A 4XWAA 1MABA 1SVOA 3LNCA 2V3CC 1F60A 3B82A 4U7DA 1SQ5A 1P60A 5EQTA 3M6AA 2PJZA 3RABA 4IDQA 4A92A 3KQHA 1HE8B 4Q03A 1VPLA 3MG9A 4QGGA 3W6OA 3F0TA 3GD7A 1B23P 2WZQA 4TTQA 3CPJB 3S1AB 4IDOA 1E2EA 2TMKA 2RGDA 1M34E 3RDPA 2ZM5A 2YOHA 4Z54A 3GLHB 4MYCA 3T35A 3BK7A 2Q9CA 3IIKA 1G3MA 2KBEA 2VSXA 4L15A 1G8HA 4CVNA 4A9AA 2QBYA 4C2UA 1X8JA 2ZTSA 4GI7A 4DXAA 1KHTA 1CTQA 1D5CA 2GEUA 3QVUA 3T1OA 2IBMA 2QNRA 2YZ2A 1RJ9A 3BFKA 3CNOA 4JVSB 2VLIA 3F3YA 4IOJA 1JXMA 2JCSA 3EAQA 1KJWA 2H5EA 1P61B 2J87A 4OI2A 1JAIA 1CF4A 1KYIA 3TLXA 3AGQA 3D6TB 3DOEA 3D8BA 4DEXA 5JMTA 2IF2A 2ZJ2A 3OIYA 5H70A 3TAUA 1KKMA 4MKIA 3RS2A 4IOKA 5FUYA 2YWHA 2WIAA 2H1LA 3AGPA 4B74A 3FDIA 4RFVA 4ZCIA 2FDCA 5GJBA 1OHHA 3TJZA 3TSZA 2FU5C 5CM9C 1U8AA 3UMFA 4L9WA 5IF9A 1ZNYA 2HLDD 4NYJQ 3MFYA 4DUGA 1X6VA 3M4YA 4D82A 4CEJA 2YC2C 2WAXA 2CLDX 1ZIPA 1Z29A 5K8TA 1LY1A 1DAMA 2J45A 2OXCA 4QM6A 4LK2A 1CU1A 2ODBA 1XMVA 5SZKB 4B3XA 1M2OB 2VHUA 4BFVA 3THOA 4IXMA 1NJFA 1GNQA 4M1KA 1UKYA 1A2BA 1OV4A 4ZDKA 1Z06A 1Q22A 2ZIAA 4MRVA 4BECA 1ZUHA 3CNLA 4BLTA 2EYUA 5KOYA 1W4CA 1PLLA 3AKCA 4TQUS 3ZDQA 3GP8A 3EIEA 1N6OA 1NY5A 2XTNA 3HU3A 1IXSB 4IDPA 4LHWA 2EW1A 4Y0AA 1RPZA 1G18A 2QMHA 4M1TA 5LB2A 1JQJC 3QUSA 5BYJA 1KMHB 3ZYCA 5FOXA 4NH0A 5EZ6B 5H1YA 4DJTA 5KPDA 1F48A 1JXOA 2RGAA 4WIAA 1JR3A 1P9RA 1SXJC 3FVQA 4IJMA 2Q21A 4KXFB 3AVOA 3QXCA 4URZR 4V03A 2W6JD 3QXJA 2ZAOA 3OZXA 3PUWA 3DDCA 4TSFD 1E2QA 3QSYA 2G0TA 2IK8A 1UBGA 4TTRA 4M9XA 4TZ0A 1G64A 3NHBA 5EP2A 3MUFA 4BLOA 3KJIA 4EFMA 4BFTA 1ZJ6A 1NVXQ 2W6ID 4OKSA 3DEFA 1AN0A 3FFBA 2Q6TA 4A0RA 4JLNA 4WZ6A 4M53A 5FBVB 2PJRA 5CB8A 1BO6A 1ZCAA 5DI3B 1GZSA 1IY0A 2HDNB 2OCAA 1FQKA 1WRBA 2GEVA 3I5XA 5EZ5A 4CW7A 1C4OA 3LDAA 4TLBA 3W8RA 2I1QA 4KLNA 4NMMA 1G16A 4PQYA 4QBFA 2ZRHA 2EFDB 4BQSA 4E09A 2O8EA 5BN4A 2VP5A 2Z4SA 3KJHA 1N6HA 1G5PA 4TMXA 2JLZA 2CMKA 2WSSA 3X2SA 1DPFA 3EZ2A 2QE7A 1OIXA 2G6BA 3T1TA 5FPTA 4Z8XA 4O0MA 1T0HB 5AWFC 4ERNA 3JVVA 4D81A 4Q48A 1SVIA 2GTPA 3EARA 3AVYA 2XSZD 2ASEA 3U3JA 4G3XA 2ZJZA 4OQLA 2L0XA 2OESA 2R9VA 2NO9A 4PZYA 4DIDA 3KQLA 3EWAA 2YYZA 3PQCA 3AVXA 3IQWA 1G21E 5EE1A 1Z6AA 1UEIA 1CKEA 4P31A 2J0UB 3EC1A 1P9NA 4NP6A 4PO9A 1NN3A 1EFTA 2C5LA 3EZFA 2ORWA 1FW6A 4Z8YA 2OT3B 1KK0A 4URUR 3PIRA 1KAGA 2BV3A 2HXSA 2ZEJA 4YLGA 3Q5DA 4O3MA 1XU4A 5E3HA 2LWIA 3CR7A 3QEOA 2P6UA 4Q1FA 4TN1A 1CR4A 2J3EA 5L3RA 1NVWQ 4N3NA 3MAAC 3JZAA 3ZQJA 2Z6VA 2J41A 2EFCB 2QTVB 3LBNA 2WBLC 2CCJA 2GESA 3LLUA 3PUVA 3THYB 2QSYA 4DC9A 4U02A 1U8ZA 4Z51A 5FBQB 1T3HA 5B30A 3V4FA 3SU8A 2IXGA 1E32A 3EPKA 1FNNA 1DO0A 5EE3A 2P2LA 2IEZA 4D0GA 1KJYA 3GLFE 2ZRLA 2H57A 4BRUA 3LW8A 1M1YE 1UBEA 1LS1A 1QHIA 2ZJOA 1ZMXA 4LJ5A 1G17A 2NO7A 2QAGA 2R6DA 4HB2A 4IEEA 1N6IA 5IDVA 2QU8A 4TMTA 3LV8A 1KIMA 4JZKA 1N5JA 4JSYA 2VP2A 5GJCA 2XJ4A 2GJSA 1SULA 1FTSA 4DLSA 1MKYA 3B13B 4QXAA 2V4ZA 3HP1A 4HLUA 3GLGA 1MT0A 2IXFA 1CS4C 3GFTA 3NEYA 4MRPA 5C2JB 2A78A 3SYLA 2BEJA 3CBQA 1CIPA 3CF2A 821PA 2BDTA 4UQOA 1XTKA 5IT5A 4TYQA 1E4YA 2F3TA 1TEVA 1KSFX 5CM8B 2FEOA 2KI5A 1OH5A 2O0HA 3GCGA 2HYDA 1AA9A 2FGJA 1N6PA 5JECA 1WQ1R 1U99A 2NPIA 3EIHA 1WF3A 1N6RA 3MGCA 5KPJA 4TL9A 3WRYC 3CRVA 5DNYB 2OUKA 3QKRB 2W2XA 2NIPA 3A58B 4AKGA 4U5XA 5HCNA 3SFVA 2XEXA 4O2RA 3S1AA 2FZLA 5J47A 2HYIC 1Z0KA 2QPAA 4D4JA 1BMFA 2X77A 3AP3A 3NEJA 3GLHA 1XRJA 4FIDA 4JLMA 1DTSA 2WWIA 5DHAA 3DVLA 5KTYA 4LC0A 1HURA 3EXAA 1R5BA 2QT0A 1A1VA 4EPWA 4A8JB 3A36A 1ZM9A 4DSNA 2BVNA 1S8FA 2XXAB 4CYMA 2IUTA 2OBLA 4OHWA 1S2MA 2ZYTX 1XTSA 1XPUA 1M7GA 1OSNA 2OV2A 4MITA 1RFLA 521PA 5HR5A 1NN1A 3U4QB 1OPXA 1HY3A 2A5JA 2DFTA 2DFNA 2IF0A 3WYFA 1G6OA 4GDFA 4PC6A 3IEVA 1G4AE 2KWIA 1LTQA 2WWGA 2EWWA 3B6EA 4HDQB 3VR5A 4GOJA 2IYRA 4M8NE 5A5GA 1G20E 3OF5A 4WA7A 1RRCA 2VIIA 3LQQA 1DADA 4Q00A 1OH8A 1OYYA 4LYJA 5HE8A 1G6HA 2DWPA 4A0HA 2FWRA 2QPOA 2ZI4A 3KQKA 