5DISB

Crystal structure of a crm1-rangtp-spn1 export complex bound to a 113 amino acid fg-repeat containing fragment of nup214
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
172
structure length
172
Chain Sequence
QVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIKFNVWDTAGLEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of CRM1-Nup214 Interactions Reveals Multiple FG-Binding Sites Involved in Nuclear Export.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Exportin-1
total genus 50
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5disB00
5JJIA 3DEFA 3FKQA 3DMNA 2PMDA 2QRZA 3QF4B 3T61A 1Q12A 1NVVR 5HZHA 1CLUA 1KKLA 2PLRA 2GWHA 5FBLB 3UMFA 3EPHA 1EK0A 3AVXA 2F6RA 2QMHA 1GSIA 3MFYA 2VP5A 4ESVA 2I1QA 4NBSA 2IUTA 3AGQA 2A3RA 1M34E 1G8PA 1Z47A 2ZJOA 3CWZA 4V0OA 1D9ZA 5JEDA 2O5VA 1IN5A 4R9UC 5DHAA 4XTRA 3NC1C 3W8RA 1MO5A 2YWFA 1CXZA 3EWSA 3BB3A 2J45A 4G5OA 4JYBA 3TE6A 1U8ZA 4G5QA 1YZUA 4EDHA 4TYNA 1G18A 5JRZA 1W4CA 1H65A 1OIXA 5GJVC 1KK1A 5FL7D 2F1RA 4OJKA 1EFTA 3KQLA 1JJVA 1KI6B 1QBKC 1VG8A 2ONKA 2FPMA 5KHOC 2JEOA 3TUJC 2FPLA 1TPZA 5JRJA 3R9WA 1S0UA 2Q9AA 4DEYA 4LHVA 5LD2C 1QHGA 5H70A 4YMVA 1IAQA 1E2IA 3BB1A 3WY9A 4BLRA 5CLLA 1KKMA 1LW7A 3LVQE 1IJEA 5ANRB 3WXMA 1UKYA 3RC8A 1NKSA 2XNSA 3V00A 2IHBA 2O8EB 4NPHA 3K0CC 4HAWA 1W36D 1OXVA 2O8CA 3CPHA 3BGWA 3CO5A 1IXSB 2XSZA 4HAVA 1FUUA 3EC2A 4NCJA 2VSFA 3W5IA 2VO1A 3QVVA 4URVR 2CJWB 3ZZ0A 1OH7A 3NEYA 4Q4HB 4QXAA 1R2QA 1VCOA 1R6BX 1KO8A 1X1RA 1JEEA 2B8TA 3J81k 1GKYA 2XGJA 3CW2A 3OAAD 1HEIA 3F0TA 3PEWA 1XWIA 2O0KA 5EXSA 4O2LA 4US1R 4MYCA 3LD9A 2GXUA 1CKEA 4JBWA 1E2KA 4LBVA 2GZDA 1T3LA 5A0FA 3EPJA 4B6EA 2B6HA 4EPRA 4HLDA 4TSFD 2NG1A 3NDBB 2IUUA 3LQRA 3BH7A 3A1VA 3T5DA 1D9XA 1P4SA 3CPEA 3UIEA 1XD2B 1SXJE 3C7KA 2HLDD 4TWZA 5JMTA 4TZ0A 2R9VA 3IKJA 3LY5A 4BPBA 3TKLA 1PZNA 2ZJ5A 4AYTA 3ZZTA 3X1XA 1UAAA 1T4GA 1XF9A 3K70C 3L82B 5AWFC 4BRWA 1IXRC 2DCUA 4KVAA 1II8A 2F9LA 3MGCA 3VMFA 1Z6AA 4V0MA 1MV5A 4Z8YA 2WWXA 1XRJA 1VHTA 1CF4A 5E95A 4P0TA 3U3MA 1DAIA 1VCMA 4FI3C 4C7OA 2HF9A 1LVGA 4QNMA 4C0KA 2V6IA 2BWJA 3AF1A 3B13B 2OEPA 4BEBA 2ZYUX 2IHYA 3VX3A 4KFTA 1NIJA 4QKQA 3OIVA 3TBKA 3C16C 4DC9A 2RKOA 4HI0E 4LJ6A 4ASUA 1FMJA 3THYA 3V9PA 1AS0A 1XP8A 4CF7A 1R5BA 1G41A 4E09A 3A6PC 1LY1A 1O87A 1R8SA 1ZUIA 3PCRB 5BW8A 1SKYB 5FL7A 2CCKA 1PVOA 2ZU6A 4LBYA 3C15C 3HU3A 3SDZA 3CRW1 1OXUA 4DSOA 1QVRA 2F1IA 3P4YA 4BE7B 3NBYC 2IC5A 1TF7A 3KJIA 3Q5EA 4A4DA 2IEYA 4HB4A 4D82A 3BE4A 3DHWC 2PEYA 1JEDA 2BM1A 1HT2E 5FI1B 4C0SA 1ANKA 4QHSA 2ASEA 5HKKD 2XNDA 1OXXK 1XB2A 4NCHA 2DYKA 3KXLA 4JBYA 2V1XA 4ZKEA 4ZI2A 1B23P 2ZRPA 2GBLA 3AP2A 2ZU0C 1NSTA 3PEVA 1KI2A 3TK1A 3ZS9A 5KPDA 4A0HA 3RRYA 5KDOA 2O8BB 3O8DA 4PO9A 3UWKA 2C96A 2GETA 3N2EA 2EFDB 1R0YA 2DFLA 2EFGA 4K46A 2QZ4A 3P27A 3T1QA 4A82A 3AF2A 2D7DA 1XBTA 2P6UA 1TU3A 1E1QD 3QKSB 5CYPA 2ZUCA 2AL7A 3B1XA 4YQFA 2HV8A 1RRFA 2C95A 4KXFB 4PO8A 1CTQA 4V0KA 3DOEA 2ZANA 3A58B 4TMZA 3KJGA 1JBKA 1E9DA 1E96A 4Q21A 2JLZA 3JVVA 1QHHA 2R6AA 4PZZA 5EZ5A 2CK3A 1GNRA 1W36B 1A2KC 3P32A 3ADCA 3LBNA 3QF7A 1SVMA 4YC7A 3MSXA 3UPUA 3I1FA 2REBA 1OFIA 5HCIA 4CEJA 1ZUHA 1Z28A 2GHIA 1YR7A 2D2EA 1XZQA 4OBEA 5L3SA 4I1OA 3R7WA 3K9NA 1MR3F 4B44A 3AVWA 1N6RA 1SULA 2ECKA 4DSUA 3EPLA 2X2EA 2WJYA 4U7DA 3B60A 1WCV1 2CDNA 4Q03A 5FOTA 1U98A 1OHHA 1TQDA 4MYUA 2ZRFA 3KQKA 3K0AA 1NN3A 3GLHE 4PAOA 4DT1A 2BCGY 4JLNA 2CNWD 3GLGA 4M1OA 2NO9A 3QKRB 5B2ZA 4IRUB 2JJ1D 1U81A 3OEHA 5K8TA 5FOXA 2Z4SA 1XXHE 4JLJA 5TV2A 3BS4A 4JS0A 4IDHA 4KAXA 3AQ4A 2RGAA 4C0AC 2AKAB 1KAOA 2D4HA 4MRNA 5TVKA 5KU1A 2Q3MA 1E1RD 3IHWA 4FWTA 1M7HA 2MSDB 2EYQA 4EKDA 2QE7A 3OIUA 3SR0A 2QGZA 2OAP1 1EFRD 2RGDA 3PENA 4FCWA 1HE8B 4A8JB 4XJXA 2VHUA 4XVQA 1YZKA 2FFBA 2JJ2D 3QKSA 4HB3A 4A92A 2FA9A 1YR9A 3KQHA 1KHTA 3HJNA 4FMDB 2EFHB 4JKYA 3U7GA 3K9LA 3B1YA 2OCBA 3H2YA 3AEZA 4NL4H 2QT0A 2ZRMA 1KDOA 4UJ5A 4ITRC 3OIYA 3GJ5A 5F2EA 3WRYC 3KFVA 1BIFA 2WICA 1A1VA 4AC9A 4GI7A 4DUGD 1X3SA 2E87A 4G5GA 4ILEA 5FH9A 1AQUA 2R6GA 4HATA 1SHKA 1TQ4A 2QM8A 2Q6TA 2P3SA 1Z29A 5SZIA 3VR6A 3VR4A 4BRUA 3SC3A 1G21E 1U0HC 2IYQA 3EASA 1AZTA 4DLSA 4DJTA 5A5GA 2JLRA 4EQ6B 2YC2C 2V6JA 5DYIA 1NMZA 4B3FX 1P2VA 1X8KA 1NMXA 2QSYA 1G3QA 1EWRA 2Q0HA 4I99A 4M0LA 5FUWA 4F92B 4B6FA 2RGEA 3GEHA 2FGJA 4A0FA 4DCTA 2EFCB 2A2ZA 4AURA 2RGNA 3QKUA 1FUKA 2ZI3A 1EFCA 4QJ5A 3G0HA 4TL9A 2TMKA 4Q7LA 3FMFA 4MUAA 3BH6A 2I1VB 2VA8A 2QL6A 3FKSD 4X8LA 3SHWA 1MT0A 4A36A 2QGNA 4PC2A 3T34A 2BKUA 1XU4A 4RD1A 3TAHA 4DDVA 4LC0A 1WBDA 1NIPA 2CJWA 1ZVQA 3SBDA 5JI3E 721PA 2CLDX 1C4OA 3CF6R 5JSZA 3K53A 2WJGA 3OE7D 3CNOA 3WRXC 3QY0A 3UANA 1GFIA 1S4QA 3AVTA 1WRBA 4HLUA 4CVNA 4M2LA 3B9QA 3LLUA 4I81A 2IF2A 4JLAA 5AJYA 5LBIA 1W49A 1LS1A 3IBYA 3LXRA 4NYIR 3BXZA 5DIFA 1OIWA 5EQTA 5EXPA 1U0LA 3ZVNA 1Z07A 1ZU4A 5CK5A 5KO2A 4OI2A 2JASA 4L15A 4M9ZA 3CB4A 3R9XA 1A4RA 4NMMA 4HB0A 4LJYA 2R44A 2Q9CA 1GIAA 3EXAA 1O3YA 2NO0A 3PG5A 4KFRA 1D2EA 4B2PA 4XD7A 4GZMA 4WZ6A 2ZXUA 2O8DB 1NL3A 2IXGA 4JLOA 4Q4HA 1UEJA 4MRRA 1GTVA 4TL7A 4DCUA 4W9MC 4DVGA 1G7TA 2WAXA 4EIWA 4ZDJA 1GOTA 3B8HA 3AP1A 4UNQA 5G40A 1XPRA 3CONA 4W5HA 3PUZA 2IT1A 