5DITA

The fk1 domain of fkbp51 in complex with the new synthetic ligand (1r)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2s)-1-[(2s,3r)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ditA00
2XP4A 4DROA 3CGMA 1BL4A 4DRPA 5I98A 3KCEA 4JYSA 2RSEA 2ZR6A 1NMVA 3KAHA 3PRDA 1FKKA 2OFNA 2PV2A 1Q6HA 1QZ2A 4BF8A 3O5QA 1NSGA 4J4OA 4C02B 4DRQA 2LJ4A 1C9HA 1FKTA 5HWBA 4J4NA 4R0XA 1P5QA 1A7XA 3TDBA 3UI5A 3KAFA 4QT3A 5HWCA 1PBKA 3PRBA 3VAWA 2RURA 3O5MA 1EYMA 4NNRA 3RFWA 3WH0A 3UQBA 1ZK6A 2PV3A 2L2SA 3GPKA 5HKGA 3O5JA 3PA7A 3JXVA 1QPFA 1FD9A 1L1PA 4TW8A 1J4RA 2RQSA 4QIBA 4TW6A 5HW6A 1KT0A 4U84A 2XP8A 2PPOA 1Q6UA 1FKSA 4LAVA 2LKNA 5DITA 4DRMA 1TCOC 4MSPA 1YW5A 2KR7A 4U85A 4TX0A 5HUAA 5HTGA 2KGJA 2MLYA 3IHZA 4G2PA 5GPGA 2PV1A 1JNSA 1JNTA 3IKGA 3KADA 1W26A 2PPNA 3MDYB 3O5RA 1ZCNA 3TC5A 4DIPA 1ROUA 2VN1A 4GIVA 1QPLA 2M1IA 5B8IC 4LAYA 2XP3A 4U86A 3UI6A 1J4IA 1JVWA 2Q5AA 2XPAA 2AWGA 3ODKA 1J6YA 1FKIA 2KO7A 2M2AA 1D7IA 4W9PA 2FAPA 5HW8A 2RUQA 4JFMA 3OOBA 4DRJA 3O5GA 4O2TA 1FKDA 3KACA 3IKDA 2ZR4A 4W9OA 5J6EA 1KT1A 3JYJA 3KAGA 4DZ3A 5D75A 5BXJA 4JFJA 2XP6A 3I6CA 4MGVA 2LGOA 2PBCA 3O5OA 4ODPA 3TCZA 3NTPA 4ODNA 2XP7A 2KE0A 4ODQA 3O5DA 2XP5A 4TNSA 1FJDA 2RUDA 1Y0OA 2ITKA 2MLXA 2DG9A 1Q6IA 3LUOA 2KI3A 1BKFA 2PPPA 2FKEA 3O5PA 4LAXA 4JFKA 3NI6A 3O5KA 2ZQTA 1PINA 3CGNA 1HXVA 1EQ3A 2JZVA 3JYMA 3UF8A 2F2DA 2MF9A 2LPVA 2N87A 1J4HA 5DIVA 2ZQUA 2IF4A 2VCDA 4JFLA 1F40A 2XPBA 4IQCA 5DIUA 4IPXA 3KAIA 3UQIA 2D9FA 1Q1CA 2F4EA 2F21A 4TYOA 2UZ5A 2DG4A 2MPHA 3NRKA 2Y78A 1FKRA 3IK8A 3EY6A 5HT1A 1D7JA 1D7HA 2XP9A 1R9HA 3UI4A 1F8AB 2K8IA 4GGQA 1T11A 1U79A 3O5LA 4IQ2A 2ZQVA 1FKGA 3O5FA 4DZ2A 1FAPA 2ZQSA 4G50A 3H9RB 1FKLA 3FAPA 2ZR5A 3KABA 2RUCA 4ODOA 4ITZA 4QT2A 4DRIA 1M5YA 2DG3A 4DRKA 4FN2A 3RGCA 4DH0A 3O5EA 4ODKA 4ODRA 2KFWA 4W9QA 4DRHA 4DT4A 4TW7A 5HW7A 4N19A 1FKJA 1N1AA 1ROTA 1B6CA 2M08A 3B7XA 1FKBA 3KZ7A 4ODLA 4DRNA 4LAWA 3UQAA 3O5IA 1NMWA 4JFIA 4ODMA 4FAPA 1D6OA 1YATA 2MLZA 1FKFA 2MNTA 1FKHA
chains in the Genus database with same CATH superfamily
2XP4A 1K9TA 2RSEA 2ZR6A 3B8SA 1FKKA 4URIA 4IT4A 4BF8A 4Z2IA 2A3AA 1WB0A 2LJ4A 3ARWA 1C9HA 5HWBA 1W1PA 4MNLA 4DWSC 2A3BA 3VAWA 3RFWA 3UQBA 1ZK6A 2PV3A 4NZCA 4UDMA 4Z2LA 3O5JA 3PA7A 3G6MA 2F23A 3RMEA 4U84A 4DRMA 2LKNA 4MSPA 1W9UA 3WQVA 1JNSA 2KGJA 2MLYA 3IHZA 4G2PA 5HBFA 3IKGA 2QF8A 3O5RA 1ZCNA 4GIVA 1J4IA 3BXWA 1JCHB 1FKIA 4Z2KA 2KO7A 1D2KA 4W9PA 2RUQA 3EIPA 2DPEA 4DRJA 3AQUA 1NWTA 1LJYA 3IKDA 5J6EA 4W9OA 2DSZA 1E44A 4DZ3A 5D75A 2XP6A 3I6CA 4L3NA 4P8XA 3O5OA 1E15A 3AS1A 3ARRA 4TNSA 5DEZA 3W4RA 1Q6IA 3LUOA 5GQBA 3WD3A 4MNKA 2PPPA 3G6LA 4R5EA 4JFKA 4HBEA 