5DISB

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-1
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5disB00
2DYKA 1R5NA 3HDTA 2OCBA 4KBGA 2ZRGA 2XX3A 4E5UA 2JCSA 2R8RA 3GLFB 4MDEA 1JECA 1SXJD 4DUGA 4R9UC 2ZE7A 5FPYA 3NH9A 1YZKA 3I73A 1BMFA 2JATA 2CCJA 1FQJA 3CM0A 4W5WA 5D3MB 4XWOA 4C2TA 3U44B 1RFLA 1MABA 3WNDA 4A2WA 4W9MC 2EYQA 4QM6A 1KI6A 1HT2E 4KU4A 3PUWA 4AC9A 2P5SA 2GILA 4TMVA 3TH5A 3FOZA 1P2SA 2JLSA 4DEXA 1VCNA 5CLLA 4E09A 2D2EA 1HA3A 2CLCX 1I2MA 4MYCA 3I8XA 5JZVA 2IBMA 2CLDX 4JKIA 1VHLA 3A8TA 4G5OA 3EZ6A 1QF9A 1S9HA 2GCOA 4YMWA 1GP2A 4PZZA 4ZO4A 1W0JA 1KJWA 1HY3A 4XIGS 3UMFA 1JJ7A 1LNZA 1T3LA 4JBYA 4IDOA 2D7DA 3MWKA 2BCGY 3KKQA 1E32A 4GNKA 5FR2A 2YZ2A 3X1XA 1M2OB 1W4CA 1JR3D 4LI0A 1M7HA 2WJYA 4Q18A 1UKVY 4KITB 2IEYA 4OL0A 5EP4A 721PA 3M0EA 2A3RA 2BKEA 2BVNA 3CF0A 4IOMA 2DPXA 4M1TA 4C0JA 5HKKD 3SI7A 1SVOA 2BJVA 1LFDB 3Q9LA 5FBVB 5KTYA 2BBSA 2C98A 2ZJ5A 5E7MA 2GJKA 5DLQC 4ITRC 2JDID 2ZE5A 3RS7A 2QTVB 4HSEA 2UVQA 2QAGC 2GHIA 4L4UA 1EFRA 5TY0A 3GFTA 4UNNA 4UXIA 3EG5A 2LWIA 2WM9B 2XSZA 3B13B 3EA0A 5AUQA 3U4QA 2QG6A 1NVWQ 1FP6A 4D0GA 2B6HA 4FINA 4DBLC 3BE4A 5A5GA 5KHOC 3BB1A 4K81B 3EPHA 4AIIA 2OLKA 2XTZA 2ZIAA 4DLWA 5IK2D 4FN5A 3ZQ6A 1KI2A 3BH0A 2VSOA 3GP8A 3TJZA 1EFTA 4HUQA 3TBKA 4B71A 1E9BA 4GI7A 4M9SA 1A82A 2QMEA 3B78A 3N5CA 4Q9IA 3RS0A 1GFIA 2IF2A 4P4SB 1LS1A 5K8LA 2IA5A 2VA8A 4OQXA 4Q1AA 4OK3A 3T15A 1NLZA 2JLXA 4DB4A 1W2HA 4RD6A 4GRAA 1UBEA 4YDHB 4GMXA 3RDPA 4EQ6A 2A5YB 3SOPA 1KSFX 4G1UC 1SHZA 2CVHA 3IO5A 2QSYA 3Q5EA 1SXJA 2ZYVX 4D4JA 2ANBA 1F60A 2GZDA 1HV8A 5KUTA 1TNDA 2VBCA 4II7A 1P6XA 1GRNA 1EFUA 3GMTA 3BFKA 3QXJA 1T3SA 2HJGA 3BK7A 5DE3A 1IQPA 5HE9A 1KK1A 1E2MA 4OHXA 1W47A 4H1VA 4M21A 1CULC 4JVLA 3ADDA 1OKKD 1W36B 3K8YA 1E9DA 1DTSA 3QVVA 2FPKA 3RRMA 1P60A 1G3QA 4FMBB 2VP5A 2Z43A 3FKQA 4LBYA 1ZM9A 3FWYA 2NMVA 3GJ3A 3NTUA 4JJZA 1E1RD 1VTKA 4RFSB 4UJ5A 3UWKA 4KI0A 4FWTA 3VU9A 2ZANA 4JKYA 2QY9A 2BCJQ 4KYUA 3QF7A 2W0SA 2DHRA 4B2LA 2LCFA 4BFZA 1M7BA 3UIEA 1E2DA 1AN0A 3FVQA 5JRZA 1GKIA 3DO6A 1W2GA 1W4BA 2ZUCA 4D26A 1HUQA 2CBZA 3QKRA 4C0BA 2ZE6A 1W7AA 1JR3A 4IW3B 1KMQA 4DLUA 3L2OB 2VHJA 5FUXA 5EE1A 2WSMA 1DELA 2HXSA 4DSTA 4YDSA 4PSAA 4LC1A 1T9HA 1SULA 2QE7D 3KTAB 4OQMA 2G9NA 3VAAA 3DOEA 5A0FA 2FF7A 2MMGA 1NI3A 2ZI6A 1KJZA 5FL7A 2OBMA 2AFHE 5FOTA 1JI0A 2JDIA 3C4JA 2ZROA 2PZGA 5JWOA 5DN6A 4LV6A 4C0QC 2FGJA 1Q21A 3NKVA 4RD4A 1ZIOA 3EC2A 1DADA 5FH9A 3KQHA 1CJUC 2DWPA 2J45A 3MD0A 3THWB 1FFHA 1NL3A 3BS4A 3SQXA 4GL2A 2EFHB 3K9HA 2F6RA 4WZAE 2IUUA 4LBWA 2ZRJA 1U9IC 1ZD8A 3VFDA 5L3SB 4JT2A 1QHGA 1TQ6A 2YWGA 3LV8A 4KBFA 3QKSB 1G4AE 4TYQA 2O8EB 1SGWA 4F91B 1OLOA 2OBLA 3GLHB 2QEQA 2OCYC 2BM1A 4ZDJA 4FCVA 1WB9A 3THXB 1OSNA 5TXGA 5B64A 2KSQA 2I1VB 2CDNA 4IFBA 4MITA 4B47A 5KDOA 3U61B 4OI4A 4KHZA 4JLPA 4UJ3A 1AK2A 4CDGA 2Z0MA 3G5UA 1NMZA 4EFLA 1AQYA 2WPDD 4MKIA 1Z08A 4A0FA 3LRPA 1Z2CA 2XNDD 3K0CC 2ZJ2A 4MRVA 4MYHA 4C7OB 1N5IA 5CYPA 4QGHA 3I62A 1ZUHA 3I72A 2HCBA 4B74A 2ZQ5A 1KNXA 1RYFA 4ZKEA 4G0NA 1D2EA 5CJ2A 4Q4LA 3THYA 1Z0DA 5JSZA 5G3ZA 3E1SA 3CUEF 1P5ZB 1XEWX 2D74A 1DBSA 1UM8A 3QVUA 1CTQA 4CW7A 1G8FA 1IM2A 1S8FA 1OKKA 4PSKA 3VKWA 5FBWB 1VYUA 3OEHA 2HUPA 4JJKA 4CGZA 4IDQA 4HZUA 1N5JA 1OIXA 4EPWA 2O8DA 1NKSA 3GEHA 1ZIPA 5DI3A 1E2EA 5EXPA 1GL6A 1N0UA 5EP2A 1E1RA 2G3YA 2Z4RA 3C5CA 3GEIA 4TMTA 1VIYA 2GK6A 4UQOA 1NN1A 3IEVA 5E7JA 2ZI5A 3IQXA 1Q1EA 1CXZA 4RKEA 4XTRA 3PJRA 2D7CA 1WXQA 4HLUC 1G1MA 4TMWA 4A0GA 3A37A 2AKYA 1KY3A 2A30A 2IS6A 1FUKA 4PPNA 2QSZA 3AGPA 1ZAKA 3NC0C 2FEOA 1DAGA 3GLIA 1AQUA 2Z6VA 4JL8A 5SZKB 2XOKD 2VHUA 3CNLA 2Z5FA 2J41A 3V9PA 1RC8A 2AK3A 4LPSA 5FI1B 3SJCA 3B60A 1J8MF 2QPAA 4LGMA 4FXPA 4B3FX 3PR1A 3S1AB 3QG1A 3CIOA 5LPNA 2CK3D 2O52A 2DWOA 2KBFA 4RKFA 2IXGA 5J4HA 1YQTA 1A1VA 4CEJA 1EX7A 5FTNA 4IOJA 3B9QA 1Q1QA 1G5RA 1SKYB 3GPLA 4H9GA 2F3TA 4A82A 1E0AA 4URXR 4D0NA 3HJNA 5HE8A 4A8JB 4BFWA 4A2QA 4M9ZA 1ETUA 5L3RA 2QPTA 4PR0A 3LLUA 4DC9A 4F4JA 2WOJA 2HLDD 4BLPA 2QQ0A 2BIFA 2Z4SA 1E9SA 1HQCA 1GNQA 2J0QA 2KJQA 2P3SA 4LWZA 3V4FA 2JLZA 4LBZA 4A0RA 2PJZA 4E03A 2W6JA 2H8KA 3SYLA 1NJFA 1Z07A 3MSXA 4B6EA 1LF0A 3A6PC 4IRUB 2VLIA 2CE7A 4NYMQ 1IXRC 4MQBA 2WPDA 3CB4A 4MGZR 4PO1A 3KKOA 3MRSA 4QC2A 1KDRA 1ZC3A 2GJ8A 2XNDA 3KFXA 5DGXA 1JBKA 4LHVA 2BDTA 3GLHE 1WQ1R 3KKNA 2QAGA 2GF9A 5JWHA 1QG4A 2GESA 3RWMB 4MGIR 3SJZA 5HZHA 1UDXA 2H92A 1YZQA 3SBDA 1JR6A 5JI2E 2BBOA 5HTKA 5GJVC 1VHTA 4R2HA 5LB2A 2ODWA 2MSDB 4BLOA 2F1RA 3RSOA 3O8CA 1MV5A 1GVNB 1ONBA 3BORA 1AM4D 3IHWA 4NU0A 3OZXA 4FCTA 1B23P 2OT3B 4L15A 4IVRA 2GVDC 3PITA 1G7SA 2C95A 1FTSA 2OZEA 3W8NA 3UPUA 5KO2A 3DPUA 4UXHA 3RNLA 2EFCB 2HT1A 1R0ZA 2REOA 5AR1A 5JCPA 1KY2A 5FTLA 4ZIRB 2W2TA 1N6PA 1S3SA 4V0LA 3O47A 4FMDB 2B7CA 3WNBA 5AUOB 4DLVA 2V6JA 4B3BA 4Q47A 5ANRB 4Q00A 4KCGA 4M1KA 3BB4A 2QP9X 1R7RA 4B6FA 4ZDIA 3QBTA 4N3NA 3VX4A 4BZPA 3ICQB 4WA7A 3K0AA 1D8TA 1E2PA 4TTPA 3AKDA 2GNOA 4W5HA 1UDWA 4O3MA 2AN9A 2RGNC 3EA5A 5FPHA 2XOKA 1TAGA 2WKPA 1CU1A 3U7HB 4AWXA 2SHKA 3BFXA 2HYIC 1YZNA 3ZIAA 4DCTA 2RHDA 2NO6A 1E9AA 2WMOB 4MKHA 4B3DA 4JLNA 