5DI9A

Crystal structure of hrio2 nes reverse mutant peptide in complex with crm1-ran-ranbp1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
208
structure length
208
Chain Sequence
VQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding nuclear protein Ran
publication title Structural determinants of nuclear export signal orientation in binding to exportin CRM1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 63
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5di9A00
2ZIAA 5KNDA 2CHGA 4Z51A 3OF5A 4Q21A 1T8TA 3LO5A 4LC0A 4CZ2A 3UANA 4CEJA 3VU9B 2NZ8A 4CYMA 2GRJA 3U3RA 1FTNA 3NBXX 4FMCF 5KNCA 1M1YE 1S0UA 2N1BA 4DUGD 4NYIQ 3U7EB 1M8PA 3QF4A 1RYFA 4B33A 2CVFA 4RSGA 2WHXA 4PQFA 5DISB 3PQCA 2QTHA 3HYTA 4OHZA 5F9HA 1QHIA 1MKYA 1FTSA 1PUIA 1T9HA 4F92B 1MO3A 1IXZA 4JBWA 3LRPA 1DBSA 4EPXA 2WSSD 3X2SA 1OIWA 3RYTC 4HAUA 2C5LA 1SVKA 3GJ7A 1LS1A 2XITA 3NBYC 4YC7A 3QI2A 3VR4A 1SQ5A 3DEFA 1KI9A 1FNNA 5TV2A 2ZJ2A 1JXMA 5D3MA 1Z6YA 2AHOA 2BKUA 2JEOA 3WYAA 1SVIA 3SBEA 4RFSB 4TZ0A 2H57A 3K0SA 2K5UA 4MGZR 2J7PA 2VP2A 1OYYA 1QF9A 4AIIA 4C0BA 1R8SA 1TF2A 1CBUA 1QBKC 2FN4A 2JA1A 2OSBA 2V7QD 2W2XA 4V0ME 2ZXUA 1G7TA 1KI2A 1J2JA 1W4BA 1EWRA 1W48A 2OCYC 2FEOA 2JJ1A 3T15A 1LV7A 3AVTA 3I1FA 1ZIOA 4FN5A 4JYCA 1U81A 1DO0A 1ZU5A 2FSHA 2WWIA 3QG1A 1DG3A 1UM8A 4PR0A 5P21A 3RDPA 3U2QA 3C7KA 3RRMA 4OHVA 4E03A 3HPQA 4ZCLA 5JECA 4LRWA 5AJXA 1PLLA 3TAHA 5E4FA 2NIPA 3U3JA 3U5ZB 2VF8A 4CF7A 4XOIA 1DOAA 2R6GA 4WVFA 2OBMA 4H9GA 2ZSBA 5FBRB 1C1YA 3MG9A 4JBXA 1HEIA 1G8FA 2P3SA 4NCHA 1NY6A 1GSIA 1AJEA 2VP6A 3L8ZA 4HLUC 5BN4A 4NKRA 2EFEB 4KSCA 2ZANA 5CYPA 3BGWA 2W83A 2HCJB 2QP4A 1T6NA 4OI4A 1T91A 4DSTA 2FX3A 1N6PA 4LDJA 4XTCS 1Z07A 3CW2A 3UWOA 4GRAA 5A5GA 4IXNA 2W0MA 4TLAA 3P26A 4Q1AA 1UKEA 4BFYA 2X1VA 1IN5A 2R8RA 4PSVA 2FNAA 1VYUA 2OILA 4JKYA 2OFWA 1DE0A 4JSYA 2GEUA 3VR6A 1PLJA 5G3ZA 2YWHA 1Z83A 1J90A 1OFIA 3LW7A 4P4SA 4OQMA 4Q02A 3I8SA 4LGMA 1IJEA 2XOKA 4RD1A 2CK3D 4IOLA 1FQKA 4AD8A 2C9CA 3VKWA 3UPUA 2LWIA 3AF0A 2FEMA 1ZW6A 1Q12A 3U44B 1G3RA 2R6FA 1P62B 2FWRA 5L8VA 4BFXA 3LLMA 1PV4A 1MABB 3DPUA 4D0LB 2LKCA 2QA5A 4LYAA 4TLCA 3BORA 5HE9A 1CR1A 4OI2A 2VH5R 2GF0A 3CRQA 3SYNA 4RZXA 3TR0A 4AKEA 1LVGA 2PBRA 3QUSA 2XZLA 1G9XA 4UNNA 5LPNA 3A58B 5KSPA 2QMEA 5EE3A 5LBIA 4DC9A 5KPDA 3DM9B 3R8CA 5C18A 5EZ6B 4JLMA 3QXXA 4ZIRB 2ZSAA 3IPXA 3OIUA 5DGXA 3U6KA 1I2DA 2XTNA 4B3CA 2GCPA 4HB4A 1W2GA 1Z5ZA 2VSFA 1LY1A 4ITRC 1Z2AA 2QPTA 4Q4AB 1E79D 3FFAA 2ODBA 1NG1A 1W47A 1FX0B 3KQNA 1NMYA 4LUCA 4E5UA 4PC1A 4UNQA 2V4ZA 3ONWA 1P9RA 3GJ3A 3HR7A 2ZRBA 5SZJA 2AD1A 1E6CA 1HA3A 2WICA 1E4YA 4KYUA 4ARZB 3PV0A 2B92A 1T3LA 1K6MA 3NDBB 5AWFC 1TQ4A 2BVNA 1R0WA 2ZETA 3L8YA 4YXWA 5IHPA 2ZR0A 3KKMA 1VCIA 3AVPA 3ZD7A 4IVRA 1RRCA 4GOKA 2Q9CA 5LD2C 1WDTA 1FPMA 4Q4LA 5JRJA 1YR7A 3A4LA 1S9DA 1SXJC 2RHMA 2HLDD 2PX3A 1SHZA 3A1UA 3AKEA 3QE0A 5GJBA 1C9KA 2PT5A 4TYWA 2FFQA 4D26A 2AD5A 2FU5C 2V55B 4B3BA 3RWMB 4US0R 5HPYB 2WWWA 4ESVA 1GL7A 1M6NA 2JDID 4DCVA 3GLGB 1G8YA 4UJ3A 3E1SA 3RS0A 3BFVA 2QUZA 3BS4A 3DZDA 2GVDC 4V02A 5K8IA 3CNNA 4F4JA 2QE7D 3HJNA 3MMPA 2FH5B 2WJHA 3IHLA 1SXJB 721PA 1BYUA 4KVAA 4FMDB 1COWA 2H18A 3SEAA 4BFUA 421PA 2ZU6A 4LBYA 1N3BA 1YRAA 4A6XA 3UWKA 5JI2E 2A2ZA 2ERXA 4DLYA 2C95A 2FFAA 2X2EA 2ZS9A 1KDOA 2Q9BA 3ADKA 3AH8A 3K0AA 4BZXA 1KY2A 2VIIA 3BWDD 2EFCB 4MYCA 4NL4H 3I73A 2QGNA 2GEDA 2IYYA 2ZI3A 4Q7JB 4G5OA 3TSZA 1N0WA 3WMFA 1CR2A 1E2DA 4OL0A 1BIFA 4XVUA 4P32A 2W58A 1E2LA 4TWZA 2WZQA 2IUUA 3FYHA 3W90A 1R6BX 3GQBA 4A2QA 4PO9A 2JLYA 4I1VA 4PO1A 4DUGA 4JL5A 2IEYA 2BEJA 3AP2A 4I4LA 4P4UA 3NG1A 1SVSA 2GCNA 3J81k 2AK2A 1LW7A 4TYPA 5FBWB 4N3NA 3AF1A 3OE7D 4ESHA 5HR5A 2CHVA 3UMRA 2Q21A 4DIEA 3K0FB 2ODWA 3T35A 4UXIA 4GT1A 4MH0R 4NMMA 4OYHA 1M2OB 1L2TA 4I1OA 5FTKA 5KSZA 2NO6A 5AUNB 2EWWA 3BB1A 2R6CA 1S3GA 2F43B 4QGHA 5JBQA 2DWOA 2KSQA 1CJKC 1VG0B 5HE8A 5C46F 1E4VA 2QAGC 2C78A 2IS6A 4QJ3A 4BFWA 4YONB 3GLIB 2JLZA 4QFMA 1D5CA 4RD3A 1Y63A 3CKLA 4JL8A 1G3UA 5EE5B 2CNWD 3QKSA 1KI1A 3T06B 1U8ZA 1I4LD 5FPKA 2G77B 1E3MA 3L0PA 2RMKA 2P6NA 4N1AA 2XX3A 5FBVB 2IUSA 2B7CA 3AVQA 5G40A 2ZU0C 3TE6A 2BCGY 2CCGA 3FTQA 1WBBA 5E7JA 1E96A 2QAGB 1OPXA 5EE1A 5EJEA 1Q3HA 2C9YA 2O8EB 4L9SA 3AVOA 1TF5A 4TTRA 4PZLA 3B8HA 2V1XA 3CR8A 4Q4HB 1AGRA 2F3TA 1XXHB 3TGPA 1QVRA 1XEWY 3QF7A 1R7RA 3FMFA 2HDNB 1FUUA 2CCKA 3DOEA 4QJ5A 3W6OA 2RGEA 5DN6D 3ZVLA 3B6EA 4A8JC 4CW7A 1M7GA 3HP1A 1GZSA 2PMKA 3RRYA 4NDZA 4PHGA 4RVCA 1QHGA 3SI7A 2E1RA 4N0EA 2GEVA 2QP9X 3SNHA 2GA8A 3CRMA 3UIEA 3V00A 5JHGB 1IBRA 4LYFA 3G0HA 4HAXA 1Q0UA 2BJWA 1NIPA 3AF4A 2NO1A 3PCRB 2ZAMA 4ABYA 4ASUD 2J87A 4DIDA 2AX4A 5EP2A 2CE7A 5CB6A 4QL3A 3TSWA 4A8JB 3UMSA 2HYDA 4EJSB 2CK3A 4YDHB 4B2PA 5EP1A 2ZM5A 1Q20A 4UXHA 2B6HA 4OHWA 4BUJA 2BV3A 3THYB 1RVDA 1GNQA 5AK0A 1Q57A 4OKSA 2A7QA 4PHHA 1MH1A 1YZKA 3ECCA 4DDUA 3LBHA 5CB8A 2VLIA 1N6OA 1M34E 3ADBA 5AUQA 3QKRB 4CEIA 3FMOB 4IFBA 4C30A 1ZNZA 4E09A 4C2TA 3HPRA 5DNYB 3LNCA 1R0XA 2F55A 3CH4B 3REFA 1E1RD 2LCFA 2QMOA 4MUBA 3TW8B 3VKHA 1JI0A 4IEEA 5LDDC 4Q48A 1JNYA 3TKLA 1E9CA 4JLNA 1KKMA 2ZROA 1W49A 1KDRA 1P2UA 1NSTA 4B3FX 1E79A 