4PPQA 2W0SA 4DUGA 1D5CA 4EPVA 1HTWA 1RIFA 2HXYA 4Z8XA 2CLCX 2O0JA 3AVPA 4DB2A 3D6TB 1F2TB 1Q22A 3NWJA 4DLVA 3MMPA 2BBWA 2GZHA 3KDSE 2ODNA 1QF9A 2GEDA 4O0MA 3I72A 2WWWA 2DB3A 2W6JA 1Q57A 2W2TA 2BEKA 4KU4A 4PSKA 4F7WA 4RD0A 1Z5ZA 5LD2B 3TNFA 4GP7A 4NU0A 4M1MA 3U44A 1GITA 2IYXA 1J2JA 2EWWA 2QAGB 4D4LA 2C78A 4X8OA 1TUIA 2J0VA 4LV5B 5E4FA 2ORVA 5L3SB 2AK3A 2QY9A 3MD0A 4W5JA 1EFHA 3MWJA 4A8JA 3KQNA 3KUCA 4GL2A 1CRQA 1S8FA 1Q1ZA 2A5DA 2RCNA 2Z6VA 2ZR7A 1M7BA 3H1TA 3T1VA 5FUXA 2F55A 3QQ5A 2VHCA 4P4SA 4MYTA 1B0UA 4GMDA 3TRFA 1NY6A 2NZJA 4HZUA 4R2HA 2ZAMA 4QBHA 4JVMA 1DAEA 1WA5A 2YINC 3OEHD 3GEEA 1E2JA 4M53A 4Q9LA 5DYGA 2ZJ8A 5J40A 2ZSBA 3SBEA 1Q0UA 4G3XA 3CX7A 1II0A 1DAHA 2BMFA 2CL0X 4EJSC 4OHXA 4TLAA 5IHPA 4M8NE 4PX9A 4TN1A 1FQJA 2FV8A 4B3CA 4IW3B 3U4QA 5BYJA 2ZRAA 3K0SA 1W48A 2B21A 3PR1A 1HH4A 4NCNA 4GRAA 3FVQA 5FTJA 4V0LA 1Z0KA 2ZS8A 4Q5IA 4DSNA 2WWIA 3O8CA 4EFLA 3TSOA 2F1JA 1N6HA 4LCBA 1IQPA 5DNYB 1GNQA 3EX7C 1IY2A 2PEZA 5FBQB 2VP4A 4OHYA 3AF4A 3QJYA 2IF0A 2QU8A 1FOEB 3S1AB 1G8YA 1N0VC 1WBBA 4LBWA 5H68A 1DBSA 3ONWA 2ZPTX 3A8TA 2OT3B 4L8GA 1L4YA 3AF0A 3HU1A 1NN0A 4E07A 3G5UA 4LOAA 3RS2A 3WYGA 1DAGA 1YE8A 1OFTA 4CRWB 1D8TA 2VPPA 4OI4A 4NHOA 2YKGA 2ZYWX 4MDEA 3KB1A 4BFTA 1GVNB 1F2UB 2VHJA 1Q44A 1R8QA 2EFEB 4B74A 1E1QA 3TQFA 1ZAKA 5CYOA 3AKCA 4PQRA 1P2SA 4PAMA 4AY2A 1DO2A 4PANA 2G6BA 4AG5A 4G5RA 1TAGA 4BUJA 3W5JA 5BN5A 5JZVA 1WP9A 1UADA 2VP0A 1CJKC 1ZP6A 4C3ZA 3QXXA 4TQAA 4QM6A 4JLPA 4BLOA 4YONB 4OI0A 3IUYA 1GRNA 3QXJA 4AKGA 2QAJA 5JJLA 1OFUX 1R5NA 3TR5A 1FFHA 2BDTA 2A78A 4KLZA 5GVRA 1XTIA 2BJWA 3RRNA 2G1KA 5TB5A 3T1TA 3AVYA 1AKEA 1GZSA 1KMHA 2MSEB 1CJMA 4URUR 5E7IA 5FPSA 1HV8A 3QKTA 3IILA 4A0GA 2QBYB 3GLIB 1EESA 4QJ3A 2V3CC 1XPUA 3QE0A 5EJEA 2WIBA 3I62A 1JR6A 1XXHB 3SFVA 2QAGC 1F60A 2J7KA 4D0GA 2GKSA 1HYQA 3FYHA 1G17A 4RD6A 3GLGB 1GKUB 3FHTA 2FF7A 3HPRA 3NTUA 3ADDA 1I4LD 1X6VA 1C1YA 1XEXA 1E2PA 1U8AA 4QOSA 3SHFA 5TXGA 1CRPA 3OEEA 1OV4A 3OF5A 4C2UA 3H84A 1U9IA 821PA 1FP7A 4IOMA 4DCSA 1NJFA 4NP6A 3CNNA 2B92A 4OQXA 2ZJAA 3C4JA 2JLQA 3BH0A 4CEHA 3HPQA 2RMKA 3QSYA 4JSYA 2IYWA 5J4LA 3X1DA 1E0AA 2KSQA 1GRRA 1KO7A 2H18A 1CULC 4O25A 3I3SR 3U6KA 1G3IA 4MDFA 1M2OB 4YXWA 1K6MA 3R9IA 3R8FA 2PZEA 3WMEA 1HA3A 3O8BA 1CS4C 4PFSA 1GWNA 4QL3A 2IXFA 3HWSA 1SKYE 4R98A 4IOJA 1Y63A 3QEOA 3N2IA 4BFVA 5JWHA 3FKSA 3QOFA 3HYRA 1CR4A 2YHSA 3FPAA 4DXAA 3TGPA 4KV9A 2PT5A 3CRRA 2BCJQ 2X19A 1DG1G 2DWOA 1S3SA 2V4ZA 2WKPA 1N6LA 2P0EA 3BB4A 4NYJR 3VX4A 1KYIA 2C98A 3U44B 3FOZA 2P6NA 4A9AA 1G9XA 2BVNA 1GNPA 2D62A 3H0KA 3ZIAA 1P2TA 1OPXA 1R4AA 4LJ9A 5K8LA 1NY5A 3P20A 4TYWA 1F3OA 2WPDA 2ZRJA 2J0SA 1NI3A 1T91A 2ZETA 3LX5A 1AJEA 1J90A 3QPWA 4RJLA 3KKQA 3OAAA 2FSFA 1VPLA 1GUAA 1XTRA 3CNLA 3RRMA 1J8MF 3QPVA 1FMLA 2VYFA 3UG7A 3ZDQA 1ZM7A 4GOXA 1XEFA 2PJZA 5KSZA 1EWQA 5JWRA 3Q72A 3LLMA 4N1AA 5KPJA 2BEJA 4E5UA 4WAUA 3GEIA 1G6HA 3PEYA 4DCVA 1TADA 1UBFA 1NVVQ 5L3VA 1Q1EA 1G5RA 3KQUA 1GRQA 4Q7MB 1FX0B 2QA5A 3KTAA 2ZR9A 2WM9B 5G3YA 3LVRE 4B2LA 4CT5A 1UKVY 2YWHA 5B58C 2PJRA 2HUPA 1BYIA 1S3GA 1DAFA 3M0EA 4JLKA 5TMPA 1A7JA 1AS3A 1E9FA 3L0PA 3VR1A 1NKTA 5AR1A 4B32A 4TLEA 4HSEA 4DLXA 5CB8A 2OFXA 2FDCA 4EQ6A 3NIBA 3JZAA 4XOIA 1KSGA 1CR0A 1FTSA 3BRWD 4XWAA 2WAYA 4DLYA 4EAQA 1FZQA 4F4CA 1R5OA 1S1CA 1IN7A 2OFWA 2VF8A 3K70B 3R8CA 3TW8B 5C4MA 1ESMA 2BIFA 1BMFA 3RABA 2ZE5A 4I1UA 4IOKA 2R6FA 3ECCA 3NBZC 2OCPA 3T35A 2WBLC 1Z6YA 3A1WA 2QORA 1UF9A 1FPMA 2VHTA 4E22A 4MGIR 3ASZA 1XTSA 3AKYA 3ZZUA 2QT1A 2XOKD 4B33A 4KYUA 3U2QA 2VQSA 2W0MA 2IYSA 2HJGA 5FOVA 1U99A 1G8HA 4MRVA 2JLYA 2O8FA 5D3MB 3P1JA 3Q7QA 4FIDA 5EP1A 4QJ4A 4DHEA 1ZM9A 2JIZA 2LCFA 1Z0JA 4N0EA 4TL8A 2BHRA 3CR8A 2HDNB 4JVSB 1JPNA 4R2IA 5K8UA 2H17A 4LZZA 1XNJA 3CPJB 4JJKA 4PR0A 2K5UA 5FPKA 2B8WA 4HDOB 5JCPA 2Q3FA 2C04A 1S1MA 2C9OA 1N5LA 2E1RA 2ZROA 3QXHA 2Q21A 2XJ9A 3W34A 1G3RA 4JLMA 5CJPA 5BQ5A 1JALA 2RH5A 3I8SA 3TSWA 2CL7X 2ZI6A 3WYAA 2UKDA 3SU8A 2V7QD 3NHAA 1R0WA 4PPFA 2IA5A 1N2CE 4O3MA 3T12A 4O2RA 2OBMA 3GCGA 1E9AA 2FN4A 3RWMB 2QP3A 4B43A 2GCOB 1XJCA 3DZDA 5DLQC 2I4IA 4P32A 5HKKA 1VTKA 3CR7A 4KCGA 4ZDIA 3THXB 4PHTA 2Z83A 5FUYA 3AVVA 1L4UA 2P2LA 5EE5B 2WSSA 4I4LA 4CZ2A 1QDEA 1F2TA 1CIPA 2AR7A 3MJRA 2YNMA 2ZI4A 5IK2D 1XXHA 5JCZA 4G01B 1M8PA 3ICQB 1OSNA 3DO6A 4AKEA 1DADA 5EP2A 621PA 2UVQA 2I3BA 2Z5FA 1IHUA 1AK2A 1LF0A 4TLCA 3JVUA 1Q1QA 4P4UA 1SZPA 2C2HA 1TX4B 3AB3A 2J87A 3QXSA 4OYHA 4Q1BA 3L2OB 2ONJA 1KO5A 1ZM3A 3QPUA 4HAYA 4CEJB 1WQ1R 3TMKA 5HTKA 1NBME 3M1IA 1NG9A 4RFVA 3DDCA 2EVWX 1TF2A 1XTKA 4BGDA 1EGAA 1YVDA 1ZINA 3BWDD 2FFHA 5AJVB 5L3QB 1K5DA 1IN8A 4HUTA 2FWRA 2EWVA 1FNNA 4A2PA 1E79D 1GILA 1Z83A 4OQNA 4R71A 5FFMA 3BBPA 5LDDC 3PQCA 3IQXA 5B57C 1GP2A 2CVHA 4L4UA 3NC0C 2AFHE 3BIFA 4GPTA 4RCYA 5IT5A 5F98A 2OLKA 2YVUA 5E3HA 1AZSC 4FINA 3PVSA 2QP4A 2REXB 4US2R 2GAOA 4D81A 4MKFA 1T6NA 2XXAA 2C77A 4WIAA 1YZNA 3REFA 2IS2A 2F3RA 2MMGA 1XDBA 2W6ID 2B7CA 3EIHA 4AKHA 1NVWQ 4AD8A 2FEMA 4QBGB 3SEAA 5CIWA 4KFUA 1WXQA 2OBNA 1TQ6A 1UBCA 3IHLA 3KJHA 2PT7A 4Q9HA 1KJWA 5FPTA 4TYYA 1PUIA 2ZRKA 3FMOB 4C30A 4X8HA 2AXNA 5FOSA 3U6BA 2G83A 3R20A 4JSTA 4FMDF 3O8RA 1N0UA 