4P3YA 2OLJA 3GEEA 4R7ZA 3R7WB 1XF9A 621PA 4HB2A 2XB4A 4R2IA 1T6NA 4I1UA 2R6DA 3A58B 1ZNYA 4XJXA 4LRWA 1XMJA 1NMXA 1IN7A 1G8GA 3I61A 3WRYC 2WHXA 4MRSA 5DH9A 3KZ1E 1EG7A 1KHTA 2AD1A 3G82C 1EX6A 5GVRA 3U3RA 4LY6A 1WBBA 4V03A 2JAQA 1NLYA 1P2UA 2DFNA 4F4IA 1KOFA 3MMPA 1GITA 1NG9A 2FFAA 2HLDA 2D3WA 1WCV1 3CRW1 1E6CA 3SDZA 1U94A 2GEVA 3LNCA 5F3WB 521PA 3UMSA 1TX4B 2YWFA 2RHMA 1DAIA 4PX9A 1SKYE 1AZSC 4NYMR 4FWIB 2ZTSA 5KOYA 1UFQA 2XJ4A 1E2IA 4KFRA 1DPFA 1PLLA 3K9GA 4Q4JB 2YNMA 2CL0X 2WICA 1UADA 4MUBA 4TTRA 2GXQA 2V8OA 2WSSA 3GQBA 5EP3A 4EIWA 3LD9A 6Q21A 3Q3JB 2HJVA 4TN1A 4YMSA 5CK5A 1OB5A 1EGAA 2J46A 1U0HC 3SJBA 5IT5A 2FFHA 4M53A 2KI5A 2FPMA 3H1TA 4RD2A 3GJ5A 2GJAA 1MT0A 3MUFA 3WBKA 1XX6A 3AVVA 4KV9A 4A6PA 5FOSA 5DHFA 2QM8A 1Z8FA 1T3HA 1KO1A 1M6NA 1S0UA 3AGQA 1IY1A 2J59A 2GCNA 1OV4A 1US8A 2AKAB 3E5HA 3T06B 4C30A 4F7WA 5EE0A 4GBMA 5CM8B 5JS8A 1Z6XA 1Q57A 2WWGA 4RZUA 1D5CA 1W44A 1PJRA 3BAFA 3WMGA 3AP1A 4IFEA 3GLGB 1P9NA 1L7VC 3QNUA 1U8AA 2J7KA 3FHTA 1MO5A 3JZAA 3QE0A 2OFOA 3UKDA 2RAPA 1GTVA 3Q7QA 1ZNZA 3L82B 4K46A 3WRXC 3MJHA 5B57C 5JCZA 3K0CA 1G9XA 1TTTA 3BH6A 4LUCA 1II0A 3AKEA 2WAXA 5DYIA 1T0JB 1WA5A 1S96A 1OHHD 1U2RA 3I8SA 2CCGA 3RS5A 5BXQC 1T8TA 3WP1B 4NP6A 2GETA 1NG1A 2A5FA 4FMDF 1HT1E 2HYDA 1Z28A 4TYPA 4WZ6A 5FTKA 4JLMA 4RZXA 4AKGA 4JZKA 2WWWA 3NHBA 3TR5A 4OQNA 4ACAA 1GILA 4PQRA 5P21A 5FUVA 4DCNA 2WWHA 2YOGA 5KYKA 1NRJB 1KZ7B 2O8BA 3L0OA 3AVUA 5IHPA 3LH5A 4DT1B 1KYIA 1BMFD 4U00A 821PA 1MH1A 2FN4A 4TZ6A 2NO7A 5TDHA 2DBYA 4KYIB 2REBA 1Z0IA 3P20A 4AYTA 2P0EA 1E9FA 5JJKA 3KUDA 5CLQA 2BM0A 2WJJA 2CJWA 4HLUA 4DLYA 3A1SA 1RJ9A 2RMKA 3K1JA 3P4XA 2ZJBA 4CVNA 5CK4A 4DRZA 1II8B 3FKSA 4BLRA 1A5TA 2QPOA 3HR7A 3L0SA 2V3CC 5FL3A 3TSWA 1ZNWA 1QRAA 2RGEA 2RGAA 3GJ7A 1AGRA 1CRQA 5JJLA 2J87A 1EK0A 1HH4A 1W0JD 1V5WA 4NBSA 2CMKA 3TE6A 2PH1A 3MJRA 1DVRA 2JA1A 4I1OA 4G5SA 1F5NA 3ZZTA 1JPNA 3AH8A 2OHFA 1PUJA 3ASYA 1GNPA 1W5SA 4BZXA 4WXPA 4LJAA 3X1YA 2UZ3A 5HPYB 3WHLA 3WYFA 1XTRA 4V0KA 1RRFA 4NCIA 3VNUA 2NZJA 4PPFA 2FMXA 3I92A 3N70A 2ZSEA 4DSUA 2VF7A 4L5BA 5EXSA 2EFDB 3PEUA 4OI2A 5KNDA 3A1VA 1UEIA 3HU3A 4AURA 3TMKA 4DWJA 1LB1B 2BBTA 3RRZA 1Z63A 4C0LA 4ZPXA 2Q0HA 2FX3A 1IN5A 1JJVA 3UG6A 3AKCA 1HURA 3BFVA 3NDBB 3R9WA 2PBRA 5FPTA 3NXSA 4NZYA 3TUIC 1ZBDA 3QF4A 2ZSBA 5E95A 1OPXA 4LJ5A 2EWVA 1EESA 2C2HA 3OIYA 2Q9BA 1NLFA 4JBXA 4QFMA 4J0QA 1E69A 4DJTA 4DKXA 2OO7A 3IIJA 3PQCA 1WBDA 3RC3A 2XNSA 4GZMA 4OQFA 3CNOA 2O8FB 2QN6A 3K9NA 2RCNA 1M1YE 4MRNA 1I2DA 1KSHA 5AJXA 3IILA 3L43A 4YMTA 2YHSA 3PV0A 2OUKA 3D6TB 3L8ZA 3REFA 3VR5A 3WP0A 4M9XA 1I4TD 3VR6A 4AG5A 3I5XA 4WAUA 2Q3HA 3ZQJA 3GLGE 2QGZA 2VHCA 5KSZA 2QROA 2V7QD 1SHKA 2E1RA 4ESHA 421PA 1R5OA 1P62B 4OI1A 3TW8B 2D4HA 2IYXA 1JALA 1Z06A 5FOXA 2ORWA 3F0TA 4PC2A 1W0KD 3IIKA 3D8BA 3PUZA 4IJMA 3SJAA 1GSIA 1U0LA 2ANCA 2ZYWX 5EE3A 3W9YA 3IO3A 3W6NA 2CVFA 3TVTA 1OH6A 1I4DD 1G19A 1OFHA 3B5JA 4RCZA 4L16A 4CYMA 2CHGA 1G7TA 1QG2A 2ZSFA 1VG8A 4RJLA 1CLUA 2WIAA 1CKEA 1J90A 3TUJC 2IUSA 1CR1A 5EUMA 1KI9A 5G41A 4MRPA 2RGNA 5JMTA 2OSBA 4LCBA 2VIIA 4PHTA 1E9EA 1RPZA 4AYWA 4BE7B 1Q22A 2O5VA 4LJYA 3NBZC 3AUXA 2J0UA 4B2IA 3KKMA 5C1BA 1Z2AA 2QRNA 4KXFB 3EWAA 4TLBA 4GDFA 2ZRAA 4M1WA 5DYGA 5LD2C 1KK3A 3REGA 1RRGA 1GKYA 3KUCA 4C2UA 3RYTC 4IXNA 2QQEA 1OIVA 3OHMA 1KI3A 4JSTA 2FG5A 5FUYA 4JVNA 5JFGA 4JMPA 1K8RA 4MRRA 5FL7D 3TLXA 2F1HA 1OH8A 2F43B 1QHSA 3PEYA 2PZEA 5AJYA 3QKUA 2ZXUA 2GCPA 4EJSA 5DN6D 2PCLA 3U2QA 3VR3A 1XPOA 1XEXA 2PLRA 1S1CA 2WKRA 4XWKA 2GRJA 3FDIA 4PO8A 3VX3A 4I1VA 2OEPA 2YVUA 1Z6GA 4NMMA 2IX3A 2DB3A 3K0FB 4JYCA 5JECA 3QUSA 1D2MA 1QHNA 4Q7KA 4YLGA 2LKDA 3N2EA 1KNQA 5EE5B 4HAVA 4BPBA 4Q4HB 4LYFA 2GEUA 3FMFA 5GADl 2F1JA 2FZ4A 5SZHB 4NKRA 1KSJA 4PHHA 4MYTA 5KSOA 1K5DA 4QJ5A 1Z6TA 2YINC 4Q5IA 4LDJA 5TVKA 2GXUA 4JLAA 5CDFE 4V0NA 2AXPA 4C0SA 1E2LA 2IYZA 4XH9B 4L9SA 2WWFA 2UZIR 4B43A 1E79A 4P4UA 1P61B 1G8YA 4GOXA 4JLOA 2Q21A 4QJ3A 3ZVNA 2ZUDA 2IYSA 3TUZC 1PVOA 4WZBE 2G1KA 5EXXA 5CITA 1TUEA 3CF2A 2V9PA 2V7QA 1XTSA 1TQDA 3RANA 2ZEJA 4DSOA 1ZUNB 3F3YA 4ARZA 1R8SA 3WY9A 3ZJYA 3FFAA 4XVRA 2QBYB 4NCJA 3I32A 2EW1A 3VQTA 2N46A 3LBIA 1W0KA 3AEZA 1T8UA 2FJUA 1TQ2A 1XD2A 3T61A 3K70D 5L3QA 1GRRA 1FZQA 2RGGA 4QXAA 2K5UA 2X1VA 3W3ZB 4HUTA 1NP6A 1NIPA 3BC1A 1FW6A 2JLQA 1EXMA 3CRQA 3OEHD 4HDOB 1VYTA 4A15A 3W90A 2R6FA 3HR8A 1KDTA 1E2QA 1X1SA 1P2VA 1XD9A 3P32A 2O8CA 2OXRA 4QRHA 3GLFE 1CIPA 4TT3D 3Q5DA 2CEAA 1Z47A 3OAAA 1WRBA 3CX8A 1OXXK 2WWXA 1A4RA 5G40A 3T5DA 2Q3FA 3SFZA 3J81k 1VG1A 3HWSA 5AUPB 4IDHA 1Q12A 4TQ9A 4UNPA 1C4OA 2OAP1 1J2JA 3K0EA 4BEJA 2XJ9A 4IVQA 2IYYA 2ASEA 3FHCB 4C3ZA 2O0JA 1ESNA 4WOPA 3EPKA 4V0MA 1R5BA 4M0LA 1VPLA 4IEIA 1XXHB 3X1DA 3U60B 2QMOA 5B30A 4B76A 3ICEA 2HEIA 2V6IA 1J7KA 4A2PA 3NEJA 3B1YA 3Q8XB 1Z29A 2JLYA 5FOWA 2IXEA 4TL9A 3T1VA 4IDPA 2I4IA 1F2TA 4B73A 1IJFA 1XPUA 3AP2A 2D62A 1N6IA 4M1OA 4MKFA 2WWYA 1E4YA 4LJ4A 4PAOA 2NO1A 3VNVA 4QBIA 3PUXA 4GSYA 5F9FA 1YE8A 3EZ9A 1ZD1A 2MSEB 8OHMA 2ZETA 1CRPA 2BMDA 3TGPA 3F8TA 5L3VA 4R71A 3AVWA 1DOAA 3B2EA 3HP1A 4BWYA 3T1QA 4US1R 3A1UA 1E0JA 2IC5A 