4PQRA 1SGWA 5G41A 1NRJB 2F55A 4JYBA 3W3ZB 2RCNA 2PT5A 1O3YA 2FSHA 4D4MA 2X1VA 3R20A 4LBVA 4A8JC 4JLAA 4OK5A 1DG1G 3SS8A 1VHTA 2R8RA 1TF5A 2Z43A 4PHFA 4C0SA 5JRZA 4N0EA 4PFSA 4QJ5A 1NG9A 1JB1A 2RGXA 3I32A 3L2OB 3ADCA 2JDIA 2ZRDA 2QMUA 1P5ZB 2DWOA 3HPRA 4YDHB 3R8CA 5JJKA 4OHZA 1N25A 4BEBA 2CVHA 4JSTA 1OXSC 1P73A 1XD8A 1KMHA 3UPUA 3VNUA 4RSGA 4H1UA 2AL7A 3ADBA 3IO3A 3SBDA 4TMVA 5TVKA 2QE7D 5EUMA 4PX9A 5FUVA 3K8YA 3X1YA 5EE9A 5C18A 4F92B 3VX3A 3VU9B 1FP6A 4B2LA 2GF0A 1ZU4A 1IY2A 5DO9A 3B60A 3TSOA 4MDEA 2MSDB 4MYUA 1KO8A 1RZ3A 3KKOA 1BH2A 2OILA 5FUXA 4PPQA 2IT1A 2ORIA 1SKYB 1XJCA 3QXSA 1W4RA 1N5IA 2C03A 1Z28A 1YR6A 2C04A 2H17A 4XVRA 3ZS9A 4E22A 4A15A 3FMOB 4I99A 2FE4A 4HB0A 3EA0A 1GNPA 3A1VA 5AJVB 3W6PA 3SN6A 2D62A 4Q9HA 4JVNA 3NH6A 3SR0A 5HZHA 2IHYA 1FP7A 2C2HA 4NYMR 2GJKA 2WJIA 3K0CC 4C2TA 4JLBA 2G88A 2N46A 4WVFA 1EG7A 4GP7A 4W9MC 1EFRA 4CDGA 1ZW6A 4B6FA 1FTNA 1GM5A 3KUCA 4E03A 3ICQB 4ZKDA 4KAXA 4KBFA 5DHFA 2WKPA 4JMPA 3RWOA 3PEYA 3A1WA 4LJ6A 2AHOA 3BH0A 4JL5A 4CF7A 1N0WA 3TKLA 5JFGA 3BBPA 2PZFA 3QEJA 3W5JA 3T12A 4EJSC 2VHJA 3CPHA 3K09A 1XD9A 2IYTA 1OLOA 1G8PA 4QHYA 2WVJA 1W5TA 1K6MA 2A2ZA 3TW4A 2FEMA 3B7GA 5FFMA 3WXMA 2GCNA 5FBRB 4NCIA 4LBYA 2FSGA 1UKZA 1U0JA 4TLEA 4DLTA 4V0KA 1T9HA 5FUWA 1E2LA 5JS7A 3W5IA 3ADDA 2BMEA 1Z6YA 3LXXA 3RHFA 3PJRA 3R9WA 1XP8A 5E95A 2A5DA 2J0UA 2FNAA 2HXYA 1CR1A 1W4AA 4TMWA 4BEJA 4B75A 1UKEA 1G7TA 2QP9X 1DG3A 2DCUA 2VF8A 4A4DA 3KFXA 2MSEB 3QJYA 1KZGB 1Z6XA 1US8B 4NCKA 5FPSA 2IHBA 5AUQA 4DWJA 3K70B 4R98A 1Y3AA 2QI9C 1P2UA 2CVFA 5AJYA 3AV0B 3PXGA 1GWNA 4LX0A 1H65A 3CIOA 3MWYW 4QRHA 4HUTA 3KX2A 1LB1B 2Y8EA 3THYA 2WV9A 1OXXK 4JLKA 1E96A 3ZGXA 1U2RA 4IEIA 4B76A 1BMFD 1XTIA 1I4LD 4ILEA 5FPKA 4FWTA 3C16C 3OESA 2QZ4A 3RC3A 3AVPA 2MMGA 4KITB 1RRPA 1E0AA 1GSIA 5DISB 2QSZA 4JVMA 4OI0A 4P4SA 4D6PA 5LD2C 2F43B 1KO7A 1WCV1 4XSGA 4D26A 2OEPA 5G3ZA 1ZNZA 1VYTA 3TUJC 2IC5A 4BUJA 4NYJR 4M9SA 2F1IA 2ZVPX 1DAHA 3SQXA 2XOKA 3I92A 2GILA 5TY0A 2ZE7A 3LD9A 4TL7A 1RRGA 3LWNA 3ND9A 4FCTA 3LH5A 1N2CE 5FPHA 4HLCA 3I61A 4PC3A 4OHYA 4F4JA 3QENA 1JI0A 3QPVA 2AWOA 2WWWA 2XZLA 3D31A 3DKPA 1UAAA 3CZQA 1Z5ZA 3GQBA 2F1HA 3IDQA 1SXJE 1YZLA 4G5GA 1W36B 1E9FA 2DFKB 5HKKA 1T91A 1XEFA 5KNDA 3Q9LA 2ZROA 3L82B 3QKRA 1D6JA 2PLRA 4GNKA 4KYIB 2G9NA 2VA8A 6Q21A 3X1WA 2BM1A 2WJHA 3E5HA 4HLQB 5FOWA 3UATA 4O2LA 1DEKA 1HT1E 2KE5A 3FYHA 5L3VA 4Q7LA 1ZM3A 4A8JA 4KFRA 1CJUC 1ONBA 3KKNA 3ASYA 4JL6A 4LJ9A 4LV6A 4UNNA 1GRRA 2XXAA 4XOIA 4GP6A 2PL3A 1E9SA 4MKGA 1R10A 2W58A 5CDFE 1G41A 4C0AC 3MRSA 3PEVA 5BXQC 4DCSA 3TSWA 1AGPA 3C41J 5D3MB 1KY3A 4EPYA 3PCRB 3ZZ0A 3U4QA 5JEDA 3GPLA 2ZRJA 5M04A 5AR1A 3BH6A 2E9SA 3U60B 1RVDA 4JS0A 1NLYA 4XSHA 1IN5A 3L0IB 2P5SA 2ZJAA 3RYTC 4B32A 1CJTC 1LS6A 4YONB 5FTNA 4EQ6B 2QEQA 4D4LA 1NKSA 2DBYA 2B7CA 4U00A 1H8ED 4OK6A 3T5DA 1PLJA 1XXHB 1YQTA 2YNMA 2XNSA 1VCOA 4RKEA 4M9QA 1EFHA 1Z2AA 4X8MA 3FMFA 5SZJA 3Q3JB 1HE1C 2H16A 3C8UA 4YMSA 1MRSA 1E2NA 2W6IA 2CJWB 1FUKA 2C9YA 3BD9A 2AKAB 5ANRB 1L4UA 1YRAA 1UFQA 3K9NA 1QG4A 2FSFA 1DAEA 2WOJA 2QGZA 3OFNA 3QI2A 2GEDA 2F7SA 2RHDA 2AX4A 1CBUA 4TZ6A 4CEHA 1RC8A 3N5CA 4L16A 3V9PA 2GCOB 2J46A 1T6NA 4DLYA 2C9OA 4EPTA 3IPYA 2P67A 4QBHA 2ANBA 5B57C 5JSZB 1G8YA 2MSCB 5JBQA 2N1BA 1UF9A 1SKQA 4G5SA 3NIBA 3T1QA 1HYQA 1NN5A 4GSYA 2D3WA 2EFHB 5AUPB 1TQ2A 3VU9A 2PCJA 3LRPA 3QBTA 4A36A 2QY9A 1KTVA 3WNCA 3EWSA 4B43A 4EJSA 3RNLA 3AVTA 3A4LA 4Q4LA 1IHUA 2RGEA 3IQXA 2ZRGA 3BAFA 4Q9KA 3C15C 4A6PA 4AKEA 3KXIA 5JHHB 2CNWD 4E5UA 2XSZA 3GEEA 2EWVA 5JRJA 3VKHA 3AKYA 1KJZA 4FMCF 3TR0A 4HYYA 2D7CA 4QC2A 3SBEA 1P62B 3UWKA 2RMKA 4NYIQ 4HSEA 2GDJA 4LV5B 4UJ3A 4PHHA 2VH5R 4FD2A 2FV8A 4DSTA 3AF4A 2ZAMA 3AQ4A 5JEEA 2A3RA 5E7JA 1ZC4A 3NH9A 3SJCA 3HPQA 3GLIB 5G40A 3NHAA 3PV0A 1E0KA 3RSOA 3VX4A 1Q21A 2DWQA 4UJ5A 1U9IA 