2A3EA 1OWQA 5DIVA 2N87A 2ZQUA 2VCDA 1Q1CA 2F4EA 1FKRA 2MPHA 3IK8A 1D7JA 1D7HA 4GGQA 4IQ2A 1O6IA 3O5LA 1FFQA 2ZQSA 3H9RB 3FAPA 4QT2A 4DRIA 4FN2A 4DH0A 4ODKA 3RM9A 4N19A 1FKJA 3OA5A 3PR9A 3KZ7A 1E6ZA 1NWRA 1D6OA 4P8VA 2VN1A 3WKZA 1F40A 1GPFA 3WD4A 1GOIA 3CGMA 3BMBA 1HKKA 4DRPA 4AY1A 3B9AA 1ZU8A 2FDMA 3PRDA 2OFNA 2G8ZA 1JNEA 1HKJA 4W5UA 3O5QA 1NSGA 2DT3A 1UR8A 4R0XA 1P5QA 3ALFA 1A7XA 3UI5A 1E6RA 3PRBA 1EIBA 3WH0A 3WIJA 1EYMA 3FY1A 2DT2A 4P8UA 4MNJA 4QIBA 4S3KA 5HW6A 4L72B 2XP8A 4ML4A 1FKSA 1YW5A 5HUAA 3WD2A 4XAKA 1LG2A 2PV1A 4DIPA 2PPNA 3MDYB 5B8IC 1XHGA 1QPLA 4Q7NA 2XP3A 1KFWA 4Z2HA 1JVWA 1J6YA 4PTMA 1FFRA 3B9EA 1GUVA 4ZPTR 2FAPA 3ARYA 3OOBA 1NWSA 1ZBVA 1FKDA 4MNMA 3CZ8A 3JYJA 4S3JA 5BXJA 1HJXA 4ZPWR 2O92A 4MGVA 2DT0A 2PBCA 4QZVB 3TCZA 3B9DA 4ODNA 2XP7A 2P4VA 1FJDA 4WIWA 2ITKA 4WJXA 1BKFA 3O5PA 3O5KA 4Z2JA 2ZQTA 1PINA 3CGNA 2PN0A 1NWUA 1VF8A 1W9PA 3UF8A 2F2DA 1W1TA 1CTNA 5DIUA 1W9VA 1TFVA 4WKHA 3UI4A 2K8IA 3ARQA 3RM8A 1FKGA 3O5FA 1LL4A 4G50A 1HJWA 4Q22A 3AROA 3ARSA 4ITZA 4KR0B 4DRKA 2KFWA 4TW7A 4ZPVR 2ESCA 4MAVA 4NSBA 4ODLA 3UQAA 3O5IA 1NMWA 4JFIA 4ODMA 1WNOA 1YATA 2MLZA 1FKFA 4DWSB 2MNTA 1E9LA 5I98A 3KCEA 1NMVA 1EDQA 4WK9A 1ZB5A 1WAWA 4J4OA 1ZBCA 3KAFA 5HWCA 2RURA 3O5MA 3CHDA 4NNRA 3GPKA 5HKGA 3JXVA 1FD9A 2WK2A 4TW8A 1L1PA 1E6PA 1OGGA 1SYTA 4LAVA 5DITA 1TCOC 4U85A 3ARPA 5GPGA 1W26A 2M1IA 4U86A 2Q5AA 2XPAA 2AWGA 2M2AA 4JFMA 4MTVA 3O5GA 3ARVA 4Z2GA 2ZR4A 1H0GA 3KAGA 4WKFA 1SR0A 2G41A 3NTPA 1OGBA 2KE0A 4ODQA 3O5DA 2XP5A 2RUDA 2MLXA 1LG1A 2DG9A 3NI6A 3CH9A 3WD1A 3ALGA 5GPRA 2MF9A 4JFLA 2IF4A 2XPBA 4IQCA 4IPXA 1ITXA 1ZBKA 2F21A 4TYOA 3FXYA 3ARXA 3CHCA 1R9HA 4DWSD 2ZQVA 1FKLA 2ZR5A 3KABA 4ODOA 3ARUA 3RGCA 3O5EA 2YBTA 1ZBWA 4DT4A 4DRHA 5HW7A 2M08A 3ARTA 1E6NA 4DWSA 1FKBA 3WD0A 4LAWA 1X6LA 4DRNA 4FAPA 3CHFA 1FKHA 2DSWA 4DROA 1BL4A 1H0IA 2WM0A 4JYSA 3KAHA 2ETNA 2O9OA 4LGXA 2PV2A 1Q6HA 1QZ2A 4C02B 4DRQA 1FKTA 1GRJA 4J4NA 3TDBA 4QT3A 1PBKA 3RM4A 1ZL1A 2DSVA 2L2SA 1QPFA 1J4RA 2RQSA 4TW6A 1KT0A 1X6NA 2WLYA 3AS3A 2PPOA 1Q6UA 2KR7A 3WL0A 4TX0A 5HTGA 1UR9A 1JNTA 3KADA 3TC5A 4ZS6A 1ROUA 2YBUA 4LAYA 3UI6A 5DO2A 3ODKA 1HKIA 1JNDA 2DT1A 2PI6A 1D7IA 1HKMA 2OLHA 5HW8A 3WL1A 1RD6A 4O2TA 3KACA 1LQ0A 1KT1A 1W1YA 3GTYX 4JFJA 1LL7A 3ARZA 2EULA 4HARA 2LGOA 4ODPA 3QOKA 3AS0A 1NH6A 3WQWA 2B5UB 1EHNA 1Y0OA 1LL6A 3GU0A 2KI3A 1HJVA 2A3CA 4WKAA 2FKEA 4LAXA 3CHEA 1HXVA 1EQ3A 2B31A 2JZVA 3AS2A 3JYMA 2LPVA 1IX5A 1J4HA 4HBOA 3KAIA 3UQIA 2D9FA 2UZ5A 2DG4A 3NRKA 2Y78A 3EY6A 5HT1A 2XP9A 1W1VA 1F8AB 1T11A 1U79A 2AOSA 2DSUA 4DZ2A 1FAPA 2RUCA 4P8WA 2IUZA 5JH8A 1M5YA 2DG3A 1XRVA 4IT6A 3PRAA 4ODRA 4W9QA 4MPKA 5DF0A 1N1AA 1ROTA 1B6CA 4KQZA 3B7XA 2WLZA
