5DI9A

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
b'VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 63
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di9A00
4DB4A 3OE7A 1P9NA 1KO4A 3ZVRA 2IUTA 2GKSA 1S9DA 1JAIA 4M22A 4EQ6A 3ASYA 3Q85A 4YMVA 1UBGA 4M1MA 1N0UA 4G5SA 1D2MA 3SFZA 4QKQA 4WXRA 3OFNA 4OJQA 2IS6A 5JRJA 1U0JA 1ZP6A 3IDQA 4JBXA 1GWNA 3EIEA 1Q3HA 3UMFA 1D2NA 1YZGA 2H8KA 1U81A 1HY3A 1PJRA 1OYWA 4A15A 2OFXA 1NY6A 2ORVA 1KDRA 4GDFA 2WWWA 1EFCA 3RS5A 4PHTA 1CIPA 1T5LA 3VNVA 5FPTA 4B3CA 2F3TA 4DBLC 5D3MA 4OL0A 5JZVA 1W36B 4B3DA 5FOXA 4GPTA 3SFVA 2GVDC 2WICA 4LJ9A 1DAIA 4URYR 4JBWA 2RGEA 3TAHA 3EC2A 2P6UA 2R2AA 2IYUA 3ZYCA 3WBJA 2JLRA 4O0MA 4F4CA 1NMXA 4D4LA 2QSZA 1U98A 3CUEF 3KFVA 2ZI3A 3P4XA 3WMGA 2IYZA 4A6PA 3Q5EA 2OFWA 4BWYA 2RGNC 1AJEA 2RKOA 2VSFA 3RRMA 4CEIA 3VMFA 4DHEA 2G77B 3CRVA 4EPWA 1G6OA 5IK2D 2FNAA 3R9XA 2ZJAA 1SQ5A 4OJKA 4DLSA 1DPFA 1WA5A 4P33A 1SXJD 2Z4RA 3PUZA 3VR5A 1YZNA 1G3IA 2YINC 4IDPA 1W0JD 1NLYA 2R9VA 1L2TA 1GAJA 1TQDA 1ZNXA 2ZRMA 3EWSA 1EX7A 4UXHA 2GK7A 2WKRA 4P32A 3GLIB 4DJTA 2ZANA 2J3EA 4HDCA 4BFZA 4JVNA 2ZRPA 4AKIA 3HR8A 1Q21A 4Q9JA 3EWAA 2O8EB 3LW8A 4JKIA 1XEFA 3GMTA 1JPJA 5FOWA 2PT7A 3QEJA 3B82A 1GKIA 5FUWA 2IEZA 5LPNA 2JGNA 1JQLB 1UADA 2B7CA 4MQBA 1PV4A 5JHGB 4G0NA 2N1BA 5JFGA 2I3BA 2ZUBA 3MWKA 1E9AA 1HEIA 2NZJA 4LJ8A 2DBYA 1MV5A 4HSEA 4TLBA 2FSIA 4TSFA 3ZD6A 3A6PC 5L8VA 1SZPA 1N25A 4D80A 2JA1A 2AFHE 1HURA 4EKDA 4C7OA 4MUBA 2C8VA 2G88A 4TMWA 1WE2A 3WMFA 3DO6A 2SHKA 1R4AA 3SS8A 3A4MA 2CLSA 1OKKA 2ATXA 2YOFA 5C46F 5A5GA 5KU1A 5FI0B 1XCGB 3MGCA 2MMCA 4N0EA 1KI9A 5BN3A 5K8TA 4AURA 2QPTA 3K9NA 3M0EA 3H86A 3LLUA 3HP1A 1M2OB 1A1VA 2XSZD 3PV0A 5EP3A 3B1WA 4KYUA 2IWHA 4EQ6B 1KI4A 3PVSA 1O87A 3GJXC 4LK2A 3LX8A 1Q1EA 3K0EA 2OXRA 3I92A 4KVGA 4Q7LA 1J7KA 1A2KC 1UKYA 4PZLA 1Z83A 2IYSA 3LY5A 3SEAA 2GXQA 2QPAA 3RS7A 5HR5A 1Z6AA 2BV3A 2GBLA 4HZIA 3QXXA 4PPGA 1UKEA 1YZLA 2EFEB 2YV5A 5JWOA 3I32A 5CIWA 1E3MA 1X1RA 3NBXX 2AWOA 2RGGA 3NXSA 2IS2A 3KKQA 4DC9A 1T91A 3LAWA 5FTLA 5D3MB 2ZRIA 3ZS8A 3GLGA 1NN5A 2BEKA 2VHCA 4QGAA 4FWTA 221PA 4RKFA 4F91B 5L3QA 4A82A 3EA5A 4IDQA 4MRRA 4DDUA 1RRPA 2DWQA 2DWPA 2AXPA 2W6JA 2GEDA 4IHQA 2FPMA 4N1AA 4YQFA 1DS6A 1P62B 3K1JA 4AIIA 2JLUA 3QJYA 3MD0A 2V1XA 4KAXA 4PTLA 1OHHD 4ZCMA 2R44A 1FNMA 4PFSA 2WVJA 5H8WA 4AG5A 3TH5A 4C0JA 3IHWA 2HJGA 4CEIB 1GL9B 3O8RA 2OCPA 2V1UA 1FMLA 4EFNA 1JJ7A 4CEJA 3KB1A 1IQPA 2DFNA 4EJSC 4LJ5A 1F2TA 2OO7A 3RSOA 4RD2A 5E3HA 3SYLA 4M9SA 4DLRA 2VSOA 2WPDA 1U2RA 3OIUA 1FUKA 5TDHA 1OH6A 3TRFA 2VP2A 4JLJA 3LO5A 4GMDA 3UMSA 4TT3D 3QQ5A 5H70A 5BWMA 1SVWA 1NY5A 2GA8A 3FHTA 4Q9HA 2ATVA 3OESA 3W8RA 3LLMA 4C30A 3I8SA 1XEWX 4W7SA 2PX3A 3AF2A 2FX3A 4BFSA 2R8RA 3CRW1 1FQJA 1KY2A 3CBQA 3PENA 5J40A 2V7QA 1WRBA 1NVUQ 4RD4A 4BASA 2FPKA 4IOLA 2J59A 2PZEA 2C96A 3A36A 4BLPA 4DSNA 5JECA 2WKPA 2QAGC 3AUXA 5CK5A 1S0UA 4A4DA 2NTYC 3PUXA 3I62A 5TV2A 4YMSA 2QQEA 5C4MA 5L3SA 1UAAA 2QQ0A 3S1AA 1IY2A 2G0TA 1M7GA 3GCGA 5FPHA 2XZOA 1RYFA 2CJWA 4MITA 1QZXA 5KPJA 3GEEA 4C7OB 5AWFC 3P4YA 1Z08A 1IJEA 1ZBDA 4PAOA 2WMNB 4YC7A 3K70C 3MLEA 1IY0A 2WOOA 1G16A 3RNLA 3BE4A 2CLCX 3D6TB 3MMPA 2Z0MA 3BB4A 2J7KA 1R8QA 1NP6A 3IPXA 621PA 1DE0A 3UPUA 5G41A 2KBFA 1ELOA 2F1JA 4L9WA 1E79D 1OXSC 1T3LA 3CH5A 3KXKA 5FH9A 5CLLA 4A8JA 3QXSA 3GQBA 5CIQA 3T5DA 4NYMQ 5DGXA 4FN5A 1SVLA 2KJQA 2QN6A 2BKUA 5EXXA 2PJZA 1G19A 1NI3A 3DMDA 5BN5A 2FFQA 3PFIA 3MWJA 3X2SA 1JALA 1QHSA 1R2QA 5A0FA 3VFDA 2D3WA 5FBLB 1ZIPA 1XPUA 2J46A 5J4HA 3OZXA 4E03A 3AVXA 4US2R 2AD1A 1KNXA 2BM0A 2ZIAA 1JNYA 4RD0A 4DXAA 4CVNA 2KE5A 3OIWA 1II8A 4PSKA 3KQHA 1ZM4A 1AKYA 1WBBA 3B9QA 1FTNA 4ACBA 1MO6A 3K09A 4NP6A 2EFCB 5FL7A 4B2IA 1RVDA 5KPDA 1OB2A 1M7BA 1QG2A 4HAUA 2EFHB 3PR1A 3GLGB 1RYHA 4LJYA 2G1JA 2DR3A 3CB4A 4XSHA 1NBMA 2IF2A 5L3QB 5GADl 3VKGA 4B3BA 5EE1A 4MRPA 2QTVB 4A36A 3VR3A 3C16C 1FMJA 1CR0A 2BBWA 1DO2A 2WWFA 1GKUB 1NMZA 3TLXA 3SE0A 1LFDB 1JB1A 5DN6D 1YE8A 3I8XA 4AI6A 2OBNA 1E2QA 2QT0A 4WXPA 2XOKD 4F7WA 3AH8A 1DAGA 2OCYC 1KSHA 4IOKA 4ZIRA 3NVAA 2ORIA 1KI2A 5AUNB 2VL7A 2VP9A 4CEJB 1II0A 4RZ2A 2PLRA 4TWZA 1PZNA 1GIAA 4L15A 1F2TB 3AUYA 2GK6A 4GZLA 3PITA 3ZZ0A 1K8RA 1UEIA 5KNCA 2BBSA 4MYTA 2XITA 3VU9A 1F2UA 1KI6A 3AGQA 3N2EA 4O3MA 1LTQA 5FL7D 1XRJA 1UBFA 3KZ1E 3BFKA 1SXJE 3SHWA 2ZJ2A 3QF4A 3KQNA 2ECKA 4OI0A 3DVLA 1Z6XA 1UM8A 2H17A 3U7HB 3U3MA 1UDXA 1KYIA 5AJYA 3NHAA 1NBMD 4A2WA 4G5GA 5AJZA 3X1XA 2QTHA 2A5GA 2OHFA 3BXZA 5G40A 1RRCA 4FMCF 2QG6A 3UXMA 1G291 3QVUA 4IKEA 4DLYA 2NO9A 4LUCA 3FOZA 3ONWA 2ZRKA 2V9PA 3C8UA 3REFA 5FOUA 2GEUA 1XP8A 5HKKA 1E1RA 2ERYA 3IQWA 3IUYA 5CK4A 3KL4A 1US8A 1AA9A 1XXHE 3RVBA 5L3SB 4DSUA 1JXMA 2RGDA 4P3YA 3S1AB 1D9XA 4LBZA 2K5UA 4X8OA 2CJWB 4EPVA 4GP6A 3RANA 1VDZA 2H5EA 3U5ZB 5DO9A 5LBIA 4Q66C 1NJGA 1G6HA 2GJ9A 5ELXA 4FINA 1S96A 1K6MA 3AF1A 3ADKA 1RRGA 5ANRB 3M4YA 4BQSA 2VHTA 4DB2A 4A8JB 2LWIA 1W4BA 2IHBA 1N6IA 4ERNA 1W36C 2PT5A 3PEVA 4UNPA 1UPTA 1N6NA 3MAAC 3LWNA 2H92A 2QGNA 4B32A 2DFKB 4D26A 5DI9A 2V55B 4Q19A 5LB4A 2OUKA 3SYKA 1OW3B 4B3XA 3A1UA 2QA5A 1XTSA 3IBGA 