5DISB

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Exportin-1
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5disB00
1N5LA 3N2IA 3Q5EA 2WPDD 2VF8A 3FMFA 2QI9C 5KHOC 1YZLA 1IN6A 3QBVA 3KUDA 1P4SA 1AZTA 1NVVQ 1XXHB 2FZLA 1XD2B 4FCVA 1XU4A 2ZJ5A 2FGJA 5CB6A 1N0VC 1CULC 5KSPA 4A92A 3ND8A 2H5EA 2RGNC 5EXXA 1JR3A 1RYHA 1F2TA 1L8QA 2ZRFA 2PEZA 2IYYA 1ZIPA 3L2OB 3DPUA 3A6PC 1VYVA 4MA4A 1RKBA 1KMHB 4BZPA 3BD9A 4OI0A 4TTRA 2WAYA 1EX6A 2C9CA 2FWRA 4PC6A 4XSGA 1P3JA 2IK8A 4BRUA 1WMSA 4JZKA 2XNDD 5JRZA 2V55B 1JQJC 1E2QA 2QM7A 5JFGA 4TLCA 3THWA 5C46F 2DCUA 1NY6A 4XVUA 4DDWA 1ZW6A 2YOHA 4B3GA 4JSTA 2YWEA 5EXSA 2EU8A 4WA7A 3GJ3A 4HLUA 2F3RA 1G3QA 5JHHB 3PITA 3SNHA 1KO4A 4GZLA 4HSEA 1MO6A 1FZQA 2CHGA 3QENA 4MUAA 4MRNA 3TR5A 1E1QD 4CDGA 4BLPA 5FOSA 2H92A 4RZXA 1KI7A 3J81k 4NCKA 4EQ6B 2C04A 1ELOA 3C14C 1DAGA 4GBMA 2ZTSA 4LJ9A 4A8JB 2PH1A 2JJ2D 3AF1A 4K46A 4US2R 4LJAA 4QRHA 1CF4A 3THXA 4TYWA 1JECA 4ZDJA 2IYXA 2NZ8A 5L8VA 3EZ9A 4W5WA 4C0QC 3DOFA 4MUBA 4ASUA 2F3TA 3GD7A 3K0CC 2WHXA 4D81A 2BBOA 1NSTA 1E2GA 1UF9A 1RRCA 4KSCA 3BFXA 4OI2A 4L9SA 1Q1ZA 1M7GA 2GKSA 1B0UA 4WOPA 2HJGA 1S8FA 5KDOA 5FTJA 4DRZA 1E2HA 1OHHA 3NH6A 4DKXA 3IEVA 1XEWX 4HAXA 4A0GA 2R62A 2I1QA 4BEBA 3K8YA 4PHFA 3SJAA 2VP0A 5EUQB 3IEUA 2WOOA 2J1LA 1JALA 2QMUA 2EYUA 2Z4SA 3RYTC 5CJ2A 1DAKA 2KSQA 2VP9A 3KUCA 3WY9A 5LDDC 4NYJR 4JLBA 3NHAA 4MDFA 1XX6A 2RGXA 1GAJA 1LW7A 1SKQA 1AM4D 4GNKA 1J90A 1ZRHA 5J5CA 4DLSA 4YXWD 1K8RA 1Z6GA 1R4AA 2ZSDA 3ONWA 5L3QB 5C4GB 1XD9A 2BIFA 1Z6AA 3K70D 1AZSC 1ONBA 1QG4A 3R20A 3C5HA 4S35A 2FFHA 1YZKA 1XEXB 1XD2A 3B1XA 4BLRA 4YXWA 4A6PA 3AVUA 5DI9A 4OQLA 3NHBA 3EPLA 2EYQA 2JLVA 1UADA 3M6AA 3EPHA 1KTVA 2X2FA 1IY1A 5KSYA 4A8JC 1N3BA 1DG1G 4XOIA 2Q6TA 3VR2A 5A4JA 1NP6A 2AWNA 1ZP6A 2RHMA 1GILA 1P9NA 2FJUA 3S1AA 3W6OA 1M7BA 1W2GA 1H8EA 3EIQA 5DO9A 1NN5A 1U8YA 2OHFA 1KO8A 2QG6A 5AJZA 4BLOA 1TF2A 4QXAA 3ZZ0A 2FN4A 3N5CA 2NG1A 1RW4A 4R9UC 4BPBA 2ZYWX 1BKDR 3VKHA 3LDAA 5G53C 1JEEA 2JJ1A 2AD5A 4TMWA 4EKDA 3GLFB 1COWA 2V3CC 2NOAA 2QT1A 3W3ZB 4HUQA 3CR7A 2YV5A 3BE4A 5UKDA 4C2TA 2X2EA 1PLLA 3TAUA 2IS2A 2C9OA 1IM2A 4ZIRB 2GCPA 3MCAA 1Q1QA 4JKYA 4FW9A 1AA9A 1DAHA 4TSFD 1OIXA 4JBWA 4QBFA 4BUJA 3R8FA 2ZRDA 4IEEA 4JVMA 4HAUA 4Z8YA 5J4KA 4AY2A 3WHKA 3LRPA 2D2EA 1F3OA 3I4LA 2OESA 2DFNA 2ZR0A 1K5GA 4URWR 4XWAA 4NMMA 3BXZA 1JAHA 1XF9A 4MRPA 2G3YA 1Z08A 2ZRIA 2O0JA 3UMFA 5FOWA 5C1BA 1SXJE 2HXSA 3OFNA 1XWIA 3A4MA 1E98A 3QF4B 4NDZA 3I61A 2CVHA 2PT7A 3C7KA 5JJLA 2A7QA 2BJVA 1SKYB 2YJTD 3SBDA 4JLNA 1YVDA 2Q9CA 2VHTA 2WKQA 1BYUA 1JXMA 2OBNA 2P5SA 4YDSA 3ADKA 1BS1A 2IYSA 3RC8A 4NPHA 2VRWA 1KI1A 1CR0A 2OEPA 4RFVA 3ZIAA 2QPAA 4P32A 1PUIA 3CRW1 5E7MA 3TSOA 1OH7A 1ZBDA 2OAP1 4CYMA 5HKKD 1KK0A 2AK2A 2B6HA 1CBUA 2HF9A 2K5UA 3EZ7A 3CF2A 4B2PA 4A36A 2GRJA 5H70A 1UBFA 2P5TB 2X1VA 4RY2A 3T1QA 1JJVA 5ANRB 2CL0X 1T8UA 2G1KA 4POAA 5SZJA 1XEXA 3L82B 8OHMA 3ADBA 1M74A 1XZPA 1NBMA 2JLSA 1DVRA 2GAAA 1RVDA 2IYZA 2XX3A 2J0UB 2ZRAA 2B8WA 1FUKA 1OYYA 3PV0A 4YC7A 2ZQ5A 1Q20A 3RDPA 1GIAA 5FL3A 3SDZA 5IK2A 1JI0A 5FOXA 1N5JA 1Z6YA 3D6TB 1C9KA 3QXXA 2OM2A 4PR0A 1DEKA 1FP7A 2FPLA 2KBFA 1W46A 1PJRA 2JLRA 1F6BA 4FINA 1R0YA 3ZVMA 4AG6A 3RANA 2ZS9A 1XCGB 1P72A 2XTMA 2GZHA 3I8XA 1TQ4A 3PXGA 2OFXA 5BN5A 2GBLA 1LB1B 1A4RA 1SZPA 1KMHA 2ZE6A 3BAFA 4F4CA 5J4LA 4UKDA 3U5ZB 2IS4A 4TL9A 4ERNA 1AJEA 1KDPA 2IUUA 3V9PA 4ZDKA 3E70C 2EWVA 2XSZA 1NN0A 4N3NA 4A0FA 2DB3A 5FUYA 1NKSA 2VHQA 1JPNA 4AC9A 4CT5A 5CLLA 1GNPA 1E4YA 3LY5A 4Q5IA 1E6CA 4DLXA 4MH0R 1ZC3A 3AUYA 2JASA 4TL6A 3I92A 4US0R 3AV0B 3D31A 2GJAA 2BMDA 4O2LA 1HT2E 2B8TA 3F0TA 2ZI3A 3PCRB 1NJGA 2BM0A 2OXCA 1XTJA 1YRAA 3C8UA 2JA1A 2AL7A 4Q4HA 4RZUA 4CF7A 1AKEA 2YINC 2Z5FA 3CB4A 3L0IB 1AIPA 1IN8A 4PHGA 4EQ6A 4G5GA 4A9AA 4DCSA 4QBHA 4E22A 3R9WA 4RVCA 2GNOA 3AKEA 3KXKA 3FDIA 2O8EA 2G83A 2YWFA 3MFYA 2IWHA 5EZ6B 3TVDA 4DIEA 1SULA 2EWWA 5HCIA 1WB9A 1JR6A 1Z06A 1HA3A 2UKDA 4D4JA 3OIYA 4HATA 3QXCA 2QA5A 1JR3E 1S1CA 1YQTA 2KB0A 3CRQA 4HDCA 4HZUB 1PZNA 2ZUCA 3V4FA 4ZKDA 3T1VA 3WNCA 4NL4H 1KI8A 3OF5A 4ZI3A 3QUSA 3I5XA 5F3WB 3QKTA 3Q5DA 1VTKA 2G6BA 2YWGA 2DHRA 1VECA 2ZI9A 4FCWA 4NONA 4TL8A 4MDEA 4ACBA 3ZLJA 4L16A 5SZHB 3TJZA 5B58C 1U8ZA 4LHWA 4XSHA 3W3AA 4TYPA 3TIFA 4CGZA 1OH6A 1VCMA 3CKLA 3R7WA 221PA 4KODA 3K70C 3OEHD 4NH0A 4P0TA 3WP0A 3TVTA 4NU0A 3UWOA 4B73A 2AXPA 1G3UA 3GJ5A 1MKYA 1GL6A 1NJFA 1XB2A 1A1VA 1M7HA 1SGWA 1KI2A 4EPVA 2VA8A 2YC2C 1XEFA 2B92A 4ARZB 6Q21A 2ZI4A 2W00A 4Y0VA 3SYNA 4DLYA 1OXTA 5BQ5A 5JHGB 1E9EA 3DMDA 3I32A 2ECKA 4RSGA 1S3SA 3SE0A 2IS6A 3FGNA 4US1R 4PX9A 2XB4A 2GAOA 2CNWD 4EAQA 1KI6A 4EUNA 2D7DA 1P9RA 1CEEA 4KITB 2DWQA 3IKJA 1LV7A 3H4MA 1AQYA 1MT0A 4BASA 2XJ4A 5TV2A 1TL7C 3IPYA 4Q03A 5DI3A 1F48A 4HB4A 1KSGA 1ZMXA 3K09C 2LCFA 2ZRGA 4O25A 5FTNA 3K0SA 4LV5B 4BZQA 4YMUA 1YR7A 2V1XA 3SYLA 4QGAA 3FKSA 4TLAA 4XH9B 1DTSA 4BLTA 2ZJOA 1OJLA 2RGAA 2CHVA 4FMBB 4DEYA 1MRSA 2WWHA 4MYTA 5D3QA 2Y8EA 5CYOA 3ASYA 3FMPB 2ZJBA 3LQRA 1PLJA 1F2UB 1P9WA 2NZJA 3B13B 3L43A 2Z83A 3HPQA 1D9ZA 4XVQA 4R98A 2IEYA 3SFVA 5KNCA 4AKIA 1G8YA 