5DISB

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
b'QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5disB00
1AKEA 2VBCA 2EU8A 4JVNA 4B32A 3PEVA 4B33A 2C77A 2GA8A 1Q1QA 2O8CB 1E2FA 3AF0A 5IK2D 1Q1EA 3Q5EA 4HUQA 2JJ1D 2GDJA 4JZKA 621PA 3ADDA 1L2TA 2CMKA 4Q21A 3I32A 2O52A 3O8CA 1IY2A 1KO4A 4A0GA 5DI9A 1KDRA 1N6PA 1NY6A 3FB4A 5CIWA 1GSIA 2HJVA 4JT2A 4JL8A 3BB1A 4A8JB 3RABA 3OE7A 2WOJA 1G19A 3GJ5A 3EPLA 1EESA 1PJRA 5JMTA 2XOKD 3O8DA 2NO9A 3Q85A 4IFBA 4O25A 1XTQA 4UXHA 2DBYA 3LX5A 1NSTA 5SZKB 3EW9A 2JLUA 2W6JA 3BH6A 4PR0A 4GI7A 4DB4A 2H1LA 4WOPA 2AD5A 3JVVA 3ICEA 2J46A 1LF0A 3I8XA 4D26A 3G5UA 3MG9A 1F2UA 2OXRA 2LWIA 4URYR 1X1RA 3THXB 1J99A 2GCNA 2WSSD 4EFNA 1HTWA 1BO6A 1KI8A 2WAYA 3IQXA 3W9YA 3QBTA 2PCJA 4A2PA 4B75A 4CRWB 1G8PA 1IN8A 1E2LA 2GEVA 4DLSA 4EAQA 3OHMA 3QPWA 2IUSA 2FSHA 1IN5A 1CXZA 1P72A 1AZSC 2R6CA 4NL4H 2OO7A 4LJ5A 3P27A 4KLZA 1P2SA 2YC2C 3ASZA 3ZYCA 3PUYA 1UAAA 4MDEA 1M2OB 1NLYA 4TLDA 2H7VA 5FOUA 3W6PA 4WZ6A 4JLKA 3SFZA 2RGDA 2VHCA 1R7RA 5IRCD 1VCIA 1ETUA 4DLXA 3LVRE 4V03A 1RIFA 4FINA 3CNNA 4DCSA 3RWMB 2P3SA 3SR0A 5FUXA 1Z6GA 3LXRA 1BOFA 1KO5A 3HDTA 2XTMA 2YYZA 3AVWA 4QL3A 4UNQA 1GDDA 3R7WA 1E0JA 2OE2A 2Q21A 1NP6A 4PAQA 5FOXA 1OIXA 3KKQA 1DAIA 5FI0B 3PQCA 5EP3A 1TF5A 2WWXA 3ZZTA 5KU1A 4NYJR 4C4PA 2QQEA 3ZIAD 4KVGA 4MA4A 2FSIA 1KNQA 3KXIA 4W5HA 3NVAA 3ZVMA 4YQFA 4M9SA 5FOSA 2ZSAA 2XAUA 4HAYA 2IBMA 5KSZA 2ZSDA 1SXJE 1U0JA 3MSXA 2G1JA 1S3GA 3UWKA 5IHPA 1W48A 4OQLA 4TL8A 4ABYA 5FL7A 5JSZB 1VCMA 4HATA 1I2MA 1IJEA 1COWD 4LC1A 5HCNA 3VQTA 4DUGD 2HYIC 3P26A 1CLUA 2WTUA 1E2QA 4XVRA 3SE0A 4P4SA 2O8BB 3GJ7A 1NN1A 3ONWA 2IYTA 4RKFA 1UKEA 5LBIA 1F2TA 1JR3D 2O8DA 1G3QA 2WPDA 4ZV4A 1CJTC 1JNYA 3RS0A 4QBFA 1GL7A 4JLDA 4PQYA 1FTNA 3E5HA 4BFTA 2OT3B 4HLQB 5C18A 4MGYR 2JLZA 1KMHA 3K0FA 3CO5A 4BECA 3KDSE 3RS7A 2EYUA 1RYHA 3E2IA 4GOJA 4DLYA 3QI2A 4DDTA 5FI1B 5KOYA 5HPYB 2FNAA 1KI3A 4I4LA 1CRPA 3ZVLA 4DB2A 5LDDC 2A7QA 1HUQA 2F6RA 2GAAA 3MLEA 2QEQA 4ON9A 3UKDA 4LJ7A 2F7SA 3K9LA 5H8WA 4M1YA 1XD2A 1RJ9A 1JBKA 4B3FX 1QHYA 3PG5A 4AKEA 1M7BA 3U6BA 4PSKA 4KV9A 3U61B 1XEFA 3AF3A 4A9AA 3IUYA 4FMDB 3ZJYA 3AVUA 1TQ6A 1Z0AA 3WHLA 5TY0A 4PO9A 5KUTA 2GCOB 1RW4A 2FV8A 1S3SA 5HE8A 3PCRB 2GBLA 4LYFA 1N5LA 1T4GA 4QKQA 3R9XA 1CJMA 2DCUA 3ICQB 2IS2A 1GNQA 1DTSA 2TMKA 2G0NA 5FFMA 1IXZA 4NCHA 4HLUA 5JEDA 3LA6A 1KZ7B 4H1UA 4FW9A 2BEJA 2DB3A 2ODEA 1Q3HA 1M34E 4MUAA 4JT4A 3F0TA 3QY0A 1GL6A 4V0LA 1DBSA 3HYRA 2CVFA 3SN6A 2NPIA 1A82A 1IQPA 3G0HA 2IHBA 1P5ZB 2EW1A 4JS0A 2ZROA 4QNRA 3U3KA 5EE0A 1GRQA 4UJ5A 3AF1A 2VF8A 3QXXA 1T6NA 2GJAA 2ZRPA 3UMFA 3IPYA 4LJ8A 4A8JA 3RVBA 2YINC 5B57C 2YJTD 2BCJQ 3MMPA 2H8KA 6Q21A 1J7KA 4I1OA 4EFMA 3A4MA 2ZSEA 3NIBA 1E79A 1LY1A 4OHWA 1M6NA 5JFGA 3OF5A 1KAOA 2CHQA 3QNUA 3B8HA 4TMZA 2FEMA 2JIZD 3DL0A 5E4FA 4XH9B 2Y8EA 2VP2A 4XTRA 5E7MA 3OIVA 2ORIA 4D4KA 3NEJA 2G88A 4OI4A 5JECA 5FUWA 1VYUA 3QKTA 3MAAC 3KL4A 1EFUA 1DG1G 1ESNA 1VCNA 4DCUA 1G7CA 4B3CA 1KY2A 4NYJQ 2CLSA 2Z5FA 3GFPA 2W0SA 2YVUA 3K53A 2HUPA 3LD9A 3ADBA 3EC2A 3IHWA 1S4QA 2C9YA 2AL7A 4MRRA 1C4OA 3K0CA 2GK7A 2NO1A 3PIRA 1S2MA 4Q7MB 3WNBA 1FUUA 2IUTA 2HXSA 3LY5A 3U7HB 3IEVA 3EZ6A 1RYFA 2V1UA 1SULA 1W0KA 3SJAA 2FFBA 2W58A 1HA3A 2WMOB 3TUIC 4AG5A 2HF9A 4K8OA 1H8ED 4QNMA 2DY1A 4WZAE 3GLFB 4BLQA 2VP5A 3QPUA 1AN0A 4Q4JB 1Z6XA 2RGNC 3AVPA 2JEOA 2C04A 3NBXX 4NDZA 2GXQA 3TNFA 1JXOA 1OPXA 1GRNA 3QSYA 4D82A 2G9NA 5IT5A 3QKRB 1R0XA 1PUJA 2ZS8A 1OE0A 2VP6A 4DDVA 2Q3HA 4C0KA 3KB1A 4NCJA 1TUIA 1N0UA 4MRVA 4FCTA 3OAAD 1SVLA 4Z51A 2ORVA 3K9GA 5HTKA 1MO3A 1RE0A 4OK6A 2PMKA 1IHUA 4TYYA 2JDIA 3JVUA 1ZUNB 3MWYW 4BFZA 2NZ8A 1XMVA 1Z29A 3BK7A 1D6JA 5DHFA 2J0UB 3PEUA 1YZGA 1II9A 3VKHA 2ZJ8A 1R2QA 3BOSA 2BEKA 4QM7A 3IPXA 4Q4HB 5DYIA 4DIDA 1NMXA 2HXYA 3UG7A 1GILA 2ASEA 1QDEA 2Q9CA 4F4IA 3NHAA 1E2GA 2P0EA 1S0UA 2IS6A 4Z54A 1ZUIA 2EFEB 2GAOA 3B1ZA 1C1YA 1VG8A 2R44A 4R7ZA 1TX4B 4PXAA 4BLTA 1LVGA 1N6RA 4A0HA 4ARZB 4OI2A 4URWR 1XD9A 3C4JA 2CDNA 2WSMA 3B13B 1NVXQ 5SZHB 1I2DA 1P61B 5D3MA 2OILA 4UKDA 4Q18A 4ZDKA 2J0QA 2ODNA 1OHHD 1HY3A 2FWRA 2QMEA 4DLWA 1G16A 3PUXA 4KFRA 3SEAA 2WIBA 4KO8A 1G291 1HQCA 1ZBDA 3V4FA 1KMQA 4PC1A 4BLRA 2V6IA 1DADA 3L0IB 4JLBA 4LX0A 2P6NA 3CNLA 4XSGA 2ZAOA 4MKIA 1QHXA 2DFKB 3GJ3A 1RRPA 4YXWD 5JHGB 1DAHA 2AXNA 5DNYB 4E07A 1XNJA 1R5OA 5F98A 2BJVA 4HEJA 1ZUHA 3ADKA 3IBYA 1T8TA 2IL1A 4JMPA 4QRHA 2OHFA 3KFVA 4C0AC 2H18A 4IDPA 4DCTA 4IOLA 4DC9A 1QHIA 3FYHA 1P3JA 4U5XA 2BKUA 2OZEA 2VQSA 2WZQA 2BM0A 3LH5A 2XXAB 3U2QA 2FA9A 4CZ2A 3U3JA 4W7SA 2BVNA 1NJGA 4L9SA 2CHGA 2P6RA 2WJGA 2F9MA 3WXMA 3Q5DA 3AQ4A 1HV8A 3AP2A 1WCV1 4JLMA 5AJWA 4MYTA 4PSVA 1JJ7A 3UATA 3AVQA 1ZD1A 2ODWA 4M9QA 1Z5ZA 2QTHA 3MGCA 2OBLA 1Z2AA 2FMXA 4LWZA 4YMWA 4KFSA 4OHVA 4KFTA 5FTKA 5AUQA 1P62B 2RB4A 1W44A 5B2ZA 5SZJA 2IEYA 3I4LA 4CEJA 3ETLA 4X8HA 4AG6A 5FOTA 3X1YA 5FUYA 2OEPA 1F3OA 2C95A 2IWHA 1J8MF 1X6VA 2DPXA 1JB1A 4WAUA 1W4RA 2XOKA 4AKHA 5TXGA 5BN5A 1DAEA 2F3RA 1OH5A 1W2HA 4A36A 2OFOA 4RJLA 2BMFA 1JR6A 4LJ6A 4TMTA 2NTYC 1JPNA 4Z1MD 5G3ZA 2G6BA 3C14C 3B1XA 3IBGA 2WKQA 