5HKKD 1E1RD 2CCGA 5G3ZA 1IY1A 4HB3A 2ZE8A 4YXWA 4MRSA 1II8B 2YWFA 1KTVA 4RD6A 1GP2A 1N0VC 3U3JA 4GP7A 3CPHA 1W0KA 1G1MA 3TR5A 4FMBB 2VSXA 1OT3A 2KB0A 3T35A 3SZRA 1MABA 1TAGA 1E99A 1JBKA 2EFDB 1T3HA 1HYQA 4TL9A 1G4UR 4KCGA 3U6BA 4DLVA 1KO7A 3UMRA 3U7EB 4NZYA 5HZHA 3RS2A 5TB5A 3QG5A 4TTQA 2FF7A 3R8CA 5EZ6B 5JCZA 1EFUA 1M8PA 1G64A 3FMFA 2P67A 2BMEA 3DPUA 4QHSA 1VG0B 2Y8EA 1W46A 2JDIA 2QUZA 4JSTA 4NBSA 4XOIA 5HZKA 4URWR 4TLCA 4RKEA 4TYYA 4IW3B 4JJKA 4QGFA 2GZHA 4Q7JB 4BLOA 4BPBA 1KI3A 1RKBA 4ZIRB 3AVVA 4A2QA 1COWA 3LA6A 1G7CA 2WSSA 3TUJC 1L7VC 4JYCA 4ARZA 1S3GA 4C2TA 3EIQA 1W2HA 2P0EA 5HTKA 4LGMA 1OH5A 1G3UA 1K5DA 4ZCLA 1N6HA 5IDVA 2ZYVX 4TL6A 2ZYTX 2QT1A 3C5CA 3SQWA 3TQFA 3P26A 3FFAA 1NLZA 3TJZA 4EAQA 3VU9B 2IS4A 1F2UB 1KI6B 1E94E 4RY2A 4XJXA 1RIFA 2GXAA 5CB6A 3QF4B 1RRFA 1Q1QA 1S1CA 2FJUA 2O0JA 5J4VA 4RCZA 4Z51A 5BYJA 5KOYA 1XEXA 1KK2A 4DKXA 2JLSA 3CPEA 2DWOA 2O8FA 3SC3A 3NBFA 1G17A 1RFLA 2ZE7A 4WZBE 2JJ8A 1T6NA 1ZD1A 2Q9CA 4QJ4A 3H84A 4EPRA 1X1SA 1AZTA 4LCBA 4ZV4A 1S8FA 5BW8A 1OLOA 1US8B 2ZJZA 2ZRAA 4E07A 4OQMA 4OI4A 2F43A 2DY1A 2OT3B 3QNUA 4V0ME 3TSZA 4WZAE 2AKAB 3RABA 5FPSA 4KI0A 1COWD 2WSSD 3I5YA 2JLVA 1P4SA 3TVTA 4YMTA 3VX3A 2GETA 4OHWA 1C1YA 2HLDD 5JEDA 1LS6A 3D31A 2VP0A 2CCKA 2ZAOA 3Q7PA 3NG1A 2VF7A 1E98A 4LI0A 5DYGA 4IEEA 3WXMA 2ODBA 2JATA 3SJCA 2J5XA 2GAAA 5FTKA 3ZLJA 1KOFA 2YJTD 2J87A 3E1SA 4NH0A 1GSIA 5FPYA 1W2GA 2ZI4A 1E2GA 4O2LA 4MUAA 4XVQA 4NMMA 5JSZA 1KJWA 4TL8A 1I4TD 3HPQA 4CIDA 4JL6A 3KXIA 5G3YA 4C0HA 1SVKA 1PLLA 4KBGA 4BLQA 5CB8A 3QPWA 4FMDB 2ZI6A 2DHRA 2PEYA 2JCSA 1KDTA 2JLQA 2PMDA 5JJKA 3JVUA 3CX6A 2VP4A 1K5GA 2CL0X 1SVSA 2DFLA 5EE5B 1KZGB 4HLUA 2RGCA 1R5BA 1S4QA 4HAXA 5HE9A 3D3QA 5EUQB 2IA5A 4K46A 4DRZA 2VYFA 1NVXQ 821PA 3B1ZA 4GFDA 4S35A 1NF3A 1MABB 3P32A 4HAZA 4D2IA 3H1TA 4TMXA 3QI2A 3IO5A 4LBYA 4KBFA 4XTCS 3QXCA 1YR6A 521PA 2OXCA 1FZQA 2EVWX 1VHTA 4JLAA 1E2JA 1VMAA 3O47A 3QKRA 1TQ2A 4NPHA 3UWOA 1F3OA 2CXXA 2J0VA 1NKTA 3ZZUA 4AKGA 2FWRA 3TUIC 3WP0A 3KJHA 4NYMR 1IXZA 2OILA 1VG1A 4Q5IA 3WYFA 1NIJA 5F3WB 3AVYA 1JR6A 1IM2A 3D8BA 4V0OA 4BZPA 1G3MA 2HCJB 1U0LA 4ARZB 2BCJQ 1N5KA 4IVQA 2ZSAA 3CZPA 3LVRE 4TZ6A 4LYHA 1TUIA 2BKEA 3QPVA 4DUGA 1Q0UA 2HYDA 5DH9A 4YMUA 5M04A 2NO0A 4DSOA 3AVUA 1GNQA 1CJTC 3ASZA 2QRNA 1I4LD 2X2FA 3KKOA 1TF2A 1KDPA 5AUPB 3A1WA 4M9QA 3AEZA 4DCTA 1BYUA 2AN9A 2QL6A 4MGKR 4PANA 1FNNA 2HDNB 1TU4A 1KY3A 4QHYA 1IN4A 4JLOA 3AF4A 4WAUA 3VHLB 1XEXB 2ONKA 4LYJA 1V43A 1SVOA 4ZDKA 2O8FB 2WSMA 4H9GA 3IILA 3NIBA 4RFSA 4C0KA 2DCUA 4FCVA 3E5HA 3EPLA 3ADBA 1NBME 3CWZA 5B64A 2C2HA 2QMUA 4C0AC 5EXSA 3QKTA 2YKGA 3ADDA 2R65A 1GRQA 2XZPA 4M2LA 1NJFA 1ZRHA 2D7CA 4GOKA 2F43B 4PQRA 2YHSA 4LPSA 5DHFA 4GI7A 4KVAA 3HU3A 3VR4A 1Z0IA 2GBLC 4JVMA 4Z54A 5J5CA 3W5IA 2WJYA 2QP3A 3R7WA 2QROA 2V6JA 5AUOB 4PSAA 5E7MA 2CVFA 3DZDA 1I4DD 3WNDA 3EX7C 2DFTA 2J1LA 2CVHA 3KJEA 3TAUA 3WY9A 2LKCA 2QORA 4I1OA 4HAWA 2A78A 1TQ6A 3I72A 3PUWA 1GRRA 3KJIA 4Q1EA 5JSZB 1SKQA 5IRCD 3QBVA 3TMKA 2HEIA 3F0TA 1U8YA 4P4TA 1OIWA 5IK2A 3ZVNA 2KSQA 1ZW6A 2FGJA 2ZSFA 4UNRA 2YVUA 1AKEA 2B8TA 3KUDA 3AP1A 3P27A 1QDEA 1NKSA 1AQYA 4U5XA 1SXJA 4Q1DA 3DHWC 3GJ4A 3VQTA 1YRAA 2N42A 4C9BA 1W0JA 4CT5A 3TKLA 1KSFX 4QFMA 5DLQC 1VIAA 3ZQJA 4CW7A 1NLFA 2OFOA 4A9AA 3GJ8A 1TPZA 3FYHA 2CCJA 1XDBA 4ZI3A 4TL7A 2ZM5A 4G5OA 1RZ3A 1N6OA 4IFBA 4B3GA 3GPLA 1Z8FA 4M1KA 2A7QA 1SVIA 1XXHA 3ECCA 3GFPA 4LHXA 1Q20A 1E32A 1QHNA 3IPYA 2F1RA 3QKRB 4NU0A 2IL1A 3UKDA 5JWHA 1Z0KA 3LVQE 3RRNA 5KYKA 1CKEA 2WTUA 3Q3JB 1M7HA 4P4SA 4TLDA 3T12A 2QU8A 4I1SA 4KLZA 2CK3D 3X1WA 1Z47A 3KQLA 4D4MA 2W2XA 2QENA 5JRZA 2ODWA 2GEVA 4FMDF 2PZGA 3MJRA 4TQ9A 1KIMA 1GNPA 1UF9A 1CJUC 1HA3A 1MR3F 3CX7A 1N6LA 3MWLA 4KFUA 1O3YA 1CXZA 2BMFA 2NZ8A 3NC0C 2ZRNA 1NVWQ 3A37A 5K8LA 1VG9B 1E0AA 2P6NA 4IJMA 1KJZA 3MG9A 4BZXA 4WW0A 3KX2A 1A82A 3B13B 2AD5A 1L8QA 3NHBA 1KO5A 4G01B 5EJEA 1CJMA 1ZC4A 2CE7A 4HLQB 2JIZD 2XSZA 4UJ3A 3EAQA 1DAMA 4DEXA 1QHGA 4D0LB 3BWDD 1YR7A 1NVVQ 2W2TA 3WBKA 2Z4SA 4OI2A 3T34A 1EFTA 5KDLA 1P2UA 2FSHA 5DSZA 4CYMA 5KSPA 2QM7A 4RFSB 2P65A 4KXFB 4DT1A 5TMPA 1F6BA 2WAXA 3DEFA 4A8JC 4PO9A 4BE7B 1G5RA 1P5ZB 3MRSA 1B23P 1ZIOA 2ZROA 1OXTA 1ODFA 4W9MC 1AS0A 2CHQA 2ANCA 3LV8A 4BGDA 1FX0A 3DM5A 4JLDA 3CNLA 3JZMA 2F7SA 1NN0A 3R7WB 3ZH9B 3JVVA 4D4JA 5E7IA 5FI1B 2XZLA 4MRNA 2HXYA 1G18A 1ZC3A 2QRZA 1W5SA 2BBOA 3EASA 4I81A 3RRZA 4OHVA 2GDJA 1OHHA 2DYKA 3K09C 4PQFA 5CYOA 4TYNA 3DDCA 3BORA 4OBEA 1KO1A 3GJ3A 1N0WA 4XSGA 4A6XA 3BD9A 3AVOA 1RPZA 1SKYE 1WB9A 3V9PA 3QOFA 4QOSA 3WRYC 2OESA 1ZINA 2DB3A 5L3RA 5D3QA 4DCSA 1X86B 1OF1A 1VPLA 4QM7A 3AP3A 1SXJB 3TBKA 4BFYA 3K9LA 4CT4B 2O8DA 3V4RA 2JEOA 1U99A 3KUCA 1P72A 4TT3A 1DAFA 4MYUA 3TR0A 4A1FA 1E2FA 3NH9A 3B1YA 1QHIA 2QTFA 3LH5A 1W4RA 3SJZA 2PMKA 2A30A 1YZQA 4B34A 3QPUA 3W6OA 4EPTA 1TF5A 1FPMA 4UXJA 3R20A 1Q44A 5IT5A 3SJBA 2YC2C 1XXHB 4XH9B 4FMCB 3OAAA 4NKRA 2YWEA 3DOEA 4V0MA 2CBZA 3LXRA 4TQUS 5JHHB 1Z0DA 1VKJA 1ZCAA 4P4SB 4DLWA 3K8YA 4QC2A 3P20A 4LHZA 3SU8A 1CP2A 5GJCA 1TEXA 5FTJA 3L0IB 4OHZA 3FKQA 1FQKA 1LF0A 4OK5A 4KLNA 3OIYA 