5DITA

The fk1 domain of fkbp51 in complex with the new synthetic ligand (1r)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2s)-1-[(2s,3r)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ditA00
3EY6A 3KAGA 4MSPA 2PPPA 3O5IA 1F8AB 1FKLA 2DG4A 2LJ4A 2JZVA 4R0XA 4DZ3A 1FKHA 1JNSA 3PRDA 3CGNA 2Q5AA 1JVWA 1F40A 1QZ2A 5DIVA 2XP9A 1D7JA 4GGQA 3IKGA 2UZ5A 4TW8A 3O5LA 4LAXA 4MGVA 2RUCA 4ODOA 3LUOA 4ODKA 2FKEA 2K8IA 1FKDA 4DRKA 4ODMA 4JYSA 4LAWA 2PV3A 1C9HA 1JNTA 1QPLA 2XPAA 3VAWA 1FD9A 5HWCA 3FAPA 5GPGA 4W9QA 1U79A 4QT3A 2MLZA 1BKFA 2KE0A 4DRNA 4DT4A 2RUDA 1PINA 4IPXA 1FKTA 3O5RA 3NI6A 4NNRA 2XP4A 3H9RB 3ODKA 3RGCA 4DRHA 1J4RA 3OOBA 4QT2A 2Y78A 3O5EA 4JFMA 4DRJA 5DITA 1P5QA 5HW7A 4ODPA 1Y0OA 4U86A 1D7HA 1FKGA 1Q6HA 2MNTA 3O5GA 3IHZA 2RQSA 3I6CA 1NMVA 2RUQA 4ITZA 3JYJA 4ODLA 5HKGA 4TW6A 4ODNA 2ZR5A 2RURA 1Q1CA 4DRPA 2PBCA 3UI6A 1YW5A 4JFJA 2FAPA 3O5PA 2PV2A 3NTPA 2KGJA 3MDYB 1B6CA 1KT1A 4U84A 4BF8A 5DIUA 1NMWA 1TCOC 3CGMA 4DH0A 4LAVA 3UF8A 5I98A 2ZQUA 1D7IA 2M08A 2XP3A 2D9FA 2F2DA 4TX0A 4U85A 5D75A 1T11A 3WH0A 1J4HA 2KR7A 3KCEA 3O5OA 5BXJA 5J6EA 3KACA 1FKKA 4JFKA 4QIBA 4DROA 2KI3A 4GIVA 3UI5A 1D6OA 2LPVA 4ODRA 1ZCNA 4JFLA 4TW7A 1FKRA 3IKDA 3KAFA 3O5MA 2XP7A 1PBKA 1ZK6A 2XP5A 2N87A 5HTGA 3O5KA 2ZR4A 1BL4A 3O5DA 4G50A 5B8IC 1L1PA 1FKSA 2LKNA 4IQ2A 3TCZA 3TDBA 2F21A 5HW6A 3B7XA 2DG9A 2M1IA 4W9OA 2ITKA 4N19A 2IF4A 2MF9A 2KFWA 4J4OA 2ZQTA 1Q6UA 5HWBA 3NRKA 5HT1A 4IQCA 5HUAA 3PRBA 1R9HA 3PA7A 2XPBA 4TYOA 1Q6IA 1FKIA 1ROTA 3KABA 3UQBA 2KO7A 2XP6A 3KAIA 4JFIA 1FJDA 1EYMA 2MLXA 3KAHA 1FKBA 2VCDA 4G2PA 3JYMA 4LAYA 3O5FA 4DIPA 4DZ2A 3GPKA 3UQAA 4W9PA 1FAPA 3UI4A 2F4EA 1FKFA 2PPNA 2ZQVA 3O5JA 4FN2A 4TNSA 3UQIA 4DRIA 3IK8A 4FAPA 2M2AA 3TC5A 2OFNA 1FKJA 2RSEA 1NSGA 4J4NA 1J4IA 1M5YA 2AWGA 2LGOA 4C02B 3JXVA 1J6YA 2MPHA 2PV1A 3KADA 4DRQA 1EQ3A 2PPOA 1QPFA 2ZR6A 1KT0A 1YATA 2L2SA 2XP8A 1ROUA 3KZ7A 5HW8A 4ODQA 1HXVA 2DG3A 3O5QA 3RFWA 2MLYA 2VN1A 2ZQSA 1A7XA 4O2TA 4DRMA 1N1AA 1W26A
chains in the Genus database with same CATH superfamily
3EY6A 4MTVA 3CGNA 2Q5AA 1JVWA 1QZ2A 1W9PA 5DO2A 2O9OA 4GGQA 2DSZA 4LAXA 4MGVA 2PN0A 3AS2A 4ODKA 1FKDA 2K8IA 4ODMA 3RM8A 2PV3A 1C9HA 2XPAA 3VAWA 5HWCA 1KFWA 1VF8A 2MLZA 1BKFA 3W4RA 2RUDA 1PINA 4IPXA 1FKTA 3O5RA 1LJYA 1H0GA 1RD6A 3RGCA 1E6ZA 4JFMA 5DITA 5HW7A 4ODPA 4MPKA 3I6CA 3ARPA 2RURA 3ARUA 3UI6A 4JFJA 4Q22A 3B9AA 1WNOA 4HBEA 3ARRA 1KT1A 4Z2IA 5DIUA 1TCOC 1W9UA 2YBUA 3UF8A 5I98A 2ZQUA 1LL7A 1D7IA 2M08A 2XP3A 4TX0A 4Z2LA 3ARZA 3ALGA 5DF0A 5BXJA 3KACA 3AS1A 4UDMA 2AOSA 3KAFA 1PBKA 1ZK6A 2XP5A 2N87A 4DWSD 3O5KA 4G50A 3FXYA 3TDBA 4L72B 2G8ZA 2KFWA 1ZBWA 