5DI9A

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords GTP-binding nuclear protein Ran
total genus 63
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di9A00
1XJ0A 4OHWA 1UKEA 4S35A 5P21A 5FH9A 2VA8A 1OB2A 3MRSA 1U8AA 5FTNA 4OQFA 2J46A 1O87A 4MGKR 3A58B 4IRUB 2IYYA 1PLLA 3VR6A 4FW9A 3SJAA 3BERA 4GPTA 4QHTA 5CYPA 4YMWA 1GL9B 2KJQA 3EZ7A 3W3AA 4V0ME 3AVWA 2X8AA 2W0SA 4MRPA 4LJAA 5H1YA 2UZIR 2ZUCA 3AKCA 1OH6A 2J0UA 1OIWA 1KO1A 4O0MA 4B74A 1UPTA 3RAPR 4TSFD 1Z63A 3KFVA 1R2QA 4MKFA 1DPFA 4BZPA 1E96A 3RNLA 3IPXA 5G3ZA 3PIRA 3CPJB 2JLUA 3PCRB 3ETLA 3X1XA 3BJIC 4HAWA 4PHFA 4C0AC 2CNWA 2R62A 1E69A 3LDAA 4W5JA 4B43A 4Q19A 4LJ9A 1OKKD 3EIEA 4Y0AA 1CKEA 4Q18A 2GNOA 2PEYA 4IFEA 2AFHE 3CRMA 5H68A 3M6AA 3U4QA 4M9ZA 1DO0A 4OQLA 4M0LA 4IJMA 4MYTA 1GL7A 1W4RA 2D2EA 4RD6A 3AVVA 3VHLB 2O8BB 5L3SB 2CL7X 2FSIA 5FPYA 5F2EA 3TMKA 2F7SA 3GEEA 1PLJA 1F3OA 3R9IA 1TX4B 2ZUBA 3GJ4A 4BGDA 2QGZA 1NN5A 1EFCA 1FNMA 4HDCA 1EXMA 2GBLA 3W6OA 4LPSA 4JLPA 4V0NA 4RKFA 3HP1A 3ICEA 5E3HA 2OCAA 3I1FA 3KKOA 1A7JA 1UF9A 3NKVA 4XWKA 1NRJB 4GRAA 1E2HA 4MH0R 3GJ5A 4GDFA 2JJ8A 4RVCA 1S9HA 5CK4A 5AUPB 1NY6A 4XTCS 4MUBA 4ESHA 2JLYA 4NE2A 3MWYW 3BB1A 2WM9B 3X1YA 5JS7A 1FP6A 4F4JA 2EFCB 1M2OB 4LHXA 4KO8A 1TF7A 2IWRA 3I5YA 4X8MA 3GJ8A 1OXVA 1TQ2A 3PXGA 3EZ2A 1P75A 1ETUA 5B2ZA 2IYQA 5FR1A 3WBKA 2QAGB 2QQ0A 4PC6A 3F3YA 4KYIB 2WV9A 1NVUQ 3QEJA 4DC9A 2C96A 2P6NA 3AB3A 4A6XA 4F93B 2NMVA 2W6ID 1BYIA 1G9XA 2JCSA 4HDOB 2Q0HA 1G6OA 3BB4A 4V0MA 2DYKA 1NJFA 5DN6A 1QHNA 4AYXA 4HB2A 1KDOA 2REXB 4LDJA 4X8HA 3OFNA 2V55B 2WWWA 1OLOA 3SU8A 2VP0A 1W48A 2ZUDA 3RC8A 3TIFA 4LY6A 2F1HA 1AZSC 3TSZA 3SC3A 3ZQJA 2RAPA 3QOFA 5DN6D 4RFSB 4A92A 1T3HA 1AKEA 4PC1A 1E79D 1QG2A 1YZGA 2FX3A 3FKSA 1W5SA 4C0BA 3ZS8A 3AF1A 3SJZA 1S3SA 3AUYA 3VKWA 5KU1A 1RKBA 4L5BA 2VYFA 4EQ6B 4IDHA 3QIAA 3DMDA 1JXMA 3I3SR 1IN5A 5GJVC 4LHYA 1WMSA 4Q7MB 3LA6A 2QPOA 2IXGA 4MA4A 2NZ8A 2EYQA 2JJ2D 5JJIA 4MRSA 2GZAA 5TDHA 1NVXQ 3T06B 3PJRA 4DHEA 1FFHA 5JRZA 2IS6A 5DHAA 4FIDA 2I1VB 3QQ5A 4M1YA 3QBVA 2CMKA 4M1SA 2FMXA 3ZDQA 1ZIPA 3EWSA 1UKVY 3AM1A 3IO5A 3EXAA 2C03A 3LFUA 2XNDA 2W2XA 1XEXA 3CRRA 1R4AA 3EZ9A 1Z6XA 4KU4A 5HE8A 2OCPA 4XIGS 5HKKA 3BH6A 4N1AA 4R2IA 3W9YA 4URVR 4Q4HB 5KTYA 1SVKA 3G82C 3EC2A 2ODEA 1J99A 3BD9A 1WRBA 2OESA 3PUZA 3TSWA 3FYHA 4TTPA 1GKUB 5EE3A 3T1VA 2QPAA 4P32A 5AJXA 5IF9A 4KAXA 4ZKDA 3EARA 3SHWA 2GJKA 3AGQA 3L0IB 1HQYE 1SULA 4XTRA 4EQ6A 2AK2A 3RVBA 4EPWA 1KO7A 3G5UA 4NYIR 4JLAA 2DCUA 3U3OA 2P2LA 3RLFA 2CE2X 2P3SA 5CM8B 1JI0A 2OLJA 2BKEA 3E2IA 2QNRA 1LF0A 2WOJA 4P0TA 5KNCA 1ZUNB 4JL6A 5JEDA 4HYYA 1KI6A 3AP2A 2D7CA 1ZIOA 1CR2A 3K8YA 1G3RA 1ZMXA 2J59A 2QY9A 4IOMA 4AWXA 3PUWA 3B1YA 2WWXA 3I8XA 4DSTA 3LLMA 1E2DA 1G18A 4DSNA 4B33A 3LV8A 5J5CA 4DLTA 4BPBA 2O8EA 2IWHA 1NSFA 2IHYA 2ZJAA 1E2NA 3CR7A 3L0SA 4DT1A 2IUSA 4DLWA 1NVVQ 4Q9JA 2DY1A 2PBRA 2QGNA 3SEAA 3PEWA 4NCNA 4QHYA 3NH6A 1TU3A 2OV2A 4OI4A 4EFMA 4RCZA 1IJEA 2GETA 4JLOA 2BMEA 4EFLA 1EX6A 4OJQA 1X1SA 1WQ1R 1RPZA 3EPHA 2VSFA 3RS2A 4Q47A 5F9HA 4JS0A 4M1KA 2D74A 1WE2A 2JLXA 3PVSA 1ZU5A 3OIWA 3LXRA 1I2MA 5AJYA 2CHQA 1XMSA 3CW2A 3FWYA 3TAUA 4OJKA 4A2WA 1N5KA 2FA9A 3I8SA 4NHOA 2C77A 3DM5A 4ZCIA 3R8CA 3UWOA 5F3WB 4EUNA 1OHHD 1CBUA 1DG3A 3AV0B 1CU1A 1BO6A 3F8TA 3W6PA 5EJEA 2GK6A 2XTZA 1FTNA 5AUQA 2ZI7A 3B13B 4URUR 2NO7A 2AWOA 2G1JA 5EUQB 3ICQB 1J2JA 3WHLA 1CS4C 1RC8A 1VKJA 3HYTA 1IXRC 3FPAA 3SN6A 2ZJ8A 1C9KA 1IY2A 2R6CA 2YC2C 3L8YA 1G7TA 3ZIAA 4DUGA 3QSYA 2WMNB 1F2TA 2VSOA 4FCVA 1FQJA 5HZKA 4HAXA 3CNOA 1Q1ZA 3SYLA 3K0AA 3DDCA 2G9NA 1SVWA 1YZQA 2W00A 4PQRA 3TUZC 5HR5A 3MGCA 3O47A 2PZGA 4JSYA 1UAAA 3R9WA 4RFVA 5FOSA 3DKVA 3MAAC 4TLAA 2ZU6A 2XXAA 2WWHA 1CF4A 1FX0A 1KSJA 4IW3B 4UXHA 2XSZA 4WZAE 2IC5A 2GJ9A 1D2EA 2ZPTX 3TUIC 5JFGA 4AG5A 3REFA 3W90A 4MRRA 5CIQA 4RY2A 4ASUD 3CF6R 4P4UA 4PQFA 1LV7A 2J5XA 3FMFA 2W6IA 4HB4A 2FSHA 1N2CE 4BQSA 3B1WA 3WNCA 3EIQA 4Q1DA 5DLQC 4I4LA 1KKLA 1IN6A 3AF0A 4JJZA 1D2MA 1UM8A 4RD0A 2R9VA 2ZVQX 2ANCA 4B71A 1TUIA 1TMKA 2BEKA 1VDZA 3B60A 2H8KA 2RHDA 2AR7A 1DELA 4A15A 1NNEA 2AHOA 1XZPA 4TMZA 3P1JA 2KBEA 1FPMA 3CF2A 2X1VA 5DI3B 2HT1A 2ZREA 3RS3A 3KFXA 4GBMA 2J0VA 2FV8A 1T8UA 4IVQA 3O8BA 3TBKA 1XJQA 3REGA 1XMIA 3Q7QA 3KL4A 4F91B 2TMKA 4ARZB 1S8FA 3UXMA 4F92B 4PO8A 3TNFA 4B3DA 1W4CA 3MSXA 3GLFE 1W0KD 3I92A 2JJ1A 5FOUA 1KIMA 2QTVB 2V1XA 1G4UR 3LBIA 3C15C 1M1YE 4ZI3A 3G0HA 3CZPA 1S1CA 4Q7JB 3EA0A 4HZUB 1P72A 4NPHA 4KHZA 3CX7A 5B64A 2P6RA 1G291 121PA 3MLEA 4F4CA 1ONBA 4UNPA 1LB1B 1N6PA 5JBQA 2PZEA 2ZAMA 5J4KA 4TZ6A 5FBQB 3ZS9A 1B0UA 1P62B 621PA 4US2R 4OQNA 1P2TA 1W47A 4OQXA 1N0VC 4NYMQ 1A1VA 1PUIA 5EE9A 2V54A 1BH2A 2W6JA 2QMEA 3LWNA 4PTLA 4MYCA 2Z83A 2X2FA 3C4JA 2I3BA 1AS2A 3SBEA 1PUJA 4PAQA 4ZDIA 2GCOA 1Q1EA 1W36C 2QRNA 4PFSA 4KLNA 3NC0C 4TTRA 3T34A 1WDTA 2YHSA 2FSGA 3NWJA 4B2IA 4CZ2A 5J47A 4PAMA 3QKSB 2F1JA 5DI9A 1Z2CA 4LSGA 5FI1B 1SVMA 4PAOA 4EPRA 1G8FA 3CKLA 3LRPA 5FUVA 2JLWA 1W0JA 2O8FA 4Q4AB 4FD2A 3B82A 4A9AA 4CF7A 3L8ZA 3A1SA 3JZMA 3VQTA 3MG9A 2V9PA 4U5XA 2ERXA 6Q21A 5L3VA 2CCKA 4MUAA 3K0AB 2UZ3A 