3TUZC 3HJNA 3H84A 1E9FA 4PZYA 2ZYTX 4IXNA 5EP1A 3TUJC 1IBRA 2XJ9A 2BCGY 1TMKA 1NMXA 2V54A 3W6NA 3AF3A 4M22A 4D4LA 2B21A 4L8GA 3TK1A 4HUQB 4DUGD 2IXFA 4MYCA 2WKPA 3MWLA 4BFZA 4P4SA 5DH9A 5J40A 5FUXA 3A1SA 4LDJA 3LX5A 4Q1BA 3A37A 2JGNA 1SXJA 1GNRA 3UMSA 2F1JA 4EPYA 3B9QA 1SVLA 3OEEA 2QMOA 3GCGA 1RJ9A 2R65A 4IOLA 4DT1B 3HWSA 4U7DA 1CXZA 2ANBA 2NTYC 3ZJYA 1DBSA 2J59A 5FBVB 4OK6A 5KNBA 2P6RA 4KBGA 1ZVQA 3ZVRA 1KAGA 2IUSA 2IWRA 2CHQA 2JLQA 4TQ9A 2Z0MA 3UIEA 2NIPA 5JWHA 1UM8A 4XTCS 1EFRA 2RMKA 4NYIQ 1HTWA 4QHTA 3BS4A 5FOTA 4M1YA 4D6PA 2XB2A 2ZVQX 3FB4A 2O8BB 4M1KA 1J2JA 4P3YA 3UG7A 1Q1EA 2F43A 1YR6A 1KNQA 2ODWA 2VPPA 2O8BA 2VLIA 2IXGA 1ESNA 1U90A 2HLDA 3BH0A 5KSOA 1G3RA 2PCLA 3DOEA 1P2SA 2H16A 4IXMA 4JVSB 1F2TB 1I4DD 1E2NA 1TUEA 3BRWD 4ITRC 4H1VA 4Q18A 3ZYCA 2ORIA 4YDHB 2QNRA 4Q4AB 3RRYA 3GMTA 3MWJA 1G3MA 4ACAA 2BMEA 1OFTA 1P7CA 3I62A 1DELA 4OK5A 2GF9A 2R9VA 1D5CA 2QE7D 4PZLA 1OH8A 1T5LA 3P4XA 1UPTA 2VHUA 3PVSA 3DM9B 5AUNB 3PG5A 1FNMA 5AK0A 3MLEA 3WNDA 2ZEJA 3K0CA 4UJ5A 4GSYA 5SZIA 5AJXA 5CLQA 3EC1A 2GXQA 3VFDA 2A9KA 4OYHA 3PENA 2BWJA 4M9QA 3QXSA 4IOKA 3PJRA 1NY5A 3ZD6A 3WMEA 3RNLA 4JL8A 4URYR 3W90A 2WSSA 3BWDD 3GLGB 4OQXA 3QPUA 1NG9A 2N42A 2P6NA 3BH6A 1VIAA 5P21A 1TQ6A 3RS3A 4HB2A 4LX0A 4MRRA 3X1WA 4OK3A 1FX0A 3PEWA 3ND9A 1CR2A 1QF9A 1WBBA 1WQ1R 3IILA 1G4UR 4H9GA 1L4YA 3AP3A 4DXAA 4Q1DA 4EIWA 4HAVA 4FWTA 4GP7A 2HDNB 2KBEA 4BFTA 3SJZA 5BXQC 3EA5A 3AVVA 1KYIA 4WW0A 3KFVA 1LNZA 1HQYE 4LC1A 3TBKA 2WJGA 1Y63A 2BOVA 2J5XA 2WPDA 2UZIR 4IKEA 3SBEA 4P33A 3O8DA 1DOAA 2PJZA 1G19A 1V43A 1QDEA 5SZKB 1GL7A 1E9CA 1QZXA 2FMXA 5EJEA 4WZ6A 4RZ2A 1EWQA 4KFSA 3SQXA 3DEFA 4B35A 1D2EA 4O3MA 1N6KA 2QEQA 1OYWA 1P73A 1U98A 1CJKC 2AHOA 3K9LA 1G4AE 3VHXA 3X1DA 2EFEB 2CL7X 4QNRA 3GP8A 4LJ4A 1G20E 1FFHA 1Q3HA 1OHHD 3NC0C 1NIPA 2N46A 3NKVA 2IBMA 5JEDA 1GM5A 4QHYA 5E7IA 4DZZA 1Z6XA 2WTUA 1IHUA 1UJ2A 2BBTA 4MRVA 5EZ5A 3T5GA 2MSCB 5HTKA 2BJWA 2QROA 1W47A 4CVNA 5JCPA 2JJ1D 3A4NA 3FFAA 4MKFA 4PAOA 4BECA 2XZPA 2ZU6A 3HP1A 3RRMA 2DY1A 3EIHA 1JBKA 1VHTA 1II8A 3EXAA 4DSNA 1E1RA 1E0AA 3HU2A 2NPFA 2VIIA 2BBSA 1GRNA 3QVUA 2RGDA 2NO1A 4ARZA 1Z22A 2C2HA 1KZGB 3GJ7A 1T3LA 4M4SA 1Q3TA 1QRAA 1C1YA 5CB8A 4RD4A 4ZPXA 2ZROA 5HCNA 4BLSA 5FH9A 5FPHA 3ZGXA 2O8DB 1IY2A 2XTZA 4Q00A 4NYMQ 1E2MA 3FTQA 2W2TA 1QG2A 1UKEA 1YJ5A 2GWHA 4P4TA 2GJ8A 3UXMA 3K9GA 2WAXA 2CLSA 2RGNA 2MMGA 3LLUA 2CXXA 3HR8A 2HCBA 3KJGA 3OEED 3GEIA 3E2IA 4GT1A 2ODEA 3SU8A 2FPKA 2BEKA 3B2EA 3OZXA 1XXHE 4D4KA 2PJRA 1XCPA 1N5KA 2VHJA 3B9PA 3GPLA 4CEJA 4TQAA 1MH1A 1OT3A 2BBWA 5DGXA 2TMKA 2YNMA 5KDLA 1IN4A 1T91A 2OILA 3BB3A 2VO1A 1HH4A 3OESA 1UAAA 4KYIB 4L4UA 4IVRA 4LSGA 3MSXA 1KZ7B 4WAUA 1U0JA 2PEYA 3T12A 4RCYA 4B2LA 1U9IC 3RVBA 2ZJ8A 4B32A 4BFVA 2GEDA 2CL6X 2QSYA 3CIOA 3O8BA 4DB4A 1P75A 3SQWA 2J0SA 1Z29A 4UQOA 2IYTA 2YHSA 1CJMA 1NG1A 3DHWC 1ZINA 1CR1A 3RAPR 1KI6B 1NMZA 5FR2A 3PEUA 3GFPA 4C0BA 2OBLA 4NCNA 4JT4A 2C03A 5E95A 5TARA 1G5TA 1KOFA 1NBMD 1NLFA 2QGNA 4HAYA 1SXJC 4ESVA 4KFUA 2ATXA 5C4MA 4PC2A 2GJKA 2VQSA 5LB4A 3RHFA 2HT1A 1N0WA 2B7CA 1EG7A 4EFNA 4IVPA 4M53A 3T5DA 2XZOA 3RS5A 3O8RA 4IOMA 4FMDF 2ZUDA 2F55A 1EXMA 1CJVC 1O3YA 3FYHA 1UDXA 1DO0A 1II9A 2AFHE 121PA 2XNDA 4JBXA 2NMVA 4W5HA 1Z07A 5B2ZA 4D2IA 1Z3IX 1FUUA 2Q21A 3VR1A 4EJSC 2QTHA 2WWYA 2FSHA 2OAQ1 4LPKA 4PAQA 3PEYA 2O8FB 1M6NA 2A78A 3LW7A 4F4JA 5HPYB 2A5JA 2QAGC 3GJ4A 2QMHA 4IEIA 4KFRA 5JLJA 1ZNXA 4B6FA 3TSZA 5TY0A 4BFWA 3I1FA 4EJSA 2C98A 5JRJA 2RAPA 1KY3A 2QAJA 1KMQA 1XFAA 4I81A 1COWD 3LA6A 1NLYA 4PC7A 4IJMA 1XCMA 2GILA 4L9WA 3EW9A 4Q7KA 3TGPA 4ON9A 5FBWB 1G6OA 2GVDC 1ZM7A 3GFTA 2R6CA 3UKDA 2ZRLA 1Q57A 4YMWA 3AVYA 3IBYA 4DC9A 3U6BA 5D3MB 1JAIA 2ZPTX 3WP1B 1RIFA 4GMDA 4GZMA 5FL7A 5JBQA 2W6JD 5FTMA 1ZUHA 2BV3A 2MSEB 3TW8B 4B75A 4ZDIA 1NVWQ 4DJTA 2NO9A 3ICQB 3B1VA 2ODBA 2H1LA 2VTKA 2H57A 4KO8A 4AK9A 4RFSB 1UKYA 3Q8XB 5J47A 1XP8A 1D2MA 1H8HD 4OKSA 4E5UA 2WBLC 2Z43A 4WBSA 1FL9A 5FL7D 1T6NA 1U81A 1KDOA 1RE0A 4LBYA 3C41J 3L8YA 2GK7A 3X2SA 1EK0A 4TTQA 3B1YA 1VCOA 3GLIE 2EFHB 1NRJB 2CLDX 4M1OA 5L3RA 1Z83A 1R0XA 3QG1A 2HEIA 4LGMA 5LD2B 2X77A 1VIYA 4M9XA 3TKLA 2IHYA 4PSVA 3LBNA 5DSZA 2AX4A 1ZC4A 3PEVA 1DE0A 3WBKA 3QEJA 5DIFA 1NVXQ 2Q9AA 3KQUA 2G0NA 2QP4A 2E87A 3Q3JB 4CEIA 2HUPA 3GLIA 3QKUA 2OV2A 1Q22A 2D4HA 2BHRA 1YZQA 1EFTA 2P67A 1QHHB 2C8VA 5JCZA 1NVUQ 3MWKA 4RD0A 2RGEA 2VYFA 4C0SA 4JT2A 4NE2A 3GEEA 3WYAA 4BGDA 2G77B 4JYCA 421PA 1VCNA 1E9DA 2IHBA 3QQ5A 4TYNA 1YZNA 2A5GA 2F43B 1VG8A 3GJXC 1E9SA 1CLUA 5B64A 2V1UA 2DR3A 4Q1FA 2BMJA 3M1IA 1OE0A 1Z2AA 3KL4A 3VX4A 4BWYA 1JPJA 4AKHA 1US8A 4PQFA 3F3YA 4Q4HB 1IXZA 2O8EB 3Q7PA 3FHCB 2QRZA 3F8TA 4GRAA 3B1WA 4B34A 5JJKA 1EESA 4V0OA 5HR5A 1MABA 3G5UA 3GEHA 3QBTA 2FDCA 3AVPA 5AUPB 3OEHA 1X6VA 1MABB 4M0LA 2J7PA 3VU9A 4RD2A 5HE8A 3Q9LA 1U9IA 4QGGA 3BGWA 2D74A 4G1UC 1M8PA 4AKGA 3RWOA 1TQ2A 3P32A 4C0JA 1E79D 5G40A 1TU4A 5M04A 1NKTA 4OHYA 1GNQA 1RRFA 3E5HA 1N25A 4KU4A 5KPJA 1SKYE 5L3QA 2FFBA 4JLVA 4ABYA 4CIDA 4DEXA 3B1ZA 2WJVA 3CNNA 3IDQA 2XNSA 1P5ZB 2DPXA 4MYUA 2A5DA 3RLFA 4N0EA 5IRCD 1S9DA 