5DITA

The fk1 domain of fkbp51 in complex with the new synthetic ligand (1r)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2s)-1-[(2s,3r)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ditA00
3TDBA 2N87A 4TX0A 1ZCNA 2UZ5A 2KFWA 3RFWA 1FJDA 3O5FA 2DG9A 5HTGA 3JYMA 1PINA 2XP4A 3OOBA 2F4EA 4NNRA 1P5QA 2FKEA 3KAFA 1JNSA 2ZQSA 2RQSA 1M5YA 1ROTA 4QT3A 1YATA 3LUOA 3NTPA 1FKRA 3B7XA 2Y78A 1A7XA 5HWBA 3O5DA 4R0XA 3TCZA 2DG4A 3UQBA 3H9RB 1D7HA 1EQ3A 4LAYA 4W9OA 5DITA 2M1IA 4ODPA 4TW7A 4DIPA 4ITZA 2ZR4A 1ZK6A 1BKFA 3PA7A 4DRNA 3FAPA 3GPKA 2KO7A 3O5RA 3UF8A 3O5IA 2F21A 1FD9A 2ZQVA 5HW8A 3I6CA 1D7IA 3NI6A 4JFMA 5HT1A 5DIVA 1NMWA 2LPVA 1FAPA 1D7JA 5HKGA 3O5JA 1U79A 4MSPA 3O5OA 3O5MA 1FKJA 2PPOA 4DT4A 2KR7A 2XPAA 4LAXA 4DROA 2ZQUA 3TC5A 1FKGA 2MLZA 4IQ2A 2PPPA 5HUAA 4QIBA 2VCDA 4O2TA 2JZVA 4ODLA 1YW5A 3KAGA 4DRIA 1W26A 5B8IC 1FKFA 2LGOA 4FN2A 3UI4A 1NMVA 1PBKA 2MLXA 1D6OA 1TCOC 1F8AB 2XP5A 3KAIA 4G2PA 1BL4A 2AWGA 2VN1A 3EY6A 4FAPA 4JFIA 3O5PA 2FAPA 4GIVA 3IHZA 1J4IA 1Q1CA 2XP6A 4C02B 1T11A 4DH0A 3O5QA 2DG3A 4TNSA 1FKIA 4TYOA 1J6YA 4DZ2A 2RUQA 4IPXA 2OFNA 3IKGA 1Q6UA 5D75A 4DRMA 2RURA 4N19A 1QPLA 4JFLA 4DRJA 4LAVA 1FKTA 2XP3A 4JYSA 3UQAA 1JVWA 2RSEA 2Q5AA 1Q6IA 2D9FA 5I98A 3O5GA 2LJ4A 1QPFA 2PBCA 1FKHA 2M2AA 4LAWA 4ODKA 4ODOA 2PV1A 2KI3A 4BF8A 3VAWA 4ODQA 2XP7A 4JFJA 1EYMA 2IF4A 3JXVA 3CGNA 4TW6A 2PV3A 3O5EA 4GGQA 3MDYB 5GPGA 3UQIA 2MLYA 2ZR5A 4JFKA 2PV2A 2ZQTA 5BXJA 4TW8A 1N1AA 1FKSA 1ROUA 4MGVA 5DIUA 2M08A 2MNTA 3NRKA 3RGCA 2KE0A 3KACA 1J4RA 2K8IA 3IK8A 3KABA 5HW6A 2F2DA 2PPNA 1FKDA 1J4HA 3IKDA 4QT2A 4U85A 1QZ2A 3UI5A 3JYJA 4DRHA 3PRBA 2XPBA 4J4NA 1NSGA 2ITKA 3KAHA 3KADA 3KZ7A 2L2SA 2RUDA 2XP9A 1F40A 1L1PA 4DRPA 1FKKA 4W9QA 2ZR6A 4ODRA 5J6EA 1Q6HA 1JNTA 3O5LA 3O5KA 4IQCA 4U86A 4U84A 1FKLA 3UI6A 1KT1A 2MPHA 4DZ3A 4DRKA 4W9PA 1FKBA 1KT0A 3KCEA 2LKNA 4ODMA 3ODKA 2RUCA 3PRDA 1R9HA 5HW7A 4DRQA 3CGMA 1B6CA 2XP8A 2KGJA 1HXVA 1C9HA 2MF9A 4G50A 4ODNA 3WH0A 1Y0OA 5HWCA 4J4OA
chains in the Genus database with same CATH superfamily