3IIMA 2C5LA 1U2RA 1VG1A 2WJJA 4B3XA 5AK0A 3LWNA 2VIIA 5DH9A 4B3DA 1T8UA 2NO7A 1WDTA 4IXMA 4GP6A 4GSYA 1DELA 1G5TA 2X77A 2Z0MA 2FJUA 3WP0A 4D4JA 2N1BA 2HLDA 3DM9B 4I1VA 1OH5A 2G77B 2B7BA 4FD2A 2GZAA 4XIGS 1AM4D 1KIMA 4Z1MA 1BKDR 4B35A 5KSYA 5FL3A 2ZSAA 2CE7A 2IS6A 1LNZA 3MUFA 3ZVRA 2D74A 2HEIA 4BLSA 4M1YA 1XEXB 3LW8A 1OYWA 3FFAA 3TAUA 2BM0A 5KSOA 3KXKA 4IJMA 3A37A 2IS4A 3C8UA 4PPGA 3K09A 4URXR 2DPXA 3U61B 2QAGA 2GVZC 1W0KD 4ZV4A 1MRNA 2A7QA 1ELOA 2QE7D 1JR3A 1P62B 3LBIA 2QPOA 2EYUA 5GVSA 4B76A 2QBYA 5FBRB 2DWPA 4TLDA 4KI0A 4UQOA 4LYFA 1KSFX 2ODEA 4UXJA 1Z0AA 1KMHB 3EC1A 2FSHA 3IIKA 5JSZB 2YZ2A 1NSFA 2QQEA 5EZ6B 2ZJZA 2J0UA 1P72A 1P9NA 3G82C 1FP6A 4M4SA 2WWYA 3LX8A 2GJ9A 4KODA 3DMDA 1W44A 1T3SA 3BORA 5KNCA 2GXAA 1UFQA 2FE4A 1YKSA 2DFNA 2RB4A 1SXJA 4S35A 2IEZA 2J7PD 1KDPA 1XJ0A 1GAJA 1OB2A 3UXMA 3REGA 4NZYA 3FDIA 1E2QA 4G0NA 2J0QA 4MQBA 1V5WA 2EQBA 1VYUA 1KY3A 1H8ED 1MO3A 4HAXA 4MITA 2IYRA 4AKIA 4XWKA 2BBSA 2EW1A 1TEVA 1TU4A 5BN4A 1ZBDA 4C9BA 3KFXA 2R6DA 4P33A 4PQFA 2AXPA 1M74A 3FMPB 1T3HA 3KJEA 2XJ4A 1VYTA 1DEKA 4MKGA 3BK7A 1W0JA 2DY1A 3SFZA 2AN9A 4H1UA 2ZS9A 4UJ3A 2O8CB 1YU9A 1WE2A 3B6EA 1KTVA 1X8LA 2ZRDA 5JLJA 4PPNA 3TW4A 3FGNA 1PLKA 2OSBA 2VP9A 2HYIC 3OESA 1N6IA 5AUNB 1AGPA 2XTMA 4LJ7A 3WP1B 2IWRA 5L3QA 2GEVA 2OESA 2ZE8A 3TQCA 3EZ7A 4Q19A 3MCAA 4LYAA 2F43A 5FBWB 3SE0A 4EFNA 3CRMA 1ZNZA 4BFUA 5J4VA 2ATVA 1GL6A 2FPKA 3RS7A 4Q47A 4KBGA 2PH1A 1TNDA 5FR2A 1MOZA 2GJAA 2XZPA 2GCNA 4EJSB 4S2EA 2H1LA 1SXJB 2A5FA 1W2HA 3QG5A 4A2WA 3RS3A 3ADBA 4AI6A 2WSMA 2OUKA 3W6PA 1PLLA 1COWA 5F9FA 5TARA 2WHXA 3RANA 1G5PA 1NLZA 1YRAA 3LFUA 1OH8A 4PSAA 2LWIA 3NKVA 2JATA 2JIZD 4P4SB 4W5WA 3GPLA 3B1VA 3I4LA 2JLWA 1G4AE 4RZ2A 1OB5A 3K1JA 5H8WA 4IDOA 3E1SA 3DZ8A 5D3MA 1RYHA 2ZI7A 4KJZA 4DIDA 3VR3A 1OFHA 2GF9A 2N46A 3ZD6A 1Z0IA 1XZPA 2ZE7A 3L0IB 1YZGA 3HR7A 3FE2A 4Q4AB 2BBOA 3LV8A 2PLFA 5CLQA 4PSVA 4DLZA 2V9PA 4PC6A 2YWGA 1D2NA 3HP1A 4XD7D 3A4MA 4JLBA 1RZ3A 1UEIA 1KY2A 2QTHA 1CJTC 1ZD8A 2W6JD 1VKJA 4MKIA 1Z0FA 3GJ3A 2WWFA 1WF3A 2RGGA 2J7PA 1ZNXA 2IK8A 5UKDA 3A4LA 3GFTA 4ARZB 3SQWA 3CLVA 1OH6A 2HCBA 1ETUA 4FMCF 2WMOB 3RVBA 2LKDA 2NPIA 4GFDA 1ZNYA 4NCIA 2UZ3A 4FMBB 1E0SA 2NZ8A 3L8ZA 2PCLA 2AX4A 4B73A 3EIEA 4UNNA 1EX7A 3QF4A 1V43A 4RZXA 4CW7A 3RLFA 1ZUNB 1DG3A 4F38A 1VHLA 3PUWA 4XSHA 1UDXA 4KHZA 1YZLA 4LBZA 3SJZA 2XAUA 2O8EA 3LA6A 4BASA 4TMKA 5J5CA 2OXRA 4PAQA 4C0JA 4LGMA 3NDPA 3ZH9B 1Z2AA 1ZMXA 1RJ9B 2H7VA 4HAZA 2V8OA 1N6OA 3K0FA 3GLFA 2ZRNA 1AS2A 2ANBA 2FEOA 4GNKA 2PZGA 2WPDD 3AV0B 1HUQA 1RFLA 3CKLA 2PCJA 4OKSA 3U3JA 3TJZA 4UNRA 3ZIAD 1T5IA 5F9HA 1WMSA 1S9DA 2ZR0A 4UNPA 3CRVA 4NONA 1XJQA 2QPTA 4QFMA 1ZIOA 3FFBA 5KYKA 1MO4A 1G4UR 2CHGA 5KUTA 2FOLA 4Z1MD 2Z4RA 5CDFA 5JHHB 2RGCA 3L0SA 5IDVA 1CJUC 3QENA 4IVRA 3A36A 1BOFA 5H1YA 4BZXA 4JBXA 1H8HD 3SQXA 1XMJA 3FWYA 1CBUA 4U5XA 2ZUDA 4LSGA 4BWYA 1K8RA 1J8YF 2RAPA 4XTCS 5SZJA 2GJ8A 1QHIA 1UJ2A 5J4HA 2QUZA 4MGYR 1E4VA 1RKBA 1KOFA 1XX6A 2FSGA 4BEJA 3L43A 2WJIA 2FG5A 4QGAA 3TVDA 2F3TA 4QG7A 1Z8FA 1II9A 4B47A 2ZSEA 3K0CA 2KB0A 1E0JA 2IYTA 3PJRA 4LDJA 1DOAA 1UDWA 2W6IA 4DEXA 3GJ4A 1YJ5A 4ON9A 4TQ9A 5FI0B 3H4MA 5AUPB 1AKYA 3K09C 4MRPA 2GA8A 2NIPA 1FTNA 4D0LB 4KO8A 1G6OA 4OQLA 2ZTSA 2ZQ5A 2KBEA 1SVKA 4C0HA 3NEJA 4G5SA 1C9KA 2ZEJA 4JT2A 2OHFA 3GP8A 4KLNA 1ZC3A 4OQMA 4YLGA 1RRGA 3AVUA 5DE3A 3KXIA 5G53C 4II7A 2WSSD 2F7SA 1GKIA 2GESA 3I92A 4OHWA 4A15A 1ZNWA 2XSZD 4J0QA 3ZGXA 1EXMA 1SQ5A 5FTNA 4LK2A 2DWQA 4TTRA 4DLWA 2XTZA 2IYZA 2IUSA 5FTKA 2NQ2C 1NRJB 1PUJA 2JDID 2OZEA 5EP3A 4D25A 4A0RA 4ZCLA 2AK2A 3SI7A 3GJ8A 4ZPXA 2VEDA 1EG7A 6Q21A 3NH6A 2JJ2A 4IDNA 3W6OA 3U3OA 4PC3A 4CYMA 4Z54A 1LTQA 4JZKA 5DO9A 4K81B 4RVCA 4KSBA 4D2IA 4URWR 4WZBE 2ZAOA 5D3QA 4ESHA 1LF5A 5IF9A 1KI7A 4LV6A 5EE3A 2WTUA 4LWZA 2FNAA 1OLOA 3V4RA 5IK2A 2VTKA 2Q9BA 3QBVA 1TMKA 3D7MA 3X1YA 5GJCA 2OO7A 3VTKA 3X1WA 2A9KA 4QHYA 3RHFA 3SJCA 3OZXA 3CZPA 4QRHA 2FX3A 2CCGA 3MWKA 3U3RA 1WB9A 3KKPA 3V4FA 2GXSA 3LBHA 4JL5A 2DFKB 3WYFA 2DBYA 2VBCA 2QQ0A 2D3WA 2GAAA 4Q48A 1II8B 4PC7A 4K8OA 5EUMA 4B71A 3S1AA 3QNUA 3T15A 3ZS8A 2D7CA 1IY1A 2R65A 4KFSA 2V7QA 3C14C 5FPHA 3B1WA 3B5JA 4EPYA 1ZIPA 4Z51A 2WWHA 2OBLA 3KUDA 1KDTA 3IQWA 4PTLA 3THOA 4A6XA 3NHBA 2Y8EA 3IBGA 2VL7A 5KDDA 1AGRA 4Q00A 4R7ZA 1RRCA 1KI6A 2VP2A 1E0KA 5FOUA 1H8EA 1P5ZB 2WJHA 1XCGB 3AH8A 3RS5A 1ZD1A 2ODBA 4XVUA 1E9SA 5EE1A 1CU1A 4M22A 1OW3B 1Y3AA 2ZUBA 3Q3JB 1W4BA 4AK9A 4P3YA 1CR1A 3IPXA 4MRSA 2FGKA 4US0R 1PLJA 4ABYA 2FFQA 4Q01A 1MRSA 4YMTA 1BH2A 4WOPA 1TF5A 2VHQA 2DHRA 4MUBA 4DLTA 5DHFA 5BWMA 3EWAA 3JZMA 3GMTA 3MRSA 1S9HA 2ZRLA 3M6AA 4Q4JB 2G3YA 2ZSFA 4B48A 2H92A 4M9QA 4KITB 1GL9B 4F4JA 2GF0A 2WKQA 4OQFA 5SZHB 5DSZA 5EUQB 1N5JA 2QI9C 5A4JA 4YDSA 1ONBA 3FTQA 1G291 2LKCA 1BMFD 4LYHA 1NVUQ 3AP3A 4QC2A 2GBLC 1NG1A 4NYIQ 1RJ9A 2IBMA 2P6RA 3OHMA 4ASUD 1NMYA 5B30A 1JNYA 4DLUA 5KNBA 5EXXA 2DFTA 1VCNA 1M7GA 1OT3A 2YJTD 4XVRA 3EPKA 2QMOA 1UBEA 3TVTA 5LPNA 5KTYA 1I2MA 1VIYA 4B3GA 2CMKA 2BC9A 1F2UA 1FQKA 2XX3A 1W7AA 2AD5A 2CE2X 1A5TA 3HU2A 3OE7A 3SN6A 4DZZA 1E4YA 4TZ6A 2X2FA 1S96A 1R0XA 1VIAA 4LC1A 3MAAC 1F6BA 4RY2A 2IS1A 3I8XA 2P65A 