1Z06A 4HZUA 2B8TA 2XGJA 1PLKA 3JVVA 4KLZA 2WWHA 4AK9A 4O2LA 1D9XA 2ZREA 1W36D 1OLOA 1X3SA 2RGGA 3EC1A 4G5RA 5AJVB 1UDWA 1A2KC 3CPEA 5EP3A 1FP7A 4ZKDA 3RRNA 1KO1A 2IYSA 1P72A 2GXUA 1QG2A 5J4HA 4HLQB 3PVSA 2AXPA 4LBZA 3KFVA 5IT5A 2CJWA 2FE4A 4Q18A 3D6TB 3GJ0A 4MYHA 1J70A 2G88A 1S9HA 5FUVA 3FHCB 2VP9A 4H1VA 3CZPA 3MLEA 1E0JA 1Z22A 4Q1FA 4JVMA 2BMFA 4C0KA 1GL9B 1OIXA 2OV2A 4K81B 2IT1A 1OB2A 4MRPA 4U5XA 1VECA 3MCAA 1U2RA 2ECKA 2BM1A 2FFBA 2GNOA 1R8QA 2MMGA 3F0TA 2GAAA 1PUJA 4GP6A 3Q8XB 2JDIA 1LFDB 4HAVA 4LYHA 1RRGA 1SULA 4F4CA 1DS6A 4NCIA 3HDTA 2ZRPA 4KO8A 3LXXA 1KHTA 3EZ2A 4PPGA 2QE7A 4W5HA 2GJ9A 4KFTA 1MO5A 4GOJA 3RSOA 2ZYTX 1A7JA 3WBKA 4F38A 4MDEA 1VTKA 1AM4D 2D7DA 2ZI4A 1OXXK 1N5LA 2BBOA 2O0HA 3A36A 2QPAA 4Q47A 5FPSA 5K8UA 3LDAA 2IYWA 1MR3F 4A1FA 1G291 2GXSA 2QT1A 3CF6R 4LK2A 5SZIA 4ILEA 4CDGA 3PUVA 5CM9C 2XNDD 4G5QA 1NLYA 1US8A 4Z1MD 5CLLA 2H5EA 5JSZB 2OG2A 1UADA 3KKNA 2QI9C 1JPJA 3BIFA 3EX7C 3OHMA 4GOXA 3ZGXA 5G53C 1CJTC 2ZRJA 5EXXA 4A36A 2QEQA 4H1UA 2C77A 1GTVA 3W5JA 5E7IA 1JALA 2WJVA 4RKFA 3GLHB 4QM6A 4ZKEA 5BQ5A 3IIJA 4PO8A 4TLEA 3CB4A 3K0CC 4KITB 2NO7A 3WRXC 3MFYA 1MRSA 2Q3HA 3K09C 2NMVA 4XWAA 3HYRA 4MYUA 3U4QA 1MOZA 3C14C 4V0LA 3MAAC 2KBFA 2ZRNA 4M1WA 1UKVY 2KB0A 4RJLA 1N0VC 2BKEA 3B1YA 2IK8A 2Q3MA 5CYOA 1SXJD 3QIAA 4YQFA 4JMPA 2GAOA 1K8RA 2J0UB 2ZTSA 1YZLA 4GMXA 3FKSA 2R6AA 2F9LA 3KZ1E 3VX3A 4MRVA 1HH4A 3RNLA 1B0UA 4Q7KA 1GUAA 4YDSA 4QNMA 1KSGA 5IDVA 2Q6TA 3KJIA 1P2SA 4B6FA 2CNWA 1CKEA 1TQ6A 2OZEA 1I4TD 5A4JA 4UQOA 3ZVMA 3JVUA 8OHMA 4PAMA 2O8FB 1TTTA 4LV8B 2A30A 2PJZA 4KXFB 3ICEA 1E2PA 4DEXA 1IY0A 4BLRA 4DLZA 1XMJA 2ONKA 4V0KA 4M4SA 1JXOA 2E87A 4D4JA 2BCJQ 3QEJA 2QBYA 3FGNA 4NYJR 4TTPA 2PMDA 4JJZA 4TL6A 1G7SA 4M0LA 4WAUA 4URVR 3AP3A 4HZIA 4LJ6A 3QNUA 1CR0A 5DN6A 1ZUNB 1HTWA 4D80A 1NVXQ 2GETA 4F4IA 1II8A 5CIQA 1MO6A 3F3YA 1UDXA 5K8TA 3FDIA 4JZKA 3WXMA 3CPJB 3AM1A 1VMAA 4B73A 2JIZD 1V43A 3N5CA 2GJKA 3FE2A 5FUWA 1G21E 3I4LA 4US2R 3KXKA 2C98A 1AS0A 2G6BA 2FMXA 4QHYA 4AC9A 3X1YA 3GEIA 4Z8XA 5KOYA 1R10A 2REOA 3M6AA 2GJAA 4G01B 3T1QA 1OH5A 4MGIR 3BH0A 2NG1A 2AL7A 2VBCA 1E98A 1L8QA 1ZNXA 5BYJA 4LZZA 2VQSA 1E2FA 1ZMXA 3TVDA 1ZCAA 1ONBA 4NZYA 2MSEB 3THXB 1E2KA 1KDTA 1E9FA 1NVVQ 2I4IA 3TQFA 2P2LA 1UBEA 3N2IA 4D6PA 1NI3A 1WBDA 3DKVA 4XVRA 1WXQA 2QM7A 3Q9LA 4GPTA 5B2ZA 4B3XA 3VTKA 4MQBA 1G6HA 1VIYA 3GJ8A 1RFLA 3B1VA 2FG5A 2GTPA 3EASA 2UZIR 3QXSA 1UFQA 2QROA 4HUQA 1YE8A 1ZAKA 4YMTA 1E1RA 1XEXB 5FI0B 3MGCA 4DCUA 4CT5A 1HUQA 4XSHA 4LHVA 1KI7A 4KV9A 5FOSA 5DE3A 5JJIA 2D74A 3SJAA 4DKXA 3A1TA 3AUXA 4HAYA 2Y8EA 2HYIC 2WAYA 4MYTA 1T3HA 1RW4A 4JVSB 1HYQA 4ERNA 2PZEA 3ZS8A 2DR3A 2ZYUX 1X6VA 2CCJA 4GP7A 4X8OA 1M7BA 4HB2A 3W3ZB 2HT1A 2HV8A 1YR6A 5HKKD 3UG6A 1U0JA 4BLTA 3Q5DA 1Z6GA 3KL4A 2VHJA 3U6BA 1CS4C 4B43A 1OF1A 2FDCA 3B78A 3RS7A 3EIQA 1ZD1A 4Q1CA 4D4MA 1OXUA 2F1HA 4XD7D 4JLPA 5J40A 2VHUA 4FIDA 2HT6A 2FOLA 3CM0A 3OEHD 2ZYVX 1YHNA 3GLFB 4DSNA 3VKGA 3IEVA 2CBZA 3CO5A 4QJ4A 2FSFA 3DZ8A 3IPYA 1KMHB 2VHTA 3KJHA 1EFTA 2J0SA 4A82A 3AVUA 5FTJA 1GL6A 1GP2A 3T5GA 3GJXC 1Z08A 2W6ID 4C3ZA 5E7MA 1S2MA 4DLVA 5L3SA 1F2UB 1N5IA 3CONA 3W8RA 1FNMA 2B8WA 1JR3D 1S3SA 1NIJA 1XF9A 2EFHB 1TL7C 1XPOA 4RCZA 3EWSA 1ZM4A 3A4MA 2IF0A 4KBFA 1IN4A 3RSLA 5DI3A 1GRRA 3AF3A 3C5CA 4FCVA 1FX0A 2ZRLA 1LS6A 4BEBA 4URUR 4MGYR 2ZE7A 3H0KA 1JB1A 4L16A 3KTAB 3B13B 4G5GA 4QG7A 2WIBA 3U7FB 2YNMA 3FHOA 3R9IA 1Z47A 2O8CA 2C99A 1XPRA 1KJZA 2WKQA 4QGFA 4Z1MA 3A1SA 4JLOA 3KDSE 2NO0A 3VHLB 3RLFA 2OM2A 4EFMA 2IW3A 1XD9A 4KI0A 2IS4A 2ZR7A 2X19A 2Z4SA 4OJKA 3V4FA 3IKJA 3GEHA 4LHZA 3BBPA 4LY6A 1NLFA 1S8FA 4A92A 1JEEA 1KK2A 1S1MA 2WJYA 3LX8A 4IEIA 5CK5A 5BN3A 4AI6A 5FI1B 4B32A 1M74A 1QZXA 2IYZA 3ZH9B 4OHYA 3IIKA 2RHDA 1QHXA 2VP0A 4B75A 1G3QA 2FA9A 2N46A 1L4YA 2VSOA 2W6JA 3B1WA 4PAQA 3I61A 1NKTA 4R9UC 2O5VA 3CRVA 2OE2A 4D4LA 4DSUA 1P61B 3AVYA 2GZAA 5CITA 1WP9A 2OBLA 2ZSFA 4LYJA 3GJ4A 3L0SA 5DO9A 1YU9A 1AQYA 2H7VA 4DHEA 4EQ6B 5HCNA 3B5JA 1E99A 2J1LA 2CE2X 2RGNC 4CRWB 4UXJA 4TQUS 3BH7A 2ZE8A 1GKYA 1XRJA 1G8HA 3L0IB 3ND8A 3T1VA 1P2TA 2Z43A 3SJCA 2ZI7A 3W34A 1ZNWA 3SE0A 5FUXA 2I3BA 1YZTA 3S1AB 3EIHA 4F7WA 1E9RA 2A5GA 1SZPA 1Z29A 1IXSB 1H65A 2JASA 2JLSA 1OJLA 2VL7A 3DOFA 3Q85A 3LXRA 2FFHA 2WKRA 3SS8A 5JFGA 1F48A 5JCZA 4DZZA 3GFOA 1WMSA 2D3WA 4HDQB 4UNSA 5FTNA 1XD2B 2XXAA 3EPLA 3WP0A 1I4DD 3T12A 4A0RA 2VO1A 2ZRMA 3LBNA 5KSYA 4FWIB 1XFAA 4EPTA 5JJLA 1ZNYA 2H8KA 3SQWA 3MWJA 1W4RA 4WZAE 4I81A 1U8AA 1FZQA 2UVQA 1X1RA 4KVGA 4ZDKA 3RWOA 4NYMR 3GP8A 5BN5A 1P75A 1AQUA 2J45A 1W2HA 4DRZA 5HCIA 5L3QB 3AVWA 3KXIA 1IOZA 1HT2E 1YKSA 1H8HD 1G18A 2PEZA 4G0NA 4JLDA 3NVAA 4BFVA 3QSYA 3A4NA 1F2TB 1XEWX 1N6NA 2W00A 3TSOA 3W9YA 1XB2A 4QM7A 1XPUA 2YZ2A 2BMDA 2REXB 2D62A 1E0SA 1CF4A 1NLZA 2FF7A 1Z0AA 1Z8FA 1Z3IX 3TRFA 4ACBA 3SQXA 1RJ9B 1YRBA 3KJGA 4QC2A 2EFDB 4L9WA 4IDQA 4Q9HA 3DMDA 4HUTA 3EZ7A 1N6HA 1EG7A 4TMWA 4HYYA 4TMVA 1VPLA 2HCBA 4CEJB 1JR6A 2IHYA 2F6RA 4A2PA 2R6DA 1NBMD 4LJ5A 1T5IA 2VHCA 3A6PC 1VCNA 3A37A 2C2HA 3ZQJA 3QF4B 1P5ZB 1PZNA 2RCNA 2XSZD 3QEOA 3IBYA 1XJCA 4NP6A 1L4UA 3ADDA 3TUZC 3EPHA 3JZAA 5H70A 2ZSEA 