2N87A 1UR9A 1LQ0A 3WIJA 1H0IA 4R5EA 3KAFA 4AY1A 4QZVB 1FKRA 3B7XA 5HWBA 3AQUA 2DSVA 1LJYA 2DG4A 3UQBA 3H9RB 2A3BA 4KQZA 1HKMA 1E6PA 4TW7A 1ZK6A 3FAPA 2KO7A 3UF8A 5HW8A 5HT1A 5GQBA 2LPVA 1NWSA 4MSPA 3O5OA 3O5MA 2A3CA 2PPOA 4DT4A 3CHDA 2XPAA 1WB0A 3AS1A 1UR8A 2ZQUA 4DWSB 2PPPA 2VCDA 4ZPTR 1JNDA 1FKFA 3UI4A 1FFQA 1NMVA 3ARXA 4WKFA 2FAPA 3IHZA 4C02B 1KFWA 1T11A 1NH6A 4Z2HA 3ARPA 4DRJA 4P8XA 4JYSA 3UQAA 2RSEA 2D9FA 5I98A 1QPFA 4Z2LA 1WAWA 4DWSD 1D2KA 1NWRA 1LL4A 2PN0A 2B5UB 5JH8A 2OLHA 3CGNA 1XHGA 4GGQA 3O5EA 3ARQA 5BXJA 4ZPWR 1FKSA 1JCHB 3RGCA 4MTVA 3KACA 2PPNA 3AS0A 1FKDA 4DWSC 2XPBA 3KAHA 3KADA 1GUVA 1FKKA 4ODRA 1JNTA 2DPEA 1FKLA 3ARWA 1E6NA 2LKNA 3ARVA 3WD0A 1B6CA 5GPRA 1HXVA 1E6RA 2WLYA 4G50A 3WH0A 4DWSA 4J4OA 3TDBA 3RFWA 1HKIA 1FJDA 3O5FA 1PINA 2XP4A 1LL6A 3OOBA 2F4EA 3QOKA 1E15A 4NNRA 2FKEA 2DT0A 1IX5A 1YATA 4NZCA 3NTPA 3WQVA 2Y78A 1A7XA 3O5DA 3TCZA 3AS2A 3WD4A 1D7HA 4P8VA 4W9OA 4ODPA 4DIPA 1OGGA 1BKFA 3GPKA 1ZU8A 3WD1A 1FD9A 1ZB5A 1JNEA 1W1YA 1D7IA 3NI6A 4JFMA 4LGXA 5DIVA 1X6LA 3WL1A 2ESCA 1FKGA 2MLZA 5HUAA 3W4RA 2JZVA 1HJXA 4DRIA 1W26A 2LGOA 2F23A 2MLXA 1D6OA 1TCOC 1F8AB 3KAIA 4HBOA 1K9TA 4JFIA 3O5PA 4GIVA 1J4IA 1Q1CA 2DG3A 1FKIA 3B9EA 3IKGA 3GU0A 3BXWA 4DRMA 1E6ZA 2XP3A 4UDMA 5DEZA 2LJ4A 4ODKA 3CHCA 2WM0A 2YBTA 2IF4A 1HKKA 3MDYB 5GPGA 2EULA 2ZR5A 1EDQA 4ZS6A 3UQIA 2PV2A 1E9LA 3ALFA 2ZQTA 1ZBWA 1OWQA 1W9PA 3CHFA 3RM8A 2M08A 2MNTA 1H0GA 5DO2A 2K8IA 5HW6A 2F2DA 3UI5A 4QT2A 3JYJA 1NSGA 2XP9A 1F40A 1L1PA 4DRPA 4W9QA 3O5KA 4U86A 1KT1A 2MPHA 4DZ3A 4W9PA 4NSBA 3KCEA 2IUZA 2DSZA 3ARRA 1X6NA 1W1TA 4ODNA 2RUDA 2YBUA 1WNOA 4TW6A 3FY1A 4TX0A 1ZCNA 1VF8A 2KFWA 4IT6A 3JYMA 4HARA 1TFVA 1P5QA 2DT3A 4URIA 1ROTA 4QT3A 4Q22A 2WK2A 1HJWA 4R0XA 3CZ8A 2G41A 2A3EA 4WIWA 5DITA 3AROA 2M1IA 4ITZA 2ZR4A 4S3KA 2ETNA 3O5RA 3O5IA 1GOIA 3WD2A 3B8SA 1EIBA 1FAPA 5HKGA 1OGBA 1HKJA 1FKJA 3RM4A 4L3NA 3WL0A 2PI6A 3TC5A 4IQ2A 4QIBA 4O2TA 4FN2A 2AOSA 1PBKA 4G2PA 1CTNA 4MPKA 4FAPA 3B9AA 4PTMA 4DH0A 2O92A 3ALGA 4TYOA 4DZ2A 4IPXA 2G8ZA 5D75A 2RURA 4N19A 1QPLA 2QF8A 4LAVA 1FKTA 1JVWA 1ZBVA 3GTYX 2Q5AA 4KR0B 