5HUAA 1X6NA 3PA7A 1GPFA 3UQBA 1CTNA 4LAYA 4DZ2A 3UQAA 1ITXA 1FAPA 2F4EA 1FKFA 2PPNA 3O5JA 1E6PA 4FN2A 4TNSA 4AY1A 4WIWA 1NWSA 2RSEA 1J4IA 3WQWA 1GUVA 3KADA 1EQ3A 1K9TA 2PPOA 1QPFA 1O6IA 2B31A 2L2SA 4ODQA 3RFWA 4HARA 4WKFA 3CHFA 1JNDA 2B5UB 1EYMA 3KAGA 4WJXA 4KR0B 4ZPWR 1IX5A 1FKLA 2ESCA 3ALFA 2DPEA 2WM0A 1F40A 2XP9A 3IKGA 1W1TA 5HBFA 3O5LA 4ODOA 3WD1A 4DRKA 2DSVA 2DSWA 4LAWA 1QPLA 5GQBA 1FD9A 3FAPA 5GPGA 4W9QA 1JNEA 4HBOA 1W1YA 1WAWA 3PRAA 4DRNA 3NI6A 3WD2A 4NNRA 1HKMA 2WLZA 3CHDA 3O5EA 3ARTA 1P5QA 4NSBA 1FKGA 1E44A 3IHZA 2RQSA 5HKGA 1LL4A 3JYJA 4ODLA 4ODNA 5DEZA 3CZ8A 2PV2A 4ZPTR 2YBTA 3MDYB 1B6CA 4U84A 4BF8A 1D2KA 1NMWA 4DH0A 2D9FA 4U85A 4Z2JA 1T11A 3O5OA 4QIBA 1FKKA 4JFKA 3UI5A 2A3AA 1ZCNA 4JFLA 5GPRA 4LGXA 5B8IC 1L1PA 1FKSA 4IQ2A 2A3BA 3TCZA 4W9OA 1ZBVA 4N19A 2IF4A 4P8XA 4J4OA 2ZQTA 4IT4A 5HT1A 4IQCA 4S3KA 3ARSA 4P8VA 4L3NA 1Q6IA 1ROTA 3KAIA 2XP6A 3CH9A 4JFIA 1FJDA 1FKBA 2VCDA 3BXWA 3BMBA 3O5FA 3QOKA 3GPKA 2O92A 4DRIA 2M2AA 1NWRA 1FKJA 1HKIA 4ZPVR 1M5YA 2AWGA 1EHNA 2MPHA 4DRQA 1FFQA 4R5EA 2ZR6A 3B9DA 1KT0A 1ROUA 3KZ7A 2DG3A 1SR0A 2VN1A 1A7XA 4MNJA 2MNTA 1TFVA 1W26A 4MSPA 3O5IA 4MNKA 1F8AB 4DZ3A 2LJ4A 4P8WA 1LL6A 5DIVA 4Z2GA 1EIBA 1E6NA 2RUCA 2FKEA 3GU0A 4JYSA 3GTYX 1NH6A 2IUZA 2KE0A 1W1PA 2XP4A 3H9RB 1GRJA 4DRHA 1J4RA 4WKHA 2A3EA 2Y78A 1LG2A 4PTMA 3CHCA 4ITZA 2P4VA 1ZBCA 4TW6A 1HKKA 2ZR5A 3G6LA 1OWQA 2FAPA 3ARXA 1XHGA 2KGJA 3ARYA 3CGMA 1LG1A 2DT2A 1UR8A 3WH0A 1J4HA 5J6EA 3KCEA 3OA5A 2PI6A 5JH8A 2KI3A 1ZL1A 4TW7A 2LPVA 4KQZA 1FKRA 3IKDA 3O5MA 4MNLA 5HTGA 3O5DA 3WIJA 3EIPA 2LKNA 4W5UA 1SYTA 5HW6A 1W1VA 2DG9A 2WK2A 3WD0A 1Q6UA 5HWBA 1HJXA 2A3CA 4DWSB 2XPBA 1WB0A 4MNMA 1FKIA 3KABA 4MAVA 1ZU8A 2KO7A 4IT6A 1HKJA 1HJVA 3KAHA 1ZB5A 1NWUA 4DWSA 3UI4A 3UQIA 3IK8A 2OFNA 4J4NA 4S3JA 1E6RA 4P8UA 1J6YA 2EULA 3AQUA 3AS0A 3AROA 1YATA 3O5QA 3RM4A 4QZVB 1N1AA 2PPPA 2DG4A 2JZVA 4R0XA 4URIA 1FKHA 1JNSA 3PRDA 1X6LA 3WD3A 1D7JA 3FY1A 4XAKA 2UZ5A 1E15A 4TW8A 3WD4A 1JNTA 1U79A 4QT3A 4DT4A 4ML4A 3CHEA 3ODKA 3OOBA 4QT2A 4DRJA 3B8SA 4Q7NA 3ARQA 1Y0OA 4U86A 1D7HA 4WK9A 1Q6HA 1E9LA 3O5GA 1NMVA 2RUQA 3WL0A 3RMEA 3ARVA 4ZS6A 1Q1CA 4DRPA 2PBCA 3WKZA 1YW5A 2DT1A 4WKAA 2ETNA 3O5PA 2G41A 1JCHB 3NTPA 2FDMA 2OLHA 4LAVA 2F23A 4DWSC 3G6MA 2F2DA 2DT0A 5D75A 2KR7A 1OGBA 1ZBKA 4GIVA 4DROA 2DT3A 1D6OA 1FFRA 4ODRA 1LQ0A 2XP7A 2WLYA 2ZR4A 1BL4A 2F21A 2QF8A 3B7XA 1UR9A 2M1IA 2ITKA 1EDQA 1HJWA 2MF9A 4Z2KA 3NRKA 3PRBA 3WL1A 1R9HA 4TYOA 3AS3A 3ARWA 2DSUA 2MLXA 4G2PA 3JYMA 4NZCA 1W9VA 4DIPA 4W9PA 2ZQVA 1NWTA 4FAPA 3TC5A 1NSGA 2LGOA 4C02B 3JXVA 2PV1A 3B9EA 1H0IA 1OGGA 2XP8A 3RM9A 1XRVA 5HW8A 3WQVA 1HXVA 2MLYA 4Z2HA 1GOIA 2ZQSA 3PR9A 4O2TA 4DRMA 3LUOA
