5DIPA

Crystal structure of lpg0406 in reduced form from legionella pneumophila
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
112
structure length
112
Chain Sequence
b'SDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDKKTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEALEAFEEFSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyl hydroperoxide reductase AhpD
publication title Structure of lpg0406, a carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Oxidoreductase
total genus 47
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 5dipA00
2OYOA 1GU9A 3D7IA 2GMYA 5DIKA 1ME5A 4G9QA 1P8CA 2Q0TA 1KNCA 2QEUA 5DIPA 3C1LA 2PFXA 1LW1A 3BEYA 2O4DA 2IJCA 1VKEA 2PRRA 3LVYA 2CWQA 2AF7A 2OUWA
chains in the Genus database with same CATH superfamily
2ES9A 3AAAA 2OYOA 2KXPA 1GU9A 3D7IA 2GMYA 5DIKA 1ME5A 4G9QA 1P8CA 3LK3A 1IZNA 2KZ7A 2Q0TA 1KNCA 3AA6A 5AFUK 2JN8A 2QEUA 5DIPA 3AA7A 3AAEA 3C1LA 2PFXA 3LK2A 1LW1A 4AKRA 3AA0A 3BEYA 2O4DA 2IJCA 1VKEA 2PRRA 3LVYA 5ADXK 3LK41 2CWQA 3AA1A 2AF7A 2OUWA
chains in the Genus database with same CATH topology
2ES9A 3AAAA 2OYOA 2KXPA 1GU9A 3D7IA 2GMYA 5DIKA 1ME5A 4G9QA 1P8CA 3LK3A 1IZNA 2KZ7A 2Q0TA 1KNCA 3AA6A 5AFUK 2JN8A 2QEUA 5DIPA 3AA7A 3AAEA 3C1LA 2PFXA 3LK2A 1LW1A 4AKRA 3AA0A 3BEYA 2O4DA 2IJCA 1VKEA 2PRRA 3LVYA 5ADXK 3LK41 2CWQA 3AA1A 2AF7A 2OUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYO A;  1GU9 A;  3D7I A;  2GMY A;  5DIK A;  1ME5 A;  4G9Q A;  1P8C A;  2Q0T A;  1KNC A;  2QEU A;  5DIP A;  3C1L A;  2PFX A;  1LW1 A;  3BEY A;  2O4D A;  2IJC A;  1VKE A;  2PRR A;  3LVY A;  2CWQ A;  2AF7 A;  2OUW A; 
#chains in the Genus database with same CATH topology
 2ES9 A;  3AAA A;  2OYO A;  2KXP A;  1GU9 A;  3D7I A;  2GMY A;  5DIK A;  1ME5 A;  4G9Q A;  1P8C A;  3LK3 A;  1IZN A;  2KZ7 A;  2Q0T A;  1KNC A;  3AA6 A;  5AFU K;  2JN8 A;  2QEU A;  5DIP A;  3AA7 A;  3AAE A;  3C1L A;  2PFX A;  3LK2 A;  1LW1 A;  4AKR A;  3AA0 A;  3BEY A;  2O4D A;  2IJC A;  1VKE A;  2PRR A;  3LVY A;  5ADX K;  3LK4 1;  2CWQ A;  3AA1 A;  2AF7 A;  2OUW A; 
#chains in the Genus database with same CATH homology
 2ES9 A;  3AAA A;  2OYO A;  2KXP A;  1GU9 A;  3D7I A;  2GMY A;  5DIK A;  1ME5 A;  4G9Q A;  1P8C A;  3LK3 A;  1IZN A;  2KZ7 A;  2Q0T A;  1KNC A;  3AA6 A;  5AFU K;  2JN8 A;  2QEU A;  5DIP A;  3AA7 A;  3AAE A;  3C1L A;  2PFX A;  3LK2 A;  1LW1 A;  4AKR A;  3AA0 A;  3BEY A;  2O4D A;  2IJC A;  1VKE A;  2PRR A;  3LVY A;  5ADX K;  3LK4 1;  2CWQ A;  3AA1 A;  2AF7 A;  2OUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...