5J4VA 4FIDA 1ZM2A 4RD3A 4FCTA 2GVZC 1YR8A 3I3SR 3QJYA 5EXPA 1UEJA 5F2EA 1SVMA 1HT1E 2WZQA 1DARA 1GTVA 3P1JA 5JSZA 4EPTA 1G3IA 5CYPA 1OB5A 1MRNA 2CCGA 2NO6A 2CK3A 1JNYA 4PPQA 4OQMA 5CDFE 4C4PA 4ZO4A 1RYFA 3RABA 1WCV1 4DDVA 2YKGA 4KI0A 3VR6A 2IS1A 2O8DA 3TMKA 3SS8A 3SHFA 3KKOA 2RGGA 1XBTA 1II8B 4LJ5A 3EIEA 4LUCA 1N6OA 2QBYB 1N5IA 3NEYA 1A7JA 5FBQB 4YMVA 3LAWA 1KK3A 3RSOA 1IN7A 4TT3D 4NYJQ 4XD7A 1XXHA 2VSXA 3KKNA 3RRZA 1JQLB 4AYWA 1W36C 4A1FA 5GJWC 4E07A 1QHNA 5DYGA 5EP2A 3VQTA 3VU9B 2F7SA 1J8YF 4IW3B 2ZRHA 3IIJA 3PIRA 3LD9A 5FR1A 3R9XA 2GESA 4IFEA 4OQFA 2WWXA 4XIGS 3KB1A 1J99A 3NBZC 1OIWA 2XEXA 1P6XA 1XZQA 1XMJA 1TQDA 4AYTA 2FPMA 3KQLA 4C0LA 1E9RA 1Z8FA 1DADA 1XTRA 5FPTA 3P26A 2IYRA 3GJ8A 2JATA 3EX7C 4QFMA 4C2UA 1OIVA 5E3HA 2JLXA 1XTKA 2GBLC 3H86A 2PT5A 3DKPA 3FE2A 1GP2A 2BM1A 2QRNA 1OKKA 3IQXA 4QKQA 1SVIA 1U99A 1OF1A 2XTNA 1W5TA 2CVFA 2VSFA 4CRWB 1OSNA 4ESHA 2A2ZA 3ZS9A 3SEAA 1XD8A 5IT5A 1NVVR 3AM1A 4LBVA 1U94A 2QUZA 4QHSA 3LNCA 4DHEA 4ZV4A 1LF5A 2ANCA 4XJXA 4LBZA 2YVUA 4TMVA 4HYYA 5EE0A 3NC1C 5BN3A 5DN6D 4IRUB 4P31A 4BFSA 3CM0A 1TTTA 2WJYA 5JJIA 1WBDA 3OIVA 2IA5A 1KO1A 1MR3F 4KBFA 1X8JA 3U60B 2UZ3A 2E9SA 2IF2A 2YZ2A 4QM7A 5CK4A 1LVGA 2A30A 4D4MA 4AWXA 4R7ZA 4B3BA 4RCZA 3CRMA 1Z0IA 4PHTA 4DBLC 2YYZA 4NYIR 3C16C 1U2RA 2WOJA 3BFVA 4HDOB 5AJWA 2JCSA 1Z0KA 3CX6A 2R2AA 5GADl 3U7HB 3SOPA 4BLQA 3AP2A 4IDNA 2R6GA 1Z28A 2F9MA 3I5YA 4DLUA 2GCOA 3QOFA 3TH5A 4Q9KA 1G17A 2QE7A 1VG0B 3AVOA 3KKMA 1PVOA 3A1TA 1R5OA 3DZ8A 3VR3A 1E0SA 2UVQA 1OB2A 3IBGA 3CZQA 4QGHA 4X8HA 1KY2A 1BH2A 1E2LA 4GOXA 1ZYUA 3LBHA 2H18A 1Q21A 3OAAD 4O0MA 3VHLB 4CT4B 3LXXA 4UNSA 3WNBA 4UNRA 4DDTA 4JVLA 2WICA 2QTVB 4Q4AA 1EWRA 1HE1C 2GZAA 1IJEA 4LI0A 4FI3C 1FTNA 5H1YA 2GXUA 3BJIC 2O8FA 1Z63A 1IXSB 4A2WA 3A8TA 3DVLA 2ZSEA 1K6MA 4HZUA 2F1HA 3Q85A 4LPSA 4LV6A 4IDQA 3LFUA 5GJCA 3VR4A 1CKEA 1PLKA 4XVRA 1YE8A 2JAQA 3IHWA 2PL3A 1E4VA 2JJ2A 2W58A 1KGDA 3AP1A 3WRXC 2JLZA 2BKEA 4KHZA 2QQEA 4DIDA 4M1TA 4IDOA 4LY6A 1ANKA 5DHAA 3HYRA 4GP6A 1U8AA 3GLHB 3L0SA 821PA 4D82A 3QXJA 1X1SA 4Q19A 2J3EA 2F6RA 1S9HA 2HLDD 3D7MA 1S1MA 1KKLA 4HZIA 4B3XA 4TN1A 2GA8A 1G8PA 5DISB 4DCVA 2GHIA 3W6PA 4R2IA 3LLMA 2KWIA 4D0GA 2YOFA 3X1XA 4TYYA 2BKUA 3MMPA 4HI0E 2IX3A 621PA 3UANA 1N6RA 5DNYB 1KO7A 1CJUC 1NIJA 4A8JA 3U61B 2G88A 3KFXA 1VYUA 5A5GA 4TYQA 2YC4C 5B57C 2JLYA 3BFKA 4B3DA 3SZRA 4F92B 5JS7A 2IT1A 1KSHA 4ZDWA 3AF2A 1ZCBA 2Q3HA 4KV9A 2QPTA 2ZI7A 3TE6A 4PPNA 3WMGA 1IY0A 2I3BA 1XJCA 1ZNZA 4CEJB 3EWAA 1R6BX 2FE4A 2AN9A 3B6EA 3BERA 4JSYA 1S3GA 2VSOA 2QPOA 5FTKA 3VTKA 3W9YA 2HCJB 2JLWA 1GDDA 5TDHA 4D25A 1W36D 4M2LA 2FOLA 1ZNYA 2FSIA 3MWYW 1T3SA 1G5PA 3LW8A 3LXRA 1D2NA 1G5RA 2A3RA 1FNNA 4FWIB 4Q9LA 1UKVY 3OIUA 4DSUA 1OLOA 2W6ID 3Q7QA 4NKRA 2J0QA 1TEXA 1WDTA 3GLIB 1NMYA 2ZJZA 3PUXA 1Q44A 1IQPA 3DMNA 3KDSE 4AURA 2I4IA 4YMTA 3UWKA 1I4TD 3U3OA 4Q02A 5KPDA 1LFDB 5CITA 3UMRA 2H17A 2FFQA 3V00A 1XMIA 5DHFA 3CO5A 3K0AB 3BORA 3IIKA 2WJHA 3H0KA 4B6EA 3ZVNA 2XOKD 3SI7A 2PLRA 1XRJA 2XITA 2L0XA 3O8CA 4DCNA 1T0HB 2P2LA 3B82A 4Q47A 3THYB 3MJRA 2PLFA 3ICEA 4TLEA 3DM5A 1SHZA 1JB1A 2EFDB 5F98A 2LKDA 5DLQC 1W4BA 4TTPA 3PQCA 1ODFA 1ZM4A 2O0KA 2O5VA 4LV8B 4L5BA 4OHVA 4X8MA 2PMKA 3SJBA 2W2XA 1AGPA 1G21E 3RS2A 1ZJ6A 2W83A 3P20A 3IO5A 4L15A 2OCPA 3AKCA 3KJHA 4F7WA 1W4AA 2ZRMA 3NEJA 5C2JB 3MD0A 4DUGA 2IYVA 1T9HA 1NF3A 1WF3A 4KJZA 2VF7A 1P2UA 4CEHA 4EPRA 4Z1MD 1E2JA 2ZVPX 3VMFA 2W6JA 3LVRE 1VCIA 4HLQB 1JJ7A 4QBIA 2YWHA 2Q3MA 4LYAA 2ZAMA 4M9SA 4KSBA 4V0MA 3OFND 3ZQ6A 2C96A 4JLDA 4LHXA 2AKAB 2R6AA 3ASZA 4HAWA 2CCJA 2CE2X 2VP2A 2NO7A 3FMOB 3QKRA 4LJYA 1DAMA 2ONJA 1G41A 1SVKA 1QHIA 3GLGE 4CEIB 4Z54A 2CDNA 5TXGA 1CU1A 4MQBA 3FKSD 1E2DA 4DLWA 5FPKA 2P0EA 3L8ZA 3HDTA 3U7FB 3K70B 4G5RA 1T5IA 1N0UA 2JDIA 2REBA 3KKQA 4KVGA 3BBPA 3KB2A 3W8NA 5HKKA 1XPUA 1G7RA 3WHLA 1YZTA 2DFKB 4YQFA 3B85A 2WKRA 4RFSA 2W0MA 4TMZA 1YZGA 4V03A 4G01B 1RJ9B 2B7BA 1CRQA 2ZITA 2GEUA 1QHXA 1G64A 3ZZUA 2J41A 2QENA 1ZD9A 1GKYA 1J70A 4HLCA 1AGRA 4NCJA 1G16A 4Q4JB 4URXR 2DBYA 4YLGA 3ZVLA 1AS0A 2ZREA 4UNPA 3THXB 2ZE7A 3SC3A 3T15A 4JLKA 3CX8A 2A5FA 2AFIE 2C78A 1E2PA 1Z6TA 3ZD7A 1E99A 1XTSA 5LBIA 1GVNB 1XTIA 2FZ4A 2XXAA 1CTQA 1HY3A 4A2QA 4BZXA 5H68A 2NPIA 3U2QA 4P4SB 2D06A 1GITA 4I1SA 2BC9A 3WMFA 4B44A 2ATVA 3CW2A 3GFOA 1SVWA 4HLDA 4F93B 1RC8A 1JR3D 5CK5A 3K09A 1WA5A 4OL0A 4QGFA 3NDBB 4DDUA 2GEVA 2O0HA 1G18A 2ZRKA 3FKQA 3MG9A 3A1VA 2FGKA 2RKOA 2FEOA 4W7SA 4R71A 3AQ4A 1EFCA 3KTAA 4JLOA 4PQRA 2ZSFA 3ETLA 3K9NA 3HYTA 2FF7A 4UXHA 4JBYA 2DFTA 1VG9B 2QAGB 3ADCA 2H8KA 4PO9A 1TF7A 1C4OA 1DAEA 2GZDA 2V8OA 4C9BA 3FHTA 1ZD8A 5JZVA 3QF7A 4DCUA 4KYUA 3RWMB 1NN3A 3AEZA 3TNFA 2C77A 2PCJA 1DAIA 3PUVA 4TLDA 4TL7A 5E7JA 1P62B 4IOJA 2CE7A 1S0UA 2GDJA 1BO6A 3JVUA 1W0JD 4A0HA 1LTQA 2IL1A 1N6HA 3A36A 4B47A 1VYTA 4E03A 4JVNA 3HU3A 1G9XA 3CRVA 4LYFA 4A2PA 3LVQE 5KNDA 2WJJA 1ZAKA 5F9FA 2GXSA 1Z0DA 3KJIA 4KCGA 2P65A 1OXVA 2R6FA 3U4QB 2CCKA 1FP6A 2WIBA 3QG5A 1T3HA 4JJZA 4V0KA 3AVWA 2JIZA 3TQFA 2FA9A 2D7CA 4TQUS 2D2FA 1KJWA 2W0SA 2F1RA 4HB3A 1QVRA 1QBKC 