chains in the Genus database with same CATH topology
3EY6A 4MTVA 3CGNA 2Q5AA 1JVWA 1QZ2A 1W9PA 5DO2A 2O9OA 4GGQA 2DSZA 4LAXA 4MGVA 3AS2A 4ODKA 1FKDA 2K8IA 4ODMA 3RM8A 2PV3A 1C9HA 2XPAA 3VAWA 5HWCA 1KFWA 1VF8A 2MLZA 1BKFA 3W4RA 2RUDA 1PINA 4IPXA 1FKTA 3O5RA 1LJYA 1H0GA 1RD6A 3RGCA 1E6ZA 4JFMA 5DITA 5HW7A 4ODPA 4MPKA 3I6CA 3ARPA 2RURA 3ARUA 3UI6A 4JFJA 4Q22A 3B9AA 1WNOA 4HBEA 3ARRA 1KT1A 4Z2IA 5DIUA 1TCOC 1W9UA 2YBUA 3UF8A 5I98A 2ZQUA 1LL7A 1D7IA 2M08A 2XP3A 4TX0A 4Z2LA 3ARZA 3ALGA 5DF0A 5BXJA 3KACA 3AS1A 2AOSA 3KAFA 1PBKA 1ZK6A 2XP5A 2N87A 4DWSD 3O5KA 4G50A 3FXYA 3TDBA 4L72B 2G8ZA 2KFWA 1ZBWA 5HUAA 1X6NA 3PA7A 1GPFA 3UQBA 1CTNA 4LAYA 4DZ2A 3UQAA 1ITXA 1FAPA 2F4EA 1FKFA 2PPNA 3O5JA 1E6PA 4FN2A 4TNSA 4AY1A 4WIWA 1NWSA 2RSEA 1J4IA 3WQWA 1GUVA 3KADA 1EQ3A 1K9TA 2PPOA 1QPFA 1O6IA 2B31A 2L2SA 4ODQA 3RFWA 4HARA 4WKFA 3CHFA 1JNDA 1EYMA 3KAGA 4WJXA 4KR0B 4ZPWR 1IX5A 1FKLA 2ESCA 3ALFA 2DPEA 2WM0A 1F40A 2XP9A 3IKGA 1W1TA 5HBFA 3O5LA 4ODOA 3WD1A 4DRKA 2DSVA 2DSWA 4LAWA 1QPLA 5GQBA 1FD9A 3FAPA 5GPGA 4W9QA 1JNEA 4HBOA 1W1YA 1WAWA 3PRAA 4DRNA 3NI6A 3WD2A 4NNRA 1HKMA 2WLZA 3CHDA 3O5EA 3ARTA 1P5QA 4NSBA 1FKGA 3IHZA 2RQSA 5HKGA 1LL4A 3JYJA 4ODLA 4ODNA 5DEZA 3CZ8A 2PV2A 4ZPTR 2YBTA 3MDYB 1B6CA 4U84A 4BF8A 1D2KA 1NMWA 4DH0A 2D9FA 4U85A 4Z2JA 1T11A 3O5OA 4QIBA 1FKKA 4JFKA 3UI5A 2A3AA 1ZCNA 4JFLA 5GPRA 4LGXA 5B8IC 1L1PA 1FKSA 4IQ2A 2A3BA 3TCZA 4W9OA 1ZBVA 4N19A 2IF4A 4P8XA 4J4OA 2ZQTA 4IT4A 5HT1A 4IQCA 4S3KA 3ARSA 4P8VA 4L3NA 1Q6IA 1ROTA 3KAIA 2XP6A 3CH9A 4JFIA 1FJDA 1FKBA 2VCDA 3BXWA 3O5FA 3QOKA 3GPKA 2O92A 4DRIA 2M2AA 1NWRA 1FKJA 1HKIA 4ZPVR 1M5YA 2AWGA 1EHNA 2MPHA 4DRQA 1FFQA 4R5EA 2ZR6A 3B9DA 1KT0A 1ROUA 3KZ7A 2DG3A 1SR0A 2VN1A 1A7XA 4MNJA 2MNTA 1TFVA 1W26A 4MSPA 3O5IA 4MNKA 1F8AB 4DZ3A 2LJ4A 4P8WA 1LL6A 5DIVA 4Z2GA 1EIBA 1E6NA 2RUCA 2FKEA 4JYSA 1NH6A 2IUZA 2KE0A 1W1PA 2XP4A 3H9RB 4DRHA 1J4RA 4WKHA 2A3EA 2Y78A 1LG2A 4PTMA 3CHCA 4ITZA 1ZBCA 4TW6A 1HKKA 2ZR5A 3G6LA 1OWQA 2FAPA 3ARXA 1XHGA 2KGJA 3ARYA 3CGMA 1LG1A 2DT2A 1UR8A 3WH0A 1J4HA 5J6EA 3KCEA 3OA5A 2PI6A 5JH8A 2KI3A 1ZL1A 4TW7A 2LPVA 4KQZA 1FKRA 3IKDA 3O5MA 4MNLA 5HTGA 3O5DA 3WIJA 2LKNA 4W5UA 1SYTA 5HW6A 1W1VA 2DG9A 2WK2A 3WD0A 1Q6UA 5HWBA 1HJXA 2A3CA 4DWSB 2XPBA 1WB0A 4MNMA 1FKIA 3KABA 4MAVA 1ZU8A 2KO7A 4IT6A 1HKJA 1HJVA 3KAHA 1ZB5A 1NWUA 4DWSA 3UI4A 3UQIA 3IK8A 2OFNA 4J4NA 4S3JA 1E6RA 4P8UA 1J6YA 3AQUA 3AS0A 3AROA 1YATA 3O5QA 3RM4A 4QZVB 1N1AA 2PPPA 2DG4A 2JZVA 4R0XA 4URIA 1FKHA 1JNSA 3PRDA 1X6LA 3WD3A 1D7JA 3FY1A 4XAKA 2UZ5A 1E15A 4TW8A 3WD4A 1JNTA 1U79A 4QT3A 4DT4A 4ML4A 3CHEA 3ODKA 3OOBA 