1GTVA 3EZ7A 2EYQA 2L0XA 4DSTA 5FUVA 1G7RA 2D2FA 1R8SA 1E9BA 3EC1A 2BHRA 4PC2A 1DO0A 1XX6A 1EX6A 1Y3AA 1E79A 2OAP1 3ZD7A 2ZRLA 3KJGA 4E09A 4XTRA 3OHMA 3W6NA 4AYXA 4CGZA 1JJVA 4NE2A 1D6JA 4PC3A 4UNNA 3AQ4A 1OPXA 5FUYA 3U44A 1TNDA 2A2ZA 3GJ6A 5JBQA 1ETUA 1T0JB 1Z6YA 1Z6GA 1M74A 1CEEA 2AFIE 1E9EA 3OAAD 4M9ZA 4DT1B 2F1HA 4JKYA 1MKYA 1R5OA 1EGAA 3WYGA 4Z8XA 2PLFA 3SI7A 1T8UA 1ESMA 1ESNA 1X8KA 4RSGA 3OEEA 1LW7A 4IOJA 1TX4B 1E2IA 1QVRA 2ZR0A 1E0SA 4B35A 1ZNZA 2DPXA 2YC4C 2H18A 2FPLA 4QBIA 2XEXA 1MT0A 1FX0B 4R98A 4NCIA 2IK8A 3BRWD 2QBYA 4ACAA 2RGAA 2V54A 1P3JA 4M21A 1J2JA 1G7TA 5GJWC 1VCMA 1E0KA 4US1R 4NTZA 1VIYA 1OB5A 1DAEA 1U8AA 3EIHA 1MRSA 2WHXA 5LDDC 3U2QA 4ZI2A 2H16A 2ODEA 3JZAA 3L0SA 3LQRA 5DN6A 1N5LA 1AGPA 2PEZA 1KK3A 2P2LA 2ZQ5A 2ZRFA 2XOKA 5KO2A 3PEWA 1DAHA 1IJFA 3MWYW 1M34E 1IN7A 1VCOA 3WMEA 4A0RA 2VF8A 2V4ZA 1JEDA 3EZ2A 3LX5A 5JCPA 2QMHA 2O8DB 1H65A 3LQQA 4YONB 3OEED 2VA8A 2W0SA 2R6AA 1KGDA 2ZUCA 3LBNA 2JLXA 4RCYA 1NL3A 4BRUA 5GJVC 1OXXK 4BUJA 4HATA 4US0R 1Z22A 2EYUA 2PCJA 2QP4A 1GOTA 4NCHA 4EPXA 3I1FA 1TMKA 2VHQA 2WJHA 5BYKA 3UANA 4IEIA 1G4AE 2OSBA 1J99A 2E87A 3CR8A 1YHNA 3J81k 3QKUA 5H68A 1NMYA 4CZ2A 1XTIA 1L4YA 3BS4A 1P6XA 1NNEA 1DVRA 1U8ZA 3BH6A 4HUTA 2IXFA 5DYIA 3OEHA 4QNMA 3EPKA 1KDOA 1UDWA 2D2EA 4M9XA 1NN1A 4M1SA 4P31A 3KKMA 3LNCA 1W7AA 3NBZC 2Q6TA 2EWVA 4R2IA 4HUQA 1N5JA 3SBEA 3PEUA 1AK2A 3GLHA 4OQNA 1F48A 3EARA 3NDBB 3L43A 1P61B 3RS3A 5TVKA 3DKPA 4XD7D 5CDFE 2O52A 2A5JA 4MYCA 3W3ZB 1E9CA 1TQ4A 1XEWY 3NWJA 1T0HB 4RFVA 3BFXA 3BGWA 2JJ1D 3GEHA 1XZPA 2IYRA 3AKEA 1BMFD 2CE2X 2ZS9A 4DDWA 2Z43A 4JLBA 1YRBA 3ZVMA 2FV8A 2ZRCA 1D5CA 1HUQA 3U44B 5KNDA 1M6NA 1AS3A 8OHMA 4G3XA 2VLIA 1Z2AA 2JASA 4QBHA 1AQUA 2KBEA 3PG5A 1DAKA 4LC0A 4I4LA 3ZDQA 3LD9A 5B2ZA 4DLUA 1EXMA 3VHXA 1Z2CA 4GBMA 3QE0A 1AS2A 3OEHD 1UKZA 2UZIR 4BRWA 2QPOA 4ESHA 2ERXA 4JL8A 1OIVA 4ZO4A 3W5JA 2NGRA 4IXNA 2NMVA 2IEYA 2ZRHA 3HWSA 5FBVB 3I61A 3CZQA 2ZVPX 4S2EA 4AG6A 4MH0R 2P6RA 4FCWA 1XWIA 3Q72A 4O2RA 4V0NA 2QSYA 2WWGA 1BO6A 1E9SA 1U9IA 4UKDA 2QBYB 2OCBA 1IN5A 1YR8A 5EE9A 2EWWA 3RAPR 1ZCBA 4ESVA 5CYPA 2AX4A 4IDHA 4DLTA 1XB2A 3B5JA 4B33A 3N2IA 2VQSA 2GXUA 1AZSC 3B2EA 4HLUC 2BM1A 2GF0A 3A1TA 3NDPA 4FWIB 4ZDWA 4B44A 4PX9A 1P2TA 3DZ8A 4Q4JA 4TLAA 1MRNA 1XZQA 2R6CA 2ZU6A 4HYYA 5KNBA 3TGPA 1OFHA 2IS1A 2RGBA 1CBUA 1R5NA 2D7DA 2JAQA 5DNYB 5AK0A 2PJRA 1NVVR 4PHFA 3VR6A 1R0WA 4KFTA 3SQXA 2YOHA 1OXUA 4OHXA 2RGXA 3B1XA 4PAQA 2R6DA 1E4VA 3NH6A 3GP8A 2FZLA 1XTRA 3FKSD 4D82A 1CR4A 5TXGA 5UKDA 3TSWA 2RH5A 1XTJA 3MCAA 4BLRA 3U61B 1XPRA 2QI9C 3UIEA 2OM2A 4PPQA 3BIFA 4NCNA 1OE0A 2ZRJA 1Z06A 4B75A 3V4FA 5AJXA 3PXGA 1G8FA 3ZIAD 4OK6A 4ZDIA 2HYIC 2O8CA 4LHWA 1KK0A 3EG5A 1FP6A 1G5TA 3WYAA 2CNWA 2GJ8A 4Q02A 4FI3C 1E0JA 3VAAA 4FXPA 2W83A 1UEJA 4QXAA 1E2NA 1NRJB 1C4OA 2G1KA 3FTQA 2EU8A 4KFSA 1GILA 4LV8B 3B6EA 4Q21A 4BFVA 3BB1A 3ND8A 1DG3A 1J8MF 1H8HD 2ZJ5A 5JMTA 2ZJYA 3B60A 1QF9A 3E70C 2RAPA 3ADCA 3CIOA 1SULA 2C9OA 2YWGA 4HUQB 2NG1A 3BFVA 3O8DA 4LPKA 2XB2A 2GHIA 2VHJA 3GLHB 3EZ9A 4JLMA 3NEJA 2HLDA 2GCPA 4ILEA 3T1OA 1VYUA 2X19A 1G41A 2HT1A 2JLWA 1EWRA 2ZR9A 2ANBA 2REOA 4L4UA 5KDOA 4MYHA 2CHVA 3GFTA 5EQTA 1G5PA 1KSGA 5DI3A 1KHTA 2ODNA 4PZYA 4UQOA 5HCIA 3W90A 1G20E 2MSCB 2UVQA 2WIAA 2CNWD 2ZRBA 3BBPA 1E2HA 4YMWA 3EXAA 2OEPA 1ZNYA 1KJYA 1SHKA 5HE8A 1G9XA 2GZAA 2V8OA 4YDHB 5KSZA 2ZR7A 2D06A 3L0PA 4TTPA 5KDDA 3I73A 2QMEA 4IFEA 3RC8A 4KYIB 2VTKA 3KQKA 2ZJBA 2OV2A 1DELA 1UBCA 4HB2A 4UNQA 1SXJC 3PCRB 2ZSDA 2I1QA 1QBKC 2JJ2A 2XTZA 3U3RA 4NL4H 4J0QA 1E4YA 4W5HA 1J70A 2VH5R 1EWQA 2FSGA 3KTAA 4Q4JB 3EW9A 3P1JA 4R7ZA 1D2EA 1PUIA 4LJ6A 2VBCA 2D74A 3PUYA 2FA9A 2H57A 2F3RA 1RW4A 1VCNA 4C0LA 2ZXUA 2JLZA 2W6ID 2IYYA 3FMOB 5GJBA 2ZI5A 3NEYA 4AK9A 1TU3A 2F1IA 3RS4A 2YYZA 1Z6TA 4Q18A 3WHLA 4Q47A 3PIRA 3PEYA 1W4AA 1U0HC 3QBTA 4NYIQ 3FDIA 4BFTA 4D0NA 2ASEA 2BCGY 1R7RA 1KK1A 2X77A 3I4LA 4Q9KA 4KSCA 3U60B 2D4HA 3L8ZA 4DLXA 1G3QA 3ZGXA 4UJ5A 4MGIR 3WNCA 1GL7A 1T5IA 1ZD9A 3B85A 3NC1C 4CEHA 1E1QA 2C77A 2GRJA 4RZ3A 3SOPA 4JLPA 4NHOA 3FFBA 2O8CB 3CRRA 4TN1A 3SNHA 4LJ7A 3EPHA 2JJ2D 1XJ0A 4BFXA 1Z07A 1Q1BA 2J0QA 3D7MA 2O0KA 2YNMA 3GJ5A 1I2MA 5LB2A 1FFHA 3RWOA 2HF8A 2GZDA 4KJZA 4URVR 4NYJQ 4D6PA 4KO8A 1BH2A 1FP7A 1CRPA 3QSYA 1WQ1R 2J9RA 1WP9A 2Q0HA 4XWOA 1CR1A 1S3SA 4HZUA 1NSFA 2Z5FA 2ZS8A 2CMKA 2N46A 3IEVA 5HCNA 2B8WA 4Z1MD 1T3SA 1X8LA 3IIKA 3K0SA 2NPFA 2NPIA 4L16A 1E2LA 2C78A 3KKPA 2Q3MA 2QE7A 4CRWB 1WMSA 4F4IA 4N3NA 4PO1A 1XCMA 4DDTA 5AR1A 1SKYB 2QP9X 2BMJA 3Q9LA 2FMXA 5JI3E 1E1QD 1ZM9A 5FFMA 3CLVA 4M1TA 5DI3B 5SZHB 2OZEA 4JYBA 4WVFA 1OFTA 1Q57A 4Q03A 5J4YA 4OKSA 1YKSA 4A0GA 1JAHA 1EESA 4KV9A 5H1YA 3M6AA 1XD8A 1CTQA 4TYWA 5E7JA 4HLCA 1F5NA 2REXB 1W4CA 5KUTA 1IBRA 2F9MA 2G3YA 4DVGA 3H4MA 4R2HA 1EG7A 4LJAA 4P0TA 4B48A 1KAGA 2D62A 4TLEA 4B73A 1JEEA 5IHPA 3U7GA 3Q8XB 4LZZA 4V0KA 1NSTA 2WV9A 3THYA 1P7CA 1U94A 1W48A 3BH7A 4JJZA 2GVZC 1E2EA 3CRQA 1IOZA 4MKHA 2FOLA 4CDGA 1M1YE 3AF3A 3GJ0A 2QE7D 4PXAA 1XBTA 2OBMA 5SZIA 5B58C 3W8NA 1G8YA 3GLHE 4TQAA 3BJIC 5TARA 2CL6X 3KTAB 5FR2A 1QHYA 3K0CA 