2XITA 3GCGA 1E2EA 3K0FA 3K1JA 3NH9A 1Q22A 2GXUA 3TKLA 1VIAA 2ZAOA 4Q4AA 2XZOA 3SNHA 2WAXA 1G3QA 3K0CC 1CEEA 4P33A 3SFZA 4B3FX 3A37A 2FFQA 2XGJA 2W83A 1KK3A 1FMLA 3ND9A 3WP0A 1RRCA 1Z47A 1TF5A 3DVLA 1OE0A 3FTQA 2PCJA 3K9GA 1SQ5A 2FGKA 2D06A 2MMCA 2OLKA 1WP9A 3FVQA 3LVQE 1E9CA 4ZIRB 4OQMA 3B85A 3EASA 4YDSA 4H9GA 2QP9X 4D25A 2ZI3A 2RGCA 4B35A 2Q9BA 1CIPA 1FZQA 3AKYA 1OH7A 3QE0A 4HUQB 1YZLA 1KI8A 4DCNA 4MKGA 3D31A 2H92A 4G5RA 4HB3A 4H1VA 3U3JA 4BEJA 1OIXA 4HLUA 2VH5R 1XB2A 3IIJA 3HWSA 2CHGA 1NLFA 2ZEJA 1K5DA 1S0UA 2OFWA 1G7RA 1GM5A 1KJZA 2G77B 1C1YA 1G19A 1W44A 5JSZA 3BC1A 2ZE8A 4BZQA 4UNNA 5A4JA 3NG1A 1HA3A 2PLFA 5B57C 4NCHA 3H1TA 2ZS7A 4TYWA 1AA9A 4CYMA 4A0GA 2HJVA 2O0HA 3BXZA 4O3MA 4OHVA 1DAFA 2Z0MA 1QHIA 4FCTA 2OT3B 1E2IA 3GFPA 1DARA 3QVVA 4QBFA 3UK6A 4TYPA 1R5OA 4GOXA 4A0FA 3K0SA 3Q9LA 2C99A 4OKSA 4E03A 3DEFA 4E5UA 4HLCA 5KNDA 1WBDA 3GLGA 4DLXA 3TQFA 2QSYA 2OAP1 1E32A 1XXHB 3UG6A 4C9BA 2QBYA 1OT3A 2F9LA 4QG7A 3A4MA 2WWFA 3W8NA 4QKQA 1U0JA 2VSXA 2VP9A 4RCYA 1EFUA 2F3RA 4B32A 2XNSA 3CO5A 3GLHA 3L0PA 1EWQA 4NYMR 2IYVA 2NIPA 2NQ2C 2Q21A 1Z0JA 3HR8A 3K0EA 2WHXA 2V6JA 4QC2A 5C18A 1KGDA 4QBGB 4WZBE 1YR6A 1XPUA 5DH9A 1KI7A 3VU9A 3W3ZB 4E09A 2IEYA 1VG0B 2OSBA 3FMPB 1JPNA 4ZCLA 1AQYA 2XOKA 3PFIA 1TPZA 3QPWA 3GLIA 4LJYA 5K8UA 1N6LA 4J0QA 2ORWA 3EPKA 3Q85A 4A0RA 3K70B 4AKEA 1MRSA 2GAAA 2YWGA 5FFMA 3PENA 2BWJA 2WTUA 1ZM2A 3IHLA 4PHGA 1W49A 1JEDA 4HLDA 1CJKC 2V3CC 2PZFA 1GNPA 1UDWA 3BH0A 3Q3JB 2YOFA 1YHNA 2BEJA 4A36A 3H0KA 3TUJC 3P20A 1N6KA 1LVGA 3OIUA 1E0AA 4YMUA 4LBZA 2WICA 4FI3C 2BC9A 4M1TA 4CEIB 2J87A 3NHAA 2QUZA 4QJ4A 4FWIB 1N5IA 5CDFE 4AK9A 4C2TA 4MKIA 1ZM4A 5E7IA 3TH5A 4GNKA 4KFUA 2VIIA 4I1VA 3TVDA 1JR3E 4AURA 4ESVA 3ADBA 2ZVPX 2O8CA 2ZQ5A 2REOA 2WSSA 1IAQA 3I72A 2QE7D 5H8WA 2PJRA 4K46A 2GCPA 2ZJBA 1ZBDA 2PX3A 2O8CB 1YR7A 3RSLA 4YDHB 3TQCA 3BIFA 1NN0A 3HJNA 2BMFA 5CLQA 5TV2A 3EC1A 4ZI2A 1II8B 1Q20A 2W0MA 3RS0A 4UNRA 2C78A 1KOFA 4B48A 3A6PC 1SKYB 3OF5A 1IXSB 3VTKA 4Q1BA 5LPNA 2P6UA 4Q1EA 2W2TA 4B2LA 4BECA 3K0FB 1ESMA 2XTMA 1E2FA 2EFEB 1KI3A 1J90A 2V6IA 1P6XA 2A2ZA 4JLNA 4IDPA 2VQSA 1GNQA 2FEMA 1JAHA 1FP7A 2Q3MA 4PSAA 2ZRGA 2WKQA 1GOTA 1HTWA 1LF5A 4ILEA 5G3YA 1LS6A 4WZ6A 4GSYA 2Z4RA 4M9SA 3UG7A 4ITRC 2KBFA 2ZYWX 2G83A 1JB1A 5BQ5A 2IYUA 5FBRB 3I73A 1XTSA 4BWYA 4KVAA 5LD2C 4K8OA 3IDQA 2ODWA 3TLXA 2CLSA 5DI3A 5GJBA 3UPUA 5EP4A 3EZFA 1ZCBA 2ZSEA 4KODA 2NZJA 5IK2D 1EFTA 4C4PA 3QJYA 2ZRBA 2CNWD 1KI2A 2VHUA 1UEJA 2VRWA 3DZ8A 4V02A 1LW7A 5DNYB 1YU9A 1E99A 1E2KA 4RD2A 3NVAA 3NEYA 3QXJA 1TQ6A 4DUGD 3FMIA 1K8RA 4YMSA 2KI5A 4RJLA 4B3BA 4AYTA 1OXXK 5DO9A 4OK6A 4PPFA 3B2EA 3DOEA 4GP7A 4WAUA 1KYIA 1XEXB 2ZETA 5KSYA 3T35A 1KTVA 2A5JA 1MABB 2A5YB 2ZJYA 1KJWA 1Z6YA 3AF2A 2P5TB 3K9NA 4C30A 1Z29A 5KSZA 4G5OA 3H86A 3IO3A 4G5GA 1VPLA 1FTSA 1T5LA 3K70D 1UBFA 2Q3HA 3VKGA 4A4DA 3N70A 1WBBA 3CX8A 1R5BA 2EQBA 1G16A 1F60A 4Q1FA 1DAMA 3PG5A 4QGHA 4ZPXA 3SJBA 2E9SA 3LBNA 1KDRA 2HF8A 4BLRA 2IW3A 1P73A 3UMRA 2AK3A 4M9XA 1BYUA 1XXHA 3PUYA 1Z83A 1N25A 1A2KC 3W5JA 1ZNXA 2UVQA 3NDBB 3OESA 1G1MA 1TEVA 1XTJA 1NN3A 2ODBA 4XVUA 2QAGA 4CEIA 2O8DB 4LYAA 2QEQA 4TN1A 1N5LA 3EZ6A 4CT4B 2HT6A 3UMFA 1QZXA 2VLIA 3TR5A 2N42A 1R10A 2YC4C 4KVGA 2N46A 2E1RA 2DR3A 3U44B 3M0EA 2IF2A 5HPYB 1UJ2A 1LNZA 4ACBA 3PR1A 4UJ3A 1GG2A 1R8QA 1RRGA 2J0SA 2WOOA 4DLYA 1S96A 1RW4A 2QT0A 1IN7A 3A1UA 4EDHA 5JJKA 4MITA 1E6CA 3RANA 1DEKA 4LI0A 3P26A 4Q66C 4QNMA 4BLSA 3SBDA 3A36A 2G0NA 2WWGA 3OEEA 3HPQA 1A4RA 3VNVA 5BN5A 4NCKA 4X8OA 4QM6A 3LO5A 4Z8YA 3D7MA 1CRQA 4B3XA 1G8YA 3WP1B 4TZ0A 3THYB 1OF1A 3WMFA 1KK2A 4F7WA 4DCSA 4LK2A 4P31A 2A5FA 1V43A 4AY2A 1XBTA 1LFDB 1FQKA 4A82A 3JZAA 3D6TB 2QBYB 2A5DA 1XCGB 2P67A 4NH0A 2JDIA 1NVWQ 4KI0A 3K09A 5F98A 3IQXA 3DOFA 3O8RA 4B2PA 3RSOA 5FL7A 1QHXA 4JBWA 1AJEA 2G6BA 4DLUA 2B92A 3SFVA 1U81A 5TVKA 2ZROA 3B6EA 4Q7LA 4W5WA 1OYYA 5DISB 4Q4JA 4DKXA 1T3SA 4CEHB 4NYJQ 4QNRA 4DJTA 2O52A 4LGMA 4LPKA 2OILA 5E95A 1IOZA 4M22A 3RHFA 2OAQ1 4DCVA 5IK2A 5FPSA 2GJ8A 2O8FB 1IN4A 1NSTA 2YJTD 1KNQA 2WMOB 4TL7A 1X8JA 1AK2A 5TXGA 2JA1A 3IIKA 5EZ6B 4BFSA 1OH5A 2ZRJA 2BVNA 2ZYTX 4QL3A 3ZD6A 1S4QA 2Y8EA 5H70A 3MWLA 1CR1A 2RH5A 3KKNA 4C0SA 4DDTA 1MV5A 5C4GB 2RGNC 1S2MA 2F1RA 2CCJA 4LBVA 1ANKA 1U98A 721PA 1CRPA 1KI4A 1D8TA 5FTJA 3CX6A 2IS4A 1E1RA 1YQTA 3NEJA 2YWHA 1EFHA 3K0CA 2QMOA 2DWPA 2V8OA 4NTZA 4Q9KA 1K6MA 2V7QD 4YXWD 3L43A 2ZU0C 2O8DA 5L3QA 1WA5A 1YZTA 2YINC 3FFBA 3K9LA 2ZITA 2J0QA 4GMXA 1N6HA 4DCUA 2R44A 4ZDJA 2HCJB 1U9IA 1XU4A 1FW6A 2FPLA 2OCYC 1GVNB 2VEDA 3B78A 1F2UA 3UWKA 1ZAKA 2GWHA 4B47A 1E1QA 1VYUA 4CEJA 1BMFD 2W2VA 4C0HA 4ZCMA 3P32A 2FSFA 1OJLA 1Z8FA 1KMQA 1UDXA 2PEZA 3OFND 4LBYA 1EX7A 4RZ3A 2IYWA 3VKHA 2NO1A 3E70C 3R20A 4JZKA 5JWHA 2FH5B 4UJ5A 1KSGA 1HQCA 4Q4HA 4JT4A 2J9RA 2RGBA 1II9A 1ZCAA 1I2DA 3CIOA 4IEIA 2BM1A 3KX2A 4LHWA 4NL4H 4ERNA 3QG5A 1N0WA 5AJZA 3OE7A 4RZUA 5E4FA 2HLDA 4U7DA 1E2JA 1GSIA 3CM0A 1QHGA 2WVJA 3DHWC 4PO9A 3EPJA 1E9EA 3CNNA 4XWOA 2QN6A 3A4LA 5CB6A 1SVOA 1WXQA 1US8A 2A78A 2RGAA 1MO6A 2FFBA 1MH1A 4P4SB 2Q3FA 4XWAA 3U7HB 4L4UA 