5DIPA

Crystal structure of lpg0406 in reduced form from legionella pneumophila
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
112
structure length
112
Chain Sequence
SDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDKKTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEALEAFEEFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkyl hydroperoxide reductase AhpD
publication title Structure of lpg0406, a carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response from Legionella pneumophila
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Oxidoreductase
total genus 47
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 5dipA00
1P8CA 3LVYA 2GMYA 2IJCA 1ME5A 2O4DA 2PFXA 2Q0TA 2OYOA 2CWQA 5DIPA 1VKEA 4G9QA 1LW1A 1GU9A 3BEYA 3C1LA 2AF7A 1KNCA 2PRRA 5DIKA 3D7IA 2QEUA 2OUWA
chains in the Genus database with same CATH superfamily
1P8CA 3LK2A 2GMYA 3LVYA 3AA1A 2IJCA 2KXPA 4AKRA 1ME5A 3AA0A 1IZNA 2JN8A 2O4DA 2PFXA 3AAAA 2Q0TA 2OYOA 5AFUK 3LK41 2CWQA 5DIPA 1VKEA 2KZ7A 4G9QA 1LW1A 2ES9A 1GU9A 3LK3A 3D7IA 3BEYA 3C1LA 3AA7A 2AF7A 1KNCA 2PRRA 5DIKA 3AAEA 5ADXK 3AA6A 2QEUA 2OUWA
chains in the Genus database with same CATH topology
1P8CA 3LK2A 2GMYA 3LVYA 3AA1A 2IJCA 2KXPA 4AKRA 1ME5A 3AA0A 1IZNA 2JN8A 2O4DA 2PFXA 3AAAA 2Q0TA 2OYOA 5AFUK 3LK41 2CWQA 5DIPA 1VKEA 2KZ7A 4G9QA 1LW1A 2ES9A 1GU9A 3LK3A 3D7IA 3BEYA 3C1LA 3AA7A 2AF7A 1KNCA 2PRRA 5DIKA 3AAEA 5ADXK 3AA6A 2QEUA 2OUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P8C A;  3LVY A;  2GMY A;  2IJC A;  1ME5 A;  2O4D A;  2PFX A;  2Q0T A;  2OYO A;  2CWQ A;  5DIP A;  1VKE A;  4G9Q A;  1LW1 A;  1GU9 A;  3BEY A;  3C1L A;  2AF7 A;  1KNC A;  2PRR A;  5DIK A;  3D7I A;  2QEU A;  2OUW A; 
#chains in the Genus database with same CATH topology
 1P8C A;  3LK2 A;  2GMY A;  3LVY A;  3AA1 A;  2IJC A;  2KXP A;  4AKR A;  1ME5 A;  3AA0 A;  1IZN A;  2JN8 A;  2O4D A;  2PFX A;  3AAA A;  2Q0T A;  2OYO A;  5AFU K;  3LK4 1;  2CWQ A;  5DIP A;  1VKE A;  2KZ7 A;  4G9Q A;  1LW1 A;  2ES9 A;  1GU9 A;  3LK3 A;  3D7I A;  3BEY A;  3C1L A;  3AA7 A;  2AF7 A;  1KNC A;  2PRR A;  5DIK A;  3AAE A;  5ADX K;  3AA6 A;  2QEU A;  2OUW A; 
#chains in the Genus database with same CATH homology
 1P8C A;  3LK2 A;  2GMY A;  3LVY A;  3AA1 A;  2IJC A;  2KXP A;  4AKR A;  1ME5 A;  3AA0 A;  1IZN A;  2JN8 A;  2O4D A;  2PFX A;  3AAA A;  2Q0T A;  2OYO A;  5AFU K;  3LK4 1;  2CWQ A;  5DIP A;  1VKE A;  2KZ7 A;  4G9Q A;  1LW1 A;  2ES9 A;  1GU9 A;  3LK3 A;  3D7I A;  3BEY A;  3C1L A;  3AA7 A;  2AF7 A;  1KNC A;  2PRR A;  5DIK A;  3AAE A;  5ADX K;  3AA6 A;  2QEU A;  2OUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...