4FMDF 521PA 1SKYE 2FSFA 3GJ4A 4O3MA 1KO1A 2A5JA 4EKDA 2REXB 4OJKA 1ZW6A 4JVLA 3I5XA 1XZPA 3AVVA 2W2VA 2ONJA 4C3ZA 3CRW1 2F43B 1F60A 2SHKA 3FKSA 1Q12A 2YC4C 1U9IC 1N6LA 3ECCA 4IXMA 4U00A 5IF9A 1ZNWA 1SHZA 3I73A 3L0OA 5AWFC 1L8QA 1NBMD 1R10A 4GP6A 3BE4A 2LKDA 4B48A 1QZXA 1Z8FA 3J81k 1KI9A 3U6KA 1BS1A 1BYIA 1JALA 1XTJA 1R8SA 2PBRA 1JEDA 1U0HC 4IW3B 1XMJA 5J40A 1NVVR 1NBME 2QAJA 2ZJAA 2QBYA 5DI3B 3W90A 3M4YA 3N2EA 1M8PA 3N70A 3P4YA 3DO6A 1NN5A 4ZDWA 4BFWA 1G41A 1SXJA 2C5LA 3Q72A 5C1BA 3NDPA 4GRAA 4Q4JA 5F3WB 3MWKA 2ZYUX 4N3NA 1TADA 4C7OA 4JJKA 1KDTA 1HEIA 1P6XA 2GXAA 4B2LA 5JBQA 2A30A 1XTKA 1II0A 4EJSB 1XB2A 1Z08A 1YR8A 1L7VC 4CT5A 2ZYVX 2FJUA 1ZNXA 1E6CA 1WF3A 4EPYA 2QT0A 2JGNA 3FDIA 2WJIA 4B76A 1QVAA 4D6PA 3QG1A 4KI0A 2AK2A 1TNDA 1UBCA 1SGWA 4ACBA 1X8JA 4JLJA 3CR7A 2OESA 4Q02A 2A78A 1UBEA 4AKGA 1UF9A 1VPLA 5AK0A 3KUDA 1E99A 3Q3JB 2AKYA 3CW2A 3ZLJA 2J0UA 4JLVA 2NMVA 1VIYA 3DDCA 2RCNA 2A5DA 3X2SA 2ZTSA 1KNXA 2GF9A 3CKLA 3WBJA 3D31A 5HCIA 3B2EA 4A6PA 1E2HA 4LJ9A 4OHXA 3IQWA 4DBLC 3I1FA 2VO1A 2ZRAA 2ZRGA 5FPYA 1C9KA 1GRRA 1W49A 2XNDA 3GLHE 2YWEA 1U8ZA 3K0AA 3FHTA 4RD0A 1J8YF 3THWB 3CPEA 2ZU6A 4XSHA 1A2KC 1NN3A 3IO3A 3NH9A 2GXSA 2CEAA 3RRZA 1VHLA 3PITA 4U7DA 4OK3A 2KWIA 1G3UA 3SNHA 4QGAA 2ZI9A 4M1OA 4QOSA 1VHTA 4BZXA 4QJ3A 5JI2E 5KTYA 1TPZA 2FFQA 3AP3A 3DMDA 4CYMA 4XD7D 5HR5A 4MQBA 3U3OA 2EFHB 1EFRA 2NO7A 4C2TA 2WMNB 3SBEA 1A7JA 1N6HA 2UZ3A 3BB4A 1E2IA 3TQCA 2FU5C 2VP0A 1MKYA 2YWHA 4RZXA 4D2IA 3WP1B 3B1YA 3CZQA 4F4CA 3KTAA 2HT1A 1OH7A 2YNMA 3T1OA 4QFMA 2G1KA 4PC3A 4KAXA 3X1WA 2D3WA 1X8LA 4QGFA 4TMWA 1YR7A 3TLXA 4RD2A 3DZDA 4BFSA 1MO4A 1YZTA 2IXFA 1NY5A 5EP2A 4RD6A 2K5UA 4BQSA 4DDWA 5HKKA 2GEDA 5J4LA 3HPRA 3VR6A 2WWHA 2Z43A 3ASYA 4RCYA 2QAGC 4HAZA 2KBFA 4RKEA 1KDOA 1EG7A 1RZ3A 3T5GA 3CPJB 1KK1A 3GLGE 1D2EA 2GK6A 2VYFA 3UIEA 1W5SA 1N5IA 2OAP1 721PA 2OV2A 2OBMA 3CB4A 2AXPA 2F3TA 4R98A 5JZVA 5JJKA 1RKBA 1XF9A 3SDZA 1M7HA 1DOAA 1S8FA 1B23P 1NVWQ 5AR1A 4D4JA 1CEEA 1RVDA 1Z06A 1DARA 2Q3FA 4NTZA 2Q3MA 1E96A 5FH9A 4KVAA 1NIPA 2VSFA 4IDOA 4ITRC 4MUBA 4BEBA 4US2R 3BB3A 1HH4A 1N0VC 2BKEA 3SHWA 5JHHB 5DN6A 3GQBA 1CR4A 4MRPA 1Q22A 4LRWA 3C8UA 4P4TA 3C41J 4A2WA 4MITA 1KTVA 5GJBA 3T15A 1II8B 1Z6TA 2QENA 2OFWA 3IKJA 3REGA 5G3YA 5JRZA 2WJJA 5M04A 3HP1A 2H5EA 3AVOA 2EWVA 1CR2A 1ZMXA 3GJ6A 4TLEA 4D25A 1TTTA 4Q9LA 3F8TA 1OFUX 3A1SA 3KZ1E 1ZYUA 3HR7A 5E3HA 1AGPA 3A1WA 4HAVA 2AFIE 4JVSB 2I3BA 1IN4A 1KK2A 2ZITA 2CJWA 4US0R 4G01B 4MH0R 4B6EA 3U4QA 2QPTA 3HR8A 4EFLA 5KSYA 2WWFA 1NVVQ 2YHSA 4V0OA 4BLSA 2Q0HA 3K8YA 3AKCA 4QBGB 4ACAA 3NC1C 5L3SA 4TMXA 4YMTA 1XEWY 4OQFA 1UKVY 2F43A 3EWSA 1E1RD 4JBXA 4F38A 3D8BA 1J70A 4JYCA 4M8NE 4PPNA 2J7PD 2CK3D 2OSBA 4V0ME 3AVTA 1VKJA 2P6UA 4URVR 2ONKA 2OXCA 4XWAA 5LD2C 2ZETA 5TB5A 2FFHA 1CJVC 3CH5A 1G7TA 2QMOA 4LOAA 4RD4A 4KBFA 4B2PA 4BPBA 4HDCA 2QE7A 3HJNA 3W8RA 4B6FA 2BDTA 1Z0IA 4JLPA 5G41A 3TSWA 3SFVA 4Q5IA 2XITA 2P65A 3IO5A 3IIJA 5J5CA 4IOKA 4KXFB 2F1IA 4TTRA 2X2EA 5DI3A 2A3RA 1YZKA 3OIWA 4YC7A 3VHLB 1OXSC 2V7QD 2JATA 2ZRHA 3W3AA 3RS2A 1G5PA 2FPLA 4M9XA 5KDDA 2QP9X 2IYWA 5FBVB 5CM9C 3EPJA 1E9DA 3ZS8A 4TTQA 3U7EB 3TH5A 5JRJA 2AX4A 1LS6A 2BC9A 2JJ2D 3DPUA 3QIAA 4EJSA 1A1VA 1VG9B 1OXVA 5DGXA 2ZM5A 1X1SA 1ONBA 1KO8A 1OV4A 2CE7A 1SVWA 3ND8A 1E2JA 3Q8XB 4QJ5A 3KQLA 1KIMA 3TW8B 4HZUB 1JECA 4LJ4A 3GLHB 3G82C 3GLIE 1IAQA 3TVDA 3VHXA 1IONA 2JLRA 4Q1BA 1JAIA 3THYB 3R9WA 2PZEA 1BMFA 4AIIA 1UBGA 5AJVB 4N1AA 4MKFA 1DG3A 3AEZA 2ZR9A 2ZJ2A 2V8OA 1XJ0A 3QQ5A 2PLRA 4IJMA 4HUTA 1PV4A 5EXXA 2CLDX 2ZR7A 3KQNA 4KU4A 1KSHA 1XXHA 4DCVA 3GLFE 2RH5A 3IGFA 3QF7A 3U7GA 2DFNA 3B82A 5DE3A 3THWA 2V55B 2JLXA 4B35A 4IDQA 2IT1A 3DZ8A 2B7CA 5J4YA 2EFGA 1LS1A 4GOXA 4LBYA 4MGZR 2X77A 3KX2A 5EE9A 2YOHA 2CE2X 3EIEA 3MUFA 3WBKA 2QT1A 1Z0DA 3CX6A 3TIFA 1D9ZA 2WOOA 3BFKA 4BFVA 2P5TB 3SBDA 5CK4A 1CTQA 1OLOA 2UKDA 3AVYA 4AD8A 4JKYA 5DYGA 2AHOA 3S1AA 3HU1A 1CS4C 2QAGB 4YMVA 1WB9A 4OI0A 2OBNA 4KFUA 5K8TA 4ESVA 1E2KA 1US8B 3GLGB 121PA 1FX0A 4Q7LA 1KGDA 4JLAA 1JR3E 2OCBA 3VFDA 1PVOA 4EPTA 5DIFA 1ZC4A 1Z83A 3O8BA 4L8GA 4PZZA 1IJFA 2ZRIA 5FPHA 5BN3A 1TU4A 2W6ID 2CHVA 3MWJA 5A4JA 4G3XA 1HYQA 2DWQA 4FMBB 2KE5A 2QNRA 2PZFA 4U02A 4X8MA 2IWRA 1N6NA 2WBLC 2OCYC 1E69A 4R9UC 2UVQA 1KI6B 3WNDA 2IXEA 3KKPA 4BLOA 3QXCA 4TMKA 1DEKA 2BBSA 2WV9A 5C46F 1HE1C 1IN7A 5J4HA 3I62A 2CVHA 3KJGA 3NBZC 2DFTA 2D2FA 1PLKA 1BKDR 4M53A 4URUR 4URZR 4ZI3A 3QOFA 4GSYA 4W9MC 5JCPA 3L0SA 4HAWA 4UNNA 3CONA 1XMSA 4TSFA 1FFHA 3RC8A 2QPOA 2KBEA 3EXAA 3PV0A 5JLJA 5KSOA 3BD9A 3DM9B 4ASUD 5FPKA 3I61A 2O8FB 5TARA 1X3SA 4M9ZA 4PAMA 2ZYWX 2GILA 2ZANA 4IVRA 1YHNA 3T35A 4D0NA 2D7CA 3CWQA 4A15A 2N46A 4POAA 4EQ6A 4CEHB 3K09A 3PR1A 2QM7A 1XJCA 3IIMA 5CJPA 3U44B 2GRJA 3U7FB 1YU9A 1II8A 3AGPA 4NCIA 4JJZA 1YQTA 2W00A 4W5JA 2BHRA 4KBGA 4Q7JB 1WXQA 2ZVPX 4ESHA 1W36C 3CR8A 3TMKA 2FZ4A 2R9VA 4NZYA 1WBDA 1W0JA 3CNOA 4M1WA 2OCAA 1KK3A 4IEEA 4EPWA 3PVSA 3BH0A 2O8CA 2XJ4A 4GZMA 2J9RA 2JJ8A 4DEXA 5CB8A 1EWQA 5JWRA 3VU9B 4ZIRB 2QSYA 1G5RA 2ZYTX 3DOFA 2FPKA 3T1QA 4TMVA 1E4YA 2O0HA 