2RGNA 5L3SB 1UM8A 2JLQA 2ZE8A 4IXNA 4EPVA 4B44A 4EFLA 4YMTA 1CR0A 4FI3C 3TUIC 3R8FA 1J90A 3WP0A 4B35A 5JZVA 2R6GA 4I1VA 5B58C 2BMJA 2QAGC 3QVVA 1UEJA 1BIFA 3EASA 3X1XA 2WSMA 3L8ZA 3LQRA 1O87A 5DLQC 3GMTA 1T3SA 3P27A 1G1MA 4HLUC 1NSTA 1QVRA 4M1WA 4AKHA 1KO4A 3CZPA 3VHLB 5JWOA 3Q8XB 1Q0UA 1EWRA 3QF7A 3A4NA 1SVWA 2BEKA 221PA 4G0NA 2XOKD 1NMYA 1UDXA 2VTKA 1CJVC 4DT1B 3CX7A 1KDOA 3D7MA 1CJMA 4PTLA 2PMDA 2XTZA 1KGDA 3NC1C 4BFZA 1KNXA 3C14C 5FTMA 2XGJA 4P3YA 3EW9A 2W0SA 4KO8A 2ZANA 1KDRA 3E2IA 1KI6B 1US8A 2JJ8A 1EWQA 3DPUA 5EXSA 3R9IA 3FHCB 4DLXA 4P32A 1QRAA 3SDZA 5HKKD 2AN9A 1OB5A 2D7DA 1A4RA 2BOVA 3LX5A 2VP0A 4A2WA 4JKYA 4HEJA 1JALA 2NPFA 3KXKA 4TL6A 2IUSA 1KKLA 1ZRHA 121PA 3B1ZA 3GJ3A 1YRBA 3RSLA 5F3WB 2FZ4A 1JPNA 3IKJA 3VHXA 1E0JA 4RCZA 4AYTA 5KUTA 1Z6GA 3FPAA 3RRZA 1XMSA 2E87A 2A5FA 1E9BA 2F43A 1F5NA 4QFMA 1JAHA 3B2EA 2GNOA 1XZQA 2JAQA 4M1SA 2YOGA 1XF9A 1MOZA 1X86B 2BBTA 2HEIA 1GNRA 3AEZA 1OFHA 2BBWA 2IEYA 1ZIOA 5J40A 4ACBA 3CR8A 2ZPTX 4C3ZA 2ERYA 4TMZA 1XNJA 4C0LA 5JI3E 4KYUA 5DYIA 4QNRA 3FHOA 4Z1MD 5EJEA 2IS2A 1X1RA 2FPLA 5AUOB 1Z3IX 1QHGA 4Q1BA 3WMGA 1QVAA 2EQBA 4D2IA 4DB2A 1A82A 3RLFA 1ODFA 1SVSA 4LZZA 3IBGA 3HDTA 3IBYA 4EPXA 2E1RA 3DMDA 5CIWA 1XPRA 3BJIC 4FCVA 1L8QA 1X8LA 1IY1A 3GJ5A 3ZJYA 1R0YA 4YMUA 3P1JA 2OSBA 5HTKA 2NMVA 3B9PA 2N42A 4TQAA 1J70A 3AVVA 3MWLA 1V43A 1NIJA 4MH0R 5J5CA 1DELA 2GAAA 3G82C 2IYYA 2WAYA 3QKSB 1GL9B 2WWXA 1G3IA 1HH4A 2ZE6A 3OFND 3U5ZB 4C0QC 3AP2A 2GJ9A 1Q12A 1TTTA 5D3MA 3NXSA 3UMRA 1QHSA 3Q5EA 3KZ1E 4V0MA 1IOZA 3N70A 5A4JA 1WE2A 1P7CA 4JLOA 1Z8FA 5FOSA 2JA1A 2QRNA 5KO2A 2AXNA 4AI6A 4D0LB 1GP2A 1NP6A 2ONKA 5SZIA 3B1XA 4IHQA 3WHLA 2VSFA 5K8LA 3KJEA 4EQ6A 2DPXA 5A0FA 4DLRA 4IW3B 4TTPA 2QTHA 4S2EA 4JYCA 4PPNA 4IDHA 1K5GA 1OIVA 1XXHA 2FN4A 3T15A 2JJ2A 4MUAA 5FBLB 5CK4A 3T34A 3UG6A 1EGAA 5GADl 4OQNA 2PEZA 1HV8A 4K81B 4QHTA 4XVQA 5H8WA 2LKDA 3RC8A 3TE6A 4J0QA 4MYHA 2WWYA 4BWYA 2O8CB 2QAJA 4P4TA 2CJWA 3Q7PA 5TARA 4A0FA 1GIAA 3WNDA 5KU1A 2QPTA 1UBCA 5E4FA 4DCTA 3EPLA 2A7QA 4OI4A 3M1IA 4AYWA 2WOOA 4C0KA 1B0UA 1OE0A 3FKSA 5D3QA 4PPGA 4BLRA 4EPRA 1XX6A 4LI0A 4M1YA 3QG1A 3FWYA 1Q1BA 3BERA 3ZD6A 4AY2A 2GCOA 2WTUA 4JL8A 1G5TA 2GXSA 2FPKA 2X8AA 2ZI7A 2GETA 3IEUA 1Q57A 4N0DA 4O25A 4B6EA 3DZDA 5JSZA 3BFVA 4II7A 1IM2A 2QORA 4Q19A 1VCMA 2WKQA 1Y63A 1TQDA 2R6CA 3K09C 2ZRBA 2C9CA 2CL6X 3RANA 5IRCD 1E4VA 1XEWY 2YWEA 3SEAA 4M0LA 4CRWB 4NCJA 2X2FA 3B1WA 2PCLA 2CK3D 2X2EA 3EC2A 4NBSA 4PR0A 4Q5IA 4KI0A 1CLUA 1TADA 4V02A 5BQ5A 4HI0E 3M0EA 1LNZA 1R8SA 2J59A 4X8LA 1NSFA 3WMFA 4Q02A 4KSBA 1W2HA 2V8OA 721PA 1KMQA 3GJ6A 3SZRA 4BFXA 1VDZA 1ZBDA 2YVUA 4TLDA 2I4IA 3CWQA 1G3QA 1W4BA 2PMKA 4MGYR 3I5YA 4HATA 1F6BA 3ZZTA 2OO7A 1Z2CA 4LYFA 3WBKA 2P65A 2GHIA 2WMOB 3L43A 1TL7C 3LA6A 1XPOA 1ZD8A 2SHKA 1XJQA 2QUZA 1R5NA 3CWZA 3GLIA 1DARA 2RAPA 1AJEA 4PSKA 1ZM4A 2VP4A 1UKVY 4L4UA 4RD6A 1M74A 3K70D 5L3SA 2QN6A 2WMNB 4ZDJA 4IFBA 4QOSA 4LPSA 3VR4A 1W7AA 4JBXA 1RRFA 4GBMA 4C0JA 2CHGA 2NZJA 3THXB 1BS1A 2R44A 2PT7A 5J4HA 1GITA 1XTRA 5LPNA 1ZAKA 1CXZA 3ZD7A 5JJLA 5CYOA 1N3BA 1K8RA 3OEED 1OKKA 1Z22A 2JJ1A 1GG2A 1T0JB 5FL3A 1D8TA 1R8QA 2ERXA 2QP3A 4JKIA 3KKPA 4Q01A 3SHWA 2BC9A 2R2AA 3A1UA 1IONA 1GILA 1P2TA 2JIZD 2DR3A 1BYIA 4BRWA 4DT1A 3L0PA 1GL7A 2C96A 4R9UC 5FL7A 2WIBA 2GXAA 4FMDB 2P0EA 4URXR 2XJ9A 1JR3E 2NO1A 2OZEA 2REBA 3VR3A 3RVBA 3BB1A 4LCBA 1OXUA 1KI6A 1RE0A 4DDVA 4Y0VA 1TU3A 2B92A 4RCYA 1N0VC 1S3GA 2ZUBA 2ORVA 1W36D 4LJ7A 4DLWA 4OL0A 1IXZA 1IAQA 4I1SA 4UXIA 5IK2A 5JCPA 1DS6A 1FPMA 4DEYA 4M2LA 1HQYE 1SVKA 1E2GA 4Q66C 1M8PA 4UXHA 2IYUA 4A0GA 2CCKA 1G8FA 4V0OA 1NVVQ 3UK6A 1KK2A 1KY2A 2FF7A 3K9LA 3PUXA 5L3QB 2WWFA 1VCIA 2HT1A 1Z47A 4JLJA 4ESVA 5CJ2A 1FOEB 2YINC 2PEYA 3HYRA 4IVRA 2JLYA 1NMZA 3SJBA 2YOFA 3C5CA 1IN7A 1KI7A 1Q20A 1JJVA 4UKDA 