4QT2A 4DRJA 3B8SA 4Q7NA 3ARQA 1Y0OA 4U86A 1D7HA 4WK9A 1Q6HA 1E9LA 3O5GA 1NMVA 2RUQA 3WL0A 3RMEA 3ARVA 4ZS6A 1Q1CA 4DRPA 2PBCA 3WKZA 1YW5A 2DT1A 4WKAA 3O5PA 2G41A 3NTPA 2FDMA 2OLHA 4LAVA 4DWSC 3G6MA 2F2DA 2DT0A 5D75A 2KR7A 1OGBA 1ZBKA 4GIVA 4DROA 2DT3A 1D6OA 1FFRA 4ODRA 1LQ0A 2XP7A 2WLYA 2ZR4A 1BL4A 2F21A 2QF8A 3B7XA 1UR9A 2M1IA 2ITKA 1EDQA 1HJWA 2MF9A 4Z2KA 3NRKA 3PRBA 3WL1A 1R9HA 4TYOA 3AS3A 3ARWA 2DSUA 2MLXA 4G2PA 3JYMA 4NZCA 1W9VA 4DIPA 4W9PA 2ZQVA 1NWTA 4FAPA 3TC5A 1NSGA 2LGOA 4C02B 3JXVA 2PV1A 3B9EA 1H0IA 1OGGA 2XP8A 3RM9A 1XRVA 5HW8A 3WQVA 1HXVA 2MLYA 4Z2HA 1GOIA 2ZQSA 3PR9A 4O2TA 4DRMA 3LUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY6 A;  3KAG A;  4MSP A;  2PPP A;  3O5I A;  1F8A B;  1FKL A;  2DG4 A;  2LJ4 A;  2JZV A;  4R0X A;  4DZ3 A;  1FKH A;  1JNS A;  3PRD A;  3CGN A;  2Q5A A;  1JVW A;  1F40 A;  1QZ2 A;  5DIV A;  2XP9 A;  1D7J A;  4GGQ A;  3IKG A;  2UZ5 A;  4TW8 A;  3O5L A;  4LAX A;  4MGV A;  2RUC A;  4ODO A;  3LUO A;  4ODK A;  2FKE A;  2K8I A;  1FKD A;  4DRK A;  4ODM A;  4JYS A;  4LAW A;  2PV3 A;  1C9H A;  1JNT A;  1QPL A;  2XPA A;  3VAW A;  1FD9 A;  5HWC A;  3FAP A;  5GPG A;  4W9Q A;  1U79 A;  4QT3 A;  2MLZ A;  1BKF A;  2KE0 A;  4DRN A;  4DT4 A;  2RUD A;  1PIN A;  4IPX A;  1FKT A;  3O5R A;  3NI6 A;  4NNR A;  2XP4 A;  3H9R B;  3ODK A;  3RGC A;  4DRH A;  1J4R A;  3OOB A;  4QT2 A;  2Y78 A;  3O5E A;  4JFM A;  4DRJ A;  5DIT A;  1P5Q A;  5HW7 A;  4ODP A;  1Y0O A;  4U86 A;  1D7H A;  1FKG A;  1Q6H A;  2MNT A;  3O5G A;  3IHZ A;  2RQS A;  3I6C A;  1NMV A;  2RUQ A;  4ITZ A;  3JYJ A;  4ODL A;  5HKG A;  4TW6 A;  4ODN A;  2ZR5 A;  2RUR A;  1Q1C A;  4DRP A;  2PBC A;  3UI6 A;  1YW5 A;  4JFJ A;  2FAP A;  3O5P A;  2PV2 A;  3NTP A;  2KGJ A;  3MDY B;  1B6C A;  1KT1 A;  4U84 A;  4BF8 A;  5DIU A;  1NMW A;  1TCO C;  3CGM A;  4DH0 A;  4LAV A;  3UF8 A;  5I98 A;  2ZQU A;  1D7I A;  2M08 A;  2XP3 A;  2D9F A;  2F2D A;  4TX0 A;  4U85 A;  5D75 A;  1T11 A;  3WH0 A;  1J4H A;  2KR7 A;  3KCE A;  3O5O A;  5BXJ A;  5J6E A;  3KAC A;  1FKK A;  4JFK A;  4QIB A;  4DRO A;  2KI3 A;  4GIV A;  3UI5 A;  1D6O A;  2LPV A;  4ODR A;  1ZCN A;  4JFL A;  4TW7 A;  1FKR A;  3IKD A;  3KAF A;  3O5M A;  2XP7 A;  1PBK A;  1ZK6 A;  2XP5 A;  2N87 A;  5HTG A;  3O5K A;  2ZR4 A;  1BL4 A;  3O5D A;  4G50 A;  5B8I C;  1L1P A;  1FKS A;  2LKN A;  4IQ2 A;  3TCZ A;  3TDB A;  2F21 A;  5HW6 A;  3B7X A;  2DG9 A;  2M1I A;  4W9O A;  2ITK A;  4N19 A;  2IF4 A;  2MF9 A;  2KFW A;  4J4O A;  2ZQT A;  1Q6U A;  5HWB A;  3NRK A;  5HT1 A;  4IQC A;  5HUA A;  3PRB A;  1R9H A;  3PA7 A;  2XPB A;  4TYO A;  1Q6I A;  1FKI A;  1ROT A;  