3O5GA 1ZBCA 2PBCA 2M2AA 2KI3A 3VAWA 1W1PA 2A3AA 4ODQA 2XP7A 2PV3A 3AS3A 4S3JA 2P4VA 4MNLA 1NWTA 4TW8A 1N1AA 4MNKA 1ROUA 5DIUA 3OA5A 1J4RA 4MNMA 3KABA 3IKDA 1J4HA 4Z2JA 4W5UA 1QZ2A 2WLZA 4DRHA 3PRBA 4J4NA 2ITKA 3CHEA 4HBEA 1GPFA 4WKAA 3O5LA 4U84A 3UI6A 4DRKA 1FKBA 1KT0A 1GRJA 2RUCA 3ARUA 1R9HA 3PRDA 5HW7A 3CGMA 2XP8A 4L72B 2MF9A 5DF0A 1Y0OA 5HWCA 2UZ5A 2DG9A 5HTGA 4Z2KA 1JNSA 2ZQSA 2RQSA 1M5YA 3PR9A 3LUOA 3BMBA 1W1VA 1NWUA 1W9UA 1EQ3A 1XRVA 4LAYA 1W9VA 1LG2A 3PA7A 4DRNA 2FDMA 2F21A 4Z2GA 2ZQVA 3I6CA 4P8UA 1NMWA 3ARYA 3CH9A 3G6MA 4Q7NA 1D7JA 3O5JA 1U79A 1LG1A 4P8WA 2KR7A 3G6LA 4LAXA 1RD6A 4DROA 4ODLA 1YW5A 3EIPA 3KAGA 3RM9A 5B8IC 4WK9A 3PRAA 2DSUA 4MNJA 1SYTA 2XP5A 3B9DA 1BL4A 4ZPVR 2AWGA 2VN1A 3EY6A 2XP6A 3O5QA 1J6YA 4TNSA 3ARSA 2RUQA 4WKHA 2OFNA 1Q6UA 4JFLA 2B31A 4Z2IA 1Q6IA 4LAWA 2DT1A 1FKHA 4ODOA 1LL7A 2PV1A 4BF8A 3ARZA 4XAKA 4ML4A 3WQWA 3RMEA 4JFJA 1EYMA 3JXVA 3FXYA 2MLYA 4JFKA 4WJXA 1ZBKA 2DSWA 1O6IA 2DT2A 4MGVA 4IT4A 3NRKA 2KE0A 4MAVA 4U85A 1HJVA 2O9OA 3KZ7A 5HBFA 1ZL1A 3WD3A 2L2SA 1ITXA 3WKZA 1FFRA 2ZR6A 3ARTA 5J6EA 1Q6HA 4IQCA 4ODMA 3ODKA 1EHNA 4DRQA 2KGJA 1C9HA 1E44A 3IK8A 1SR0A
chains in the Genus database with same CATH topology
2N87A 1UR9A 1LQ0A 3WIJA 1H0IA 4R5EA 3KAFA 4AY1A 4QZVB 1FKRA 3B7XA 5HWBA 3AQUA 2DSVA 1LJYA 2DG4A 3UQBA 3H9RB 2A3BA 4KQZA 1HKMA 1E6PA 4TW7A 1ZK6A 3FAPA 2KO7A 3UF8A 5HW8A 5HT1A 5GQBA 2LPVA 1NWSA 4MSPA 3O5OA 3O5MA 2A3CA 2PPOA 4DT4A 3CHDA 2XPAA 1WB0A 3AS1A 1UR8A 2ZQUA 4DWSB 2PPPA 2VCDA 4ZPTR 1JNDA 1FKFA 3UI4A 1FFQA 1NMVA 3ARXA 4WKFA 2FAPA 3IHZA 4C02B 1KFWA 1T11A 1NH6A 4Z2HA 3ARPA 4DRJA 4P8XA 4JYSA 3UQAA 2RSEA 2D9FA 5I98A 1QPFA 4Z2LA 1WAWA 4DWSD 1D2KA 1NWRA 1LL4A 5JH8A 2OLHA 3CGNA 1XHGA 4GGQA 3O5EA 3ARQA 5BXJA 4ZPWR 1FKSA 3RGCA 4MTVA 3KACA 2PPNA 3AS0A 1FKDA 4DWSC 2XPBA 3KAHA 3KADA 1GUVA 1FKKA 4ODRA 1JNTA 2DPEA 1FKLA 3ARWA 1E6NA 2LKNA 3ARVA 3WD0A 1B6CA 5GPRA 1HXVA 1E6RA 2WLYA 4G50A 3WH0A 4DWSA 4J4OA 3TDBA 3RFWA 1HKIA 1FJDA 3O5FA 1PINA 2XP4A 1LL6A 3OOBA 2F4EA 3QOKA 1E15A 4NNRA 2FKEA 2DT0A 1IX5A 1YATA 4NZCA 3NTPA 