4BZQA 5C4GB 5K8LA 4DVGA 4OQXA 2CNWA 3QG5A 2CCJA 1WBBA 3B9PA 3VKGA 2QTFA 2ZJYA 1H8HD 1W46A 2IYYA 4TT3A 2V9PA 3BH7A 3B6EA 2ZE7A 3FHCB 1D2NA 1ESMA 4UJ3A 2RGXA 5AJZA 3V4RA 1CP2A 1M74A 1ZP6A 5JI3E 3WP0A 3RAPR 2OCPA 1QBKC 5DH9A 2N42A 1DS6A 4Q19A 2D2EA 1E9EA 4V0KA 3TE6A 1IY0A 3THXA 5CDFE 2HLDD 2R65A 3TR5A 3P4XA 2QGNA 2ZRNA 3KJHA 2FGJA 1B0UA 4NONA 1G7SA 5K8IA 2ZQ5A 2GJ9A 3B1WA 1KO7A 1Q1BA 2G83A 3ZS9A 1D8TA 2IYXA 1OIWA 4DXAA 5A5GA 3CF6R 3GLIB 3F5FA 2J41A 3TRFA 2FDCA 2GJSA 3CM0A 3EC1A 1G8HA 3AUYA 4CVNA 4DWJA 2J1LA 1NL3A 2C9CA 4MYUA 2PX0A 1SVSA 5AUOB 1FMLA 5HZHA 4B3GA 3TSOA 3E70C 4LV6A 3AF4A 1JAHA 3H1TA 4HZUA 5FTJA 1U8AA 3W6NA 4Q9JA 5SZIA 5EXPA 1E1QA 2F1HA 1LB1B 2GEUA 5BN4A 3TJZA 4JLNA 4M0LA 3QJYA 4PQFA 1Z0KA 3PUZA 4M1MA 2A5YB 2W6JD 2FGKA 1ZCAA 5FTMA 1GNPA 2JLQA 5F9HA 1FQJA 1VG0B 4Q1EA 3A36A 5EE5B 1VG1A 1EFHA 1W4BA 2QQ0A 5EXTA 1XP8A 5FOWA 2ZI6A 3WNCA 5KNDA 4DLTA 1TU3A 1GOTA 4OKSA 4B71A 1EGAA 5JSZA 3AM1A 4WXRA 1Z22A 4IDNA 2XSZA 4QJ4A 3ZQJA 4B3BA 2BJWA 4E09A 4PC2A 3I72A 2O8BA 2AK3A 2HCJB 1OB2A 3AB3A 4RVCA 1XTRA 2X2FA 3TSZA 1A4RA 1T0JB 2AWNA 4PZYA 2VSOA 5GADl 1G6HA 5C2JB 4AY2A 4JBWA 2R8RA 1ZD9A 3EARA 3GP8A 2PEZA 2ERXA 1Z0FA 2DHRA 3LLMA 5FUVA 1E4VA 2AN9A 1ZCBA 4X8OA 2O8EB 4E22A 2IA5A 1US8A 5CYOA 3B78A 3UMSA 1T9HA 2PH1A 2WICA 1SVOA 3LO5A 5CLQA 2ZRMA 4K46A 2ORWA 4MRNA 4DHEA 4ZCLA 2L0XA 2XTNA 1QF9A 4YDSA 5FTLA 1DO0A 2JLSA 3RNLA 3CRMA 4C0LA 1U98A 1AK2A 3VAAA 4PANA 4BASA 1NLZA 3UXMA 2QTVB 4M1KA 5BYJA 1SQ5A 2JASA 1P2TA 3K70D 4B73A 4I1VA 4CEIB 3BWDD 1K6MA 3LDAA 4FWIB 4PQRA 3TKLA 4ZCMA 4JSYA 2ZE8A 1ZM4A 3RS4A 3K70C 2ZRDA 1RPZA 5GJVC 1N6IA 4Q4LA 1F5NA 5FL7D 2BBOA 1RRCA 3RRMA 4XWKA 3C5CA 2O8FA 3RDPA 2IX3A 2GCOA 2WJVA 4HLDA 4OK5A 4RZUA 3L82B 2VHUA 3SC3A 4DEYA 3O8RA 3OEEA 2AD1A 2H17A 3MJRA 4CEHA 3PEWA 3U44A 1AS3A 1CJKC 1WQ1R 3W8NA 4QHTA 2WPDD 4KODA 4PTLA 3X1DA 4PPQA 3E1SA 4EPRA 2VL7A 3QF4B 4A2QA 4LZZA 4Y0AA 3LAWA 2XEXA 2GKSA 3B7GA 3T06B 2HYDA 1UKYA 5LB4A 1ODFA 2MMCA 3AGQA 5IK2A 4B3XA 3OFND 2JJ1A 1GM5A 2GVZC 4TYPA 1SHKA 4IVPA 4V0MA 3VX4A 2B8TA 2ZAMA 3T34A 4Q1CA 4WZBE 4LV5B 4LY6A 3VU9A 1J2JA 3HU3A 1DAMA 4DIEA 8OHMA 1NMZA 1QHNA 4M4SA 2VF7A 4UXJA 3ND9A 1S1MA 4FD2A 1GVNB 2ATVA 4FMCB 4OL0A 1E0AA 2QG6A 3R20A 3HU2A 2IF2A 2MSDB 1IN6A 4HDQB 2VP9A 4PPFA 4X8LA 2ZSBA 2O0JA 3BGWA 4BRWA 2C98A 3NDBB 2ZEJA 3CH4B 1KHTA 4JLOA 2ZR0A 4XOIA 1U81A 2R6DA 1N6OA 3AV0B 1G4AE 4Q00A 2WSSA 3GCGA 5FBWB 1R5BA 1E2MA 3MWLA 4QXAA 4LV8B 2NO6A 1TMKA 2HDNB 2V7QA 5ELXA 1U94A 3T5DA 4C0QC 5CLLA 4Z8YA 1P7CA 2OLJA 3QKUA 4TYQA 1JPJA 1AGRA 2GBLC 1R4AA 4KYIB 1T0HB 5CB6A 1A5TA 3B9QA 4S2EA 2RGBA 2J3EA 3KKNA 5EJEA 1ZM3A 4HLUC 4B44A 4OQMA 1D9XA 2GHIA 4HUQB 1RC8A 1OXXK 1SZPA 3KJIA 4AWXA 1XPRA 1QHHB 1G7RA 2P2LA 4GFDA 4HDOB 4M1TA 1AJEA 2AKAB 2RMKA 4P33A 2H57A 1JQJC 3K9NA 3A1TA 2ZJOA 3VMFA 3H86A 3CF2A 1Z63A 4QGGA 2XGJA 3AUXA 2J59A 5EUMA 3W3ZB 1P73A 3KQKA 1OSNA 4GMDA 3W34A 3GLFA 1NSFA 2D74A 2PJZA 1PLJA 2P5SA 2GF0A 4BRUA 2ZRKA 4KLNA 2MSCB 2WAXA 5H68A 3PXGA 3ZIAA 2ZXUA 1R5NA 1KKMA 5E7IA 1I4LD 1UBFA 1E79D 3V9PA 2X8AA 4L5BA 4D0GA 3QKRA 5EE3A 1KJYA 4A8JC 4F93B 1LTQA 1G8GA 1PLLA 1F2UB 3Q9LA 2XZLA 3P32A 4TYWA 3SJCA 4A1FA 2GCPA 1COWA 2ZRLA 3R9IA 4DUGA 1XEXB 4LBZA 1NJFA 1TQDA 4URXR 2WHXA 2G0TA 3RWOA 4GMXA 5P21A 3B1VA 2VHTA 1LF5A 2RHDA 1WP9A 221PA 2PZGA 2WWWA 1YR9A 3WYGA 4Q9KA 4HLCA 2FN4A 4MKGA 5CIQA 1E32A 3TGPA 4GDFA 3SJBA 4L9WA 1JR3A 4TZ6A 1Y63A 1MO6A 1UEJA 2OUKA 2IW3A 2HV8A 4NPHA 1QRAA 2FOLA 2QMHA 3FPAA 1CJUC 4G0NA 4Q4HA 3R8CA 1EK0A 1NKSA 1E0SA 2IYQA 2ZI5A 2WVJA 2PT7A 4OHYA 1PZNA 2BCGY 3NTUA 3OESA 1FNNA 1GL9B 4BZPA 4NU0A 2QUZA 5JJLA 4ARZA 4FN5A 1DAGA 1W0KD 1T5LA 2JCSA 2O8EA 2PX3A 2Z6VA 3AKYA 1R6BX 4BGDA 3VNVA 3K0CC 2DFLA 1L4UA 3B5JA 1KJWA 4JL5A 3VR4A 4EIWA 4HB0A 1NG9A 5JEEA 2ZRJA 3Q7QA 1K8RA 3GEIA 4TWZA 4B47A 2V3CC 2XJ9A 2IYRA 4LYHA 4WA7A 3K70B 3UK6A 1OYWA 3CPHA 4TLCA 4TTPA 1ZRHA 1HT2E 3ZVRA 2LKCA 4UNPA 4Q1DA 1NVUQ 3EZFA 3GEHA 5EZ6B 2VH5R 1BIFA 1AA9A 4AYTA 4H1VA 1QG2A 2FEOA 3LRPA 3VKWA 3LW8A 2XZOA 2JDID 2ZJ5A 3MFYA 2GJKA 4JSTA 5BYKA 1V43A 5H1YA 5DISB 3RYTC 4MGIR 3T12A 2XXAA 4TZ0A 2O8DB 4YLGA 4ZPXA 1QHGA 5CYPA 3EASA 3DKVA 3SZRA 2I4IA 5FL3A 2BIFA 4OQNA 3C5HA 4LYJA 4JL6A 2QM8A 4PHGA 2VP4A 4GZLA 4F4JA 5KPJA 3BFVA 1OT3A 3QF4A 1G3IA 2ECKA 1OB5A 1KY3A 1OW3B 3WYAA 2XB4A 1ZAKA 4GPTA 3SS8A 1XPOA 2WKPA 2IF0A 4HZIA 1XMIA 4WXPA 4M22A 3WRYC 1YZNA 5F9FA 1YZQA 5CM8B 1NRJB 4RCZA 2NG1A 4OI1A 3AH8A 2VHQA 3LVQE 1JXMA 5CJ2A 5FPSA 3WY9A 4AK9A 1N0WA 4MRSA 5BXQC 1XD2B 3U5ZB 3D6TB 4YONB 5AUNB 3BJIC 1OJLA 3UANA 1ZD8A 5LB2A 1E9SA 2REBA 3EZ7A 4CIDA 1OKKD 4DSTA 2QGZA 4LPSA 1MOZA 5CDFA 4OBEA 4P4UA 2NZJA 2BM1A 5G40A 2FE4A 2IS4A 2ZREA 1ZM7A 3C15C 2ANBA 5HE9A 2C78A 1RFLA 5CK5A 4CW7A 2JIZA 4RY2A 3A4LA 1AS0A 1DE0A 3L43A 1Z3IX 1BYUA 3OZXA 3IIKA 1VCOA 3MRSA 3U60B 2FF7A 1NF3A 2DYKA 2WWYA 4G5SA 2E87A 1ZNYA 2ZPTX 3CRVA 2EWWA 4A0RA 1XRJA 4GOKA 1W4AA 1YR6A 2FZLA 1KK0A 1N25A 2QRNA 2WKRA 3MCAA 2IYSA 4Q66C 4TLAA 2QA5A 3H0KA 2I1VB 5HZKA 3SQXA 1VTKA 3LX8A 1EX7A 2NPFA 3SU8A 1HE8B 4CDGA 1QHHA 2RGNA 2W2XA 4G5RA 2VTKA 