3CRQA 3VAAA 1CEEA 4DDUA 4JIMA 1I4DD 2BV3A 2KWIA 2OV2A 4Q4LA 2H8KA 1F5NA 4YMWA 4CEHB 3WHKA 4W7SA 2RGBA 1P9WA 2D2FA 2BMJA 2ZITA 4V03A 4CIDA 5J4KA 2O8DA 2V1UA 4OL0A 1J70A 3PXGA 2IYVA 4YDHB 2ODWA 1OXTA 1YR6A 4MGKR 4TSFA 1E2NA 2ZRBA 3K0AB 5F3WB 2C9CA 3SNHA 4PXAA 1E2HA 4FMCB 1RW4A 2EU8A 4HDQB 3VU9B 4MYHA 1E69A 2H5EA 4UXIA 3PFIA 5SZKB 4OK5A 4KVGA 3MLEA 2V54A 4HLQB 3K8YA 4FW9A 3UMRA 3BFVA 4XSGA 3DM5A 2YWEA 1JAIA 4LV8B 4IXNA 3GLIE 1CP2A 4BZPA 3TSZA 3B85A 3C5HA 1XTQA 2G0NA 2ZIAA 1BO6A 1XTJA 4EPWA 2PL3A 2A5GA 3P4XA 2AHOA 5L8VA 4GOKA 2GJSA 1XMSA 4BFXA 1E79A 2J46A 1NLYA 3GLHA 2G88A 2WWGA 1ZM4A 4TYQA 4NTZA 1KJYA 3I73A 3QXCA 4DDTA 2ZREA 4ZCMA 5C1BA 1P3JA 4OHVA 1N0WA 4AYWA 4TQUS 4BLPA 2OXCA 2WKRA 2ZS7A 5HR5A 3BAFA 3MWYW 2RHMA 4LX0A 1UKEA 4Q9IA 3RAPR 2QTVB 3F5FA 3T1OA 1NVXQ 3OEED 3GJ0A 3CX8A 2F43B 3E2IA 5M04A 4OI1A 2XXAB 1E2DA 3B7GA 3TR0A 3UG6A 2OFOA 4U00A 4TTPA 3M4YA 3RSOA 1MO6A 1Z6GA 2C8VA 1YZQA 1GL7A 1Q1BA 1IY0A 4FN5A 3R7WB 3WMFA 2CHVA 3GLIA 2QEQA 1X8JA 2IYUA 2IYYA 3Q5DA 2XZOA 4FWIB 3THXA 3K9GA 4OK3A 3TUIC 2JJ1A 1MKYA 4JLVA 5EXTA 3SJAA 2RGNC 4WXRA 1RVDA 4GDFA 1AA9A 1VECA 3RS0A 4BZQA 4M9XA 1HQYE 4M1WA 3CM0A 2J59A 1KJZA 3WNBA 2IL1A 1KI1A 2CCJA 4Q1FA 1M1YE 3N70A 3ND9A 3VFDA 5AUOB 2VLIA 1XEWY 1J99A 3TIFA 3QI2A 1EFRA 2W58A 4TT3A 3THYB 2JLUA 5JJKA 1T0HB 3RYTC 3KL4A 4C0LA 1SVWA 5JS8A 3DL0A 4PQYA 2H57A 4C4PA 4GBMA 3PUXA 1Q3HA 4Q02A 2GTPA 1DARA 3BFKA 2ZVPX 1IJFA 3RWOA 3X2SA 2HT1A 3N5CA 3W6NA 1U8YA 2O8BA 1G3MA 4IDQA 1KI4A 3VHLB 1Z2CA 1OYYA 5KNDA 1N25A 4AG6A 1DE0A 3MG9A 2GRJA 4ZI3A 1P61B 1EFUA 4JMPA 1JPJA 4BFWA 5K8IA 4L16A 5DI9A 4MA4A 5G3ZA 3ZQ6A 4DSTA 2FMXA 2NGRA 1KZGB 3EG5A 4RZUA 3BC1A 4X8MA 1VDZA 1COWD 1DAMA 4LJ5A 4TMTA 1P60A 4ZO4A 2RHDA 4I1SA 4LJ4A 1XMIA 2VF7A 3QG1A 1UBGA 1HT1E 1MABB 2YOGA 5AJZA 5KOYA 4QNRA 4QM7A 1RC8A 1E2FA 2C99A 2BOVA 3ZD7A 3IGFA 3AVOA 2JLXA 4XWOA 2QG6A 4RD3A 4C2TA 4NDZA 1ZCBA 2GNOA 1CJVC 4B2IA 2Q3HA 1SHZA 2VRWA 3I61A 4EPTA 1ODFA 4Q9JA 2ZYTX 3WHLA 2ZI9A 2VSOA 1OKKD 2CEAA 5FBVB 1QG4A 2GJKA 2JJ8A 2JA1A 3O47A 5FPYA 2VH5R 4PZYA 3UWOA 1KK2A 5CM8B 2CVFA 2XOKA 4OK6A 1NF3A 4Q7JB 5JI2E 1JAHA 2QM7A 3ZJYA 1TTTA 4HLCA 4CEIA 2QTFA 3D8BA 5AJWA 1M6NA 3WBKA 2Z43A 3F3YA 1KO4A 2ZJBA 2C03A 1G20E 1HQCA 1E2EA 1YHNA 3IEUA 4RKFA 4ACAA 2GCOA 4DBLC 3EAQA 1JR3D 3AF3A 4ERNA 1XCPA 2ZI5A 1A82A 1NN1A 4WXPA 3VR2A 1YRBA 2VSXA 5JECA 4IEEA 4RFSA 3LW7A 3VHXA 4JKIA 1JXOA 3WNCA 5P21A 1N6PA 4M1KA 1E3MA 3QUSA 4IVPA 1IN6A 5EE9A 1L2TA 2GCPA 3IIJA 3THWB 3VNVA 5CDFE 4D6PA 2J9RA 1SXJD 4CEIB 1D6JA 4JT4A 1W4AA 3U7EB 2QMEA 3SYKA 3X1ZA 1JJ7A 4Y0AA 4NCKA 2IWHA 3H86A 4U02A 5FTLA 3C5CA 4AIIA 1KDRA 1Z6TA 1KSJA 3LDAA 3WMGA 1JB1A 1GG2A 2FH5B 4DKXA 1W46A 2KE5A 3L0OA 1E6CA 5BYKA 2BJVA 1UKZA 5FUVA 4YXWD 1SVLA 3EZ9A 4Q9KA 1JQLB 3D31A 3SYLA 3OFND 3FHOA 3ZLJA 1F48A 4BQSA 2QSZA 4HZIA 1QG2A 3KB2A 5J4YA 1W0KA 2N42A 4BLTA 1LV7A 4JL8A 2G1JA 1NLFA 3T06B 4WW0A 1ZJ6A 4F91B 3KX2A 1DAKA 1HURA 5CK4A 2W83A 4LUCA 3LRPA 3W8NA 1N5IA 4RFSB 4TMWA 1KK3A 1G7SA 4H9GA 4IHQA 1KSHA 1OE0A 1ZD9A 2X8AA 2QROA 3W90A 1IN4A 1G3UA 2NPFA 1JI0A 4EFMA 4LHYA 3ND8A 8OHMA 2QNRA 1D2MA 3ETLA 3RS4A 4RSGA 1KI3A 1OF1A 3VKWA 4BECA 1VCIA 3VR5A 1H8HA 1IM2A 4QBIA 4QGHA 1RPZA 2FZ4A 1A2BA 2KJQA 4URZR 3MWLA 1LS6A 4OJQA 3SZRA 1IXZA 3CUEF 1Z63A 5JHGB 1JR3E 2AWNA 4V0ME 3TUZC 5E7MA 4PHGA 4D80A 5GJWC 1KZ7B 3B9PA 4AWXA 2OM2A 5DGXA 3HYTA 2QPAA 3AUYA 4LHWA 3THWA 5HCNA 4RKEA 4NYMQ 1G1MA 2H16A 4GOJA 2ZYVX 3EW9A 2ZSDA 4LI0A 3UATA 2A30A 3IO5A 3RC3A 5FOWA 4ACBA 1KI9A 2IW3A 3Q8XB 3IDQA 1ZU5A 4PHFA 4LY6A 3GLFB 1YR8A 4V02A 4WZAE 1RYFA 1KMQA 2HF8A 4F93B 5HZKA 3B82A 3I5XA 4M1TA 3VQTA 1R0ZA 4LPKA 1W2GA 1KAGA 1JQJC 2CXXA 5KSPA 4RZ3A 4TYPA 2A5YB 2J3EA 3EZ2A 3E70C 1US8B 1ESNA 4NKRA 2OILA 4V0NA 2XB2A 2ZM5A 1T8TA 2C9YA 4G1UC 4IOLA 1X1SA 2D06A 3TLXA 2GDJA 2W2VA 5CB6A 3EARA 5C2JB 1NBMA 5JS7A 2PMKA 3GQBA 3I5YA 2HXSA 3ZYCA 4IEIA 3T5GA 4JL6A 3NH9A 2PX0A 4MKHA 1T0JB 4L9WA 2WZQA 3U7FB 4POAA 2HCJB 3CF0A 5AUQA 1KNXA 5BXQC 2QN6A 3CBQA 2UZIR 3A1UA 1QHNA 4Q7KA 1TQ2A 1ZYUA 4BFYA 2X1VA 2ZE6A 3GJ6A 3GLFE 2W00A 1OXSC 3K70D 3Q9LA 2ORWA 1R7RA 1E9CA 3AUXA 3WBJA 1W36C 4CGZA 1CR2A 4HDCA 4TMXA 4IDPA 1G7CA 3GFOA 1RRPA 4UXHA 3QEJA 3SYNA 1QZXA 4C7OB 4E03A 2GK7A 3UMSA 1U90A 3AKDA 1P73A 3UKDA 1XPOA 3DPUA 4Q66C 2HT6A 4TL6A 2NO1A 3CF2A 4ZIRA 1DPFA 3I32A 4DWJA 4D4KA 4HUQB 4A6PA 4MGZR 2JGNA 1EX6A 3ICEA 1TEXA 5FTMA 3W9YA 2OG2A 1U9IC 3IPYA 4UNSA 5C4GB 2KBFA 4CDGA 2CNWA 2F9MA 2ZRHA 1AN0A 3ZVMA 3NBXX 2GK6A 2OAQ1 3AGPA 3EZFA 4NYMR 1L8QA 1OHHD 1ZM2A 2WOJA 3PUVA 4IVQA 4PHHA 5KDLA 1G16A 1QHXA 1W5SA 2AWOA 4Q4JA 1ZW6A 3QVUA 5GADl 1X86B 2ERYA 4JVNA 1E9BA 2J41A 5AJXA 3QBTA 4LHZA 1XD8A 4H1VA 1G64A 1NN5A 2YOFA 4Q18A 4HUQA 1NBMD 1DS6A 1JXMA 1IOZA 5ELXA 3OIWA 3DVLA 5G41A 2ZVQX 4OHZA 2JDIA 3A1TA 3WNDA 1FNMA 3LO5A 2YV5A 2KI5A 4FCVA 5CIQA 4DLRA 4HAUA 2FFAA 3CH4B 1XD9A 4RCZA 1SVIA 2IYLD 4HZUB 4B3BA 1HY3A 3A4NA 3FHCB 2GVDC 4Q1AA 4NE2A 3U7HB 3CWQA 2CK3D 4PC1A 2XTNA 1N6KA 1PV4A 1QHHB 2NOAA 5DISB 3KKNA 4LJAA 1E94E 4LYJA 4Q1EA 4BLQA 4B34A 2O8FB 2QENA 1W0JD 2REOA 5C18A 5J47A 2AFIE 3PEUA 1XFAA 2ATXA 3FB4A 4EPXA 3L8YA 