3WQVA 2Y78A 1A7XA 3O5DA 3TCZA 3AS2A 3WD4A 1D7HA 4P8VA 4W9OA 4ODPA 4DIPA 1OGGA 1BKFA 3GPKA 1ZU8A 3WD1A 1FD9A 1ZB5A 1JNEA 1W1YA 1D7IA 3NI6A 4JFMA 4LGXA 5DIVA 1X6LA 3WL1A 2ESCA 1FKGA 2MLZA 5HUAA 3W4RA 2JZVA 1HJXA 4DRIA 1W26A 2LGOA 2MLXA 1D6OA 1TCOC 1F8AB 3KAIA 4HBOA 1K9TA 4JFIA 3O5PA 4GIVA 1J4IA 1Q1CA 2DG3A 1FKIA 3B9EA 3IKGA 4DRMA 3BXWA 1E6ZA 2XP3A 5DEZA 2LJ4A 4ODKA 3CHCA 2WM0A 2YBTA 2IF4A 1HKKA 3MDYB 5GPGA 3UQIA 2ZR5A 1EDQA 4ZS6A 2PV2A 1E9LA 3ALFA 2ZQTA 1ZBWA 1OWQA 1W9PA 3CHFA 3RM8A 2M08A 2MNTA 1H0GA 5DO2A 2K8IA 5HW6A 2F2DA 3UI5A 4QT2A 3JYJA 1NSGA 2XP9A 1F40A 1L1PA 4DRPA 4W9QA 3O5KA 4U86A 1KT1A 2MPHA 4DZ3A 4W9PA 4NSBA 3KCEA 2IUZA 2DSZA 3ARRA 1X6NA 1W1TA 4ODNA 2RUDA 2YBUA 1WNOA 4TW6A 3FY1A 4TX0A 1ZCNA 1VF8A 2KFWA 4IT6A 3JYMA 4HARA 1TFVA 1P5QA 2DT3A 4URIA 1ROTA 4QT3A 4Q22A 2WK2A 1HJWA 4R0XA 3CZ8A 2G41A 2A3EA 4WIWA 5DITA 3AROA 2M1IA 4ITZA 2ZR4A 4S3KA 3O5RA 3O5IA 1GOIA 3WD2A 3B8SA 1EIBA 1FAPA 5HKGA 1OGBA 1HKJA 1FKJA 3RM4A 4L3NA 3WL0A 2PI6A 3TC5A 4IQ2A 4QIBA 4O2TA 4FN2A 2AOSA 1PBKA 4G2PA 1CTNA 4MPKA 4FAPA 3B9AA 4PTMA 4DH0A 2O92A 3ALGA 4TYOA 4DZ2A 4IPXA 2G8ZA 5D75A 2RURA 4N19A 1QPLA 2QF8A 4LAVA 1FKTA 1JVWA 1ZBVA 2Q5AA 4KR0B 3O5GA 1ZBCA 2PBCA 2M2AA 2KI3A 3VAWA 1W1PA 2A3AA 4ODQA 2XP7A 2PV3A 3AS3A 4S3JA 4MNLA 1NWTA 4TW8A 1N1AA 4MNKA 1ROUA 5DIUA 3OA5A 1J4RA 4MNMA 3KABA 3IKDA 1J4HA 4Z2JA 4W5UA 1QZ2A 2WLZA 4DRHA 3PRBA 4J4NA 2ITKA 3CHEA 4HBEA 1GPFA 4WKAA 3O5LA 4U84A 3UI6A 4DRKA 1FKBA 1KT0A 2RUCA 3ARUA 1R9HA 3PRDA 5HW7A 3CGMA 2XP8A 4L72B 2MF9A 5DF0A 1Y0OA 5HWCA 2UZ5A 2DG9A 5HTGA 4Z2KA 1JNSA 2ZQSA 2RQSA 1M5YA 3PR9A 3LUOA 1W1VA 1NWUA 1W9UA 1EQ3A 1XRVA 4LAYA 1W9VA 1LG2A 3PA7A 4DRNA 2FDMA 2F21A 4Z2GA 2ZQVA 3I6CA 4P8UA 1NMWA 3ARYA 3CH9A 3G6MA 4Q7NA 1D7JA 3O5JA 1U79A 1LG1A 4P8WA 2KR7A 3G6LA 4LAXA 1RD6A 4DROA 4ODLA 1YW5A 3RM9A 3KAGA 5B8IC 4WK9A 3PRAA 2DSUA 4MNJA 1SYTA 2XP5A 3B9DA 1BL4A 4ZPVR 2AWGA 2VN1A 3EY6A 2XP6A 3O5QA 1J6YA 4TNSA 3ARSA 2RUQA 4WKHA 2OFNA 1Q6UA 4JFLA 2B31A 4Z2IA 1Q6IA 4LAWA 2DT1A 1FKHA 4ODOA 1LL7A 2PV1A 4BF8A 3ARZA 4XAKA 4ML4A 3WQWA 3RMEA 4JFJA 1EYMA 