4GL2A 3QXSA 2PCLA 3FHOA 1H8EA 5LPNA 3KQUA 1S96A 1UDXA 2ATXA 4PAOA 5EXSA 4PX9A 1XEWX 1Z07A 1KDPA 4E03A 1NNEA 2QRZA 4RD3A 2OLKA 3DOEA 4C0SA 2D4HA 4FWTA 1T3HA 2QN6A 4ZDJA 3DMNA 3TAHA 4WIAA 1XU4A 4FMCF 1LFDB 1OYYA 1ZIPA 2RGCA 5D3QA 3VR1A 1KSGA 2A5GA 3OAAA 1DPFA 1GKYA 3FMPB 2AFHE 1QG4A 3K0SA 1P4SA 2I1QA 1ZJ6A 2A2ZA 2RHMA 4DSNA 4II7A 5EQTA 1UEIA 1XEXA 5EZ5A 2WJHA 2Q9AA 1W4CA 5KSPA 1ZINA 3W5IA 3ZVNA 3CUEF 3BRWD 1BH2A 4PC6A 2QP4A 2YV5A 1OFIA 3QXJA 4UNSA 1ZM2A 4IVQA 5L3QB 3FKSD 2FG5A 2UZIR 1CIPA 1U99A 1YRAA 3AP1A 3REFA 2F9LA 2H92A 2RGGA 3D7MA 1T3SA 4OYHA 1UM8A 1D5CA 2J5XA 1OH6A 2R6FA 4JBYA 4QM6A 1JQLB 4B43A 2IXGA 1OXUA 4PO1A 4RD1A 4K81B 1CR0A 2IUUA 2YWFA 3NG1A 2ZRFA 2ZSFA 1JJVA 4TL9A 5GJCA 4LBWA 1EFTA 3DM5A 3QVVA 4M21A 2J7KA 2W83A 3HPQA 1OHHA 2R2AA 5AJXA 3BXZA 4D0LB 2NGRA 1SXJD 2XNSA 2RGEA 3K1JA 3FE2A 4F92B 1TUEA 3THOA 4FIDA 2QY9A 4JIMA 4KJZA 2A5FA 1WMSA 3PJRA 1IBRA 3UG6A 4WW0A 4C30A 1YKSA 3I5YA 3LQQA 4YXWA 1SXJC 1R0YA 3IILA 2O0KA 5FPTA 3AKEA 4PPGA 3WMEA 1OF1A 4PFSA 4A82A 2IK8A 2CCKA 3ZGXA 2OG2A 4QBIA 3A4NA 2BWJA 1M7GA 1MH1A 3LNCA 3IHLA 5EP4A 4DLVA 2QP3A 2VA8A 4DRZA 3WYFA 1YZUA 2QPAA 3SI7A 1XCPA 3H2YA 2KI5A 3ZD7A 2ODBA 3GMTA 1SVMA 4ZKEA 4ILEA 2D62A 3NBYC 4O2RA 5DSZA 3AF2A 4DLRA 2PEYA 3NH6A 3BERA 3GJ8A 1N5KA 3TQFA 1MV5A 1T5IA 4PHFA 4C0JA 4ZKDA 5CITA 1HT1E 2DWPA 3I92A 4RFVA 3FOZA 1CF4A 4PO8A 4MDFA 2V54A 4FXPA 3EIHA 4GNKA 3KXKA 2LCFA 4I81A 1FNMA 2FX3A 4NYIR 2XNDD 3Q7PA 1EXMA 1G21E 1Z6AA 3OFNA 2Z0MA 5D3MB 2FH5B 1Z6YA 2KSQA 4FI3C 1P2UA 3VNUA 2QU8A 4GP7A 4DT1B 1G9XA 4ERNA 4AURA 4A0FA 1FPMA 4G1UC 2VEDA 2QZ4A 2ZIAA 4LHZA 4AKIA 4RSGA 3TUZC 1EFRD 2WWGA 3LW7A 5DLQC 4LJAA 1XFAA 1UJ2A 2IC5A 5FBRB 1W36D 4LSGA 2ZUCA 2ZE6A 1T91A 1TEXA 4QGHA 1G5TA 3OEHD 4BUJA 3FFAA 1NI3A 1W2GA 2GNOA 3F3YA 1ZM9A 4Z1MA 5KDOA 4XJXA 4MYHA 2GWHA 4EPXA 3QPVA 3U3RA 3I3SR 1WRBA 3RS5A 4A6XA 1GITA 3CLVA 1P75A 3L0PA 4LBVA 2A9KA 1ELOA 1E2EA 3SYNA 3PFIA 1U9IA 4KITB 1HQYE 1RRGA 5HKKD 4LYAA 2HJGA 4RZ3A 2GESA 5KPDA 4XVUA 4Q1FA 2J45A 4NMMA 5LD2B 4TYNA 4UNRA 3UMRA 3SQWA 4A92A 3DEFA 1YE8A 3LXXA 1G8YA 1FQKA 1LNZA 3FMFA 3WRXC 1KZGB 1FP7A 1NBMA 3QEJA 4RZ2A 5FR2A 4YMSA 1V5WA 1E9RA 1W1WA 2HCBA 4LGMA 1N3BA 5GVSA 2IS1A 1NKTA 4QC2A 4DDUA 2Q6TA 2GTPA 4CEJB 3GD7A 1TL7C 2BV3A 1CKEA 3FTQA 4NHOA 3QBVA 2VPPA 5JCZA 3N2IA 1N2CE 1R0ZA 3AKDA 3FFBA 4CT4B 4Z8XA 5FR1A 1GKUB 1S9DA 2NQ2C 2ZUDA 1G64A 3M6AA 5AUPB 4HYYA 1CR1A 3W6OA 1F6BA 2DWOA 4CF7A 4KYUA 5DN6D 1MRSA 1SVKA 2VRWA 2B21A 3CF0A 4EPVA 2FFAA 4HB4A 3EPKA 2C9OA 1CRQA 1Q3TA 4D81A 4R2HA 4DCNA 3A6PC 2F1RA 3SHFA 2E9SA 2GZDA 2BOVA 2P67A 1KAGA 1Z0JA 2GETA 3JZMA 1OFHA 1MO5A 3PUWA 4IOJA 3U3MA 3T1TA 2J0VA 3QKSB 1HURA 2ZI4A 4DZZA 1AQUA 1D2MA 4EDHA 3FGNA 1KSFX 4ZDIA 2QORA 3K0EA 4FCVA 4UQOA 5KYKA 1Z47A 2B8WA 2FPMA 4BFXA 1GZSA 1ZU5A 3CBQA 3GLHA 1WDTA 4M1SA 4Q4AB 5L3QA 3THYA 1TEVA 1YJ5A 3OE7D 4TL6A 3RLFA 4JVMA 3X1ZA 4W5WA 4J0QA 3VX3A 2CL7X 4AYXA 5L8VA 2J87A 5JWHA 1KI7A 3BFXA 4LUCA 5BW8A 4Q03A 1P2VA 1E98A 4A4DA 2MMGA 3SYKA 4Q9IA 3FWYA 4ZO4A 1JEEA 3GEEA 2QE7D 3FMIA 2QBYB 1WA5A 3CX8A 3IDQA 1KI2A 3NC0C 2KJQA 4QG7A 3P1JA 1PUIA 1SXJB 3R8FA 5EUQB 1KOFA 1P60A 4XD7A 4C0BA 2CL0X 2OM2A 1P9WA 2W2TA 2G3YA 4M2LA 4C7OB 1XWIA 1Z2CA 1NMYA 1S9HA 2CCGA 4I1UA 4DSOA 2Z4SA 4XIGS 4Q47A 1K5GA 4RFSB 3KXLA 3NHBA 4TLBA 3X1XA 1GG2A 5B58C 3SJZA 3LBIA 2NIPA 5KDLA 1NIJA 2O5VA 4NYIQ 3DHWC 4LC0A 4Q7KA 1XDBA 4IHQA 5J4VA 2N1BA 1T3LA 1XD8A 4IKEA 4LDJA 2HF8A 1H65A 2QAGA 1E2NA 2ZJBA 4NCNA 3RRYA 3EAQA 4L15A 4N0DA 4EJSC 3GLGA 3CZPA 1E0KA 3NXSA 5L3VA 1FUKA 1AZTA 3LV8A 2H16A 3GFTA 1IXRC 4DSUA 1KI1A 1YZLA 4TQAA 2QL6A 1UKZA 1Q0UA 1BMFD 2F1JA 4TQ9A 5KNBA 1GWNA 1ANKA 4IXNA 2HT6A 3LBHA 1LW7A 3QUSA 4QHSA 1Q1ZA 2BMDA 1E9BA 3EPHA 4JYBA 1Q20A 1P9NA 2QSZA 3NBFA 3TW4A 3KKMA 1E2DA 2ZI3A 1KI6A 1A2BA 2XTZA 1VIAA 3K0AB 2ANCA 4PHHA 3VTKA 5TV2A 3B85A 5TDHA 3H4MA 3RANA 3KQHA 2PL3A 3RC3A 4LHYA 1TAGA 1AIPA 2BBTA 2BMJA 3OIYA 1MT0A 4LI0A 3ZQ6A 1IOZA 1KJZA 2IYVA 4KSBA 4DT1A 4Q9HA 3RSLA 1GKIA 4QHYA 3ZD6A 3O47A 4FCWA 3BBPA 4E5UA 2QROA 2AWOA 2IYZA 1XXHE 3GFOA 4YDHB 1CULC 2WWIA 5JWOA 1W36B 1VECA 4LHXA 2GJ8A 2IYLD 2F55A 3QE0A 2ZRBA 1OKKA 2CL6X 3BORA 1O87A 3KTAB 2R6AA 1UADA 3PUVA 1E3MA 3KFXA 4PSAA 4P3YA 1Z28A 4O2LA 2WJYA 2Q9BA 2ZE5A 4AI6A 1IXSB 1X86B 2VLIA 3A8TA 3H84A 4G5OA 1AKYA 3LBNA 1M1YE 3GJ0A 1TF2A 1N5JA 4I1SA 2RKOA 4R2IA 1TQ2A 4V02A 2C96A 4Q01A 4LHVA 2X19A 4IFEA 2JLWA 1VDZA 2JA1A 4NP6A 3RHFA 1GIAA 1S1CA 4B2IA 4ZIRA 1FZQA 2IEZA 4IOMA 1L4YA 2C99A 1KI4A 2E1RA 2G77B 1E1RA 1XJQA 2QI9C 4P32A 3RS3A 3D3QA 4DLZA 4BFYA 1Q57A 1DVRA 2CK3A 2J7PA 3MJHA 3TAUA 2V4ZA 4QBHA 5EE1A 1GTVA 421PA 4B74A 2C03A 3NEYA 4MGKR 1Y3AA 3EG5A 3RSOA 4D80A 2YKGA 4PZLA 4CGZA 2YOFA 821PA 1VMAA 4TSFD 3KJEA 4NCKA 4P31A 1E94E 3NWJA 1IM2A 1EFCA 2ERYA 4HI0E 1MRNA 2BBWA 3CX7A 4WBSA 2AR7A 1XCGB 1E2PA 1UPTA 1MABB 2JLYA 5DHAA 4NH0A 5KNCA 4I99A 4NKRA 2VIIA 2OAQ1 5F2EA 2ZU0C 1UFQA 3ADCA 3SOPA 1FP6A 1GUAA 5H70A 3KUCA 2CXXA 3QVUA 2PJRA 2JJ2A 4NYMR 3K09C 1FL9A 4BFUA 3GLIA 2HEIA 1WE2A 1OH8A 3ZDQA 3BC1A 5IDVA 4HSEA 2ZUBA 2CJWB 1W0JD 3BAFA 