3IGFA 1BYIA 2CK3A 5CDFA 4JLVA 5SZJA 1JXOA 2FN4A 2IYWA 2OLKA 3IKJA 1XJCA 3W6PA 4K8OA 5C1BA 5GVSA 3W3AA 2WBLC 4URUR 2WWYA 1VTKA 4IRUB 1E6CA 3IIMA 3KQUA 4BFWA 1EFRD 4M4SA 1HQYE 3IIJA 5A4JA 4LHVA 2PH1A 3U4QA 4KHZA 3C4JA 2XJ9A 1E9RA 2P3SA 1KI8A 1Q3TA 4GMXA 1G3RA 1ZM3A 2NQ2C 1WCV1 2WJGA 2WWIA 1GZSA 1ZU4A 4C0QC 5LD2B 2NO6A 5E95A 2JIZA 1JR3A 1XMVA 3T1TA 1ONBA 4CEHB 3RWMB 1FUUA 1TL7C 1N2CE 4JVLA 3A1VA 2H7VA 3K0AA 4LYFA 2ZU0C 1E9FA 4XVRA 4ZPXA 2XNDD 1W1WA 4XWAA 4NONA 4ABYA 1KO8A 3QG1A 4ZKDA 2XNSA 1P2VA 1Q22A 4Q7MB 3LBHA 4TTRA 4LBVA 1EK0A 3AVQA 4JLKA 1KMQA 3THWA 5FBRB 2X1VA 4Q4LA 3T1QA 1VG8A 4GRAA 4JT2A 3GEIA 3RC3A 2WOJA 1A5TA 2ZRDA 4HZUB 3TIFA 4EPYA 2VP6A 3K53A 1XCPA 3EPJA 3TQCA 3B1VA 4A0HA 3AVPA 5DISB 1A7JA 2IYXA 2AXNA 2UKDA 3A4LA 3K0FA 4ZKEA 4HB4A 5F9HA 1G8GA 3Q7QA 1DBSA 2TMKA 4Q7KA 2R62A 4URZR 2X2EA 5F9FA 2C9YA 4Y0VA 3OE7D 1XNJA 2FE4A 2JLYA 2WAYA 4Q4AA 1IAQA 3BB3A 1T4GA 1Z28A 1JR3D 2G83A 2VEDA 3OIVA 5AJWA 3WP1B 3OFND 4MKGA 4DWJA 4DCUA 3CF0A 3T06B 1XTKA 2G9NA 4YDSA 4EDHA 5FOSA 3RDPA 2QY9A 3AB3A 1XD2A 1BOFA 3CNOA 5P21A 3FMIA 2GWHA 2VO1A 3N5CA 2OLJA 2B7BA 2IC5A 3DM9B 3VKWA 4BFUA 1Q1ZA 4H1VA 1Z3IX 4ZDJA 1IN8A 2XXAA 2FDCA 1DTSA 4TYPA 4W5WA 3LFUA 4QRHA 3QUSA 4Q1FA 4RZUA 4B3FX 1TEVA 2ZSBA 4D25A 3HJNA 3THYB 4LYAA 3GLFE 5E4FA 2X8AA 2PCLA 4ITRC 1E2MA 5F98A 2ZJ8A 1XMSA 2I1VB 1R6BX 421PA 1V5WA 1LS1A 3TW8B 5FOTA 1QHXA 4QGHA 1TUEA 1FTSA 4Q00A 2O0HA 3MUFA 3CPJB 1YJ5A 1P73A 1R0ZA 2ONJA 1GDDA 2QGZA 3A4NA 4XIGS 3TE6A 2J0SA 4OK3A 5KTYA 4PHHA 4JMPA 1KSJA 1OIXA 3THXA 4E5UA 2IXGA 5AJVB 1KI1A 4ASUA 1E2KA 3U4QB 4TMZA 3BERA 1JI0A 4PPFA 3ND9A 1YU9A 2YZ2A 3QXHA 4MA4A 5KHOC 4U02A 3B78A 4I1VA 3A58B 2AK3A 3CW2A 2CDNA 4PHGA 4QL3A 4X8LA 3SDZA 3VX4A 4TZ0A 1P75A 1CJKC 1YVDA 4YLGA 2HF9A 4PC1A 5CM8B 3K0AB 2O8BA 2VPPA 2WIBA 4B71A 1Z0JA 4NDZA 1IN6A 1MO3A 4IDNA 2GJSA 2VP5A 4GOJA 4II7A 4M1OA 5BXQC 2Q21A 4FD2A 3AP2A 3IHLA 1UJ2A 2KWIA 4BECA 4TSFD 3SN6A 2FZ4A 2ZUDA 3O8CA 2ZPTX 3LDAA 4JIMA 1XTQA 3THWB 3NTUA 2NIPA 2BIFA 1XPOA 2MSEB 4Q4HA 2ZREA 5J4LA 1KZ7B 1C9KA 1EFHA 1G7SA 1MO5A 1NG1A 2GJAA 2WJIA 1AM4D 1OKKD 2WWXA 2BWJA 1DOAA 5JWRA 3QKSA 4Y0AA 1N6KA 4GSYA 3K0FB 1HH4A 4IVPA 4GL2A 1GG2A 1BIFA 1CU1A 5C2JB 2WZQA 5JLJA 2WKQA 3BAFA 4ASUD 5FR1A 4MGZR 3AKCA 1P60A 2BMDA 2MSDB 3F5FA 4LV6A 4KITB 1Q12A 4HAYA 4NYIR 3SR0A 3KFXA 4JVSB 2AHOA 1JECA 1FOEB 1W47A 4Q4AB 4GNKA 1N5IA 4LRWA 3VNUA 4C0BA 2FSFA 3C5HA 1GNRA 4JS0A 4GT1A 4M8NE 1U9IC 4LOAA 2FFBA 4V03A 3B8HA 4F38A 1CULC 4B74A 2ZI9A 1CRQA 2NO7A 2GCNA 4MDFA 5K8UA 2O5VA 4Q01A 4FCTA 1XMIA 2CL7X 1XD2B 2R6GA 4M1YA 1TTTA 2IXEA 4V02A 1MO4A 1W5TA 2BVNA 4LSGA 2IYLD 1I2DA 3TK1A 3L8YA 1W44A 4MKIA 4NYJR 1IXSB 1GFIA 3BK7A 1AGRA 4WOPA 3VTKA 2XXAB 1ZU5A 3M1IA 2RGNA 4Q1CA 721PA 2GAOA 4LHYA 1ZUHA 3VR2A 1JQJC 1RE0A 2W6JD 2OCAA 3QEOA 2ZITA 4RJLA 3TVDA 3X1DA 4BEJA 1J8YF 4ON9A 1XFAA 3R9WA 4LV5B 2J7PA 4A0FA 4LJ4A 4OQXA 2FGKA 4BEBA 3THOA 3EA0A 4PZZA 1ZUNB 4HI0E 3QY0A 5F2EA 1OYYA 1R0YA 5FUXA 1OV4A 1ZMXA 3UG6A 3AGPA 2IYVA 3CO5A 2RCNA 4N0DA 5BQ5A 1MOZA 2GILA 3KB2A 2AL7A 2AWNA 3QENA 1PLJA 3MJHA 4PPNA 1NN3A 4NCJA 4F93B 3THXB 4XD7A 2MMGA 3T5GA 2WPDD 1ZVQA 4RD1A 2VHUA 1GKYA 2C03A 2ZYUX 4EUNA 1N6RA 2JJ1A 3C14C 2ZS7A 1BMFA 2R6FA 3CRMA 4AWXA 5JEEA 3L0OA 3DOFA 1ZAKA 2GNOA 4PC6A 2CHGA 2IYQA 1YZUA 2CLDX 1B0UA 1DEKA 3NKVA 2C5LA 3RHFA 2P5SA 3GLIE 2O8BB 4C0SA 1HTWA 1Z29A 2XB4A 2Q9BA 2V7QD 4EFLA 1U90A 4Q48A 1G8PA 2J7PD 2OE2A 1XMJA 3F3YA 2IUUA 4HDOB 2RHMA 3HPRA 4I99A 2B6HA 2NO1A 1TF7A 1HT1E 2XTNA 4RZXA 1FW6A 2ZRGA 3T61A 4OQFA 1HE1C 3TW4A 2WM9B 4AD8A 3G0HA 3FVQA 5CM9C 4Q4HB 5G53C 2ZTSA 3GJ7A 2IBMA 4IXMA 1Z0FA 3QKSB 4AC9A 2BC9A 2FFHA 4QNRA 2IX3A 3KKNA 4KSBA 1XD9A 1SVMA 3K9GA 4CF7A 1F60A 2BOVA 2GF9A 1CLUA 3BH0A 3SHFA 3AV0B 3B7GA 4V0LA 4RD3A 3WHKA 1OH8A 2UZ3A 4HDQB 1GL6A 1W49A 2PBRA 5CITA 3HU2A 3LRPA 3NBYC 3FE2A 1LNZA 2FU5C 1BS1A 3FGNA 4OYHA 3X1ZA 4JSYA 3AVTA 3QXJA 2YOGA 2FFAA 3F8TA 3KXLA 3RSLA 3W34A 1E96A 2IWRA 1JR3E 1Z0AA 1G8HA 1GRNA 1LF5A 3E2IA 5IF9A 4TMTA 2HV8A 3EZ6A 3FKSA 2ZE5A 2GCOA 1E2PA 1KNQA 2EFGA 4BLSA 2PX0A 4M53A 1T9HA 3ZIAA 1WBDA 3ICQB 4QBFA 3CONA 3C7KA 4C2UA 3RLFA 1X8JA 1ZUIA 2I4IA 5GVRA 4Q1AA 2P5TB 2OBLA 4D81A 2ZVQX 4M0LA 2ZSEA 4EJSA 4LDJA 1S2MA 3V00A 4OQLA 3RRYA 2QMOA 5LD2C 3K9HA 3W9YA 5KSOA 3TSOA 5JJIA 5L3VA 3WNBA 4ZCIA 3LW7A 4QGGA 1CJVC 1H8HA 1OH7A 1PUJA 4QM6A 4G5QA 1HT2E 2IYTA 4UNSA 3DKVA 2Q3HA 3SBDA 3SYNA 1OXVA 3GD7A 4P4UA 4E22A 4URXR 3WRXC 2REBA 1VCIA 3B9PA 1X6VA 4D0GA 2QAGA 2BDTA 3L82B 2Q3FA 2EQBA 4PO8A 2FEMA 2G0NA 2F55A 5JI2E 4I1UA 1E69A 3HR7A 5C4GB 2LCFA 4OI1A 2QZ4A 2OG2A 3DL0A 1QHHA 4IVRA 1KAOA 4A92A 4KU4A 4POAA 5DHAA 4AY2A 5JS8A 1VECA 3U3OA 1IONA 2A5YB 5FPKA 1ZNWA 3SJAA 1CS4C 4LX0A 3G82C 2HCBA 2WJVA 2ZI7A 3A1SA 1RJ9A 1QVAA 4U00A 2FG5A 2J0UA 3FB4A 2KI5A 5FTNA 4O25A 4XWKA 3GLFA 3I5XA 1LVGA 4KFRA 1SGWA 4AYWA 5B57C 2RHDA 2FEOA 4TYQA 1ZJ6A 3FHCB 3KDSE 121PA 1Z63A 4DCVA 1CR2A 1A2BA 1OFUX 1PLKA 2W0MA 2QM8A 4C4PA 5SZKB 2BJWA 3CKLA 3Q5DA 3ETLA 4L8GA 3R8FA 3PJRA 4R71A 1WDTA 4W5JA 3ZS9A 2BBTA 2J45A 1OJLA 3UWKA 2F9LA 5DIFA 1PVOA 1NIPA 