chains in the Genus database with same CATH topology
2XP4A 1K9TA 2RSEA 2ZR6A 3B8SA 1FKKA 4URIA 4IT4A 4BF8A 4Z2IA 2A3AA 1WB0A 2LJ4A 3ARWA 1C9HA 5HWBA 1W1PA 4MNLA 4DWSC 2A3BA 3VAWA 3RFWA 3UQBA 1ZK6A 2PV3A 4NZCA 4Z2LA 3O5JA 3PA7A 3G6MA 3RMEA 4U84A 4DRMA 2LKNA 4MSPA 1W9UA 3WQVA 1JNSA 2KGJA 2MLYA 3IHZA 4G2PA 5HBFA 3IKGA 2QF8A 3O5RA 1ZCNA 4GIVA 1J4IA 3BXWA 1FKIA 4Z2KA 2KO7A 1D2KA 4W9PA 2RUQA 2DPEA 4DRJA 3AQUA 1NWTA 1LJYA 3IKDA 5J6EA 4W9OA 2DSZA 4DZ3A 5D75A 2XP6A 3I6CA 4L3NA 4P8XA 3O5OA 1E15A 3AS1A 3ARRA 4TNSA 5DEZA 3W4RA 1Q6IA 3LUOA 5GQBA 3WD3A 4MNKA 2PPPA 3G6LA 4R5EA 4JFKA 4HBEA 2A3EA 1OWQA 5DIVA 2N87A 2ZQUA 2VCDA 1Q1CA 2F4EA 1FKRA 2MPHA 3IK8A 1D7JA 1D7HA 4GGQA 4IQ2A 1O6IA 3O5LA 1FFQA 2ZQSA 3H9RB 3FAPA 4QT2A 4DRIA 4FN2A 4DH0A 4ODKA 3RM9A 4N19A 1FKJA 3OA5A 3PR9A 3KZ7A 1E6ZA 1NWRA 1D6OA 4P8VA 2VN1A 3WKZA 1F40A 1GPFA 3WD4A 1GOIA 3CGMA 1HKKA 4DRPA 4AY1A 3B9AA 1ZU8A 2FDMA 3PRDA 2OFNA 2G8ZA 1JNEA 1HKJA 4W5UA 3O5QA 1NSGA 2DT3A 1UR8A 4R0XA 1P5QA 3ALFA 1A7XA 3UI5A 1E6RA 3PRBA 1EIBA 3WH0A 3WIJA 1EYMA 3FY1A 2DT2A 4P8UA 4MNJA 4QIBA 4S3KA 5HW6A 4L72B 2XP8A 4ML4A 1FKSA 1YW5A 5HUAA 3WD2A 4XAKA 1LG2A 2PV1A 4DIPA 2PPNA 3MDYB 5B8IC 1XHGA 1QPLA 4Q7NA 2XP3A 1KFWA 4Z2HA 1JVWA 1J6YA 4PTMA 1FFRA 3B9EA 1GUVA 4ZPTR 2FAPA 3ARYA 3OOBA 1NWSA 1ZBVA 1FKDA 4MNMA 3CZ8A 3JYJA 4S3JA 5BXJA 1HJXA 4ZPWR 2O92A 4MGVA 2DT0A 2PBCA 4QZVB 3TCZA 3B9DA 4ODNA 2XP7A 1FJDA 4WIWA 2ITKA 4WJXA 1BKFA 3O5PA 3O5KA 4Z2JA 2ZQTA 1PINA 3CGNA 1NWUA 1VF8A 1W9PA 3UF8A 2F2DA 1W1TA 1CTNA 5DIUA 1W9VA 1TFVA 4WKHA 3UI4A 2K8IA 3ARQA 3RM8A 1FKGA 3O5FA 1LL4A 4G50A 1HJWA 4Q22A 3AROA 3ARSA 4ITZA 4KR0B 4DRKA 2KFWA 4TW7A 4ZPVR 2ESCA 4MAVA 4NSBA 4ODLA 3UQAA 3O5IA 1NMWA 4JFIA 4ODMA 1WNOA 1YATA 2MLZA 1FKFA 4DWSB 2MNTA 1E9LA 5I98A 3KCEA 1NMVA 1EDQA 4WK9A 1ZB5A 1WAWA 4J4OA 1ZBCA 3KAFA 5HWCA 2RURA 3O5MA 3CHDA 4NNRA 3GPKA 5HKGA 3JXVA 1FD9A 2WK2A 4TW8A 1L1PA 1E6PA 1OGGA 1SYTA 4LAVA 5DITA 1TCOC 4U85A 3ARPA 5GPGA 1W26A 2M1IA 4U86A 2Q5AA 2XPAA 2AWGA 2M2AA 4JFMA 4MTVA 3O5GA 3ARVA 4Z2GA 2ZR4A 1H0GA 3KAGA 4WKFA 1SR0A 2G41A 3NTPA 1OGBA 2KE0A 4ODQA 3O5DA 2XP5A 2RUDA 2MLXA 1LG1A 2DG9A 3NI6A 3CH9A 3WD1A 3ALGA 5GPRA 2MF9A 4JFLA 2IF4A 2XPBA 4IQCA 4IPXA 1ITXA 1ZBKA 2F21A 4TYOA 3FXYA 3ARXA 3CHCA 1R9HA 4DWSD 2ZQVA 1FKLA 2ZR5A 3KABA 4ODOA 3ARUA 3RGCA 3O5EA 2YBTA 1ZBWA 4DT4A 4DRHA 5HW7A 2M08A 3ARTA 1E6NA 4DWSA 1FKBA 3WD0A 4LAWA 1X6LA 4DRNA 4FAPA 3CHFA 1FKHA 2DSWA 4DROA 1BL4A 1H0IA 2WM0A 4JYSA 3KAHA 2O9OA 4LGXA 2PV2A 1Q6HA 1QZ2A 4C02B 4DRQA 1FKTA 4J4NA 3TDBA 4QT3A 1PBKA 3RM4A 1ZL1A 2DSVA 2L2SA 1QPFA 1J4RA 2RQSA 4TW6A 1KT0A 1X6NA 