3JXVA 3FXYA 2MLYA 4JFKA 4WJXA 1ZBKA 2DSWA 1O6IA 2DT2A 4MGVA 4IT4A 3NRKA 2KE0A 4MAVA 4U85A 1HJVA 2O9OA 3KZ7A 5HBFA 1ZL1A 3WD3A 2L2SA 1ITXA 3WKZA 1FFRA 2ZR6A 3ARTA 5J6EA 1Q6HA 4IQCA 4ODMA 3ODKA 1EHNA 4DRQA 2KGJA 1C9HA 3IK8A 1SR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDB A;  2N87 A;  4TX0 A;  1ZCN A;  2UZ5 A;  2KFW A;  3RFW A;  1FJD A;  3O5F A;  2DG9 A;  5HTG A;  3JYM A;  1PIN A;  2XP4 A;  3OOB A;  2F4E A;  4NNR A;  1P5Q A;  2FKE A;  3KAF A;  1JNS A;  2ZQS A;  2RQS A;  1M5Y A;  1ROT A;  4QT3 A;  1YAT A;  3LUO A;  3NTP A;  1FKR A;  3B7X A;  2Y78 A;  1A7X A;  5HWB A;  3O5D A;  4R0X A;  3TCZ A;  2DG4 A;  3UQB A;  3H9R B;  1D7H A;  1EQ3 A;  4LAY A;  4W9O A;  5DIT A;  2M1I A;  4ODP A;  4TW7 A;  4DIP A;  4ITZ A;  2ZR4 A;  1ZK6 A;  1BKF A;  3PA7 A;  4DRN A;  3FAP A;  3GPK A;  2KO7 A;  3O5R A;  3UF8 A;  3O5I A;  2F21 A;  1FD9 A;  2ZQV A;  5HW8 A;  3I6C A;  1D7I A;  3NI6 A;  4JFM A;  5HT1 A;  5DIV A;  1NMW A;  2LPV A;  1FAP A;  1D7J A;  5HKG A;  3O5J A;  1U79 A;  4MSP A;  3O5O A;  3O5M A;  1FKJ A;  2PPO A;  4DT4 A;  2KR7 A;  2XPA A;  4LAX A;  4DRO A;  2ZQU A;  3TC5 A;  1FKG A;  2MLZ A;  4IQ2 A;  2PPP A;  5HUA A;  4QIB A;  2VCD A;  4O2T A;  2JZV A;  4ODL A;  1YW5 A;  3KAG A;  4DRI A;  1W26 A;  5B8I C;  1FKF A;  2LGO A;  4FN2 A;  3UI4 A;  1NMV A;  1PBK A;  2MLX A;  1D6O A;  1TCO C;  1F8A B;  2XP5 A;  3KAI A;  4G2P A;  1BL4 A;  2AWG A;  2VN1 A;  3EY6 A;  4FAP A;  4JFI A;  3O5P A;  2FAP A;  4GIV A;  3IHZ A;  1J4I A;  1Q1C A;  2XP6 A;  4C02 B;  1T11 A;  4DH0 A;  3O5Q A;  2DG3 A;  4TNS A;  1FKI A;  4TYO A;  1J6Y A;  4DZ2 A;  2RUQ A;  4IPX A;  2OFN A;  3IKG A;  1Q6U A;  5D75 A;  4DRM A;  2RUR A;  4N19 A;  1QPL A;  4JFL A;  4DRJ A;  4LAV A;  1FKT A;  2XP3 A;  4JYS A;  3UQA A;  1JVW A;  2RSE A;  2Q5A A;  1Q6I A;  2D9F A;  5I98 A;  3O5G A;  2LJ4 A;  1QPF A;  2PBC A;  1FKH A;  2M2A A;  4LAW A;  4ODK A;  4ODO A;  2PV1 A;  2KI3 A;  4BF8 A;  3VAW A;  4ODQ A;  2XP7 A;  4JFJ A;  1EYM A;  2IF4 A;  3JXV A;  3CGN A;  4TW6 A;  2PV3 A;  3O5E A;  4GGQ A;  3MDY B;  