3RVBA 2AD5A 2ZVQX 4IXMA 1GG2A 2OE2A 4YONB 1GL7A 1ZUIA 1GKUB 1KMHA 2XEXA 3MFYA 2ZE8A 1OH5A 1UBFA 3CPHA 3TK1A 3P1JA 3EZFA 4JL6A 2PJRA 3H0KA 4OJQA 1Q0UA 4Q4AB 2V4ZA 1YZLA 2W6JD 2R6AA 3TQCA 2ATVA 1R6BX 1P9RA 1GAJA 1NJGA 2P67A 2X2FA 2ZPTX 1N25A 2ZREA 4OJKA 4JSYA 1G17A 4WBSA 4S2EA 4XOIA 1Q20A 3IBYA 5HCIA 5HCNA 2NPFA 4PPQA 3ZVRA 4QHYA 3TW4A 5F9HA 3B1ZA 2QORA 5J40A 1QHHB 1XFAA 2GXAA 3DM9B 2JASA 3A4LA 1G4UR 4R98A 5JBQA 3O8BA 1S4QA 3T12A 1MO3A 2FFQA 1SVIA 1OFTA 4D0LB 4I4LA 4DSNA 4F38A 1N6NA 3M1IA 2ZR9A 4WVFA 2AR7A 1TADA 3A1WA 2WBLC 2JLVA 4TT3A 1XU4A 2B92A 3H2YA 1MABB 2G0NA 1YZTA 4M22A 4C9BA 1KI6B 1UKYA 4P32A 3A1TA 1JXMA 3CONA 1BYUA 2GA8A 1G8HA 3CRMA 4BZQA 4EPVA 4GOJA 4Q01A 4MUAA 4HYYA 5FBLB 2YYZA 3NH6A 2E9SA 2FSIA 1IN6A 2QTHA 4Q1FA 1KTVA 4CEIA 4HLCA 1OW3B 1TUIA 1N5KA 3Q85A 3CBQA 4NCNA 1E99A 3HU2A 1G21E 2IYQA 1E2HA 4Z1MD 1Z22A 2GCOB 5FBQB 4Q66C 2CL7X 5C46F 2G0TA 1G5TA 3QXCA 4QKQA 3TQFA 4DLXA 4KFTA 1AZTA 2R6GA 4D80A 1NBME 4JT4A 4GP7A 1CS4C 3ZIAD 2Y8EA 2VP4A 4LZZA 1MR3F 2VSFA 5UKDA 4DCUA 2IT1A 3IPXA 3H86A 3SS8A 4OKSA 2NOAA 3DZ8A 4RD3A 2ZS9A 4LJ7A 1R0XA 1YRAA 3TAHA 1V43A 1N6HA 1T5IA 3MAAC 2PEYA 1OIWA 1OE0A 5KPJA 4TL7A 2KB0A 1YR7A 5KSYA 3AVYA 2EQBA 3B9PA 3IEUA 1M8PA 4TTQA 5EQTA 4BLTA 2VTKA 1XXHE 4RCYA 4LJ6A 4X8HA 4PC6A 3X2SA 3CR7A 3KJHA 3OIVA 2IK8A 4L8GA 3NBYC 3QOFA 1CEEA 2A9KA 1IONA 1P73A 2FZLA 2XXAA 2G1JA 1U99A 4JYBA 3KB2A 3GCGA 2X77A 4KFUA 2G6BA 2ZJAA 3RLFA 2D2FA 1Z6YA 5AK0A 2FA9A 4TL8A 1CJVC 3CH5A 3U4QB 2GAOA 4DLRA 1KDOA 1S1MA 2CCKA 1D9ZA 5EXTA 2C78A 4ASUD 5K8TA 1AJEA 5FR1A 5J4VA 1IXSB 1F2UA 4CEHA 1ESMA 3G0HA 3QXHA 2C04A 2WSSD 1XZPA 2O0HA 5DISB 3T1TA 2R44A 4BQSA 2IYRA 4FCWA 3CPEA 1G7CA 1P9WA 4HUQB 3CH4B 3Q7PA 4EFMA 4B3GA 4TLAA 2ZYUX 4EAQA 1KIMA 1MO6A 3TSOA 5DNYB 1GOTA 5HR5A 1YHNA 3K09C 3DZDA 2YC4C 5FTMA 3FTQA 4EQ6B 2R6CA 4KO8A 4TZ0A 5FPSA 3U3MA 3BH7A 4ABYA 1VIAA 2Q3MA 1SXJB 2P6UA 4G3XA 5CDFA 4DHEA 5BYKA 3K0SA 1ZU4A 1VDZA 5AJVB 5TB5A 1FX0A 3IDQA 4GFDA 3PXGA 2V1UA 4D2IA 4Q1EA 1X6VA 2L0XA 4Q7JB 1PLJA 5CYOA 2NG1A 2HF8A 3RHFA 3OEED 4BASA 4IOKA 4Z51A 3SZRA 1ODFA 1AIPA 2FH5B 1NY5A 1ZD9A 1IN8A 2W2VA 4O2LA 4Y0AA 2GJSA 3T35A 4U7DA 3W3AA 1HTWA 4LC0A 3VU9B 1XTJA 2BV3A 4Z1MA 2IWHA 2J0SA 1IY2A 2AFIE 4A9AA 4F93B 1Q1BA 3QQ5A 2AL7A 2Q6TA 4US0R 2NQ2C 4PC3A 2ODBA 1WDTA 2ERYA 1TMKA 3I3SR 4QBFA 2QZ4A 3EIHA 3OE7A 3QKRB 5CIQA 3U5ZB 2B21A 2BKUA 4LOAA 5AUNB 1Q44A 1XEFA 4OHVA 1SZPA 1KGDA 2PT5A 2ZRKA 5JWRA 2P5TB 3RRYA 1DE0A 3GLFA 2JJ1D 1K5GA 5FBRB 3HYRA 3RSLA 1G3RA 2IYWA 3GJ0A 4E22A 4PPGA 1P3JA 5JS7A 2NO0A 4PHFA 1VCIA 3EWSA 1CP2A 5B58C 1RKBA 5D3MA 3U44A 1GDDA 1OXSC 4Q19A 3QPUA 1N6KA 4EJSC 4OHWA 5AJWA 3A36A 2AHOA 2ODNA 3FKSD 4Q1BA 1U8YA 2DR3A 1AGPA 3AB3A 2WWIA 4ZCIA 1YR6A 1ZM2A 2J3EA 4Q7MB 3MWJA 2WVJA 1KSGA 2CLSA 1W4RA 1SVSA 5KSPA 5BN4A 4C0KA 4ASUA 2GWHA 4A8JC 4QGFA 1M74A 4FMCB 4B35A 1U0JA 1ZM7A 2QT1A 3NBFA 3RS4A 3CX6A 1G6HA 3FMIA 4JVSB 5DI9A 3SBEA 3KXIA 5C18A 2QL6A 3VKGA 4Q9JA 1KAOA 2LKCA 2IYVA 2JJ8A 4QNRA 4XWAA 2J5XA 4XSGA 1TF2A 3ONWA 1TEVA 1UF9A 3KDSE 4LHZA 1AS2A 1N3BA 1TL7C 1J70A 2VHTA 3QEOA 3U3JA 1OFUX 4LV8B 1P72A 2R65A 3P27A 5M04A 1BOFA 2H57A 1P7CA 1E2NA 1XCMA 2P2LA 3IBGA 4ILEA 2JLUA 3NBXX 4XVQA 3THYB 1UBCA 3K70B 3AVQA 1VG9B 1R4AA 5JSZB 1KO8A 1G7RA 4H1UA 1XWIA 2GAAA 3FPAA 3DL0A 2ZM5A 4NONA 4UNSA 5FOVA 3D3QA 3N2IA 4C0AC 2AX4A 3OEEA 1XJQA 2GBLC 3PENA 1UKZA 4MH0R 4HZUB 3V00A 2O8DB 1RW4A 1K6MA 3KKPA 4XD7A 2RKOA 5CIWA 5DI3B 4G01B 1JAIA 1SXJE 1U98A 2W00A 4DLZA 4A0HA 2KBEA 2FSGA 221PA 2QU8A 2RH5A 1KK2A 1DAMA 1KI4A 4RZ2A 4ERNA 4ESVA 1RE0A 3RRNA 4QHSA 4P4SA 2YOFA 1D9XA 3BERA 4MGYR 1JNYA 2PLFA 2PZFA 4Q9LA 4WW0A 1L8QA 1W4AA 4Q1DA 2NZ8A 2H17A 4AKIA 1GRQA 4NE2A 2RGXA 3GLIB 2JJ1A 1Z3IX 2X2EA 2Q9AA 5BQ5A 3NHAA 1NVVQ 1OJLA 3D31A 1WE2A 1KKLA 3AP3A 4DDUA 5FI0B 1BH2A 3AVOA 5EZ5A 3R8FA 4Z8YA 5BN5A 1MKYA 2DFTA 3HPRA 2ZRLA 4JIMA 2KE5A 1CR4A 4CEJB 2ORIA 4HEJA 4DCSA 1JR3E 2ZYTX 2CXXA 1P75A 4HDQB 2EFEB 3ZVLA 4P33A 1CJKC 1CR2A 1BIFA 4DDVA 1E1QD 1TQ4A 1OYWA 1X8JA 4Q03A 1UKEA 3UK6A 1IHUA 3BWDD 4HAZA 4RFSA 1BS1A 1T4GA 3AF3A 3EPLA 1O3YA 3VHXA 1QVAA 4QBHA 1VCOA 1FTNA 2ZS7A 1KK0A 2GTPA 3LFUA 4M8NE 2FPLA 3ETLA 1ZMXA 2VQSA 1G3IA 4DIEA 3NG1A 5J4YA 2JGNA 2W0MA 4PC1A 2IW3A 2YC2C 4G5QA 4G5GA 2J7PD 3LY5A 2NO9A 3BIFA 3RABA 2DCUA 3GFOA 4GZLA 1G41A 1XTKA 1OB2A 2QUZA 3KTAA 4FMCF 2ZRBA 4G5RA 3W34A 3QY0A 2IEZA 3ZD6A 1E4VA 4YXWD 3KFVA 3EZ7A 2ATXA 2QAGB 2XZPA 2EYUA 3LBHA 3T34A 2ZR7A 2VO1A 3AM1A 2ORVA 2MMCA 1QBKC 1PUIA 1AS3A 1HEIA 2FSHA 4ZV4A 1HYQA 3THWA 4W5JA 3R9XA 4PAMA 1S3GA 1YZUA 3RC8A 4S35A 2EVWX 2ZAMA 3WMFA 5L3SA 5B2ZA 4C0HA 5CJPA 3QXXA 5DIFA 2HDNB 3AF4A 3QKSA 1ZC4A 4NTZA 2PMDA 4HI0E 3GD7A 2O8EA 2VF8A 4TLCA 2VSXA 3GLHA 4OQLA 3THXA 3CKLA 1E79D 2QNRA 2QM7A 2N42A 3NC1C 3MCAA 1H8ED 3SE0A 1KAGA 2E87A 2QTFA 3CLVA 1NSTA 2BMJA 4HLQB 1VKJA 1SVWA 3K09A 1RRPA 1U8ZA 2NTYC 3O8RA 3QBVA 2PCJA 2V54A 2DY1A 3LO5A 1QHXA 3DHWC 2IS1A 1DAKA 1DARA 1LW7A 4N0EA 4NHOA 4RSGA 1QZXA 1E2KA 5HZKA 2WTUA 3K0AB 2ZI4A 3VTKA 3BRWD 1NVVR 4ACBA 4C7OA 2AWNA 3IHLA 2VPPA 3L0IB 1QHHA 2C77A 