2QMUA 3U4QB 4NBSA 2MSEB 3K9HA 1I4TD 3QKSA 2YOGA 4DJTA 5E7JA 2V6JA 1VYVA 3EZ2A 3EZ9A 5L3SB 5FOVA 1W7AA 2B6HA 3C7KA 2EQBA 2W0MA 1AS2A 3GJXC 2ZI7A 1G17A 1GP2A 1R8QA 4Q4AA 4OHZA 5K8UA 5KHOC 2CNWD 1GAJA 4LK2A 1GNRA 5A0FA 1G20E 1DAKA 4JKIA 1CBUA 4TT3D 4TN1A 3GPLA 2EFCB 4HB3A 4YMUA 4LCBA 1GFIA 3TBKA 2NO0A 3LFUA 4GBMA 1DELA 2C2HA 2IYUA 3WMFA 4B3DA 3DVLA 5C4MA 4R71A 4KCGA 2IHYA 1G3MA 1P9RA 1OIVA 3CRRA 1KSJA 3ZZUA 4DKXA 1UDWA 3LWNA 2R6GA 4O0MA 1U0LA 5KO2A 1TQ4A 3EWAA 4ZI2A 5TVKA 1TF7A 1J90A 4MKHA 1Q21A 1U90A 5EP1A 4KHZA 4C9BA 4KSCA 2XZPA 4OJQA 5G53C 3MD0A 1SKQA 4F91B 2GXUA 4RFSA 1NLFA 1T8UA 1E9FA 2V1XA 3QEOA 1FMJA 3LQRA 4BE7B 3A37A 4AC9A 5ANRB 4HAXA 3WMGA 1YRBA 2EYQA 4D4LA 3UPUA 5B30A 4GT1A 4XWOA 2CLCX 4XTCS 3N5CA 1LV7A 2EVWX 1U2RA 3ZZ0A 1SVIA 4Y0VA 1XZQA 4PC7A 5FBQB 5BWMA 4LHWA 2XX3A 3DKPA 1EWRA 1G8FA 2W6IA 4UXIA 3R7WB 2PMDA 4BWYA 3HYTA 1I4DD 1U8YA 4C0HA 4WVFA 1G6OA 3VR3A 1MR3F 3EA0A 1E1QD 4MYCA 4S35A 5JJIA 5AJYA 1NN0A 1XCMA 2Z4RA 4TL7A 1X8KA 3W5JA 2DR3A 4BLPA 5B64A 2YWGA 4NE2A 4BEJA 2OFXA 4L4UA 1XXHB 1ZC3A 3CRQA 3OIUA 5L3RA 4B34A 4CEIA 3A1UA 3WHKA 2WM9B 4PHTA 4ZCIA 1K5DA 4IEIA 5J4KA 3PEYA 2XB2A 4IDHA 2JAQA 3ZH9B 2C8VA 2ZRCA 5FBLB 3BS4A 2ZJZA 3T1VA 4ASUA 1DO2A 2PLFA 1FTSA 3LLUA 4L16A 4AYWA 4P4SB 2XSZD 5DO9A 3L2OB 3L8ZA 4Q48A 5UKDA 1OFTA 1F2TB 3L8YA 1Q44A 5GVRA 4IRUB 3OEHA 1RRFA 3S1AB 3AVXA 3FKQA 4D4MA 1JI0A 1KKLA 1FW6A 1G4UR 1YVDA 3JZAA 3TR0A 4Q1AA 5GJWC 1OXTA 4N0EA 1FX0B 2PT5A 1KMHB 3K0FB 3TVTA 1IY1A 3VR5A 1R0WA 2GZHA 4G5GA 5TMPA 3TK1A 2D06A 1N6KA 1XTSA 4H9GA 1VYTA 1O3YA 3CWZA 1G18A 1ZNZA 4HAUA 2ZVQX 3KKOA 2YZ2A 1XBTA 2ZS7A 3T61A 2JLVA 1NG1A 1XX6A 3EA5A 5JS7A 3EIQA 3NKVA 4F7WA 1RJ9B 4LPKA 4TQUS 3M1IA 5E95A 2KB0A 1FOEB 1H8HA 4HB2A 1QHSA 1DAFA 4LJYA 3TUJC 2RGAA 3BIFA 3PENA 2R62A 2GZAA 2Z83A 3IEUA 3EX7C 3M0EA 4NYMQ 2J0SA 1AQYA 1ZU4A 3B60A 2WIAA 2CBZA 2RAPA 2REOA 3I8SA 4V0NA 2D7DA 1QVRA 2VHJA 1ZIOA 3A1VA 3CIOA 3RRNA 2GVDC 4EUNA 5FTNA 3C16C 3KB2A 2EFDB 1E9CA 3A58B 3SYLA 5BQ5A 4C2UA 3V00A 1E9AA 2BMEA 4XVQA 1SKYB 2HLDA 2ZS9A 3FMOB 3FVQA 3P20A 4EQ6B 3UWOA 5JS8A 1G3RA 2FSGA 1XTIA 2NOAA 1KYIA 1MABA 1CU1A 3HWSA 3OEED 1XPUA 3QENA 2VSXA 1F48A 4US1R 1W47A 1W5TA 4P0TA 3VR2A 1EX6A 4DLUA 2X1VA 2B7BA 5J47A 1G1MA 2B92A 1ZVQA 4G5QA 3QXHA 1AM4D
chains in the Genus database with same CATH superfamily
4AN1A 3OQ1A 3HO6A 3VC2A 4OQ4A 4CM3A 3JQAD 4U3JA 2AJDA 5EIBD 2GA8A 4F1WA 1KETA 3DTTA 4AJLA 1PZFA 3DT6A 5IK2D 1Q1EA 3KZKA 4GR5A 2NVOA 621PA 3ADDA 2JVJA 2CMKA 4RPLA 3I32A 1NVFA 4BKRA 3O8CA 1KO4A 3MN1A 4BO4A 4YRKA 1SEPA 3HO8A 2F9FA 1KDRA 2C3MA 3FB4A 5CIWA 3AESB 1HMPA 2UDPA 3CZCA 4JT2A 3V1LA 4JL8A 1O8BA 1SNYA 2CXHA 3RABA 1G19A 4Y0NA 4Z0PA 4AS1A 3LXMA 1RC1A 3OEYA 4H4DA 2EC5A 3DDWA 2C94A 3CLUD 1PZHA 1SVNA 3F3SA 3L84A 1A7AA 3O8DA 4MKXA 4NE7A 1TAHA 3WLEA 4DMLA 4UCQA 1TW2A 2F3PA 4G4SP 3EW9A 1M2NA 1SU7A 3B36A 4P3NA 3ZVKA 3K3PA 4PR0A 2OGWA 5COAA 2CYBA 2HOQA 2VJDA 4GX5A 4O4IA 1Y8RA 4G6ZA 1VL8A 2XNKA 3CLUC 4XGQA 3ICEA 1HYGA 1SBZA 4Y67A 4AX8A 3RIMA 4ZFNA 4OLHA 1F2UA 1ZUD1 2OXRA 1I3OA 2HHCA 2LWIA 5BW6B 3BKXA 1J99A 3BGDA 2WSSD 1I2ZA 4EFNA 1C9YA 3QBTA 2A1UA 5HM8A 2BN4A 2PCJA 4UZFA 2B7LA 2YDYA 2P40A 5LQRA 2VYCA 4EGFA 3O03A 2IUSA 5LM3A 1IN5A 1SUWA 4U8HA 5FNVB 2R6CA 3F6SA 4KE9A 4B6GA 3UBTA 1O58A 2X6TA 2JLBA 3HBAA 4Y6SA 1M0EA 1UAAA 1M2OB 4W7HA 2BFMA 1VJ1A 1OVMA 4G63A 1MIOA 5FOUA 4WZ6A 3CVOA 2VHCA 2A8YA 2HHJA 2XVXA 3BULA 3MBOA 1L7OA 3VBCA 1RFGE 1VCIA 4RETA 2I1WA 2I6SA 3KG2A 4V03A 1RIFA 3BKWA 3KLNA 1VFNA 3P2JA 2CWDA 2WVAA 1DKNA 3DQPA 4FINA 4BQPA 2G7ZA 3CRZA 1VJRA 3G0DA 2DLCX 4TWIA 1Y4UA 3O93A 1X7ZB 2P3SA 4FR5A 1SUEA 4GKJB 1EJ0A 1Z6GA 4NCXA 2HIAA 5DU2A 3AVWA 4ESOA 2YYZA 2M6KA 5TE9A 3HVIA 4UNQA 5LP6F 3G8DA 1GDDA 2CD7A 3KYIB 4I3FA 2FPPB 2OE2A 1NP6A 2Q21A 4MYSA 4PAQA 1N2XA 1Y6RA 1OIXA 1OXBB 3IEKA 4GP9A 2A9OA 1XZ8A 3PQCA 5FI0B 3UK2A 3ZZTA 5BR1A 1TK3A 4A8TA 4UAJA 3NCTA 4NYJR 4NQZA 3ET4A 1MLDA 3O82A 3DTYA 4K6FA 3TKYA 3EXHA 3STYA 1FTWA 2QWXA 3B6JA 3OP4A 4UEWA 4X44A 3TOCA 3KXIA 5IBRA 5FA6A 1IG3A 5KVQA 1H6CA 2BFEB 2ZTLA 5T8KA 4AP9A 5LXTA 5GMOA 4BQQA 1J6UA 1TKBA 3P0FA 3ISJA 1SXJE 4N8DA 2VF4X 5EWLA 2H4WA 1AQLA 3L6EA 4MLZA 3UWKA 2SKDA 4ABYA 2BM9A 2C1EA 1CQJA 4HXGA 1I2MA 5K8JB 5HCNA 3VQTA 3N59A 1CLUA 1GZ6A 2B94A 3CG4A 1HNXB 2Y0EA 5JYCA 1TJ3A 5JTUA 4HRYA 3LYHA 1HTBA 1RABA 4M1QA 1PT9A 3GH3A 4UREA 3ONWA 2IYTA 2QIOA 2W2LA 4YFYA 5KJFA 2OCDA 1YR1A 5M34A 1M1YA 4XM1A 1UKEA 2B0CA 2Q0SA 4JU8A 2H0RA 4EH1A 4NOLA 1JR3D 3SSAA 3F5DA 1YWGO 3OZAA 3V55A 2WPDA 5AKJA 3V8QA 1CJTC 3PDWA 2EFJA 4BRSA 3R6TA 4XX1A 1BQ3A 1GL7A 2ZYIA 1V4BA 2X15A 3C1TA 3IB6A 5CU7A 5F33A 4EOGA 4A5SA 3LPAA 1SCJA 2XW6A 2Y1WA 4JNCA 4RTJA 1CP3A 5C18A 1VLHA 2P90A 2Q4TA 2OXFA 1WDKA 2N75A 3CT4A 2CLHB 3WRVA 4XSVA 4EG4A 3PNLA 2EYUA 4C14A 4ZT2A 3N0XA 3DTNA 3QI2A 5FI1B 3EUAA 3TSYA 5HIAA 5HPYB 2FNAA 5F73A 1IN1A 2A7QA 1R0BA 1GGVA 4H17A 1ZGAA 4MS1A 3U37A 3T0FA 4LJ7A 3K9LA 3TZKA 3VU8A 1QYVA 4MVJF 1K27A 4BGUA 1L4MA 3GLRA 1Y6GA 1Z3CA 1QHYA 3PG5A 1MC1A 2Q6OA 3NJRA 2AOVA 3DVRX 4ZCQA 2Z09A 4MTLA 4BJ3A 4EGQA 1LDNA 