1AGRA 1IM2A 1JPJA 4H1UA 1EK0A 2YV5A 1CLUA 1FUKA 2JJ2A 4I81A 1GL6A 2ZRDA 1D5CA 3EPLA 4XVRA 1G5TA 4FMDB 2OM2A 3U3RA 2VHJA 2FDCA 2JIZA 4HUQA 2WWIA 3FE2A 4DLZA 4B75A 3T1OA 1MRNA 3GLFB 3WYAA 1U99A 1G8GA 1AS3A 4P3YA 4TMVA 1VHLA 2GKSA 4TYNA 1VHTA 1XRJA 1T4GA 3IBYA 3QNUA 4TQAA 3GJ3A 5DHFA 1HE8B 5KSPA 2HF9A 3W6NA 1L2TA 1NJGA 3OEHD 5G40A 4IXMA 1IY1A 1TADA 1GWNA 2ZE7A 4MKHA 4AIIA 5JS8A 2BIFA 4XH9B 4B3CA 4PANA 2ZRFA 1W5TA 2IBMA 2ODNA 5K8IA 4TL9A 1DAHA 1XEFA 4YMVA 3IKJA 1O3YA 1VCNA 2VO1A 3FDIA 4TMTA 1SVLA 2NO6A 4O25A 4ON9A 3GJXC 4UNSA 4CW7A 5CDFA 4D0GA 1GP2A 4M1OA 3HU3A 3A1VA 1NMYA 3R7WB 2Q9AA 4Y0VA 2ECKA 5TB5A 3X2SA 4AG6A 1DAGA 2OBNA 2PH1A 3LY5A 1KZ7B 2J3EA 2VBCA 4EJSA 5CYOA 4AKHA 3DKPA 4BLPA 4CDGA 3TSOA 1EGAA 2I1QA 1KK0A 1G8HA 1KJYA 2QU8A 1SHKA 4M9QA 5JI3E 5L3RA 2ZM5A 2ZR7A 2F55A 4NCIA 2V1UA 4NCJA 3SQXA 2YYZA 1EFRD 3BGWA 3WHKA 3IEUA 3X1ZA 1OFIA 1E1RD 4M1WA 1XTIA 1SXJA 2ZJ2A 4B6EA 3E1SA 1G41A 2H7VA 3BWDD 4XSGA 3AH8A 2IEZA 2SHKA 2BCGY 2E87A 1SXJB 2CVFA 4WVFA 1E79A 4GOKA 3BFXA 1XWIA 1Z22A 2XJ4A 4Q00A 4WBSA 1X8LA 4HLUC 1XTRA 4MGZR 1G5RA 4JKIA 2GCNA 5HCNA 1P9NA 3H4MA 5D3MA 2XTNA 3OIVA 2G88A 2IK8A 1EWRA 1WCV1 1NBME 3B1XA 3C8UA 1I4LD 3CONA 4NZYA 4EIWA 4JJKA 2BOVA 2CDNA 4V0KA 5FOVA 1ZNWA 3U7FB 1QBKC 3ZZ0A 2RHMA 1KO4A 2VL7A 4L9WA 4RD4A 3NBXX 1R0ZA 3FGNA 3IHWA 3GLIE 1Z6TA 4ZDWA 3PQCA 1ZD8A 4AI6A 2ZJZA 4DLVA 1KI9A 4C0JA 1E9DA 1XD2A 2YNMA 1XFAA 2IYZA 1GUAA 1FOEB 1G4AE 1NLYA 1T0HB 4JLDA 5JRJA 2QPTA 1U8ZA 3HR7A 4RZ2A 4MRNA 1OPXA 2P5SA 1H8HA 4CEJB 3OE7D 2OHFA 2ZRNA 4YLGA 4OI0A 3AKEA 2QM8A 4B73A 3U5ZB 5A0FA 2NTYC 4II7A 4OK3A 4LYJA 1QVRA 2FG5A 4US1R 4D26A 3VR5A 1F2TB 3IILA 1UFQA 1R0WA 3MD0A 3LBHA 2IXEA 4TYYA 1F5NA 2HJGA 4IXNA 2D62A 3Q8XB 4GOJA 1U0HC 5EXTA 2QTHA 3I62A 3BE4A 3IPYA 5LBIA 3IIMA 5L3QB 1JALA 2QP3A 3CH4B 4QHSA 3BK7A 3K9HA 4X8LA 3U3MA 2O0KA 3QPVA 4M21A 4ACAA 1CXZA 4LJ7A 1PJRA 5AWFC 3RABA 1OSNA 2DWQA 3LAWA 4D0NA 1HT1E 2DWOA 3AVQA 2XXAB 1W1WA 3TR0A 4NP6A 3AP1A 1SZPA 4O2LA 4GP6A 4KLZA 4RKEA 5EE0A 2FU5C 4CIDA 4BE7B 1BOFA 4IOLA 2ZTSA 3GLIB 4IDQA 4QXAA 2BV3A 4L9SA 2ONJA 4G01B 1NIJA 4PPGA 1QHSA 1T0JB 4LHZA 5K8LA 3F5FA 3LQRA 4D4JA 3NXSA 1IBRA 1KNXA 2FN4A 2XSZD 3KDSE 4AYWA 5SZHB 2ANBA 3KJHA 2OXCA 4BLQA 1OV4A 3QXSA 5TY0A 2H16A 3KQNA 4OHZA 2QRZA 3JVUA 1E2GA 2Z43A 2ZRAA 1QDEA 1E1QD 1OFHA 3UANA 2IS1A 4WA7A 3GQBA 1OXUA 4LC1A 1HE1C 1VYTA 4HATA 2GVDC 4ZIRA 1J8MF 2WJHA 4JVNA 3E5HA 5FPKA 1BKDR 1MR3F 3ASZA 3RRYA 3VHXA 5JECA 3WYFA 2XX3A 3IEVA 1ZJ6A 4WOPA 5FPHA 2GHIA 4Q4JB 3RYTC 5HE9A 1E98A 1NP6A 4BEBA 1ZINA 3I32A 1H8ED 3LH5A 4ARZA 4A6PA 3KTAA 4IVPA 5CM9C 4CEHA 1TL7C 2VHTA 4JLVA 4LJ6A 1E0KA 2GA8A 4ZKEA 4LYFA 1H65A 3ECCA 1Z2AA 2OE2A 3N2EA 4Q9LA 5G41A 4HAVA 4JLKA 3EW9A 4U02A 2AXPA 1W0JD 2WIBA 5EP1A 3BFVA 2ZS8A 1SVSA 3HYRA 2FPMA 3TRFA 2NGRA 5J4YA 3PEUA 2LKDA 3L82B 5FBLB 3ADDA 4BUJA 4M8NE 3AQ4A 3GP8A 3TW4A 4K81B 2JIZD 5KPJA 221PA 2VPPA 3ZIAD 3GLGE 821PA 2CK3D 3AVYA 4PO1A 4PX9A 4TSFA 5KNBA 2NPFA 1UKZA 1Q3TA 4G0NA 2BJWA 3KZ1E 1RJ9B 4Q4LA 2OCBA 4QBHA 1XTKA 1SKYE 1CULC 1NI3A 2ERYA 3IBGA 4GI7A 4D0LB 3O8DA 4HAZA 2GRJA 2XZLA 4QRHA 2W6JD 3LVRE 1AM4D 2C98A 2VP4A 3QKUA 2AKYA 1II0A 4B3GA 1G64A 1Q0UA 5B58C 1NY5A 2RGGA 4TWZA 1KY2A 2YOHA 4EAQA 4Q9HA 5KDDA 1OH8A 1TTTA 1KDTA 1HV8A 1MKYA 4JT2A 1G5PA 1GRQA 1PLKA 2CHVA 2PLRA 2WPDA 4TLBA 1MO5A 1HURA 1Z6GA 4A8JB 2OUKA 4NONA 2J7PA 1E2QA 3Q5DA 1L4UA 1RRPA 3AUXA 3GMTA 1W7AA 5F9FA 1NBMA 1J8YF 1E2LA 2BKUA 3B7GA 5FOXA 1A82A 5J4HA 4B76A 3K53A 2ZXUA 1NKSA 3FFAA 4LBWA 2R6AA 4LV6A 2IXFA 2XJ9A 3EA5A 3KB2A 1JECA 4R98A 2NG1A 1G3MA 5EP2A 4C3ZA 2YVUA 5BWMA 4UQOA 4HI0E 2AWNA 5JCZA 3GLGB 1FMJA 1P60A 2NPIA 4PPQA 3L0OA 2FFHA 4QOSA 2EFDB 5GVRA 5DYIA 5IT5A 2ZJ5A 1TF2A 1IN8A 2WJIA 3R7WA 1KMHB 3WMEA 2OG2A 4O2RA 1IXZA 4MDFA 4PR0A 4IDOA 1QHHA 4D4MA 3THWA 3P4YA 2WSMA 3D8BA 1AQUA 2I4IA 3T12A 1PZNA 2L0XA 2GK7A 3I61A 2RGEA 5EXPA 4HB0A 3ZVLA 4IVRA 2CEAA 2J7KA 5CB8A 2G3YA 3CUEF 1ZYUA 3U3KA 2FF7A 2RCNA 1T91A 3ZVMA 4D2IA 4BFXA 2YKGA 1X8KA 5A5GA 5DYGA 4OBEA 5FTMA 2R6GA 2ZYUX 5JCPA 1V5WA 3LW8A 4DXAA 3FOZA 4OL0A 3QXCA 2HEIA 2Q9CA 3H2YA 5EP3A 2FGJA 2IYTA 5J4VA 4DB2A 1IONA 4B34A 1XEWY 2REBA 1BMFA 1VMAA 4TQ9A 2VP5A 4JYBA 1E2PA 2VHCA 2H17A 3SZRA 4CGZA 2JLQA 3EWAA 1JQJC 2WPDD 1GAJA 1SKQA 4DEYA 4UXIA 4BRUA 2XB2A 4BZXA 3WY9A 4Q01A 5JI2E 1Z0FA 2LCFA 4JSTA 3RS4A 2D4HA 2F6RA 2HV8A 2PL3A 2WIAA 5KHOC 4R9UC 1AN0A 1N5JA 3N5CA 1I4TD 3QF4A 1XNJA 3ZLJA 4N0EA 1NL3A 5M04A 1E9FA 2EU8A 4C2UA 3BAFA 2HLDD 2F3TA 5KYKA 1IQPA 1RYFA 4LUCA 1Z0AA 5DSZA 3GLHB 5GJWC 4URYR 1BIFA 1VECA 3NBYC 2GVZC 2GJAA 5FTKA 2GAOA 2OEPA 2QP4A 4JVSB 2C9CA 3RC3A 2G1KA 4DLRA 5FBVB 5JMTA 1ZU4A 3MWKA 3TJZA 3PUVA 2BHRA 5C4MA 3U6KA 2BMDA 1M7GA 5FPTA 4Z1MD 2QT1A 3R8FA 1OXSC 3QEOA 1J7KA 4EFNA 1Z3IX 3AP3A 5DGXA 2QI9C 3SYNA 4TT3A 1XF9A 2CBZA 1OFTA 1OIVA 3BFKA 4E07A 5BN4A 2QMUA 3GJ0A 3T1QA 2XOKD 1YR9A 2R6DA 3TE6A 2GJSA 1HEIA 3C14C 1MOZA 1AGPA 1JXOA 1QF9A 4GZLA 2IA5A 3MUFA 4FMBB 421PA 2HXYA 3BORA 2A7QA 2QAGC 2QL6A 1P5ZB 4KFRA 3LNCA 2OO7A 3WRXC 3RRMA 3AVUA 1E3MA 1DE0A 4A2QA 3CLVA 5L8VA 5SZJA 