2IYZA 3SNHA 4D0NA 4GOKA 1P9WA 4OBEA 4RD4A 2VRWA 4Q1DA 1TF2A 1QHXA 1QHHB 2FX3A 2REOA 2OCPA 2WPDD 1YR8A 2RB4A 1T8UA 4FINA 4W5WA 1T8TA 2RGGA 3WY9A 1WB9A 1S96A 2KBFA 4B48A 3F5FA 4DCUA 2OFXA 1DVRA 3CPEA 2EU8A 5KSYA 2VEDA 4N1AA 1OH6A 5AK0A 1TAGA 5DE3A 4XH9B 2CBZA 1R4AA 2Q3FA 4DLVA 1VG8A 3QQ5A 2GJ8A 3R7WB 4TQ9A 3KTAB 3O8CA 1II0A 3KFVA 1L2TA 1H8EA 1N6NA 2JLVA 1CULC 2ZSBA 4NONA 2JJ2D 2DHRA 4DDWA 2P5TB 3THWB 1J8YF 1SVLA 1U98A 3LVQE 5K8UA 3GJ4A 4LJAA 5C4MA 3J81k 4B2PA 4B34A 1E3MA 4RD1A 4M22A 3LFUA 4LPKA 3FKSD 4QL3A 3RAPR 3P26A 3DO6A 4OK3A 5DN6D 1W0JD 2D06A 2QT1A 4Q1EA 5DI3A 4JLDA 3VMFA 3I62A 1G291 3QOFA 3N2EA 2UKDA 1U0LA 2ZRMA 3H86A 2WHXA 2CEAA 1ZUIA 4B3DA 5HPYB 4ZI3A 3U7FB 3CLVA 4LRWA 4P33A 4Q18A 1K5DA 1OFTA 3AF2A 1RKBA 3EZ7A 4XWOA 4NYIR 5DSZA 5CB6A 2ONJA 1Z0AA 1RW4A 3SC3A 3U44B 1OXTA 1P2SA 4LV8B 1FNMA 4Q9JA 1ZU5A 3I8XA 2BJWA 2YJTD 3EPHA 5JWRA 3GJXC 2O0KA 5JJIA 3NDBB 2R62A 1KZ7B 2ZS8A 2ZQ5A 3EA5A 1E2JA 1F3OA 4Q4HB 3TAHA 4E07A 3E1SA 2CNWA 3GLGE 2H18A 2H8KA 2NTYC 4EDHA 1NBMA 5EXXA 3HU1A 4XVUA 3PFIA
chains in the Genus database with same CATH superfamily
3P2EA 1QU2A 5BWNA 1ISPA 1DE0A 2E4AA 4JD5A 1X15A 3IC5A 3CX6A 4YC7A 1TMGE 3OLYA 1NRIA 1TC2A 3DXFA 3GPIA 4H4DA 2Q0HA 3LGAA 5B1SA 5K6RA 1JHMA 8LDHA 2ATVA 4HFNA 3D6AA 3KZXA 5ADHA 4RHUA 4N5LA 2RGNC 2RBGA 3RAGA 1W4ZA 2V4UA 3IEXA 5D8DA 3SZMA 1XLVA 1LJUA 4PM4A 1JR6A 2WIFA 4FFBA 1JDNA 3E2MA 4HZUB 2XCIA 2Z3ZA 3FHLA 3LO8A 2PTGA 4WNCA 4F9EA 1YNOA 1QDEA 5C35A 3ETLA 5K0TA 1CHDA 1PJRA 3CC8A 1T0BA 4RSHA 1PWXA 5DLEA 1A95A 1HA3A 2DMRA 2ZI9A 1ELOA 1GPWB 2C95A 2XTMA 2ZAGA 2OBNA 3KYDA 4TOIA 5E0KB 2FPRA 1YR7A 3UMBA 3WDSA 4E4RA 3EODA 1LTHR 2JJ1D 2Y0PA 4Y67A 2HJVA 4Q47A 5F3DA 2IX3A 1SKMA 3BGSA 2XVXA 3RWBA 1N9KA 2GN8A 3DVSX 3R4VA 4HQKA 3AHHA 5EHQA 2IH5A 2ADOA 3G5AA 3UOGA 2RIRA 1E2FA 1OAOA 1NOKA 2AZMA 1WMAA 3PDCA 4EKYA 5JASA 1YJQA 3DE4X 5EOVA 3QYAA 1TEHA 5E7MA 3IBFA 2Y92A 1P7VA 2P9FA 2WLSA 1X0XA 1HFWA 1YAHA 4TRJA 5JTTA 3GV0A 3CNQS 4JXKA 4PQGA 3WLJA 1PYOA 2ZXUA 1Z0IA 1A7JA 3C0KA 1TEXA 3HJGA 3LC1O 1T0UA 1KEUA 4KFUA 1FDOA 4US0R 4WNAB 1H2AS 1NXSA 3UGTA 2C7GA 1GZ6A 3I30X 4LMBA 4K0KB 4LRSB 4J0GA 4FDVA 3ZWMA 4JYPA 2ZE5A 4YXFA 4RS3A 2WVGA 1YQQA 3HFRA 4AUMA 4ER5A 1R9NA 4AO8A 4S1PA 4YR7A 3OCJA 2FR0A 3G9UA 3NR2A 4UAVA 4FNOA 4C0HA 2NUBA 3KYCB 5IK2D 1ZFNA 4YMGA 2YS7A 4WRRA 1OR8A 1OROA 2PH1A 1MIOA 3ET4A 3IVGA 4IOLA 3RGGA 1A8IA 1NFQA 3BREA 3JQBC 1BAPA 3DLCA 1ZJJA 1YFJA 2W6CX 1YRYE 4LY0A 1VECA 1ZIYA 3HRKA 3SBXA 1EINA 2WSLA 4WZBE 1TU4A 1F2VA 4OJKA 1JXQA 2H29A 1FTGA 2R00A 3FPBA 3HU2A 4QUGA 4AX4A 1LDYA 5KSZA 3DL2A 2C2WA 3KCNA 3GT7A 2D74A 1X7XB 1XTPA 1E0SA 1L4MA 4DJEC 3BORA 3BZBA 2Z4TA 3CB4A 1V5WA 4BZPA 3NTUA 3USCS 4H7DA 5LUAA 2JLUA 1OT3A 1E9AA 2R7KA 1P1IA 4RVCA 1XEXB 3PXAA 1VSTA 1D07A 3U3OA 5IXYA 2VJOA 1F0PA 3EUEA 5TV2A 3QE0A 5FWNA 3JPYA 4I50A 1GTRA 1I3OA 3PG5A 4LMAA 4RFSB 1Z2PX 3MJVA 1L8XA 2QL7A 3MYYA 4MHSA 5BSTA 2DP4E 2JRCA 2VF7A 4Q7JB 3OTWA 2P6PA 3FGPA 3TW0A 3ZU5A 5GM2A 5T4EA 1SBIA 1D5WA 3DC2A 3QK7A 4BE7B 4L0MA 3OOEA 4LNUB 3TBFA 1YCFA 4X24A 3ELUA 1UXIA 1VHQA 2WAAA 4WN9B 1DRKA 4S1WA 4BX9A 1TIPA 2V7QA 3A3KA 3I4CA 5E2BA 1H3NA 1XZPA 2KS6A 2X41A 3U3XA 1PVOA 1I1HA 1TOAA 1Y7LA 2ISQA 4DLZA 5IJ0A 2X4LA 1OD6A 3DOFA 3PQFA 3ZHZA 1V6CA 4DNOA 3ED1A 2WQ6A 3V32A 3KT3A 3DE2X 5EFOA 2FR8A 4NJEA 1NKTA 3CRQA 2YJGA 4IINA 1RYFA 4OAPA 5KVQA 1X1AA 4AK9A 3SQWA 1J99A 4NAHA 3IH5A 4Y3UA 3ZZUA 1GZ4A 1CY6A 2JGDA 3QQPA 5NLLA 4DDHA 1U0TA 1V1RB 4NX2A 3W4IA 2BP7B 4BPBA 1SEPA 3ORQA 3NDPA 1J20A 4CFZA 4HDMB 4R7GA 5FH9A 2YWFA 3O1JC 4INJA 2VA9A 4WCDA 4YB8A 3LDFA 3CJQA 3NCHA 1NVTA 4FKBA 4WK2B 5ECWA 5FPQA 1BJRE 3IJRA 3TQOA 3HCDA 4PX2A 4BU1A 4L0CA 3NWEA 3HXKA 2VTBA 3RRNA 4NBNA 2EXXA 2QN7A 3RU3A 2VWGA 2AWNA 4TYMA 1UMCB 2CHVA 2OZPA 1E1QD 1BKDR 1C41A 2HO4A 4LZNA 1FUYB 