4Z4QA 3FPKA 1HDEA 2YHUA 4BNTA 2Q27A 1SC6A 3DGFC 3AZPA 3U16A 2GZ1A 4O33A 3WICA 1EXWA 2CFCA 3H7IA 4RGVA 3OE4A 3WHLA 5JS1A 3KSAC 3ZU4A 3B8EA 4J3JA 3W2GA 5KUTA 1CUVA 1PSDA 2FSUA 2QTAA 4EPVA 3RYIB 1F7UA 1PEKE 4D9FA 2GBLA 4LYFA 4E7PA 1DKUA 3R9XA 2PJUA 5AHXA 1CEQA 3IHTA 3LZ6A 3ICQB 3MTAA 1TM2A 1DTSA 2TMKA 2G0NA 3JQRA 1PE0A 4NCHA 4R83A 3H13A 5CX1B 1USVA 1EEHA 5REQB 2V4UA 3UOWA 4HFJA 3I0ZA 2WYWA 2V96A 5JBIA 1Q1GA 2CHUA 5HIJA 2WVGA 4IIHA 2VPYA 2WUGA 1WW3A 4H1UA 1CY7A 1H2EA 5AKIA 1E92A 3I6QA 5C7OO 3K32A 3NKLA 2DB3A 1IHXA 4LOJA 1SXHA 3S44A 3WGOA 2CSUA 3F0TA 1UKCA 4X97A 1ZJZA 4NQRA 1DBSA 1DWUA 4UCFA 4LDZA 2WTBA 3IAFA 2WQ7A 2UYYA 2XA1A 1T35A 2IHBA 4AMYA 4TS1A 2EW1A 4UEKA 5K0JA 4BXOA 5BNFA 2F8LA 4M36A 3DLHA 3FTEA 1O96B 4IHAA 4UDOA 3L7CA 4YXFA 1NWCA 1DOHA 4IUBS 4UDNA 3BILA 4HNSA 4WKGA 1T6NA 2GJAA 2R7AA 1XCBA 1CDOA 3UC5A 4JC8A 3JQ6A 5IASA 2O54A 1N5MA 4EB3A 3IPYA 4EQZA 2ADOA 2BCJQ 4J6EA 2XCSB 3MMPA 3WGNA 5DGIA 3OX3A 4XM0A 4OHWA 3OCJA 5JFGA 4XOUA 3HCAA 1KAOA 2CHQA 4IGKA 4OJNA 3D6NB 1QAMA 2P2YA 1DLIA 3B8HA 4ZCSA 4HWOA 3VZPA 4W1SA 3OZTA 5DM60 1U1EA 4NIMA 2WFLB 1F1JA 1M1UA 1QTIA 3EIUA 3H75A 1P1IA 4JJ7A 1ODTC 4KK4A 4L51A 3D3NA 2JD2A 4QQ8A 4DUPA 2Y8EA 2O3RA 4CQJA 2MR5A 1LTHR 3OIVA 3DMTA 1AVTA 2J5RA 3V46A 3W77A 1N33B 1VYUA 2WRZA 1Y7TA 2XVZA 4JWKA 2ZDQA 2X9QA 1XAJA 1MN6A 2X5NA 3FY4A 2W48A 3JZFA 4MJXA 4X3CA 1VCNA 4Q9AA 4DCUA 1DIAA 2IOHA 4RTMA 3L7MA 4YCBA 4NYJQ 4OSPA 1MAUA 3GRYA 3ZE6A 4OJTA 1UP7A 2YVUA 1VSBA 1IZZA 5K0SA 1FP1D 3LD9A 2HUPA 1ZGZA 1FXSA 1JV2B 4FHFA 1BXRA 3H1FA 1BN6A 5JDIC 2C9YA 4BX2A 1UT5A 3E7WA 3FLEA 2GK7A 1CY0A 4NBNA 1S2MA 5BQFA 1BD4A 5JALA 3PYXA 4GWKA 1NBEA 1W1IA 2HXSA 1UBMS 2OFFA 3ORYA 3U7HB 5C1PA 3HKDA 4XYMA 1WVGA 4XGKA 1U6IA 3UJCA 1ECBA 2HU5A 3VZCA 1WNTA 1JQDA 4ZQFA 4JJAA 5HYVA 1H8ED 4NR0A 5LZ7A 3GGPA 4TWBA 3DVAB 3B5IA 5K4HA 3M1YA 5JROA 1A95A 2K7ZA 1FS5A 4TZKA 2F59A 2RGNC 4RVDA 3WYBA 4IYJA 5EY5B 3ZEIA 5IHXA 4OFZA 2C04A 3A4YA 4MB2A 1V1MA 2GXQA 2EF1A 3WLHA 4BO5A 5JBNA 1JQEA 1JXOA 5J43A 1JIVA 3FOAA 2G9NA 4C7XA 3QKRB 5LYJA 1XDUA 2VJQA 3T9BA 1PUJA 3GMIA 1BJRE 1AE1A 1Q7TA 4OMDA 3HCCA 4BN4A 4GOND 4XYGA 3HJAA 4C0KA 1I94B 4EVSA 1ADGA 1DC4A 1IATA 3K15A 3EGOA 3GARA 3V6MA 1T29A 4IIBA 4YK7A 1LU9A 3VH3A 4QDJA 4FDVA 4RCVA 4XIFA 2ORVA 2IE8A 3AI2A 1J25A 2IPXA 2D59A 1RE0A 5AD1A 2PMKA 1OC4A 3MELA 4HN9A 3JVUA 3ANXA 4HYTA 4U2BA 5BUQA 1YXMA 3JYLA 3S70A 3RQIA 2B98A 4RWEA 4F3TA 1X7HA 2ZJ8A 3OKCA 4HNVA 1VHDA 3BOSA 2BEKA 4QM7A 3IPXA 1NMXA 2DBRA 3HN6A 5FNVF 1FYXA 1P17A 2ASEA 4DNXA 1NXPA 3D43A 4NATA 2P0EA 3AJRA 1DEXA 3JARA 1S0UA 1V8PA 1FQOA 5G1NA 4LAFA 2VYVD 4C3VA 1QX3A 2I03A 4Z2AA 2IS6A 1C1YA 4R7ZA 3WRYA 1N2HA 1UK9A 2VJKA 4P1ZA 4PXAA 3JVIA 3U13A 3VM6A 4F5YA 1QQAA 4INZA 4CJXA 5C9ZA 1JA9A 1XRQA 2CDNA 1J06A 3B13B 1J22A 2X8JB 3C4JA 2J85A 3EVDA 4EF5A 1C9JA 1P61B 5CDGA 5CXQA 5LLDA 3DCYA 3RFXA 5AVUA 4UKDA 2NPOA 2ZT7A 3AHIA 2J0QA 1BSVA 1SXQA 3PXBA 2ODNA 1OHHD 3BXPA 4IILA 5AVOA 4RENA 1DCFA 1IOVA 1G16A 1PKEA 2Q07A 1IY8A 3CUSA 3N2GA 3PUXA 1HQCA 4KO8A 1IWOA 3RASA 1IMOA 4AZ3A 4UHFA 3LL7A 1DKMA 1XYYA 1UOEA 2WKWA 4UD2A 2XRZA 3JAWA 3RIYA 4BMNA 4UVHA 1Y6FA 3UUEA 3HRHA 2BSQA 3N2KB 2ZAOA 4BO8A 3GJ3A 4FM9A 2E3JA 3GEBA 1JG3A 2AXNA 5JHGB 1DUVG 3DONA 3VSAA 1TCUA 4OPMA 5LN1A 2BGJA 1R5OA 2ZWMA 4MUGA 2WW8A 2BJVA 3Q9NA 3IBYA 2OO3A 2P27A 1MO2A 3CKKA 3KOUA 3T3NA 1SCIA 5J23A 3CEHA 3A14A 5DLEA 4LZAA 4R2MA 4JLSA 4W5TA 4O3FA 4G24A 1I6WA 3HS3A 2BKUA 4MYDA 1UMBA 4BTLA 4OLFA 1UCFA 1KARA 2BM0A 2WF7A 5AOVA 5A7GA 3U2QA 4WBNF 3JR3A 5DM0A 2FA9A 1T9BA 5JNLA 3ZHZA 1GRVA 1TGYA 1YL7A 2XQJA 3L6BA 1PG5A 3ND6A 2P6RA 2P0AA 2F9MA 2Y68A 1PWZA 3WXMA 3QP9A 4MVJI 5TPZD 5IXJA 4X66B 5AJWA 1YJ8A 2DPMA 3BDVA 1FRQA 1JJ7A 2CB9A 4JSRA 4MYTA 1E7YA 3UATA 1ZD1A 2P30A 1U8UA 3MMZA 3SICE 1J4AA 4HJXA 2GD2A 1LV8A 2B8JA 1O89A 2FMXA 3R6GA 4RMJA 3GN1A 3BK1A 3M34A 4KFSA 3E4DA 3IKMB 4OHVA 4RK7A 2OORC 3NGXA 3IPLA 2MTBA 1W44A 3I4LA 4L50A 2PL1A 3ETLA 3I2YX 1JJFA 3NONA 7MDHA 2OEPA 4XWTA 2H7CA 3F8SA 2IWHA 3S8YA 2CD9A 1J8MF 5DGTA 1JB1A 1J8FA 4CMCA 4KNVA 3IAM6 1S4MA 1V3TA 1PR6A 2HDWA 3PHGA 1L5KA 3B3JA 3N8HA 2PQMA 3OU7A 4AKHA 3CHYA 4QPCA 3ER8A 1UWCA 1XCOA 3VYSB 3X0DA 3CXRA 4R9NA 3FBWA 3H9EO 3G5AA 3IT3A 2HXGA 4R41A 1JR6A 2FQXA 5IAKA 4KR9A 1IXKA 4G0YA 3AHJA 3TL2A 5I9BA 2NTYC 3ICOA 3UJ9A 1J56A 2GERA 2GSWA 3BBLA 4OHPA 1E8NA 4EMTA 3GGOA 1WABA 3B1XA 1L5NA 2VDWB 3OPYI 4J2TA 2DUNA 1JT9A 4JB3A 4HTFB 1ADBA 2A5JA 4EKDA 4EK9A 3IUPA 4OJKA 4S24A 1VI6A 1SHLA 1RP7A 3M9XA 3M9LA 1XZPA 3HLYA 4D9EA 1RMYA 3KV3O 3HY4A 1KR2A 1NNI1 1QU2A 4Y2JA 4JUCA 3WLSA 3CRW1 3ZXYA 2F43B 5CT9A 2G40A 4JAVC 2NZ2A 4IXWA 5FA5A 4MR7A 1M2KA 2GO1A 2R8XA 3ECCA 5JH7A 3EPPA 3LCCA 5JD5A 3L1JA 5IF9A 4NENA 1SHZA 3M5DA 4LHEA 5F76A 3RI3A 2WSYB 3PXDA 4BDSA 1NBMD 2HBZA 2IOQA 3LT1A 4MPDA 4TXLA 4X64B 1L5RA 2PS0A 1PS9A 4NJOA 3D0KA 4RQTA 3SCZA 3KTDA 1BYIA 3VU1A 3AOGA 1JALA 1XTJA 2DBZA 3HJGA 1FEZA 1R0LA 1R8SA 2WNIA 4UCWA 3LFTA 4FGSA 5AVYA 1EGQA 1JEDA 3DMFA 3AMVA 5GGYA 3V4LA 4URHA 5FFFA 1U4NA 1LI5A 3FX2A 3IX7A 4Z2YA 4CHTA 4F8JA 1AU9A 3KEOA 3M4YA 1B8VA 3N2EA 