3ADKA 5E7JA 4FXPA 4C0QC 1YZTA 5HE8A 1MH1A 2GEUA 2WVJA 4GMXA 4Q1DA 2J5XA 4BFSA 1KGDA 1SVSA 4HEJA 1W5TA 1OIVA 2JCSA 1U0JA 4P4TA 3EA0A 4ZCIA 1GDDA 4FCTA 1Z08A 1MABA 5TY0A 3U3KA 4L9SA 1FW6A 1Q21A 3D3QA 1IBRA 3TH5A 1N5KA 1Z06A 2DR3A 2PBRA 4M9SA 1LB1B 3F8TA 4Q4AA 1UPTA 2R6CA 2QP9X 3KKMA 1E32A 1P6XA 2XB4A 1BS1A 5DN6D 2CBZA 5LB4A 2XNDD 4DIEA 2HYDA 121PA 4GZLA 1RE0A 2O52A 1SGWA 3EZ6A 4M1SA 2P67A 4NH0A 1ZC4A 1DVRA 4L5BA 1G8GA 2ZRCA 4N0DA 3ASYA 2NTYC 4LPSA 3AM1A 4A2QA 1NNEA 3PIRA 2PX3A 2WJVA 4MH0R 2QRNA 2J0UB 4JJZA 2GILA 3BD9A 1P9RA 3Q85A 1HE1C 3AKEA 1XMVA 1Z22A 3IO3A 2YOHA 3GD7A 3NXSA 4LJ8A 3W3ZB 5JEEA 3RSLA 4QBFA 2FSIA 4EJSA 1G19A 1XEWX 3ZVLA 2JLVA 4HYYA 4F4IA 2CLSA 1E2GA 2NO6A 5IRCD 1J7KA 2WMNB 2GXQA 4IKEA 4RD2A 1QHSA 3FMIA 1U94A 2WOOA 3AVQA 5BN3A 1Z3IX 1OJLA 4NYJQ 4AYXA 4RD4A 1W47A 3NG1A 5DI3A 5EE0A 3PV0A 4JVLA 1IONA 2JAQA 2AKYA 2XZLA 1US8A 1ZRHA 3HR8A 3QIAA 4JYCA 4BFZA 1TL7C 1KI8A 4EUNA 3OFNA 3LNCA 3RRZA 2NMVA 3VKHA 1KK0A 2BMEA 3PITA 1R10A 4WA7A 3A1SA 3LXXA 3IEVA 1S2MA 1E2MA 3B78A 3SJBA 2XITA 4ZDWA 1NJGA 3MJHA 5CITA 2G9NA 3GLGE 4ZIRB 1AQYA 4QHTA 2BBTA 2WIAA 3C41J 1XD2A 1T5LA 5CJ2A 3ZQJA 2OCAA 2P5SA 5DN6A 1NP6A 1Z0DA 4KSCA 3NVAA 3K0EA 4D0NA 4KYIB 4D4MA 2XEXA 1YQTA 3DKVA 4DCNA 1GM5A 1I4TD 4PZLA 1AIPA 1VMAA 5DI3B 4C0BA 1L7VC 3CH5A 1P7CA 4JLDA 5JWOA 4TTQA 3LAWA 1QRAA 1K5GA 4DB4A 2G0TA 2ORIA 2YC4C 1E99A 2BMDA 3BJIC 1VG0B 1XCMA 2ZRIA 3RDPA 2CHQA 1I2DA 4A8JC 1E9RA 5JBQA 2J1LA 3SS8A 5JFGA 3GJ7A 3HDTA 5CM9C 2R8RA 3CIOA 4P31A 4A1FA 1N6NA 4LRWA 4YMSA 5EP4A 2P5TB 2ANCA 4GT1A 1QVAA 2FZLA 1LFDB 2OLJA 1VYVA 3KZ1E 1Q20A 1W4RA 421PA 2SHKA 4TLBA 1TUEA 3U5ZB 3GFPA 3DKPA 4WVFA 3CZQA 2OCYC 3RNLA 2ZJYA 1E9EA 2ERXA 1P75A 2FU5C 1G7RA 2MSCB 3CX6A 4B75A 4DRZA 4QGGA 3K0FB 4ZKDA 1E98A 3LQQA 1DTSA 1N3BA 5B64A 5FR1A 2IX3A 1ZCAA 3BFXA 1W1WA 2RGXA 4D26A 1Q3TA 521PA 4HLUC 1KNQA 3E5HA 3UK6A 2V55B 5GJBA 3U60B 1FL9A 221PA 2ZRGA 2O0HA 3VNUA 3PUYA 1UM8A 1PJRA 3GLHB 1JECA 3K9HA 4PO1A 5HPYB 4TMVA 3U4QB 1FX0A 2MMCA 3KTAB 2BKEA 1G8FA 1E1RA 1Z6XA 3W3AA 1E2LA 5HE9A 1DO0A 3EIQA 2HJVA 3VKGA 4HB2A 1QHYA 4ARZA 2F1HA 1SXJC 2QMUA 2R62A 3B1ZA 2R2AA 4CT4B 2VP6A 2IXEA 4YMUA 3SOPA 3NBFA 1VG9B 4XH9B 3LH5A 3QKRA 1OKKA 5C46F 4URYR 4N3NA 1T9HA 3KKOA 5L3RA 4DT1B 3P26A 4DDWA 2CL6X 4QGFA 1P2UA 4KBFA 2OE2A 3GJXC 3B2EA 4LHXA 3DOFA 4UKDA 5LB2A 2E9SA 4TT3D 2JLSA 4WBSA 4M21A 4IFEA 2PZFA 1SVOA 1BYUA 2AD1A 3BOSA 4Q1CA 2WV9A 3BERA 3VU9A 2YYZA 2L0XA 4ZDKA 3EA5A 2A5JA 2W2XA 5TDHA 1KO1A 1SKQA 3Q7PA 2ZJ2A 4Y0VA 4IFBA
chains in the Genus database with same CATH superfamily
5JJIA 2G9VA 3DEFA 4CR7A 3FKQA 4M0PA 2QRZA 1XRMA 3QF4B 4WNYA 4ZI5A 5HZHA 2BDEA 4ZEXA 4ZOLA 2C4UA 1RT9A 4Q7EA 4BO9A 1ODTC 2QMHA 4QFBA 3MFYA 2VP5A 4X7RA 4NBSA 4MWDA 1M34E 3IPCA 5H82A 4BQIA 1JEYB 3BGSA 3CWZA 1A9TA 1HLDA 1D9ZA 3LJKA 1LPPA 3ZV6A 4BVGA 4XTRA 3W8RA 1VBFA 2AW5A 5CEJA 3N2KB 2YWFA 1L1RA 3BB3A 2AI1A 2EGHA 2ZTUA 5I7FA 3BD7A 3K1AA 3QU2A 4UMEA 5J59A 4L5JA 4UM8B 1FFXB 1MTZA 3RSSA 1G18A 3RYCA 2AMJA 3IEIA 2IU6A 3O8OA 5C7LO 4OJKA 2C2OA 4WUVA 5U1PA 4ER3A 1Z2DA 1ZXBA 5DEIA 3WGVA 2FUNB 3KQLA 5CB4A 1B15A 2ONKA 4G25A 3RUFA 5FUQA 2NAFA 2FPLA 4X95A 2YMQA 2VZ0A 4K9OA 1NR7A 2WAAA 4LHVA 5LD2C 5LU8A 3GUZA 3CVYA 2JGKA 1HG0A 5H70A 4YMVA 1UZNA 2CDRA 5EESA 2BSQA 1NUAA 1FMCA 3BB1A 4V3CA 3ZX4A 4BLRA 4LQLA 2O4CA 5KWJA 2C7OA 5AVQA 4PF1A 3KKLA 2TECE 5FKJA 3V00A 3FTNA 4CKCA 5LQMA 3JQ6A 4JYMA 4NPHA 2Z6QA 3WL8A 2BI8A 2C4VA 3WJ1A 1H1DA 1SCIA 3NONA 3QVOA 4HAVA 5HBGA 2PY6A 1EXVA 2PE5A 4PZCA 3V6LA 2FJ0A 1RLIA 2VSFA 3MA0A 3T4XA 3M3DA 2RJ3A 3ZE0B 4U2DA 2OD2A 2CXTA 4RULA 2C42A 5LNK6 3MTBA 2CJWB 2QZJA 4Q82A 3AL2A 2QJRA 3NWBA 4WCFA 1U1GA 1KBZA 1VCOA 4PGGA 4CG1A 1J0DA 1UOEA 1T5DX 4X7MA 5E6RB 2DRIA 4G5HA 2C0QA 1KO8A 1TTPB 1RRKA 1JEEA 1X1RA 5EERA 5C8YF 4KR3A 1YR1A 2XGJA 3CW2A 2BPOA 2GOYA 1R27A 4EY7A 2CXRA 3C74A 1JHMA 2NUBA 1PS9A 3RGGA 3B48A 3HRKA 5EXSA 3WDKA 5C3MA 4LF7B 4FEAA 5FPPA 2Y2VA 2AFHA 3P0JA 1LPNA 3OOSA 1T3LA 4HFRA 4MMXB 3W5HA 1AQJA 3A0UA 3C1OA 5FADA 4EPRA 2R6JA 1OX4A 2HSZA 4RMJA 4AJJA 3NDBB 1ECGA 1KP3A 4HCJA 4TVBA 3JRXA 4N18A 3IR6A 4WESA 1A4IA 5K3FB 1U6IA 5K4HA 3A1VA 2PD6A 3IAHA 1SNYA 1XD2B 5HWSA 1IEWA 1R37A 1TM1E 3C7KA 5ES3A 2J07A 3IKJA 1Q0LA 4PYJA 1BKYA 1PZNA 2VJBA 1DCMA 2ZJ5A 5CX1A 3UK2A 3VR6D 3ZZTA 1T4GA 4ETIA 5AWFC 4BRWA 3D1VA 4WXMA 2LUOA 1IXRC 4DPKA 2JIRA 5F2KA 5JAQA 3QYPA 4K6GA 3N1UA 2WJ4A 5K3DA 3WC4A 3D3JA 4LFBB 5HGJA 5JCJD 1XELA 1UBHS 3DPIA 5THQA 3R75A 2WWXA 4TUYA 3BK2A 3UFXA 1CF4A 1NWCA 3U4IA 1AHPA 4D9JA 4QU0A 1DQNA 1C0KA 2ADMA 1Y4UA 2IHYA 3FETA 4HGRA 3RU2A 3VX3A 2R11A 1NIJA 4QKQA 3TBKA 3QUBA 4AMBA 2OZKA 1LPAB 4DC9A 4YUZA 2RKOA 5GOTA 3THYA 1PX2A 2YFYA 1AS0A 1XP8A 1U2TA 1Y8QA 4QO8A 4J7CA 2SCUB 3JTEA 3VO8A 2XUAA 3PFNA 5LQNA 1K6JA 2XQVA 2YJ5A 4D56A 1LY1A 1R8SA 2Q0XA 5FYDA 3BHIA 3PCRB 1PCXA 1D1QA 3MT7A 5BW8A 5FL7A 2CCKA 2W5UA 4MW9A 1AX9A 4HFJA 3OOEA 1DQYA 3QYAA 4KLCA 4NICA 4C5AA 4XIFA 3K4HA 4DSOA 6REQA 3DLBA 1DI0A 2V7BA 1DCFA 1WW3A 5I5GA 2D0OB 2IC5A 3NBYC 3E03A 3AR9A 4GIBA 1UAYA 3T3OA 3NBMA 1P31A 2F64A 2GCGA 1XVUA 1Z0ZA 2B4TO 2BM1A 5A5EA 3R3SA 5GP1A 1GNLA 3S81A 1YCFA 