3OJWA 4HGOA 1ECJA 3ONVA 3TI7A 1IFXA 1QYVA 3P4YA 3JRNA 3SFTA 1GSOA 1MO2A 2G3YA 2G77B 3IP5A 2JFYA 3ROGA 3T7KA 4EJFA 3LTNC 3MAJA 2IWRA 4ESEA 2IUFA 1OJ7A 2WUGA 2Y27A 1C0EA 3V1UA 1H4VB 1ZMOA 5BR8B 3DULA 3ZIAD 3BD6A 3FIJA 3LBFA 1NP3A 3I8OA 4QSHA 3OT4A 5DKFA 2P4SA 2JW5A 2TMYA 1YU6A 2EBFX 3NAZA 1UJ5A 2PZJA 1MGPA 1SZPA 5ALSA 5FI5A 5F7OA 5LQRA 4OOFA 3LPAA 3B1FA 3A6FA 2REQB 4O59O 1NBMD 1FU8A 3ZHQA 1IUKA 5IC4A 2JFWA 3OH8A 2VRNA 3ICCA 2WF9A 3AR3A 1ZI6A 5CDHA 3NTQA 5K5EA 3IMCA 2IPMA 2NSJA 4HDRB 2IW3A 1ESNA 2FMKA 1ZM2A 3BIFA 2JD1A 2HSWA 2A9RA 1DCMA 3A1SA 4IMPA 3ZWWA 3ONWA 3N39C 8ADHA 1L7NA 1AQYA 3PD7A 1R5OA 4PO1A 3QWAA 1P6XA 2E5LB 4GFDA 5CDUA 1JYEA 4Z53A 2QL6A 2Z8ZA 3U6BA 1KPGA 2IP2A 1G5RA 4CV3A 1XNQB 4PQEA 4U8HA 2PH3A 1NFFA 2J5BA 3GLGB 2UXDB 4M7WA 3Q3GE 4LF9B 4X8HA 4Q7MB 5BWOA 1GUFA 2AJLI 2WZCA 3EDYA 2PBFA 3PWKA 4DHEA 1G21A 5LXTA 4CN9A 1JHQA 3I05A 3R09A 2I2BA 3GN2A 3EG5A 4EUEA 4NH4A 1JHPA 1QFJA 3FFXA 4HB3A 2JLXA 1QH9A 3AW8A 3U9LA 1Y33E 4RIFA 3SC2B 2OD2A 3EGOA 3MC1A 4TV9B 5JQGA 1M5RA 2VUIB 1MHPA 2XUKA 3MMNA 4I14A 4YRIA 4F4CA 4ZYTA 1QXSA 1WXIA 5F4ZA 1HM5A 1NN0A 5REQA 5E6SA 2YIDA 4KQIA 4PO8A 4O4HB 4E14A 1HEIA 2BBOA 1QS0B 3MJHA 3EPJA 2X4DA 3TGWA 2VWPA 1SG0A 1G7RA 2G71A 5DNEA 4BRZA 2NVOA 1KOFA 3SKXA 2P27A 1VIYA 2ZI6A 3TZLA 3CNBA 1L7DA 1H6AA 2QXUA 1SIOA 3QYPA 4UARA 3G9XA 1RMQA 3DTNA 1FQWA 4ABTA 4ARUA 4XGIA 1KO1A 4E2ZA 1F20A 3BWYA 1WP9A 2PXHA 4I55F 1OMOA 2DUUA 3C5VA 2IY9A 4PIVA 4CMJA 1XAHA 3GLFA 2AOWA 4R2KA 2A5GA 3C85A 1ESMA 3FB4A 4F2HA 4N5IX 4HLDA 5FADA 4CGZA 2ZS7A 2C3PA 4WEOA 3RJTA 5JZMA 5K8IA 2W7TA 3LF2A 4YT8A 3WHKA 2OCBA 1G1AA 3C70A 5LP6F 4AG6A 1KF0A 1V8FA 1I2BA 5LP1A 2ZVQX 3AXSA 2EFEB 4EZIA 4L5YA 5IM4F 3H9QA 2WABA 4EYGA 1HDIA 1T9AA 1MB0A 4NECA 3DZGA 4J7CA 1KMMA 2GLXA 3EFOB 3GARA 3FNGA 2O2GA 5GGYA 1N2CB 4YMVA 4YJ2F 3SYRA 3OEEA 1KQ3A 2OXIA 1WX1A 5ITVA 3I1FA 5FLYA 1E6WA 2HA3A 1E1RD 2OZKA 2W2TA 4QBGB 1LDBA 3L41A 3PEWA 2DFLA 2O3QA 1U3CA 1XHFA 3Q3HA 5DMXA 2NP6A 3F1LA 3KZOA 1Z7WA 1CX9B 5T3YA 2IBTA 2JIZA 3RFVA 3IE0A 3SVTA 3ZH9B 3I0ZA 4E30A 2W2LA 5C52B 4WD3A 5JXJA 3B8HA 2QRJA 2PT9A 3KM0A 3PKIA 4QICA 2ZJ8A 4C3UA 5KYUB 1F06A 2CNNA 4ZOAA 3W3AH 4J9VA 3ZLJA 4H1VA 4B8WA 2ZCJA 4GMDA 2NU7A 2VPXA 2LKCA 4UU1A 2G40A 1XD2B 3RUEA 4DCVA 1IEXA 4XIGS 1ZH6A 2QROA 3N2IA 5CAEB 3SYMA 3BIOA 4I1IA 4KQXA 1FUUA 4GZLA 1LK7A 2ZYVX 1A69A 4LGVA 1VYVA 2IDKA 1SUFA 2OTCA 3LPNA 1XNRB 1BFDA 4RTSA 3UOAB 1EBBA 1CY1A 4CIVA 4EMTA 5LZ2A 3HRHA 4MUIA 2JLWA 3AR9A 2BEVB 1GTVA 2HGZA 3B85A 5L4LA 1SCUA 3G2MA 4LF7B 4PW0A 2NXJA 4D41A 3PDIA 2YY6A 3STWA 4HV4A 1U9ZA 4P4NA 3RC1A 1KI9A 4C7XA 2IV2X 1SCKA 4G5QA 2GK6A 2V7GA 4K2HA 5D7BA 4Z0PA 1YIDA 1VIVA 4PXAA 1Z8NA 3TTVA 1JDBB 3OCVA 1U81A 3IALA 1N36B 1Q2UA 4ZOLA 2EGUA 2FZEA 2P90A 4ES6A 2BFDB 3TN7A 3HH8A 2HJGA 2I4RA 2NWQA 4X45A 1SUPA 1OC2A 3OIUA 3UANA 4PGFA 3O8RA 2CJYA 2HF9A 2V9CA 2FFHA 4Z0NA 4R8LA 3RGWS 3VTKA 4RVDA 3MBKA 2ZSFA 3L7BA 1Y3BE 1D6SA 3PVCA 1XTQA 4LA4A 3NKLA 3TW8B 2C9ZA 1YJ5A 2IKSA 1TJ4A 2LR0A 2O5VA 4XAQA 4L4ZA 3G8CA 3M9WA 2HT6A 3KL4A 2YXDA 1EP9A 421PA 1LH0A 1K0UA 4HQNA 1YQ9A 1S9HA 4KQHA 1J1ZA 1Z6TA 3O84A 5IX8A 2XLCA 1XN1A 4N65A 4EG4A 2YFYA 3QU5A 4HXYA 2OL4A 3N87A 3L8FA 3W5SA 5DVZA 3X1JA 5IH7A 3N5KA 1SKYE 2QZPA 2WTEA 3LQKA 1GCIA 1WUKS 5JYBA 2OC9A 1LDEA 1R0SA 3ETHA 1LX6A 3K9GA 4HFJA 1YV9A 1T3LA 4CMIA 3ZDDA 1C9YA 1N5KA 2X0RA 3UMSA 3EJWA 3HWSA 3SKVA 5DYTA 2Z04A 3PUZA 3OF2A 4FBGA 4MVJM 3U31A 3WIOA 3FMGA 5JZBA 3OM8A 2O1XA 5TQ0A 3LPCA 5CBKA 3H2IA 5FR1A 2VUHB 4LJ4A 4DW8A 3HN2A 2Z5VA 5T5QA 5BRAA 4FM9A 1EQ2A 1ABEA 1T4CB 1A9SA 5DN6A 4R2IA 3OEHD 1TECE 4ISCA 4PIPA 2VJQA 3CZAA 3ZCUA 2CYCA 4AJKA 3EVEA 2EBHX 4LDJA 5BQFA 1LX7A 3SQDA 1CJBA 2OGSA 1R2QA 1XP5A 2DT8A 4KK3A 3THRA 5JWHA 1WPGA 1R37A 3UQYS 1MU0A 3RQSA 1A50B 1QTIA 4KUEA 1ZDMA 3O2SB 4XKJA 5EZYA 