3KAB A;  3UQB A;  2KO7 A;  2XP6 A;  3KAI A;  4JFI A;  1FJD A;  1EYM A;  2MLX A;  3KAH A;  1FKB A;  2VCD A;  4G2P A;  3JYM A;  4LAY A;  3O5F A;  4DIP A;  4DZ2 A;  3GPK A;  3UQA A;  4W9P A;  1FAP A;  3UI4 A;  2F4E A;  1FKF A;  2PPN A;  2ZQV A;  3O5J A;  4FN2 A;  4TNS A;  3UQI A;  4DRI A;  3IK8 A;  4FAP A;  2M2A A;  3TC5 A;  2OFN A;  1FKJ A;  2RSE A;  1NSG A;  4J4N A;  1J4I A;  1M5Y A;  2AWG A;  2LGO A;  4C02 B;  3JXV A;  1J6Y A;  2MPH A;  2PV1 A;  3KAD A;  4DRQ A;  1EQ3 A;  2PPO A;  1QPF A;  2ZR6 A;  1KT0 A;  1YAT A;  2L2S A;  2XP8 A;  1ROU A;  3KZ7 A;  5HW8 A;  4ODQ A;  1HXV A;  2DG3 A;  3O5Q A;  3RFW A;  2MLY A;  2VN1 A;  2ZQS A;  1A7X A;  4O2T A;  4DRM A;  1N1A A;  1W26 A; 
#chains in the Genus database with same CATH topology
 3EY6 A;  4MTV A;  3CGN A;  2Q5A A;  1JVW A;  1QZ2 A;  1W9P A;  5DO2 A;  2O9O A;  4GGQ A;  2DSZ A;  4LAX A;  4MGV A;  2PN0 A;  3AS2 A;  4ODK A;  1FKD A;  2K8I A;  4ODM A;  3RM8 A;  2PV3 A;  1C9H A;  2XPA A;  3VAW A;  5HWC A;  1KFW A;  1VF8 A;  2MLZ A;  1BKF A;  3W4R A;  2RUD A;  1PIN A;  4IPX A;  1FKT A;  3O5R A;  1LJY A;  1H0G A;  1RD6 A;  3RGC A;  1E6Z A;  4JFM A;  5DIT A;  5HW7 A;  4ODP A;  4MPK A;  3I6C A;  3ARP A;  2RUR A;  3ARU A;  3UI6 A;  4JFJ A;  4Q22 A;  3B9A A;  1WNO A;  4HBE A;  3ARR A;  1KT1 A;  4Z2I A;  5DIU A;  1TCO C;  1W9U A;  2YBU A;  3UF8 A;  5I98 A;  2ZQU A;  1LL7 A;  1D7I A;  2M08 A;  2XP3 A;  4TX0 A;  4Z2L A;  3ARZ A;  3ALG A;  5DF0 A;  5BXJ A;  3KAC A;  3AS1 A;  4UDM A;  2AOS A;  3KAF A;  1PBK A;  1ZK6 A;  2XP5 A;  2N87 A;  4DWS D;  3O5K A;  4G50 A;  3FXY A;  3TDB A;  4L72 B;  2G8Z A;  2KFW A;  1ZBW A;  5HUA A;  1X6N A;  3PA7 A;  1GPF A;  3UQB A;  1CTN A;  4LAY A;  4DZ2 A;  3UQA A;  1ITX A;  1FAP A;  2F4E A;  1FKF A;  2PPN A;  3O5J A;  1E6P A;  4FN2 A;  4TNS A;  4AY1 A;  4WIW A;  1NWS A;  2RSE A;  1J4I A;  3WQW A;  1GUV A;  3KAD A;  1EQ3 A;  1K9T A;  2PPO A;  1QPF A;  1O6I A;  2B31 A;  2L2S A;  4ODQ A;  3RFW A;  4HAR A;  4WKF A;  3CHF A;  1JND A;  2B5U B;  1EYM A;  3KAG A;  4WJX A;  4KR0 B;  4ZPW R;  1IX5 A;  1FKL A;  2ESC A;  3ALF A;  2DPE A;  2WM0 A;  1F40 A;  2XP9 A;  3IKG A;  1W1T A;  5HBF A;  3O5L A;  4ODO A;  3WD1 A;  4DRK A;  2DSV A;  2DSW A;  4LAW A;  1QPL A;  5GQB A;  1FD9 A;  3FAP A;  5GPG A;  4W9Q A;  1JNE A;  4HBO A;  1W1Y A;  1WAW A;  3PRA A;  4DRN A;  3NI6 A;  3WD2 A;  4NNR A;  1HKM A;  2WLZ A;  3CHD A;  3O5E A;  3ART A;  1P5Q A;  4NSB A;  1FKG A;  1E44 A;  3IHZ A;  2RQS A;  5HKG A;  1LL4 A;  3JYJ A;  4ODL A;  4ODN A;  5DEZ A;  3CZ8 A;  2PV2 A;  4ZPT R;  2YBT A;  3MDY B;  1B6C A;  4U84 A;  4BF8 A;  1D2K A;  