4QHSA 1F4PA 2ASEA 4YRAA 5HKKD 4P08A 1TD1A 1O6BA 2ZTVA 1HYBA 5G02A 3N74A 3WJAA 4ZI2A 4PZDA 1SOVA 2ZRPA 4KN5A 2OD9A 3ZXIA 1YC5A 3L7OA 1HE5A 2XADA 2N1MA 3N7AA 3TK1A 2YWJA 2VEOA 3H6KA 3RRYA 3B6ZA 4EFDA 5KDOA 3TBHA 4E14A 2REQA 2R5WA 4TTIA 1IPFA 4PO9A 3W7BA 1PT6A 1OVGA 1WVGA 1Z33A 2GETA 1UBTS 1R0YA 1TVKA 3GOHA 3OX2A 5CDYA 3DW1X 3NUZA 2VJQA 3P27A 4K86A 3VRHA 1JFRA 1XAJA 5MN6A 1DOHA 3WGYA 5I4IA 2VT6A 3QKSB 5CYPA 2JI9A 4FM9A 1BROA 1QYCA 1TFUA 2CWDA 2HV8A 4YQFA 1OQAA 2C95A 1CTQA 1E6KA 1JDVA 2C4MA 2ZANA 5JFTA 1Y1QA 4TMZA 4ZN6A 3WWPA 1JBKA 1E9DA 5HSGA 3JVVA 1T34A 3AYZB 3P32A 1D4ZA 4KXNA 4GXQA 4YC7A 3DFZA 2ZTMA 3MSXA 3RBVA 3UPUA 2PRSA 2AEMA 1OFIA 1BRMA 4QOEA 1K0FA 2P90A 2PGXA 3ETGA 3HN2A 1EWYA 1X94A 3OHSX 3Q9UA 4YAJA 3SQDA 5JYEA 2C82A 2OXEA 4W5TA 3DFUA 3ORHA 1YR7A 3MTIA 1XZQA 2AFIA 4Z9XA 2GB4A 2YJNA 3C97A 4O5AA 2GS9A 3AVWA 1C5KA 1XR3A 3IEXA 3C7TA 1SULA 2CXUA 3AHCA 4DSUA 2WJYA 3GQBB 3DHEA 5AHRA 4JI0B 2NPOA 1RABA 1WCV1 4IF4A 3QLUC 4NOLA 1ODCA 1NQWA 2H54A 4UZFA 1TQDA 3WR5A 3JSAA 1XVAA 4RIEA 5MDHA 1ZITA 5ADUS 3V2HA 5M2QA 4RPIA 3MINB 2TS1A 2WSLA 3RJ9A 2CNWD 5KTSA 2O54A 2GF2A 1JFTA 2DBZA 3LX4A 4M1OA 5B2ZA 2JJ1D 1U81A 1BQ3A 1JP7A 3AERB 3CLUC 4EHAA 5K8TA 5CFMA 3AWIA 4HV4A 5TPZA 1CUCA 1FSZA 3GFVA 1ILWA 4JLJA 1CDEA 3HXMA 1M1NB 2A6PA 2E4WA 1VJ5A 3BS4A 1XQ1A 3AQ4A 3AJEA 4JBNA 1JZSA 1KAOA 4XUDA 3Q8MA 2GLXA 1QYXA 2YY5A 3IHWA 4JEIA 5AI5A 2Y1DA 3W3AD 5HIKA 3ZDBA 3V55A 3PWZA 1B2LA 1CRZA 1Z7YA 2EYQA 3EWNA 5DMXA 4EKDA 2W4IA 4M98A 3LP5A 3EBPA 3LBFA 1U2ZA 4HJXA 1EFRD 5BSGA 4E7OA 4G0OA 5SYNA 4FC6A 4ZJZA 4A8JB 2R79A 1T2DA 3A2LA 3U9TA 1I1OA 1Y8QB 5EJ9A 3NVDA 3JWIA 3IP1A 1LDGA 4QASA 3HBLA 4C14A 2N47A 4B7ZA 3PA8A 1Q84A 3HYCA 2NSYA 4BO8A 2HA5A 3HJNA 4MTLA 3U7GA 3LUFA 3UTCA 2E5WA 3PQDA 5EHIA 1E2BA 2W2KA 3OPVA 3K5PA 2OCBA 3H2YA 3AEZA 3JQ8B 4EF6A 3AUAA 4FGZA 4KKXB 4GX1A 2HKIA 4JP1A 3GJ5A 3QYJA 4OB7A 5F2EA 3UJ9A 1OWNA 1Z26A 4MPJA 5JBIA 3UGJA 4CMEA 4UOQA 3EPPA 1UZAA 2WICA 3DT8A 3FGZA 3LYHA 3RS9A 2E87A 2IEDA 4HYQA 4DUGD 4F45A 4G5GA 4WEOA 2FMFA 2AA3A 4HATA 3SZGA 3GB9A 3V1LA 4MB0A 4PLTA 2Q6TA 2XMPA 1IHYA 4JJGA 4S0ZA 2ZBPA 3KCQA 4UTRA 1CDZA 2BZGA 3VR6A 3RKSA 2Y05A 3SC3A 5CBPA 4R0NA 3CISA 3FFXA 2IYQA 5REQB 2EQAA 1WUYA 4XUCA 2FMHA 3VZSA 5TJHA 4DJTA 5KCZA 1KQFA 5LOVA 4RY8A 4EQ6B 1BCSB 4FHZA 1G21A 2YC2C 4NHEA 4HXYA 4MCIA 4BP1A 2FFJA 2HMUA 13PKA 3DR3A 5H7XA 3U7RA 1G1AA 2PBZA 3BMCB 2W2LD 1JYEA 1VZ2A 4M0LA 1L5RA 5FUWA 4E46A 5IM5A 3WE7A 2XB9A 2I87A 4C2BA 5JMOA 3JQAA 2RGEA 3GEHA 2FGJA 3EXIB 3IEKA 5EOVA 3OPQA 3VH4A 4DCTA 5KVCA 1EFCA 1IWPB 4TL9A 5FBKA 2TMKA 3DAFA 3O26A 5JMWA 2Y0PA 3D8HA 3MWDA 2VA8A 1EINA 5K3BA 3SHWA 4DG5A 4A36A 3TF5A 2QF7A 4CUJA 3JYHA 3UMBA 1QAQA 1UDCA 3OG9A 1WBDA 3NHMA 1NIPA 2H2GA 4MARA 5LKAA 1UAGA 2AF4C 4C05A 4QUHA 3VSEA 1RPAA 721PA 1HDCA 4DJEC 2NADA 5JSZA 1OXMA 3SIPA 2Y1GA 2K2WA 4ND6A 1HKUA 2HPVA 4BVJA 3U1TA 3SICE 2R3SA 4LDQA 3UANA 1EHYA 2FEPA 4LDRA 2QV0A 4WA8A 2PD4A 3IDAA 3AVTA 1D1SA 4FILA 4FZ5A 5K7SA 4JU9A 5AJYA 2BSXA 3STTA 1QZTA 5KQRA 1MVNA 1ULAA 3HBFA 3BXZA 5J5VA 1OIWA 1WXWA 4Y9SA 3RHSA 4BWVA 1YI1A 2CB9A 3ZVNA 1VE3A 3ITEA 2J3IA 4OI2A 1VPDA 3ROPA 2JASA 3GPDG 4L15A 4MQ5A 4M0UA 3GX1A 2PRIA 1ZUNA 3H5OA 3JWJA 3JZDA 4HB0A 1CUVA 4NMMA 1GIAA 2O7SA 2XE7A 3BKXA 4KFRA 2ZWOA 4GZMA 1Z13A 4O8CA 4WZ6A 1YS4A 4AY4A 2VXOA 2ZXUA 1WEHA 2O8DB 1ZFNA 4Q4HA 1UEJA 4YCJA 4NBTA 4TL7A 2G5PA 4IDDA 1T4CA 4MCJA 1TDJA 1DHRA 1U4OA 4IIFA 4YP7A 1GOTA 3SP1A 4BCCA 4QZVA 1ZGHA 2I2CA 3LPLA 4Y9RA 2N3ZA 2IT1A 1VE9A 2YHUA 3L1HA 2W0SA 2H4HA 1D5CA 2CLIB 1OI3A 5DXFA 1RIFA 4Z8XA 2ZCJA 4KIJA 4L28A 4TKUB 3GD5A 3OC6A 4FBMA 3GCWA 4H4DA 3WRWA 2JARA 3TPFA 1YA8A 4BJ1A 3CNBA 1JHPA 1Q22A 3P5SA 4BL5A 3ESDA 5T4BA 3NKFA 3KDSE 2EBFX 3ZE9A 5BPFA 2IDJA 2WWWA 3I72A 2HRQA 3KE9A 4M8LA 4D9KA 1LJLA 3HXOA 4F7WA 4B5KA 4RD0A 1EIWA 1GV1A 3L1IA 2JFPA 1JHXA 3T5MA 1XQ9A 4NU0A 1GITA 4D4LA 2EWWA 2QAGB 5G0VA 2VFAA 2NXCA 1M6YA 1QH1B 3COVA 5CA0F 1K08A 4GEGA 4C07A 2J0VA 2CJPA 2IZOA 5CD9A 2HSJA 2H1IA 4ISCA 4R2XA 2BSAA 4YMGA 5L3SB 1IB0A 2AK3A 3ZCXA 2VTBA 3AT1A 1NFRA 3EWIA 1P1RA 3G5TA 3DOUA 1XP5A 4FN4A 4J0CA 3V33A 1A76A 2C4HA 4WK4B 4EK9A 1Q1ZA 1Z56C 2RCNA 2Z6VA 4U7TB 3H1TA 4EITA 3IAAA 2X0DA 4W82A 4P4SA 2R00A 2EP5A 4GMDA 3V8EA 4YQYA 2KLHA 2Q1TA 1NY6A 4MW7A 4HZUA 3EGEA 2WUWE 4R2HA 5CNMA 1FFYA 2HWYA 3C24A 2YINC 1M2GA 2H2DA 1MB4A 2ZSBA 1E8MA 4PNZA 4ZVVA 1GZVA 1NATA 1RXYA 5TGDA 1II0A 3G9XA 4L4ZA 3VZRA 2J30A 4U1RA 3VDMA 2ZWPA 3PGKA 4EYGA 5DBHX 4M99A 4M8NE 4PX9A 2WB2A 1DC4A 3IB3A 4NU6A 4LF9B 4IW3B 3U4QA 1LU9A 2ZRAA 3X1MA 2LD4A 3I12A 4PG4A 5IAJA 4OY3A 1LBSA 2H4FA 1WCXA 4QGBA 3HS3A 3AO0B 1XDZA 5FTJA 3BMXA 4ROTA 4CM7A 3LQ2A 2HWXA 3GL9A 4E94A 2WWIA 3O8CA 3L3BA 2WUGA 3K5IA 4LCBA 3TSOA 4CM5A 1IQPA 3CTPA 3WYNA 1IY2A 2X8BA 2RH9B 3UFXB 2AC4A 2VP4A 1IAVA 3E7FA 2BFCB 3S2ZA 1W88A 2JW5A 2WF6A 4XLTA 3FYUC 4P93A 2R7AA 2RAVA 2J4FA 4WOCA 5DT9A 1BVYF 1N0VC 1UWKA 2IGTA 3HM9A 1HNWB 1DBSA 3ONWA 2ZPTX 3TB6A 3HU1A 3H1BA 1KE2A 1SMKA 3G5UA 3RS2A 3WYGA 1DAGA 1Q17A 1UQRA 4HEA6 1PGJA 4RQUA 1MGOA 2OGUA 2ZYWX 2VH2A 3V7YA 4MDEA 3AL0C 3KB1A 4R1TA 4BFTA 1FDSA 2WLTA 5KNLA 5LYJB 1R8QA 2EFEB 