5KPJA 1G4AE 2BMEA 4KYIB 2ZRKA 1KSFX 2AWNA 2Z6VA 1Q1BA 3E70C 5C4GB 1Q44A 5JLJA 1QHSA 2QMUA 1SKYE 4PX9A 5C4MA 2KJQA 3GJ5A 4GZLA 5D3MB 2J3EA 1Z0FA 4QHTA 4W7SA 4DWJA 2QU8A 1XTQA 2IXEA 4I99A 4LI0A 4DJTA 4M1OA 4GMDA 3TJZA 4NCNA 4D0NA 1AS3A 1KO7A 1UPTA 5LD2B 2FZLA 5C2JB 5HKKA 5DHFA 1JQJC 2QT0A 4Q9JA 3KUCA 4WOPA 4DDVA 1EESA 3WP1B 1G17A 2HXYA 1TPZA 2V8OA 2IYXA 5TXGA 1EFUA 4TL8A 4XD7A 1TEVA 2IYLD 2QMHA 4NH0A 3PG5A 1DAEA 4LV5B 1G8GA 1G5RA 4NONA 3BXZA 3EZ6A 2I1VB 1GKIA 4C0AC 4DDWA 4IVQA 3NIBA 4A0FA 3K70C 1KNXA 1UBFA 1NJFA 2WPDD 1KIMA 1VG1A 2JGNA 1AKEA 4FW9A 1W0KD 4RCYA 1FMLA 2W6IA 4XJXA 1NN5A 2O8FA 2YOGA 1OB5A 1IN8A 5CJPA 5KTYA 4A2WA 2QGZA 4PZYA 3B2EA 3ZVRA 5FOUA 3DVLA 4PPFA 2IYQA 4NYJQ 4HLCA 2H92A 4O0MA 4URXR 4PHTA 1SVWA 5B58C 4F93B 2GXQA 3T34A 3DL0A 2WSSA 3K70B 1YVDA 1RYHA 4KHZA 4LHWA 2NGRA 2F1JA 3AKCA 3BRWD 1D2NA 3C4JA 4QBFA 1Z6TA 4DLRA 3AVXA 3GJ6A 2DWQA 2XJ9A 2AR7A 2FPLA 1I2MA 1D8TA 3OEED 3P1JA 1Q1ZA 1VCMA 4F91B 1GFIA 1Z2CA 2FGKA 1W0JD 3D8BA 4P4SB 1AIPA 4RFVA 4DSOA 1AZTA 3EIEA 5FR1A 4CEHA 5K8LA 2JJ8A 1P73A 2D2FA 5C1BA 4M1YA 2XZOA 1E2NA 4A9AA 1M7HA 2V7QA 1EFRD 1NMXA 4C0HA 2WWFA 4GBMA 2CL7X 1Z0DA 3B9PA 5FR2A 4BRWA 1N0UA 3CLVA 1XTJA 1P4SA 2YINC 3DMNA 1Y3AA 4Q1BA 5DSZA 3F5FA 3RS3A 3X1ZA 5KSOA 4IJMA 4LJAA 5GJVC 3BERA 4ZPXA 1RE0A 1XZPA 2R44A 1ZUIA 3CNLA 5AJYA 3THWB 3FPAA 3PIRA 2GBLA 3N2EA 4DT1A 2HJVA 2QY9A 3NXSA 3PEUA 3ZZTA 1XP8A 1A5TA 3AGQA 5EE9A 4P33A 3KFXA 4Q4JA 2WWYA 1MO4A 5GVRA 1UEJA 2PH1A 1DAFA 1VYVA 4O3MA 5GJWC 4C7OB 3SHWA 1QHHA 2CLSA 2EW1A 1XNJA 3FMIA 4AWXA 4Z8YA 2ATVA 3SDZA 3TH5A 4BPBA 3AVVA 4U02A 4ZI2A 2F1RA 3EAQA 1FFHA 4B44A 1LNZA 2ZJOA 1P3JA 2P65A 5FTMA 5TMPA 4NCKA 1E32A 2C96A 5EE0A 1DELA 1XWIA 2V6JA 2RGDA 1KJYA 3NH9A 2O8BA 2BEKA 2CL6X 1DARA 1E9DA 1OH6A 3GLHA 2WOOA 4TT3D 5FTLA 3BOSA 1Z0KA 1DO2A 2Z0MA 2AKYA 1CR4A 1VIAA 1ZM9A 3ZZUA 1QRAA 2HF8A 3EWAA 4ZCIA 1RKBA 2YJTD 4DLTA 3LLUA 2J7KA 1H8HA 2CEAA 4DXAA 2OFXA 1J7KA 3PUXA 2ZYWX 3I72A 3CUEF 2O8DA 2J5XA 2G1KA 1ELOA 3TK1A 1HT1E 1KJWA 3R7WA 3TQCA 1XTSA 5SZKB 3ZIAD 3FHTA 4A6PA 2DBYA 1B23P 2BBSA 1P6XA 2ZRHA 1FQJA 1OH8A 3K0AB 121PA 3U3MA 5HZKA 4R7ZA 3ASYA 1HQYE 2G9NA 3TBKA 3SOPA 2CLCX 4V0NA 4AG6A 3L0OA 3U3OA 1ZM3A 5HZHA 2V1UA 1GOTA 4PPQA 5GADl 4NBSA 1KI6A 1NBMA 3KUDA 2DFKB 4LPKA 1J99A 2YKGA 1HE1C 1J8YF 4R2IA 3AEZA 2NPIA 5SZHB 4MRSA 1SVMA 1CU1A 4FMDF 5FFMA 2J0VA 2RB4A 1OE0A 4Q1DA 5F9FA 4TN1A 2GK7A 3PITA 3K9HA 3OIYA 2P6UA 5KHOC 1JJ7A 1CRPA 4B35A 4KODA 4BASA 2HLDA 2ZS7A 1G64A 4DLSA 3KQLA 3MSXA 2ZE5A 2VP4A 1YZQA 3H86A 2OAQ1 1EK0A 4FWTA 4LWZA 1XTKA 1KO5A 2IXFA 1N2CE 2H1LA 3PENA 4RZ2A 1GAJA 3U60B 2YHSA 5G41A 2G3YA 1NN1A 4XVQA 3I5YA 2JLRA 2FV8A 4Z54A 1YR9A 1F60A 1U8YA 1X86B 3AGPA 1JECA 3MWKA 2CHQA 2O0JA 4JLJA 2VSXA 1BKDR 1G7RA 2JLXA 2HJGA 1NG9A 4D4KA 1VG8A 3QKSB 3PEVA 4R2HA 3QPUA 5JS7A 2NTYC 1T0HB 1AKYA 1QVAA 4M1MA 1ZC4A 3RC3A 2ZRAA 3EC2A 4TZ6A 2ZJYA 1PJRA 3OIVA 1KNQA 4M9QA 4E07A 1KAOA 2QQEA 1D6JA 1NN3A 1RPZA 5J5CA 3B82A 4PTLA 3HU3A 1G16A 2DYKA 3A1VA 6Q21A 1LB1B 2KE5A 2WPDA 4YMSA 4C9BA 4M1TA 1W1WA 5FPYA 4RD2A 2F3RA 1P9WA 5DYIA 1ZJ6A 4YMUA 3RS5A 1KZGB 3IIMA 5EXTA 3VNVA 2NQ2C 1N25A 2BDTA 2NOAA 3E5HA 4IVPA 3OE7A 4JLBA 5A0FA 4BFSA 1N6RA 2WJIA 3DKPA 4LOAA 4TL9A 1T4GA 3U3KA 2ZITA 2RAPA 4OK3A 1FL9A 3IQXA 1ZM7A 3N70A 2JLWA 4HAZA 4TSFD 1U9IA 3NTUA 4B47A 5J4LA 5F98A 4GDFA 4BQSA 5H68A 4DLWA 1R5OA 3TUIC 2ZJAA 1O87A 4DDTA 3ZZ0A 1XU4A 3QXHA 1W44A 1CJUC 2IS2A 1N6LA 3OEEA 3MUFA 4FMCB 1AN0A 2EFGA 2YWGA 4IDHA 2GCOA 821PA 2A5JA 2CDNA 2J7PD 4C0SA 2VHQA 4I1UA 1KI4A 2REBA 5JJKA 5AR1A 5JRZA 3FB4A 1T3SA 3F8TA 2JJ1D 4Q9IA 5TY0A 1EFRA 1RRPA 1QG4A 3OAAD 2ZR9A 1G1MA 3NBZC 4S2EA 5CK4A 2PCLA 3QVVA 1YR8A 1U90A 1CXZA 3IDQA 1A4RA 3VU9A 4FCTA 4CEIB 2QG6A 4M2LA 5IK2D 1KDPA 4DCNA 3CNOA 2RGCA 2QZ4A 4PC6A 1P9NA 2JJ2D 3ZD6A 2F9MA 1SVLA 2F7SA 1OW3B 3LVRE 2OAP1 5FOWA 1ZP6A 4PSAA 2ZJ5A 2RGBA 1TUEA 2RKOA 2Z83A 1W7AA 2GWHA 3K8YA 4DCTA 2VTKA 4HZUB 5ANRB 1NSFA 3K70D 1TAGA 1U98A 4LJYA 4XIGS 2DWPA 2YVUA 4IDNA 4M21A 1OFTA 4LHYA 1N5JA 2WIAA 4XH9B 2E9SA 2O52A 2R9VA 2WWGA 4JLAA 1DTSA 3HWSA 1XDBA 4NHOA 4TYYA 2CJWB 4U00A 4GZMA 2DHRA 5KDDA 4K8OA 1HE8B 2MSDB 4B74A 1Q1QA 1A82A 3MWLA 4ASUA 4RFSA 1Q22A 5JWHA 2IX3A 3P4XA 1CJVC 4JVNA 4WZBE 3VR1A 3NHAA 4JBYA 3T1TA 1Z6XA 4W5JA 1JBKA 3BAFA 2GILA 3H1TA 4RKEA 4TMTA 1P60A 5CLQA 2ZAOA 3LAWA 4HEJA 3P32A 1WE2A 2YC4C 4HSEA 2EYQA 3LH5A 4DLXA 1D2EA 2IUTA 3B1XA 4YMWA 3UK6A 5F2EA 2ORWA 5JI3E 1IJFA 4Q00A 1XCGB 1K5GA 2OESA 4B3GA 4BWYA 3K53A 2HEIA 2Z4RA 5EUMA 2UKDA 4BRUA 1R2QA 5JS8A 2ERYA 5J4YA 3FFBA 3AP1A 3A1WA 4ACAA 2ZI6A 4UKDA 1G5TA 3IO3A 3ZS9A 2FSGA 3M0EA 3ZIAA 521PA 4D81A 1EX6A 2D2EA 5GJCA 2Z5FA 4B2LA 4C0JA 2MMCA 1AGPA 5HTKA 2OHFA 2R62A 4AY2A 2QTFA 3TNFA 4AYWA 3ASZA 1KO8A 4EDHA 4PSKA 1DEKA 1HQCA 3CWZA 1G41A 2EWVA 2FSIA 4LHXA 3IO5A 1MRNA 3X1DA 2ZRCA 4RZUA 3GLGE 4YXWD 1LF5A 3SR0A 4YLGA 1KMQA 3FMPB 4LJ4A 3FOZA 1R0ZA 4J0QA 5BXQC 1R0YA 2A9KA 5KDOA 2ZRDA 1TNDA 5FL7D 1G19A 1FW6A 1KK0A 1WB9A 1RRFA 1XMVA 2ATXA 3IILA 4FD2A 4NCJA 4O2RA 4XWOA 1SXJE 2J59A 5JCPA 3W5IA 1NVWQ 1S96A 1OFHA 3GEEA 2IXGA 4QNRA 2QSYA 4ZO4A 3AKYA 3U44A 