2WLYA 3AS3A 2PPOA 1Q6UA 2KR7A 3WL0A 4TX0A 5HTGA 1UR9A 1JNTA 3KADA 3TC5A 4ZS6A 1ROUA 2YBUA 4LAYA 3UI6A 5DO2A 3ODKA 1HKIA 1JNDA 2DT1A 2PI6A 1D7IA 1HKMA 2OLHA 5HW8A 3WL1A 1RD6A 4O2TA 3KACA 1LQ0A 1KT1A 1W1YA 4JFJA 1LL7A 3ARZA 4HARA 2LGOA 4ODPA 3QOKA 3AS0A 1NH6A 3WQWA 1EHNA 1Y0OA 1LL6A 2KI3A 1HJVA 2A3CA 4WKAA 2FKEA 4LAXA 3CHEA 1HXVA 1EQ3A 2B31A 2JZVA 3AS2A 3JYMA 2LPVA 1IX5A 1J4HA 4HBOA 3KAIA 3UQIA 2D9FA 2UZ5A 2DG4A 3NRKA 2Y78A 3EY6A 5HT1A 2XP9A 1W1VA 1F8AB 1T11A 1U79A 2AOSA 2DSUA 4DZ2A 1FAPA 2RUCA 4P8WA 2IUZA 5JH8A 1M5YA 2DG3A 1XRVA 4IT6A 3PRAA 4ODRA 4W9QA 4MPKA 5DF0A 1N1AA 1ROTA 1B6CA 4KQZA 3B7XA 2WLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP4 A;  4DRO A;  3CGM A;  1BL4 A;  4DRP A;  5I98 A;  3KCE A;  4JYS A;  2RSE A;  2ZR6 A;  1NMV A;  3KAH A;  3PRD A;  1FKK A;  2OFN A;  2PV2 A;  1Q6H A;  1QZ2 A;  4BF8 A;  3O5Q A;  1NSG A;  4J4O A;  4C02 B;  4DRQ A;  2LJ4 A;  1C9H A;  1FKT A;  5HWB A;  4J4N A;  4R0X A;  1P5Q A;  1A7X A;  3TDB A;  3UI5 A;  3KAF A;  4QT3 A;  5HWC A;  1PBK A;  3PRB A;  3VAW A;  2RUR A;  3O5M A;  1EYM A;  4NNR A;  3RFW A;  3WH0 A;  3UQB A;  1ZK6 A;  2PV3 A;  2L2S A;  3GPK A;  5HKG A;  3O5J A;  3PA7 A;  3JXV A;  1QPF A;  1FD9 A;  1L1P A;  4TW8 A;  1J4R A;  2RQS A;  4QIB A;  4TW6 A;  5HW6 A;  1KT0 A;  4U84 A;  2XP8 A;  2PPO A;  1Q6U A;  1FKS A;  4LAV A;  2LKN A;  5DIT A;  4DRM A;  1TCO C;  4MSP A;  1YW5 A;  2KR7 A;  4U85 A;  4TX0 A;  5HUA A;  5HTG A;  2KGJ A;  2MLY A;  3IHZ A;  4G2P A;  5GPG A;  2PV1 A;  1JNS A;  1JNT A;  3IKG A;  3KAD A;  1W26 A;  2PPN A;  3MDY B;  3O5R A;  1ZCN A;  3TC5 A;  4DIP A;  1ROU A;  2VN1 A;  4GIV A;  1QPL A;  2M1I A;  5B8I C;  4LAY A;  2XP3 A;  4U86 A;  3UI6 A;  1J4I A;  1JVW A;  2Q5A A;  2XPA A;  2AWG A;  3ODK A;  1J6Y A;  1FKI A;  2KO7 A;  2M2A A;  1D7I A;  4W9P A;  2FAP A;  5HW8 A;  2RUQ A;  4JFM A;  3OOB A;  4DRJ A;  3O5G A;  4O2T A;  1FKD A;  3KAC A;  3IKD A;  2ZR4 A;  4W9O A;  5J6E A;  1KT1 A;  3JYJ A;  3KAG A;  4DZ3 A;  5D75 A;  5BXJ A;  4JFJ A;  2XP6 A;  3I6C A;  4MGV A;  2LGO A;  2PBC A;  3O5O A;  4ODP A;  3TCZ A;  3NTP A;  4ODN A;  2XP7 A;  2KE0 A;  4ODQ A;  3O5D A;  2XP5 A;  4TNS A;  1FJD A;  2RUD A;  1Y0O A;  2ITK A;  2MLX A;  2DG9 A;  1Q6I A;  3LUO A;  2KI3 A;  1BKF A;  2PPP A;  2FKE A;  3O5P A;  4LAX A;  4JFK A;  3NI6 A;  3O5K A;  2ZQT A;  1PIN A;  3CGN A;  1HXV A;  1EQ3 A;  2JZV A;  3JYM A;  3UF8 A;  2F2D A;  2MF9 A;  2LPV A;  2N87 A;  1J4H A;  5DIV A;  2ZQU A;  2IF4 A;  2VCD A;  4JFL A;  1F40 A;  2XPB A;  4IQC A;  5DIU A;  4IPX A;  3KAI A;  3UQI A;  2D9F A;  1Q1C A;  2F4E A;  2F21 A;  4TYO A;  2UZ5 A;  