4CF7A 2ZJYA 4GPTA 1N2CE 3KJGA 3LX5A 3A4NA 2X8AA 3TSZA 5A4JA 4I1SA 4EPRA 1B0UA 5KNBA 3B1XA 3C15C 2B7BA 3BJIC 4XTCS 3X1ZA 1COWD 4BLQA 4URUR 3IPYA 3E2IA 2B8WA 4TMKA 2N1BA 3DMNA 2ONJA 4AG6A 3KB1A 3MLEA 3UATA 2IYTA 1VYVA 1E2JA 5EJEA 1A7JA 4MDFA 1E98A 3B85A 1AKYA 1NF3A 1E1QA 3OAAD 1T0HB 4Y0VA 1Q1ZA 5FPKA 3KQKA 3GLIE 4A36A 5FOUA 2DWQA 2ZJ8A 3GJ4A 2F55A 3SYNA 1XZQA 2ZSDA 4IVPA 2P6NA 2VP0A 3MWLA 1FL9A 2GVZC 4AD8A 4A4DA 3W6OA 1N0VC 2F9MA 1YR9A 1Z0AA 3A4MA 2VHQA 5EUQB 5SZJA 1F3OA 2ZRCA 2IF0A 3CRVA 4O2RA 4OK6A 2GEDA 1EFCA 2WOOA 4KLZA 2PMKA 4LPKA 4C4PA 1YU9A 2J7PA 3T5GA 4KFSA 2FEMA 1XBTA 3KQUA 5IRCD 1DAEA 4AYXA 5TARA 2H16A 5IDVA 4HAUA 2QMHA 2CL6X 4YXWA 4LHYA 4LYAA 3D7MA 3S1AA 1R2QA 2JLRA 3QKTA 4HDCA 4B3CA 1ZNXA 1HE1C 3CO5A 3X1WA 4V02A 3M6AA 2C99A 2ODEA 3GJXC 1ZVQA 1TU3A 1ZM4A 2O0KA 4I99A 4PC7A 5C4MA 3TRFA 2OM2A 2FGKA 4KVGA 1KI7A 1N0WA 2Z83A 4FD2A 4A8JA 2FOLA 2C96A 1XJCA 1NVUQ 3BGWA 3R8CA 1XCPA 3UWOA 1PLKA 3U3KA 4MKGA 1US8B 3CZQA 2A2ZA 3L8YA 5J47A 2GDJA 3ZZUA 2IYUA 2VP2A 4NL4H 1NN5A 3DM5A 4D4MA 3AF1A 4I81A 3LQRA 1H8EA 4FI3C 1SVMA 5EE9A 4FIDA 1RZ3A 1AS0A 2BMEA 3QSYA 2XB2A 1YRBA 2BC9A 4LYHA 3W8RA 2OILA 4OHYA 4A92A 1XNJA 2GZAA 2FNAA 4OI0A 3UG7A 1G20E 2ZRNA 3SNHA 3CF6R 3JVVA 5BW8A 3ZYCA 1IOZA 1EWQA 3NIBA 2EFGA 1COWA 4KAXA 4MYUA 4PFSA 3FMOB 2GBLA 2ZU6A 4BECA 3ZS9A 1UJ2A 2ONKA 4QM7A 4HB3A 2O8BB 3EARA 1DEKA 3WNCA 3PFIA 1ZCAA 1Z83A 4ZI2A 3O8DA 3ZZ0A 4ZDKA 4TLEA 4TYNA 4XSHA 2IXFA 4KVAA 4ZIRA 2EU8A 1FQKA 1T5LA 4HLDA 4WXRA 3U7EB 1BYIA 3FMPB 1ELOA 5H1YA 4DB2A 3WXMA 2WIBA 2CJWB 1HE8B 4KSBA 3BD9A 1RJ9B 1NSFA 5C2JB 1ZYUA 3FB4A 3B7GA 1AKEA 3AF2A 2FE4A 1KZGB 2ZRIA 2YOHA 3Q72A 4B2PA 1EFHA 1NMYA 2CNWD 5JEDA 1WP9A 4PZYA 1CBUA 1KO5A 5F2EA 3RS3A 3UMRA 1TF5A 2OG2A 3JZMA 4KJZA 5D3QA 3LW7A 1HQYE 4GP6A 3SU8A 3EPJA 1H8HD 4Q9KA 1ZM3A 2ZUBA 3QXSA 3AKYA 3FFBA 2GZHA 2NPIA 5JRJA 2HV8A 3KQNA 4BFYA 1C1YA 2VP6A 3SQWA 3EAQA 5GJCA 4QBGB 3R7WA 4OBEA 1JAHA 3DKVA 4LK2A 3VR1A 2IS4A 4K8OA 1YKSA 2I3BA 3CX7A 1N5LA 3DOFA 3LVRE 5HKKA 4NCKA 1X1RA 1CJTC 2XTMA 4GT1A 4NH0A 2R9VA 4ZCMA 2QRZA 3CRRA 2I1QA 3EZ2A 3QF4B 1CF4A 4GOKA 1P4SA 1YVDA 1G5PA 2EWWA 3IGFA 1IXZA 4D4KA 3RAPR 3H84A 3B8HA 1S9DA 1L2TA 4JVMA 4HATA 2CE2X 1H65A 1KKMA 2BJWA 2FU5C 2GKSA 2RGDA 3SHFA 1E0SA 5ELXA 1KI1A 1Z6AA 2XTNA 3W5IA 1NNEA 1Y3AA 4IOLA 3ADBA 5LDDC 4D81A 4Q4JA 2JIZD 3CNNA 1DO0A 3UXMA 4B48A 1LTQA 5L8VA 3QPWA 5IK2A 3FE2A 4X8MA 4DXAA 1L4UA 3HYTA 4M4SA 1TPZA 1W5TA 1N6OA 4PTLA 3CWZA 1XDBA 2R62A 3AVXA 5LB4A 3IKJA 4V0OA 1DS6A 2IYLD 2HCJB 4LSGA 2W83A 1OXTA 3C41J 3EIEA 3AVTA 4UKDA 2V55B 4LV5B 2ZR0A 3TIFA 1XJ0A 3NEYA 1XEWY 3LXRA 2QGNA 2XITA 1I4LD 4JLVA 5H70A 3MG9A 1Z0FA 1W48A 2VYFA 2ZAOA 3LQQA 3LVQE 4LHWA 4EKDA 4Q48A 4TWZA 4URVR 4YMVA 3IIMA 2OFXA 2A5JA 5JEEA 5IF9A 2J1LA 3PEWA 1WMSA 4D6PA 3DKPA 4PQYA 3GLGA 2VP9A 1S2MA 3WHKA 2WJIA 1ZRHA 2ZRPA 3DEFA 4M2LA 4B75A 1CR0A 1FMLA 1UBGA 4PO9A 4BFVA 4D82A 1GM5A 2G77B 2PX0A 4DLSA 1T91A 1W36C 1LV7A 3PUYA 2CNWA 3KXKA 3PG5A 1Q3HA 2WAYA 1IY0A 1D6JA 3W6PA 1Z0JA 3U7FB 2W58A 1DG1G 3B1VA 2J0UB 2OV2A 1G3MA 1H8HA 3RS2A 1YZGA 3OE7D 4LX0A 1IJEA 2QP3A 2ZRMA 2C5LA 4PQFA 3VKHA 2FSFA 4BGDA 4TLDA 1ZCBA 4D25A 1M34E 4M1YA 2RB4A 3OIWA 1QVRA 2F7SA 3OFND 1RRCA 1ZINA 1FNMA 2P6RA 3EW9A 1KDPA 5E7IA 1QDEA 2F9LA 3UANA 2BMFA 4M1MA 3SC3A 4DT1A 4URWR 2JJ2D 2QE7A 1G64A 4QGGA 2H7VA 1U90A 1KO4A 1VG0B 4NYIQ 2CHQA 4EJSB 1KO7A 1E9RA 3KX2A 5FUWA 5CB6A 1QHYA 1XEXB 4TSFD 1RVDA 4B34A 3WBJA 5CB8A 1OH7A 3LLMA 3CR8A 3FGNA 3JVUA 3ND8A 2XZLA 3AUYA 2CHVA 3ZVMA 2NGRA 2C9CA 4N1AA 1UEJA 5KDLA 4JL5A 4TYWA 1II8A 4JLKA 2F3RA 2J9RA 4AK9A 2RGCA 5H8WA 5GJBA 5JJIA 3EX7C 1M7GA 1FP7A 2X19A 5FTJA 2AXNA 4D4LA 3ZH9B 4TMXA 4F92B 5KPDA 1UAAA 1MOZA 2BHRA 2JIZA 2WJHA 3PIRA 3LW8A 1PZNA 1YJ5A 4JLBA 4B33A 3LWNA 4M1SA 2IHYA 2ZU0C 1Z0KA 3IUYA 4JLJA 4NPHA 1X8LA 2H1LA 2YJTD 1SVKA 5EZ6B 2OXCA 1R0WA 2A78A 1Q3TA 2J0VA 3VR2A 3KQLA 1KI8A 3WMEA 4HAYA 2QA5A 1NVXQ 2RGBA 4BFUA 2QT0A 3NVAA 4EPYA 2WKQA 4ARZB 2HXYA 4Z8XA 3SYKA 4QL3A 2VL7A 1G8PA 2A5DA 4URYR 4NDZA 4RFVA 1XD2B 4UNQA 4MGKR 5L3QB 3EXAA 3AQ4A 3DMDA 3HPQA 2BWJA 3BB3A 4PXAA 4MA4A 2ZI9A 3H4MA 2IS2A 3C8UA 3U3OA 2VEDA 4KLNA 1XTQA 4FW9A 3SFVA 2O8CB 5GVSA 1MRSA 2PL3A 1C9KA 4XD7D 5JLJA 1J8YF 5TV2A 2O8FA 3LXXA 4L9WA 3C16C 1DO2A 2WJGA 4CT4B 2WMNB 4KSCA 4BFTA 1QHIA 1LF5A 4U5XA 3AVPA 4KODA 3TNFA 3I1FA 4LJ9A 3SEAA 1R0YA 2AK2A 2OESA 3QI2A 1GL9B 2PEZA 4E07A 1X8KA 2JLWA 1ZU5A 4DEYA 4EFNA 3U6BA 1Z5ZA 4EDHA 3ZD7A 5SZIA 2QENA 1UPTA 2GXSA 3OIUA 3WYGA 2PT7A 5K8UA 4YQFA 3OFNA 4P4TA 4O0MA 3DVLA 4A1FA 4NYIR 4LHXA 1XRJA 2JJ2A 3PCRB 3GJ6A 2IUTA 3TR0A 1F2TB 1F48A 1JB1A 2IL1A 5BWMA 3PVSA 3OF5A 2DFKB 5G3YA 4TSFA 3U6KA 1E9CA 3B6EA 2NIPA 4XVUA 1GNRA 5J4KA 1OT3A 1JQJC 2CK3A 2OCAA 3V4RA 1J99A 2DFLA 1W36D 4TYYA 1E3MA 4BUJA 2QI9C 1JEDA 2ECKA 1TF7A 4OHZA 2V1XA 1R10A 3TVDA 3VMFA 4Q21A 3R20A 1G6OA 3EC1A 4B3XA 1NBMD 4BFSA 4NYJQ 3GJ8A 2H5EA 4CRWB 4Q7LA 5BYJA 2PX3A 4LJ8A 2D06A 3FHOA 1KMHB 4PZLA 1ZP6A 4IDNA 4RD1A 1IN4A 4AI6A 5JHHB 4X8LA 1L4YA 3NDPA 3VHLB 3LDAA 1JQLB 5BN3A 2GK7A 4PSVA 3B82A 5DSZA 5DHAA 2XAUA 