2GZRA 1MX9A 4IS2A 1ZAKA 1YB1A 3AKCA 3L6BA 1M6EX 1P2SA 3L8CA 3MJ4A 1Z7WA 5A02A 1DO2A 3I83A 4O2BB 2DERA 4G5RA 4HDRB 4BUJA 2UYCA 1WP9A 1UADA 2VP0A 5K0TA 3U4AA 2BT4A 4ZZIA 4TQAA 4JLPA 3X1KA 4QUBA 1RXIA 3DW3X 1NJ8A 4DJAA 4KIUA 5BXYA 1WLYA 1CF2O 4FFSA 1FFHA 3LDGA 1YFLA 3WWEA 4KQ2A 5K45A 5LBUA 1GZSA 4L9RA 2B5OA 2WM3A 1KMHA 3TCNA 2HMYB 4I46A 1CJMA 3K0HA 2RKWA 3K8OE 4RNDB 4URUR 1JGTA 1XSEA 5FPSA 4EEXA 3OY7A 3IILA 4MQFA 4D44A 2RHGB 3GLIB 2FW6A 2V3CC 2IV2X 3MHTA 5CW2A 5EJEA 4HMQA 3I62A 5ICEA 3SFVA 3WGIA 3B6JA 1JIJA 4FHCA 1HYQA 1HL3A 1M2NA 1U0TA 3GY0A 4JITA 5AKHA 1VDMA 2FHPA 3TQSA 3WKEA 2XVZA 3TAXA 5KSWB 2Q28A 1YBHA 2PUFA 3A06A 3ZZ1A 5DXJA 2F3PA 5HKBA 1C7QA 2R86A 4HDNA 1XEXA 1E2PA 2E4AA 3EZNA 3K35A 4XOUA 4ZT4A 3U31A 3KR1A 5DOVA 1V16A 5TXGA 3RTBA 3W9BA 3WJ7A 1MQAA 2R48A 2FPGB 4L07A 4OQ4A 2OK8A 2XA9A 5DLDA 3CN7A 4DCSA 4IH1A 2B92A 1YFJA 4EKEA 3D4BA 3BH0A 2XUJA 1Y4SA 3D1JA 3HPQA 3Q4GA 2Z30A 3JATA 5MGNA 1CZRA 1B8PA 2P4HX 2Q7DA 2R2GA 3RH0A 2AQ8A 4OA5A 1E0AA 1LD3A 2KSQA 3OT4A 3SX4A 1GRRA 2H18A 2ECOA 1NBWB 3UJCA 3I3SR 3UICA 4YRNA 1K7FB 4MDFA 1Y0BA 2R5FA 4HDNB 4PZUA 1Y9EA 3PE3A 3IRUA 1K6MA 2QS9A 5CVJA 2PZEA 2RG7A 1HYGA 3I2KA 3BIXA 3EQ6A 3O8BA 4PFSA 5DLEA 1Z5UA 4QL3A 4TKMA 2G71A 3H3FA 2IXFA 1TYDE 2MOKA 2QAIA 4MQ6A 1PL0A 2B1GA 2NUTB 2IUFA 3QEOA 1EJ0A 3N2IA 2JZNA 4J03A 3RIXA 5JWHA 3FKSA 4BFVA 1FYDA 5AM1A 2RHBA 4RTJA 2PT5A 3RQIA 3P71T 2V4ZA 4DMCA 2PRZA 4QYIB 3PNMA 2QTNA 1K89A 2QTRA 3WA6A 1DX6A 4R2WA 2ZB3A 3H0KA 3JQAD 2TSYB 1A27A 1OPXA 3QU9A 3FOWA 1NY5A 3P20A 4X1YB 3VUFA 4TYWA 4NU5A 4G36A 4AF7A 3LPAA 1PYDA 4RNCA 3UA3A 2DLDA 5K3OA 2AR0A 2WP8J 1YNOA 2HV9A 2ZETA 2EG5A 3QPWA 3LLCA 1EA7A 1QLWA 1RSZA 2HF2A 3ZC3A 3OAAA 5BNTA 1BFUA 5KNDH 1RKUA 4NBWA 1GUAA 3UPDA 3CNLA 5AOBA 2H29A 4G07A 4GBJA 1FMLA 3RRMA 3F90A 5LXTA 5TX7A 3M34A 3DPSA 1H85A 1ZM7A 5KSZA 3ERCA 3G89A 3PHIA 3Q72A 4GZ3A 1LDYA 1SVUA 2XA2A 4TLMB 2AXQA 4QYTA 4AQYB 3H5NA 3ZDDA 4WJKB 1IEQA 2ZTLA 5HIIA 3QWBA 4DCVA 3MMXA 4AJOA 4E1BA 1L5HA 1XO1A 3O2QB 1Q1EA 1LH0A 1LWOA 1GRQA 2JAHA 1QGED 2QA5A 1FDWA 3KTAA 4X65B 4GC9A 4YLEA 1DJMA 2WM9B 3ABIA 4AXXA 1VE1A 3BXPA 4IV0A 1UKVY 2YWHA 3IQZA 3IAM1 1D2AA 4IZOA 5CJJA 2QTTA 1ZA2A 4ES6A 3Q10A 1AUVA 3USCS 1DAFA 4U0JA 3KD2A 1N1DA 1O8BA 1Q5PA 3L0PA 1JS1X 2VWHA 1Y81A 4HH4A 5AR1A 3W05A 2AB0A 2FPRA 4TLEA 1IZ8A 4YR9A 3GP3A 4YP1A 2BFFA 5CB8A 2J6BA 5LQUA 3JZAA 1KSGA 3R24A 3BRWD 4XWAA 1GQ2A 3V1NA 3G8AA 1FZQA 2GN4A 3M49A 2XIJA 4BV3A 4ENTA 1KBOA 4IRXA 1B8OA 2OFWA 1L5QA 2VF8A 3ZE7A 3K70B 1GTMA 3TW8B 2Y1LA 4Z1OA 2UXDB 4BP8A 3RABA 2VPZA 2ZE5A 4NC9A 3WADA 2IE8A 5HS4A 5K3SA 1U65A 1QQTA 3NBZC 4DTIA 2FJPA 1DBPA 3K1YA 4LVUA 3BKWA 3IDZA 2DVMA 4MUYA 1S2NA 2Z6AA 4XASA 3R41A 1XA3A 4LZOA 2QORA 3WAJA 2ID9A 1U8FO 3QMVA 3KK0A 4OJTA 1I94B 2RK4A 2X4LA 5L3ZA 2XUOA 1CHDA 2PTGA 3B53X 3TINA 2WG2A 3PFKA 4UD6A 3NGXA 4KYUA 3U2QA 5B55A 2VQSA 2W0MA 5FOVA 2YVQA 1U99A 1G8HA 1Y3HA 4G85A 2B2XA 3FDXA 5D3MB 4FIDA 3ZW8A 3PEEA 4FGWA 2O3TA 1Z0JA 2Y1WA 4N0EA 3E4CA 2ECPA 2CMGA 1W5BA 3GNQA 2JI4A 4LZZA 3INGA 1XNJA 2RCYA 2P3QA 3I2GA 5I9BA 1AF4A 3NDJA 2B8WA 4TTJA 1DLIA 1VOTA 4LWPA 1S1MA 3LLVA 1Q2XA 1XZGA 1VPWA 4MWTA 1DXHA 2AUNA 2DSNA 5DPMA 5IVKA 2AG5A 2E1RA 1QBGA 2APJA 2Q21A 4LRUA 4BATA 2BGNA 2CXHA 1IOLA 2IYNA 3BA6A 3I8SA 5CJPA 5BV0A 2SECE 2CL7X 5CLJA 1FS5A 3HKCA 3ED1A 3WYAA 1W8IA 2UKDA 3NEAA 5ILGA 3SU8A 1R0WA 4ZFNA 1RAFA 3A2KA 2OD7A 4B9AA 3RC1A 4O2RA 2OBMA 2C54A 1E9AA 3S2UA 1NWHA 2QN1A 3KLOA 5LIRA 1LTKA 1N92A 4P3PA 5JOQA 2GCOB 1XZFA 3KWLA 1PFVA 3GAFA 1T15A 3DZDA 4JH0A 4OBWA 5DLQC 5LQSA 1TQHA 2AXEA 4TV8F 2K87A 1FFEA 2YIMA 5C5CA 2EKQA 5FUYA 3IVXA 3SIWA 1L4UA 4D8TA 2E21A 1DKRA 4G2NA 3MJRA 4P2BA 4KSCA 4YECA 1JH8A 2PLAA 5AK3A 3RC2A 1E1YA 4CM8B 2CUKA 2UDPA 2PMWB 1D6SA 1S01A 1Z4OA 2JRLA 1K7SN 3K9WA 3QW4B 5IJ0B 5EQFA 3RKUA 1MAUA 2I3BA 2Z5FA 3W2FA 1AK2A 4FGLA 4MRAA 1EHIA 3JQ7A 3ZZMA 1IBMB 2QRVA 3JVUA 2ATIA 1UC5B 2FSVA 1WZNA 2I6TA 3ROQA 1ENPA 4LCEA 1ZLYA 5KYYB 1XT6A 4IR7A 3AB3A 3P9QA 4M86A 4OYHA 5F3DA 2ONJA 3W4KA 4BJ3A 5A3QA 3ETCA 1EWTA 3K31A 1E5LA 2VNJA 3ICVA 3LP8A 3M3HA 3ZI0A 3WQHA 4J3FA 5A4MS 4Y1RA 2JFGA 1NG9A 2AZXA 1TF2A 3B52X 2QUIA 2EIXA 4JGBA 5JNUA 3OU2A 5EJGA 3WYCA 1N7GA 2I99A 5AJVB 4NJMB 4DS3A 2UUCB 3N2KA 2QRQA 2QTZA 4KW7A 5G0UA 4CMKA 2B20A 5FFMA 3COWA 3F5SA 2TMYA 3NOOA 3IQXA 5ECDA 3CVOA 1PQWA 4D02A 2HSGA 1RQGA 3HL0A 3U4HA 2JIPA 2CVHA 5D1NA 5B57C 3G7SA 5HZMA 3JYNA 3BIFA 3P9CA 2OLKA 1J09A 2FCRA 1K8ZB 2YVUA 3S99A 5E3HA 3TIIA 1LI7A 1X7YB 2NAPA 1AZSC 3L02A 4FINA 3RR2A 3HC7A 1WOYA 4HGYA 3H1AA 3IV6A 4CKWB 1SD2A 1EQUA 5ICGA 4DYHA 3VA7A 4D3ZA 1UPFA 1X74A 2GAOA 3ODGA 5AW0A 4I4TB 4ZVLA 1DBQA 2D00A 4MMYB 3UK0A 4BZZA 4LZLA 1RBQA 2ZQYA 4WIAA 1OFGA 2FMTA 2IS2A 2F3RA 1Q14A 1W88B 5EIOA 1M8GA 1V35A 2B7CA 4QYIA 3EIXA 4NMLA 5I4BA 3CJQA 4L6CA 4EMBA 2FEMA 3GFSA 1G60A 3FMVA 4AS1A 3GLSA 2A9JA 1UBCA 3KPJA 1T5SA 3ZE1B 4GDMA 5LQJA 1M3SA 5KOJA 2BTQA 2Y0CA 3DV2A 3I2JA 4MZDA 5D5HA 4OVKA 4X8HA 2AXNA 3U6BA 1VE7A 3UMGA 1KJNA 3BTVA 3QTBA 2QLLA 2B37A 4OAQA 4WN9B 2R84A 4B9EA 1AV6A 1N0UA 4QULA 3IIMA 3WQSB 3NRCA 5TSDA 4Q3OA 1U2RA 2IIVA 2XGOA 5AK0A 1TZBA 3LWNA 5F76A 2VYQA 