1Z5OA 2G80A 3P4YA 4BFWA 4EATA 3VTFA 5BWLA 1G41A 1YBMA 3Q72A 3UN1A 5HX7A 3HJRA 3KJQA 3N8NA 2H3HA 2A0XA 3GUVA 2VTBA 1T8YA 2A0FA 4Z4FA 3IBSA 4AS3A 1ZISA 3SKXA 3BWMA 3FDZA 1HEIA 3ESAA 2PZKA 4PRKA 2DY0A 4DA6A 2FF5A 2CMDA 2A30A 3QK7A 1XTKA 1II0A 4RF5A 5ALDA 1XB2A 2QG4A 1Z08A 1VCHA 1A9ZA 1UWLA 2QW1A 4UPDA 4XLTA 4XCVA 2ZYVX 2FJUA 3S29A 5B3KA 4EI8A 1E6CA 3R4VA 4PNZA 1WF3A 1IJKA 1T4BA 2H0AA 3OA2A 4KR0A 4B76A 3FBGA 2BE7A 2XEDA 3MK31 3NIDB 1HEYA 1EXVA 2AUMA 3TYXA 1HLDA 4BQNA 3OA0A 3CR7A 3VHXB 3UQZA 1Z5NA 5K0CA 3ZXUB 4HH3C 4HWTA 1AUXA 3O4HA 4PLYA 1VPLA 2QD3A 5AK0A 3Q3JB 4GRIA 2J0UA 3BZBA 2NMVA 3DDCA 5KYYA 2DQ4A 1MQ9A 3ABRB 4HX2A 2A5DA 2ZTSA 3JD1A 1XT6A 2VQDA 4W82A 2QTTA 4OHUA 3VV2A 2W4MA 4BO7A 3BWVA 1LBIA 4LJ9A 4OHXA 3IQWA 4DBLC 1O97D 2VO1A 1C9KA 1QCCA 1KFJB 1CY1A 4MVJH 3DP9A 2XNDA 3KP1A 4N8EA 3CCFA 3MJTA 2R60A 3KYJB 4BCCA 1U8ZA 3G49A 4QUKA 5HDQA 3FHTA 4F6CA 4RD0A 1KU0A 4RIIA 3SX0A 1A2KC 1DAOA 2DFDA 2XAAA 1NN3A 2I4TA 2VJMB 4H0FA 5J2UB 5BV7A 1O97C 2YJNA 2CEAA 1ODJA 3RRZA 4MHOA 2JFPA 4RW0A 4EB8A 3SNHA 5KYGA 1GCGA 1RM5A 5BWOA 2RBEA 5JI2E 3ROMA 3KZOA 2FFQA 3DW3X 3DMDA 5D51S 5DT2A 4I1IA 4M0EA 1A69A 2AT1A 5CCXA 1OROA 1P6UA 5AJTA 3TECE 4BNFA 2ZBPA 3SBEA 1HOXA 2FG6C 3RVSA 4NABA 3QX7A 1Q0LA 2BFPA 2UZ3A 3BB4A 3MCZA 1OMOA 4X84A 1I3KA 3TQCA 1AQIA 2QUKA 2VP0A 1MKYA 4WASA 3ZWXA 4D2IA 1K7XB 1AB5A 2BAGA 3CZQA 2X0FA 2Z2ZA 3KYCA 3R7LA 4B6OA 2BEUA 1DP4A 3QLVC 4IDFA 4MW5A 3T1OA 3O91A 1DL5A 4OM8A 4PLVA 4QFMA 4RHFA 4F3CA 2YBDA 5KAPA 3X1WA 2QV0A 1NBHA 1XLVA 4TMWA 3TLXA 4RD2A 3JYPA 3KUUA 4X63A 4AQYB 1G6Q1 3ZH2A 1NY5A 5EP2A 3EFOB 1GTSA 2UXBB 3DSRA 2YX1A 3LCJA 3RC2A 3WRXA 1P1BA 1I7DA 4Y1RA 4NJEA 1Q50A 2WIGA 2QAGC 2YVAA 4HAZA 2I8CA 3ZY4A 4ZAVA 1W5AA 1LX7A 2AG6A 3GROA 4PZUA 4D46A 3WL4A 5DV9A 5KYUB 2Q0XA 3M1AA 2QVLA 2ZRQA 3AU9A 3DCJA 1P7ZA 3K5IA 3N2NA 2OV2A 4YDQA 5DSTA 2OBMA 4Q05A 1ORVA 4ZVTA 4QO8A 2C4KA 3EISA 4LDRA 1N7GA 2F8SA 3NNNA 4QYMA 5ALEA 3RJ9A 1L8AA 1NVWQ 3UHJA 4BC1A 4ZYXA 1QC5B 2V0CA 3KBBA 3OT1B 5LQKA 4NTZA 4ZVVA 1ZHFA 4HF7A 4DM3A 4BQIA 3TJRA 1HFJA 3ZKWB 3RYHA 5FH9A 5TJHA 1SOWA 1KVSA 1NIPA 2GKGA 2INGX 2QYSA 2YMQA 3KAPA 4ITRC 1WXEA 2WU8A 1S7CA 3VVMA 3BB3A 2ZBVA 3WE7A 1D04A 3FTCA 4B3HA 1T1JA 2WAAA 2DUMA 4CMEC 3OQVA 1FPQA 3F97A 4TYMA 4OXNA 4FFNA 3ANTA 4M1ZA 2BDUA 1KTVA 5GJBA 3M3HA 1H5QA 3MT0A 2QENA 1PG2A 3IERA 5G3YA 5AVJA 3BXOA 3OWXA 3CUKA 3HP1A 1K7EB 2H5EA 2AN4A 1CUAA 2EWVA 3AVOA 3GJ6A 4JEMA 1XUOA 1XTUA 4MV4A 5CVCA 5TMBA 1ZYUA 3FSGA 2IIVA 4WCFA 4GRDA 5E3HA 4HAVA 2PSHA 1RBQA 3I12A 4Y2RA 4KE8A 1MFPA 1X1DA 1X0VA 2ZITA 1GLNA 3JQBC 4US0R 4B6EA 5IF3A 1XNHA 2FHPA 4PZPA 2YHSA 4BMYA 4V0OA 1XZAA 2Z1DA 4WX2B 5LP6A 1QQ5A 3ROZA 2ZOSA 3PGA1 3DOIA 1G0NA 3SVTA 4OAOA 2JAOA 2PQ6A 4J1NA 4YMTA 3HM9A 5JY6A 2XQIA 4AJ4A 1PJ4A 3N58A 3EWSA 5DHQA 1WR8A 2IYPA 1BH6A 3T5TA 4HDKA 4F38A 1EXDA 4TVBA 2Q8QA 4QXRA 4YX9A 1GAEO 3EQ6A 4JYCA 4JYAB 4YV7A 1XDZA 5BUZA 4X1KB 5ADHA 2OSBA 4KTVE 4ZXPA 5EVJA 3AVTA 4L57A 1T8WA 4FFVA 5A4DA 1L5MA 4FW8A 1XKQA 4D3XA 2OXTA 2JPDA 4F6RB 1RLUA 2QMOA 4EVIA 4F9FA 3PNMA 4X3OA 2HA3A 3OZBA 3H1BA 1C7RA 5E1MA 3ORRA 5C1IA 4FS8A 4GQBA 1EJ6A 4RA6A 3VTAA 3GUYA 1R16A 2ESRA 5G41A 3SFVA 3TSWA 2P65A 2E5LB 5J5CA 5CYFA 1T2VA 1G8JA 2X0IA 4FZJA 5DI3A 1VPEA 5K05A 3OIWA 3VHLB 1ZIDA 4F2PA 2V7QD 5JYEA 1PBTA 5A9RA 3LJKA 4OU5A 5L95A 1LPSA 2F3QA 2IXTA 4AX4A 2FPLA 4M88A 4WKPA 5COQA 5DHSA 1KORA 5ERGB 5JY1A 3T7EA 3E3LA 1E9DA 2IPMA 4TTQA 5JRJA 3UV6A 1K2WA 1ILEA 1LS6A 5MFZA 4EJSA 3DV9A 4H7PA 1TLTA 3QPAA 1OXVA 4G0ZA 5F21A 1FDVA 1PJ2A 3IL2A 2W6OA 3L7AA 1RRMA 3ND8A 4CF6A 2F1KA 4MROA 4HNRA 3VRHA 1L1QA 4ATNA 4HDAA 4UTZA 4Q37A 1MGOA 3IJ5A 1D3AA 4MR9A 4LJ4A 4H7IA 3P2IA 2XWPA 4FDUA 5EPUA 5EINA 3WKBA 1NATA 4MP6A 2JLRA 3THYB 1I6KA 1S8OA 1TKAA 3O3OB 4AIIA 3SHQA 1C1XB 4F9TA 2LGJA 1D7OA 2LTAA 2YN0A 4N1AA 4MKFA 1DG3A 4MVJA 3T7IA 5BNWA 4H7DA 4FJ2A 5IC6A 2WINI 4R5HA 1H6BA 2I29A 1YS7A 3ETEA 3MPOA 3QVJA 1P5RA 1GAWA 3E9ZA 3IVAA 2CLDX 4K9KA 2BFBB 2I0FA 5KVSA 3KQNA 4BVEA 1JZSA 2C8JA 3RSHA 5TT1A 2CNDA 3HMQA 1T9AA 3GLFE 1C7EA 1W581 2OBYA 1BJKA 3ZLUA 1H2FA 3TIGA 3B82A 3THWA 5AXAA 2L19A 5ICSA 4JMLA 2IZ6A 3SIRA 4EHHA 16PKA 3STTA 3U1TA 2B7CA 1EDOA 3PGMA 2EFGA 3DAYA 3SIPA 4CUJA 1G8AA 3H4TA 1B8PA 3PQ8A 4ML3A 3TM5A 4KQGA 3OFKA 3Q1LA 4UMDA 4DNOA 1U3FA 4ONEA 4UFNA 1R9GA 1ZNQO 2FSPA 1FFGA 3R9KA 1YUMA 2FR0A 2QJWA 1F8YA 4D44A 2DUUA 3QVLA 2Q5QA 3RUFA 2UKDA 2V5AA 3TOZA 2O50A 3LF1A 4AD8A 4FQ8A 5CFOA 2YVLA 4D9KA 5DNCA 2ID9A 1UK6A 1WB9A 2BI4A 1DC8A 2VDKB 2OBNA 3MQ2A 3QYJA 3F49S 3OPYA 4KFUA 1HFEL 5EESA 2ERCA 5T3UA 2XCIA 4KDRA 3RJTA 5K8TA 4JBIA 1FX0A 2SKEA 3L1IA 2WHPA 5DWVA 3OURA 4KVFA 1VGQA 1QV9A 5DIFA 4L8GA 4PZZA 1M54A 3WI7A 4EPTA 5BN3A 2Z6AA 2W6ID 5KJCA 1UMKA 3MWJA 1Q2XA 4BO2A 4ZMBA 2DWQA 2NSJA 3WTCA 1NUHA 2MR6A 2QNRA 1Z4JA 2EKZA 5HFJA 2IKQA 4WN3A 4P4LA 2BF4A 3D8RA 2E85A 3DMRA 4WFKA 3E1GA 2GWRA 5BSMA 1K4KA 2BGGA 4BLOA 3K7EA 3GYGA 3AOEA 1JJIA 4TMKA 4DJFC 4QJBA 4JELA 4CG3A 4I5GA 3GN2A 2HPZA 3KEQA 2YN2A 4UE6A 3IAAA 3F9RA 2BUCA 5CG2A 2CVHA 5C1OA 1W25A 2JKVA 2D2FA 2J3IA 3E9QA 4JJFA 2M1ZA 