1G21E 1ZM7A 1KMHA 1VYTA 1RC8A 2Z83A 2H1LA 1GITA 2IT1A 2ZYWX 3LXXA 2W6IA 4JT4A 3K70D 4DLZA 2OAQ1 5EE3A 4HB0A 4DZZA 1LV7A 2HXSA 2WJJA 4H1UA 1UFQA 4G1UC 1VHLA 4PC7A 2C98A 4D4KA 3FPAA 1KI7A 4YXWD 3CWQA 3UK6A 3MFYA 3N70A 1YR9A 3K0CC 2XAUA 3ZQ6A 2GCOB 3IBYA 1W0KD 2GXSA 2AK2A 3ZJYA 3IQXA 4HEJA 1GM5A 2W00A 4B6EA 3AKYA 4NCKA 4Q9IA 3FMPB 3EZFA 3X1YA 4JBYA 2ZEJA 1VYVA 4JZKA 1DG1G 2E9SA 2EW1A 4A2PA 2AKYA 1Y63A 1T8TA 4WA7A 2C04A 3RS0A 4EJSB 1D9ZA 1WF3A 5FOVA 3GLGE 3DMNA 3T1VA 4DEYA 1QRAA 4QJ5A 1UKVY 2JDID 5EXTA 5EP4A 4OHYA 2ZAMA 2IF0A 4X8MA 5EZ5A 4TMKA 1ZYUA 1N3BA 2VRWA 4B76A 1GVNB 1S9HA 1L4UA 1NG9A 3REGA 1DARA 1Z5ZA 3AVWA 5TY0A 3AKDA 1AIPA 2IW3A 4XVUA 4L9SA 2ZJOA 4IDOA 1GUAA 1ANKA 3GFOA 5KSYA 2C99A 4Z1MA 2RB4A 3LBIA 5DE3A 3G5UA 2GESA 2VIIA 4F4JA 1CF4A 4Z8YA 4K81B 4WZ6A 4BZQA 4EFMA 4EIWA 4DIEA 3VKHA 2QAGB 2ORWA 3L2OB 3IO3A 4LBWA 3QIAA 3A8TA 3HDTA 3OF5A 4LY6A 3CR7A 4MGYR 3FHOA 2PZFA 5CLQA 2WWHA 1N6PA 1QHHB 5EUMA 2WMOB 3PQCA 3IEUA 3U7FB 2QEQA 4AKEA 3T15A 3CF6R 2J41A 2B92A 4FW9A 3K70B 3ZZTA 4JLNA 2NOAA 1HV8A 1MH1A 1ZD8A 2W58A 3QVVA 4PR0A 1HE8B 1JPNA 1P9RA 2IUSA 1WXQA 2W2VA 3RYTC 2G6BA 4AYTA 3ZVLA 4GOXA 1RJ9B 1H8EA 2J0UB 1X3SA 3GLFB 2V3CC 4Q9LA 3H0KA 4R9UC 2FH5B 4M1WA 4G5RA 3CX8A 4JL5A 1J90A 1D8TA 2CEAA 1SHZA 4HAVA 5FBWB 4MKFA 6Q21A 4MDEA 1XF9A 4IOMA 1S1MA 5JS7A 3U3KA 2A5DA 4PQYA 3MSXA 1FL9A 1LY1A 2AR7A 2GJKA 3I3SR 2A9KA 2C95A 2PL3A 4BLTA 2HJVA 3AM1A 5CJPA 4FIDA 1ZM2A 5FL3A 1YZTA 1KKMA 2BJVA 1AN0A 2QNRA 1KMHB 3ICEA 2XJ4A 1OFIA 2F6RA 2A5FA 4L5BA 1BKDR 3HYTA 1HQCA 4Q1BA 4QG7A 5FTMA 4DDVA 1IHUA 3C41J 4U7DA 4AKHA 4F92B 4WBSA 2GTPA 4C3ZA 4B2LA 1R0XA 2YWHA 1EFRA 2QAJA 2HUPA 5EP1A 3CM0A 4KODA 1H8ED 2RMKA 3GLIA 1KKLA 4MRVA 1DADA 3CNNA 3CF2A 4PAMA 4QBGB 3PUVA 5FBQB 3U6KA 3UG7A 5JJLA 2V6IA 1E9DA 2O8EA 4B47A 2A3RA 1W36D 3R9IA 3HYRA 2XTMA 4WIAA 4DIDA 1OSNA 4QJ3A 4RVCA 1A4RA 1QG4A 1XU4A 2XNDA 3HU1A 4LWZA 4PSVA 5EP2A 3VR1A 2Q9AA 1YZKA 4LC1A 5EE0A 4DCNA 5BN4A 5J47A 2HT6A 1XJQA 3AF0A 2C9CA 2ZETA 3BC1A 3UATA 1TADA 1UBEA 5B30A 5J4KA 1R10A 4X8HA 5AUQA 2ZE6A 1IXRC 3QF7A 4HLDA 4QHTA 3C15C 2Z6VA 2B21A 3FWYA 3H2YA 4TMVA 1YQTA 2IHYA 4UXIA 1II9A 2XX3A 5C18A 5CJ2A 1P9WA 3O8BA 5K8IA 5EXPA 3CH4B 3TUZC 2E1RA 3TNFA 1P2SA 4B43A 4B6FA 2BEJA 2XGJA 3BOSA 4DUGD 5HPYB 4GZMA 1E2DA 1LB1B 2LKDA 4B2PA
chains in the Genus database with same CATH superfamily
4H17A 2AKEA 4JB3A 3ZVRA 2BMWA 7ADHA 1TPYA 1XLTA 3PDJA 1QVZA 1FUIA 1NF9A 3OX1A 3R23A 4M22A 1TK3A 1VA4A 3ASYA 3F6SA 4MQFB 4WOCA 2ADMA 3VPXA 4BUCA 5JRDS 4IFTA 2W6PA 4QKQA 2DETA 3VU0A 3OFNA 3WJAA 4Q7QA 2WU4A 1NVBA 4JBXA 5D87A 3EIEA 3LQFA 2RBGA 4FD3A 2R8XA 3S29A 3UMFA 3X2FA 5CAEA 3QF7A 2H8KA 4O33A 1U81A 2WAMA 3M4XA 3HA5A 1HY3A 3HGTA 4FKZA 3VDQA 1OYWA 4A15A 2OFXA 2WT4A 4J91A 4MR7A 1ONSA 3R8XA 1KDRA 3SD7A 3GLUA 5KX5A 3ZU2A 1T6BY 4YT8A 1WUTA 1P6QA 1EFCA 2VYVA 3RS5A 5BMVF 5F7JA 4E4YA 4F1KA 1CIPA 3O38A 4B3CA 3PJGA 3KBBA 4PYIA 4U2DA 4PXYA 5KYUB 2QVBA 1P1RA 4UASA 3VPSA 2VUUA 4BGEA 3H9CA 5E6SB 5JZVA 2WD8A 2Q45A 3ERCA 1F8FA 3N8KA 1R5JA 2QUHA 3PDIB 4GPTA 5FOXA 2GVDC 2WICA 4G23A 4MUJA 5B37A 2H54A 2JRLA 2BW0A 3EC2A 2DFPA 3WBJA 3DQPA 3NBKA 4H7KA 3A6FA 1NMXA 2OV8A 4XYGA 2OD2A 3KFVA 3IBTA 1JMYA 4MA0A 1Y3BE 2ZI3A 1N7HA 1H3FA 2YZGA 1WLSA 2Q2WA 3PZBA 2ACKA 2IYZA 4GPIB 2IY9A 4TRRA 5ERGB 4KOEC 4AY3A 5A3JA 2QRKA 1KBOA 1YB1A 1C0PA 5TQJA 2VSFA 5J2UA 4O4LA 4CEIA 4DHEA 2G77B 3CRVA 1MJ5A 5IK2D 3EGOA 3JVDA 3T3IA 1Q7RA 3AB8A 2XUGA 1O97D 1SQ5A 5HKOA 1PQYA 1K8QA 1NUUA 1OGYA 1WA5A 3LOQA 5CTAA 5HG0A 3VO1A 1QS0B 1UK6A 5DCLA 1W0JD 1NLYA 4IICA 2R9VA 3F8WA 2ZRMA 1GAJA 1FJ2A 3DNFA 3G5MA 2BFCA 3H6HA 4RABA 5EHZA 2VYVD 4UXHA 1L4HA 5LIRA 4P32A 4QUEA 1ZWLA 4DJTA 2ZANA 2BUAA 4JVNA 4AKIA 4D9FA 5EKSA 3DMRA 3VYRB 2JRCA 2IZZA 4JLWA 4C6TA 1Q21A 3D7LA 1XXLA 2BLNA 3LW8A 4JKIA 3GMTA 1BEEA 1JPJA 1H0SA 3IMGA 4N6GA 2R47A 1DXOA 3OZFA 1LEHA 2IEZA 2JGNA 4JP3A 3VJRA 3HJUA 5KIAA 3AO0B 4C7JA 2N1BA 5JFGA 1I2BA 1GDTA 2HSWA 2NZJA 1M6WA 2VAPA 4D9EA 4IV8A 1PGJA 2DBYA 4I9GA 3PSHA 2HHJA 5FF9A 4AS1A 5K3SA 2ZULA 3N07A 3RVLA 4BIMA 1H1DA 2ZAYA 1EX1A 3RSGA 3LC1O 1E7WA 1SZPA 4OVKA 3T3MB 3RFVA 4DCMA 1MAWA 4EECA 3IDOA 2JA1A 1LZKA 5DBGA 1XK6A 4EKDA 3OQIB 1YZ3A 3UHFA 2IPAB 1CZUA 4GR5A 1WE2A 3UK7A 1A2OA 3SS8A 4AJIA 2H2GA 3A4MA 3L05A 2ATXA 2Y71A 1QP7A 4H15A 1VQ1A 5C46F 1BVUA 3KAPA 3BSWA 1NRWA 1I51A 4ENPA 1G21A 1VHDA 1Y8AA 2MMCA 3V1LA 4Y1FA 1JH8A 4G4SO 2QPTA 4BNDB 4MCIA 2NUAB 3ETGA 5AI9A 1V96A 1W5EA 1A9XA 4LTMA 1L7QA 5CH5A 2R0QC 3EW7A 1A1VA 2XSZD 4O2BF 3WA6A 3RUDA 3CZ4A 1CQIB 1A0OA 3OICA 1WZNA 3PVSA 4LJLA 1O87A 2GCEA 2J3MA 3GJYA 3LX8A 4LK2A 3K0EA 2OXRA 4AJJA 2P3OA 4KVGA 1GGMA 1A2KC 1KVRA 4PZLA 4UC0A 2FR1A 3SEAA 3ZVKA 2GXQA 4EKNB 2QPAA 3ZHCA 5HR5A 3Q6IA 1Z6AA 2BV3A 2WNIA 3C85A 2HA3A 4HZIA 4EHIA 1UKEA 3NUGA 4RZQA 2EFEB 2LCIA 3P71T 3DEIA 4FGLA 4LMRA 1VJ5A 3UQYS 3VPHA 4EZBA 5KTNA 5CIWA 1E3MA 1MFPA 3URKA 2V03A 3P9RA 3Q15C 3NXSA 2RGGA 3DNPA 4N0PA 1M6EX 4B87A 4EF4A 3BVPA 2AOUB 4EHBA 3NIDB 4Z7JA 5FTLA 1QKIA 2ZRIA 1ITZA 4QA9A 2L42A 2VHCA 2OCGA 4F3KA 2PM8A 4R1LA 4OHUA 2I4OA 221PA 