4PANA 1MABA 5M04A 1L7VC 1X8JA 2WJGA 1CLUA 1HV8A 3OFND 1S4QA 3U4QB 3ETLA 5J4VA 4JLVA 3O8DA 1U0HC 1E2HA 3R20A 1ZM2A 2VYFA 3DO6A 4PQRA 3DHWC 3NEYA 3NDPA 3RANA 2Q0HA 4G5SA 2TMKA 1KYIA 2OLJA 3WHKA 4ZI3A 4U7DA 2IHBA 4ZIRA 3AV0B 2DFNA 2W2VA 3CX8A 4WIAA 2G0TA 4MKFA 4O25A 4Q4AA 2ZUBA 1AZSC 1KZ7B 2ZI5A 4P0TA 4Y0VA 1IM2A 1NKSA 3TAUA 2IWHA 3SYLA 1OH7A 2QAJA 2A5FA 1YQTA 2EU8A 3H4MA 3LW8A 4BFTA 2XNDA 1KTVA 2Q9AA 2YYZA 4NU0A 3IQWA 4ARZA 1EFCA 2GHIA 4QBIA 4IKEA 1U94A 2EQBA 4IOKA 2AWOA 3IHWA 2GZDA 3C41J 2QBYB 1OXTA 2QSZA 5FBLB 2AFIE 4MITA 4EAQA 3LQQA 3Q5EA 3TR5A 2QN6A 1N5KA 2X77A 3KQHA 2HUPA 2MSCB 4QBHA 3G82C 2BWJA 2ORIA 3LA6A 2DFLA 1TADA 3GLIE 1II8B 4TYQA 1UEIA 2PX0A 1E94E 1GNRA 1GIAA 4KFRA 4FMBB 1DADA 1XX6A 1IONA 2GJ8A 4TSFA 2YOHA 1JEDA 4X8MA 4EUNA 1VHTA 4ZDJA 1AK2A 3GLGA 5TB5A 2OCAA 1D2MA 2AKAB 2EYUA 2PZFA 5LB2A 3Q3JB 2CL0X 1XTIA 5CDFA 3SYKA 2GZHA 2A5DA 4OK5A 3KQUA 2ZJZA 1ESNA 1GRNA 1KI3A 1IHUA 1SXJA 2OLKA 2RGAA 2ZQ5A 3EA0A 3O8BA 3SBDA 4AURA 1TQ2A 5JHHB 1KKLA 4S35A 4OI0A 2DB3A 4JSTA 4JLKA 1BS1A 1XXHE 2XTZA 4Q1EA 4EPWA 3AKDA 5KU1A 3GFPA 4C0LA 3C8UA 3WBJA 1DPFA 1GDDA 1RZ3A 3OAAA 5F3WB 2JLQA 1IAQA 5KDLA 1ZD9A 1ESMA 1TUIA 4GNKA 3WMEA 2AK3A 3M4YA 4G1UC 4A15A 4PFSA 4B76A 2IYUA 3VQTA 4BZQA 4X8LA 1W36C 3EW9A 4KSBA 1SKQA 1WRBA 2GESA 1GG2A 5IK2A 2OFOA 3BH6A 3W3AA 2IBMA 4HUQB 3TIFA 4B71A 4PPNA 4UJ5A 2PEYA 1KGDA 2GJSA 4KJZA 3KKQA 2JJ2A 4OK6A 4Q66C 4PXAA 1ANKA 2R65A 2F1IA 2ZSDA 1Q21A 2PZGA 4M53A 3WRYC 3VFDA 4OBEA 1NNEA 1SVOA 4BE7B 4MDFA 2OXCA 1II9A 3ZQ6A 1ZU4A 4LJ7A 3M1IA 4PC2A 3K0FA 4PZZA 2QRNA 5L3VA 2W0SA 4AYXA 4AKIA 4HB3A 1E2GA 2WBLC 2BIFA 2QTVB 1BOFA 2WJJA 3QBTA 1W36B 4FCWA 3W6PA 3D3QA 4QBGB 4QOSA 2JIZA 2A78A 2ZRIA 4JS0A 2XTMA 3K9GA 1ZBDA 2F43A 1J8MF 1Z0IA 3OIWA 4P31A 2EVWX 3UG7A 3ZYCA 4X8HA 1W5SA 3WYFA 2B7BA 3MJHA 3GLIA 3K0EA 4R98A 2ZVQX 3SHFA 3A8TA 2OO7A 2FZ4A 3B7GA 3H84A 3K1JA 1X8LA 2H16A 1FOEB 3IEUA 1E69A 1JR3E 3C15C 2OCBA 3QXCA 3LX5A 1PVOA 2PT7A 1R5NA 1RIFA 4BLSA 2V9PA 3SJBA 5AJWA 1QHYA 1SGWA 1ZVQA 2QAGA 4TMZA 1G5PA 1E9EA 4MA4A 3VR5A 2FJUA 1VG9B 4US1R 2O8EA 1Z63A 1OKKD 2JLVA 3WHLA 4RY2A 4V0MA 2QPOA 5L3SB 4Q4HA 3THWA 1UJ2A 2BBTA 1XXHA 5L3RA 3RS4A 3X1WA 1OHHD 1X1SA 1GNPA 4RZ3A 1NVUQ 3EZFA 2CVHA 1E2EA 4M1KA 5DI3B 2XJ4A 2CLDX 2DCUA 5JEDA 3LV8A 3SZRA 3REGA 4ZDIA 3L2OB 4C7OA 1EFHA 1ZCBA 1W4AA 1BYIA 5IRCD 2O8CB 4JIMA 4A0HA 4A0GA 2YC2C 1BMFD 1NY5A 1NJGA 3BFXA 3U7GA 4BLPA 1IN7A 3T1OA 4B3DA 3RABA 4KFUA 4PC7A 1JJVA 2N42A 1E2IA 4MRNA 4OQLA 1IQPA 1W46A 5G3YA 5EZ5A 4A8JA 3H2YA 4RD4A 2SHKA 3PUYA 1N6IA 3CF2A 4IXMA 1W5TA 2G83A 5FL7A 5FOVA 4EJSA 3PR1A 2J0QA 1KK1A 3CR7A 3RS2A 3ZVNA 2ZRFA 2BOVA 3THYA 5D3QA 5H1YA 2NPFA 3TLXA 3TVTA 621PA 4OHXA 2C04A 4D82A 1E0AA 3OEHA 3WNDA 1DAIA 4PQYA 3OFNA 3WYGA 5CIWA 3L43A 3ZDQA 1NMZA 5J47A 2GVZC 3L82B 3QKRA 4QGAA 1ZD8A 3CZQA 4LCBA 4CIDA 4EPYA 1UKZA 3G5UA 3P4YA 5FBQB 3AUYA 2W2TA 1NVVR 4L15A 1TU4A 3U61B 1XZQA 3SN6A 2CXXA 1JR3A 2QRZA 2ZJBA 4MKGA 2IWRA 1U99A 3I3SR 3KB2A 3ADCA 2IA5A 4WBSA 4N0DA 1YZGA 1KO4A 1G3MA 3HU1A 1G3IA 5JMTA 3GLHE 3QENA 4TYNA 2ZE6A 2IC5A 1KY3A 1TEXA 1OFUX 1P2VA 5KNBA 3EA5A 3VR3A 1E9SA 1UBGA 4GSYA 1R4AA 4AYTA 1LTQA 1E9BA 1DAGA 5GVSA 2XXAB 4FXPA 3ZLJA 5EXPA 4TQ9A 4Q03A 3C16C 3CF0A 2IL1A 3UMFA 1WQ1R 4CT4B 3QPVA 4B2IA 4DB2A 1X8KA 3FVQA 5DIFA 1KI8A 3C5HA 4BGDA 3RAPR 2QP3A 2WKPA 2YOFA 1JPNA 3VAAA 1E2MA 1XEFA 3PEYA 1OXSC 1E2QA 2IF2A 1XJ0A 1GRQA 2KBEA 5BW8A 4JKIA 5TARA 3RRZA 4PHFA 4NTZA 2XZPA 2ZUDA 5TDHA 1XMIA 4XWKA 3FKSD 4TMXA 3EPKA 4LBWA 3QY0A 1NBME 2PLRA 3ZJYA 3QVUA 1XJQA 1Q1EA 3IUYA 2BHRA 2AXNA 3VHXA 4DLUA 3FWYA 1F6BA 5UKDA 4L4UA 3SFZA 3WNCA 4LPSA 4Q7MB 2VF7A 4M9SA 2YWFA 2XAUA 4NYIR 2AN9A 4RD6A 2R2AA 2XB4A 1GITA 1NF3A 3FKQA 3HR8A 3UKDA 5JSZA 1UKYA 1KAGA 5JEEA 5B30A 1OT3A 4DEYA 3O8RA 4Q5IA 2QQ0A 3KXLA 4LV6A 1T5LA 3V4RA 5FH9A 1BH2A 4WXRA 4HDOB 2ONJA 1Q3TA 2I1QA 4BLOA 4JVLA 2JAQA 5DI9A 3EARA 3THOA 2XB2A 3R8FA 1YZNA 3I5XA 1OV4A 2FPMA 4EJSC 1KSHA 4WA7A 2OXRA 1FUKA 1FP6A 3K9NA 3KX2A 1QHNA 2HF9A 1W4CA 5AUOB 5LB4A 4HI0E 4LJ9A 3D31A 1UF9A 4CVNA 5H8WA 3RC8A 3QJYA 1CTQA 1G20E 2BMJA 1O3YA 4D2IA 3K9LA 4L8GA 2VRWA 2VP5A 1CRQA 4TL7A 5FPHA 3U7HB 2OEPA 2J0UA 3X1XA 1A2BA 3R9XA 4AKGA 4G3XA 1TF7A 2OUKA 3K0CA 3MWYW 2P6RA 5DLQC 3VMFA 4QKQA 1C4OA 5KUTA 3K09A 2V6IA 2BM0A 3SFVA 2PJRA 4D25A 2X2FA 3CRW1 3GD7A 2GF9A 2P0EA 1Z0JA 2QL6A 4M8NE 2BBWA 3BD9A 1GILA 2ANBA 2D06A 2V54A 2XNSA 4OQFA 1E1QD 4Q19A 3RVBA 1DAHA 3B1ZA 3LY5A 4EPVA 1JAHA 2WOJA 3PUZA 2BJVA 4IRUB 4Q7LA 3EXAA 4LC1A 4XTRA 4Y0AA 3W6NA 3Q7QA 1G6OA 3BFKA 1OKKA 4TLBA 1OYWA 2WWXA 4KLNA 2Q3FA 2ORVA 4WXPA 1VCOA 4URYR 4M1SA 3GFTA 1OHHA 2XSZA 4A4DA 4C0QC 3O8CA 1ZINA 3CIOA 2GDJA 1T8UA 1V5WA 2ZEJA 1U0LA 3CX7A 5KYKA 4HAWA 2ZS8A 1F3OA 5BYKA 2D7CA 1WA5A 3QQ5A 4OQXA 4QGGA 3DM5A 4UNPA 4EFLA 4YMVA 5BWMA 1HY3A 3WNBA 3PEWA 1WCV1 1K5DA 4HDCA 4V0OA 3TUJC 2WM9B 4DB4A 4WW0A 1CJMA 4OJQA 1BMFA 2G0NA 2P5TB 3CRRA 4P3YA 3AQ4A 4OI1A 3GLFE 2C9OA 3P27A 3BB3A 3NKVA 3CBQA 1XCPA 1R5BA 2DPXA 1DAKA 5CM8B 1YJ5A 1VYTA 4KAXA 4CEHB 1CP2A 3PUWA 1TMKA 1EGAA 2VPPA 3SJZA 1VDZA 3MD0A 2ANCA 4KBGA 4UNRA 1SKYB 4JL6A 5B64A 1H8ED 