1FNNA 3QENA 1D2NA 2QMUA 4LBVA 5C4GB 4TMZA 3AF0A 3CWQA 1EWRA 2WZQA 3KL4A 3LAWA 3QG5A 4OK5A 4DDWA 1VMAA 3ZLJA 3KJIA 2F43A 1XP8A 2REXB 2ZITA 4PANA 5EP1A 1JEEA 4DZZA 2YV5A 1AA9A 5CM9C 3BXZA 4UNRA 1NN0A 1BKDR 3P26A 2G88A 1SKQA 3EASA 3K0FA 2FWRA 3K9LA 4URZR 3T1OA 3KJEA 4B32A 1U81A 4ON9A 3W5JA 1TEXA 1RYHA 3C5HA 3IQWA 2VRWA 1U9IA 1ZJ6A 4HZIA 2ZJOA 4Q02A 3SHWA 1P2TA 4POAA 4Q4HA 4X8OA 1GWNA 2OCPA 4QJ4A 2FFBA 1DG3A 2Q9CA 4HB0A 2ZSAA 1O87A 3TAUA 4UXJA 4QNMA 3E70C 4YMUA 1OYYA 1G16A 2OFWA 2F1IA 1KJYA 1SXJC 2WJVA 1E94E 4CZ2A 1IAQA 3PEVA 4Q1CA 4RD0A 3NWJA 1XMVA 3B1WA 5J4LA 1LY1A 3F5FA 3P4YA 1TU4A 1XMSA 3OESA 5H68A 2W6ID 1N6RA 4RVCA 4IHQA 3M4YA 1SVLA 2XZOA 4HB4A 2WV9A 3BBPA 5AWFC 1W46A 1OFIA 1X3SA 3R9IA 5KDDA 2C8VA 2ZRHA 4CEIB 4PAQA 5GJWC 4M9QA 1A2BA 1YR8A 2FDCA 2QBYA 5F98A 2XGJA 1LS6A 1FPMA 4WIAA 4NCHA 2OAQ1 5JI3E 1E96A 1XD8A 1OXUA 1E0KA 3SR0A 2BOVA 2C9YA 1MO4A 1XB2A 3AV0B 4YC7A 1BO6A 4ZKDA 4IEEA 4DVGA 2B8TA 3L0PA 2HF9A 2IWRA 1PV4A 1JPJA 2ZI7A 2C9OA 5J5CA 1ANKA 4BFXA 1NKTA 4TL6A 5KU1A 4OYHA 2OBNA 2MSCB 4PHGA 4DCVA 4JLDA 4DUGD 1G3UA 3ZDQA 5E3HA 1E2FA 1ZW6A 5AJZA 4V0ME 4NYJR 2ERXA 1WF3A 4JBWA 1XCGB 4P31A 1GIAA 3HU1A 1RIFA 2IHBA 1XTIA 1NBMA 5KNCA 1FOEB 4RZ3A 2GJ9A 3RWOA 1DAFA 3VR4A 3U7GA 5LD2B 2XXAB 1JXOA 4QG7A 4U02A 5K8IA 2A5GA 3ND9A 3DDCA 1N6LA 2AWOA 3CPJB 4EPXA 3ECCA 4AKHA 3EIQA 5LBIA 4A6XA 5E4FA 4BRWA 1MRNA 4QOSA 5G53C 2GF0A 3ADKA 4CEHB 1F2UB 121PA 1XXHA 1FMJA 4BRUA 4EPTA 3MWYW 3ASZA 2BBWA 1OF1A 2BEKA 2ZVPX 4EUNA 1XMIA 3ADCA 3BOSA 2VH5R 3LA6A 1GZSA 4ZCLA 1W49A 1NIJA 3C7KA 3CW2A 4CT5A 1A2KC 4GMDA 3KXLA 2ZI3A 1XPRA 2ZJZA 3K53A 1R8QA 2YWHA 3QIAA 4DIDA 2UKDA 5TMPA 2QAJA 4ZI3A 1FUUA 3QEJA 2YKGA 3GFPA 3LX8A 4RY2A 3SN6A 4DDTA 1G291 4P0TA 2YWEA 4HAXA 4US2R 4F4CA 3ZGXA 1G18A 2ZRDA 4BEBA 2ZS8A 1W1WA 4TQUS 1EFRD 3PUVA 4TQAA 1FX0B 1VECA 3ZS8A 1II9A 2QP4A 2W2XA 4Z54A 5JHGB 2A7QA 1VCMA 4Q9HA 2XSZD 4Q4AA 2H18A 3K70C 2W6IA 2P65A 2ZRFA 3I5YA 3I4LA 1F6BA 1Y63A 2BEJA 3LBNA 4JS0A 3TKLA 1NY6A 3CZPA 3WYAA 2G83A 1X86B 1OXVA 1CJMA 2KWIA 4AY2A 1SQ5A 2C03A 4O25A 1GUAA 4W7SA 4CIDA 2JEOA 4QGAA 2TMKA 4IKEA 3FYHA 4LYJA 1IBRA 2FV8A 3C14C 5FFMA 4ZDWA 1E2GA 3THOA 4B44A 2HT6A 3QPVA 1DAHA 1OHHA 4HAWA 4N0DA 3QJYA 1NN3A 1LVGA 4DLTA 2R2AA 5DO9A 3MGCA 4QHTA 4BLSA 4AKEA
chains in the Genus database with same CATH superfamily
2JVJA 4D9MA 1JHYA 5ALTA 3HXKA 3H05A 4QA9A 3FDZA 2ZRGA 3EVFA 4KBGA 2MWMA 4E5UA 1L4HA 2DPYA 3L4BA 2YN2A 1X74A 3GLFB 4MDEA 1Z13A 3DVAB 4M86A 3RT1A 2CBXA 4O4IA 4DUGA 5L9AA 3AXTA 3RAEC 4GC5A 1RQPA 1Y7HA 4R9UC 4ZVMA 2PZAA 1N8KA 3DE1X 2JPDA 2YXEA 3I73A 3M49A 1WPQA 2CCJA 2JATA 1RHUA 1CF9A 2XXJA 3CM0A 3N6XA 3NIFB 2EFYA 3F7MA 3Q1KA 4GOLD 2OHOA 3O4GA 3DTVB 5DTEA 3WNDA 4E6PA 1W0CA 1F5SA 1KI6A 2GHRA 1OROA 1R6AA 1DRWA 2MSNA 4KACA 4XRGA 3FDFA 2GILA 4Q16A 3IEMA 1FVOA 5E8RA 1P2SA 3EXHB 1DU4A 2Y1XA 4QPCA 5IUKC 5CT4A 3KLMX 3P5BA 5CLLA 2AG6A 2ILTA 1SB9A 2XIQA 4RKRA 3U4HA 2D0IA 3I8XA 2IBMA 2CLDX 3DYBA 1SQ6A 1U2QA 5FCDA 1KRXA 5COBA 1Q2XA 4H7JA 5BN4B 3EZ6A 1QF9A 3FRIA 3ZHOA 1UBRS 3FLEA 1NXQA 4PZZA 1SC3A 3RUPA 4IJQA 2QZJA 4XIGS 2AFHB 3GFQA 4ZCRA 1JJ7A 5LQUA 3JARB 3NYIA 2P91A 2D7DA 1J24A 2BCGY 4QWWA 5FR2A 2R1VB 2ZQYA 1M2OB 3QE2A 2OAEA 1JR3D 4FYKA 4BTEA 4MA0A 4CR7A 4MR9B 1M7HA 4BO6A 1BG6A 1FU4A 3E8XA 3K5HA 4PGFA 5I4KA 3TD9A 5EP4A 1E18A 1A5BB 2N9UA 4X90A 5K3CA 4WZAB 1E6KA 5BNZA 4M1TA 3CR3C 3ISTA 5E2AA 2MTBA 3WISA 4BKQA 1E5TA 3HO6A 3B1FA 4C20A 1E64A 1SVOA 2BHNA 4CV3A 5KTYA 2BBSA 3L49A 5LMZA 4L1KA 1C81A 5FHQA 5AVKA 4FU0A 1T36A 4U0KA 2ZE5A 4B6OA 2QTVB 3ZQUA 1JIKA 2D5LA 4OMCA 2DMRA 2RI1A 2HSZA 4QLOA 2QAGC 1JFTA 5ITVA 4HMQA 4PWZA 1EFRA 3LY7A 3L79A 4J29A 4WNAA 4AUKA 2EW8A 3EG5A 2LWIA 3UCFA 2ERCA 2NWQA 1JG2A 5IZ4A 3EA0A 1RZRD 2AJBA 2Z8XA 3KVRA 1D2GA 5AI4A 1GAQA 3R5SA 2IZ7A 3AONB 3CPSA 4FBLA 3PFHA 1QGED 5ER9A 3PPVA 3TEJA 5EJIA 1FP6A 2BLNA 3SK0A 1YRHA 5KKAA 2C2GA 2E2WA 4QYIB 2CXUA 1YK1A 3BE4A 3ZY3A 1PYOA 5A5GA 3EPHA 2F00A 4BQIA 3SAJA 1ATZA 1NZJA 2ZIWB 3T54A 3WNVA 2O6HA 4PLHA 3LUFA 4ZU3A 1DQRA 5HS6A 3ZQ6A 3CW9A 1KI2A 2OZLA 2C58A 3KE9A 3KP1A 4POOA 5FWXB 2NU8A 3MSCA 3GP8A 1WHTA 1QRDA 5CFMA 2BL4A 3HN2A 4QEKA 4M9SA 4GI7A 4Q9IA 3DUFA 4L3VA 3RSZA 3HVIA 3RS0A 1JVNA 3N74A 1N3LA 2IF2A 1WSWA 2HIMA 2WU3A 1ND5A 3UTCA 3ZEAA 2NXJA 4JX9A 1NLZA 1JWAB 3DT8A 1W2HA 3DV9A 3H87A 2ZBFA 1UBEA 3BEDA 3NRCA 3BQMB 1E8NA 1LA2A 1TUGA 3KHTA 2VXYA 3PFGA 2E4UA 4GMXA 5BUCA 1QRTA 3BKWA 3KPUA 3QEMA 5A4MS 1T1EA 5T5QA 2QSYA 3Q5EA 1ULSA 1F60A 4RK6A 3G8DA 1NYQA 1PJ4A 1G5HA 1TNDA 2VYND 3AM4A 4IO1A 1P6XA 3IV7A 4TM8A 2C54A 2AKEA 1YOBA 3C1AA 4O3FA 4R1SA 1V4VA 3BFKA 3QXJA 1SCDA 2AUNA 2VT7A 1KFKB 2ZCVA 3BK7A 3P9ZA 4MDYA 1OWMA 4FEAA 4EF6A 1GFWA 5IFLA 5BSRA 4OHXA 3SQNA 4W1RA 3W2HA 4BRZA 4F3YA 2ZJFA 1K27A 3FRJA 2WWVD 1XDWA 3TD6A 5IJ9B 3PWZA 1QG0A 2OXTA 5FYQA 1P60A 4FEGA 4EBFA 1KZYC 4WDRA 2VP5A 4WLEA 1P19A 1TCUA 3KKLA 3EFOB 4XCVA 4UJ5A 3NTUA 4RFSB 1E1RD 4FWTA 4AY5A 1F9EA 3IJ5A 2UXBB 2QY9A 3DWIA 1HEYA 4KPEC 3DBHB 2YJGA 5DNUA 4LE2A 3CCFA 1CZKA 5KIAA 1OGYA 5IHXA 2PD3A 3UIEA 4LRYA 4RK4A 1AN0A 3DMYA 