2OCYC 3U44A 4TZ6A 2WMOB 3QKSA 1F60A 1ZIOA 2ZYVX 5KYKA 3CR8A 2GXAA 3BB4A 1M34E 1AQUA 4OHXA 5LB2A 5TB5A 4NTZA 3HPRA 1JEDA 1F5NA 2GJSA 2MMCA 2I1VB 3G0HA 4V0NA 2IYQA 1LF0A 1MO5A 2KE5A 1DPFA 3TUIC 1I2MA 3C15C 1J8MF 1R5NA 2QGZA 2PZGA 2X8AA 1E69A 3SFZA 3GLFA 5J4HA 2DWOA 1LS1A 2QY9A 5FOUA 3IPXA 1UEIA 1ZM3A 3IIMA 4XD7D 5JWOA 3LQQA 4B76A 1ZM9A 1E79A 3CNOA 3RS4A 4C0KA 1OV4A 3EAQA 3PUZA 4M8NE 4PZZA 5EUMA 1EFUA 2V7QA 5AUQA 1BIFA 2HJVA 2J46A 3GQBA 4M1SA 5K8IA 1AN0A 2IF0A 1K5DA 3AB3A 5IHPA 3IHLA 3BC1A 4Q66C 5JECA 1L2TA 2WWFA 2NQ2C 4F4IA 1GUAA 2IYUA 1EX7A 3SHWA 2YOGA 1FPMA 1YKSA 5AUOB 4IHQA 4IVQA 4YMSA 3T06B 1XPRA 2CNWA 1P2TA 3IQWA 1AS2A 3ZH9B 5AJYA 3FVQA 3EARA 3KQHA 1E2IA 1R8QA 4B48A 4MGIR 1KDTA 1WXQA 1CIPA 3U3MA 1M1YE 3K0AA 4DSTA 1PUJA 1W49A 3RSLA 2V9PA 4AKEA 1H8ED 3T1OA 4HLUC 2EQBA 5AJVB 2AKYA 4DB2A 3TAHA 1ESMA 2REXB 2ZI5A 1N2CE 4D0NA 2GETA 3IGFA 5BN4A 2VHCA 2VP6A 4URVR 2C9YA 3MGCA 3EZ6A 4FMCB 4PPGA 4DSOA 2OG2A 3ECCA 2NO0A 1TADA 2WWIA 4BE7B 3FOZA 4FMCF 2D3WA 4PC3A 4X8OA 3AH8A 4LJ8A 1DO2A 4UNNA 5HE9A 2J0UA 4M21A 4RD1A 3TR0A 4GI7A 4B71A 1E96A 4CZ2A 2GJ9A 4LWZA 2QL6A 4G5SA 1GZSA 2OCAA 3M0EA 4URZR 1A2KC 3C4JA 2ZE5A 2WVJA 4LHYA 1A5TA 3U7GA 2XXAB 2AR7A 1E9AA 1FMLA 4Q4JA 4A4DA 4LCBA 2Q0HA 2JJ8A 1KI9A 2OSBA 1OKKD 1RFLA 1WP9A 3FFBA 1CP2A 4D26A 3K1JA 3KZ1E 4QOSA 4PSAA 1NLZA 4HB0A 1Z0FA 5FPSA 2IYLD 2KJQA 3UK6A 3VX3A 4A15A 4EFLA 1NN1A 3R9IA 1NI3A 1OFIA 3MAAC 5BWMA 2QBYA 1FOEB 2H7VA 3BB1A 1GRQA 4EPWA 5FTLA 4ILEA 3REGA 2OO7A 2ZRBA 1FW6A 1CR4A 2P3SA 4CW7A 2GCNA 2O52A 1TU3A 2ZJYA 1S2MA 3A4LA 4JJKA 5EP4A 2Q3FA 2HF8A 3P27A 1UBGA 2IEZA 2IW3A 4MGYR 3AF4A 4M9ZA 3TSWA 3T1TA 1Z47A 3CBQA 4QJ5A 1TAGA 2BDTA 3I72A 3JZAA 1GL9B 1HQCA 5FFMA 2ZUBA 2PX3A 1FQKA 2HV8A 4W9MC 1AKYA 4DLZA 5FI0B 2WM9B 4JYBA 4NP6A 2P6UA 4IFBA 1UFQA 2C5LA 4WXPA 2ZJ2A 1OFUX 5B30A 3WYGA 1XTQA 4XWOA 1GG2A 3GLFE 5AR1A 4OBEA 2ZS8A 4V02A 3RS7A 4ZIRA 1E3MA 1T8TA 2C95A 3ZS8A 1W36B 1YHNA 4QC2A 1RRPA 3GLGA 3JVVA 4O2RA 1W4CA 1Z0AA 1GKIA 3CZPA 4C0AC 2AWOA 3N70A 3NWJA 1MO4A 4Q7LA 3NVAA 2ONKA 3B8HA 5DN6A 2FH5B 2WJIA 2WSSD 4UXJA 1CRPA 1KJYA 4NCHA 3DKVA 3KJEA 4OJKA 1N6IA 3HU1A 4EDHA 3CUEF 1HURA 1XDBA 2GK6A 4LYHA 2BVNA 1TEVA 1NSFA 1TPZA 1UKZA 4H1UA 1SVOA 2OBMA 2G9NA 1E1QA 4TWZA 2ZSBA 1KAOA 1TNDA 3L0OA 5FPYA 1ZU5A 4B33A 4I1VA 5CJPA 3BK7A 5FI1B 4Q9IA 4WIAA 4BFYA 4DWJA 4MKGA 2NGRA 2ASEA 3QEOA 1N6NA 3QIAA 3AKDA 3AKYA 3JZMA 4D0LB 4YONB 2ZS7A 4GPTA 3K9HA 2EW1A 4G5OA 1KK2A 3NH9A 4UXIA 4AI6A 3SN6A 2WWWA 1F2UA 3NBYC 3OAAA 4TMTA 2FG5A 3K0FB 4I1OA 1IAQA 3EZ2A 3WXMA 4DLVA 1G7SA 5EE9A 4E09A 1HV8A 1OXSC 1N6LA 1YRBA 2QT0A 2RGBA 2RB4A 1PV4A 1IN5A 4Q21A 4G0NA 4QBGB 3FPAA 4QM6A 4JMPA 2CEAA 2ZANA 1OXUA 1UBCA 4I4LA 4JKIA 3T34A 3CRRA 4MITA 4NZYA 4GOJA 4QJ3A 2GTPA 1E2KA 2GCOB 1Z0JA 3A1WA 1VG1A 1G8HA 2KI5A 4QG7A 4G3XA 1FTSA 3L0PA 4MGKR 4DLRA 1J7KA 4DT1A 5JMTA 4NBSA 1MOZA 3BIFA 4PPFA 3UPUA 5CM8B 5L3VA 1E1RD 3CX7A 3EZFA 4PXAA 1HYQA 1E0JA 2CBZA 5A0FA 3ZQJA 4LC0A 1W0KD 4MKHA 3CF6R 4BQSA 1ZU4A 1VMAA 2AXNA 1U0LA 4FXPA 2QM8A 4JLPA 4KLNA 2OE2A 2Z6VA 5HZKA 3CLVA 4JLMA 4MKIA 4PQYA 3FWYA 1GOTA 3QI2A 2O8CA 3VKGA 1E2FA 1ZD1A 1EFHA 1OW3B 1UBEA 1YZUA 2FSGA 2AK3A 3RC3A 3R7WB 4PANA 1GSIA 2G0TA 1M2OB 4GOKA 4QNMA 3WBJA 4WZAE 2OLKA 5IF9A 1IXRC 2C99A 3B7GA 3LWNA 4Q48A 3OHMA 4LOAA 1OPXA 1T0JB 3CPHA 2CK3D 4B74A 4PO8A 1L7VC 2FNAA 3F5FA 4ASUD 4XWKA 3RS0A 3EPJA 2CLCX 2ZJAA 1V5WA 1X8LA 4OI4A 1G8GA 3O47A 5LPNA 3KQNA 4BFXA 3THWB 1HEIA 2AD1A 1FQJA 4S2EA 3NDPA 4M1WA 4RJLA 4U5XA 1DG3A 1H65A 1FMJA 1ZUNB 2XAUA 4G5QA 4B2IA 5GVSA 2V6JA 4TT3A 3OE7A 1SHKA 1U0HC 5K8TA 3DO6A 2W6IA 3CPJB 3CWZA 5AWFC 3MJHA 4C0HA 3KKPA 1O87A 1P2VA 2FU5C 2ZRCA 4KXFB 2ZRNA 2LWIA 2Z4RA 1BMFD 1ZUIA 2DYKA 1VHLA 2IYWA 1XJQA 3VKWA 4I99A 3U3KA 2QTFA 1R0WA 2XGJA 1WE2A 2VP5A 5KSZA 3AVXA 2ZIAA 1G8FA 1X3SA 4K8OA 4FMDB 5K8LA 4Z8XA 5CIWA 2BEJA 1BOFA 1I2DA 4LHVA 1BMFA 2W2VA 5FBRB 4BRWA 2REOA 3W5JA 1GWNA 2ZR9A 2QMEA 2WIAA 1GFIA 5CM9C 5EXTA 4Q7JB 1US8B 3OIWA 4B3CA 3EA0A 2ZYUX 1DS6A 2OFOA 4UJ3A 4A6XA 5LD2C 2IC5A 4TMXA 1MV5A 4U00A 2VEDA 4URUR 4ZCIA 4FN5A 2QAGA 1E0KA 5FUVA 2R44A 3CF0A 3CWQA 5J4YA 4JS0A 2ODNA 2F9LA 5FUWA 2PX0A 3QE0A 3CH5A 4C3ZA 3TLXA 4PHHA 5GJBA 5IK2D 1P60A 5G41A 4ZCLA 2QU8A 2XSZD 3KQKA 2Q9BA 3GLHE 1G7CA 4C7OA 1HE8B 4RD6A 1ZNWA 2VH5R 1OXXK 1KIMA 1KI4A 1R0ZA 3X1ZA 4LZZA 1Q0UA 5JSZB 3AVTA 3A1UA 2IXEA 5FBLB 1KNXA 2R8RA 3U6KA 3THOA 1LY1A 5EE1A 2VL7A 2PZEA 1VPLA 1QHSA 5L3SA 4JL6A 3G82C 2ZAOA 3QKSB 1W7AA 2R6DA 4WVFA 5GVRA 3SR0A 1KDRA 3U44B 1Q1BA 4B3FX 4Q4LA 5DI3B 3MRSA 1EGAA 2RH5A 4Q1AA 4PTLA 5KU1A 3ADDA 3I73A 3A58B 2ZI6A 5DE3A 1X8KA 2CMKA 4NHOA 4DLTA 1H8HA 5F9HA 1L4UA 2J0VA 3QY0A 3TRFA 2FX3A 2OXRA 1MO3A 1KSFX 2ZR7A 3LV8A 3NTUA 3Q72A 1GRRA 2OUKA 5G3ZA 4ZCMA 1XPOA 4A82A 3REFA 4JLJA 3QPVA 4DCTA 3QPWA 4KLZA 3CPEA 2RGCA 2OT3B 2FEMA 2V4ZA 3CNLA 2ORWA 4WZBE 4Z51A 2RHDA 5KDDA 1JXOA 1DAFA 1SXJD 1YR9A 1D6JA 2ZXUA 5EQTA 2HYIC 3PR1A 3QNUA 5FOVA 721PA 4PC1A 3KXLA 2JDID 3NIBA 2ZE8A 4GMXA 4NCIA 1B23P 1VDZA 1VKJA 2VBCA 2HXYA 3AVQA 5KO2A 2JLUA 3P4YA 4OJQA 3KTAB 3QXHA 5JS8A 