1XBTA 2GBLC 2JATA 3P20A 5EQTA 3VX4A 3THXA 4Q9KA 3GPLA 4JT2A 1MT0A 1CULC 5EP4A 2WV9A 3EZ9A 2V3CC 1VKJA 4BZPA 2GKSA 2AFHE 4PC3A 2LKDA 4BECA 4POAA 1HURA 4QRHA 4E22A 1VHLA 2KI5A 3NHBA 3QOFA 2IYVA 1ZRHA 4IDPA 4Q9LA 4KFSA 3KKOA 3LWNA 4URWR 1JQLB 1W0KA 3IGFA 1XEXA 2IEZA 4DT1B 1EX7A 4M9XA 1E2JA 3LQRA 4IOMA 4AKHA 3UATA 3QG5A 3I8XA 2A3RA 2QORA 4I1SA 5TVKA 4Q4JB 1SHKA 2P5SA 4B34A 5JWOA 4AG5A 3I62A 3BC1A 2JLUA 4DCSA 2WVJA 1UAAA 4W9MC 2H17A 3WMGA 1NP6A 3KQKA 3TMKA 1FMJA 1QHHB 3SC3A 3I92A 5CJ2A 1MV5A 1G4UR 4B6EA 2OBNA 5AJZA 3V9PA 4BLQA 3WY9A 2X8AA 2J41A 2GXAA 1T0JB 3NC0C 4NYMQ 3OZXA 4KU4A 2YV5A 1AS2A 5IF9A 3KKPA 2YWEA 4LJ8A 2HXSA 1OXVA 4C2UA 1W0JA 3W8NA 2FGJA 4ZCMA 2O8BB 3E2IA 5J4KA 2NO9A 4TLDA 4C4PA 3B60A 1RC8A 3BJIC 2B21A 5FUYA 5B57C 2W6JD 3NC1C 3LBIA 4TTQA 3RHFA 3VR2A 1AA9A 5FPTA 1JAIA 1EXMA 3NBFA 1ETUA 1Z28A 5DHAA 3T5DA 4BEJA 3GLFA 4GL2A 2BC9A 2QM8A 3QPWA 5ELXA 1CEEA 1KMHA 1E0KA 3NWJA 1EWQA 2OT3B 2WSMA 3QBVA 4TQAA 2O8DB 1OIVA 1F2UA 3EG5A 1GKUB 3GMTA 4MKHA 4EPRA 2ASEA 3R7WB 4M22A 4EKDA 3Q72A 1WF3A 2RGXA 5DH9A 221PA 3I32A 1KK3A 2VA8A 2CMKA 1N6KA 4ON9A 3B85A 3ND9A 3O47A 4CGZA 3ICQB 2FPKA 4PAOA 3KTAA 2ZUCA 3BB4A 1DG1G 3PFIA 5E3HA 4LX0A 1IY2A 4WZ6A 1G7CA 4JYBA 2O0KA 2ZPTX 1Z6AA 1II0A 4ZDWA 3TW4A 2IYRA 1QDEA 1XTRA 3OESA 1KI6B 1E9AA 4LBVA 2IYTA 1XD8A 1UBCA 2VEDA 4HATA 4GFDA 2QENA 2XOKD 3LVQE 2IS1A 4W5WA 4NPHA 4GI7A 3SU8A 3D7MA 3Q7PA 1IXRC 1KSJA 1DVRA 4DVGA 4QHSA 4IDOA 2ZRGA 2ODNA 1GVNB 3JZMA 3NEJA 5FOTA 4TT3A 4TMKA 3CX6A 4M9ZA 2ZI9A 3CH5A 2PLFA 1TU3A 3AB3A 1CIPA 4L5BA 2XEXA 3LFUA 3MRSA 3QXJA 4FI3C 4JT4A 2JCSA 2ZVPX 4MKIA 4MUAA 1NL3A 2RH5A 3KJEA 4EQ6A 2WAXA 3QKUA 5EUQB 1GWNA 4MGKR 2C03A 1ODFA 1F5NA 4BFZA 1A1VA 3HU2A 5KO2A 4EFNA 3B9QA 3BK7A 4RD0A 2L0XA 2DY1A 1XCMA 4ZV4A 2PL3A 3S1AA 2WTUA 4V03A 1D9ZA 2KWIA 2ZJ8A 4DBLC 1P7CA 1E1QA 3MJRA 3NH6A 1US8B 3KB1A 5E95A 2RGNA 4P4TA 2D4HA 2G1JA 5JWRA 2WMOB 1U9IC 3VNUA 4HB0A 4XSGA 4HLUA 2A5YB 4Q01A 4IW3B 1TQDA 4K46A 1XD2A 3GCGA 5EXSA 2UZ3A 1IN6A 2P67A 2OCPA 4NE2A 1LF0A 2J9RA 2NZJA 4II7A 4LSGA 4URZR 4R71A 5CDFE 4EIWA 1NRJB 3AF2A 3IBGA 2DFTA 1DAMA 1IY1A 5FL3A 3R9WA 1KOFA 5L3QA 4JJKA 2ODEA 3CPHA 1YZUA 1ZC3A 3DDCA 2GK6A 1NN0A 1GM5A 1XMSA 1OSNA 2J46A 3LD9A 3PXGA 3T61A 1F2TA 1ZUHA 4IHQA 5DYGA 5FOXA 4KCGA 4IFEA 2GCOB 3BE4A 2QNRA 2WMNB 3QKTA 5JZVA 3PJRA 1COWD 1BO6A 3CWQA 4FINA 4IOJA 4D0GA 1S1CA 2PCJA 4B48A 1ZYUA 4OQNA 1RJ9A 4MRRA 4HLDA 1G8PA 4QXAA 1H8EA 1ZIPA 5AUPB 3UXMA 2C8VA 1TX4B 3EPJA
chains in the Genus database with same CATH superfamily
2XGMA 4LOHA 3EXIA 3KSRA 4O4LF 4U7WA 2IE0A 4ERXA 2BGTA 1FNBA 3OF5A 1VRWA 1QG6A 2ISSD 3V8RA 1M75A 1T8TA 3TTWA 4LC0A 1QM5A 3DMPA 3PWTA 1WBBA 1X1AA 4YP0A 4EHJA 3LUBA 2GRJA 3KPVA 4UZFA 4GKVA 4ZALA 3U3RA 5L4SA 3KYDA 1M1YE 3HKDA 3KBBA 3OQ6A 4UHHA 4NYIQ 1M8PA 4H31A 4IHJF 5D6OA 3WGHA 3VDXA 1UR5A 4B33A 3GV0A 4RSGA 2WHXA 2QS9A 4PQFA 3E8MA 3PQCA 3HYTA 3D4OA 4QELA 2C07A 1KBOA 4M0UA 3PGLA 1FTSA 1PUIA 1T9HA 2FHPA 3SJ7A 3ANMA 3LRPA 1ODLA 4XB6B 3LF1A 1QFZA 4OJYA 2I67A 3VKFA 3F98A 1LS1A 1UMDB 2EP7A 1NF8A 3ZU4A 1M5TA 3QI2A 4YC7A 1K8QA 4UBJA 4XQ9A 2NQTA 4AJOA 1VBNA 2C29D 1YSCA 3IULA 4ZEXA 1S2OA 5BMVF 4S0XA 2ETXA 3O7MA 5HQ3B 4J2OA 2AHOA 2JGIA 3OURA 4ED9A 2BKUA 2P4EA 3NWBA 3IUNA 3V9AA 3G0IA 4IF6A 2EKLA 1YAJA 4GI5A 4TZ0A 4WK0B 1Z73A 3BQ9A 3MB8A 3QE2A 3QW4B 7AT1A 2EGGA 2H0AA 2K5UA 4QGSA 5JZBA 2ZYAA 1OYYA 4DUYB 4AIIA 1L0BA 4BMVA 2W2XA 3T7TA 1QBKC 2OSBA 5BNTA 3G2IA 2BELA 1G7TA 1J2JA 2VWQA 3CCFA 4M7OA 2JJ1A 4P7FA 1KWKA 1UDBA 1M2WA 3OCYA 2O1EA 4HEA6 3AVTA 3BHMA 1O95A 1FLAA 2TMGA 2FSHA 4PR0A 1TIBA 2B34A 4I4TA 5P21A 3HXTA 4GPBA 4U2KA 4Z4CA 2I3AA 5CT5A 3RRMA 4OHVA 2IUYA 2H2DA 2VT3A 1FNCA 3F47A 4N5MA 3ZY3A 4E03A 4D02A 3HPQA 1NT2A 5JECA 1PLLA 3ABQB 4IKOA 2NIPA 4HFJA 2CD7A 4CF7A 4G09A 5K0GA 1WZNA 2R6GA 4BP3A 2IHVA 5FBRB 1C1YA 3G1UA 3GUCA 4JBXA 4E21A 1KPHA 2XNKA 3HCEA 1M33A 1DDGA 1NY6A 3BWXA 2VP6A 2VZ9A 4INJA 4TPKA 2OHVA 5K3AA 4KSCA 2ZANA 2W83A 4OLAA 2QP4A 2C4NA 1R88A 4OI4A 1XQWA 4DA8A 1U65A 2FX3A 5FA6A 3D0QA 1KP2A 4A1OA 4B8YA 3AR7A 4XTCS 4G84A 5KREA 2OOSA 1NMQA 4DMRA 4ZJZA 5J2TA 4Q1AA 1L5ZA 3L1KA 3DZBA 4UREA 4TTAA 3V5NA 3NASA 2FKAA 1IN5A 1U3DA 2X1VA 3UJHA 2Z6AA 4PZPA 2FNAA 1VYUA 3JQCA 4JKYA 5AW0A 2JW5A 2RGUA 2GEUA 3VR6A 2JCGA 2HRQA 4BP9A 3OIGA 1PLJA 5G3ZA 2FFJA 1TJPB 1Z83A 1OFIA 4CN9A 1TYAE 4WEQA 1T5BA 2XOKA 3RIYA 4KAAA 2JFYA 2DZDA 4IOLA 3T7SA 4DCPA 13PKA 1YDGA 2PLAA 4DIUA 1WPQA 2XNHA 3L93A 4ZK6A 3UPUA 3ZZMA 2LWIA 3AF0A 3JQBC 4IG4A 5TJHA 1FXWA 1L4HA 5T3UA 1WDMA 3CUSA 3TKYA 4XYLA 4QVIA 1XK7A 2H1OA 1MABB 2VA9A 3JD4A 3DAHA 1QV7A 2XYQA 3D4LA 1CR1A 5HE9A 4G0VA 4HUJA 3CRQA 4O2BB 3SQNA 1B26A 2OSVA 1LVGA 1S8NA 1G5HA 3L5KA 2XZLA 4WZBB 2QN3A 5LPNA 1VSVA 4UEOA 5G0SA 3CZCA 3EJ6A 5KPDA 1OI2A 3O4JA 3DM9B 3R8CA 5C18A 4JLMA 1LBSA 3WLTA 3IPXA 4Z1OA 4N48A 2AT1A 3OIUA 4C08A 3O75A 1X7WA 2YRXA 1MP0A 3H4VA 3NX4A 4KMOA 5DGXA 4B3CA 4DANA 2UYCA 3KXDA 5K3FA 3B1JA 4GM0A 3R2JA 1FJGB 3FR8A 4GE0A 1V8DA 2QPTA 2OZVA 1UANA 3SBOA 4NXMB 5IYZB 1RAFA 1NG1A 1W47A 1FX0B 2GYWA 1NMYA 2ODBA 4LUCA 4TZKA 5EMJA 4HXFB 2V4ZA 2XT6A 4F8EA 5JPIA 1P9RA 4CQMD 