2DG4 A;  2MPH A;  3NRK A;  2Y78 A;  1FKR A;  3IK8 A;  3EY6 A;  5HT1 A;  1D7J A;  1D7H A;  2XP9 A;  1R9H A;  3UI4 A;  1F8A B;  2K8I A;  4GGQ A;  1T11 A;  1U79 A;  3O5L A;  4IQ2 A;  2ZQV A;  1FKG A;  3O5F A;  4DZ2 A;  1FAP A;  2ZQS A;  4G50 A;  3H9R B;  1FKL A;  3FAP A;  2ZR5 A;  3KAB A;  2RUC A;  4ODO A;  4ITZ A;  4QT2 A;  4DRI A;  1M5Y A;  2DG3 A;  4DRK A;  4FN2 A;  3RGC A;  4DH0 A;  3O5E A;  4ODK A;  4ODR A;  2KFW A;  4W9Q A;  4DRH A;  4DT4 A;  4TW7 A;  5HW7 A;  4N19 A;  1FKJ A;  1N1A A;  1ROT A;  1B6C A;  2M08 A;  3B7X A;  1FKB A;  3KZ7 A;  4ODL A;  4DRN A;  4LAW A;  3UQA A;  3O5I A;  1NMW A;  4JFI A;  4ODM A;  4FAP A;  1D6O A;  1YAT A;  2MLZ A;  1FKF A;  2MNT A;  1FKH A; 
#chains in the Genus database with same CATH topology
 2XP4 A;  1K9T A;  2RSE A;  2ZR6 A;  3B8S A;  1FKK A;  4URI A;  4IT4 A;  4BF8 A;  4Z2I A;  2A3A A;  1WB0 A;  2LJ4 A;  3ARW A;  1C9H A;  5HWB A;  1W1P A;  4MNL A;  4DWS C;  2A3B A;  3VAW A;  3RFW A;  3UQB A;  1ZK6 A;  2PV3 A;  4NZC A;  4UDM A;  4Z2L A;  3O5J A;  3PA7 A;  3G6M A;  2F23 A;  3RME A;  4U84 A;  4DRM A;  2LKN A;  4MSP A;  1W9U A;  3WQV A;  1JNS A;  2KGJ A;  2MLY A;  3IHZ A;  4G2P A;  5HBF A;  3IKG A;  2QF8 A;  3O5R A;  1ZCN A;  4GIV A;  1J4I A;  3BXW A;  1JCH B;  1FKI A;  4Z2K A;  2KO7 A;  1D2K A;  4W9P A;  2RUQ A;  3EIP A;  2DPE A;  4DRJ A;  3AQU A;  1NWT A;  1LJY A;  3IKD A;  5J6E A;  4W9O A;  2DSZ A;  1E44 A;  4DZ3 A;  5D75 A;  2XP6 A;  3I6C A;  4L3N A;  4P8X A;  3O5O A;  1E15 A;  3AS1 A;  3ARR A;  4TNS A;  5DEZ A;  3W4R A;  1Q6I A;  3LUO A;  5GQB A;  3WD3 A;  4MNK A;  2PPP A;  3G6L A;  4R5E A;  4JFK A;  4HBE A;  2A3E A;  1OWQ A;  5DIV A;  2N87 A;  2ZQU A;  2VCD A;  1Q1C A;  2F4E A;  1FKR A;  2MPH A;  3IK8 A;  1D7J A;  1D7H A;  4GGQ A;  4IQ2 A;  1O6I A;  3O5L A;  1FFQ A;  2ZQS A;  3H9R B;  3FAP A;  4QT2 A;  4DRI A;  4FN2 A;  4DH0 A;  4ODK A;  3RM9 A;  4N19 A;  1FKJ A;  3OA5 A;  3PR9 A;  3KZ7 A;  1E6Z A;  1NWR A;  1D6O A;  4P8V A;  2VN1 A;  3WKZ A;  1F40 A;  1GPF A;  3WD4 A;  1GOI A;  3CGM A;  3BMB A;  1HKK A;  4DRP A;  4AY1 A;  3B9A A;  1ZU8 A;  2FDM A;  3PRD A;  2OFN A;  2G8Z A;  1JNE A;  1HKJ A;  4W5U A;  3O5Q A;  1NSG A;  2DT3 A;  1UR8 A;  4R0X A;  1P5Q A;  3ALF A;  1A7X A;  3UI5 A;  1E6R A;  3PRB A;  1EIB A;  3WH0 A;  3WIJ A;  1EYM A;  3FY1 A;  2DT2 A;  4P8U A;  4MNJ A;  4QIB A;  4S3K A;  5HW6 A;  4L72 B;  2XP8 A;  4ML4 A;  1FKS A;  1YW5 A;  5HUA A;  3WD2 A;  4XAK A;  1LG2 A;  2PV1 A;  4DIP A;  2PPN A;  3MDY B;  5B8I C;  1XHG A;  1QPL A;  4Q7N A;  2XP3 A;  1KFW A;  4Z2H A;  1JVW A;  1J6Y A;  4PTM A;  1FFR A;  3B9E A;  1GUV A;  