4DBLC 4PLYA 1JMKC 2B6HA 2D4HA 1WDWB 1KU0A 5CB4B 1X19A 1L7OA 2ZOSA 5E6UB 4CM9D 5CX4A 4JOCA 2X8LA 3MMPA 5EEGA 1FX0B 3BM5A 2HD4A 1F14A 1P39A 3ESCA 3ROTA 5KKAA 1CB0A 1PVDA 3O1IC 3SYKA 4DIMA 3MK31 1I0ZA 2XHEA 4EZEA 2XW6A 1A9ZA 4MKXA 4PWZA 4B3GA 1Z68A 3TUZC 3DHWC 1CEXA 4HEA1 1EZ1A 1VGRA 2R79A 3T3MB 2B99A 2H2HA 1IK4A 4TMKA 5HIMA 3DAOA 1CEQA 3G9QA 3VPHA 3O8LA 3BRSA 1RJFA 3RUFA 4ARZA 1FMLA 1H2XA 1JEQB 2Z8XA 3I9V6 1J0BA 2GXQA 2QP4A 1KVTA 2SKEA 3BIJA 4J4TA 3RSQA 4L51A 4N0PA 5K0FA 5A9TA 2JFVA 1NX6A 4X84A 4LHYA 3AF3A 2F59A 3DM5A 3V4LA 1RYDA 5FOUA 5AW8A 2XNDA 1W5SA 5DM1A 2OE2A 2ZSDA 4JGBA 2PSJA 2XA2A 3TO5A 5G02A 1GCAA 4WTOA 4ZXFA 4YV7A 3T5AA 3MGGA 4DVGA 3HM2A 2FLVA 1T9KA 3E6AA 4GPBA 3TRFA 1LDNA 4LFAB 4G5RA 1UT8A 2OXRA 4G6ZA 2IHTA 5IUNC 3AEYA 4PAGA 1M2GA 2FKNA 1RADA 2PZ8A 2FUNB 2B34A 4FQ5A 4R2JA 2IS1A 2G83A 4X1IB 3QU7A 4CEIB 1VRCA 1WMSA 4ZAYA 3W8NA 4F1JA 3KAJA 3BCUA 3CE6A 1OYWA 2IYVA 5C5IA 1ZL2A 3TLZA 4IJ5A 3DMRA 2I7DA 3R41A 3D81A 2I91A 4MOWA 2BDEA 1VKNA 3Q7EA 4ZOCA 3LBIA 3WMXA 4FHZA 2NXCA 3M2TA 3AKDA 3HKCA 5DCYA 4MRNA 1QTQA 2OQ2A 1L5OA 4BNNA 1EGVB 3A4TA 4TWRA 1NASA 2GA8A 4WZAE 1ZVMA 4DS3A 5U9CA 1IIBA 2WFAA 1FLVA 3ZXUB 1T1SA 5K8VA 1C3EA 3K0FB 1VE7A 4GXTA 3WAGA 3DKVA 1CQJA 2GK7A 2FPSA 4J7AA 1KL7A 2FZCA 1X7GA 3FI0A 4KU4A 4LYGA 1HSOA 4OJTA 4Z4EA 3CRNA 2XGGA 4CT5A 2NUPA 1YB5A 3C97A 4JJGA 1IB0A 2A0YA 1MQ9A 3ADOA 1AQUA 1VHLA 1JEDA 2NTNA 2MR6A 1FMCA 3BHIA 4PX3A 1XZHA 1VCHA 3HYSA 2OFWA 3B3AA 5G0SA 5CLQA 4BBPA 1FMJA 1SU6A 2HF2A 2JIMA 3VNRA 2R96A 2V3VA 5KBYA 3RYCA 2P8JA 3ZJ4A 1C30B 1IWOA 1L6IA 5EHZA 5IHXA 3AUYA 4QDXA 4V0NA 1TC1A 1JECA 1LU9A 1RP7A 4P83A 3RRYA 1KYTA 1QCZA 3QLJA 2Z83A 4FFWA 4OGGA 5IWCA 1II8A 5J1SB 2JASA 3M82A 4ENRA 4ZPJA 1CQXA 1WXFA 2BLLA 4V0ME 4DIFA 2VYQA 2ATCA 1IEQA 3REGA 4CQJA 1C4KA 1ETUA 2NT4A 3UHJA 1Z6ZA 1OGJA 1Z0ZA 2FK7A 4MK4A 4G01B 4FFRA 1R4ZA 5I7WA 1OH8A 3GELA 3BFPA 1KP9A 1P3Y1 1V3VA 2G67A 4L9SA 1JKMA 4PG7A 1RWBA 4FC6A 1C0PA 3U4AA 2HADA 4OM8A 1JSZA 2I3DA 1OZHA 4QELA 1P74A 5FI1B 4EW1A 3R3ZA 4EKDA 4I1OA 1DWPA 4OQ4A 4IO1A 1FP1D 4QRDA 1PIWA 2JJQA 5HF6A 4O33A 4EATA 2O3RA 3PNLA 3QEMA 1PJTA 3ZNNA 2CFCA 1G7CA 5FO0A 1ESCA 1R9GA 2R47A 4CKYA 4GS5A 1BOOA 2BKVA 2C20A 5F98A 4D4GA 1GKYA 2V6MA 1K66A 1DJOA 1NTOA 2DU8A 2NGRA 3HFSA 5FA6A 1VKHA 3PQDA 3ID6C 4TWAA 4F91B 1XEWX 3F47A 1JHXA 1QMPA 1E79D 3K20A 3ONEA 2Q4DA 3ZGZA 3L40A 1ZD9A 2GN4A 3KJGA 4X1YB 4TXMA 2E48A 4YRPA 3T06B 1OFUX 3KKEA 1MBZA 4YP1A 2ZRIA 3L0SA 4OSOA 1N1EA 1DQSA 2A9OA 1Z75A 2C5HA 1PV4A 2WJJA 1I01A 1NVDA 3QKSA 1ZA2A 4UUMA 1M0TA 3T54A 1YASA 2ECKA 3WI7A 4CMGA 2XTJA 2O3UA 3DOCA 1WXDA 4EJSB 4P86A 1THGA 3MJEA 1PUJA 5AW3A 1D6MA 1U6IA 3ZVMA 4D25A 5LLTA 1DFHA 3O8BA 3PFNA 2EIXA 2VNKA 4JLPA 4ETIA 3VSDA 5KVCA 2IH4A 4WAUA 2YC4C 1R9MA 2FZWA 2XZOA 2G0NA 5BMVA 2GAIA 1O5OA 4AYXA 4MA4A 5K8JB 4AJ9A 1UBKS 1JH9A 4BMDA 4MJ7A 1QG6A 4ZYYA 3VPCA 1GQ2A 3VR5H 5JNTA 4TLMB 3L84A 2IZZA 4TT3A 1TZBA 4OIFA 1PJBA 2YZGA 3KWJA 4F3RA 1K0FA 1MABB 1GG5A 1QDLB 2C2YA 3D6NB 5HJ2A 3QOXA 1VG1A 3PGJA 4BMCA 3OKFA 4BNZA 3PFWO 2JGLA 4MVYA 5GJWC 4RULA 1WABA 5EGSA 1Y3HA 2GF9A 2ZRNA 3TMYA 3U1VA 4GG1A 2IHZA 4Q3AA 1JKXA 3CUEF 4E08A 4UHCA 2VHQA 3R3UA 3LY8A 3ZN2A 4N03A 5A3QA 4AG5A 3NBZC 4PBRA 5EZSA 3CVVA 2J7PD 4PAQA 4AWXA 4NEGA 1PWZA 1UKBA 2A0UA 2OCYC 3JTEA 5TQ2B 4C88A 4D9CA 1PR4A 2I7CA 2P75A 2UZAA 3STTA 2PZEA 2QM8A 4URVR 4NV3A 3RSSA 2OFOA 1YCHA 4YT4A 5FWYA 1PL0A 5GP1A 4Q4CA 2BTOA 1ORDA 5CA0A 4DTIA 6ADHA 4M1QA 5H3HA 1I10A 2OB2A 2FPPA 3OZCA 2R5FA 1S1MA 5AIBA 3O8OA 5E6RB 4NBKA 1A7AA 3FWNA 4FZJA 4ZRNA 3U7QA 3W9BA 3NFRA 3AWIA 4B7ZA 4KVGA 3RF6A 3R3YA 3PRYA 2Y4NA 1VSVA 2ZSEA 4OBXA 4LSMA 1I13A 2OG2A 4NAVA 1Z5NA 2Z30A 2ZETA 4B8ZA 1V96A 2QM3A 4YRLA 3R74A 5I48A 4IVQA 1N2EA 2YHSA 1M0EA 4B3RB 2ID4A 3CNNA 4UNSA 4B7CA 4MV7A 4XSVA 3VZSA 2EP8A 