4WBNA 1DFIA 3O1HB 2B2CA 4UD2A 3ZX5A 4GYKA 1K6XA 3G2MA 3E5NA 2VSQA 3OTIA 4MI6A 5GIOE 1GNTA 2DECA 3OOSA 4HAIA 2AD1A 1M0TA 1E6CA 1SURA 2WICA 1E4YA 1PW7A 4ARZB 1V9LA 4UBKA 3ZJ5A 4BB9A 1KYZA 1TUBA 3BWYA 3NDBB 3LC2O 1FQWA 1T2FA 1TQ4A 5AM4A 1R0WA 5DTIA 2FRVA 1UBJS 4JBGA 4YXWA 2JKYA 4KPFC 4U63A 2ZR0A 4HQFA 3UAGA 1M8GA 1KJ9A 3AVPA 4PRYA 5KAPA 4EG8A 3ZD7A 3OCUA 4CIVA 5CNMA 3RIHA 1BDJA 3HV0A 4GOKA 1WVIA 2Y77A 1WDTA 1FPMA 3E9DA 4AMYA 1YR7A 3A4LA 5LP1A 1SXJC 2CNLA 2RHMA 4Q0MA 2PX3A 4YMIA 1MB2A 4FYXA 4UAVA 1WZIA 1XPJA 2FFQA 4MV6A 1XGKA 3R6WA 3ESBA 2D5IA 2FU5C 4QREA 3BCRA 3WB2A 4GBED 1RVV1 1ZK4A 1VE5A 2JH3A 3BDIA 3U4IA 1M6NA 2JDID 3FUVA 1Z7EA 3G88A 1U8EA 3WLAA 3GLGB 5KCMA 1G8YA 4LGCA 2RHWA 4EMUA 3DZDA 1YB2A 1AXEA 1PHRA 1K0FA 4KXWA 4U6NA 4OATA 5CCBA 4FDAA 2DT5A 2W71A 1PQYA 1IVNA 2QE7D 3P94A 3QTBA 2OQRA 4Z9YA 4ZAZA 3UWDA 4DYHA 5AW8A 2H65A 5HCUA 3FJ1A 5GINE 5DRTA 2JFQA 3AQIA 4W99A 4ND5A 4WZAA 2W2MA 3JCZA 3WG9A 3OQJA 2ZU6A 1DMSA 4RVSA 1YRAA 2UZ1B 4FM9A 3OX3A 4O4HB 4OA5A 2ERXA 3SF8B 5EINA 4ZTBA 2C95A 2RHBA 3UXHA 5KINB 1E1MA 1KDOA 2Q9BA 3AH8A 4BZXA 3ONNA 1GU7A 3DE7X 4ME6A 4OLFA 5J2UB 4OX9B 3PD7A 1FJ2A 3BWDD 3Q8WA 2ZUTA 4MWEA 4RLFA 3I73A 2QGNA 3H3FA 2JBAA 4LY0A 4NRDA 3LDFA 3TSZA 4MJ7A 4ZVUA 1E2DA 3QHQA 1BIFA 3T95A 2C4HA 3KR2A 1E2LA 3C3JA 4M0FA 1YR3A 4TWZA 2IUUA 3FYHA 3W90A 1OBHA 1R6BX 3GQBA 3JSAA 4FFBB 1YFJA 4DIOA 4PO9A 3WLMA 3FZNA 4I4LA 3AP2A 4IUCS 3LUGA 5IVDA 3SZOA 4CUZA 2B25A 2WUEA 3BTOA 1O96A 3C48A 1QAOA 1AUQA 1DCFA 1LW7A 1SUEA 2AK2A 3NB0A 4ESHA 3E4DA 2J3IA 3OE7D 2JGLA 3FYDA 3FY4A 3FUUA 1GNVA 3H6HA 4MTLA 5FFNA 4DIEA 2CXUA 3K0FB 4PE5B 5IJ0A 2ODWA 3D1JA 3FPCA 1GT91 1V5FA 1C7QA 2YN2A 3O8OB 3SC6A 3T35A 3V32A 5A04A 2PK3A 4MH0R 3ROZA 2OKGA 4K5QA 1M2OB 2EJCA 4D9NA 3WOVA 3C3KA 5M3BA 1WIWA 3RU9A 3C3DA 3GA5A 4UCWA 5G4KA 5KSZA 3LPCA 2B1GA 3BB1A 2M6LA 5BV0A 2B69A 4I36A 5FIUA 4H7IA 3D3KA 2FHSA 4R1SA 1JKXA 3PS9A 1X7YA 5EMLA 3RVOA 4XQGA 1WZ2A 4XYEA 5C46F 3I76A 4M0DA 3URKA 5EMMA 4QJ3A 4ZCRA 1I36A 3KOXA 1MNQA 3ZLVA 2JLZA 2DKNA 3TD9A 2Q0QA 1D5CA 1A71A 1VMEA 3T7AA 4K3VA 2QYOA 1X1EA 1AD2A 1QP0A 1CLEA 3F7TA 3O95A 1OLXA 1OA1A 1KI1A 2GCGA 3DJFA 4G1BA 5ADUS 3IUJA 1R6VA 3KAPA 1E3MA 1WY7A 3NQ41 3ZV5A 5JJCA 1ZN9A 1QXSA 1UC4B 5D86A 2VUSA 2B7CA 3TCKA 2ZU0C 3TE6A 3FTQA 1XHLA 3ENQA 5E7JA 1R6AA 1L8XA 3Q4GA 2QAGB 4RHUA 1GV0A 2IGTA 1MX9A 1OPXA 2FPGA 2M6RA 3L7YA 3UBMA 1LI7A 2C9YA 2H3HA 4RLQA 1UL1X 3AVOA 4L9SA 1YQGA 4K88A 3RODA 1RMQA 2UAGA 3KKEA 4DR5B 5F23A 2O20A 2Z1NA 4G8BA 5DPMA 3T4UA 3CR8A 4N12A 3H16A 2XCUA 1F8YA 4X60A 1XXHB 3DXXA 3WWEA 5BSFA 1XEWY 3Q41A 4MINA 1PGNA 2Y27A 3W8FA 1ZSYA 2QE6A 2WYOA 1QV9A 3W6OA 1RXWA 4BLVA 1IPFA 4HOYA 2X2PA 3E3NA 2EIXA 1I5OA 3FI0A 3LDGA 5G1PA 5IJAA 5LOVA 3AEKB 1MEEA 4IG9A 4UTNA 5REQB 3HWRA 1GZSA 2GO7A 2PMKA 3RRYA 3VI3B 5ITZB 1XU9A 4O4LA 3Q10A 4GLBA 3IQHX 5BSEA 2G1AA 1U0FA 2E1RA 1Y4AE 3SNHA 2OY0A 2EZUA 1SBQA 3CRMA 3SCZA 1YAHA 3SMQA 3G0HA 4HAXA 1Q0UA 4MB2A 4MWGA 3PCRB 4HAOA 3PL5A 5E6UA 1WR8A 2J87A 2WUVA 4ABYA 6ABPA 1PGOA 3BM5A 3LA8A 2IEDA 3RO7A 2CE7A 1C1HA 3LOUA 4IHJA 5DLYA 10MHA 2PUGA 4J16C 3UMSA 2PR7A 1SC3A 1R37A 3W9BA 4EJSB 1O6GA 2CK3A 4BNYA 1A5ZA 4B2PA 2ZM5A 2RI1A 2WFLA 2Y0BA 5IMSA 4FHCA 2CT8A 3I2JA 4HF7A 2I7CA 2XRMA 5AK0A 3L46A 4CUKA 2A7QA 5ITSA 2Z6UA 1M1NA 3F6YA 1YZKA 3LT4A 4ZXFA 3LBHA 3FYCA 1RYNA 2Q5JA 1JH8A 3N6RA 3UC5A 3D4IA 5BMVA 2AC2A 2HQSA 1I80A 1T6XA 1UT5A 5AUQA 4D7AA 1MJGA 1XDZA 2AZTA 2C94A 2PGJA 4WBXC 2XYHA 2PMCA 3FMOB 3JAKB 3A27A 4IWXA 3HPRA 2C0PA 3BL5A 4ZMSA 1YACA 2J6IA 3CH4B 5IZ4A 1QQBA 3VKHA 1KZYC 2QMOA 5CVDA 4RORA 1JI0A 3WGQA 1N8KA 1NJSA 5CAEB 3O5AA 4KW7A 3WLLA 5KBYA 1KQPA 2DBRA 4ZAXA 2I91A 4JLNA 4D8VA 3PQ4A 3R5TA 4OB8A 5B6JA 4NZOA 4RACA 4S05A 4L6CA 3IL2A 3N2GB 4MZDA 2B8TA 1W87A 3ZDEA 3JVVA 4HYQA 4KLZA 2WWHA 4F21A 4DMKA 1D9XA 2DRIA 1W36D 2RGGA 3NGXA 4JR2A 1T1GA 3GJTA 4ZZ3A 4G1MB 1G60A 1GTRA 1MX1A 1FJXA 3LNTA 3I64A 3DS8A 4NPCA 2QQGA 4ZO6A 2D3TA 3N3BC 3WLNA 1W5EA 2RCYA 3ENVA 3C98A 4YT4A 1TK2A 3D6TB 1V3VA 3TRHA 1G55A 4YRLA 2WIDA 4M86A 2A8YA 1Z22A 4N40A 4Q1FA 3D5EA 2CHFA 2A0KA 1LC3A 3TTTA 3WGMA 4K81B 2OV2A 2IY8A 3OPNA 1KMMA 4MRPA 1Y1TA 1Y4UA 2XPCA 5AKHA 2Q5IA 2ECKA 3LJKA 2BM1A 4JEMA 4K9NA 1MPTA 2MMGA 4EM6A 2VOJA 5CIYA 4E94A 4CLEA 3F7OA 4QDKA 4JI8B 3H2JA 1HOTA 5DTJA 5B5SA 1DEXA 2HUNA 1IOWA 2A0FA 3CTMA 1FXSA 4LNAA 2XVAA 4LYHA 2QPLA 4OHOA 4C7MA 1UXOA 1IB6A 1PBNA 4IDFA 4KO8A 1KHTA 3EZ2A 2HO5A 2QJRA 3NHRA 3F5DA 1H85A 3CLKA 5HXAA 2QYHA 3KO8A 4KFTA 5BR8B 2G80A 3O03A 1VE7A 1VXOA 5CW2A 1C7IA 2WVGA 1CDEA 1Z62A 4DV2B 4WASA 3H2HA 1K86A 5SICE 2O0HA 3A36A 3HC7A 3K1YA 1F8XA 2QUKA 1BFUA 1I14A 4A1FA 1NNUA 1YBFA 4QPDA 4OLHA 3OFSA 1G291 2GXSA 1Z6QA 3R7DA 2IVZA 3CF6R 4LK2A 5HIIA 2WA2A 1YS9A 1MJFA 4NMHA 1MRZA 4GVXA 4ZZ0A 1NLYA 1F9AA 2OORC 3CHYA 5THQA 1TW3A 4Z1MD 4P2GA 5CLLA 2A6PA 1TMGE 3JZIA 1GQ2A 1AV7A 5B1DA 5JSZB 1NE2A 1RQLA 2OG2A 3JV7A 4FIZA 3DB1A 3O3CA 3UWMA 4ND2A 1X1QA 1WCIA 3IOEA 3JD0A 3IAM1 2LZ0A 2B3TA 1C7FA 4E3ZA 5JATA 3EX7C 2XBUA 4U9HS 3OHMA 3TN7A 4C05A 5G53C 5HYVA 4L4SA 4JOCA 1E6LA 3LLVA 3QE4A 1SKMA 3W5JA 4D9GA 5KYWB 2AH5A 2FE1A 2J4DA 2W4IA 