5JRZA 3D0RA 2VTBB 3WYNA 1W4BA 3KOMA 2J6CA 3TEMA 3WWEA 3DE5X 3W04A 5HBGA 1TECE 2ORED 1AMNA 1W7AA 2RHBA 4ZRNA 3DAHA 3AFGA 4A23A 3JZIA 2DXIA 3M5PA 2G17A 4UCFA 5DEOA 4DSTA 1FMTA 4LMAA 2RGUA 3PWSA 4J6EA 4OHCA 4PSAA 4DV4B 1PJCA 1SULA 1ZOSA 4PLPA 4X91A 5AKEA 1U7PA 5CA0B 1PHPA 1BHQ1 1Y8RA 1A27A 3O4VA 1QOPB 2GGSA 2ZI6A 2IYNA 1KJZA 3DBRA 4UVIA 4BRSA 4GYWA 1T6BY 1NW7A 2ZWPA 5EHXA 4BY9E 3UV3A 4KIUA 1BE8A 1K3TA 3MTJA 3NHPA 2VUSA 2A86A 2HU5A 2PZGA 3PI7A 5DN6A 5KAMA 3STUA 4KR6A 3NHSA 4A10A 1UL1X 2JLCA 1FDUA 3KB6A 2JL1A 4FILA 4MLZA 5T67A 5FH9A 1YO6A 2DWPA 4KMSA 2WF8A 2IXAA 1DP4A 3FOCA 4HS4A 2ZT8A 4PONA 2EFHB 1JVBA 1PR6A 2F6RA 2RGWA 4IEFB 2R6R1 4LBWA 4J76A 3GRAA 5CR9A 4JT2A 1AGNA 1TQ6A 3VJMA 1IK4A 3LV8A 3HABA 4ZODA 2N1MA 3OQOA 1G4AE 1LLUA 2WW8A 4OGKA 4WEOA 1YDHA 1HDRA 2BHTA 3OCYA 4XIFA 2JI7A 4F91B 2OBLA 2OCYC 5TR9A 3D7SA 4JJ4A 1RXWA 3EQ6A 9LDTA 5B64A 3HLYA 5ICSA 4E11A 1HRDA 1ZO8A 3AXSA 5ENVA 2PZ8A 2H1FA 2VJYA 2CDNA 2O7VA 4IFBA 5KDOA 1KL7A 3WL7A 1KXZA 5KKCA 1LD3A 1VM6A 3PNVA 1ZH4A 2PUEA 1MVNA 3MF4A 4TPKA 4JLPA 1EWVA 2Z0MA 1N1DA 4HN4B 3WICA 4AP9A 2XBMA 5KREA 1NAHA 3BMNA 1BTOA 2XQKA 2F9FA 3TPFA 3OMWA 4EFKA 1Z2CA 1L8LA 4YJGB 2XNDD 4LXTA 3ANSA 1XCJA 2A33A 3K0CC 2GN9A 4GPBA 2CUKA 2VK4A 4MRVA 1UJ4A 5F5XA 4EP1A 3I62A 5M34A 1DJMA 3I58A 1OX4B 1N1EA 3E4CA 1CF2O 3TMAA 4JXXA 3THYA 2AMJA 3WJ2A 3F6YA 4V38A 2PDAA 3BIXA 4YGYA 5JSZA 3JALB 2PUCA 5LLTA 4ZQIA 4BNFA 3V46A 1XEWX 4E5KA 1U8TA 5KQMA 1UM8A 3WYEA 4FGWA 4OUKX 1XELA 5L51A 3KV1A 1PO7A 4RADA 2WA1A 4M7PA 3DLIA 3LWZA 1OKKA 4BX3A 5FBWB 4IFTA 4Z4HA 4JJKA 1YS6A 1V3TA 1V41E 2Z3WA 4HZUA 4BV2A 4F6RB 3KSAC 1QP0A 3RUCA 4CV1A 3CB2A 1E2EA 5EXPA 1GL6A 1N0UA 2HPAA 4O4HB 3C5CA 3GT3A 4RVDA 5EP2A 3S1SA 4D56A 1VIMA 1BMQA 1ZJWA 1N2CA 2P69A 1H9AA 4PWYA 4UTVA 4B81A 1UAYA 3CINA 1QWOA 3Q2OA 1L4EA 1NN1A 5IZCA 1FC0A 1PEDA 2DSTA 2QX8A 3D3JA 3HO8A 3W0LB 1RXSA 3LT4A 3UCXA 4ZFNA 4GPD1 2P9BA 2OL4A 4JA0A 4LQ4A 1XV5A 1FMFA 5B1EA 5DCUA 1OLSB 1FUKA 1X2EA 3QFFA 1RFGE 1UKAA 2GBIA 2H1RA 4S1NA 5A4IS 2J07A 4BNYA 4FFMA 4CM1A 2F64A 2JIPA 2Z6VA 3IJEB 3ZGNA 4EUKA 1PV2A 1QS0A 2HK7A 1FLDA 2J41A 3LUAA 5FI1B 3LHFA 3AYXB 4JELA 1J8MF 2ECPA 2PVCA 1TMGE 3OIGA 1X7YB 3UPDA 4DXDA 2QVGA 3NIDB 2C0QA 4D3YA 3U1TA 4R0MA 4M7OA 2ATEA 1N1MA 1VE3A 3MNFA 5TMDA 4QUIA 2Z3VA 4HNGA 2Z09A 1EX7A 4CEJA 1E3JA 4IMJB 3HEAA 2E4ZA 5AW5A 3QA3E 3GPLA 4DV1B 1R9NA 5CNJA 3W5CA 2FWMX 1MXHA 1ZLXA 2WFZA 1E0AA 2VAWA 4BPRA 1SK9A 1FSZA 4MUIA 3PB3A 1PYDA 4HRXA 5HE8A 4MS1A 1PJ8A 4AWAA 3GEBA 5DBGA 4ZYVA 5MHTA 3S2IA 1CZUA 4RUKA 1C3XA 2ROQA 1RM3A 2VDKB 3D64A 4II3A 2WI8A 4PAWA 3NWPA 2Q4BA 4HS9A 1V6CA 3INGA 4CUKA 2J0QA 4BC1A 3TVYA 1ZN7A 2KJQA 1JIQA 1CHDA 1LBQA 1GSHA 5FPQA 1TAQA 4A0RA 4E31A 1X1DA 4KYTA 3SYLA 3V97A 1NJFA 4YCCA 2BR5A 3MINA 4I5DA 3ZV4A 4IRUB 4UVDA 4KQ1A 2CE7A 5F21A 1R0SA 2WTAA 4DCJA 1WLSA 1UT6A 3WAKA 1ZC3A 2GJ8A 3WQHA 3G6KA 4H7HA 3W4KA 4LHVA 4L8YA 3K1AB 3GLHE 4AUNA 2GF9A 1QG4A 5JAZA 4UFPA 1XDDA 2IITA 3RWMB 4EKGA 5C52B 1ZN9A 1ES9A 2WYIA 4MVJF 4BV8A 2H92A 3GA7A 1NVTA 2AJ8A 1KJ8A 1ZMTA 1P6UA 1E59A 2BBOA 2DKFA 1ENZA 2JLAA 3DOJA 3H2SA 5GJVC 1VHTA 5HTKA 3ZD9A 4TVKA 5IVPA 2ODWA 4OXYA 5IULC 3EG9A 4CMAA 5KINB 3G6WA 3L7KA 2OB2A 1MV5A 1ONBA 4NU0A 2VPTA 1R4NA 4XWGA 1B8VA 1S6YA 2QRGA 3JQFA 3VDXA 4E32A 3HCCA 3A31A 1M5UA 2OZEA 2WMDA 1YRYE 1SAYA 5A5EA 3CRZA 5LZ7A 4QFCA 4GSLA 5AR1A 5IEBA 4FNGA 5FTLA 4ZIRB 2GNPA 3D6AA 2ZBGA 3L04A 4LZNA 3LX6A 4MNTA 4ER3A 5J59A 3WNBA 1CEYA 5JSHA 4DLVA 2V6JA 4UARA 4WZZA 4JB3A 5F2NA 3FLMA 2YWDA 3H5IA 1Q7EA 2YJ6A 1L5LA 4JROA 2QRLA 5DX8A 4N6OA 2YVQA 4NBRA 1XG5A 1XAIA 2J4DA 1UBMS 4HXGA 5F52A 1D8TA 2QTAA 4CIWA 2AN9A 3M89A 2ARKA 2YYAA 4E1BA 1Y4AE 2RGNC 4K9DA 1TAGA 2ZCJA 2R7AA 3ENQA 3TOSA 1U8FO 4OATA 3WLHA 3NTLA 1PL7A 3I9OA 4GM0A 2O19A 2JH8A 1YACA 3AEKA 3K0BA 4R7ZA 3GEEA 3DZKA 3R7WB 4A0QA 4C03A 621PA 4R2IA 5KYYA 1J1UA 1R8XA 2PUBA 3A58B 4XJXA 1ZNYA 4CG1A 3CQ9A 4LRWA 5AW0A 1ISSA 1NMXA 2A94A 1XZGA 3D02A 1IN7A 3L8GA 1UFKA 1ZHFA 3WRYC 2QJFA 4U6QA 3EBOA 2WHXA 1WXDA 1LPAB 2PO7A 3Q3HA 1EG7A 3QP9A 1L5RA 1EX6A 3JQBC 2VSNA 4WKPA 4ZO8A 4GPAA 4C4SA 1C4XA 3KZMA 2DFNA 1XA3A 1GITA 2Q46A 4OXQA 1NG9A 4Q24A 2FFAA 1AHPA 3HKBB 1R3DA 1GGJA 1E6CA 3T94A 3SDZA 1U94A 3JQAD 4O6VA 4O8CA 4QREA 1M6VB 3RREA 2YWFA 1M2HA 1VKNA 3RBZA 1ZD3A 2JANA 3AEXA 3FCCA 5G0TA 4DBZA 1AZSC 2PXAA 4KAJA 1QB7A 2AQHA 3D7KA 1V95A 1GZHB 5KOYA 2FMHA 1E2IA 3GRCA 1VPDA 1PLLA 3K9GA 1BHJA 4Q4JB 2CL0X 2INGX 2WICA 4D4HA 1UADA 3T95A 5LYJB 2BEVA 1MX1A 1NBHA 3FROA 2GXQA 1UIMA 2V8OA 3GQBA 3PDIA 1KFEB 1NUAA 4OB7A 5H9VA 1RJDA 5AVVA 2M2IA 4TN1A 4P8RA 3L0YA 2JGLA 3K35A 4YMSA 4YCBA 2BFCA 4LOIA 4MV6A 4P54A 2Q7OE 2HBRA 4CU5A 2EQ5A 4B87A 4ZVRA 1NR1A 2X7XA 4DCPA 3IV6A 5D01A 1U0HC 3R5JA 1H2FA 4XPIB 3SJBA 3VI3B 3H1TA 4RD2A 1DFIA 3GJ5A 3HCOA 3LJKA 4IIXA 2OA0A 3WBKA 1CDDA 3AVVA 4KV9A 3IUQA 5JBIA 2HR1A 1RLIA 1YCDA 4BVLA 4ZOCA 5FOSA 3BTUA 1Y5NA 1I6WA 2QM8A 3FPFA 4JP5A 2W2KB 1M1YB 3ETCA 1T3HA 1KO1A 1Z8FA 4B79A 4DYHA 2AUTA 1S0UA 3AGQA 2J59A 2P79A 2VDWB 3BHMA 3M5DA 3QYFA 4NJOA 4DW8A 1US8A 4MWOA 4R9RA 3T06B 4C30A 3RS9A 