4ZPT R;  2FAP A;  3ARY A;  3OOB A;  1NWS A;  1ZBV A;  1FKD A;  4MNM A;  3CZ8 A;  3JYJ A;  4S3J A;  5BXJ A;  1HJX A;  4ZPW R;  2O92 A;  4MGV A;  2DT0 A;  2PBC A;  4QZV B;  3TCZ A;  3B9D A;  4ODN A;  2XP7 A;  2P4V A;  1FJD A;  4WIW A;  2ITK A;  4WJX A;  1BKF A;  3O5P A;  3O5K A;  4Z2J A;  2ZQT A;  1PIN A;  3CGN A;  2PN0 A;  1NWU A;  1VF8 A;  1W9P A;  3UF8 A;  2F2D A;  1W1T A;  1CTN A;  5DIU A;  1W9V A;  1TFV A;  4WKH A;  3UI4 A;  2K8I A;  3ARQ A;  3RM8 A;  1FKG A;  3O5F A;  1LL4 A;  4G50 A;  1HJW A;  4Q22 A;  3ARO A;  3ARS A;  4ITZ A;  4KR0 B;  4DRK A;  2KFW A;  4TW7 A;  4ZPV R;  2ESC A;  4MAV A;  4NSB A;  4ODL A;  3UQA A;  3O5I A;  1NMW A;  4JFI A;  4ODM A;  1WNO A;  1YAT A;  2MLZ A;  1FKF A;  4DWS B;  2MNT A;  1E9L A;  5I98 A;  3KCE A;  1NMV A;  1EDQ A;  4WK9 A;  1ZB5 A;  1WAW A;  4J4O A;  1ZBC A;  3KAF A;  5HWC A;  2RUR A;  3O5M A;  3CHD A;  4NNR A;  3GPK A;  5HKG A;  3JXV A;  1FD9 A;  2WK2 A;  4TW8 A;  1L1P A;  1E6P A;  1OGG A;  1SYT A;  4LAV A;  5DIT A;  1TCO C;  4U85 A;  3ARP A;  5GPG A;  1W26 A;  2M1I A;  4U86 A;  2Q5A A;  2XPA A;  2AWG A;  2M2A A;  4JFM A;  4MTV A;  3O5G A;  3ARV A;  4Z2G A;  2ZR4 A;  1H0G A;  3KAG A;  4WKF A;  1SR0 A;  2G41 A;  3NTP A;  1OGB A;  2KE0 A;  4ODQ A;  3O5D A;  2XP5 A;  2RUD A;  2MLX A;  1LG1 A;  2DG9 A;  3NI6 A;  3CH9 A;  3WD1 A;  3ALG A;  5GPR A;  2MF9 A;  4JFL A;  2IF4 A;  2XPB A;  4IQC A;  4IPX A;  1ITX A;  1ZBK A;  2F21 A;  4TYO A;  3FXY A;  3ARX A;  3CHC A;  1R9H A;  4DWS D;  2ZQV A;  1FKL A;  2ZR5 A;  3KAB A;  4ODO A;  3ARU A;  3RGC A;  3O5E A;  2YBT A;  1ZBW A;  4DT4 A;  4DRH A;  5HW7 A;  2M08 A;  3ART A;  1E6N A;  4DWS A;  1FKB A;  3WD0 A;  4LAW A;  1X6L A;  4DRN A;  4FAP A;  3CHF A;  1FKH A;  2DSW A;  4DRO A;  1BL4 A;  1H0I A;  2WM0 A;  4JYS A;  3KAH A;  2ETN A;  2O9O A;  4LGX A;  2PV2 A;  1Q6H A;  1QZ2 A;  4C02 B;  4DRQ A;  1FKT A;  1GRJ A;  4J4N A;  3TDB A;  4QT3 A;  1PBK A;  3RM4 A;  1ZL1 A;  2DSV A;  2L2S A;  1QPF A;  1J4R A;  2RQS A;  4TW6 A;  1KT0 A;  1X6N A;  2WLY A;  3AS3 A;  2PPO A;  1Q6U A;  2KR7 A;  3WL0 A;  4TX0 A;  5HTG A;  1UR9 A;  1JNT A;  3KAD A;  3TC5 A;  4ZS6 A;  1ROU A;  2YBU A;  4LAY A;  3UI6 A;  5DO2 A;  3ODK A;  1HKI A;  1JND A;  2DT1 A;  2PI6 A;  1D7I A;  1HKM A;  2OLH A;  5HW8 A;  3WL1 A;  1RD6 A;  4O2T A;  3KAC A;  1LQ0 A;  1KT1 A;  1W1Y A;  3GTY X;  4JFJ A;  1LL7 A;  3ARZ A;  2EUL A;  4HAR A;  2LGO A;  4ODP A;  3QOK A;  3AS0 A;  1NH6 A;  3WQW A;  2B5U B;  1EHN A;  1Y0O A;  1LL6 A;  3GU0 A;  2KI3 A;  1HJV A;  2A3C A;  4WKA A;  2FKE A;  4LAX A;  3CHE A;  1HXV A;  1EQ3 A;  2B31 A;  2JZV A;  3AS2 A;  