2HN9A 2R8YA 2RHLA 4M0KA 3GLHB 2IITA 3SY8A 4DA9A 4QM6A 4ZKEA 4RTNA 3NHSA 4TLEA 4MULA 3G2HA 3CB4A 3K0CC 4GPD1 4Y2HA 1XRRA 3TOCA 4I6JA 3WRXC 4Z7NB 5LYJB 1MRSA 4P80A 1JG7A 1E9VA 2NMVA 4XWAA 4JXXA 2LR0A 2XGOA 4MYUA 1E77A 2G1UA 3AUFA 3U4QA 3C14C 3HVHA 3MAAC 2ZTVA 1ORHA 2NSLA 3QBEA 3JWGA 4OHUA 2PSJA 1Y1KE 3FWHA 3FPHA 1NI4A 4N0MA 5CYOA 5IKOA 4E1VA 5LL6P 2ZIUB 4MS4A 2ZTSA 5KKNB 1QPGA 5KYNA 1LBTA 1YZLA 4BO3A 2R6AA 1TO6A 3R9XB 1P7WA 4D3SA 4G36A 1HH4A 2A9JA 4YCBA 1B0UA 3SGLA 2WYVA 4Q9DA 3OPYA 2WHYA 1GUAA 2H4WA 2Y71A 3AXSA 4FDTA 1RM0A 2Q6TA 3QEBZ 3T3IA 3EBLA 1PKXA 5BT9A 6REQA 1ESDA 2OZEA 2HL6A 3RV4A 5I9BA 3S2ZA 1SIUA 1UH5A 4ARIA 1PWXA 1SFRA 2A30A 2B1JA 2QLLA 2WSLA 3AOEC 3R3YA 4I55F 4KXFB 2IY9A 3EZYA 3IAEA 3NALA 4DA4A 1E2PA 3DE4X 3TMAA 1VFPA 5BXYA 1XMJA 3RHZA 4HADA 3OZEA 3QEJA 4Y9TA 3L4JA 4K8RB 1Z6ZA 3NYQA 5BR1A 4NYJR 4LE0A 4JJZA 3DC2A 4P4LA 2I54A 4M0LA 4GSLA 3QWAA 3IPAA 2GD2A 4URVR 4P4NA 3QFTA 4CFSA 5HVNA 1X7HA 3VNQA 4BQEA 4LJ6A 1CR0A 1DCKA 1KS2A 1L4LA 4D80A 3KYBA 5KAMA 2V6FA 1II8A 5CIQA 4EB6A 4WLNA 1TYEB 3F3YA 5EKDA 1J1ZA 2JHAA 4D74A 5LUAA 5BQFA 1EUCB 1UDXA 5AK5A 3ESYA 1V71A 1Z0SA 5H0IA 1LK0A 5K8TA 1N78A 3FDIA 3JYHA 3WXMA 3AM1A 4A10A 2QZ9A 2AN4A 1V43A 1K7FB 1BVRA 3N5CA 1JWAB 4D41A 3MJDA 3ETNA 1E92A 2HPZA 3KXKA 3A7EA 5KOIA 3HZRA 2FMXA 5ESWA 2Z2YA 4NY1A 5K45A 3VYTB 3X1YA 1KMCA 1A7AA 4IH4A 5L7YA 3KWLA 4QLOA 3RFFA 4Q3LA 2NG1A 3SHTA 1E98A 4X1YA 1NM5A 2N75A 3DR3A 2R1TB 3AEXA 1CUDA 1RCFA 2WDPA 1O89A 2OD9A 2VQSA 1E2FA 3CLRC 1ONBA 1X7DA 4NZYA 1RKQA 3TTVA 1E9FA 3IA2A 2I7VA 1EZZA 1FVOA 2P2LA 5MDHA 4FE7A 1FVHA 1B16A 3ENKA 1VLHA 2F64A 3MJSA 3Q9LA 5K0LA 2UZ0A 5DXAA 1E18A 4YT5A 1VIYA 3FKJA 4N4AA 1NAHA 4ZO9A 4CMEA 3SKXA 4BLUA 1RPTA 2ZT5A 4KX5A 3EASA 2O7VA 2EGUA 3DMHA 3UENA 3G59A 3PIDA 3LUDA 4HUQA 5ALUA 4WOBA 2OO5C 1XEXB 2II6A 3IP5A 4DCUA 1HUQA 4XSHA 3FOWA 3AUUA 3N6XA 4Y2TA 3CMCO 3RK0A 5FOSA 3QPCA 2VAMA 1Y5RA 1GSAA 4IY1A 2C2MA 1QAQA 1AURA 4PFKA 1NC3A 1SZDA 2A9RA 3A1TA 4Q3KA 4TM7A 1C7RA 1E62A 4HG2A 2L17A 2H2HA 4HAYA 4I4CA 2Y8EA 1VMKA 2UUPA 4D9JA 1UJBA 1T3HA 4LRSB 3N0WA 1ABFA 1K7XB 1AHHA 3SFTA 4L8YA 1LDNA 1W1UA 2YUIA 4LQCA 3Q9UA 3ZHZA 1CYEA 1KE1A 4R9VA 1M7BA 3WRYA 1HEYA 1RXEA 4UDOA 4V0SA 3QPDA 4AY5A 2HBRA 2JFGA 4G2NA 4OVKA 3UG6A 3QYFA 4MKRA 1Z6GA 3KL4A 2VHJA 5COAA 3LIPA 4B43A 5CVEA 2FDCA 4AS1A 1G59A 3EIQA 4BNVA 1V95A 2GTHA 2NZYA 2F1HA 3K6JA 2BGMA 3UJ7A 2PUWA 4MR8A 3UH1A 4D4MA 3K6RA 4YQZA 4FIDA 1VP3A 3D4NA 1LSSA 3F9CA 4TXNA 3U1VA 3GLFB 1QNLA 3GCXA 4KGVA 3K9WA 4DSNA 4B3HA 1BW9B 2HWXA 1YA4A 3RQSA 3U26A 1W73A 1IDN1 1FQOA 1T4DA 2IZ7A 2CBZA 4XRRA 4J7AA 3WI7A 4B2YA 3KJHA 1KMHB 2VHTA 3DL2A 3OM8A 3O1LA 2I6SA 3ECAA 2CC2A 4I6GA 3F2VA 3DVRX 2BFBB 1WXEA 2X4GA 1F2UB 4EOGA 3K32A 2ZVDA 2FW7A 4R1UA 2AOTB 1VA4A 3GBPA 1TL7C 1X80B 1YUNA 3EWSA 2K87A 2FSSA 4RCZA 2AFVA 1ZM4A 4IDCA 2CZQA 1IN4A 3HG7A 1R74A 1QE3A 3IVMA 3AF3A 2J3MA 3CJQA 4FCVA 3RBXA 5FPPA 1J56A 2ZDGA 1M2GA 3EIWA 2XGSA 4NMXB 1GYPA 3KTAB 2ZT7A 5ALMA 4BPRA 3U7FB 3IUBA 2B35A 3R9IA 4MQMA 1I2CA 3G1TA 4QDTA 5KNBH 4BC1A 2B3DA 2WKQA 3QX9A 4MW6A 1J6UA 3VPXA 4RIEA 3S2YA 2BF4A 4FEAA 4DCCA 1XK6A 4MQ6A 2NO0A 4BDTA 3VHLB 1LKZA 1Q0PA 3L4SO 4L0QA 4F0JA 4YUAA 4IF4A 4NH4A 2OM2A 4QICA 3IPLA 4RSRA 4KI0A 4RS3A 3H2IA 4MV0A 4WXYB 4ESOA 2X19A 2AG5A 1GCOA 1FIUA 3WQSB 2XAAA 3LLCA 4LHZA 4PLZA 4KOEC 4IGAA 3TW0A 2XCRB 3RS9A 1IZ7A 3BUSA 3T0FA 1U2ZA 1S1MA 2MR6A 4IEIA 2Y9MB 4KXLA 1JJIA 2J9YB 4G4SO 2JAHA 4LOLA 2X0EA 4AI6A 4B32A 4YRJA 2RHDA 1CUUA 3LGAA 4NV3A 2BMVA 2ZDHA 4B75A 3WK9A 2V03A 2OGSA 4RVDA 4ISCA 5DM1A 1P2DA 4O5AA 1PJBA 3R75A 4PAQA 3TLCA 3V1NA 5DBFA 1LX7A 1VJRA 5LJIA 2CV2A 4Y7CA 5KJ1A 1WP9A 4F46A 4AX4A 2JNWA 1DRWA 4MI9A 3MF4A 4AMGA 3IAAA 4EVRA 4MV1A 4YX9A 3C3EA 1E2BA 1MJNA 4HNRA 4JN6B 1E99A 4CRWB 3NBQA 3MMXA 1PL0A 4B4OA 4D6YA 3WAGA 1XRJA 3EG9A 5T3YA 4KO1S 1G8HA 3L0IB 4W4TA 1SOUA 2DR0A 1P2TA 1F2VA 2Z43A 4ZRDA 2ZI7A 5A7GA 5A0TA 3DTTA 3PQ8A 4DREA 3U7RA 5FUXA 4JU8A 4C06A 3AEUB 2PPVA 4KQXA 3C3XA 3EIHA 2A5GA 3KR9A 3TL3A 1BX0A 3DOFA 4B9AA 2UYYA 4OPMA 5F7JA 1N1MA 3V46A 2FFHA 2WJ6A 1N2HA 4MMXB 3HKEA 1NKVA 1QH9A 5EIXA 1XDDA 4OSEA 4C0WA 2AJBA 4ITVA 4OQYA 3WWCA 3H4TA 4DZZA 3GIDA 1L5QA 3G5TA 4HDQB 4PG7A 1K0UA 1OXKB 5FJIA 5CBPB 3IQDB 3GPIA 1OTXA 2OGZA 2ZRMA 3E7XA 3LBNA 1ILWA 4C4RA 1EFPA 3I09A 4Z7JA 1KEEA 4FWIB 2OG1A 4ZCQA 4O4JB 4MMZB 4RPGA 3GI1A 1M6VA 2H8KA 1GPWB 4HT3B 2QG9A 1T2VA 2P78A 4NV1A 3R1IA 4KVGA 1PWYE 4UTRA 4ZDKA 1RT9A 5F64A 2ZUEA 2WINI 3ETHA 4YK7A 4ENPA 3L6UA 4NEGA 5AMXA 3AVWA 1IOZA 1HT2E 2AEFA 2AMJA 5EJ6A 3BXOA 1W8IA 5ERXA 2I71A 2PZBA 1PJLA 2G82A 2PIAA 4BFVA 5ALSA 1JZTA 3A4NA 2W00A 8AT1A 2JVIA 4MRMA 2WYIA 3PIIA 3AFHA 3H9BA 2REXB 3EN0A 5JOQA 3BGDA 4XFKA 4ENTA 2ZVJA 4CMHA 5IW8A 1P5RA 1U3UA 3EISA 2YIVX 2K7ZA 3R7LA 1B14A 4ACBA 2OCDA 3ZD9A 1K66A 3RREA 4QC2A 5A4IS 3GJRA 4CHTA 3HKCB 5AVVA 4ZJUA 3GZNA 4IDQA 1JIVA 1YT5A 4NDNE 1SZCA 4OLJA 4QEZA 4IFIA 1EG2A 1MT3A 4RK5A 4Y2JA 2XE6A 4RA6A 5DCWA 5J1TB 4BRZA 2GA9A 2BFAA 4QPNA 4TMWA 2OOKA 2HCBA 1NDHA 2WQZA 1G98A 4A2PA 3WRWA 1PD0A 4MJXA 2H31A 2QLMA 4J4HA 2HOQA 1T5IA 1YUBA 5TSDA 4HEA1 6PFKA 1JFSA 4JI2B 5AW4A 2FJPA 