4FWTA 4F91B 4LZWA 3SX4A 4MRRA 3EVAA 3EZLA 2QTVA 4N1AA 2VSYA 3C3MA 4GXQA 4YJ2B 5C3UA 1M2KA 4AIIA 4K6CA 2DTXA 2O2HA 4U7GA 4PO3X 4WI1A 1GG5A 3WIDA 2V1XA 4KAXA 3VU1A 1NW4A 3ZDZB 3RUPA 4YRJA 5BSEA 3DE4X 2R44A 3GFBA 2GZSA 4WNAB 4L76A 4PBTA 4CIWA 1A71A 5H8WA 4KG7A 3TH5A 3IHWA 4P3PA 3KZNA 2ZZNA 4FWBA 3BJZA 4W8OA 1U63A 4XM1A 3FF1A 1O5TA 4ZYWA 2GN9A 3MCVA 3WRWA 4L8VA 5LN1A 1FMLA 1FW8A 5C37A 2V0CA 1U4SA 4RH1A 1GZ6A 1K66A 1IQPA 3FA2A 4MB0A 4UUOA 5AM3A 3W4JA 3ZH2A 2OO7A 4P92A 4QVIA 3UGKA 1OJ7A 3F46A 4EVQA 2O8VA 3A7DA 4UMVA 5JASA 5F52A 4JP8A 5K8VA 1VP9A 2GF2A 2W6CX 5TDHA 2VJMA 3QFHA 2MSNA 3PC4A 3UMSA 4B7CA 2VP3A 4HFNA 5H70A 1RWPA 2O4UX 1C3LA 5BWMA 1GG9A 3KD3A 5KNLA 3T99A 3KLPX 4EUSA 2ATIA 3CLTC 1W75A 1PJ2A 1WVMA 3OESA 4E08A 3WGGA 4C2AA 3I5UA 1BDHA 3EXG1 3AERA 3ZEAA 3HLYA 2FX3A 4GI2A 1FQJA 1FUYB 1KY2A 2D59A 2VJOA 2V7QA 1YIDA 3PENA 4MW1A 5G0SA 1S2NA 2FPKA 1QZTA 4IOLA 4AJOA 4BASA 4F12A 1RAGA 4N3GA 4OHOA 4OFXA 2QAGC 2V7XA 4RL4A 2WF8A 2NTYC 4XR9A 4RQUA 5TV2A 3Q6NA 4LVNA 4YMSA 5C4MA 1UAAA 2QQ0A 3CH6A 4Y6SA 2JIOA 4YUZA 4O2AA 1M7GA 5JARA 5D00A 4MITA 5LA6B 4M38A 5AWFC 2EG5A 1TVCA 1Z08A 2YJZA 4NHEA 1MG5A 3ORYA 4PAOA 5A1TA 2CHEA 1VL8A 1IY0A 1T5TA 2HRRA 2WOOA 2GH1A 3B12A 2PSEA 2CLCX 1AY0A 1Q5PA 2Q1YA 3D6TB 3ES9A 3KIPA 3MMPA 3R0VA 5GMOA 5T64A 4CMIA 4P5DA 4Z49A 1PJZA 1DE0A 4YP0A 5G41A 4K0KB 4R84A 2BUBA 5DNUA 2R68A 4TTJA 1T3LA 3CH5A 3ONNA 3QWHA 5T6BA 3JQGA 4ED9A 1PS0A 3AW8A 4ML3A 5F9MA 5JD3A 4NQRA 1YBHA 3C6ZA 4FN5A 2J9ZB 3DFUA 1YVRA 1SVLA 3QKWA 4Q4DA 2O5CA 1A8PA 2PJZA 3M5WA 2PQMA 3R24A 4W1QA 4ZT3A 5FA6A 4FB5A 4NCBA 2BEWB 1T3TA 1JALA 1QHSA 5ESRA 1WP4A 4G0QA 2V96A 5A0FA 2VHWA 1QQAA 2FZVA 4KWTA 3UAOA 4MW9A 1XPUA 4GI1A 4KO3S 1DC4A 2VBGA 4DDHA 1EXNA 1L4FA 4GL4A 3AVXA 1TLTA 1K27A 3QVWA 5TPWA 2BM0A 1JNYA 4RD0A 3M4NA 3I34X 4DXAA 1WULS 4Q05A 3GVPA 3OIWA 2ZWOA 3MZ0A 3VR5H 1WBBA 4ND8A 4BJHB 1RWBA 2A0YA 4NJMA 4DMKA 1RVDA 3O9MA 1I3NA 1V47A 2OCIA 1OB2A 3HKCB 3PR1A 3ZV3A 4LJYA 3OCXA 2IF2A 4JLSA 1I1HA 1ZLXA 3L9WA 3C16C 1JXQA 4L95C 2AQ8A 1JDBB 4E2ZA 3RVMA 4KRGA 1C4WA 2PZMA 4QU8A 3VV2A 3A1CA 1GKUB 4TRNA 4L6IA 4N6OA 4V38A 2AJDA 2ZBFA 4ZAVA 2NN3C 5K03A 2OOKA 2QT0A 4MPDA 3L7MA 1AXRA 1RAAA 4WXPA 3AH8A 1CQZA 3HCOA 3HR4A 1T9AA 3DL7A 1CUDA 4IRXA 2C2XA 2VL7A 5AUNB 3WJ2A 1RR6A 4CEJB 1II0A 2YXBA 5K3CA 5BWNA 5JDIA 5U4XA 4WN9A 3G2PA 4CNBA 4QICA 4HWPA 1V3UA 3C3BA 3HBAA 1KJIA 5LOVF 2PBLA 5LQJA 2O48X 1NW3A 4YRPA 4H08A 1ZONA 1PW7A 2GYWA 3C3KA 4UZFA 3ZZ0A 4O5OA 4Y2GA 5JAPA 5KNCA 3KOUA 3TCXB 2BBSA 1RJFA 2VTBA 1U8UA 5AXBA 3N2EA 4JXKA 5FBHA 4F2GA 1UBFA 5KAMA 4LGVA 2ZJ2A 4I6EA 1QU2A 4OI0A 3DVLA 1Z6XA 2QTBA 3KWLA 4U8HA 4WGGA 5JQGA 1UPFA 4P8RA 1KYIA 4Y9RA 1GPAA 3NHAA 1V7CA 4CFYA 1MP0A 1T9BA 2CF6A 2B25A 2F59A 1XV5A 4G5GA 4M0EA 4YRCA 4A2WA 2DT5A 1Z88A 4FMCF 4JU8A 3L1UA 3RJ5A 3IPRA 3WBFA 4IKEA 3BGOS 2Z08A 1D07A 3VGJA 2K7FA 4LDAA 5E6RA 2EHJA 1UC5B 2ERYA 2Y0EA 4MICA 5K1ZA 2INGX 2P11A 5CK4A 5A5DA 1MORA 2ZVDA 2YIDA 3NO4A 2O2ZA 1XXHE 2XYQA 1VLLA 3PVZA 4DSUA 1AMNA 4ZJYA 4GKVA 4QUDA 1ADJA 1RKVA 1TQHA 2W93A 4KIJA 2OO3A 2CJWB 4S12A 1PWEA 2IIBA 1QH1B 5FJIA 1NJ2A 2Q1SA 4BZZA 1VLZA 2GPSA 3KOZA 4ZCPA 4DGSA 3U5ZB 5LBIA 3BMNB 3QVKA 2YYAA 4KTVE 1RMQA 2GJ9A 1AGYA 4E7PA 4RX1A 1K6MA 3ADKA 3H2KA 4ZQIA 5KNCD 3MT9A 3ZWOA 2VHTA 3PK0A 1MXFA 1MXHA 1VSTA 1XA4A 5K6AA 3GQBB 3DVRX 2WWRA 4OKIA 1A7AA 5J9FA 4O59O 3CKYA 1HE5A 5DW3A 2BD0A 1JHPA 4EWLA 1P39A 5BN5B 2HJSA 5IBPA 4AZTA 1XZIA 3LC2O 3O4GA 3PEVA 1UPTA 2CYCA 4J1QA 3MAAC 3O8QB 4RW0A 3WGHA 3LWNA 1S4MA 2DFKB 4CLRA 1EUQA 3QYAA 5IU6A 2V55B 1KEUA 2FN8A 4FDAA 3R7FA 2CW5A 3HDVA 3CZ5A 4YX9A 3GUVA 4C4AA 1JDJA 1O2DA 1WPGA 3AHCA 1FLAA 1OCEA 5G3ZA 4YV7A 1JHZA 4HB3A 4MRSA 2GI4A 3A27A 3AR4A 1OTYA 2R7MA 1KTVA 4HV4A 5FOQA 5LA6F 1B3BA 3F74A 1W0KA 4EX7A 1G1MA 5ILQA 5DBHX 3MWEA 3GC6A 5JDCA 4RMNA 1OT3A 3QKIA 3LWBA 4WFIA 3S8EA 4TWIA 5C1DA 1FJHA 1E99A 5CUQA 3ZX4A 1T3HA 4IMRA 3QE3A 3GFVA 3TSCA 2EW2A 4X00A 2P2CA 3IKTA 4DLVA 3OQ1A 1KO7A 3U7EB 4RPHA 5HZHA 2GEFA 3RU7A 1N2BA 2RSLA 4RTPA 1NWCA 1P8AA 2FF7A 1C1XB 1F12A 1HOTA 3FCAA 2HMVA 4K5QA 1U3WA 1EFUA 1N57A 2CMFA 3FMFA 2D1RA 3VU8A 3WLTA 2DKOA 5KZMB 5TEWA 1VG0B 3VZCA 3PTZA 4GM4A 4IKOA 4MP8A 5EIXA 3V2IA 2PRSA 1JT2A 3FVVA 4QGFA 3BGSA 1FZTA 3A14A 3GUCA 2YTZA 5DYTA 4D02A 4CUKA 1E66A 1T8WA 3G2OA 1ZXXA 3AK4A 4EG0A 1ZEMA 3VC7A 1G7CA 2AEJA 2W6QA 4JYCA 4YJHA 4AP6A 4RV9A 3N8DA 5FO1A 4Q12A 1QQTA 1ENPA 2LIVA 4UHJA 4YMIA 5F78A 5HSGA 4RMIA 1OXBB 1O9BA 3ZWCA 3QFCA 1FFEA 3PYXA 3LYUA 4HS4A 3SQWA 1CETA 3TQFA 2I2BA 4R41A 4S1VA 3B3QA 4ARBA 4EJ6A 5F2OA 3GUUA 1JHYA 3ESDA 2EGUA 4AJ2A 3DW3X 1XLUA 1U0NA 3QF4B 1IM5A 1S1CA 2PJDA 5E6UB 2Q3LA 4EG4A 1G5IA 5J4VA 4EYEA 2XB9A 4RCZA 2DQSA 2YWXA 1KK2A 3O4RA 4BO0A 2DWOA 5EHNA 3L3BA 2O8FA 3TLJA 1QONA 1QKJA 1GGHA 2FPXA 2OQRA 3PNVA 3EG9A 3KLBA 4JEMA 2AT1A 1ZD1A 2Z09A 4LXGA 2R84A 1K3TA 4TYMA 1J9ZA 1IH8A 2ZIUB 3OOEA 2MR5A 5CXXA 5DW0A 3FUTA 1JJIA 4LCBA 2IZ0A 1ZOOA 5EYPA 3VO8A 1L7RA 3DF7A 3OPVA 4CQMB 4EYOA 5CXSA 1OLOA 2B9VA 2YHBA 1Z73A 4L0QA 1UM9A 3H11B 3W9UA 4K9DA 3HCBA 2F43A 3QNUA 5JYCA 3GD5A 1YAHA 4PIMA 