4C07A 2QD4A 3H84A 4NC9A 4XA8A 3A0UA 3OECA 2C2BA 1CF2O 2VRBA 2CHUA 3NKVA 4HAZA 4RY2A 3A6DA 2RE8A 3IV6A 4S04A 1HLFA 4QUKA 4QE3A 4O4JF 5I7OA 1USKA 5EMKA 2XWSA 2IXAA 2NNWB 3NTXA 5DBHX 1PZFA 1LLCA 1CY0A 3ZKAA 3EZGA 2BPOA 1MVLA 4PN3A 5AVZA 1ZKDA 4L22A 4LBZA 2C7RA 3Q5GA 1VJ0A 2EP5A 1NQWA 1V7ZA 2EF1A 2FOXA 2W83A 1DU4A 3GRZA 5HIKA 2WFLB 3KKMA 2AFIE 2OBMA 2AFHE 1VE9A 1A9TA 5JE8A 5HSGA 1E58A 4ESHA 1E3QA 3E4DA 3N2GB 2VDJA 2KSQA 3HG7A 5DXAA 3HA5A 3U39A 2PBZA 1SH7A 2JLRA 1FDVA 4RHCA 3EAFA 4IKOA 4DMRA 2BW0A 2BHNA 1DCKA 4NCAA 2QQFA 1D4FA 1NUAA 3WA6A 3GJ8A 2I6GA 3A2NA 1H5UA 1HYGA 4EUNA 2YZNA 4C4PA 1MRNA 2JCBA 2Y05A 3HU5A 2FEWB 1XCGB 2SECE 1U7XA 1F38A 2Q9AA 1Q7EA 1DXYA 3KVVA 1E98A 4TKUB 2D1YA 5JS8A 3K5IA 4GT1A 5LA6F 3IUMA 3M34A 2IY7A 4GR5A 3V1LA 3R5TA 1C7JA 2D2EA 1QO7A 2CLOB 4Q4JA 1LQTA 4AURA 2E21A 2V4MA 3N8KA 1RWNA 4BXOA 2B7LA 4IPTA 4LYEA 4JGIA 4JT4A 3RWMB 3VBCA 1R8XA 4A23A 2QZSA 2IHKA 3EXG1 4KCGA 4Z3KA 3BMCB 3AVUA 4IUCS 4X8OA 4HT3B 4O4IA 2GR9A 1KI4A 3WX0A 5J3JA 1FRVA 4IIJA 4UBMA 2YV5A 4A5SA 3GFPA 1XWIA 1QG2A 2PSSA 3CA8A 3OU2A 3CUSA 3ES9A 1GFIA 4B3BA 1KY4A 2BIFA 2J07A 2Q3HA 2WJVA 4NICA 4OSPA 3RREA 4ZJPA 3ETJA 1SC4A 4JIMA 2JHAA 2IHJA 3BH7A 2IUUA 1C14A 4IDCA 5CDSA 5IZCC 2ROQA 3FCAA 2A9VA 2IZ6A 3K1JA 1D04A 2H1IA 4LYDA 4MV8A 1MAHA 1O96A 3T61A 3VU8A 3AFMA 1F2TA 1P91A 3N8IA 5LBIA 1Q3KA 4CETA 5TGZA 1EVZA 5EJ4A 2JDID 3F71A 3NBFA 5FEUA 2Q2WA 1RTTA 2ZSHA 1VP9A 4IIYA 5C34B 3VHQA 2FW0A 4CI0B 2FWBA 5JSKA 3W8FA 2CKMA 2DB3A 1N7IA 4QX6A 4HAVA 2HSEA 2O8FA 1Z7GA 1WXWA 4BNTA 3K31A 3P96A 2DKOA 3BC1A 1YZUA 1KOGA 1IE3A 4KE8A 5GONA 5K2OA 2ZIXB 4FXPA 1ULSA 1XELA 2FYTA 3EWIA 1OW3B 4OHBA 5DDIP 5BMOA 5KHOC 1RWXA 4X7PA 3LL4A 1NUQA 1T2CA 3IMKA 4B9EA 1VGVA 4NU0A 1DBSA 2QSUA 3GT4A 5F7ZA 5HOQA 5K4GA 5DM4A 3ER8A 4I46A 2IA5A 3ORYA 5JZSA 2C98A 4QLBA 4BN0A 5IT9A 4OO3A 3ZW9A 1FLDA 3K1ZA 3BHNA 4EB3A 2W6JA 3HRIA 2HF8A 1SCDA 4F84A 3I8SA 1YQUA 1CS0B 1KR5A 1WXEA 2I80A 3PT9A 3IQZA 1T2FA 3SHVA 4PLWA 3SJUA 1DIAA 1XMQB 2AA3A 1U4SA 3D8UA 1V4VA 3KV3O 5B3JA 5IVIA 2GARA 1ZYUA 3CV3A 3SEQA 3WGNA 1W47A 4YO7A 4EHAA 3UG7A 4AQ7A 4FGWA 1OVMA 1GKIA 3G6KA 3B1YA 2B1RA 3NIWA 3RRXA 4AY3A 3EXHB 5DZSA 3WBJA 1MHTA 2FA9A 2P1DA 4OYYA 4ASUA 4K2AA 5TIIA 5E2IA 4EFNA 2IYPA 4QPDA 4TRNA 4QBIA 2CCGA 2FGKA 1TA9A 3KUXA 2ASVA 5HE9A 3P9RA 1BXRB 2ZJBA 1I2ZA 3PUHA 3H04A 1YZNA 2J4DA 4CLXA 1C3JA 4DSOA 5KYXA 5DIFA 2GFIA 4J4HA 3ZHVA 3UK2A 2ZRPA 2C88A 5AICA 2HB6A 2HLHA 1TRKA 3RADC 1E1NA 1NIPA 2W0MA 3M4JA 5KMGA 2X0EA 5C4IA 1FXWA 1OTYA 3BB4A 2Q0QA 2B8NA 2NG1A 4RQAA 1RYHA 4DIUA 2Z2YA 1MW8X 4P0TA 2VDUE 4NYMQ 4UMEA 1UDRA 5LQCA 5FOVA 4BKOA 5IASA 1GLVA 2QQ5A 2I8LA 3EBLA 4Q3DA 3GZTB 1CQPA 2XAUA 5DYWA 3TOSA 3WGMA 3WFIA 1G3RA 1GTL1 3S5JA 1TVKB 3TVYA 1MX3A 4G86A 4OGKA 4XYBA 2DEUA 1G2OA 4Z2YA 4DXHA 1L1RA 4BZZA 1F8XA 1JXAA 3PC8A 1PV2A 4KIWA 5I7FA 1LBQA 1CUWA 1LI7A 3LX8A 2NUAB 5GJVC 3WAJA 5FBWB 4XEHA 2P3SA 4ZQIA 3V1NA 4KIUA 3CVWA 4XWTA 1A8SA 5AVVA 1Z4PX 2AI3A 4XTRA 2J1LA 4YY3B 4Q21A 3W3AA 3DDZX 3CH5A 2X0DA 2PL9A 1M5UA 3UUGA 4CF4A 3H5RA 4ODIA 3T52A 3OE7A 5LKRA 3QX3A 5CGQB 3SIWA 1ANKA 2PRKA 1ZD4A 3FUXA 4QJ3A 1XYVA 3FW1A 3FSGD 3LNCA 3RTAA 5HX7A 2V3CC 1GTMA 1ZR2A 3I1JA 1GT6A 5HJEA 4NVRA 4LF6B 1D0VA 2ZW9A 3TRIA 1TZMA 3HB0A 3ONFA 2PJZA 4KOAA 1FTYA 3PD0A 3B3FA 1Y1SA 1HE8B 4ZYZA 2GPAA 1UINA 3ASUA 2I55A 3PF8A 3F0TA 4EKNB 5AW6A 3CPJB 3IT3A 3S1AB 3EVTA 3WIBA 3BMNB 1M34E 4MCHA 2P9BA 1FFCA 3NGLA 3PD1A 2XT9A 4EY3A 3RVQA 4BO2A 2WZBA 2KBEA 2VSXA 3B3GA 5BR4A 1P0FA 1RVV1 2QBYA 4CVNA 1V5GA 2OO5A 4C2UA 4RL6A 2ZTSA 1U5BA 2KYRA 2X9VA 4IO0A 4ARIA 1NP7A 4R9SA 3VNQA 3NRCA 4KUGA 2GEUA 2C54A 3MT7A 4RPJA 1VB5A 1ZCFA 2IBMA 2QNRA 3MMSA 4REQB 3T1OA 4RLQA 4IJ6A 1CZOA 4FDUA 3FTEA 2WKSA 1JXMA 1PFKA 1XAJA 3K9WA 1FSFA 1KJWA 1V9SA 1NW5A 3UJDA 4Q3BA 1C9MA 3ROMA 1QKKA 2UYHA 