1NMW A;  4DH0 A;  2D9F A;  4U85 A;  4Z2J A;  1T11 A;  3O5O A;  4QIB A;  1FKK A;  4JFK A;  3UI5 A;  2A3A A;  1ZCN A;  4JFL A;  5GPR A;  4LGX A;  5B8I C;  1L1P A;  1FKS A;  4IQ2 A;  2A3B A;  3TCZ A;  4W9O A;  1ZBV A;  4N19 A;  2IF4 A;  4P8X A;  4J4O A;  2ZQT A;  4IT4 A;  5HT1 A;  4IQC A;  4S3K A;  3ARS A;  4P8V A;  4L3N A;  1Q6I A;  1ROT A;  3KAI A;  2XP6 A;  3CH9 A;  4JFI A;  1FJD A;  1FKB A;  2VCD A;  3BXW A;  3BMB A;  3O5F A;  3QOK A;  3GPK A;  2O92 A;  4DRI A;  2M2A A;  1NWR A;  1FKJ A;  1HKI A;  4ZPV R;  1M5Y A;  2AWG A;  1EHN A;  2MPH A;  4DRQ A;  1FFQ A;  4R5E A;  2ZR6 A;  3B9D A;  1KT0 A;  1ROU A;  3KZ7 A;  2DG3 A;  1SR0 A;  2VN1 A;  1A7X A;  4MNJ A;  2MNT A;  1TFV A;  1W26 A;  4MSP A;  3O5I A;  4MNK A;  1F8A B;  4DZ3 A;  2LJ4 A;  4P8W A;  1LL6 A;  5DIV A;  4Z2G A;  1EIB A;  1E6N A;  2RUC A;  2FKE A;  3GU0 A;  4JYS A;  3GTY X;  1NH6 A;  2IUZ A;  2KE0 A;  1W1P A;  2XP4 A;  3H9R B;  1GRJ A;  4DRH A;  1J4R A;  4WKH A;  2A3E A;  2Y78 A;  1LG2 A;  4PTM A;  3CHC A;  4ITZ A;  2P4V A;  1ZBC A;  4TW6 A;  1HKK A;  2ZR5 A;  3G6L A;  1OWQ A;  2FAP A;  3ARX A;  1XHG A;  2KGJ A;  3ARY A;  3CGM A;  1LG1 A;  2DT2 A;  1UR8 A;  3WH0 A;  1J4H A;  5J6E A;  3KCE A;  3OA5 A;  2PI6 A;  5JH8 A;  2KI3 A;  1ZL1 A;  4TW7 A;  2LPV A;  4KQZ A;  1FKR A;  3IKD A;  3O5M A;  4MNL A;  5HTG A;  3O5D A;  3WIJ A;  3EIP A;  2LKN A;  4W5U A;  1SYT A;  5HW6 A;  1W1V A;  2DG9 A;  2WK2 A;  3WD0 A;  1Q6U A;  5HWB A;  1HJX A;  2A3C A;  4DWS B;  2XPB A;  1WB0 A;  4MNM A;  1FKI A;  3KAB A;  4MAV A;  1ZU8 A;  2KO7 A;  4IT6 A;  1HKJ A;  1HJV A;  3KAH A;  1ZB5 A;  1NWU A;  4DWS A;  3UI4 A;  3UQI A;  3IK8 A;  2OFN A;  4J4N A;  4S3J A;  1E6R A;  4P8U A;  1J6Y A;  2EUL A;  3AQU A;  3AS0 A;  3ARO A;  1YAT A;  3O5Q A;  3RM4 A;  4QZV B;  1N1A A;  2PPP A;  2DG4 A;  2JZV A;  4R0X A;  4URI A;  1FKH A;  1JNS A;  3PRD A;  1X6L A;  3WD3 A;  1D7J A;  3FY1 A;  4XAK A;  2UZ5 A;  1E15 A;  4TW8 A;  3WD4 A;  1JNT A;  1U79 A;  4QT3 A;  4DT4 A;  4ML4 A;  3CHE A;  3ODK A;  3OOB A;  4QT2 A;  4DRJ A;  3B8S A;  4Q7N A;  3ARQ A;  1Y0O A;  4U86 A;  1D7H A;  4WK9 A;  1Q6H A;  1E9L A;  3O5G A;  1NMV A;  2RUQ A;  3WL0 A;  3RME A;  3ARV A;  4ZS6 A;  1Q1C A;  4DRP A;  2PBC A;  3WKZ A;  1YW5 A;  2DT1 A;  4WKA A;  2ETN A;  3O5P A;  2G41 A;  1JCH B;  3NTP A;  2FDM A;  2OLH A;  4LAV A;  2F23 A;  4DWS C;  3G6M A;  2F2D A;  2DT0 A;  5D75 A;  2KR7 A;  1OGB A;  1ZBK A;  4GIV A;  4DRO A;  2DT3 A;  1D6O A;  1FFR A;  4ODR A;  1LQ0 A;  2XP7 A;  2WLY A;  2ZR4 A;  1BL4 A;  2F21 A;  2QF8 A;  3B7X A;  1UR9 A;  2M1I A;  2ITK A;  1EDQ A;  1HJW A;  2MF9 A;  