3SJCA 3WMGA 4HAUA 4Q5IA 1RIFA 1Y3AA 2RB4A 2GTPA 2MSCB 2ZJOA 3EAQA 4LHVA 4QBIA 4FMDF 5JHGB 4URXR 3RRZA 1XDBA 4RD1A 2Q6TA 5LB4A 4FWTA 1IJFA 5L3SA 3Q72A 4M2LA 4E22A 4A8JC 1U8YA 2WJVA 3JVVA 3T5GA 4G1UC 4DT1B 3ZZUA 4XD7D 1ESNA 1NMZA 2RGXA 1SGWA 2AD5A 2CCGA 3B5JA 3NBZC 2QROA 4I1UA 1Z28A 2CL0X 1XP8A 4C7OA 4LC0A 3KUDA 2EWWA 4JLMA 1EG7A 5FUWA 4BRWA 1IHUA 3TK1A 5EXXA 1G7CA 4YMTA 1ZD1A 5D3QA 3RWOA 2WZQA 2HCBA 4EPXA 1II8A 4QM7A 2O0JA 1HT2E 3CWQA 4NYIQ 3X1WA 1YR8A 4ABYA 1VCMA 3MFYA 1JBKA 3VX3A 2YWFA 3U44A 4V03A 3KTAB 4CVNA 2QTFA 1E0SA 1ZM9A 1GRNA 5FL3A 3B1VA 5G53C 1XD8A 1UBCA 2FE4A 2J0UB 2B7BA 3ZYCA 3HDTA 2GEUA 2NOAA 4HEJA 4TTQA 4OHYA 1RZ3A 2QMHA 2F9MA 4JIMA 1TEXA 2R8RA 2OBMA 3OAAA 4Z1MA 2ZSAA 4M4SA 4KYUA 2V4ZA 3BB3A 1X3SA 2CXXA 2ZIAA 3IUYA 3MJRA 4KSCA 3NBFA 3RDPA 3WRYC 2VP2A 4TLEA 3RWMB 4DDWA 1PVOA 1KY3A 1N6NA 3GJ6A 2ZI6A 3GPLA 1DS6A 2GF0A 5FUXA 4HSEA 5DIFA 4TMXA 2ZRPA 4TL6A 2GCOB 4EPTA 1XEWX 2ZRCA 4DZZA 3KB1A 4I99A 3VR1A 5DE3A 3P4XA 1YRBA 5CITA 1P2UA 1I4DD 1J70A 1YZKA 5LD2B 4IHQA 1QHHB 4W5HA 5FL7D 2FJUA 4PSKA 2DPXA 1F6BA 3CZQA 3N2IA 5KOYA 4G3XA 1D2NA 1A5TA 1Q44A 2VF7A 3KKQA 4FN5A 2H1LA 1RFLA 2MMGA 3MMPA 4XSHA 3W5IA 2WWYA 2RGNA 4BFVA 5C46F 4JL5A 3B8HA 3LW7A 1HYQA 1E2MA 4YQFA 1AIPA 1JNYA 4JBYA 4LYHA 3SHFA 4LZZA 1OB5A 3SS8A 4D4KA 3Q7PA 3LLUA 4DLSA 1SXJD 2DHRA 1X1RA 3AEZA 1T8TA 3C5CA 3KKPA 1GNRA 3NDPA 2B7CA 1CTQA 1MT0A 2ZRMA 2KB0A 4JKYA 1XZQA 4PHHA 3VNUA 5JJLA 2WJJA 3ZVNA 2DFNA 4BFYA 4D82A 1R6BX 1KMHA 5FTLA 2PT5A 2ZSFA 2JLSA 3AVPA 5CK5A 3BBPA 4KJZA 3A1WA 1E0JA 1SXJC 2ZANA 4HZIA 2ASEA 3THXB 2ATXA 1PV4A 4QJ5A 2IT1A 1TQ4A 5HTKA 1Q3HA 1L7VC 1VIYA 4LWZA 3LX8A 4HAYA 4DSOA 2J41A 3OAAD 3PV0A 4DIDA 1YRAA 1ZW6A 3MJHA 3Q5EA 2O5VA 2XAUA 3B9QA 1F48A 1Z0DA 4KBFA 2OBLA 3NIBA 2GF9A 2GZHA 4PZZA 4RZXA 1GDDA 4DWJA 3WNDA 3CB4A 1FL9A 3EG5A 1XX6A 4DB4A 4Q02A 4TYQA 3IQWA 2X19A 2C9YA 2ZSDA 3ADCA 4FCWA 1UADA 1G21E 2NO0A 2ORVA 5LB2A 2AN9A 4POAA 1JR3D 1S1MA 3IGFA 4TLCA 4QJ3A 1H8EA 1GITA 1ZNYA 1UBGA 5AUOB 1OHHA 3I4LA 4Q48A 2ZR0A 1QVAA 2DFTA 1WB9A 2IYSA 1M74A 1VCOA 1NG9A 1R5NA 5J4LA 4HUTA 1G6HA 4IKEA 1G17A 2UKDA 4LX0A 2NO9A 3C41J 3TGPA 1G8PA 5JEEA 4V0LA 1KAOA 5EUMA 1VTKA 2H18A 3PEVA 1UEIA 1T5IA 1ZC3A 2WSSD 3QI2A 3J81k 4HZUA 3WXMA 1HH4A 4W9MC 2C9OA 1GTVA 1VG1A 3VFDA 5EZ5A 1KAGA 5JWOA 4LJ8A 1ZP6A 5C1BA 2MSEB 4LOAA 4YONB 1UBEA 3RRNA 1SXJE 2AXNA 1Z5ZA 2ATVA 5SZKB 3SQWA 2JLRA 3GLHE 3CF0A 1Q21A 2GESA 4IEEA 4KBGA 3SR0A 2BM0A 1CP2A 1E94E 1KSHA 1LTQA 1KDPA 2WAYA 4MGIR 5AK0A 3PUXA 4LRWA 2IS2A 1DG1G 4PPNA 1W2GA 2R6FA 2CVHA 4EKDA 3VU9B 2YOGA 2GZDA 1MO4A 4N3NA 4RD3A 4RSGA 2DBYA 2DFKB 3QG1A 4LV5B 4DCTA 4R71A 4N0DA 2YWEA 3AF4A 4LV8B 4R7ZA 2FFAA 3QBTA 4D4LA 2YZ2A 1GILA 1KHTA 5JLJA 3MWJA 2AKAB 2QG6A 3GFOA 4ASUA 4JMPA 1Z08A 4NYJR 2A9KA 2J7PD 4US0R 3FHTA 3GEIA 1NG1A 2EFHB 3QF4B 2GXAA 4D6PA 3GFTA 1MO3A 4BASA 2VP6A 1KZGB 3KQUA 2GXQA 3QUSA 2N1BA 4XD7A 3ZQ6A 3CRW1 2QZ4A 2ZI9A 4OYHA 2OXRA 2XZPA 3OZXA 4TMKA 2QM7A 5IDVA 3THWB 4AKGA 5ANRB 4XJXA 1P61B 2EWVA 2ZRKA 5HZHA 1Q1QA 2H57A 3LXXA 1R8SA 2WJYA 5HCIA 3DM9B 1GZSA 1GRRA 4FXPA 1M6NA 4JLJA 2MSDB 3CWZA 1VCIA 2WJGA 3T5DA 3LQQA 3QENA 3F0TA 2IF0A 4PZYA 2WKRA 3VAAA 4S2EA 3S1AA 5FR2A 2PCLA 4IOKA 3THXA 3MCAA 1ZRHA 3V4FA 2EFGA 2P65A 3ZGXA 4JYCA 3UKDA 2VF8A 1CR0A 4DIEA 5TMPA 2F1IA 5BYJA 4BFTA 3RS5A 1M8PA 4C0QC 4KCGA 3CNLA 1YE8A 4URWR 2JJ1D 4KXFB 1S3GA 1KO8A 4KFSA 4A0HA 2DFLA 2J45A 2QORA 1OYWA 1JQLB 3A1TA 1KK1A 2KE5A 4PZLA 3THYA 3VR2A 1OW3B 3AKDA 3UMSA 3QXXA 2BMJA 2IYXA 3P27A 1D9XA 2C2HA 2ZRHA 4M1MA 1JJ7A 1YJ5A 2C5LA 2XEXA 5IHPA 4LJ4A 2BBWA 3GJ7A 5FI0B 1ZNZA 2LWIA 1YZNA 4JL8A 1OKKA 3PITA 4Z51A 3KQKA 1Z06A 5AJWA 4IFBA 4BFUA 1N6OA 1QRAA 2OFOA 5BYKA 4AKIA 3WYGA 1YKSA 3NHBA 5GADl 2F43B 3AVOA 3KQLA 3C16C 1G7SA 1LY1A 2ZSBA 1T6NA 4DBLC 1JR6A 3ZVRA 3U60B 3TAHA 3ZJYA 1DAEA 1GFIA 1CJUC 3RS7A 2GBLC 4I1SA 3NTUA 3TVTA 4DEXA 4Z54A 1P9WA 3HU1A 3DL0A 5AR1A 4P4TA 5JSZB 3KJGA 1E9RA 3OHMA 2FOLA 2CLDX 3CRVA 3CR8A 4UNQA 3M1IA 4D81A 1DVRA 4TLDA 5BW8A 3QKTA 4RFSA 4UKDA 4PC7A 4JVLA 1TU4A 1U0LA 4Q7KA 1T3LA 4DSUA 3SDZA 1ELOA 1AKYA 2G0TA 3HU2A 1GKYA 1N6RA 2ZYVX 4TT3D 1FX0B 3OEHA 1W4BA 1NMXA 2BJVA 2ZI5A 1T9HA 2CE7A 3KXLA 1RE0A 4M53A 5FOWA 1TNDA 2QENA 2FPKA 4ZDKA 1P2SA 2XNDD 1ZUIA 5LDDC 1X86B 4QGGA 5JZVA 3A4NA 521PA 3AVTA 3FHOA 5KDOA 4NMMA 1U2RA 1DO2A 1YZUA 2PT7A 4KSBA 4U00A 1L8QA 4NU0A 2J1LA 1NVVR 2B8TA 2W58A 1W4AA 1ZD9A 3THOA 1VG8A 1FUUA 3ND8A 2WBLC 1Q12A 1QHYA 5ELXA 2QAJA 4P4SA 2RMKA 2C95A 1OFUX 4WXPA 5KPDA 2JEOA 3FKQA 4LCBA 2JLVA 4BLOA 1US8B 2GEDA 5EXSA 1XJCA 1XTQA 3GD7A 2O8EB 1R7RA 2D2FA 1EFRA 2JLZA 1XCMA 1A2BA 1JEEA 2Z6VA 4A8JA 5JWRA 1FNNA 3QKRA 4TQUS 2PJZA 1M7HA 1UKYA 1D6JA 3AGPA 3QKSA 5AJVB 1NLZA 3KUCA 4W7SA 1ZM7A 4CT5A 5K8TA 1U9IC 1KKMA 8OHMA 1CR4A 1XMVA 4KFTA 4Q21A 1G3IA 1W0KA 5FOTA 3CPHA 2HUPA 4GFDA 3EX7C 4I1OA 1R0YA 1XPRA 4NKRA 3VX4A 4TMWA 2GXSA 4CRWB 4PQYA 5KO2A 1GIAA 1W46A 2RGDA 3BOSA 5UKDA 1E4VA 1XCPA 2ZI4A 1COWD 1N3BA 1ZC4A 2ZS9A 3VMFA 1TQDA 4Q03A 3V9PA 3QPUA 1AZTA 4OI1A 4QGFA 2EW1A 1JJVA 2XB4A 4XVQA 1Y63A 2A30A 2IX3A 2A3RA 5SZIA 