5GPG A;  3UQI A;  2MLY A;  2ZR5 A;  4JFK A;  2PV2 A;  2ZQT A;  5BXJ A;  4TW8 A;  1N1A A;  1FKS A;  1ROU A;  4MGV A;  5DIU A;  2M08 A;  2MNT A;  3NRK A;  3RGC A;  2KE0 A;  3KAC A;  1J4R A;  2K8I A;  3IK8 A;  3KAB A;  5HW6 A;  2F2D A;  2PPN A;  1FKD A;  1J4H A;  3IKD A;  4QT2 A;  4U85 A;  1QZ2 A;  3UI5 A;  3JYJ A;  4DRH A;  3PRB A;  2XPB A;  4J4N A;  1NSG A;  2ITK A;  3KAH A;  3KAD A;  3KZ7 A;  2L2S A;  2RUD A;  2XP9 A;  1F40 A;  1L1P A;  4DRP A;  1FKK A;  4W9Q A;  2ZR6 A;  4ODR A;  5J6E A;  1Q6H A;  1JNT A;  3O5L A;  3O5K A;  4IQC A;  4U86 A;  4U84 A;  1FKL A;  3UI6 A;  1KT1 A;  2MPH A;  4DZ3 A;  4DRK A;  4W9P A;  1FKB A;  1KT0 A;  3KCE A;  2LKN A;  4ODM A;  3ODK A;  2RUC A;  3PRD A;  1R9H A;  5HW7 A;  4DRQ A;  3CGM A;  1B6C A;  2XP8 A;  2KGJ A;  1HXV A;  1C9H A;  2MF9 A;  4G50 A;  4ODN A;  3WH0 A;  1Y0O A;  5HWC A;  4J4O A; 
#chains in the Genus database with same CATH topology
 2N87 A;  1UR9 A;  1LQ0 A;  3WIJ A;  1H0I A;  4R5E A;  3KAF A;  4AY1 A;  4QZV B;  1FKR A;  3B7X A;  5HWB A;  3AQU A;  2DSV A;  1LJY A;  2DG4 A;  3UQB A;  3H9R B;  2A3B A;  4KQZ A;  1HKM A;  1E6P A;  4TW7 A;  1ZK6 A;  3FAP A;  2KO7 A;  3UF8 A;  5HW8 A;  5HT1 A;  5GQB A;  2LPV A;  1NWS A;  4MSP A;  3O5O A;  3O5M A;  2A3C A;  2PPO A;  4DT4 A;  3CHD A;  2XPA A;  1WB0 A;  3AS1 A;  1UR8 A;  2ZQU A;  4DWS B;  2PPP A;  2VCD A;  4ZPT R;  1JND A;  1FKF A;  3UI4 A;  1FFQ A;  1NMV A;  3ARX A;  4WKF A;  2FAP A;  3IHZ A;  4C02 B;  1KFW A;  1T11 A;  1NH6 A;  4Z2H A;  3ARP A;  4DRJ A;  4P8X A;  4JYS A;  3UQA A;  2RSE A;  2D9F A;  5I98 A;  1QPF A;  4Z2L A;  1WAW A;  4DWS D;  1D2K A;  1NWR A;  1LL4 A;  2PN0 A;  2B5U B;  5JH8 A;  2OLH A;  3CGN A;  1XHG A;  4GGQ A;  3O5E A;  3ARQ A;  5BXJ A;  4ZPW R;  1FKS A;  1JCH B;  3RGC A;  4MTV A;  3KAC A;  2PPN A;  3AS0 A;  1FKD A;  4DWS C;  2XPB A;  3KAH A;  3KAD A;  1GUV A;  1FKK A;  4ODR A;  1JNT A;  2DPE A;  1FKL A;  3ARW A;  1E6N A;  2LKN A;  3ARV A;  3WD0 A;  1B6C A;  5GPR A;  1HXV A;  1E6R A;  2WLY A;  4G50 A;  3WH0 A;  4DWS A;  4J4O A;  3TDB