2DWPA 3H2YA 2CJWB 2EVWX 4Q1CA 4C30A 1QHHA 4V0LA 4RKFA 4II7A 4Y0AA 4BEJA 2CJWA 1R10A 2SHKA 3GJ6A 5L3SB 3MUFA 4J0QA 2N1BA 2ZSAA 2J9RA 3QSYA 1W0JA 3NBXX 4C7OB 1FX0B 4PAMA 2G1JA 2ERXA 4OI1A 5DYIA 3U7EB 5JEEA 1W1WA 4QL3A 4KVAA 3H1TA 4LRWA 3WYFA 1HUQA 1OFHA 3T61A 2RCNA 4XTRA 3VNUA 3LX8A 3B60A 1AK2A 1A82A 2V6IA 3K0EA 1Q12A 2X19A 4Q9JA 1CS4C 3B5JA 1XJ0A 1E94E 4B43A 2J7PD 3D8BA 4TLBA 5CDFA 3EC2A 2VP4A 3U4QA 2GF0A 4HAZA 3ZDQA 1WRBA 1IJFA 3DL0A 4V0ME 1XNJA 3NG1A 2FSFA 4OQNA 3M4YA 3THYA 2OLJA 3TQCA 4AIIA 2A5YB 3VAAA 5EE3A 3TW4A 1A2BA 1XEWY 1R5BA 521PA 2EFCB 2FV8A 4F38A 3VNVA 5KUTA 1NL3A 2QQ0A 3GLHA 4M1MA 5CIQA 3SJCA 4X8LA 4GFDA 4BFUA 1SXJB 1W2HA 2HT6A 2EFGA 1KKMA 3LO5A 1BYIA 4EPXA 1QHGA 4PSKA 1OH5A 1Z2CA 4Q01A 3C5CA 1IONA 1XMVA 1TX4B 4N0DA 1P61B 3OE7D 4HEJA 4R2HA 5EE5B 3ZZTA 3RRNA 3AF0A 5IDVA 3E1SA 2JIZD 1R8SA 1S96A 2JEOA 3UATA 4MGZR 1KJZA 5HZHA 3DZDA 4ZI2A 2ZU0C 4IDPA 1Z5ZA 5BW8A 2WV9A 4F91B 1AS3A 1CJTC 1W4RA 4W5JA 4PO1A 1QHYA 2OCBA 2V7QD 4TMKA 5TVKA 3EG5A 3T35A 4LK2A 4A0RA 1W0KA 2OFWA 4OHWA 4Q9HA 1ETUA 3EASA 4LJ6A 2E1RA 2PBRA 1QVAA 2ZRJA 3IO3A 2LKCA 4JIMA 4U02A 4CEHB 5H8WA 3KXIA 2QSZA 1G1MA 2D62A 3WRYC 1N6PA 3EPKA 5JI3E 1SQ5A 1KSJA 1TUIA 1W48A 3EWSA 3W8RA 2HYDA 4UNQA 4PFSA 1RPZA 3LBIA 4JLAA 3X1YA 2WMNB 1XMSA 2XOKA 4OHZA 1LS6A 2IUTA 4DVGA 1D9XA 4LBWA 3AGPA 4IDHA 3UG6A 1E2EA 3FHOA 3HR7A 3V4RA 4FD2A 1I4LD 4Q1EA 3IUYA 2QP9X 5JWRA 1E32A 4TSFA 1E9BA 3PUWA 2MSDB 4GDFA 1IOZA 1R2QA 1RRGA 2FFAA 1X1RA 3CONA 3U3JA 3AGQA 4K81B 1G6HA 3I8SA 1X86B 1R7RA 5TMPA 3QVVA 4HUTA 5K8UA 3S1AB 5JI2E 1W44A 3R8CA 1EFRD 4RZ3A 5D3MA 2ERYA 2J45A 1SVSA 4WXRA 3FMIA 4EFMA 1ZCAA 1II0A 5C18A 2BCJQ 2J7KA 1NBME 4NYMR 5KOYA 3QKRB 1Y3AA 3QF4A 1KK1A 1KI3A 3NBFA 3PUYA 2QN6A 2ORVA 1D8TA 3GJ0A 3K53A 3NXSA 3N2EA 4EJSB 2ZRPA 1NNEA 5BYJA 4MRSA 1UDWA 3KX2A 5EP3A 4KAXA 1TF5A 5BYKA 3BH7A 5KTYA 3D3QA 3K0FA 1G291 4TZ0A 3LH5A 4ZKEA 2BMFA 3VR5A 4MYHA 1W5SA 4AD8A 3CH4B 3PFIA 3U3RA 2WSMA 1KHTA 3BOSA 3W34A 4LYJA 4HDQB 2DFLA 4KFTA 2PMDA 4I1UA 1RZ3A 4N1AA 4QJ4A 4P4UA 1T4GA 1S4QA 2F1IA 1KO5A 5GJVC 3B78A 4Z1MA 2PZFA 3DDCA 2O8CB 5ELXA 4Q7MB 3ZIAD 4LHZA 5E4FA 1YU9A 4JL5A 1GKUB 3AUXA 5G3YA 4RKEA 2ZM5A 4AG5A 2XZLA 4LJ7A 2QZ4A 2ZETA 4GL2A 4D80A 1G7TA 3W5IA 2J87A 2QORA 2QP3A 2WWGA 4AYXA 2OZEA 3SYKA
chains in the Genus database with same CATH superfamily
1BVUA 3DXYA 4EHKA 2B8EA 2FZGA 4G5FA 2H85A 1LC0A 2QI9C 3LMKA 3V7YA 3DS8A 3U17A 5GZ1A 5HOEA 1IN6A 4MV0A 4PRZA 4BPRA 1AZTA 3WLHA 3KQQA 1Z12A 3GBSA 2CLIB 1KC3A 5CB6A 3BJZA 1IC6A 3ZCPA 1WW2A 2BEUA 2ZBGA 4Y98A 5L7WA 5CX4A 3E2PA 4MPDA 5M3BA 4DCPA 4AMVA 2CXUA 1K6EA 3Q0EA 5J9FA 1DDGA 2A9RA 3E82A 3AF5A 2IYYA 1Q0HA 4NR0A 5F5NA 2XXJA 4D8UA 1WSAA 2Y3IA 2ORED 1VYVA 3CISA 3F6EX 4MA4A 1LZLA 3ZU4A 1QLHA 2YNMC 3GW8A 1A98A 1ZESA 3COYA 3BD9A 4UHHA 2II6A 4OFXA 4Y2UA 3V4SA 4KWTA 4BRUA 2C9CA 4AUMA 2OV1A 1P3JA 2OO5A 5KYNA 1WMSA 4ZVKA 3RFCA 4FB5A 3GMIA 3V8BA 3BCUA 1U5CA 2IOFA 3AETB 2XB8A 4B4UA 2DCUA 5C46F 4X45A 2C1EA 2H63A 4IIVA 1ZW6A 2OLEA 2JD0A 2HFKA 1XQ6A 3MMZA 1A2QA 2P30A 3N6VA 1J8DA 4KQHA 1CIJA 2EU8A 1Q7RA 5AVVA 2VJMB 1H93A 1K5PA 4HLUA 1HNXB 1PI3A 1XTTA 2FE1A 2ZBFA 4D96A 2Z56A 2HDOA 4GZLA 2X6QA 2CHGA 1FZQA 3OQHA 3FSJX 4MRNA 3TR5A 5IDQA 3KPUA 1JRLA 1GZDA 4I4IA 3IQIX 1LJLA 1KI7A 2MINB 2C04A 3GJTA 1E3LA 2NACA 2ZBDA 2FVXA 4UHEA 5FULA 3HJRA 4A8JB 5TE9A 4KDEA 3DWFA 2PH1A 1J2UA 1DX4A 2IZOA 2JJ2D 2QRJA 3G2MA 1LTKA 3MLBA 4MUMA 2QZSA 1HDRA 3GDWA 4LJAA 2MYNA 4G84A 5FWYB 4A26A 4F2GA 1N2IA 5LQCA 2Z6UA 1CEYA 1CF4A 2VWQA 4ZDJA 2FPSA 3T7JA 2IHKA 3EH1A 5BV2P 4ZHSA 4JXZA 3UNXA 3DOFA 2B4YA 2F3TA 3GD7A 3B1KA 4X7MA 2PRIA 5KYTA 1NSYA 3H18A 1O9BA 3ZWCA 2FMHA 3L05A 5HVNA 1I94B 2Q8QA 2BBOA 4M38A 4WXMA 4GR4A 3WWCA 1C7FA 1QJCA 3BFXA 3ICWA 1N2CA 2AVDA 5HF8A 3F5QA 4FFBA 4WOPA 3C6QA 4YHBA 1YS1X 1EP1B 2HJGA 3CLTD 3KKLA 3RH0A 2O54A 1TO2E 3HVHA 4RSHA 2JVIA 1E2BA 4UFNA 4IMIB 5E9AA 4DZRA 2HSDA 1XEWX 3PJGA 5L7YA 3K8YA 2I8LA 3PCXA 3QVLA 4PHFA 1YAHA 5EUQB 2JCGA 2H6EA 1XRPA 2BFBA 3IP9A 3LWBA 5KQGA 2X0RA 2Z4SA 4C0XA 1DAKA 4ISCA 2KSQA 1KDYA 4BB9A 4OM8A 4NYJR 2FPPB 1NUTA 1K6IA 3Q0TA 1TCCA 1XX6A 5JAZA 3G17A 4QA9A 3COVA 5TGDA 2A9VA 4DLSA 1ZRHA 2IYNA 1BS9A 1CUIA 1R4AA 2Y2UA 3WBFA 4RK6A 3LUKA 5IT9A 1QB7A 2RHBA 1EUCB 4HK4A 3KEOA 4CI0B 5JSFA 1U7XA 2HRCA 2QE6A 1BW9A 3K70D 4MLCA 2YVQA 4WTOA 4EW3A 2O50A 2FFHA 4LG1A 2ZCUA 4FEAA 2YY6A 4J6FA 4HDRB 1O9GA 3B6MA 2A7XA 2EYQA 1OWPA 3DV9A 2JLVA 3MFQA 5IKPA 1E8MA 1UUFA 1IY1A 3SMQA 3WLJA 3MCVA 2B2XA 2WT9A 3DZHA 1N3BA 3UT5A 1DG1G 4LF9B 4K7JA 2Q6TA 4Q3OA 3IXLA 4KN6A 3VR2A 1XRRA 5BP7A 1A72A 5CURA 2RHMA 3KALA 2VN8A 4MHSA 3RGGA 1SBTA 2CFCA 3B1FA 1NN5A 5T4EA 3I2YX 1XLUA 1RI4A 1HF3A 1IIRA 2OHFA 4YJ2F 1H6CA 1U5BB 3AEKA 1BE6A 3P2JA 4JP3A 3NJ4A 4H7FA 5DKFA 4QXAA 4BLOA 4HDNA 2FWAA 2NG1A 4YMLA 2NX2A 2W6PA 1W96A 2YHUA 3I9OA 3TZQA 3UK2A 4EHDA 4EJ6A 4IFTA 4WZZA 1KWKA 4W9RA 2ZYWX 4B8YA 3GYGA 4OYLA 3V7NA 3JSAA 3LC1O 3WNQA 1SUCA 1BKDR 3VKHA 3H1FA 4QIHA 3MNFA 5G53C 4EK9A 1CV2A 2VJCA 1O5OA 3WWOA 2AD5A 1GUDA 4TMWA 3GLFB 2IIPA 1COWA 5ISMA 1OBFO 2ECPA 5GPBA 5T8KC 