2BBSA 4JLBA 1N0UA 5J40A 4GZMA 1NIPA 1Z0KA 3FB4A 4NDZA 4G5SA 5EQTA 1P2VA 4QGAA 3S1AB 4MYUA 2QSZA 2FEOA 4YC7A 1ODFA 5AUNB 1SHZA 2F43A 4L15A 2D7DA 1NF3A 4GMDA 4EJSB 4XOIA 2VHQA 1YVDA 1E4YA 2GDJA 1SVIA 5TARA 3WBJA 1D9ZA 4DDVA 4Q9IA 5HKKD 4IOJA 1C4OA 1G20E 4MRVA 2R65A 3KKMA 1DAKA 4OK5A 3ASYA 4ZV4A 1HY3A 3KJEA 1P7CA 4FMCB 3U4QB 3AF3A 1RYHA 3K09C 4DDUA 3DZDA 4C0KA 1BS1A 1F2UB 4JBXA 3NC1C 1AS0A 5EE1A 3UIEA 4AD8A 2AX4A 4F38A 1XPOA 3LX5A 1L4YA 1CJMA 1E9BA 2GEVA 4PSVA 3VR3A 1DTSA 4V0OA 1CJTC 2FNAA 3DMNA 3ZZTA 5BN3A 2IL1A 3W34A 2H5EA 3D3QA 1Q1BA 3FMOB 4MGYR 1DOAA 5KSOA 5IRCD 1P9RA 2GILA 4MQBA 5FUYA 1RRFA 1P3JA 1KSFX 2IUTA 3BRWD 5D3MB 2FZLA 4ZO4A 1KI1A 3ZD7A 1W36D 5CIWA 2Z4SA 4D80A 5BXQC 4BFZA 1R0XA 1RJ9A 3V4RA 3U7EB 3LD9A 1KO5A 4PHTA 5B30A 3BS4A 4OI2A 1KI6B 2V7QA 2QE7A 1W2HA 3C7KA 2HDNB 4EPYA 4KITB 5GVSA 1Z07A 5FBWB 2QQEA 4YXWA 4EPVA 3PEYA 4GT1A 1ZVQA 1M34E 3WNBA 1DADA 1S9DA 2BBOA 3HPRA 1DBSA 5JHHB 3KXKA 2EYUA 1QG4A 3GEHA 1Q57A 2C04A 1P4SA 2ZE6A 3C5HA 1HUQA 3KJIA 1G3UA 2Z5FA 3KXIA 3QF7A 4LJ5A 2ZRLA 4PC3A 3UATA 3ONWA 2DB3A 1TUEA 2B6HA 3L2OB 2X2EA 2X77A 4WXRA 3W8RA 2RKOA 1K5GA 4OHXA 3V00A 3FHCB 4B6FA 1NN1A 1B23P 2ZRIA 4Q1AA 1ZM3A 2IUUA 5KDLA 4AC9A 4Q1CA 2JATA 3OIYA 2LKCA 2AFIE 3R9XA 2HXSA 2KSQA 3T1TA 1N6IA 2FZ4A 2A5GA 3U2QA 3OEED 1DAIA 2OFXA 5EE5B 4GL2A 2WKPA 4PXAA 3U61B 1WF3A 1NKTA 2ONKA 1TAGA 4FMCF 4MDEA 1GKIA 4KV9A 3SOPA 1CJVC 2IYRA 3K70C 2AD1A 5KUTA 3T15A 4QFMA 2O8BA 3QKRB 2C8VA 1VG9B 2CK3A 4WW0A 1U94A 2B21A 3QY0A 3TW8B 3CRQA 3U7GA 3B9PA 4IDNA 2IYLD 2JDID 3SYKA 4BLTA 1E9AA 1Z0IA 5E7MA 4B44A 3VR4A 2ZE5A 5CJ2A 1LS1A 2K5UA 3ZH9B 4BFWA 1XMJA 3AVXA 3B1ZA 1M7BA 3ADKA 3CBQA 3H84A 3GLFA 1E9SA 3CH5A 4R2HA 1JAIA 2BCJQ 1MABA 2HYDA 2KWIA 3A8TA 4DVGA 4A1FA 4WIAA 4JVMA 4URZR 3KQHA 1NBMD 4L16A 3DPUA 4PC2A 2CLCX 5CLLA 1W36B 4L8GA 3X1DA 4HLQB 4EJSC 2IHBA 5CJPA 1OXTA 2CJWA 4C0LA 1U90A 2QA5A 4FINA 2BDTA 1X6VA 3CPEA 1ZUHA 4MYHA 2D3WA 2HYIC 1H8HD 3U6BA 2JAQA 2OZEA 4NBSA 2EVWX 2CJWB 4HDQB 3I5XA 1RVDA 1JR3A 4A2PA 2JASA 2FWRA 1XD2B 3EIHA 4UXJA 2PMDA 2CL6X 2B8WA 3SE0A 1EESA 2PMKA 1VYVA 2PX0A 3QVUA 3T61A 5E7JA 4TL8A 4G5QA 3O8CA 2R2AA 2ORIA 3SI7A 3BH7A 1Z6AA 2VTKA 4C7OB 4DRZA 1XD9A 5C2JB 2JGNA 4Z8XA 3QXHA 4F4IA 1IY0A 1XXHE 3DO6A 3M4YA 3FKSD 2P0EA 2AL7A 5GJCA 2BBTA 1COWA 2ZR9A
chains in the Genus database with same CATH superfamily
2I4RA 2JG3A 1NKVA 4S35A 3AR8A 5EI5A 5KYWB 1XZ8A 3C2QA 5T4BA 1Y6ZA 2MSLA 1OX6A 3EQ8A 4NFYA 1PG5A 5BNTA 4WLNA 3KD3A 1SAYA 3BD8A 1U7ZA 2P77A 4OHOA 4L78A 4DBZA 3ZK7A 1PLLA 1WMFA 2VK4A 5IABA 3C6KA 4PCUA 3SYRA 4GPTA 5CYPA 2X76A 4WKPA 1GL9B 5AW9A 1TDJA 4FYJA 1WSWA 1NTOA 4MRPA 2NZXA 1IBLB 1XZEA 1FRFS 2UZIR 5BQOA 3EEYA 2J0UA 3MT7A 4O4HA 1QUEA 5IVHA 3O75A 2D8MA 5IBCA 2CXOA 3HCEA 4TSFD 3AL2A 1U7PA 4Y6SA 6AT1A 1R2QA 3CJRA 1J09A 3S4YA 3IPXA 1M5RA 2WJZB 4ZI7F 4AX4A 1TK3A 3CPJB 5FUBA 3X1XA 5I7RA 2Q45A 3BJIC 4HAWA 4A3SA 3NWBA 1CQPA 4O4IF 4PHFA 5AVKA 3VBEA 4C0AC 3HVHA 3T5BA 2R62A 4FKBA 1NP7A 3FOZA 4LCEA 4O1IA 4Q19A 2MCFA 1GZ4A 2P1ZA 4YXFA 3QHPA 4Y0AA 4UOZA 2GKOA 2G7ZA 4LGVA 4ZVMA 2Y0BA 2I7TA 2PEYA 1FXSA 2VJAA 3L7IA 3SX2A 5H68A 1ADCA 2AB0A 3WNZA 5K0GA 4CIBA 1DO0A 5DRTA 4O1HA 3LYHA 4CF4A 4MYTA 1UZNA 4IJMA 2O8BB 2D2EA 4WACA 5JS2A 2KQUA 1FVHA 1VB5A 3KSZO 3BMNA 3REOA 4JR0A 5DRYA 5DCUA 2PHZA 3R44A 4BGIA 4KFCA 3OHPA 1TW3A 1K6XA 2JCBA 2ZUBA 5BWBA 1SOVA 3GJ4A 5JRDS 4BGDA 4ROSA 1DRVA 2CSUA 2RARA 3UHFA 1CDDA 2V7EA 3H8WA 1FNMA 1IBMB 3OKCA 3TRHA 2R5FA 1G20A 2OY0A 3E0XA 4Z0TA 4LPSA 2VCHA 1A5AB 1PR3A 2Z8XA 3O7WA 4V0NA 4RKFA 3HP1A 3RFXA 3TNYA 2D5AA 3I1FA 3F7TA 3FR8A 4ND8B 1A7JA 1PNQA 3NKVA 4GAEA 1V35A 4J29A 1C9YA 1Q0SA 3I53A 2VTBA 4JQOA 1E2HA 2JFWA 4MH0R 2QAIA 3GJ5A 1C0LA 1NUHA 1LLDA 2ETXA 2JJ8A 2QRQA 4RVCA 3S70A 4B6SA 1KEVA 1XAGA 2AJTA 1NY6A 1TZBA 5B1SA 3IUEA 1KRXA 3HJAA 5DBGA 4J0EA 2D59A 1FP6A 1NLMA 3EHEA 2EJVA 4S3MA 1B0AA 3SS7X 3T5PA 4Z9FA 3BRCA 4I5GA 1RQXA 3C5WP 4TLLB 2IWRA 1GQFA 2Q1WA 1EI9A 3GJ8A 1TQ2A 3L49A 1NNI1 1KQNA 4F2HA 4HNQA 1FYDA 4HWKA 3G23A 4OLHA 1ENYA 3KHTA 2ECQA 1JA0A 5A4AA 5DEIA 1Z5PA 3FR7A 3D54D 4R8SA 4KYIB 3RJ9A 4OEHA 2P6NA 3AB3A 2XWSA 2HUNA 3HEBA 5H3HA 4J16C 3S40A 4MO2A 1JT2A 2W6ID 4BNWA 4HDOB 3CG0A 3HGMA 1XVUA 3D7KA 3GGJA 4PE5B 3VM6A 4ECAA 4ENPA 1JWLA 2IZ5A 2DYKA 2EJTA 2YQ5A 3H16A 1EHCA 2B3DA 3E18A 4CHGA 2EARA 3OFNA 5BSMA 3K1YA 1Z15A 1OLOA 3SU8A 5K6AA 3O2JA 2FMTA 2J5KA 2ZUDA 2NLOA 2FKAA 5B6PA 1HNXB 3RC8A 3IL2A 1EUZA 4MQ4A 3GHHA 1KP2A 1ZS9A 1B6GA 4UBKA 4I7EA 1SXPA 3BWVA 1QPBA 3DSRA 4JBNA 5DN6D 3RBAA 4F4HA 3A6DA 3P5BA 1T3HA 2QX6A 4CKZA 3CVWA 1I0ZA 1Z8HA 4D8VA 4PC1A 4XM1A 1E79D 3HBMA 1KXJA 4NBWA 3FKSA 4C0BA 2G4LA 3O74A 1SHUX 3AF1A 4GH5A 2OKGA 4NULA 1J21A 4BLWA 4UPVA 4UHBA 1UC9A 2VYFA 3UK7A 1O5OA 1L1QA 2RHCA 3DMDA 4LF8B 1YHZA 1BS9A 1R64A 2V9ZA 1DQYA 4HVTA 3KYCB 1BH6A 3M4NA 5JW6A 1WMSA 2YICA 4UUBA 2H52A 3LA6A 3CRNA 4GSLA 4P1ZA 3ACBA 4S0XA 2IXGA 1M3SA 4ZT6A 2P5YA 1Y5MA 2ZWVA 5BNIA 4OHCA 4KN6A 4OP1A 3C48A 3NT4A 3KVVA 4DHEA 2HSZA 1ZQ9A 4C5CA 5JRZA 5LQJA 4UVGA 4FIDA 5DHAA 2C7QA 3PC7A 3Q3GE 3QV2A 4M1SA 2HMWA 2P4HX 