3LP6A 2Z56A 3ONFA 5AI4A 5D86A 2EFJA 3LPNA 4NH4A 1GTJ1 4FFPA 4ZGGA 3BZUA 2N1BA 2PSFA 3AEKB 3ON5A 2BKVA 3L7MA 2B5WA 4N5IX 1FS6A 4I1VA 4A6DA 1HDEA 4EVRA 3MRTA 2B7BA 1J5EB 1UPUA 2OYSA 1WABA 3AQIA 4YAUA 4B35A 1QKJA 1Y1RA 2D2VA 4Y9UA 5ITWA 4B3MB 5IUNC 5KNCH 1OLUA 2CE7A 3AONB 5FTWA 1XQYA 4JOBA 4BLSA 4PO3X 3HYLA 2CNNA 3H9GA 3L4SO 5EI5A 1ZH4A 1XEXB 3CUTA 1JDUA 1YH3A 4CKBA 1SKAA 3SCZA 1MOPA 4PRKA 1ECJA 1OYWA 3TAUA 4QATA 3MLBA 1Q0QA 5KSOA 3HY4A 1EKXA 2IS4A 1U4SA 5CXQA 1YMVA 3C8UA 3CZRA 1O6ZA 2DPXA 3W4IA 5HKAA 1ZHOA 1N5RA 2CLMB 1W0KD 4GXNA 4E08A 4ZV4A 2A7QA 2QQFA 1SFRA 4IJWA 2A4MA 2I4LA 3MCZA 4CF3A 1IPHA 4HH1A 3PXUA 4BN4A 4BNLA 4UTPA 3LQFA 5GVSA 2EW2A 3G49A 4KI0A 5K01A 2ZIUB 1K88A 4B81A 4RLQA 1ADJA 1KMHB 1SUFA 1P4GA 1SR8A 2FSHA 3IIKA 1X7YA 2P69A 3U62A 4F3YA 3P7MA 4Q6WA 1P72A 5DNAA 2VUTA 2VA9A 3ZWPA 3O8NA 1CX9B 3LX8A 2OHOA 5TPZD 4N76A 1L3IA 2RFLA 3BRCA 3AXSA 3GPBA 3OUUA 4QSHA 2HWKA 4E5VA 2GXAA 1QJ4A 1SO8A 3SX2A 1CDOA 2JHFA 5A4DA 1INLA 1NE2A 3VTFA 1GDTA 2IEZA 4S3MA 3LSTA 3RTGA 5BMVF 1OB2A 3KELA 3UXMA 1NF8A 1J8VA 4TX1A 4NZYA 1T8YA 3GELA 3LCJA 4MQBA 1V5WA 3L46A 3G02A 4IIYA 2VTVA 1JSLA 1VHDA 2GN0A 1H8ED 2NNLD 4MITA 4NIMA 4E2XA 4MULA 3SQOA 2EW1A 3BXFA 3U37A 2NU9B 5BN4A 4UARA 4UASA 1ZSVA 3QLEA 3FX2A 5H3LA 4P33A 4CXMA 4L4YA 1M74A 2QTGA 3GRFA 3U1VA 4WSOA 2I29A 1LSSA 2F1KA 2XJ4A 1YIDA 2WIDA 4QYWA 1VYTA 3ESRA 2P2YA 3VVMA 3F4BA 4BLWA 1W0JA 1C3OB 1JLRA 1G0OA 1W34A 1WJGA 4OJYA 4TQGA 2PQ0A 2HDWA 4IDFA 4KEAA 1YU9A 3ZN2A 1U3WA 2DEUA 3AOEC 1RLTA 1YIOA 2P9CA 2R8ZA 3LMKA 3AIOA 4M6WA 5CVCA 3GK3A 1VJ1A 5SYAA 3TW4A 4AWAA 3NHLA 1M8KA 4TTAA 5B1SA 1PLKA 3B8EA 3S40A 2HYIC 2P2DA 2NSLA 4P98A 5A0VA 2ONYA 4Q6BA 1AGPA 1WMBA 3F5MA 4RFLA 2XTMA 2Q5IA 3WP1B 5KJ6A 3CKMA 1EM6A 3QX8A 3MCVA 5L3QA 1QGDA 1R4MB 2P4SA 3ANYB 4Q19A 1QH0A 3PC6A 4O6VA 4EW3A 1CIVA 5KEIA 5FBWB 1FP4B 1NJ2A 4QDKA 5ECWA 4EFNA 2O2CA 3KFLA 3F8WA 3PHBE 3D7NA 1EUZA 4YI5A 2ZWVA 3C3WA 1HC7A 2C3YA 2FPKA 2FX5A 2QR5A 4K6OA 4KPUA 4PTZA 4EPVA 1NGSA 1ZS9A 1QYRA 1Y1KE 1JG6A 3EIUA 3OLXA 1U5CA 4L8FA 3S7TA 5FR2A 2GJAA 2V03A 2XZPA 3AOGA 3OCCA 4M0KA 5CIYA 2JBWA 2FN3A 4S2EA 4A2WA 4WXYB 7MHTA 3RS3A 3GWGA 4G41A 4EUKA 2OUKA 2B0CA 1PLLA 5C31A 1GPJA 2ZBRA 1EK1A 2WHXA 4MK4A 2JL1A 5TARA 3ZHVA 5E3IA 2OV6A 2QB5A 1L5YA 1KIAA 1MFPA 4PSAA 5D85A 1OH8A 3H1EA 3NKVA 4P4SB 1MJGA 4KLRA 1P44A 4ZP1A 3I4LA 3NRBA 1YS6A 2JLWA 2YASA 2FR8A 3ZTTA 4R8SA 5COBA 2QVCA 3UJ8A 2H9AA 1RYHA 2HSEA 3JU3A 4AL4A 2ZI7A 4KJZA 1EM8B 4AMVA 3VR3A 2HPHA 3NP7A 4QQKA 1D0IA 2W2KB 3CLHA 3FYTA 2GF9A 2VDOB 2N46A 3B89A 1H93A 3O0TA 5ALSA 1AUXA 3UCFA 2COKA 2VXBA 1KXZA 3PDUA 1LLFA 5AW2A 4UVGA 1I30A 3PNSA 3HR7A 3FE2A 3WL6A 4EJ6A 1X87A 3I45A 4RJJA 1TM3E 4Q3DA 4RCVA 2V9PA 3TECE 4GYWA 3OHPA 4PC6A 4XD7D 3VYWA 4MUMA 5BR4A 4Z7OB 4JLBA 4LK3A 1B76A 5AHKA 1WMDA 4AKSA 4DQKA 4A73A 3K9CA 4R2MA 1BX3A 3FRHA 1M1XB 1L7QA 1OTHA 1QRDA 1TLFA 2CVOA 4MKIA 1Z0FA 4RH0A 4PGAA 1BQ4A 4HSGA 5JJKA 1S2LA 3GJ3A 2WWFA 4HEA1 1ZNXA 5JDCC 2IK8A 2PUDA 1A9QA 5UKDA 1JJIA 2HRZA 1K92A 4Y7DA 3VGPA 4GOND 3GFTA 2X42A 3PT9A 2WUVA 3RWBA 1ETUA 2RHCA 2WMOB 1G5QA 2LKDA 4DR5B 3ENNA 2HK7A 3F67A 2E37A 3SZLA 3VSAA 1U80A 2UZ3A 3TMKA 1T8WA 2PCLA 1MC1A 1NASA 1Z2PX 3PIDA 4PFKA 4WOKA 4UNNA 4B73A 1H2EA 1BN7A 2B4AA 3FF4A 4G81A 4D5GA 3F8SA 3QF4A 1V43A 2PU7A 2PYDA 4CW7A 3AFMA 3RLFA 1B3BA 1OWLA 1ZA1A 1UDXA 4KHZA 4N3GA 3SJZA 5CX4A 2XAUA 4DM4A 4N5NA 3CVJA 4BASA 2D6FA 2O8EA 2FW9A 2XH8A 2EP7A 2OXRA 2QL7A 4X64B 4C0JA 3EHEA 2QZSA 3P9RA 2XI4A 1SXPA 2X7XA 1YKGA 1UR5A 1JIVA 2XB6A 2ZRNA 2CL5A 1AS2A 2ANBA 3TTUA 2V9ZA 3WGMA 2PZGA 3JAMA 3RVNA 2H5IA 3U3JA 4C3OB 4TM7A 2VDWB 1ZMBA 3B70A 2XNCA 3WO1A 2VJLA 3CRVA 1XJQA 2QPTA 1RXCA 2B83A 3C7AA 4QFMA 5FBHA 2V5UA 2OXTA 4Z1MD 4HNRA 4YTEA 5IP5A 2I7XA 3GGGA 5E4YA 4A5OA 1O2DA 1XZEA 4J3JA 4YRKA 3CE9A 1PT7A 4LZAA 5ALWA 3A36A 5I47A 3O03A 1O95C 3ZBPA 1L4FA 2ZBUA 4AJLA 5ICMA 3FWYA 4U5XA 3HXKA 4D45A 4BQEA 1VLVA 1H2BA 3RK0A 5SZJA 1M67A 2JFVA 3HDHA 3WGLA 4E5PA 1QHIA 3VBCA 1UJ2A 4AU1A 1H1TA 2FTKE 1KOFA 1OA1A 3L43A 5C5IA 5CA1B 2FUG6 4KI7A 4H7IA 1VLZA 2JFYA 3JALA 4X1IB 1DJQA 2FG5A 4X66B 3TVDA 4MW6A 1EU1A 1ZLXA 1CRWG 3ZJTA 1RJGA 4MW2A 4BV8A 1KJIA 3K0CA 5BYBA 3AL3A 2VCEA 1OLXA 4PCAA 4LDJA 1DOAA 2W6IA 3RYFB 2WU0A 1YJ5A 3EMBA 3GJ4A 4ON9A 5FI0B 1GA4A 1PZEA 3H4MA 1YUMA 3R8XA 3SSNA 2QYHA 4G5FA 1XTTA 4D0LB 2P4QA 4F9EA 2OGSA 2ZTSA 3NTXA 4L9AA 4R81A 1SVKA 4QDTA 3NEJA 2O07A 4G5SA 2OHFA 3L1UA 4I55F 1QP8A 3DD1A 1ZC3A 1XZLA 1TUBA 3VSBA 4YLGA 2Y0BA 3VC7A 4E31A 2OBFA 3RF7A 1F0PA 1N75A 5A5FA 3KXIA 4LEIA 5C34B 4FU0A 4CMIB 1ML4A 4BMOB 4Z5XA 3L4JA 1GKIA 1YJXA 4OHWA 4QU9A 4H1HA 4YJGB 4J0QA 1AN9A 4AZSA 4A15A 1EXMA 5IM4A 4LK2A 2FZGA 4N7MA 3RK1A 4NNJA 3GNTA 2VYCA 2XTZA 4AAYA 2IUSA 3MBIA 4H4CA 4RESA 1NXQA 2JDID 2OZEA 5FTKA 2OA0A 2HMWA 4CLOA 4A0RA 4D25A 1DV1A 2BHSA 1T26A 2IFTA 2OGWA 2XUDA 4KIGA 5CDGA 3GJ8A 1I1HA 1KC1A 1ENZA 4ERXA 1ZSYA 1KWKA 1Z5WA 6Q21A 2FQ1A 4FDAA 4IDNA 5DW3A 3W6OA 3ITNA 3U3OA 2CUNA 1CJBA 2WFAA 4X63A 1JAXA 2CY0A 4BBAA 5BV1A 1IQ0A 3KXPA 1Y34E 2R5NA 4QEZA 1C7EA 1JZTA 1ZK3A 5DO9A 5BWOA 4REOA 5KBYA 2C7RA 2M6RA 4K81B 4CIAA 5IT0A 3SG0A 3KPYA 4WZBE