3JYM A;  2LPV A;  1IX5 A;  1J4H A;  4HBO A;  3KAI A;  3UQI A;  2D9F A;  2UZ5 A;  2DG4 A;  3NRK A;  2Y78 A;  3EY6 A;  5HT1 A;  2XP9 A;  1W1V A;  1F8A B;  1T11 A;  1U79 A;  2AOS A;  2DSU A;  4DZ2 A;  1FAP A;  2RUC A;  4P8W A;  2IUZ A;  5JH8 A;  1M5Y A;  2DG3 A;  1XRV A;  4IT6 A;  3PRA A;  4ODR A;  4W9Q A;  4MPK A;  5DF0 A;  1N1A A;  1ROT A;  1B6C A;  4KQZ A;  3B7X A;  2WLZ A; 
#chains in the Genus database with same CATH homology
 2XP4 A;  1K9T A;  2RSE A;  2ZR6 A;  3B8S A;  1FKK A;  4URI A;  4IT4 A;  4BF8 A;  4Z2I A;  2A3A A;  1WB0 A;  2LJ4 A;  3ARW A;  1C9H A;  5HWB A;  1W1P A;  4MNL A;  4DWS C;  2A3B A;  3VAW A;  3RFW A;  3UQB A;  1ZK6 A;  2PV3 A;  4NZC A;  4Z2L A;  3O5J A;  3PA7 A;  3G6M A;  3RME A;  4U84 A;  4DRM A;  2LKN A;  4MSP A;  1W9U A;  3WQV A;  1JNS A;  2KGJ A;  2MLY A;  3IHZ A;  4G2P A;  5HBF A;  3IKG A;  2QF8 A;  3O5R A;  1ZCN A;  4GIV A;  1J4I A;  3BXW A;  1FKI A;  4Z2K A;  2KO7 A;  1D2K A;  4W9P A;  2RUQ A;  2DPE A;  4DRJ A;  3AQU A;  1NWT A;  1LJY A;  3IKD A;  5J6E A;  4W9O A;  2DSZ A;  4DZ3 A;  5D75 A;  2XP6 A;  3I6C A;  4L3N A;  4P8X A;  3O5O A;  1E15 A;  3AS1 A;  3ARR A;  4TNS A;  5DEZ A;  3W4R A;  1Q6I A;  3LUO A;  5GQB A;  3WD3 A;  4MNK A;  2PPP A;  3G6L A;  4R5E A;  4JFK A;  4HBE A;  2A3E A;  1OWQ A;  5DIV A;  2N87 A;  2ZQU A;  2VCD A;  1Q1C A;  2F4E A;  1FKR A;  2MPH A;  3IK8 A;  1D7J A;  1D7H A;  4GGQ A;  4IQ2 A;  1O6I A;  3O5L A;  1FFQ A;  2ZQS A;  3H9R B;  3FAP A;  4QT2 A;  4DRI A;  4FN2 A;  4DH0 A;  4ODK A;  3RM9 A;  4N19 A;  1FKJ A;  3OA5 A;  3PR9 A;  3KZ7 A;  1E6Z A;  1NWR A;  1D6O A;  4P8V A;  2VN1 A;  3WKZ A;  1F40 A;  1GPF A;  3WD4 A;  1GOI A;  3CGM A;  1HKK A;  4DRP A;  4AY1 A;  3B9A A;  1ZU8 A;  2FDM A;  3PRD A;  2OFN A;  2G8Z A;  1JNE A;  1HKJ A;  4W5U A;  3O5Q A;  1NSG A;  2DT3 A;  1UR8 A;  4R0X A;  1P5Q A;  3ALF A;  1A7X A;  3UI5 A;  1E6R A;  3PRB A;  1EIB A;  3WH0 A;  3WIJ A;  1EYM A;  3FY1 A;  2DT2 A;  4P8U A;  4MNJ A;  4QIB A;  4S3K A;  5HW6 A;  4L72 B;  2XP8 A;  4ML4 A;  1FKS A;  1YW5 A;  5HUA A;  3WD2 A;  4XAK A;  1LG2 A;  2PV1 A;  4DIP A;  2PPN A;  3MDY B;  5B8I C;  1XHG A;  1QPL A;  4Q7N A;  2XP3 A;  1KFW A;  4Z2H A;  1JVW A;  1J6Y A;  4PTM A;  1FFR A;  3B9E A;  1GUV A;  4ZPT R;  2FAP A;  3ARY A;  3OOB A;  1NWS A;  1ZBV A;  1FKD A;  4MNM A;  3CZ8 A;  3JYJ A;  4S3J A;  5BXJ A;  1HJX A;  4ZPW R;  2O92 A;  4MGV A;  2DT0 A;  2PBC A;  4QZV B;  3TCZ A;  3B9D A;  4ODN A;  2XP7 A;  1FJD A;  4WIW A;  2ITK A;  4WJX A;  1BKF A;  3O5P A;  3O5K A;  4Z2J A;  2ZQT A;  1PIN A;  3CGN A;  1NWU A;  1VF8 A;  1W9P A;  3UF8 A;  2F2D A;  1W1T