4PZPA 1OR8A 2Y05A 3A3PA 3W7BA 1FNCA 1VJGA 7YASA 5FV4A 4LAFA 3TVTA 4YMTA 1VE1A 3LCJA 1DL5A 3R5FA 4OHWA 3ITKA 2FPRA 3L1IA 4YHBA 3UV6A 1LS6A 3A06A 5DNEA 3Q7PA 3G0IA 3C8HA 3OPXA 1PDWA 1G8JA 3C7CB 3P2EA 4LI0A 3R2JA 3N0WA 1A4IA 3SJCA 5REQA 1JEYB 1XKXA 2WFLA 2MIIA 4K6MA 2J5XA 3L0BA 1UWLA 2OO5A 1GYRA 1GSIA 2HSDA 3IAEA 3GO4A 1E77A 1WXFA 4O2LA 1TZMA 4OMUA 4Y6OA 4MUAA 3BMQB 4XVQA 3SLKA 2ID8A 4CM4A 5CB0A 1I4TD 2X9GA 3RT1A 3KXIA 5JPIA 1SVKA 1KGSA 3S8YA 2VRBA 1KWKA 2QTWB 1EGMB 1XMPA 3MLAA 1T8PA 3CCCA 3ZKAA 1DEHA 4CM8B 4P4GA 2JCSA 1J2TA 5FYQA 1XAJA 4OP1A 1K1EA 1RLIA 1ODCA 3OSUA 4J0DA 2PMDA 2ZYHA 3B70A 2R6JA 3UCEA 3H13A 1MJNA 2IOFA 4I55A 2CL0X 1ILEA 2GK4A 3L40A 4RK0A 4RKWA 5EE5B 4BDTA 4C88A 5KAPA 3GOQA 1RZUA 2PVPA 3W2GA 4GM1A 3D3QA 1DWQA 4OFWA 3VNSA 1ODLA 5HTOA 2VYFA 3R5HA 3B1ZA 3VA7A 3G5AA 4NDAA 4BO8A 2VNHA 5CA0F 1MABB 4HAZA 4BX2A 1IAVA 5BNIA 1TKCA 4L22A 4TMXA 3QI2A 4LBYA 4QPPA 4KBFA 4WBNA 1MTZA 5K4GA 3ROQA 4H4CA 4XTCS 5DM1A 2PU7A 5LIPA 5DXFA 5MN6A 2EVWX 3KT8A 4JLAA 3UWOA 5JD5A 4H18A 4JOBA 4FDTA 2CXXA 2J0VA 2EKBA 2VNIA 4BQPA 5F76A 4MQ4A 1QGUA 2BTOA 3CUUA 3TUIC 3WP0A 4V1CB 5FORA 4Y2VA 3QVSA 3UMBA 3TPCA 2H59A 2PG3A 1R27A 4QUJA 1PCXA 3ZXIA 2HMSA 3E7DA 3WYFA 5I7WA 5IJ9A 1JR6A 3TPZA 2ZBPA 1G3MA 2HCJB 3CUYA 4QPCA 1ONNA 4UU7A 3EDMA 2QMYA 5ALTA 4Z9YA 1U0LA 1YJQA 3RFXA 5IXJA 3O7MA 4UDNA 2BCJQ 1V7ZA 2ECOA 2MJLA 3OC6A 2R66A 4PY2A 5KPJA 1B1AA 1YV9A 2ZSAA 3Q12A 1I01A 1H94A 3CBGA 1VJCA 2BKEA 5GZ6A 4WKGA 4X44A 3UAXA 1PVDA 1XQXA 4X5OA 3TZHA 4I1RA 1CJTC 3D1JA 4RSMA 2X2FA 3L6EA 1TF2A 1VHJA 3RTBA 4NH4A 4D8TA 3G7SA 3HXOA 5IWCA 2PGAA 5B12A 2V6MA 2QL6A 3HCWA 4MGKR 3H9BA 1KY3A 1JDUA 5DLPA 1PBTA 1Q0LA 1QAOA 1SVOA 1ZZGA 3I05A 4EF6A 1PJLA 3F3MA 4Y2RA 3IILA 3NIBA 1C0EA 4B40A 4C0KA 1J5EB 2WM3A 4WCFA 2DXIA 1J5PA 3QRWA 3HB5X 4Q34A 4JUFA 2JKZA 1XDUA 3IP9A 3FCYA 1TMGE 1JL3A 3JVEA 1GTG1 4CKBA 2CFRA 3VV3A 4QDXA 4C0AC 3QKTA 4ETNA 3Q0IA 4DLPA 2XZPA 3UHPA 2IIQA 4HVAA 2PR2A 3AY6A 2BKXA 4M2LA 1ZRHA 1D5WA 4PQRA 5I7SA 1H4QA 1WZIA 2YHSA 3I30X 3QEKA 2ZFUA 3R77A 3A1FA 1LLFA 3ZGYA 3WA7A 4GI7A 1Z2EA 3DE5X 1L7EA 1TDJA 3VR4A 1QCZA 3V8MA 2JLBA 4JVMA 4AP5A 2QP3A 2VYCA 1WDLA 3IE0A 4V39A 4DMCA 5K8JB 1YJAA 1NBHA 2V6JA 5FV7A 1NX6A 3GZTB 3I04M 3RHTA 1SN7A 2YR0A 5DOVA 2F62A 2CVFA 3A31A 3D8SA 4CFZA 2LTAA 3K9FC 3EX7C 2H08A 4Z0HO 3RE1A 1QC5B 3VZSA 2RK3A 3R41A 3RTEA 4B7ZA 2P7IA 1E3IA 4ZTUB 2YMMA 3PUWA 2BH9A 3EFBA 4GBED 5E8RA 1GXSB 2IV3A 3PD7A 3TMKA 1OIWA 5F3DA 2KSQA 3JY6A 1ZW6A 2HGSA 4QNNA 3EDRA 5JSQA 2YUTA 1ZCZA 1JDBC 3V1TC 2B8TA 2AJ8A 3KUDA 4KR6A 1CF9A 1AQYA 1R3UA 1SXJA 4XSVA 4YPFA 2D1YA 1A7UA 1YNSA 1KPIA 3MUOA 3JALA 2XZTA 3Q40A 1LZLA 1K7YA 1MAAA 1E1YA 4MJ3A 5IYZB 1MPTA 1R88A 3ROEA 4CT5A 2HK6A 1KSFX 5IJXA 4QDZA 4QFMA 1VIAA 1G2QA 3ZQJA 3BILA 5LYYA 2Y1XA 3KKEA 3AHFA 4CDMA 1NDUA 4YPVA 3GJ8A 1YVPA 1T5SA 4FQ5A 1MLDA 4HT3B 3HZHA 4CM3A 2DUNA 3FNGA 2DCMA 1L1FA 4G5OA 1IRXA 2PZJA 4DCGA 2PTGA 4B3GA 4UU0A 5F77A 4AZ0A 3GPLA 1QR6A 1SVIA 1RHJA 3LHDA 1E7YA 3EGDA 2Q1WA 3A3YA 4ESEA 3EVCA 2IS4A 3SQOA 1P1FA 2VPZA 2VDWB 2ZAGA 1E32A 1SCJA 2F1RA 3GCWA 1NJ1A 4FYYA 4NU0A 2IL1A 3G9TA 3EVFA 4JZYA 4S1WA 1Z0KA 3GZJA 5KYKA 4LF5B 1HI9A 4R81A 4D5GA 1M7HA 4G86A 4BFCA 2QU8A 3F1LA 4KLZA 1FSZA 1S7CA 4XGQA 2F90A 4DM7A 1YGYA 2YBEA 4ADSG 4QTUB 1GU0A 1ZRMA 3NGXA 5K05A 1U3CA 3MJRA 3U3XA 1KIMA 4E2WA 1C7JA 1HA3A 3NUQA 1DINA 1CXZA 1CUYA 1UJCA 1KYTA 2QZZA 1NVWQ 2R7LA 3D9QX 4O6VA 3A37A 1IDOA 1YZFA 2NT4A 2ZIXB 1COZA 3QFFA 2P6NA 1V1MA 3EVDA 4BNVA 3MVEA 2XDWA 4WW0A 3TPFA 1A82A 4KQ2A 3B13B 3W5BA 2AD5A 1L8QA 3NHBA 2Z1DA 4Y1RA 2X40A 1DLJA 2CE7A 2QN8A 4FYVA 4HLQB 2CYAA 1DAMA 2OUIA 2X9VA 3I2KA 2ZUTA 4W7HA 2VQEB 1JZSA 1J1IA 2RE8A 4YAJA 1YR7A 1YMQA 1NVVQ 2HIGA 3NETA 2W2TA 5BORA 4OI2A 4MS4B 2BFEB 4N7JA 1H0RA 3WWPA 3IEKA 1MCZA 3CQ9A 3ICWA 3C0KA 3ZI4A 3L8GA 4KXXA 1U7HA 2QM7A 2H7XA 3UUFA 4BBZA 4JJIA 1B6SA 3DEFA 2YW9A 3NAMA 3O84A 3WTBA 5CDUA 2CV2A 1SOMA 2Z9CA 4B4UA 1ZIOA 1U7OA 3DLIA 5JCXA 3HQ4O 4UEJA 1UC9A 4OAOA 2XCRB 1ODFA 2Y1EA 4FSXA 4W9MC 1M6VB 4JHLA 3PP8A 4AY4A 2ANCA 1BMDA 1OGJA 1T5HX 4BGDA 1L4NA 2YXDA 3NTRA 4AS2A 1BHJA 1QSGA 3JZMA 2E7ZA 4M55A 5BOSB 1G9TA 3R7BA 5AM1A 2P40A 3ZH9B 3KS9A 3O9VA 5E7IA 1PGPA 2XF8A 3JYOA 4UOEA 4HZGA 3H8VA 4RIFA 4OUDB 4MVXA 4AW9A 3L7NA 3WSWA 2JGLA 5FJJA 1OHHA 2J0EA 3SVTA 3CMCO 1ETHA 2DYKA 3HXTA 5F1PA 3K09C 4X84A 1J8FA 4PQFA 4QSHA 5ALYA 4ZFNA 4XGIA 5LQNA 2C8KA 1TO2E 4TYNA 2BSXA 2BP7A 3BORA 5LDGA 3OM0A 4YPOA 3OWHA 1KQOA 1AUXA 1Q84A 4XSGA 4DR2B 3BD9A 4PLZA 4W1SA 1RPZA 1KR5A 1SUFA 3GGOA 5KWEA 4N48A 2OESA 1ZN2A 4M0CA 2Q5IA 4JLUA 2D0OB 4J4BA 5D3QA 5L3RA 1M8JA 3UAVA 2FLWA 1T13A 4KW7A 4QM7A 1OF1A 5TQ0B 4MV3A 4H60A 2Z3VA 4MS1B 3HUDA 3K9LA 2H2HA 3VNAA 4BFYA 2O8DA 3D6MA 1FDVA 2AW5A 4BJ3A 4K6FA 4A2CA 1Z9BA 2UZ1A 2A4MA 3F7OA 1BJRE 1BHSA 5BUCA 1LSOA 4CLEA 2P6PA 2WVGA 2G4CA 4TT3A 2QWXA 3HJAA 1JG7A 2PUHA 5DP2A 3JQ8B 2VDMB 4MARA 3TR0A 4A1FA 3NH9A 2G1PA 5GOZA 4C0XA 1W4RA 2PMKA 4TXHA 1QRSA 4AMVA 1R6AA 1EINA 1WF6A 2HOQA 3ISTA 4RXMA 3W6OA 4EPTA 3P2YA 1UT6A 1FPMA 4UXJA 2D2VA 3NHFA 4XWYA 3CXRA 5C5EA 5CJJA 1S5PA 