3RCBA 3W3ZB 2YV5A 3BE4A 3BZBA 2VSNA 5UKDA 3U9SA 3K30A 4BP9A 4REOA 5I6DA 3EYAA 3EXG1 3KSAC 1BCSA 2D5IA 3RREA 4R2KA 1RXSA 3UAVA 3CLKA 4RA6A 2J3LA 3OD5A 4E6PA 1YNOA 3N1UA 4FFLA 1QO0D 2IZ5A 2ZRDA 4IEEA 4JBWA 2X8LA 4MEBA 4MUJA 4YREA 1ZXLA 2GN2A 2XA9A 1N7IA 1CWUA 4PF1A 4LRSB 5J4KA 4HFJA 5MDHA 2C4UA 2NNWB 3LRPA 2JHFA 3I4LA 3HS3A 5DM4A 3PNVA 1Z26A 1NW4A 1Z16A 2OCXA 2ZR0A 4U8HA 1MX5A 4TRMA 4ALLA 4NMMA 3EXHA 1HNZB 1FZTA 1MJGM 4DMCA 5I7FA 1WZ2A 1DBIA 1Z08A 1WCIA 1N8TA 1WDKA 2O0JA 2VQ6A 3NBAA 4OOEA 1FUIA 2HDHA 1U3CA 2HXSA 5FOWA 3A4MA 1PW5A 3B2QA 4MKRA 1G59A 4NDZA 4H60A 5C0OE 3I61A 2CVHA 2OBBA 2YJTD 1AV6A 4RKRA 4ZEXA 3UV7A 4FYWA 1YTUA 1BYUA 1V1MB 1U2ZA 4AZ0A 4CIYA 1ZGGA 3V1LA 3ADKA 4R9NA 1JKIA 3WI7A 4AJOA 2H54A 4NPHA 4ER5A 3KPYA 1KQOA 1XLTA 3NUQA 4O59O 1KI1A 1LVUA 4RPKA 5DBGA 2QPAA 4ZVLA 3H3XA 1O94A 3TSOA 1ZMTA 1P80A 5IJ0A 4YCSA 2WHRA 3WLLA 5B6JA 3GIWA 1KK0A 5A7HA 1I3MA 1O8CA 1RWBA 2HF9A 1CBUA 1RWVA 3EZ7A 5IWAB 4YHHB 3CF2A 5C34B 3VGJA 4B2PA 2GO7A 2GRJA 2IPOA 2RDMA 4LF8B 2CWDA 2CL0X 1T8UA 2G1KA 2OK7A 4KIJA 5EJAA 3AY3A 1C2TA 2YVAA 4MVYA 4IVNA 2VF5X 4S3MA 1NBMA 3ZOKA 3CVWA 2GAAA 4CFYA 1RVDA 2IYZA 2XX3A 3PUIA 3QVJA 2J0UB 1WVGA 5K4GA 2ZRAA 2B1QA 1UK8A 2QV0A 3OMLA 3R2JA 1FUKA 4U7HA 3JQ9A 4X24A 1OYYA 5FF9A 1I0LA 1FEZA 3FTNA 3QX8A 1Q20A 1Q7GA 3EXHC 5J23A 3RK1A 3SDZA 1N5DA 5IK2A 4TQGA 3IAS6 5FOXA 2IOYA 3EOZA 3D6TB 5CW1A 3KZMA 4R3NA 1WUJS 3KG2A 3QXXA 3EEBA 2VT7A 3WX0A 4EY4A 2O2YA 4AULA 4ZYZA 4E08A 1XOIA 1A76A 1Z34A 2P35A 2X8WA 4GMHA 5A04A 3TZCA 3IQZA 3PQEA 3RANA 4AG6A 2X2OA 1P72A 4AN1A 1EVIA 2GZHA 4TPKA 4NOLA 4WSOA 2JBAA 4N48A 1M2EA 1BWSA 1SQFA 4WKBA 5JBIA 1SZPA 1A4RA 3CZRA 2V6GA 5AI5A 3HUFA 2VZ9A 3W04A 1GUFA 4ERNA 1U28A 4PG4A 1RI5A 3JATB 1X77A 3IVXA 1SIOA 3ONNA 4QDOA 4R83A 4ZDKA 3HCEA 5I7SA 3R41A 2DB3A 3TMAA 2E37A 3IS3A 3D43A 2L2QA 5FUYA 4XX1A 1JPNA 3MRTA 4XCQA 4UATA 1HSOA 2F62A 4LDAA 1P19A 1GGMA 2Q99A 4P35A 4ZVTA 4MIEA 1JG3A 4DLXA 5TT1A 1ZC3A 4IIUA 4Z3DA 1JXQA 3PS9A 1XNGA 2PZ8A 4M76B 4J75A 2UVDA 1EBUA 2PU5A 3F0TA 3M82A 1YJQA 3OCYA 4CF3A 3ICOA 4U7JA 3DH0A 3SIPA 1Y3DE 3GEGA 1JHYA 2YWBA 1AKEA 2YINC 3PB3A 3L0IB 1T9GR 1AIPA 2PXAA 4G5GA 4A9AA 2PH5A 4QBHA 1Z8HA 3VPDA 3W6UA 4E22A 1JEYB 2I03A 3KQOA 4ENTA 1Z4MA 3KXKA 4LGCA 3H1BA 1H6DA 1KL7A 4DIEA 4JJ6A 1XJWA 3KZNA 3UAYA 1NNLA 2PAFA 4WQMA 5EYPA 3SC2B 1FYWA 1WPXA 1JR6A 4TKUA 1CDOA 3BFJA 4ZT3A 1SUBA 2KB0A 1OBCA 2ZOSA 4HZUB 3OIDA 5ALDA 3WNCA 3SWWA 4K28A 4NL4H 1KI8A 4O4IB 3U39A 3KZOA 4A8TA 4ZI3A 1XWWA 4YGYA 4PYRA 5F3WB 4FNMA 1VTKA 2G6BA 2YWGA 2DHRA 4FCWA 4UOQA 2X1HA 4YBRA 3TZLA 4MDEA 2R48A 2WU1A 3EIUA 4L16A 5SZHB 3L7OA 1GARA 3VZSA 1U8ZA 2CMDA 1Z25A 3IR7A 1QKJA 3EDCA 1LA2A 2Q5CA 3RTBA 4CGZA 1OH6A 2R8BA 2FQYA 4UVGA 4RL4A 4NEHB 1Z39A 1WXHA 1YE3A 3OEHD 3EUAA 4KQ9A 4P0TA 3GHYA 1RXYA 2Y1CA 2IEBA 1PQYA 2Y0DA 4MB6A 4B73A 2DFVA 2JFZA 5KJFA 2H08A 1GL6A 2JB9A 1E64A 1EVYA 2SECE 2B92A 6Q21A 2W00A 3BILA 3DV0B 5H16A 2I8AA 3KB8A 1HZZA 1OXTA 5IW8A 5BQ5A 3RU9A 3MYRA 2I8CA 1Q83A 3DMDA 3KC2A 3SXJA 2QW8A 3CUKA 4RSGA 1Y9ZA 2GPWA 4L8VA 3SE0A 1PZGA 2IS1A 1WZIA 4MVJI 3GFQA 2FKNA 1ZL0A 3D54D 4M1ZA 3TIVA 4D43A 2RD2A 3TB4A 3GT0A 4J3JA 1NXOA 4UUOA 1LTHR 2W2MA 3INYA 4FVTA 1TJ4A 2VUSA 4M36A 3R0QA 4MWCA 2UZ4A 4BNIA 1CY4A 1PW7A 1Q7EA 3E7WA 2A33A 1NI4A 1CEEA 1DC4A 1R9NA 3VPHA 3WWZA 1SHJA 4W7HA 1FRVA 3VYWA 1ORTA 4KG7A 2QOEA 1VE1A 2Q1TA 3HP4A 4KRYA 3UENA 3X1JA 4ENWA 4M83A 3LGSA 5L4SA 1BTOA 2FPOA 3QTLA 1E9VA 4L51A 5CLFA 2GKGA 1C8LA 3IPYA 3NRJA 4FYPA 2QN8A 4MCHA 2R8PA 1NUSA 3K09C 2LCFA 4O25A 4WJKB 2I1WA 3JATA 1BQEA 4UQLA 4Q3NA 2WG0A 2PK3A 5BSMA 1L5RA 2VAPA 4N3GA 4YRAA 1GAEO 3FKSA 4ID3A 2HLPA 4BLTA 1BD3A 1MD9A 4TVKA 4Z4QA 2BL4A 2X86A 2CHVA 4PM4A 3ZE8A 4FMBB 5FAKA 2LIPA 3U49A 3WGKA 5D3QA 1K9SA 4C7MA 1P2BA 5CYOA 1YKFA 4KXQA 3RTGA 4YCLA 5EJ6A 2J3IA 1OWLA 3FI9A 2JGMA 3JALA 1KRXA 1UBUS 3DMHA 1DG9A 4JEUA 4AUEA 3B13B 3HUEA 2Z83A 3HPQA 1D9ZA 1X7XB 3PDUA 3SFVA 1BWRA 1G8YA 2EQ5A 3LNTA 4N47A 1NKVA 2B4TO 4P34A 2ZYTX 1Y9DA 1CY0A 1IBRA 2IGBA 5FBZA 1YVPA 4DGSA 3UHJA 3VMMA 4PINA 3TZHA 1SBYA 1A0OA 1D1QA 3R3UA 2FZ5A 4OXKA 3TK1A 3W1EA 1TCVA 3M6MD 4UVDA 5C5DA 2WKPA 3DUFA 3MWLA 4MDHA 1X19A 5B7PA 4BFZA 4P4SA 5IBRA 2YBDA 3G23A 5C5CA 3WQSB 4EG4A 4PBTA 5ENZA 4DBVO 2HSWA 1X15A 2JCYA 1TGVA 2WYIA 1X14A 3PC6A 3A37A 3TMYA 1CC1S 1USIA 2GN9A 1GNRA 2VDQB 2X9GA 2F1JA 3DKKA 4JAVC 3UMSA 1KOLA 1L7RA 2JKZA 3L8CA 4GOND 1EA5A 4BWFB 4NHEA 5DM70 5FNVF 3OEEA 4CTKA 4NATA 2PXXA 4IOLA 3ODGA 3S2YA 4PGMA 4F0JA 1CXZA 1GGNA 1SUEA 3GFFA 2D59A 1EB8A 3B70A 1E58A 3H9CA 4ZO6A 1LPSA 4XPIA 5BNIA 1C1XA 3FTPA 2X5XA 1A1SA 4WK2B 2P6RA 4X1KB 1ZVQA 2VXOA 4JFRA 2AFIA 4PX5A 5SYNA 1WF6A 5DYWA 4TQ9A 2G06A 2XH8A 3UIEA 4UFOA 1MVLA 1RXEA 2NIPA 1EFRA 2FX5A 1O89A 5LNK6 2H5IA 4NYIQ 3H5WA 2Q6VA 4YAUA 3GUCA 2CVOA 1UL1X 4BWGA 5FOTA 5PNTA 2W71A 4M1KA 4HOYA 3DXZA 2C7BA 4DG9A 4OHBA 2WFLB 4QYIA 2VLIA 2A0WA 2IXGA 3MOSA 3FNIA 4H7EA 4R68A 3RSZA 2AZDA 3WB9A 2BGLA 4CKBA 3SZLA 3WYDA 2PCLA 3MWDB 3PD7A 1NBIA 4IS2A 4JC5A 3J80A 2H16A 1C3EA 1GAQA 4P9NA 4IXMA 4JVSB 1F2TB 5AVQA 4YQYA 1A3CA 