5ECDA 3RTDA 4E31A 3R7FA 2ABWA 1Z3CA 5D2CA 3RJZA 1EMDA 3BXXA 2MYPA 2LIPA 3TD6A 1K7FB 1ZSYA 5JDCA 4DLAA 4CMBA 5K0BA 1XA3A 2C03A 4WADA 1EWYA 2XNDA 3IB3A 3LFUA 5CB0A 2E4XA 3IKVA 4KU4A 3WK7A 1EFVB 2BGUA 3ZYZA 3MK31 3NEPX 4URVR 2RE8A 1HM5A 1XK7A 2R87A 4XWTA 3VRHA 2PV0A 3G82C 8ABPA 3DBRB 1A5BB 1B6RA 1DBVO 5E9QA 4E94A 2FHSA 3C98A 1WPGA 3PUZA 3FYHA 3TSWA 3LVBA 3WQSB 2Q5JA 5EAIA 4F1JA 1SEVA 3LPLA 3HI6A 3GJQA 1P2DA 3EDCA 3GDWA 3OT1B 4PAWA 5IF9A 2O7NA 2QUBA 4UOQA 1K6JA 1X7XA 3I83A 4GXQA 1WXDA 3MCTA 1Z38A 1KQOA 4NARA 5ALUA 4EQ6A 2AK2A 4FYVA 2FJ0A 4JLAA 3JD4A 3WLAA 1HFEL 1KWGA 2DCUA 3JQ6A 3PGXA 1N9GB 1Y4SA 4OQQA 3RVOA 2V74B 1OAAA 1KEPA 2FWMX 2VG8A 5ALFA 1ZONA 2NUAA 1JW9B 4P0TA 4F9EA 5KNCA 3K9FC 2G80A 5JEDA 1NJ5A 1M33A 1GV1A 3JQFA 1PFUA 3GROA 2GAJA 3KZNA 1HLPA 1ZMXA 3AI7A 3O4JA 4IQ0A 3PUWA 4MV9A 3MJEA 4ZAYA 1QC5A 3LLMA 3GLTA 2PLWA 3OOYA 5ETJA 1ZQ1A 2XWBF 4AY5A 3HWX1 5IKOA 5J5CA 1X2BA 4B33A 2AV6A 4BPBA 2Q2WA 2IHYA 3G1WA 4JLWA 3F4BA 3WB2A 2XMDA 2OFFA 1K75A 1NVVQ 5DYWA 1IB6A 1SD1A 1HDIA 2DY1A 4BBPA 4WECA 4NCNA 4QQRA 4OI4A 3UF0A 5MGBA 4WNAB 4LW8A 3NOOA 3TCKA 1WL8A 3T9AA 3K2BA 1LPBB 4OJQA 5IJ9A 4MWTA 1Y3HA 2TMYA 3QZUA 1ZMRA 2C8JA 2HSGA 1N2GA 3IERA 3EPHA 5CA0B 3RS2A 1IVSA 2XAAA 2C2BA 4ZAZA 5AM1A 5F9HA 3DMRA 4JS0A 2D74A 4M1KA 1F8GA 2UZ1B 2AC7A 2NP7A 1CUFA 3I6QA 3W05A 3OIWA 3LGXA 3R5HA 1DX6A 5AFSA 3GEBA 2CHQA 3ET5A 1VZ2A 4OJKA 4MIKA 3V7UA 1KPGA 4KR9A 2C77A 3U4GA 3CE6A 5FV4A 2CKDA 3QEMB 4L9AA 4NEQA 3T4UA 2H51A 4DIBA 3VVMA 1J5PA 3CUSA 1Q0PA 1WSDA 5B4VA 1OHHD 3HB9A 3AV0B 5K0NA 1CU1A 4QJIA 4DV6B 1WXFA 4K1XA 3WRWA 5BVGB 2IY9A 1T9GR 1NI4A 4NZNA 2JH9A 3EMVA 4QPJC 4WERA 3GNTA 3M3DA 1ZJ5A 2AWOA 4DRXA 2G1JA 1IVYA 3IFSA 2PQMA 5CHYA 5EWJB 1E59A 4CCSA 1XPJA 3E8SA 3QLVC 1I5OA 1WJGA 4J07A 4J1SA 2ZJ8A 1PJ8A 4YTEA 5CFQA 3EUEA 2X0KA 3L8YA 4AN0A 4B3RB 4CMAA 1SKMA 1PL7A 3WFZA 2WMNB 3AOGA 3AHGA 5KINB 4FCVA 1FQJA 5HZKA 4HAXA 3CNOA 1SBTA 4LWQA 3ZDXB 4M1QA 5EZYB 1LK0A 5KNCD 1G8MA 1X94A 1B6TA 4BC1A 4I5FA 1GYQA 3RUPA 5K99A 4JU9A 4BLUA 1DIGA 2V7UA 2G9NA 1HKUA 4OATA 2COUA 1TJ3A 2CSXA 1J2EA 3Q0TA 3FRHA 1SOAA 2PWYA 5IJ0B 3R9WA 3C3BA 3DKVA 3ORRA 1R8XA 4GQIA 4JB8A 4W1SA 5DTQA 1U7DA 2HO4A 1CF4A 3EDQA 2R4QA 4EA9A 3ZKWA 2QQ5A 3R6WA 2Z8ZA 4N49A 4NS4A 4QXPA 1YV9A 1ORTA 3CUUA 3OI7A 4P3PA 4X1IB 3FJ1A 2IKSA 1QONA 2PNJA 2G9QA 4Y30A 4DL9A 4G8JA 2ZPTX 4ZRNA 1WMDA 1M1XB 1O96B 2BT4A 3F5MA 3MD9A 4K28A 1FPQA 2Z1NA 3U4CA 3GH1A 1LC0A 3I1IA 3VOSA 4NXNB 3CO0S 3IR7A 1S2NA 3DAPA 4HH0A 4RY2A 5ALLA 4PLTA 3QVTA 4PQFA 1CHNA 3AT1A 3OQIB 1ZI6A 3HNOA 4QYIA 3V8NA 3IQHX 4Y2RA 3HVJA 4HB4A 2E2WA 1P39A 3GVHA 2FSHA 4XM2A 3DAGA 4JUBA 1RZRD 1AF4A 1M6HA 2W22A 4N65A 3WNCA 1PGPA 4DCOA 4I4LA 1IN6A 1XLTC 1UMCB 3HZRA 5IKMA 3AXSA 4FBGA 4JJZA 1R6XA 1UM8A 2ZCVA 1CIJA 2AG6A 3S5JA 4RD0A 2CNOA 2R9VA 2ZVQX 4IG4A 4CT0A 1TYAE 3DYBA 4E5PA 1L3BA 2PUVA 4CMJA 2DH5A 3DNPA 2H8KA 3H2ZA 2CHEA 3LC0A 2AR7A 2CNKA 4E2XA 1W59A 1XZPA 3R4VA 1NRIA 1FPMA 4WOBA 5DI3B 3SXJA 1MC5A 2ZREA 5FNZA 3T7AA 5JDIA 3S27A 1A7AA 2XMQA 4EB6B 3NOQA 1KL7A 1MB4A 2QOEA 2VHZA 2FWPA 5CVDA 1FFWA 3O8BA 1YOVB 2X86A 4LHSA 1CDOA 2QTNA 3AJDA 1C81A 3DLIA 4NFHA 1SCIA 4OOFA 4EUFA 3I04A 3HDYA 3REGA 4H0CA 3Q7QA 1C41A 2ZG6A 2XYPA 1S8FA 3X1JA 4EMUA 1YWGO 2PFGA 1GGEA 3F8SA 4PO8A 1UMBA 4YQYA 1DKPA 2B34A 2PGLA 3FDJA 3AEQB 3L7LA 5FBHA 4B3DA 1T0IA 4YK7A 1W0KD 3I92A 4BO1A 5FADA 1KIMA 3LBIA 3RWBA 2Z9DA 3G0HA 3E8XA 3U26A 5MFZA 2WF9A 1H0HA 4HZUB 2IU4A 3VDNB 2FP3A 1G291 1IAVA 121PA 1L7BA 1KZ4A 4RQUA 2HN9A 3TO5A 5JMWA 3W5BA 4UNPA 2Z2IA 1RT9A 2NYUA 5A4IS 2G0AA 3IP7A 5L6MB 4R51A 2EJWA 5LKAA 621PA 1OAOC 1QV9A 2DQSA 4PYKA 5EHQA 5A3QA 5AKXA 1LPMA 1VLHA 2C5SA 1ZSNA 3IVAA 3KKEA 4IQFA 4JEUA 1RKXA 2JFOA 4NYMQ 2VF2A 1BH2A 3K1AA 4GPEA 4GZ6A 2W6JA 4LOJA 2QMEA 5D84A 1CW2B 3LWNA 2O3UA 5ITZB 3PC6A 5JMOA 2Z83A 2HA5A 4CI0B 4D9NA 2XT9A 1AS2A 4IWNA 4UTNA 4E14A 1GEGA 4JYPA 1PUJA 1T4CB 3JWJA 5IW8A 4EATA 5I4BA 3B48A 1H3FA 2GCOA 4CG0A 1VOTA 1Q1EA 2AFRA 3PS9A 1A9ZA 1RPAA 1O6BA 3KCQA 4TTRA 4BLVA 1WDTA 5BT8A 2BDEA 2FSGA 2XA1A 1MCZA 3NWJA 1EBUA 3H9QA 1R74A 1TKBA 4PAMA 2QVZX 4N3AA 1RWXA 4LSGA 4YCCA 4MV7A 2QJRA 5AKGA 1Z17A 1SVMA 4PAOA 2BFWA 1AK9A 3RUAA 2O8FA 2VDWB 2Y1FA 2PUHA 2C7PA 3EXEB 2JLWA 4Q4AB 4RTPA 3B82A 1DHRA 1POXA 1WXXA 3L8ZA 4HDRB 3Q7EA 4RHXA 2E5LB 3C0KA 3MG9A 7YASA 5L3VA 4RQAA 1NXTA 1A2QA 2C92A 2HQ1A 2ZTUA 1E2EA 1Q22A 4ZTUB 4Q4AA 2XZOA 2D1SA 3TGWA 1G3QA 6ADHA 4IUYA 2DBVO 2HA4A 4KO2S 5K3FA 2Z6UA 3L4SO 1P80A 2OAGA 3A37A 4HN2A 4LMPA 3ZDZB 2ADOA 3RFUA 3W79A 1TJ4A 1CE8A 3ND9A 3WP0A 3P9NA 1TEHA 1RRCA 1LVUA 3AR5A 1JJBA 3DVLA 3MGBA 1EAMA 2CUTA 3E2PA 2FGKA 2Q4TA 1YF3A 2OLKA 3FVQA 3HACA 3NANA 1G59A 4ZIRB 3NM4A 4NFLA 4OQMA 3EMDA 4YAUA 1N2ZA 2DPHA 1RAHA 3P71T 2GPNA 1MAHA 1Z5OA 1MD9A 4MX8A 4MQUA 5CT9A 4D25A 1RKVA 2TSYB 4B35A 1CIPA 1OH7A 3QE0A 2RAFA 1KI8A 3K73O 4DFDA 1E1LA 1V7PC 1OLXA 4UZSA 1AC5A 2H92A 1XQVA 3D31A 4G5RA 3RH0A 3U3JA 3G1UA 2IVZA 5C80A 1OVGA 4QFCA 3ONEA 1Z62A 3QW4B 4TWRA 1F9AA 2FZ5A 1JR4A 1PFVA 2C5FA 3FXAA 1K5DA 3I5UA 3N8DA 2BMWA 5IJ9B 2GBIA 2OFWA 4GNRA 5ESDA 1QMGA 5C4IA 