4Z2K A;  3NRK A;  3PRB A;  3WL1 A;  1R9H A;  4TYO A;  3AS3 A;  3ARW A;  2DSU A;  2MLX A;  4G2P A;  3JYM A;  4NZC A;  1W9V A;  4DIP A;  4W9P A;  2ZQV A;  1NWT A;  4FAP A;  3TC5 A;  1NSG A;  2LGO A;  4C02 B;  3JXV A;  2PV1 A;  3B9E A;  1H0I A;  1OGG A;  2XP8 A;  3RM9 A;  1XRV A;  5HW8 A;  3WQV A;  1HXV A;  2MLY A;  4Z2H A;  1GOI A;  2ZQS A;  3PR9 A;  4O2T A;  4DRM A;  3LUO A; 
#chains in the Genus database with same CATH homology
 3EY6 A;  4MTV A;  3CGN A;  2Q5A A;  1JVW A;  1QZ2 A;  1W9P A;  5DO2 A;  2O9O A;  4GGQ A;  2DSZ A;  4LAX A;  4MGV A;  3AS2 A;  4ODK A;  1FKD A;  2K8I A;  4ODM A;  3RM8 A;  2PV3 A;  1C9H A;  2XPA A;  3VAW A;  5HWC A;  1KFW A;  1VF8 A;  2MLZ A;  1BKF A;  3W4R A;  2RUD A;  1PIN A;  4IPX A;  1FKT A;  3O5R A;  1LJY A;  1H0G A;  1RD6 A;  3RGC A;  1E6Z A;  4JFM A;  5DIT A;  5HW7 A;  4ODP A;  4MPK A;  3I6C A;  3ARP A;  2RUR A;  3ARU A;  3UI6 A;  4JFJ A;  4Q22 A;  3B9A A;  1WNO A;  4HBE A;  3ARR A;  1KT1 A;  4Z2I A;  5DIU A;  1TCO C;  1W9U A;  2YBU A;  3UF8 A;  5I98 A;  2ZQU A;  1LL7 A;  1D7I A;  2M08 A;  2XP3 A;  4TX0 A;  4Z2L A;  3ARZ A;  3ALG A;  5DF0 A;  5BXJ A;  3KAC A;  3AS1 A;  2AOS A;  3KAF A;  1PBK A;  1ZK6 A;  2XP5 A;  2N87 A;  4DWS D;  3O5K A;  4G50 A;  3FXY A;  3TDB A;  4L72 B;  2G8Z A;  2KFW A;  1ZBW A;  5HUA A;  1X6N A;  3PA7 A;  1GPF A;  3UQB A;  1CTN A;  4LAY A;  4DZ2 A;  3UQA A;  1ITX A;  1FAP A;  2F4E A;  1FKF A;  2PPN A;  3O5J A;  1E6P A;  4FN2 A;  4TNS A;  4AY1 A;  4WIW A;  1NWS A;  2RSE A;  1J4I A;  3WQW A;  1GUV A;  3KAD A;  1EQ3 A;  1K9T A;  2PPO A;  1QPF A;  1O6I A;  2B31 A;  2L2S A;  4ODQ A;  3RFW A;  4HAR A;  4WKF A;  3CHF A;  1JND A;  1EYM A;  3KAG A;  4WJX A;  4KR0 B;  4ZPW R;  1IX5 A;  1FKL A;  2ESC A;  3ALF A;  2DPE A;  2WM0 A;  1F40 A;  2XP9 A;  3IKG A;  1W1T A;  5HBF A;  3O5L A;  4ODO A;  3WD1 A;  4DRK A;  2DSV A;  2DSW A;  4LAW A;  1QPL A;  5GQB A;  1FD9 A;  3FAP A;  5GPG A;  4W9Q A;  1JNE A;  4HBO A;  1W1Y A;  1WAW A;  3PRA A;  4DRN A;  3NI6 A;  3WD2 A;  4NNR A;  1HKM A;  2WLZ A;  3CHD A;  3O5E A;  3ART A;  1P5Q A;  4NSB A;  1FKG A;  3IHZ A;  2RQS A;  5HKG A;  1LL4 A;  3JYJ A;  4ODL A;  4ODN A;  5DEZ A;  3CZ8 A;  2PV2 A;  4ZPT R;  2YBT A;  3MDY B;  1B6C A;  4U84 A;  4BF8 A;  1D2K A;  1NMW A;  4DH0 A;  2D9F A;  4U85 A;  4Z2J A;  1T11 A;  3O5O A;  4QIB A;  1FKK A;  4JFK A;  3UI5 A;  2A3A A;  1ZCN A;  4JFL A;  5GPR A;  4LGX A;  5B8I C;  1L1P A;  1FKS A;  4IQ2 A;  2A3B A;  3TCZ A;  4W9O A;  1ZBV A;  4N19 A;  2IF4 A;  4P8X A;  4J4O A;  2ZQT A;  4IT4 A;  5HT1 A;  4IQC A;  4S3K A;  3ARS A;  4P8V A;  4L3N A;  1Q6I A;  1ROT