2I03A 2QRVA 1U2GA 2VNKA 2WHRA 1QR6A 5AKYA 5JNVA 4JQSA 1PJRA 3WMGA 4CCSA 3AP1A 3GLGB 2IY9A 1R15A 3VC2A 1EFPB 1P5FA 2J7KA 1KXJA 2GKGA 2R96A 2DLNA 3QE0A 2OFOA 2RAPA 3KJFA 3HH8A 3L82B 4HDNA 4K46A 2H4FA 3DBVO 5TEVA 3WRXC 4BO4A 1TTTA 3UAYA 3ZX4A 1XZMA 1C7QA 1RYDA 1FNBA 4UDOA 1II0A 1LDGA 3BG5A 4JCOA 5DSXA 1WKCA 3C3DA 1A9PA 1P6QA 1T0JB 4ZHQF 5EJ9A 1OHHD 3JQ8B 4KN5A 3RS5A 3TPCA 1EDDA 1T8TA 2IU4A 2WD9A 3AC0A 3G2MA 3IAS1 4XSVA 4E51A 2IEDA 1GL3A 1Q77A 2LTAA 1HT1E 3HCWA 2HJWA 4FMDF 1SU8A 1Z28A 3UV7A 3DEZA 3N3BC 3G9QA 1QTQA 2ZBEA 2H9IA 4AKTA 1KS9A 1K63A 3FIUA 1MW9X 3NHBA 2AQ8A 4JN6B 3TR5A 4F0JA 1NOJA 1PWEA 1JX6A 3N3AC 3GBVA 2PRSA 3QA9A 1YA4A 4GBGA 4O4LF 4HX5A 5P21A 4N6GA 2WWHA 5L7TA 4PFKA 3ZI0A 3HK2A 2G9ZA 3CJQA 3GH1A 3L0OA 4XIYA 4X62B 4IG4A 5IABA 5A7HA 4UDYX 3PF9A 1T10A 1W2WB 4CM3A 2B0CA 5DBEX 5IDXA 2FG7C 2JFPA 821PA 2ZJ6A 1MH1A 1NJ6A 2FN4A 3O3CA 1ZAYA 3H2JA 3ODGA 2PQ6A 4KYIB 5ALKA 4EA7A 3U1BA 3ETHA 4AYTA 4FDUA 4J4BA 1SIOA 1UP7A 1Z2DA 4L0CA 3N2GB 1N9GB 2SECE 4HLUA 4AZWA 3ASUA 1PYGA 1RJ9A 3P4XA 2ZJBA 4LJSA 5CK4A 4AO8A 3PFKA 1WUYA 3MYYA 3O38A 3Q6MA 2D0PB 4RJ2A 5IAGA 1FLNA 3EF0A 3HR7A 2HLPA 3ZDEA 2V97A 5AI6A 2V3CC 1QB8A 2RGYA 3O75A 1MAVA 5EGNA 5FL3A 5HTOA 3W2TA 2R6JA 2OBYA 2ECFA 1MHPA 3CS3A 5JJLA 2RHHA 5K0EA 4BMNA 4LHSA 4QLBA 1VQ1A 4KRYA 3UMMA 2ZIFA 2R5FA 3S2EA 4AZ0B 5L53A 2AI3A 1OT5A 1NBOA 1S3IA 1UOOA 3MJRA 2FE1A 4GOND 1VA5A 4MQFA 4FZJA 3OP1A 2OHFA 1GQQA 4Q4CA 1FE8A 5KOJB 1IYZA 2IPAB 5BWBA 5BOVA 5GV8A 1NVEA 2OGZA 1G5FA 2PT6A 2UZ3A 4MV0A 1XTRA 1FB5A 2YN0A 1O89A 4V0KA 3REQB 2QM0A 3VNUA 1R12A 4CDNA 4ENWA 1ZIYA 3I92A 3ISVA 3QUCA 2ZSEA 4L3WA 5A3VA 1KQ3A 4DSUA 2J33A 1B41A 3PNPA 4M8SA 2BGRA 4P84A 5EXSA 2EOAA 1DIHA 1KC3A 2G9NA 2CMDA 1YMVA 2OQIA 5D3KA 3A1VA 3H19A 3W1VA 1DBRA 3A1FA 4DWJA 4IIJF 5IC5A 8ABPA 1SBYA 3ZXUB 2FW0A 1PK9A 5B7QA 3ED5A 3H6GA 4DM4A 3PD0A 3ZZMA 1PN3A 4JX8A 1YVUA 1T2UA 1BFDA 1OX5A 3BFVA 4RE5A 3R9WA 3TUIC 3AHDA 4JWTA 2X8JB 1ZBDA 5CCBA 1X15A 1QCCA 5LMCA 1C4KA 4LJ5A 5AJUA 3T3NA 4NJEA 5DZSA 3RFTA 3HJBA 4RGQA 4WZBB 4KX5A 3D3EA 3BUSA 1QVZA 1I2BA 5LR6A 3MEQA 4YRTA 2Q0XA 4ALMA 5B3JA 5LXTA 2XNSA 3IXQA 1D4AA 4GZMA 2QZZA 2VATA 4LWPA 4OQFA 4D9IA 2UYCA 1Z2NX 5K4HA 2NX2A 2JIDA 1RAIA 5C1IA 1Z62A 3C74A 4L2IB 4X64B 1XKQA 1J00A 1MORA 3C7CB 1KSHA 4QSMA 5KSWB 1SC6A 3K9FC 3L43A 4UTPA 4R3NA 4YMTA 1NW3A 2YHSA 4NNPA 3PV0A 1H2EA 2BPOA 3D6TB 3QTLA 4JNCA 5LA6B 3SC4A 3AEQB 3WP0A 2IDJA 4M9XA 4R1LA 4REQB 5HBRA 1EFLA 4P7FA 3VR6A 4WAUA 3WKAA 5KVSA 5DTMA 1FW8A 4UBKA 5KYNA 2QN3A 4B8WA 4RTSA 4JLWA 1UXJA 2PZBA 3X1JA 4DE5A 2L2QA 3DHEA 2VRCA 1KERA 2ZDHA 1CQPA 4H1WA 5ALGA 4RTKA 3OUZA 2D4HA 3T7IA 2FQYA 1GDHA 4Y2QA 1BDHA 4ZAYA 1SH7A 4MW0A 3MHPA 4PC2A 2VZEA 5IBRA 1UXOA 5AIAA 3D8BA 4UW9A 1CVLA 3CJTA 3SJAA 3R5FA 1OREA 3KLOA 4BBPA 1P5JA 1U3GA 3R6DA 4WGFA 2BONA 2ZYWX 3IR6A 5EE3A 5FAXA 3DNMA 3IYLW 4RS4A 4YRIA 3NALA 1OH6A 2Z6UA 1G19A 4IY1A 1JTVA 1RVV1 2C7GA 3B5JA 1O5TA 1E8MA 4L16A 1SOAA 1MJGA 4CYMA 2P9JA 2YY7A 3EJ6A 2CHGA 2BFPA 1NMSA 1G7TA 2PSJA 2UVPA 3KEOA 1QG2A 4P36A 2ZSFA 1VG8A 3D43A 3ANYB 3DJYA 3L84A 1CLUA 4OHFA 1Y6ZA 3PE3A 1Y89A 2B20A 2B83A 1VE5A 5G41A 3CLSC 1ZH2A 3OEWA 2OSBA 4G1MB 4PHTA 4BN4A 1E9EA 1TJPB 5CLFA 2G1PA 1Q22A 3AT1A 3NBZC 3AUXA 4J43A 4V2UA 3KKMA 3ADPA 4LZJA 2QRNA 4JV5B 4TLBA 1PSDA 4GDFA 2ZRAA 5DYGA 2IYPA 4MPTA 2JGKA 6REQA 4KN6A 3HFJA 1YHZA 3IKLA 1I2ZA 1SUWA 3WB0A 5K0BA 4C2UA 1WV1A 1TM3E 4IXNA 1FMCA 1M8JA 3RASA 1LTKA 1EE9A 3OHMA 2R00C 5GIOE 1ISMA 1JT9A 3UUWA 4DIBA 1H0KA 2RI0A 3PK0A 4G9GA 4NMWA 5D5PA 2X1HA 2XW6A 3OM1A 2DF8A 2VCYA 4Y8VA 2CWDA 1SUBA 3T4UA 4J2OA 3VISA 3C24A 2XYGA 2BSAA 4ZT3A 1G5QA 2XB6A 3KAPA 4EJSA 4PN7A 2PCLA 3U2QA 4CMGA 1QGUA 3TLEA 3WQRA 1S1CA 2I8CA 2I54A 4RHXA 3LOQA 1SMKA 3DW3X 4S24A 2AF4C 3IAHA 4I9FA 2OEPA 2DB3A 2IX3A 3IAAA 4BMVA 1CUZA 1DC3A 2V5VA 3MLAA 4G07A 5FTWA 1QHFA 2ZVJA 3PFBA 1RI1A 1D2MA 3O2SB 3QUSA 4Q7KA 1DBQA 2LP4Y 2ZK7A 5LZ9A 4F2WA 4D9FA 5LOVF 3EXIB 5JFTA 5DXFA 1L9KA 3CMCO 1KSJA 3EXEB 1U1DA 4N65A 3C3BA 3JQQA 4PLCA 2RHLA 2AXEA 4V0NA 2AXPA 4S3MA 1C3OA 2I22A 4AW9A 3AJ9A 3F9IA 4E70A 1TYDE 2WWFA 3CSSA 4B43A 2CL5A 4MRAA 5AVWA 2G40A 3HCBA 4DGSA 4RPLA 2OBBA 3A25A 1RT9A 5I9IA 3OMXA 2IYSA 5I8ZA 4MLCA 3ZHYA 2G1KA 4IHJB 1TUEA 2XUFA 3G0DA 4ZGBA 5HQ3A 1T9ZA 2NUPA 2V9PA 5JXJA 3P19A 1KH2A 1MJ5A 3C8ZA 1VSVA 1TQDA 2XA2A 1P1KA 4G97A 2ZEJA 4B85A 4DSOA 3ECSA 2RG7A 4ILKA 1R8SA 3AR6A 2G09A 3EBLA 3Q5GA 4KQXA 4NFSA 2FPRA 3FFAA 3MWEA 4YAUA 3B2NA 2EKPA 2CMFA 2OPHA 3T99A 5HZGA 2OFFA 1W0KA 2C7BA 2X0NA 1PNVA 3MN1A 1T8UA 1QZTA 5BVHA 5AKIA 3DNFA 4C76A 5JT1A 3E58A 3K70D 2GLTA 3JTEA 1H6CA 3P2IA 3N2ZB 2XZTA 4ZEXA 3IVRA 3W3ZB 5AMXA 1YB5A 1K88A 1NIPA 1ECGA 1YJCA 3MJFA 2JLQA 2PVSA 3ZHUA 1LCIA 5BMVA 4Q15A 3C45A 1UPBA 2CNNA 1VYTA 2F8LA 2RHCA 3OEHD 3R09A 4HYQA 3W90A 3HR8A 4EW3A 1G21B 1OQAA 4HY3A 4DV6B 4QRHA 3HV2A 2NUAB 1UC5B 1CIPA 3NI2A 2BN4A 4LMBA 4TKZA 3ZHVA 2GN6A 1WRBA 4CUZA 3BRQA 1KVTA 4QQ8A 2WWXA 2PKEA 1O5IA 1UPUA 4E33A 4M0MA 3E9NA 1VG1A 3VO1A 1KEKA 4HO1X 1Q12A 2PUWA 2WIFA 3D3NA 1M34B 4BEJA 2WRZA 3L7AA 1E5XA 1QE0A 3EXHC 