3NHRA 5AW0A 2FXVA 4UNNA 2IHUA 1VBFA 4P92A 3DBLB 3V8VA 3H13A 1HA3A 2QY6A 3H1TA 2ZS7A 4ARUA 1R3DA 4HL6A 1QNLA 4A0GA 3F9CA 5AOAA 1UZMA 2Q1SA 3ZK8A 1DAFA 3SX0A 1RR6A 2QW1A 4BKRA 2FUG1 4V3CA 2WK1A 3R0VA 1YR1A 2AJLI 1CERA 2FSPA 4WJKB 3WTBA 4QBFA 3WIDA 1UXHA 2VHYA 2O20A 3Q41A 3L0CA 4UULA 2Q07A 4A0FA 3K0SA 2CF5A 1T29A 3Q9LA 2A1UA 4XAQA 5EEHA 3NGLA 5LLSA 4QBKA 1FS6A 1GA4A 3DUFB 3D3WA 4IHJF 1WBDA 4CIWA 5C8YB 2PGDA 1G9SA 2QSYA 1FQWA 2CMHA 4BNTA 3WICA 3PD1A 3GFSA 1XXHB 4NJOA 1V9CA 1GN8A 1ZHOA 4QG7A 2HSWA 3A4MA 3D3WB 3IMKA 2WWFA 1FYVA 2AC4A 3A0RB 1WZUA 1U0JA 2GHRA 3OLXA 3V80A 3W8NA 1KEUA 3F90A 4CTMA 4QKQA 2I91A 1EFUA 3GARA 2G1AA 3CO5A 2HMAA 5K4GA 5E4TA 3H2BA 2QZSA 1H5QA 1NV9A 2NIPA 2WD7B 3LLVA 2NQ2C 1I4WA 1Z0JA 2Q21A 3IURA 3HKEB 3O8QA 3VDXA 5HKBA 1T26A 3QYFA 2Y6VA 2WFLB 2XWPA 1IWOA 3QUAA 4BKOA 5TLSA 3VZDA 1YR6A 4DV4B 1XPUA 1A04A 1D6MA 2LRHA 2YJGA 4N4AA 4RORA 2OZPA 3GU3A 3IV6A 1Y1QA 1NVEA 2IEYA 4OH1A 5EJMA 2AJCA 3A1DA 3LCJA 4WZBA 4UHFA 3ITNA 1RLMA 4DC0A 1BE8A 1SKBA 1DBWA 3TIVA 1TMOA 3QPWA 4EKYA 1O97C 2EKQA 1H1LA 4LXYA 4M8LA 3WSWA 4G85A 4N0PA 3EPKA 3Q85A 4A0RA 3FDZA 2EZUA 2GM5A 1ZRMA 5AQ1A 2AOUA 3R3HA 4Q7EA 5TEVA 3D7RA 2XVYA 3IP3A 1GN9A 3OLYA 4MS3B 4NMXB 5DTRA 1CJKC 5E3JA 2ST1A 2F62A 2EXXA 3D4BA 5COAA 5AKJA 1NW6A 1SUBA 5LOVB 4YACA 5TT1A 4MQFA 1N6KA 6NULA 3BEDA 4BX8A 4RXMA 2VR1A 1RJGA 4NBRA 1MHTA 2JI4A 3UC5A 3ZJVA 3KEQA 3UMJA 3OFSA 4CEIB 5AW1A 2J87A 3NHAA 2QUZA 2WHRA 2OXTA 1DC7A 3WSVA 4OA5A 4HG2A 3QGMA 1Y7HA 3GEDA 2CXTA 2XCTB 2QD1A 5AICA 2IXAA 1ACLA 2FUEA 3NGMA 3Q10A 1NR1A 2VIIA 4LVOA 4I1VA 2ID7A 3UHAA 2ZVPX 2O8CA 1EU1A 1YVUA 2QF7A 4L8YA 4F04A 5B2EA 4CBVA 1YNSA 2VHEA 2Q5FA 1Z6QA 4BNXA 2QE7D 2WB4A 4QRDA 4HEA6 3JQ7B 4N6GA 4PBTA 4K46A 1XZGA 5IT0A 3WB1A 5JCXA 1ZBDA 2PX3A 2O8CB 1KYZA 4HYQA 4CL0A 4H3VA 1NN0A 5LZ2A 3HJNA 2CV1A 2EEPA 3MOSA 4B4DA 4Y2YA 2BMFA 4OKNA 3EC1A 3PBKA 4PFQA 2W0MA 4UNRA 2C78A 5GY7A 2O59A 2RBGA 4B48A 4AQ7A 1SKYB 2V7TA 2YQZA 1AN9A 1IXSB 3P9KA 3ZJ4A 3WKCA 1BWQA 1V8PA 5FLKA 4PIPA 4Q1EA 2VLBA 3O84A 4B2LA 4Y0NA 1Y8RA 4OV6B 3KETA 1R4ZA 1A3CA 1E2FA 4R41A 2M6LA 4WUVA 2CYAA 3MWEA 1ZUD1 4MUKA 2BAGA 4G86A 4J90A 4UXHA 2FEMA 1JAHA 3IEXA 3N39C 1OLSA 1HEUA 2ZRGA 1AKWA 2CDAA 4MYDA 3RV3A 3DL4A 1GOTA 1XNHA 2PK3A 3UXEA 3VYUB 4C4OA 5KHLB 3AETB 4ILEA 5G3YA 3VU0A 4P4LA 4GSYA 2BFCA 3TPFA 4Z1OA 4EG5A 1KBZA 4ITRC 2XUHA 3EGXB 4S1VA 5IZCA 2KBFA 4RNDB 3GZJA 2X7XA 1GLVA 3RK4A 3BG5A 3GGCA 4DADA 2G83A 5ED4A 4G81A 5FBRB 5EZQA 1XTSA 3EOAI 4UPEA 5AK6A 5HWSA 5GONA 4K8OA 5A5DA 3ILHA 4TV8B 4F7DA 2PS9A 4COOA 1Q7EA 3TLXA 4RTNA 5GJBA 3ZCUA 1VL8A 5EP4A 5IK2D 3EQ2A 2FMKA 2NZJA 1PVDA 1CR6A 2XLBA 1EFTA 4IIHA 1RRMA 2ZAGA 1OBFO 4HWPA 5L4NA 3ENKA 4OA8A 4J43A 4X44A 3RC2A 1OY1A 3KELA 1XZLA 4V02A 2VRWA 3RLIA 3VJLA 1LW7A 3A6KA 4KR7A 5I3CA 4RD2A 1RQ7A 3QXJA 4BX3A 4L4XA 3O03A 5G1NA 5KSWB 5I8WA 2X5NA 5E0KB 4MR7A 4YMSA 3TN7A 3U9LA 2DWUA 1GU1A 1OXXK 2AZDA 5DO9A 4OK6A 4DJEC 3O92A 3B2EA 4MW0A 3DOEA 3KL2A 3K31A 4AZWA 5GINE 4WAUA 4Y2SA 5DNVA 4BEWA 3OH8A 10MHA 2QYSA 1XEXB 3CLHA 2ZETA 1PIWA 4EA6A 4OHUA 4NZZA 4Y1FA 3T35A 1T5HX 5KSYA 3PNVA 3U1BA 1KTVA 5DCWA 2A5JA 2RG7A 4YR7A 3O4RA 2ZJYA 3C7AA 3OLWA 4WCFA 3UK0A 5JQGA 4C30A 5KSZA 4G5OA 4JYMA 2IQIA 1VPLA 2CUKA 3A25A 1U3FA 3QWBA 1T5LA 4DUPA 3K70D 4I66A 5CA1A 1JR2A 2DPLA 2P9YA 2FRDC 3N70A 3DMTA 3PFNA 3K92A 4H7FA 4U2EA 3TTWA 4A4DA 5BWNA 1WBBA 2NZUG 4PHCA 5ALHA 3KYDB 5A05A 3OCVA 1F9EA 4ZPXA 4R2KA 3HA5A 1I3LA 4KOEC 2HF8A 1XL1A 2IW3A 2VJMA 4BLRA 1J1IA 1P73A 3BGOS 5AW4A 3DE6X 3NZEA 4UM5A 4Q82A 4F85A 4N82A 4UREA 4BNLA 3NV7A 3UH1A 4C76A 3RVDA 1SUFA 1YFJA 1A2KC 3KAQA 3FNEA 2AA3A 3GVCA 1ZNXA 4LRXA 1TEVA 3ZHTA 3DE1X 1HZZC 4EHDA 3E9MA 4BYGA 2ODBA 3FETA 4XVUA 5MF6A 2QAGA 2RK3A 1JH9A 1HE5A 1SB8A 1YI1A 2I87A 4M99A 4LYAA 4CEIA 5A5FA 3D4PA 1SXQA 2WG2A 1ZSVA 2XQVA 3MQ4A 3NBMA 1H9BA 1VLQA 3UMFA 1OLXB 4G24A 2QG9A 2YHIB 1KMCA 2BPOA 2E4YA 2O2XA 3TR5A 2OCKA 2VJBA 1YULA 4RVSA 1FFDA 1MQAA 3VPSA 5DULA 1QF7A 4AJIA 4TXLA 2IF2A 4OL9A 4ITVA 1QH0A 1LI7A 4EAAA 2J0SA 2WOOA 4OLJA 4JEMA 1N75A 3RVKA 2QT0A 2ZDGA 1CUVA 2EGUA 3R3WA 4PXSA 4FS3A 1Q16A 1YMUA 3A1UA 3ABRB 3AHIA 3LC1O 2B0JA 2XEDA 1J0DA 1E2UA 2H63A 2HBYA 4IIXA 1JJIA 1PYDA 2HD4A 4ZI7A 5JJKA 4M0PA 1ZVJA 2J32A 1ZGGA 3RANA 3BMNB 4HSGA 4LI0A 1UANA 4Q66C 1LH0A 4QNMA 4MQEA 3OSUA 4L07A 3OEEA 3UAVA 4UD2A 1D1PA 1A4RA 4CV3A 4PFJA 3CGGA 5F23A 3W9SA 2KX7A 5B7PA 4K6KA 5BN5A 1YQXA 3LO5A 1CJBA 1EEHA 1PX2A 1M2HA 3ZJUA 3DFUA 1B16A 1P2GA 2VTVA 3HCRA 2Y99A 5KYYA 4CF6A 3HLYA 1OF1A 2AXQA 2GAFA 4CR6A 3EVZA 1XJWA 3UJCA 2QZ9A 3NONA 3LG2A 4AY2A 2XIJA 8ADHA 1GCUA 1XBTA 3QOYA 5EMMA 3OUZA 4CKBB 2R48A 2A5DA 2ZPUA 1XCGB 4E30A 4KI0A 4YASA 1NXXA 2B69A 2RH9B 5F98A 1MAAA 2F9FA 1FP4A 4GECA 3O8RA 3NM5A 1LDMA 1XFDA 3U17A 4B2PA 1QVWA 4AKIA 3RSOA 4KREA 2FUNB 3KHSA 4JJ7A 5CCXA 1SC9A 1OOEA 5EFOA 1QHXA 1NW8A 2FPWA 2ICAA 3M6XA 4HFRA 4ZVPA 3TL6A 3ZLVA 4B7XA 2CV2A 4PS0A 2B92A 1U81A 1PK8A 4CEHB 1S01A 1OYYA 4C1NA 3GXOA 4O5OA 5TS3A 5JCJD 2YX1A 3P9IA 3PDIB 4QNRA 2PDAA 5TPZD 4LPKA 2R7KA 3Q5GA 1ORWA 3CFYA 4UPDA 1I9CA 5CA0A 5EJ6A 