A;  3RFW A;  1HKI A;  1FJD A;  3O5F A;  1PIN A;  2XP4 A;  1LL6 A;  3OOB A;  2F4E A;  3QOK A;  1E15 A;  4NNR A;  2FKE A;  2DT0 A;  1IX5 A;  1YAT A;  4NZC A;  3NTP A;  3WQV A;  2Y78 A;  1A7X A;  3O5D A;  3TCZ A;  3AS2 A;  3WD4 A;  1D7H A;  4P8V A;  4W9O A;  4ODP A;  4DIP A;  1OGG A;  1BKF A;  3GPK A;  1ZU8 A;  3WD1 A;  1FD9 A;  1ZB5 A;  1JNE A;  1W1Y A;  1D7I A;  3NI6 A;  4JFM A;  4LGX A;  5DIV A;  1X6L A;  3WL1 A;  2ESC A;  1FKG A;  2MLZ A;  5HUA A;  3W4R A;  2JZV A;  1HJX A;  4DRI A;  1W26 A;  2LGO A;  2F23 A;  2MLX A;  1D6O A;  1TCO C;  1F8A B;  3KAI A;  4HBO A;  1K9T A;  4JFI A;  3O5P A;  4GIV A;  1J4I A;  1Q1C A;  2DG3 A;  1FKI A;  3B9E A;  3IKG A;  3GU0 A;  3BXW A;  4DRM A;  1E6Z A;  2XP3 A;  4UDM A;  5DEZ A;  2LJ4 A;  4ODK A;  3CHC A;  2WM0 A;  2YBT A;  2IF4 A;  1HKK A;  3MDY B;  5GPG A;  2EUL A;  2ZR5 A;  1EDQ A;  4ZS6 A;  3UQI A;  2PV2 A;  1E9L A;  3ALF A;  2ZQT A;  1ZBW A;  1OWQ A;  1W9P A;  3CHF A;  3RM8 A;  2M08 A;  2MNT A;  1H0G A;  5DO2 A;  2K8I A;  5HW6 A;  2F2D A;  3UI5 A;  4QT2 A;  3JYJ A;  1NSG A;  2XP9 A;  1F40 A;  1L1P A;  4DRP A;  4W9Q A;  3O5K A;  4U86 A;  1KT1 A;  2MPH A;  4DZ3 A;  4W9P A;  4NSB A;  3KCE A;  2IUZ A;  2DSZ A;  3ARR A;  1X6N A;  1W1T A;  4ODN A;  2RUD A;  2YBU A;  1WNO A;  4TW6 A;  3FY1 A;  4TX0 A;  1ZCN A;  1VF8 A;  2KFW A;  4IT6 A;  3JYM A;  4HAR A;  1TFV A;  1P5Q A;  2DT3 A;  4URI A;  1ROT A;  4QT3 A;  4Q22 A;  2WK2 A;  1HJW A;  4R0X A;  3CZ8 A;  2G41 A;  2A3E A;  4WIW A;  5DIT A;  3ARO A;  2M1I A;  4ITZ A;  2ZR4 A;  4S3K A;  2ETN A;  3O5R A;  3O5I A;  1GOI A;  3WD2 A;  3B8S A;  1EIB A;  1FAP A;  5HKG A;  1OGB A;  1HKJ A;  1FKJ A;  3RM4 A;  4L3N A;  3WL0 A;  2PI6 A;  3TC5 A;  4IQ2 A;  4QIB A;  4O2T A;  4FN2 A;  2AOS A;  1PBK A;  4G2P A;  1CTN A;  4MPK A;  4FAP A;  3B9A A;  4PTM A;  4DH0 A;  2O92 A;  3ALG A;  4TYO A;  4DZ2 A;  4IPX A;  2G8Z A;  5D75 A;  2RUR A;  4N19 A;  1QPL A;  2QF8 A;  4LAV A;  1FKT A;  1JVW A;  1ZBV A;  3GTY X;  2Q5A A;  4KR0 B;  3O5G A;  1ZBC A;  2PBC A;  2M2A A;  2KI3 A;  3VAW A;  