A;  3KAI A;  2XP6 A;  3CH9 A;  4JFI A;  1FJD A;  1FKB A;  2VCD A;  3BXW A;  3O5F A;  3QOK A;  3GPK A;  2O92 A;  4DRI A;  2M2A A;  1NWR A;  1FKJ A;  1HKI A;  4ZPV R;  1M5Y A;  2AWG A;  1EHN A;  2MPH A;  4DRQ A;  1FFQ A;  4R5E A;  2ZR6 A;  3B9D A;  1KT0 A;  1ROU A;  3KZ7 A;  2DG3 A;  1SR0 A;  2VN1 A;  1A7X A;  4MNJ A;  2MNT A;  1TFV A;  1W26 A;  4MSP A;  3O5I A;  4MNK A;  1F8A B;  4DZ3 A;  2LJ4 A;  4P8W A;  1LL6 A;  5DIV A;  4Z2G A;  1EIB A;  1E6N A;  2RUC A;  2FKE A;  4JYS A;  1NH6 A;  2IUZ A;  2KE0 A;  1W1P A;  2XP4 A;  3H9R B;  4DRH A;  1J4R A;  4WKH A;  2A3E A;  2Y78 A;  1LG2 A;  4PTM A;  3CHC A;  4ITZ A;  1ZBC A;  4TW6 A;  1HKK A;  2ZR5 A;  3G6L A;  1OWQ A;  2FAP A;  3ARX A;  1XHG A;  2KGJ A;  3ARY A;  3CGM A;  1LG1 A;  2DT2 A;  1UR8 A;  3WH0 A;  1J4H A;  5J6E A;  3KCE A;  3OA5 A;  2PI6 A;  5JH8 A;  2KI3 A;  1ZL1 A;  4TW7 A;  2LPV A;  4KQZ A;  1FKR A;  3IKD A;  3O5M A;  4MNL A;  5HTG A;  3O5D A;  3WIJ A;  2LKN A;  4W5U A;  1SYT A;  5HW6 A;  1W1V A;  2DG9 A;  2WK2 A;  3WD0 A;  1Q6U A;  5HWB A;  1HJX A;  2A3C A;  4DWS B;  2XPB A;  1WB0 A;  4MNM A;  1FKI A;  3KAB A;  4MAV A;  1ZU8 A;  2KO7 A;  4IT6 A;  1HKJ A;  1HJV A;  3KAH A;  1ZB5 A;  1NWU A;  4DWS A;  3UI4 A;  3UQI A;  3IK8 A;  2OFN A;  4J4N A;  4S3J A;  1E6R A;  4P8U A;  1J6Y A;  3AQU A;  3AS0 A;  3ARO A;  1YAT A;  3O5Q A;  3RM4 A;  4QZV B;  1N1A A;  2PPP A;  2DG4 A;  2JZV A;  4R0X A;  4URI A;  1FKH A;  1JNS A;  3PRD A;  1X6L A;  3WD3 A;  1D7J A;  3FY1 A;  4XAK A;  2UZ5 A;  1E15 A;  4TW8 A;  3WD4 A;  1JNT A;  1U79 A;  4QT3 A;  4DT4 A;  4ML4 A;  3CHE A;  3ODK A;  3OOB A;  4QT2 A;  4DRJ A;  3B8S A;  4Q7N A;  3ARQ A;  1Y0O A;  4U86 A;  1D7H A;  4WK9 A;  1Q6H A;  1E9L A;  3O5G A;  1NMV A;  2RUQ A;  3WL0 A;  3RME A;  3ARV A;  4ZS6 A;  1Q1C A;  4DRP A;  2PBC A;  3WKZ A;  1YW5 A;  2DT1 A;  4WKA A;  3O5P A;  2G41 A;  3NTP A;  2FDM A;  2OLH A;  4LAV A;  4DWS C;  3G6M A;  2F2D A;  2DT0 A;  5D75 A;  2KR7 A;  1OGB A;  1ZBK A;  4GIV A;  4DRO A;  2DT3 A;  1D6O A;  1FFR A;  4ODR A;  1LQ0 A;  2XP7 A;  2WLY A;  2ZR4 A;  1BL4 A;  2F21 A;  2QF8 A;  3B7X A;  1UR9 A;  2M1I A;  2ITK A;  1EDQ A;  1HJW A;  2MF9 A;  4Z2K A;  3NRK A;  3PRB A;  3WL1 A;  1R9H A;  4TYO A;  3AS3 A;  3ARW A;  2DSU A;  2MLX A;  4G2P A;  3JYM A;  4NZC A;  1W9V A;  4DIP A;  4W9P A;  2ZQV A;  1NWT A;  4FAP A;  3TC5 A;  1NSG A;  2LGO A;  4C02 B;  3JXV A;  2PV1 A;  3B9E A;  1H0I A;  1OGG A;  2XP8 A;  3RM9 A;  1XRV A;  5HW8 A;  3WQV A;  1HXV A;  2MLY A;  4Z2H A;  1GOI A;  2ZQS A;  3PR9 A;  4O2T A;  4DRM A;  3LUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...