1IOZA 1EEXB 2OAQ1 1TC1A 5IK2A 2GJ8A 3H4VA 1Q1NA 3HUEA 5U4XA 1IN4A 3PQ7A 1WTAA 3BSFA 1QCYA 3ZI0A 5BNZA 4L74A 1X8JA 3LNTA 1RHUA 2JA1A 4BFSA 1JEQA 2AOUB 1D1TA 1T9AA 2ZYTX 4QL3A 4YHBA 2Y8EA 3MWLA 2CNDA 4FUTA 5D01A 5EPOA 3NHUA 3E0QA 1KDVA 3L05A 4JI1B 3WWYA 4CV2A 1MV5A 3HCBA 4DDTA 3UICA 3FPLA 4GXRA 4MHSA 4C3OB 3FRIA 5B6JA 2QXTA 3H0EA 3HUDA 1U0FA 4MWCA 4DBVO 5EYPB 1LNSA 3ENQA 2BFFB 2QT9A 1V4VA 4EMSA 1F6DA 3CX6A 1DP4A 1O1YA 5D1HA 2FP4A 1A8SA 3C70A 4J0CA 3DE4X 4JGGA 1DLJA 5LCXA 3DZHA 4ZT2A 5BV8A 1JA1A 1WEHA 1EQ2A 3NBKA 4X91A 4YXWD 3IHTA 3L43A 4FB5A 5L3QA 2YINC 3K2EA 2O8DA 2FUKA 2INGX 3IVCA 4GMXA 5DGIA 3HADA 4JELA 2Q3LA 1EGMB 1A5SB 4H3HB 3EFBA 4MWBA 4CL8A 2FZGA 1RI1A 4O8ZA 4ZOBA 1K66A 2CVZA 3U9TA 3UWKA 2VEDA 5E9AA 1T1GA 3B78A 1GJRA 1T5DX 1ZAKA 1N2EA 1VPTA 4H0NA 2B83A 5FKJA 4A2CA 4FHGA 1JFFA 1CNEA 1H22A 1GLNA 1L1RA 2C2GA 2L2QA 1ZKDA 3DBRA 2WYVA 3KTDA 3BWYA 3M5PA 2P4EA 3QUTA 1XU7A 4ZCMA 3P32A 5DLDA 1EDEA 2DG2A 1ECLA 1OJLA 1LD3A 3ANNA 3RS9A 1FIUA 4LBYA 2ZSKA 4OXYA 1EX7A 1TM2A 4JEHA 4R3NA 4RZ3A 3TTUA 4F84A 1MC8A 2JBAB 3E70C 1MAUA 2FH5B 5ALJA 4QYTA 3S7TA 4CQJA 4NRDA 1RKUA 3FSEA 2UV8A 3EY9A 1HQCA 3R3ZA 3AERA 2C97A 4JT4A 4UJ5A 5CT5A 1PR5A 2J9RA 4ZYTA 1NYTA 3CSDA 5HJEA 4K2HA 5AJZA 1Y3IA 4RZUA 3RRJA 4CFZA 4U7DA 1E2JA 1MQ9A 1SY7A 2DH6A 1YJ8A 3IUQA 3LZCA 1E9EA 4XWOA 3H2KA 3IAM1 2XCLA 3UYKA 5E8JA 5A0VA 2OGUA 3ZE0B 3ICCA 1TT5B 4NHEA 4KI7A 4DCGA 1AE1A 5TIIA 4P4SB 4KNWA 2EP5A 1ZL2A 3WKDA 4F11A 1IM2A 1P5HA 4OFWA 1OT5A 2PX8A 2SNIE 4TVKA 5A9TA 5PNTA 5P8WA 1W19A 3SSOA 4O4IB 1KEZA 4E15A 4I81A 2AHRA 4RDHA 3VNRA 3V7WA 1OWLA 4FMDB 4PWYA 1Q83A 1CC1S 1N9KA 2VHJA 2QTMA 1YJQA 2EERA 3U3RA 1JZQA 1F8UA 1U0RA 4IQ4A 3LCCA 4AY6A 1B8VA 1CUWA 3EHDA 1P1HA 1WXWA 1RCTE 5LDGA 3DJYA 3SM3A 1DSSG 1IU9A 5CVEA 4FB4A 2GKSA 2G1UA 1SR8A 1VHTA 3PHIA 3AFGA 1T4GA 3AESA 4D3SA 1LX7A 1WULS 3GJ3A 1RLIA 2NYAA 4WL0A 4EKGA 2W8BB 2DKNA 1HE4A 4FGUA 1HQDA 4YJ2B 3OEHD 1SXHA 5MDHA 2ZE7A 4GW3A 4MKHA 1WW2A 2BIFA 4FYMA 4B3CA 1FU4A 1EFAA 2NP6A 2ZRFA 5JNVA 1W9HA 2D1FA 3C8DA 1W5TA 4ZVQA 3B6KA 3C3MA 5HIKA 3PT5A 1JEQB 2BKVA 1ZXXA 2YZNA 3I1YA 4KQIA 2SICE 4WCVA 3OD1A 1K5HA 4PG4A 3FDIA 3B53X 1PW5A 1CUUA 2OOKA 4OYLA 4D0GA 2VNSA 4R8RA 1PFKA 2UYCA 3LUBA 4K86A 2P4QA 4QZVA 2R60A 4ZYZA 3X2SA 2ECKA 1X1EA 1TU0A 4AG6A 3FFTA 5IT4A 4BJ3A 1KZ7B 1IZ0A 3KSDO 4S24A 1KZHA 4C0XA 4EJSA 4F6CA 1ZVKA 2J08A 3DKPA 4D9HA 4U2KA 1PEAA 1EGAA 1AU9A 1CY2A 1S7CA 2QSJA 4MVJG 3CQ9A 3E9NA 4R2JA 5T57A 5JAUA 4M9QA 4PWZA 2ZCJA 5AKKA 4IS2A 5L3RA 2BE7A 5IXSA 3SS9X 2HRQA 1IUOA 3UGJA 2PUTA 2IIVA 3NWOA 4NCJA 5LA6A 2YYZA 1QQBA 3SQXA 4ND1A 5AVJA 2OZLB 1OFIA 1LLFA 1YHYA 2AG5A 4QTTB 1QLHA 3LXXA 5BN4B 4DTCA 1AXRA 3BWDD 3DCYA 4XSGA 4XASA 4G2NA 2DXIA 2FW9A 4D44A 2UYOA 3MGAA 5K09A 1X3LA 2AJ8A 2E87A 3MOGA 1Q0HA 4WVFA 3ACDA 1E79A 1VE1A 4RLFA 1MG0A 2IOYA 1WPRA 1Z26A 3KLMX 4JOCA 4MGZR 4FC7A 3PF8A 1N9GA 1Z12A 1Z5GA 4XWYA 1P9NA 4TXNA 3H4MA 2PGOA 2GRUA 1VLMA 3F47A 2P90A 3KZCA 2G88A 1T9ZA 4IDEA 5CX4A 1EWRA 3RKUA 3T0FA 1NBME 4EIWA 4NZ9A 1WZCA 4EI9A 1UAYA 3EXFB 4JJKA 2CDNA 3TNJA 1UOOA 1ZNWA 3GFBA 1QBKC 2MU1A 3ZZ0A 4JYZA 1RVV1 2RI0A 2Z09A 1U8UA 3BRSA 1U28A 1R0ZA 2C3PA 2G28A 3IHWA 1DV1A 1TCBA 3PQCA 4YLYA 1A8QA 1K9SA 3P9PA 3UENA 3WMXA 4MNTA 5EJAA 3QX3A 1E9DA 4MUGA 1XD2A 3TRJA 4QNNA 1XFAA 4JGBA 2ZJ0A 1DAOA 1FOEB 4REQA 1KU6A 2IEBA 3VR5D 5GZ6A 4D42A 5KTRA 2C9ZA 1H6BA 1OPXA 3ETJA 2VS1A 3AHDA 1PL6A 2P5SA 1SBNE 4CEJB 3LL7A 3E35A 4ARCA 2WNHA 1BXGA 5IVPA 4ZMSA 5ARBA 2NV6A 4FHCA 5JNSA 1S2GA 3U5ZB 4OK3A 4LYJA 1QVRA 2FG5A 2GEJA 2YNMC 3DTNA 5AW5A 3FNQA 1TLFA 3VR5A 5BWCA 1B42A 1F2TB 4R7TA 2FHPA 4Y2UA 5ADVA 5K7SA 4QYXA 1JLLA 1IUKA 2PLNA 4IXNA 1BXGB 4GOJA 2QTHA 2AZTA 3BE4A 4WBNA 3FUWA 3ROKA 1Z18A 3CH4B 2QP3A 4TMFA 2Q27A 2PGNA 1WR8A 1JEOA 3BK7A 3FAZA 1QOQB 3K9HA 4X8LA 4M21A 5AVZA 1ESCA 4MW6A 5CG2A 1W85B 4XFKA 1IXYA 3RABA 4QEKA 3GRCA 1Q7RA 3GA0A 4Z49A 1UZAA 4OBBA 3B5IA 3HJHA 1M76A 4RADA 2XXAB 4O2LA 2QK4A 3E61A 1AD2A 3KVOA 2FU5C 1GSAA 2HDHA 2DE0X 2WJWA 3KXDA 1YONA 5EE0A 4IDQA 3H17A 2V0NA 1MIHA 1NIJA 1T0JB 3HYCA 3F5FA 4XUCA 4EJMA 3T9EA 4X93A 2C20A 1AB6A 4K9QA 5EKSA 1EHYA 1QRSA 5BQPA 4MVJA 1KNXA 2PX2A 3KDSE 4AB1A 3N07A 4DW8A 2ANBA 1EFLA 1EUDB 1VPVA 1OV4A 1AKVA 4BLQA 3OX3A 3DWGA 5JVDB 3KQNA 5C34B 4HD8A 2QRZA 1QGAA 2HF2A 2X42A 3MCUA 4L6AA 3QWAA 4QD3A 3A3KA 3JVUA 1Q0QA 2IX9A 1JAXA 4D9FA 5I3ZA 3IV7A 5LQSA 3HFGA 3C7CB 3IELA 1E1QD 1VI6A 4LNAA 4OMCA 1E64A 2IS1A 2PKRA 4HQ0A 3I34X 1OXUA 4IY1A 5BUCA 2I7VA 2VJDA 3G68A 4TKUB 5AVOA 3SC4A 5JAMA 1LLQA 4JVNA 4CUZA 2CLKB 3CZ9A 4PYIA 1DLIA 5BN3B 3D3EA 3FYDA 3E6AA 2SECE 3BXEA 3S8EA 1MT3A 1QDUA 2XX3A 1ZJ6A 1D3AA 4JOSA 4C4YA 1G8SA 4ZQEA 2GHIA 5ERXA 2NQTA 4X1IA 5HE9A 1E98A 2JI7A 1E5VA 2CVQA 4Y6RA 4JI5B 3I32A 4D1YA 1P8AA 3HSSA 3PVCA 2OD9A 1JSCA 3HLKA 4IVPA 2VUIB 2X0IA 5CM9C 3DD5A 1CS0A 4LJ6A 1Q7CA 4DQLA 4O2AF 2P40A 3G2NA 4JLKA 3TM4A 4NIMA 1JDUA 4JP5A 2AXPA 1HDRA 1O4VA 1GSOA 5EP1A 1SVSA 2GHTA 4R8LA 4GIBA 4RV4A 4Y1RB 4BX2A 3ISTA 4DMRA 1UJ4A 2V0GA 2J5QA 1ZK2A 4RSRA 3SP1A 3RVQA 3U37A 5AVXA 5JIBA 2ZYDA 3QM1A 3ZNQA 3S2UA 4PBRA