1IOLA 4MJ3A 4MROA 4CMHA 1UK6A 3MTQA 3VZDA 2ASEA 3IKMB 3KBBA 4KBYA 4UVGA 5JNRA 4WOPA 4P92A 1TI7A 3L0CA 2QTTA 2XA1A 2QLFA 3OQBA 4LS3A 5GPBA 3U60B 4WOBA 3C1TA 3GUVA 3LDFA 3ICEA 2FJ0A 4B6GA 1CJSA 4MYDA 4IDPA 1N77A 2WNSA 3LSTA 4L0MA 3ETJA 3RVOA 5K99A 2I91A 1PTKA 2O7RA 2K4MA 4Y1FA 3DYVA 3PXEA 3WJAA 4ARSA 1L7MA 4LJ4A 2Z95A 3VNVA 1P81A 2Y67A 3KBOA 1YE8A 1HZZC 4YECA 4DPKA 2Q29A 2IHNA 4BATA 1PQYA 3WA7A 3F8TA 2C5HA 2PD6A 4MUXA 3GZNA 2I4OA 2VJBA 1EUZA 4BWYA 4OY3A 5H16A 1LDNA 5J2UB 3T1QA 2XUOA 3JSXA 5DGCA 1I3OA 2A88A 2AD5A 2IC5A 4IXMA 4BEWA 4YONB 3H83A 4RTMA 1ZGGA 4O63O 4R05A 1KMHA 1AQIA 2LCIA 1XXLA 2C29D 2EZ4A 1VI5A 3TK1A 3A3PA 3NPMA 1RRKA 4JL6A 1XDSA 4UU7A 4X61A 1CZHA 4M8KA 3UZUA 1JDVA 1PFQA 1Q0UA 2YRXA 1UBJS 5K45A 2VH2A 2UZ4A 1NJ8A 3PJGA 1GGFA 1SA0A 2QV7A 2W6JD 4FOTA 4OEHA 3A9SA 2QY6A 4PIVA 4OGLA 2CB9A 3E5RA 3QYAA 3RBAA 2LPMA 3TZCA 1R6BX 2CN1A 3VAYA 5KJ6A 3T5PA 1P9RA 2X2FA 2ZPTX 5EIFA 4M0UA 4OJKA 1P7WA 1KMIY 1RC1A 4XOIA 3O31A 3JQ9A 5HCIA 2F1KA 3WMWA 4FYVA 2NPFA 4MO2A 2FWJA 3ZVRA 3WLJA 3E8SA 5K0LA 3CBGA 3B1ZA 1EAMA 5C53B 1G8AA 4Q3DA 4WBXC 5J3JA 2CNBA 2YIMA 4LF5B 3DM9B 2YYYA 1OI4A 2ZBVA 3HXLA 3KQPA 2E49A 4E88A 5JPCA 3K0HA 1SVIA 2IHKA 1OFTA 2ZWMA 3MCTA 4D0LB 3FDZB 4DIUA 4DSNA 3KYBA 3A4IA 1J1IA 2Z04A 1SUIA 1TLLA 4ED9A 5AW2A 3L02A 1P1HA 3AERA 4KJXA 4R01A 4O4IB 1N6NA 2HB6A 2ZR9A 4WVFA 2AR7A 2V7PA 1Z34A 2V6MA 1AD2A 1DQNA 1WNTA 2HREA 3I83A 4GOOD 1S8OA 2YUTA 1C2YA 4N6NA 5CFQA 3ZHSA 3NONA 1B0PA 4RMGA 1KI6B 3A1TA 1BYUA 2GA8A 1G8HA 4AMBA 4ZOLF 1MJGM 4RTNA 4YCDA 1U1FA 1GQYA 1NJ2A 4Q01A 1P31A 1RD4A 4ZOBA 3I6ZA 1TTQB 3BKXA 5IW8A 3MCVA 3TRJA 2R84A 5JSKA 4ZI5A 3BJMA 4UM7A 3NH6A 4YRRA 4RV4A 2FSIA 1A9SA 1IN6A 2QTHA 1KMMA 4JBHA 3TIXB 1TUIA 5BWCA 1G59A 3A2NA 3DLHA 4GUAA 3FXAA 2IYQA 2IHTA 1DKMA 3AUUA 4Q66C 1EX9A 2CL7X 2JS7A 1RZVA 5HJEA 3QXCA 4OP1A 2OORC 5AI5A 1XHLA 2R6GA 1YT5A 4J0GA 1NBME 2YICA 4JT4A 2ZB4A 4E12A 1CS4C 2HFKA 4EOGA 5IJXA 1BN6A 2Y8EA 2YZNA 4AJPA 4EVQA 2SCUA 2B0JA 1MR3F 2W7TA 4JD5A 3PQFA 3IPXA 4HKTA 1Y9AA 1EDBA 4C4TA 3SX2A 1BGWA 2ZS9A 2GF2A 3JV7A 4ODIA 5ALHA 1O54A 3E4DA 1T5IA 2PEYA 2X23A 4YUAA 5KEIA 4D3DA 3ROQA 4IIGA 2XQFA 3QVGA 4FC6A 4MVYA 2KB0A 4YRBA 3TG8A 4Z0NA 3JWIA 4HNAA 3AVYA 2IKSA 4I36A 1KOGA 4K86A 5E1OA 1E77A 5HWSA 1XXHE 2ZGVA 3LBFA 5DHPA 1XVAA 5AVXA 3CR7A 1EINA 4PX5A 5EPOA 4UOEA 4D4GA 1T36B 4YAOA 1TIKA 3VNBA 3RCBA 4UE6A 3NBYC 1KDZA 4QXQA 2A9KA 1IONA 1P73A 4F5ZA 2OCXA 1P80A 5EERA 4BMSA 1T4CA 4NABA 4DR2B 2CEKA 4NH4A 3KB2A 5T6BA 2APJA 7ABPA 3ADOA 4WNAB 1V26A 2G6BA 1YR3A 4KQWA 4GDMA 2DWCA 1JDTA 1PK8A 2FA9A 2VDNB 4RJTA 3CH5A 3UK1A 4B80A 1SFRA 2X5KO 1KDOA 4JUIA 3H9GA 3IDAA 4DMFA 2C2YA 1FYVA 2XGMA 1OV6A 4P1ZA 2LNDA 2XT6A 5FR1A 4BUZA 3AFMA 5DYTA 4B3TB 4NR0A 5IVIA 3RTBA 4QASA 3Q10A 2C04A 3G0HA 5DISB 3TEFA 1RPJA 1ZA1A 2R44A 3LE8A 4BB6A 1G66A 2WUFA 3V8VA 1JKXA 2OZLB 5CW2A 4FCWA 4HEA1 4BU0A 2NU8B 4DUYB 4CG0A 3GROA 1BS9A 1B73A 1WHTB 2X4DA 2ZYUX 2MYUA 3EVZA 3DUFB 1HNWB 4RXUA 3LPAA 1MO6A 4Y2RA 3TSOA 1XR3A 3RC9A 3DZDA 3L8DA 1T8SA 4QTYA 1XNHA 2PQMA 5K8CA 3DAOA 4FE3A 3ROFA 2YC4C 5IXSA 4DUZB 4KO8A 3H13A 2BSQA 1UAGA 3U3MA 3QEMB 4WT7A 2DEUA 1M2EA 4G3XA 4WXYB 5DTQA 1WAMA 2EP5A 1BA2A 2H65A 3WX0A 3T3IA 5JARA 4G24A 2E4AA 1EPUA 2ZB2A 1OA0A 2JCXA 2ZB7A 5AJVB 4YP7A 3WFIA 3WWZA 3HCAA 3K5PA 4C29A 1Y9EA 3FPJA 1YVRA 2W98A 5CCEA 3X2FA 3VOTA 1JHQA 2C4HA 4R9NA 4Q7JB 3D2AA 1AKVA 1L7EA 5ENDA 3OX3A 1B42A 5JCOA 4E4TA 1PWYE 1M10A 4F1KA 3KWFA 4D3SA 3CKKA 2FWPA 4ZZ1A 1L5OA 1ZD9A 2F17A 3UH1A 2IODA 4FSHA 4U6SA 2GJSA 1PZEA 3EVDA 5BUZA 1IK6A 1HTWA 2JH9A 3ESBA 4UFNA 1RMTA 4EHFA 4XX0A 1Z88A 3QQ5A 1V3VA 3WC4A 2QX7A 1PQUA 4LOLA 2NQ2C 4PBTA 2M6RA 3DFZA 4DWOA 3COSA 2AFVA 2QK4A 2EF1A 4QBFA 1AUXA 4X9XA 5JAPA 4UBMA 5AVRA 4IXDA 3UJ7A 4ICIA 3RF7A 2B21A 1J0BA 1ISRA 4IIUA 5JYDA 1C7IA 1ZG3A 4KE6A 2PT5A 2ZRKA 5JWRA 2IBTA 3IVAA 5CFLA 4PYQA 3G0IA 2Z5VA 3DFMA 4TTTS 4FQ5A 4IJVA 5AKZA 5FBRB 3RSLA 1U1IA 3HYRA 3OOJA 2IYWA 2XDQA 3KKKA 4PXYA 3UHAA 4PPGA 1P3JA 1YKGA 1CRZA 2NO0A 4CKWA 4OBWA 1Y8RB 2GFIA 1G2IA 3DBRB 2Y92A 3G88A 3SZLA 1QORA 2EJTA 4ALJA 5B58C 4RXMA 2YJ4A 1DUVG 1GDDA 3UC5A 1S2LA 3STTA 5K5EA 2G4VA 2DTDA 3NU1A 4Q19A 1YR2A 3MT8A 4XYLA 5J63A 2PLWA 2JA2A 3WGGA 4TZKA 1CNMA 3DCNA 3EVGA 4R1OA 5B1IA 5U9CA 3ZVKA 2Y9PB 5FNVA 3AOGA 1Y7TA 1ZM2A 1UC4B 1Z4QA 1QH1A 4QDOA 1SVSA 1XRPA 4OGFA 5KSPA 1L5QA 3BCHA 4KQ6A 1E4OA 2ZSIA 4ASUA 2GWHA 4X7MA 2RG1A 3BBLA 4PRZA 1DXHA 3JD1A 5H9WA 1C9JA 1VL6A 3NBFA 2WG1A 2Q4OA 3NX4A 1G1AA 2R60A 3CX6A 1QVWA 2IOFA 3MUEA 4D6YA 3KXIA 1REQA 5C18A 2ZBDA 2QL6A 1HKHA 1KBOA 1M6HA 1MBZA 4G0MA 4C05A 3VKGA 3OZEA 1RKVA 2SKCA 2FP4A 4JI6B 2B1QA 1ULHA 1ZCJA 2JFXA 2QTZA 2X86A 4KK4A 3FDJA 2GFQA 4C2BA 4W1PA 3RF6A 2M32A 2M1ZA 1TEVA 3BMNB 4GW3A 4J0EA 5BNIA 1YFLA 4HFJA 3QEOA 4TWIA 3RM3A 4OGWA 4OO3A 3P27A 4H15A 3ISJA 3ITKA 1EZ4A 1QX3A 5D1HA 5AVQA 2BCEA 2IXDA 3P0EA 4ZCPA 3R7DA 4ILEA 1VE1A 4JFAA 4C87A 2GYUA 3OQIA 3THYB 1KYZA 1LH0A 3G2LA 1C3LA 3WHIA 3AVQA 5JSZB 4F4UA 1KO8A 4H1UA 1XWIA 4L8WB 3WB2A 3JRWA 4TZTA 5GOTA 1YH3A 1I3KA 1H4VB 2C3UA 2ZM5A 4NONA 5FOVA 3SEZA