A;  1CTN A;  5DIU A;  1W9V A;  1TFV A;  4WKH A;  3UI4 A;  2K8I A;  3ARQ A;  3RM8 A;  1FKG A;  3O5F A;  1LL4 A;  4G50 A;  1HJW A;  4Q22 A;  3ARO A;  3ARS A;  4ITZ A;  4KR0 B;  4DRK A;  2KFW A;  4TW7 A;  4ZPV R;  2ESC A;  4MAV A;  4NSB A;  4ODL A;  3UQA A;  3O5I A;  1NMW A;  4JFI A;  4ODM A;  1WNO A;  1YAT A;  2MLZ A;  1FKF A;  4DWS B;  2MNT A;  1E9L A;  5I98 A;  3KCE A;  1NMV A;  1EDQ A;  4WK9 A;  1ZB5 A;  1WAW A;  4J4O A;  1ZBC A;  3KAF A;  5HWC A;  2RUR A;  3O5M A;  3CHD A;  4NNR A;  3GPK A;  5HKG A;  3JXV A;  1FD9 A;  2WK2 A;  4TW8 A;  1L1P A;  1E6P A;  1OGG A;  1SYT A;  4LAV A;  5DIT A;  1TCO C;  4U85 A;  3ARP A;  5GPG A;  1W26 A;  2M1I A;  4U86 A;  2Q5A A;  2XPA A;  2AWG A;  2M2A A;  4JFM A;  4MTV A;  3O5G A;  3ARV A;  4Z2G A;  2ZR4 A;  1H0G A;  3KAG A;  4WKF A;  1SR0 A;  2G41 A;  3NTP A;  1OGB A;  2KE0 A;  4ODQ A;  3O5D A;  2XP5 A;  2RUD A;  2MLX A;  1LG1 A;  2DG9 A;  3NI6 A;  3CH9 A;  3WD1 A;  3ALG A;  5GPR A;  2MF9 A;  4JFL A;  2IF4 A;  2XPB A;  4IQC A;  4IPX A;  1ITX A;  1ZBK A;  2F21 A;  4TYO A;  3FXY A;  3ARX A;  3CHC A;  1R9H A;  4DWS D;  2ZQV A;  1FKL A;  2ZR5 A;  3KAB A;  4ODO A;  3ARU A;  3RGC A;  3O5E A;  2YBT A;  1ZBW A;  4DT4 A;  4DRH A;  5HW7 A;  2M08 A;  3ART A;  1E6N A;  4DWS A;  1FKB A;  3WD0 A;  4LAW A;  1X6L A;  4DRN A;  4FAP A;  3CHF A;  1FKH A;  2DSW A;  4DRO A;  1BL4 A;  1H0I A;  2WM0 A;  4JYS A;  3KAH A;  2O9O A;  4LGX A;  2PV2 A;  1Q6H A;  1QZ2 A;  4C02 B;  4DRQ A;  1FKT A;  4J4N A;  3TDB A;  4QT3 A;  1PBK A;  3RM4 A;  1ZL1 A;  2DSV A;  2L2S A;  1QPF A;  1J4R A;  2RQS A;  4TW6 A;  1KT0 A;  1X6N A;  2WLY A;  3AS3 A;  2PPO A;  1Q6U A;  2KR7 A;  3WL0 A;  4TX0 A;  5HTG A;  1UR9 A;  1JNT A;  3KAD A;  3TC5 A;  4ZS6 A;  1ROU A;  2YBU A;  4LAY A;  3UI6 A;  5DO2 A;  3ODK A;  1HKI A;  1JND A;  2DT1 A;  2PI6 A;  1D7I A;  1HKM A;  2OLH A;  5HW8 A;  3WL1 A;  1RD6 A;  4O2T A;  3KAC A;  1LQ0 A;  1KT1 A;  1W1Y A;  4JFJ A;  1LL7 A;  3ARZ A;  4HAR A;  2LGO A;  4ODP A;  3QOK A;  3AS0 A;  1NH6 A;  3WQW A;  1EHN A;  1Y0O A;  1LL6 A;  2KI3 A;  1HJV A;  2A3C A;  4WKA A;  2FKE A;  4LAX A;  3CHE A;  1HXV A;  1EQ3 A;  2B31 A;  2JZV A;  3AS2 A;  3JYM A;  2LPV A;  1IX5 A;  1J4H A;  4HBO A;  3KAI A;  3UQI A;  2D9F A;  2UZ5 A;  2DG4 A;  3NRK A;  2Y78 A;  3EY6 A;  5HT1 A;  2XP9 A;  1W1V A;  1F8A B;  1T11 A;  1U79 A;  2AOS A;  2DSU A;  4DZ2 A;  1FAP A;  2RUC A;  4P8W A;  2IUZ A;  5JH8 A;  1M5Y A;  2DG3 A;  1XRV A;  4IT6 A;  3PRA A;  4ODR A;  4W9Q A;  4MPK A;  5DF0 A;  1N1A A;  1ROT A;  1B6C A;  4KQZ A;  3B7X A;  2WLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...