2C2HA 3ZQJA 4RSMA 5HZGA 3L1UA 1P5ZB 1PZNA 2XSZD 3LZDA 1W19A 5CEJA 4NP6A 3HNOA 1YJBA 3EPHA 3FYSA 4MWSA 3ZV4A 1P5HA 1XLWA 2QX7A 5ED0A 4YV2A 5KPJA 1ZOLA 4P92A 4PYJA 2ZRKA 1WSAA 1GA1A 2C7PA 1SPBS 2D00A 3BMNB 4Y9RA 3E70C 3OFJA 5C4GB 2WY2D 5JLJA 1M5RA 1QHSA 3VHRA 1X42A 1SKYE 1I4EB 5HIMA 3SC4A 1NW6A 4P58A 3WGZA 3PSHA 5JXIA 1X14A 2Q45A 1GG5A 4I55A 3GJ5A 3PQ2A 5C4IA 2J48A 2QIPA 4KFCA 2J3EA 4FFLA 2QXTA 4J2TA 1ZFNA 4QHTA 3G9UA 3CVVA 2QRUA 5DNWA 1R12A 4M1OA 2ZIGA 4N9WA 4NCNA 4D0NA 4A0QA 2PYIA 4EEKA 4IYRA 1J4AA 5BPHA 3OF3A 4PLVA 2QT0A 3O4VA 1RP7A 3IQGX 1C3VA 3KUCA 1RM4A 3KCNA 3M89A 1A9XB 2M32A 3ED1A 4ETIA 2V8OA 3LP8A 4HRAA 1E6WA 2IYXA 5DHQA 1EFUA 3AJ8A 1D2RA 1V16A 3NHYA 4OFBA 3KOWA 1J8FA 1VI5A 5IC4A 4RZHA 3S5UA 4DSAA 1DAEA 2P9TA 3BMQA 1OMOA 1G8GA 2CHUA 3LPAA 4GMGA 3BREA 3E9YA 4N6NA 4NONA 4RHYA 4CTNA 5HOEA 1T10A 3AERA 3C6KA 3HSSA 4WDQA 1N32B 2JBHA 4IVQA 5IVIA 1KNXA 3HFSA 3HL0A 5L7TA 3GW8A 3CR3C 3ZI0A 1H6DA 2NU8B 1ULHA 2BRUA 1IEWA 4WECA 4CKEA 1G66A 2D0PB 2V9CA 4AICA 4OL9A 5BNZA 1OB5A 2QTRA 5DEOA 4MP8A 5HF6A 3NKLA 1HLFA 2OMKA 2JLBA 1FDSA 2QGZA 4X3OA 3WB1A 5BYAA 5HDQA 3QFHA 4S1NA 4UVDA 1E5QA 2XUHA 1UMCA 4JT8A 2HCRA 1RQGA 2H92A 2J33A 2EKPA 1G2QA 2WUDA 3BHJA 1LBEA 3I53A 4BYMA 4BAZA 3DAOA 1RKVA 2J6CA 1YVDA 1ODSA 2FWMX 2HLHA 2Q2OA 3AESA 3CJTA 4JODA 4LHWA 4UW9A 3BRWD 3RADC 3AETB 4ZCTA 4IJUA 4POOA 4CL3A 4AUNA 5C5EA 1L4EA 3W4KA 1D8TA 4PIVA 1DXYA 1Q1ZA 3G17A 3NIDB 1F20A 1O6BA 1GFIA 3KLOA 4JVOA 4K9LA 3SQOA 1CF9A 2FGKA 2IKQA 5D6NA 3RRFA 1NFFA 4TGLA 2FW0A 3EIEA 4XYBA 3HJFA 4CEHA 4XR9A 5HTOA 1GQFA 4XEUA 4C5BA 5C1BA 2XZOA 4NENA 4Z99A 4JI5B 3L18A 2B0JA 2MYNA 3JTMA 4GPAA 2Q5FA 3VR2D 5BSTA 4KTVE 4G0MA 2OXFA 1GGHA 1NATA 1EFKA 3VTAA 1J2UA 5E9JA 1AB6A 3ULKA 1T36B 2WM2A 1XQVA 4XWYA 1ACLA 1NW3A 1VLQA 1P4SA 2W70A 4EZEA 4I3FA 3KQQA 5FTWA 1EAMA 3BILA 4LJAA 1B1CA 2A1TS 2F8LA 3NTQA 4P3OA 1N8TA 2PA0A 2WAOA 1PDOA 1DOZA 4XGQA 2HSJA 2ZZNA 2BFCB 5AJYA 1F17A 3R4CA 4OXQA 3FPAA 1JU3A 1CE8A 3PUIA 4RSHA 2V5UA 3DULA 2ZBRA 1RBZA 4FGUA 1JEOA 1VBKA 1JE1A 2HJVA 4HDNB 1D0IA 1PAUA 3NXSA 1FP4A 4U3JA 1XP8A 5EFOA 1V1RA 4CMGA 4DY6A 1Q1GA 1VGRA 3FZEA 1N9ZA 4K9MA 4QFDA 3G9TA 3KFXA 4JB3A 4Q4JA 4BX9A 3RKSA 5GVRA 1UEJA 2PH1A 3GARA 4DNXA 2X76A 5GM2A 3VSEA 2R7MA 3PJEA 4U0JA 3DAGA 1RPNA 3JWJA 4XIJA 3SHWA 5GZ3A 1Y34E 3GHYA 1LBQA 3GLKA 4Z8YA 4O2BF 3FCAA 3H87A 3E7PA 4B40A 2QUAA 4UMFA 2OC9A 4KVFA 3LUAA 1L4MA 3D6UA 2ACEA 3QKIA 4J6EA 2ZJOA 3D02A 5FTMA 5TMPA 3TL6A 5EE0A 3V8MA 1CK4A 1DELA 1OAKA 1LJLA 1PP4A 1Z4JA 3RSZA 3L6RA 1ZXLA 2RGDA 1NVDA 3KJXA 1EVJA 4RK1A 1IHDA 2BEKA 3DEJA 1E9DA 1BDBA 4RIFA 3TDMA 4XUGB 4BB0A 4YJFA 5IC5A 1UPXA 5FTLA 1W1IA 3BOSA 4KH0A 5IYZF 2BFMA 2VNJA 2Z0MA 1W5AA 5DVZA 3SQMA 5KQPA 2JAUA 1PR1A 2HF8A 3EWAA 3GOQA 1P2BA 5HQJA 2Q0XA 2XRYA 3RIEA 3T7IA 4WNAA 2JKZA 3C45A 4DLTA 3LLUA 1QFYA 2CEAA 2YRFA 5ETJA 1J7KA 3WX0A 4PFQA 2OHJA 1E1CB 1AMUA 5IZCA 2PKQP 1EA5A 3EODA 4NV0A 2XLCA 2B37A 4TTSA 2BJHA 2J3HA 3CUEF 4ZARA 4DQDA 4DV4B 4UPDA 3VHXB 4PZCA 1JKFA 2J9GA 3TK1A 2C2BA 1D07A 1YC2A 3AFOA 5AW3A 1SBHA 4A6PA 2V74B 1ZGAA 2BBSA 1P6XA 1ZI9A 2R8EA 1SWVA 2VNIA 2ZRHA 2QV7A 5CCXA 4GECA 5BYBA 1HQYE 1T5HX 3LTNC 3V7YA 4R5MA 3JVIA 2JLUA 3FPFA 4CQMA 3BZWA 2CJPA 1IHYA 2VDRB 4FFWA 3H1EA 4AO6A 4AULA 4KQWA 4PPQA 1W9MA 3FUXA 5CDSA 5GADl 4NBSA 2AG8A 1P0FA 2ZWAA 3D3NA 3CSSA 1KI6A 1SUWA 1J99A 1UT6A 2YKGA 1O94C 1ZVKA 4O59O 5FO1A 3ZTWA 4Y1RA 3BJMA 5ECWA 4Z3KA 3W77A 4CKBA 2RB4A 4JUDX 1DC6A 4V24A 4AS2A 1NQAO 4MV5A 3ZYZA 3QLUA 5IDXA 3K9HA 3OIYA 4O4HF 5JMOA 4DZRA 4ZT5A 2PMWB 5J2UF 1OVGA 2BHNA 2ZAIA 3K30A 4G24A 4CKCB 4L4XA 4FPXA 4MCAA 1BGVA 1I7NA 3C70A 2JI7A 4R7GA 2VP4A 4EW2A 4ZTZB 3SMVA 2VAVA 1NXQA 2CHEA 4X84A 2C31A 3SDBA 2VQDA 4G07A 1NDQA 3GGOA 4MS1A 3RUCA 2XDYA 3AC0A 5CD9A 1XTKA 3PENA 2DQKA 2WD7B 2INGX 3VZDA 1SBNE 4IMRA 4QDOA 3AR8A 3I5YA 2FV8A 3TSCA 1B0AA 1YR9A 1QPBA 3NIGB 4JXJA 3AUJB 4ZQCB 2B4QA 3AGPA 1JECA 5G0TA 4KN8A 3VSBA 4AX8A 1QRUA 1BKDR 1G7RA 3GWGA 4L51A 2PAFA 2HJGA 1APBA 1XZGA 1Q3KA 1J5EB 2YVAA 5T64A 3CZ4A 5JAPA 2UUCB 1D1TA 2F2TA 3W78A 4KHPB 1O8BA 2QRPA 1N5OX 2FWIA 1AKYA 1DKQA 4HWKA 2UYOA 2W6ZA 2ZRAA 5KYXB 3EC2A 4TZ6A 2VHXA 1KNQA 4DAOA 4NJMB 4E07A 2CYBA 3PDIA 1RPZA 3DFZA 5J5CA 4PTLA 1QDLB 1R0SA 5K51A 5KYVA 3SC2B 3WNZA 1ACJA 4M1QA 4GEKA 4NZZA 1HSZA 2DGDA 3ETDA 3OCWA 4M1TA 5C8YB 1W1WA 4RD2A 1XZFA 2V0CA 1P9WA 2FTKE 3L40A 4TMFA 3L4KA 3QOWA 4GQIA 2ZBPA 1GGMA 3N0VA 3RVQA 1ZJ6A 1P3Y1 2MR5A 4LDQA 5EKSA 3RS5A 2V7XA 4QD3A 8LDHA 2FSUA 1GXSA 3DONA 1BRMA 3PDJA 2YVLA 3OE7A 4JLBA 1N6RA 1OX4A 3GGGA 5CH3A 4F4FA 4EEZA 5CXUA 2AA3A 3IKLA 4ZVOA 5C7IO 1DKMA 1KF0A 2RAPA 2FN3A 4JKOA 2QL5A 4ZQFA 1ZM7A 3T3GA 1EUYA 2GFIA 4HAZA 1SC6A 3L0ZA 2JLWA 2XZTA 4ZC8A 3IUEA 5A7HA 5F1PA 4DYVA 1HT3A 3INRA 5F98A 1R5OA 3TUIC 3TIGA 3PNLA 3F8WA 1PG5A 2VUTA 1FK8A 2MYUA 4XDZA 3UMJA 3ZZ0A 4DMCA 4BEWA 1CJUC 5FUBA 2OHIA 2PIDA 3AEQB 3OEEA 4FGWA 1P1BA 2FOXA 2J3JA 2JH9A 1G5FA 2GCOA 5BO5A 5JJKA 5JT1A 2XDQA 3BL8A 5JRZA 2AJ8A 1EP9A 1IOVA 3QRWA 3ODPA 4RA9A 3SSNA 2QTBA 3IH5A 3LCMA 2I7XA 1QG4A 3KEQA 3OAAD 1PDWA 1NUAA 1U2DA 3NBZC 4XDHA 2PCLA 1D7OA 1RQ7A 1PT9A 3HDVA 3LWZA