2HBYA 3OJOA 4GX1A 4OA8A 1UDRA 2JKYA 3PDIA 2ORIA 2EOAA 2YHIB 4RENA 5L4NA 2WNSA 1OI7A 2EFJA 1M0WA 2O5CA 3CB2A 4GH5A 1OFTA 3IAHA 2FMUA 2P75A 4OK5A 2GF9A 1D5CA 3PFBA 4LV8B 4PZLA 3UY4A 1YUBA 3KZXA 2ACWA 1PZHA 4HDMA 1QAMA 3IPCA 2C88A 1UMKA 2MSLA 3PG5A 4WFJA 4X1KA 3W77A 1BMDA 1XRMA 4UJ5A 1T5SA 3I6ZA 4BAUA 2GPNA 1PZEA 3PLRA 4TV8F 1WNTA 4FNOA 2FSVC 4XLZA 3F6CA 2A0UA 5DHQA 2XEDA 4EGSA 4Q82A 2VOJA 4GR9A 4I6JA 2R97A 5KOJA 3FUWA 5C53B 4OHMA 6GPBA 1WNFA 5DVZA 3WLAA 2HW8A 1NUHA 3RNLA 4KO1S 3DFUA 2PGXA 4X1IB 5IJXA 4ZHQA 2AFHA 3KAKA 2N42A 1VIAA 3FTFA 2WU8A 4FOOA 4G09A 4LY0A 4UTVA 1C3JA 1YDHA 4BVBA 3DUFB 2BEWB 3IJPA 4OK3A 3UBMA 4ZHQF 3PEWA 1QF9A 3EZXA 4FMPA 2VJOA 3IILA 3LZCA 1J07A 1L4YA 4EIWA 4BO5A 1YR2A 4HAVA 1ZIXA 5CB4A 3M6XA 4ND8B 1GQRA 4A8PA 3DEIA 3SJZA 1JWAB 4XUCA 1BHO1 3V48A 1J24A 4US2R 3KFVA 2XDQA 1Y63A 2BOVA 5I45A 3HDQA 5DEIA 3OQBA 3WL8A 3EZYA 3OIFA 4CKWA 4FEEA 4QGBA 3X1MA 5ER9A 3QU7A 1DRKA 1ABFA 1HNNA 3NHKA 2PJZA 2WUFA 3FHTA 3R5HA 1YL5A 2FMXA 3JAWB 1I9CA 3DXFA 4WZ6A 4BP8A 2DETA 2EX0A 4HBZA 4ZD6A 4X20B 3ISTA 1SZJG 3SQXA 2JA2A 1YJCA 2C42A 4NNOA 4C7XA 2JFBA 1B8NA 4O8CA 4YT2A 7MDHA 4O3MA 2QEQA 5BV7A 4KGVA 1U98A 2WP8J 4F1WA 2EFEB 3JZDA 4DBLE 5DF1A 2XRMA 3GP8A 4YUXA 1ZA2A 3W4KA 4MVWA 3F1LA 5KYUA 1XVTA 1NAHA 3TCXB 2VK1A 1KQFA 2I54A 3EISA 5ARDA 5HRUA 5DYNA 1GM5A 1M1UA 2ZGVA 4I08A 2RH9B 3LWZA 4G8DA 1HDZA 1Z6XA 5LZ9A 4AJ1A 2A0YA 1O95C 1XCBA 2PV0A 1U1CA 2R5WA 3M4ZA 4MRVA 5ALHA 5U4XA 3EFHA 4FFVA 3T5GA 3WGYA 4AJ4A 4R0MA 1H0HA 2BJWA 2XYRA 1W47A 2PFKA 3HEBA 5FA8A 3CEAA 2GEKA 3BFPA 5JCPA 1PTKA 2YJNA 1Y81A 2VHEA 5ECDA 2EJWA 1P5RA 3AR6A 2QLFA 2XZPA 3HP1A 1IBKB 4KIGA 3EIHA 2RAUA 3CY6A 1EP3B 1II8A 3EXAA 4YRDA 3SZOA 3WQBA 1QO7A 1E1RA 4MHOA 5D7BA 1PBNA 4YP7A 1NW8A 4RU1A 3TDNA 3TDKA 1E0AA 1S2IA 1Y5NA 1P44A 3QVUA 2CZQA 2HWXA 5BNWA 1N3IA 3Q9UA 2GEBA 1T3LA 5CFLA 4L5CA 1KMMA 3A25A 5CB8A 5CB4F 3RW9A 5FWDA 3I9MA 4O4LF 4OBBA 1U02A 1QF6A 1XZAA 1S2DA 1X7WA 4BLSA 5FPHA 3EEQA 2LE0A 2JCBA 4Q00A 1I3NA 4C87A 1E2MA 3CF4G 5BUCA 2W2TA 1FP4B 3BWCA 2FP4A 5BN4B 5LBUA 4BYGA 3A9WA 4ATNA 1J5PA 1C9JA 4N5NA 4F9TA 2GJ8A 4P5EA 3K9GA 2IOQA 4YMVA 1VQ1A 3NKFA 1L7QA 1OCEA 1YDWA 2MMGA 4FOPA 3HR8A 2HCBA 4PFJA 4UEQA 5EG5A 3E2IA 5AKZA 5F3RA 4QODA 2FPKA 1ISFA 3B2EA 4X3PA 1XXHE 1XF1A 3FCUB 2J09A 1N5KA 3B9PA 2EW8A 3ORYA 4AJIA 4WFIA 3C3DA 5IBCA 1JIKA 4JUBA 3ROZA 1QQBA 1GAXA 1RXWA 3DKIA 2TMKA 2VYVD 3VSBA 1JFSA 1IN4A 2OILA 3OESA 1HH4A 2P68A 3L0DA 1VP9A 1XZIA 3NNNA 4WI1A 4KYIB 1OA0A 5EYPB 4RH0A 5LN1A 1KZ7B 1Q74A 1BC5A 1IQRA 3AO0B 2Q9UA 1Y1KE 3RHZA 2QN7A 2UV8A 4WWHA 2GEDA 2G9VA 2QSYA 3QKIA 2QZPA 5IVDA 2R6JA 3I39X 4ITVA 5ALTA 4DDHA 2PVSA 4UDNA 2F8LA 4F85A 1ZD2P 5H4HA 2YHSA 1W0CA 1QK3A 1TKRA 2IIVA 5F7XA 3C85A 3ON5A 2QMQA 1RM5A 5FR2A 5JVDF 3IVGA 4H0NA 4C0BA 3IKLA 4WBNB 3GWGA 4JNKA 2C5HA 4MI3A 2GK3A 5I8ZA 3A2NA 4AFNA 1KYVA 3ZDRA 5A0VA 1S5PA 1PGJA 1EJ0A 3BMCB 1N7JA 1MXHA 1EFPA 5A9TA 3EDOA 3JW8A 4EFNA 4EH1A 1EG7A 1UOQA 3R4CA 3T5DA 4GZ3A 4IOMA 3AXTA 2NUPA 2ZUDA 1VHDA 1H2XA 1QVZA 3ONVA 4I55A 4R1TA 1AOXA 2VZ8A 5IN5A 4D2IA 4LQCA 4UBIA 3WGMA 1FUUA 1VE9A 2A0XA 4HPJB 3TB6A 4BKOA 4EY7A 2QTHA 3ABIA 1WO8A 2QTCA 2Y1XA 2ZRQA 2J5BA 4LPKA 3EGXB 4M0MA 4UPVA 3PEYA 1M6NA 2EAUA 16PKA 1JQ3A 3IR5A 1LV8A 1EJ6A 2EL7A 3KVNA 1RABA 4JP5A 5HJEA 5HPYB 2PD3A 1C7JA 2D0PB 4OG2A 1DZ3A 4IEIA 4KFRA 3EXIB 2C83A 3LVFO 1A9XB 1EU1A 4B6FA 1GGJA 1Z5WA 3CLUD 4NEGA 2C98A 4RZSA 2IU6A 3F71A 1JHAA 1PIWA 2RAPA 3LQYA 4E94A 4I81A 5HS4A 4KXNA 4OX9Y 4IJMA 1XCMA 2GILA 4L9WA 4G1EB 4O3FA 4S05A 1G6OA 2EDCA 2GVDC 3GFTA 4C03A 3UJNA 2XUDA 4D3FA 1Q57A 3AVYA 3GLKA 1H2AS 3SD7A 1XVAA 4PNZA 1B74A 3T5TA 1YMVA 1X3LA 4GZMA 1M8GA 5F21A 5FL7A 1XWFA 3UEOA 4AP5A 1ZUHA 2R5FA 4LW8A 4ZDIA 1ZHFA 3E4CA 2NO9A 3B1VA 2H1LA 2H57A 5DYTA 4PICA 1LBTA 3ZXXA 4BLWA 1XP8A 1I36A 1COZA 2CUZA 3ZOZA 2WBLC 1WHTB 4CKCA 3KUXA 1K06A 1P7PA 1U81A 1FTWA 1RE0A 1DUVG 1YRHA 2V58A 3KDAA 3L8YA 3Q87B 2GK7A 4KAFA 4ZO9A 3X2SA 4BBPA 1D8AA 1XELA 1UJCA 4N82A 1I0IA 5EHQA 3GLIE 5EESA 3EVZA 3N76A 3CUYA 4EFDA 2XNCA 1ZI6A 1M2VB 5ES4B 3C3EA 2VNIA 1QONA 2AE1A 3GPBA 1VIYA 3KLOA 4CTJA 1UQTA 3CEMA 2QJTA 1UBLS 3C7DB 1ESZA 5DSZA 1ZC4A 1GTL1 1HLPA 3IAM6 3OOJA 3VJLA 3KQYA 2J07A 2WU4A 3QEJA 5BXYA 3KQUA 3ND5A 4KXYA 2QP4A 4CEIA 3GLIA 1I4EB 1YRWA 3A06A 4GOOD 4J7AA 4C4SA 2OV2A 2PGAA 1I2BA 3PA8A 4Y2HA 1GN9A 2BHRA 3AHGA 3DEAA 3IV6A 5FO1A 1JH9A 4IKOA 2PGLA 3E9MA 3UJHA 1NVUQ 3N0VA 4Q3DA 4FLFA 3MWKA 4D9JA 1PVDA 4RD0A 3G79A 2WF9A 3IEIA 4NE2A 4EMUA 3PT5A 5BMVF 1FYEA 2UXBB 3WK8A 5FWNA 5BW6B 3WGZA 3LPMA 2G77B 1Y4DE 3N2NA 1JS1X 5TQJA 2IHBA 3HKDA 2QL5A 3QQ5A 4EEKA 5FOQA 1E1DA 3CFYA 1LWOA 1H0RA 3GJXC 1E9SA 1V95A 4R1PA 4Q1FA 1PWXA 1NM5A 4GUDA 4W1PA 5IJWA 2BMJA 4BMOB 2I6GA 3KQWA 2BHTA 4GGOA 1SIUA 2B34A 4BWYA 4BNHA 1T9AA 1WR8A 2HK6A 4DAEA 5COBA 3CE9A 3LCRA 3FOFC 1O6FA 1NLMA 2WV7A 3B3JA 3CLUC 3F3YA 5E0KB 4Q4HB 4C4XA 5EIWA 5LJLA 2C2WA 3FHCB 1M0TA 4AY4A 3AQIA 2ID4A 3AEYA 3B1WA 4B34A 3N53A 1K89A 3HO1A 2OGTA 3VHRA 1JJAA 4YAGA 3IVCA 4QELA 4P3XA 3AK4A 2OGZA 4FC7A 3T9BA 2Q1UA 2XA1A 4R1LA 3MF4A 4N54A 4C21A 