2X1HA 4R1TA 4URUR 2X86A 4URZR 4XRGA 4WGFA 3ZYZA 2FVXA 4II2A 4ECEA 2I6XA 4WOBA 4E0BA 2GHQA 4Q0MA 2R1ZA 4PG8A 2IHNA 3DM9B 4EDFA 4YR7A 1X3SA 1XTBA 2AOTA 1JHZA 4L9RA 5TF0A 3RUHA 5KNCH 3MQ4A 4IG9A 3R3UA 4UHHA 2D7CA 3C8HA 3CWQA 4POAA 4Q4DA 4XLLA 4EQ6A 4A15A 3KRTA 2QM7A 3LTEA 3A1FA 1XJCA 5E38A 5F5LA 3N6RA 3OLCX 3IDSA 4BJ1A 1X9GA 2J3QA 3AGPA 2ETXA 2WE8A 3NOVA 3OE5A 2UAGA 1ORIA 4JJZA 4NCIA 4Y7DA 2Y1CA 1V25A 5I8WA 4BRZA 4YMIA 3CLHA 3S7ZA 4V2IA 5SY4A 1U0NA 3DO5A 3DOOA 2Y05A 4RK1A 3JQDA 2R9VA 3AFGA 3CNOA 3KB6A 3M81A 4IS2A 4EPWA 4J0JA 2RI0A 4GLFA 5ALZA 3WHIA 2PMEA 1ISIA 1PJSA 5DNWA 1DTWB 5CB8A 1UJCA 1P0QA 2XYPA 1V3UA 2JFQA 1ZESA 4IUYA 1BDHA 5FO1A 3SYTA 1T0IA 2H2IA 3JD3A 3DOFA 5GPBA 1P91A 2ZCJA 1ZQ9A 2ZZMA 1PGJA 1WX1A 1L7QA 2O0HA 3GPBA 4LZWA 2W4IA 5IULC 4DVGA 5K8LA 1Q0HA 1V1JA 2A9PA 2G9UA 2Z4TA 4MRAA 5LIPA 3VA7A 2MSNA 3B9PA 1XK7A 3O9MA 2C4VA 2VS1A 4TVSA 4U6QA 3ND5A 2V9PA 2I2DA 3BH7A 4JN6B 2WU1A 4CV1A 5ABPA 3WAKA 1V9CA 3V4RA 3DXZA 3RF7A 1M74A 1ZP6A 2YQZA 3AT1A 3EVAA 3KOMA 4EZIA 1D0VA 3FROA 1JEJA 5D1HA 2OCPA 2W2KB 3WP0A 3DR3A 2OQ2A 1IK4A 4ROSA 5EIAA 1L5GB 4ALMA 1BW9B 1L4HA 2HREA 3ENKA 2D2IA 5LWHA 4C6TA 5CDFE 2HLDD 2FB9A 2R65A 3PI7A 3H1GA 3VU3A 4BNZA 1G66A 4HZGA 4PO3X 5K8IA 2Z6UA 3P2OA 4D9MA 4G25A 2ZQ5A 2EZ8A 1PEDA 2PO5A 2G83A 5FQOA 2CMHA 1D8TA 4CFSA 4CL2A 3G3EA 2AI1A 5F51A 3HKCB 2IYXA 5FNVA 3VR2D 4ENPA 3FCCA 5EKSA 1FK8A 3OWOA 3CF6R 4Q3LA 1RJGA 1ZA1A 7ADHA 1M2OA 2BTOA 4KUGA 4JUFA 3VPBA 1G8HA 4P0PB 2FXVA 3EHDA 4QG3A 3FZEA 3OP1A 3IP3A 5EJIA 1SVSA 1FMLA 1DLJA 2RAFA 2VH2A 1SD1A 2ZBEA 3KQYA 3AF4A 1QU3A 1PNOA 3FUWA 4D9CA 2YW2A 4UMVA 4EO9A 2ODQA 5BSTA 2VNHA 3OIFA 4DLNA 2EXXA 2O2EA 2IVFA 1KS9A 4WV3A 4Q9JA 3RC9A 3O0TA 1N92A 3PWZA 1E1QA 2X0DA 1LB1B 2FPPA 1CX9B 3B48A 3H9BA 3T0GA 1INLA 3U48A 4DSZA 3TJMA 1NVBA 4OATA 2V58A 4PQFA 4EA6A 3P4UA 3PUZA 5EC8A 4QU9A 2XDAA 1XQYA 4GMKA 1V8BA 5F9HA 1FQJA 1XVTA 3A36A 3SF8B 4L2IB 1CEXA 3EZYA 1M1ZA 2QQ0A 2ZI6A 1RAIA 5FBZA 1OA0A 4DLTA 3EEOA 1MIHA 4B71A 1DHRA 1HDZA 3ODGA 1RI4A 5BWCA 2QTRA 1Z22A 4WBNA 1BU8A 1CUUA 4E09A 1HQDA 1J8DA 4EHBA 3I72A 2HSWA 2FWAA 2VDRB 2ZWAA 3NJ4A 5LQMA 4PTZA 1OB2A 1G63A 1PQYA 4OBWA 3AL0C 4GKVA 3ZDYB 3I2FA 1CQIB 3TSZA 1A4RA 1DXYA 1G6HA 1JYEA 2HCTA 2Y0BA 1ABEA 4IIJA 2XCUA 1ZD9A 3GLSA 2PEZA 3HFGA 2DHRA 1UANA 1X9HA 3LLMA 4N3GA 5FUVA 3WVNA 4D6XA 1VIVA 4U5QA 3MUEA 3NEAA 2AQIA 3E2MA 3UT6A 1ZCBA 5DTJA 2O8EB 4ALJA 1C1DA 1US8A 3LK7A 4AJ1A 1Z6QA 3B78A 2IUFA 4I2VA 1BJTA 2QMYA 3Q0TA 5EHGA 2JFOA 1BXZA 3HNPA 4LEIA 2C5GA 2WNHA 2YWJA 4RKYA 3MAJA 2WZCA 4CMGA 2ORWA 1H1LB 4GXQA 4YDSA 3TZCA 2B34A 4DMKA 2JLSA 3RNLA 1MB9A 2EBWA 2JGDB 2XODA 4BASA 4PANA 1EVZA 2GZ3A 2RFLA 1NLZA 4QELA 3RAEC 2BHLA 4B3TB 1OWMA 3L1UA 2WT8A 2ZBUA 3CH6A 4IS3A 4FEGA 4LY0A 1SZDA 3GP5A 3E9RA 3AEQB 3VV3A 4FYJA 4XKJA 3LDAA 3RTCA 5JPCA 2HIGA 2ZE8A 1WMEA 3PQ2A 1ZM4A 3VJRA 4MTCA 4D79A 1RPZA 1IYZA 1VPTA 4LOLA 1N3YA 1F5NA 5GJVC 2QHXA 4ES6A 2BBOA 4OKIA 4R84A 1S7GA 1EK2A 1GLVA 3C5CA 2VJNA 2C3YA 2IZ7A 3RDPA 2GLXA 2FLKA 1SM4A 3DDNA 4Q15A 3BMNB 4EHLA 2YXNA 4HLDA 5AESA 3RYIA 3NPMA 3TVYA 3KB8A 1TK9A 4ZI7A 2CY0A 4M9CA 3CUVA 1YTUA 3D4LA 3O8RA 1UQTA 4UAVA 3HK2A 3MJRA 4HNTA 3NHMA 4UBKA 3OZRA 3O2JA 3OE1A 3EEYA 2YIJA 5D3ZA 5REQA 1WQ1R 2QU7A 4DDHA 4KODA 3X1DA 2G76A 1VLZA 3E1SA 3LUCA 4CDRA 3QEBZ 5BQOA 5BV2P 1TVEA 2H08A 3L8MA 4UBIA 5DOVA 2WSLA 3G7NA 1I4OA 2XEXA 1W76A 3KZNA 3R3ZA 2GKSA 3TNLA 3B7GA 5GTDA 5LB4A 3R3YA 4LRQA 2P4EA 1NUAA 2P9JA 3AZQA 2Z1NA 3Q11A 2X0EA 5C3MA 1KEKA 2GVZC 3LGXA 1XRSB 2C1XA 4Y2GA 4V0MA 2AQHA 2LE0A 4EITA 3BEDA 1ZHOA 1NFFA 3T54A 5CJJA 3EWNA 2QDXA 4UHDA 4AU1A 1IOWA 3R3HA 3P0HA 5B1HA 1DAMA 1P18A 1RHUA 1NMZA 8OHMA 1KAQA 3DOCA 1N2CB 2PLNA 4UW9A 5ADWA 5IDXA 2JI7A 1XOIA 1I3NA 3L4SO 2A1IA 3UHOA 3ONNA 2IP2A 2VDOB 5AM3A 3A2KA 3CQ9A 1GARA 3TW0A 3ILHA 1D2CA 1LPAB 1WXHA 1A27A 3FJOA 3INYA 3QXGA 2ZSBA 5SICE 3VH2A 4BRWA 7GPBA 1Y7HA 3AFIA 1DI0A 2Q1TA 2Y0CA 4BLUA 3NDBB 2ZEJA 4LOHA 5LR6A 2QRMA 1GFZA 3QW2A 4Q7QA 1RWKA 1JYFA 4FFSA 4Q00A 5FBWB 3GCGA 2WFLA 1UJ5A 3FRIA 4LV8B 1EUCB 4YRIA 1YVPA 1SXGA 2V7QA 3T5DA 4C0QC 2B2XA 1GEEA 1P7CA 5H82A 4GBGA 1XV5A 3D6VA 1L7DA 4IWXA 4WE3A 1R4AA 3L46A 3ET5A 4WQMA 3L18A 5COBA 4D8YA 2R68A 2BFOA 1A5TA 1RKUA 3LX6A 3BIXA 3MSCA 2RGBA 2OUIA 3KKNA 1ACLA 2MDTA 3ZN2A 5AK6A 2FQQA 5SYMA 1PGOA 2GHIA 3OFJA 4DIOA 3D59A 1QLHA 1O03A 1SZPA 4QUHA 4YMGA 4QOGA 4GFDA 1AJEA 4J3NA 3TQSA 1M5RA 1Z4KA 4BHTA 3G6KA 1JQJC 4NJMA 3VMFA 2AHRA 4N48A 2UYHA 3VJMA 1IPEA 4XJTA 1Z63A 4Z53A 4YASA 5FYDA 1NPDA 1MPTA 1KEVA 1ZKDA 1K4MA 2V65A 4FOPA 1PR1A 1B8NA 1PLJA 1Y7PA 2QY6A 3N05A 4RS4A 2H52A 2I7TA 2ZRKA 2ZQYA 4GGOA 5ILOA 2ZXUA 1R5NA 2E4YA 4LYDA 3VZBA 3W7BA 1J2RA 1SCNE 2RIRA 4D0RA 3GOQA 1UBFA 1PTJC 1ZGJA 2VBIA 1SOUA 2X8AA 2ZJ3A 1B6GA 1F20A 4CFYA 4QPNA 5GWXA 2XZTA 4D0GA 3QKRA 4OFBA 2DP4E 2IEDA 3P5SA 2VAVA 4KXLA 3SG0A 2UYGA 1G8GA 4KRFA 1P3DA 3WJ7A 5C5EA 3L4BA 2I33A 1X7WB 5FXMA 4ZICA 2GCPA 1COWA 2GKOA 1NJFA 1TQDA 2W37A 4LBZA 2G0TA 2XT6A 1JN0A 3RWOA 1QO9A 4FS3A 4E33A 1FC0A 1UOOA 2H63A 3BYZA 2RHDA 4YPFA 4D45A 3WYGA 2WWWA 3HE3A 2H4XA 3UA4A