2Q8NA 1ZOLA 3P9PA 1UMBB 2QXUA 1ZN7A 4MMZB 4V0MA 2CBZA 4EA7A 3JASA 1UR5A 1GYQA 3SDBA 1Z0DA 3ZDFA 5JHHB 2DQKA 5KVSA 1IHDA 4DLWA 3OY2A 3K8YA 4LOJA 4H3KB 2C59A 2JIRA 2JFXA 3LL7A 3V8RA 3SU8A 1EJ2A 2B2CA 3CZ9A 1CP2A 4Z3OA 1TEXA 2PXHA 1K7FB 2L82A 1CX9B 1ES9A 4X62B 1LF0A 1QTIA 3OIYA 1J00A 2P6MA 3FNIA 3M6WA 1VGVA 3ZU5A 1Y3CE 1EJ0A 3EZ7A 4D42A 4DCJA 5JTTA 1ZGZA 5I7HA 4DSTA 4URFA 1BKYA 1N9GB 2XNJA 4LRSB 4RMJA 1P0PA 1R8SA 3ZCVA 1H85A 1WDMA 4KR7A 4GBGA 3SM3A 3IL2A 1P17A 2X6RA 4PC2A 3TQSA 2I91A 5E2AA 3IQFA 1Y3AA 1E79A 3ZD7A 1SU6A 3Q1KA 3RRBA 1BFKA 2YHIB 2CZCA 2WIFA 3W6NA 3FRJA 4AYXA 4F1JA 1JQ5A 1JJVA 4NE2A 5JZMA 3GA7A 2H1IA 4PC3A 2VWGA 5ALDA 4UNNA 4NK4A 3SVZA 5FUYA 3BTUA 1MENA 1FVHA 4MVJA 5E1MA 1T0JB 1Z6YA 4LA4A 2XHEA 3W8DA 2ORED 2QQFA 4H0CA 4MTLA 1MW8X 2AFIE 1QMPA 1E9EA 1I14A 2XQFA 1NXQA 1T2FA 1HORA 3E1GA 1TM2A 3PR2B 2E6KA 4XYBA 5ALVA 1JH9A 4RH3A 3K2EA 5LSAA 3OQJA 1B0PA 1GZ4A 3OKPA 4YJ3A 4Z8XA 1E1MA 3UPTA 1ESMA 1SRQA 1VE5A 2Y93A 3M6XA 3OEEA 4DJFC 1TA9A 4EM6A 1TX4B 3N0TA 3USCS 3ZU6A 1E2IA 3TLEA 5EGSA 4EEZA 4BLWA 3FG9A 4B35A 2YC4C 2GUWA 3FYDA 2R4UA 3HBNA 3WGOA 2JD0A 4MRMB 5ED0A 3F9IA 4FR2A 1FX0B 2QBYA 4NCIA 2IK8A 1XDSA 4ACAA 4B4DA 4YASA 2YIMA 4M21A 4X1OA 3DHYA 6AT1A 4G0YA 3UK1A 4MUYA 3UTCA 4CR8A 1CUBA 3QUBA 1JFTA 2E4VA 3NV9A 1LPMA 1EUCB 3IUBA 4Y2QA 2ODEA 3JZAA 4EKIA 2FKAA 3N39C 3SZGA 5I7AA 4JASB 4C76A 1H3NA 3OCJA 3R7LA 3RR2A 1XCOA 1QGAA 1POWA 2PEZA 3IAUA 4QYIB 1NBOA 2VDNB 3WLMA 1YJBA 1IJFA 2HEGA 2VNJA 4GSLA 1M34E 3PGJA 1UANA 4RY9A 1NQUA 1QAMA 2VAMA 2WVAA 3HRHA 4B3TB 1VSQA 2QOEA 4XLLA 2E1PA 1PJAA 3B89A 3MBOA 4ZVMA 3UHAA 2VXCA 5JCPA 1KZHA 1H23A 3W5AA 3IA7A 1H65A 4JV5B 1O9HA 1UBLS 3EXEA 3MHPA 3OEED 4YONB 2Q46A 3AM5A 4HAOA 1CV2A 3V5NA 4C6RA 1T1SA 3NTVA 3F5SA 3JZFA 1ADFA 2JGKA 4QULA 2OTCA 5B4VA 2WSBA 3OIDA 4WZBB 5KJCA 5D1HA 3LIPA 5A9TA 2FN9A 2FUG1 4V24A 3MQFA 4NCHA 1ESCA 4QYXA 4EPXA 2FQWA 1U02A 1T26A 2P3LA 1G66A 3EODA 4YP5A 4ZV9A 5CTJA 1C80A 4MAMA 4IEIA 4DR6B 4EBBA 5KS2A 2NU8A 5TGZA 2H1OA 2WU0A 4HXYA 5AVJA 5ICGA 3GP5A 3NHUA 1RYYA 3MXOA 5B53A 4BQEA 5AVYA 1DVRA 2GLXA 3L49A 3BH6A 3K30A 1N4DA 2NSDA 3BREA 2IXFA 4YP1A 2C54A 1RWNA 3EPKA 1NN1A 4PLPA 3GOHA 2ZUFA 4M1SA 3LNCA 3FZYA 2PQ0A 5LMNB 2Q6TA 3GR6A 4PNHA 3DZIA 4CDNA 3SBEA 5JADA 5AI6A 1GV1A 3EARA 2WABA 3HM9A 3NDBB 3RS3A 1O6GA 3LBAA 3DKPA 5DHRA 1THZA 3LSYA 2A5JA 2IHVA 4PW0A 5CDFE 2XNKA 3QLTA 1EZ1A 1YQGA 1IMJA 1DUVG 1E9CA 1FDRA 5AKZA 1XEWY 3W3ZB 3QEBZ 2AR0A 2AE1A 2BGWA 2FQQA 1BHQ1 1JFLA 3BGWA 2JFUA 1XZPA 3D1LA 3A6ZA 4M1QA 3UOGA 3WGUA 1JQEA 2ZB3A 3WB2A 1NC1A 4UQPA 4P34A 4CKWA 2FV8A 4ZICA 3U44B 8OHMA 1E5TA 4MVWA 3ZDXB 5CPFA 3SF8A 4G3XA 3O26A 1IOLA 1CDDA 1TJPB 1V8ZA 1DAKA 3VHXA 5DV9A 4FU0A 4FYIA 3RAJA 1KAMA 1HXHA 1FSGA 1Z2CA 3G2JA 1M6HA 4NECA 2RI6A 5B6PA 1AS2A 3WVNA 5I01A 2G1AA 2IPNA 4COOA 2QPOA 2XIJA 5K0CA 1L5OA 3OMXA 1ISSA 4GX0A 1NR1A 3W5JA 4F72A 3BDIA 4IXNA 3SHQA 3HSSA 3ZV5A 3I61A 1N1GA 4O2RA 1Q1AA 4LZNA 2QSYA 4HR7A 4V0NA 4C87A 9GPBA 3OJWA 1U9IA 1YJ8A 4MV1A 1XK7A 2J07A 2OCBA 2P9BA 3D6UA 5MFZA 4ESVA 1ZCBA 2PX5A 2R48A 2AX4A 1XB2A 3W5HA 3H5VA 3N2IA 4QXOA 4E31A 3MD9A 2D8MA 2VQSA 3MFQA 2PRKA 3NTLA 4X6YA 3UY4A 3VZQA 5HP4A 1RYEA 1X2EA 4Q6WA 1DIAA 1UJ5A 3A1TA 1PZMA 4RVUA 4N5DA 3N2GA 1B15A 5I7VA 1J33A 1L4MA 1MRNA 3DHVA 3NB0A 3CNEA 3G0BA 2R6CA 5KNBA 2DUWA 3DOHA 3S28A 2JAQA 4L73A 4M7RA 3F8SA 5AK0A 1NNUA 4XIJA 1R0WA 4XVHA 1FQOA 3SQXA 4FFWA 2YOHA 5KMGB 3QVGB 3LY9A 4OHXA 3RKRA 2BTQA 4HH4A 4I4TA 4MQ5A 5EMJA 5TF0A 4ZK2A 2R6DA 3NH6A 3GP8A 2B5WA 4IMPA 3JAWB 4ISBA 2OGWA 4PS1A 2H4FA 5A6SB 1F2DA 3IAS6 1WB6A 4BLRA 3SYMA 1XPRA 2QTRA 4UE3S 1ZVJA 3BULA 2CWWA 3BDVA 4F9EA 2UZ0A 4PPQA 2G6TA 3S44A 4B75A 3SE7A 5CVTA 3D4OA 1IU9A 3NTOA 1Y8ZA 1C30B 1RRVA 3VUFA 5IM4A 3OHPA 1P80A 4KAAA 4EZEA 1DQNA 1R12A 3ZGVA 3AF5A 3WYAA 1G5TA 4HQLA 1PVVA 4BO1A 2CNWA 2VLBA 4IGKA 2GJ8A 3O5AA 1PUXA 4JP2A 4Q02A 3AEXA 4M8LA 3TJRA 3FDXA 2VPIA 1QHEA 5PNTA 5C51B 1XC7A 2Y6UA 3SCZA 3A1DA 3TVYA 4QXAA 2VXBA 1NRJB 3HBMA 2H00A 2WAOA 3OM9A 4LV8B 4BFVA 3GF4A 3ZWMA 1V9SA 2WJ6A 4EUKA 1RLUA 1MA0A 1LBSA 3AWIA 3RPEA 2ZJYA 3JATA 3UNXA 2PUVA 4DA8A 3U31A 5B1EA 1SU4A 2RAPA 1Y48E 3TD2A 3CIOA 1SULA 3N7AA 3LCVB 2BF4A 2NG1A 4MWGA 3ADCA 1Q7GA 1VLVA 4C89A 1TU0A 4FBGA 3COPA 3ENQA 1YCHA 3KU4A 4AMUA 3NEJA 3V2GA 1LSUA 2HLDA 4JX8A 3A9CA 3QWFA 3HUTA 4FR5A 1CT9A 1QFZA 4QARA 2DF8A 2X19A 2KW5A 1PZXA 2M98A 3O3OB 4KQCA 4M8SA 1AKWA 1C7IA 3V34A 3HCDA 1EWRA 4HYQA 4NZ9A 4RZHA 1P5FA 2ANBA 3UA4A 2GN2A 4ZT2A 3W2IA 3ZNPA 3PC3A 4DQVA 2BRUC 4PWZA 2CHVA 3P2KA 3HVUA 1B1CA 4EG8A 4EABA 3DDNA 5IBQA 3OY7A 5KINB 4U2CA 4YLYA 3DTTA 2ODNA 1E3WA 4PZYA 3UH1A 4QT4A 1YZVA 3W90A 1GPDG 1Y81A 2FLKA 2UVQA 1GCGA 2CNWD 1LGYA 4WY5A 1H2BA 1XZFA 4LXQA 1VSBA 3QNMA 3EXAA 4WL0A 1QK5A 4X97A 4HTFB 1SHKA 5HE8A 2V58A 1G9XA 5L45A 1L5YA 3IAFA 2DT8A 3IP8A 2V8OA 4FFBB 3GAFA 4YDHB 5EZSA 3BGIA 1T25A 1UBRS 4S24A 2FRDC 4TV8F 5BWBA 4DDKA 3JWIA 3UJPA 2HPVA 2LGJA 4FHGA 3STYA 2VTKA 3TZEA 3FYUA 3E7WA 4F46A 3KQKA 4QDKA 2OV2A 5B3AA 2R8OA 4L7VA 3BXEA 4EUEA 4Z4CA 5EJAA 4JQZA 3S2FA 3G13A 3GB9A 1B2LA 2AN1A 1Z13A