4URHA 1ZBQA 4G23A 4JT9A 3COJA 2GD2A 2J7PA 3L92A 2I3AA 4RD2A 4RPIA 5HE8A 3WGQA 4FR0A 1M6WA 5JLAA 4PSDA 2GCGA 1GTZA 1VBFA 3T3HA 5L51A 1LJUA 3BM5A 4G1UC 3UAOA 1OOEA 3CINA 3RWOA 1TQ2A 5JSUA 2PANA 5I9IA 1GDTA 4C0JA 1PQUA 3AC0A 4JQZA 3LC0A 1GNQA 1GO2A 2YN0A 1YCDA 3OTHA 4KU4A 1SKYE 2A1TR 2QW1A 2FFBA 1DKNA 1DWOA 4RPJA 5L3QA 4CM7A 4QXOA 1WKBA 4CIDA 1AC5A 1UBHS 4DADA 4F3RA 3B1ZA 4G0WA 5JRDS 4O4HB 1QCCA 2X9VA 1AK1A 2WJVA 5TMEA 2Q8NA 3IDQA 4DY6A 3VOSA 3BSSA 2L18A 5JOQA 3K15A 4D9MA 5F35A 1S9DA 4KRFA 4FIDA 1YONA 5TX7A 4FCTA 3C48A 3JRXA 4CIWA 5IM5A 2J5KA 2I65A 2ZPUA 3I3SR 4DPMA 2WZQA 4KB5A 2MYTA 3TTYA 4F8YA 5JSZA 5ALMA 4W5TA 3C1UA 2CVZA 2UYOA 4I19A 1JSCA 4AZVA 1MB9A 1MP0A 2CCGA 2GO1A 2PUBA 3KZKA 1JHQA 1JNYA 4CQLB 2BGKA 2QX8A 5EVJA 1GTJ1 1KEPA 3RABA 4DJEC 1WCV1 3I83A 5JVDB 3SICE 1LI5A 4DDVA 3SSAA 5A9SA 2Q41A 2XBUA 5HRCA 3TMKA 1ZKMA 5MN5A 4GM0A 3MS4A 2DQZA 4PCVA 4NCAA 2FW8A 3K1YA 2QBYB 1N5IA 1MVNA 1QLJA 2HBRA 3QLUA 5IVPA 2YQ5A 1OI4A 3LAWA 5HK9A 1KK3A 4NFYA 3PHLA 3RSOA 4HFRA 1IN7A 4TT3D 2Y9MB 4PO3X 3R5FA 1NW9B 1QQTA 2B6NA 5T41A 5C5EA 1Q14A 1UODA 1XXHA 2VSXA 5G0SA 4DMMA 3C8DA 1GTG1 1A7KA 1QF7A 2DKOA 3UK0A 3JQGB 3O93A 1W36C 3L7NA 4O4LA 5KQSA 4EMTA 5DYGA 5EP2A 4A8HA 1X74A 2WM8A 3WG9A 4Y2SA 2FW0A 1L9XA 3T4XA 3HYNA 5FR1A 5A3RA 1AQLA 4WN9A 4UVIA 2COEA 3GUVA 2FN7A 2GESA 3H1GA 1DFHA 3H17A 3AFIA 1VL6A 1RRMA 1UPCA 4IFEA 4PW0A 2B1RA 3KB1A 4XIGS 4NFSA 3AHIA 1RWWA 3VDMA 5ICGA 4REQB 5AVJA 2XEXA 2VYVA 3ST7A 1RLUA 2H4JA 1L7NA 1G9TA 5B5SA 3HBAA 4OSOA 2FPMA 1K88A 3LM8A 5LM3A 4RAQA 2XCLA 3KQLA 2PUDA 1E9RA 4OIFA 1H5QA 1XTRA 1J7JA 5DT9A 4HGQA 3T4UA 2PUAA 4D46A 1A8PA 1SNYA 1PV1A 4I4CA 3M3DA 4E2YA 3TSAA 4QLBA 3AR8A 1KRHA 3ZWYA 4C89A 2CXRA 5FI3A 3JYQA 3KE9A 4LQ4A 2VJMA 4QFMA 4AS3A 4IMRA 4ARBA 4BX8A 2DLCX 1XAGA 1A5AB 3VVMA 2GBLC 3L02A 3H86A 3DKPA 4R5MA 3V34A 1CW2B 5THXA 2KW5A 2ZVJA 4YROA 3VPAA 5K3BA 1JU3A 4QVGA 2QRNA 3IQXA 4UUMA 2XTNA 1U99A 1CUHA 3OOYA 2CVFA 2VSFA 1F9EA 1DV1A 1OSNA 2LGJA 4H35A 1XQXA 4XFDA 2DULA 4EF6A 3ZKWA 4HGOA 3HDYA 4FKMA 2ACVA 4KOEC 4RANA 3PFFA 4X6XA 1PJTA 1OXBB 2R8XA 3ITDA 3WYCA 4JBHA 3SHTA 3WLMA 2QUZA 4QHSA 4BQOA 1JLKA 4GEGA 2ADMA 4L74A 2GNPA 2ANCA 4XJSA 4LBZA 4Z49A 5BN3A 1EYZA 3OCXA 4KH1A 4YFVA 1YOVA 3AU9A 4ZZ0A 5I5GA 5KCMA 5JBNA 1TTTA 2WJYA 1T2AA 3A2MA 5HKBA 4KBFA 3EDMA 4EY3A 2IF2A 1SIBE 4D8YA 2AJTA 5IMBA 5CK4A 1LVGA 4DKJA 4YUZA 4AWXA 1P6UA 3VBEA 4RCZA 1K68A 4DBLC 4NYIR 3OOWA 5KOHB 3C16C 1U2RA 1G55A 3WWEA 3HCFA 3L07A 2UZ1B 5E3JA 4IG9A 4DRYA 2PVCA 1FJ2A 4HDOB 2JCSA 1OX4B 5AJWA 3CX6A 5IAJA 5F52A 3VH1A 1NI5A 3AW8A 3QBJA 1DLIA 4KVFA 4B0OA 2GCOA 3N2GB 2JHAA 3IT3A 5T4FA 3OQIB 1L6IA 4ZOAA 4G0YA 4BQFA 5KOIA 4PEVA 1PVOA 1IZ7A 3VUFA 2CXTA 3DMRA 3QE3A 3VR3A 5IU6A 1F3LA 3ZBUA 3FOWA 1UC5B 1WB5A 3KB6A 2O2EA 2PX6A 1M66A 4ZICA 3F1KA 4QGHA 1F8GA 1KY2A 3O2NA 4IH4A 1ISHA 1BH2A 1E2LA 3D6AA 4IM7A 5EWJA 2H18A 3OA2A 3HJHA 4HQRA 3O82A 3LXXA 4UNSA 1W8DA 4WY2A 4RK0A 2C5GA 4LSWA 2BFCB 1V9LA 4E5VA 3R1IA 4TMYA 1BEEA 4S12A 1PNOA 2QTVB 1ZOSA 1FUYB 2XWPA 4Q4AA 3REQB 1YZYA 4FI3C 3W5AA 2C9BA 1BJRE 3Q7RA 4NS4A 5LYJB 2VHVA 2ZWPA 4BWVA 3D1VA 3PX3A 3A8TA 1B41A 4LV6A 4KZPA 4MV6A 4E13A 1JQEA 2ZIVB 2XUQA 3IUMA 3VR4A 4U3JB 4U9HS 2JIOA 3ABOB 4XVRA 5ITSA 5IDWA 2UDPA 3E6AA 1GAWA 2HZBA 2QQ5A 3GGJA 2GPJA 1E4VA 3SMVA 1P0CA 1TPYA 1KGDA 3WRXC 2WNIA 3PI7A 6PFKA 4MYSA 2FUG6 3QVTA 4KHZA 5BRAA 4JYAB 1KRWA 5CT6A 1U2QA 2QQEA 1YU6A 3QHAA 4J0GA 1ANKA 3PX2A 4PGFA 1ZI9A 3DP7A 5E1MA 3AJ8A 4K6OA 1U2TA 2ZUSA 1L7EA 2W8BB 1S9HA 3D7MA 3KWLA 1KKLA 3CRNA 3NYIA 4IJQA 4TN1A 1UZAA 2GA8A 4EMBA 3NWBA 5LOVF 3KPJA 3WLPA 3FDZA 4D0GA 2XVXA 4KZKA 3U1VA 4ID9A 1RRVA 3WKBA 1UCFA 2IVZA 2DUJA 3MMPA 4LVOA 4RVFA 3ZIUA 4ONEA 3HKCB 4OHPA 4RF2A 1ACMA 3I6QA 1QIIA 3K6JA 3SM9A 1CJUC 2BFDA 1YR1A 4GX0A 3U61B 3KFXA 1GTRA 4LZJA 1BHQ1 1G2QA 2QRGA 2YC4C 3LHFA 4GC9A 2IH5A 4M9RA 3ZU5A 1AK9A 3NHRA 3SZRA 1E62A 4FZJA 1JWLA 4JJAA 1EE1A 1MDFA 1K7SN 1PR1A 2L69A 2Q3HA 4ZDWA 2F48A 5DULA 3G7NA 3ICPA 5LU9A 2ZI7A 3DOIA 1OWMA 3E3LA 1QQ6A 2QIOA 3LKVA 1IY0A 4UU7A 1L5MA 1WY7A 4QWWA 2DR0A 1JKJA 4CMKA 2QTBA 3EWAA 1P1IA 4M8LA 2P2ZA 4RK1A 2JFVA 4ZQGA 2FE4A 3ZV5A 3B6EA 4EY8A 3GG2A 4JSYA 4MX8A 3QPAA 3VTKA 4D25A 3FYDA 3S0JA 1W36D 1JBEA 4M2LA 2FOLA 1ZNYA 2QNBA 2YUIA 3MWYW 1ES9A 3Q3CA 1T3SA 4K3UA 4L8LA 3LW8A 4M6WB 5TC4A 5JO0A 2XRZA 2H2GA 5LYJA 1Z4OA 1G5RA 2X42A 1ISJA 3MD9A 3ZGVA 1H4QA 3BCHA 1DINA 2NUTB 1DT5A 5HZGA 1QGUA 2ECFA 3ZTWA 3JYLA 5JDCA 4KR3A 3WLKX 1JILA 1XP5A 2OQIA 1KPGA 2HF2A 1NMYA 2R8ZA 2ZJZA 1ZVKA 4RK4A 5JS6A 3VPXA 1M2KA 5I51A 2HA7A 1YK0A 4AURA 1SN7A 1N2HA 1SEPA 5AQ1A 3W9SA 1JZQA 3T8YA 5KJ6A 1BDBA 1I4TD 3IP8A 2ZIXB 5KPDA 1LFDB 1ZGBA 4QYXA 5CITA 3DMPA 4QEKA 1VB5A 4WBXC 4AXXA 1M6VA 5SICE 2DGDA 3KEMA 1KFBB 5DHFA 4Z5XA 2P69A 3K0AB 3VV2A 5A5DA 3CURA 2R79A 3T9DA 1TQHA 2WJHA 4LXQA 4B6EA 3HUDA 1ESCA 1QIHA 1QKKA 4ZYUA 3ZI0A 2G9UA 1I5RA 2EQAA 5IH7A 3D7KA 4B3TB 3ORHA 4NI5A 2L0XA 3U16A 2WRZA 1IYZA 3O8CA 2P2LA 3G85A 4Q47A 4FKZA 1HQKA 2R86A 4ROSA 2B99A 4DWWA 3ICEA 1WEKA 4E11A 1XQYA 1ORDA 2EFDB 3U3DA 2VQ3A 2FN8A 1CDZA 2LKDA