3REQA 1CF4A 1JKJB 3CTMA 1XNGA 1VJ5A 2WIKA 1I1QB 1V8OA 3D6TB 1EWVA 2QXYA 4IH4A 4DEXA 1Y7TA 4IQFA 4MR8B 2JHCA 3D1VA 3VJLA 3OIYA 2QIPA 2FPGB 1OX6A 2QLMA 3TAUA 5J2UF 1C4XA 1OBOA 1WZIA 3S3TA 5IS2A 4C7BA 3LUFA 2ZTVA 2VUUA 3WGOA 3ELYA 4RFVA 2CJXA 1QH8B 3G8DA 1OHHA 3G0DA 3MZ0A 4M38A 3TJZA 2FU5C 1YBAA 1QB7A 2CFTA 2PIDA 1X7DA 3PU6A 4ZEVA 1ITZA 3C3MA 5BR1A 1ZNYA 1K8XB 4NYJQ 4DUGA 2H1OA 4MWSA 1C7EA 2YC2C 4CEJA 3EH1A 5H9WA 3JRXA 1B8VA 1QVVA 4CMEC 1EHIA 2FETA 2PDAA 3AG6A 3AHCA 1MQ8B 1CERA 1DAMA 1ECFA 1Q2XA 3KSUA 3MCVA 3D8NA 4TV8B 4BMNA 4LK2A 3U48A 3VVCA 2EQAA 2ODBA 2W6PA 5A7FA 4FYWA 3ZVKA 3DOUA 1GSHA 3AZPA 2C0CA 3ESAA 4BJHB 4BFVA 4MARA 1DJLA 2ZYAA 2JI7A 3NM6B 4FZ5A 4WZBB 3THOA 4P58A 4KXYA 1ZH4A 2Q3EA 2HI0A 2R7NA 2CWDA 1CIJA 3B9RA 3QWFA 1Z06A 3IELA 4ZDKA 1IDOA 2BEWB 1J5EB 4BLTA 5KOYA 4DANA 5DEOA 1W4CA 4GDMA 1OZ0A 2C1ZA 4TQUS 1DQZA 3ZDQA 2ZSKA 3MBOA 4IDPA 4Y0AA 4LOKA 1IXSB 1RPZA 2F00A 4OLAA 1SXGA 5C2JB 2QMHA 2ISCA 5LB2A 2XRMA 3QUSA 5BYJA 1MJ5A 1QF7A 1MVNA 2G08A 1KPIA 4YJFA 3ZDFA 4IXTA 4AS3A 4X61A 3MCUA 3WLPA 1ZSYA 4EWLA 1BD3A 4Y7CA 5EZ6B 5CURA 5H1YA 4DJTA 1T26A 4BDSA 1F48A 3U26A 1BVRA 1DDIA 1H6CA 1JR3A 3GGGA 1SO8A 1W581 4URZR 1G0NA 3QXCA 3E22A 2BMVA 1Z4NA 2IOQA 3QXJA 2ZAOA 1OI2A 2UZ1A 3WGJA 1BMTA 3PUWA 2MWMA 4O4LB 3S2IA 3UO8B 3WDLA 1IY8A 3GDGA 4V0RA 4ENSA 4WEQA 4BAGA 2I3GA 4QTTB 4NATA 3NHBA 4FDMA 5HMMA 2AVDA 4YJ3A 3S5UA 1RWKA 3TXAA 3DEFA 1SPBS 4YP5A 3LFTA 2Q6TA 1YJXA 2YICA 4A0RA 2LXNA 1XYGA 1HMYA 2J6IA 2WF5A 3QY9A 4M53A 1F1BA 2JI8A 5FBVB 2PJRA 1ZSNA 4DC0A 3X44A 3OTHA 2N3ZA 3GOHA 3X43A 1FQKA 4KMMA 5IBCA 4NF2A 2Q4OA 1DBIA 1B8PA 1IIRA 3RIYA 4II3A 4O3FA 4NMMA 5DCLA 5H3LA 4CL8A 4EB8A 3HBJA 2ZRHA 2EFDB 4BQSA 1HKUA 4EQZA 4LQCA 1GGFA 1D7AA 5KQLA 3H13A 2FPUA 1IZYA 1LGYA 5ECYA 1X1DA 3GJZA 3I39X 4P4LA 4ZFNA 2P2GA 2WSSA 1DPFA 1L4HA 2A9PA 2PD3A 2ZUSA 4LDPA 4WBNF 5JNLA 1IHPA 1CY7A 3NVMB 3QUAA 4INAA 3IV7A 2GYYA 4AUKA 2JBWA 3O8NA 5AWFC 2WD9A 2PZLA 3QU9A 4WFKA 3NONA 3K8ZA 1QIJA 4HGQA 1VLQA 4DDMA 3PSHA 2WNIA 2GTPA 1DKNA 4F6LA 1UBTS 4ZU1X 5TPZD 1WVIA 4XR4A 5E3JA 4Z9XA 4QT4A 4OQLA 2ZJZA 5JY6A 1MG0A 1ZY2A 2WFMA 3EVDA 5EI5A 4FYPA 5KOJA 7MHTA 3IQWA 1CR6A 1S2OA 1IULA 4UDXX 1LPPA 4DV7B 1A2OA 2WA2A 1CG6A 5EHNA 2M6LA 4NP6A 4PO9A 4JB0A 1NN3A 3UJ9A 1UPBA 4RA9A 5C7LO 3SLKA 3KETA 1M6WA 1NI5A 4HGZA 2I6QA 4MUGA 2QX7A 4Z8YA 2OT3B 3KRTA 4URUR 3LXMA 4YCDA 2ZEJA 1RHUA 5DHQA 1NXOA 4DBVO 2JEZA 4ZV9A 1C9DB 2LWIA 3QEOA 1RYYA 4Q1FA 2Q1TA 3Q8WA 1NVWQ 3MAAC 2JFGA 3JZAA 1NJ1A 2Z6VA 4IDGA 2DKFA 3W6ZA 4MUFA 3OJ0A 3EGEA 5LZ9A 2ZIUB 1YS6A 1YB6A 1YZHA 2GESA 3LLUA 3RU2A 1CUFA 1FP4A 4U02A 2J08A 1ES9A 1NBOA 5FBQB 5A04A 4QUBA 1E5QA 5IP5A 1K5HA 2IXGA 2C97A 3U7RA 2VJLA 2XCLA 5EE3A 2CXRA 2IEZA 1Q7CA 1UK9A 3FBTA 1M1YE 1UBEA 4AG3A 3OF3A 3LQ2A 3ISTA 4LGYA 1L1FA 2NO7A 3T0GA 1DRJA 1N6IA 2X4GA 3L7NA 1MAAA 3K32A 4WXHA 3T3PB 1DKLA 3KJNA 4JSYA 4V2UA 2I33A 2CYAA 3FTPA 1V8BA 3DT9A 4DLSA 1MKYA 2ZXEA 3B13B 1PW7A 2QJRA 4ROSA 4CN8A 1MT0A 2B1GA 3UPDA 2V97A 1V7QA 1NULA 1CB7A 2VN8A 3QGMA 4YCJA 4RACA 1SBTA 2HL6A 3MTEA 2V7WA 4W82A 3SYLA 5HRUA 3GMIA 4BQNA 3SC6A 2O2ZA 2BDTA 3DE7X 3H65A 1IZ9A 3DAFA 4UQOA 3FF4A 5K0LA 2O3SA 1FVFA 1E4YA 2F3TA 3FVTA 4FT4A 4QPPA 1TEVA 4WFQA 3EIXA 4QPJC 5CM8B 5IVDA 3OO1A 3GCGA 3L5OA 4XDYA 3ZW8A 5BQ3A 3FCUB 3FVWA 5BRNA 1GLNA 4N40A 1BA3A 1R6AA 1RRKA 1EVQA 2UVPB 3GNQA 4FOSA 1WF3A 4Z7OB 1W5AA 3PNMA 3QVOA 4QA9A 2O1SA 4GEKA 3KVRA 1KEEA 1T13A 5JZ9A 1DUIA 2OUKA 3GROA 4DV1B 2Y9PB 2R6R1 2W2XA 4D42A 1F9EA 4M55A 4UHKA 4U5XA 5HCNA 2FB9A 2XEXA 3SFVA 2HYIC 3HK2A 3LUDA 3NJRA 3WO1A 2MTBA 1Z4KA 1XRJA 1TAHA 1G8SA 2Q29A 4AULA 4KQCA 4YBRA 4LC0A 3I01A 1PBTA 3ZWOA 4Q15A 4NU5A 2OXFA 4HVTA 2X9QA 1S8OA 3A36A 3G13A 3ND5A 5ITSA 4KWIA 5DPMA 3KUKA 1XT6A 1N7JA 3OJEA 3FHJA 2IUTA 1CIVA 4LVOA 4P3OA 3Q0EA 1IQUA 1VPTA