1W1P A;  2A3A A;  4ODQ A;  2XP7 A;  2PV3 A;  3AS3 A;  4S3J A;  2P4V A;  4MNL A;  1NWT A;  4TW8 A;  1N1A A;  4MNK A;  1ROU A;  5DIU A;  3OA5 A;  1J4R A;  4MNM A;  3KAB A;  3IKD A;  1J4H A;  4Z2J A;  4W5U A;  1QZ2 A;  2WLZ A;  4DRH A;  3PRB A;  4J4N A;  2ITK A;  3CHE A;  4HBE A;  1GPF A;  4WKA A;  3O5L A;  4U84 A;  3UI6 A;  4DRK A;  1FKB A;  1KT0 A;  1GRJ A;  2RUC A;  3ARU A;  1R9H A;  3PRD A;  5HW7 A;  3CGM A;  2XP8 A;  4L72 B;  2MF9 A;  5DF0 A;  1Y0O A;  5HWC A;  2UZ5 A;  2DG9 A;  5HTG A;  4Z2K A;  1JNS A;  2ZQS A;  2RQS A;  1M5Y A;  3PR9 A;  3LUO A;  3BMB A;  1W1V A;  1NWU A;  1W9U A;  1EQ3 A;  1XRV A;  4LAY A;  1W9V A;  1LG2 A;  3PA7 A;  4DRN A;  2FDM A;  2F21 A;  4Z2G A;  2ZQV A;  3I6C A;  4P8U A;  1NMW A;  3ARY A;  3CH9 A;  3G6M A;  4Q7N A;  1D7J A;  3O5J A;  1U79 A;  1LG1 A;  4P8W A;  2KR7 A;  3G6L A;  4LAX A;  1RD6 A;  4DRO A;  4ODL A;  1YW5 A;  3EIP A;  3KAG A;  3RM9 A;  5B8I C;  4WK9 A;  3PRA A;  2DSU A;  4MNJ A;  1SYT A;  2XP5 A;  3B9D A;  1BL4 A;  4ZPV R;  2AWG A;  2VN1 A;  3EY6 A;  2XP6 A;  3O5Q A;  1J6Y A;  4TNS A;  3ARS A;  2RUQ A;  4WKH A;  2OFN A;  1Q6U A;  4JFL A;  2B31 A;  4Z2I A;  1Q6I A;  4LAW A;  2DT1 A;  1FKH A;  4ODO A;  1LL7 A;  2PV1 A;  4BF8 A;  3ARZ A;  4XAK A;  4ML4 A;  3WQW A;  3RME A;  4JFJ A;  1EYM A;  3JXV A;  3FXY A;  2MLY A;  4JFK A;  4WJX A;  1ZBK A;  2DSW A;  1O6I A;  2DT2 A;  4MGV A;  4IT4 A;  3NRK A;  2KE0 A;  4MAV A;  4U85 A;  1HJV A;  2O9O A;  3KZ7 A;  5HBF A;  1ZL1 A;  3WD3 A;  2L2S A;  1ITX A;  3WKZ A;  1FFR A;  2ZR6 A;  3ART A;  5J6E A;  1Q6H A;  4IQC A;  4ODM A;  3ODK A;  1EHN A;  4DRQ A;  2KGJ A;  1C9H A;  1E44 A;  3IK8 A;  1SR0 A; 
#chains in the Genus database with same CATH homology
 2N87 A;  1UR9 A;  1LQ0 A;  3WIJ A;  1H0I A;  4R5E A;  3KAF A;  4AY1 A;  4QZV B;  1FKR A;  3B7X A;  5HWB A;  3AQU A;  2DSV A;  1LJY A;  2DG4 A;  3UQB A;  3H9R B;  2A3B A;  4KQZ A;  1HKM A;  1E6P A;  4TW7 A;  1ZK6 A;  3FAP A;  2KO7 A;  3UF8 A;  5HW8 A;  5HT1 A;  5GQB A;  2LPV A;  1NWS A;  4MSP A;  3O5O A;  3O5M A;  2A3C A;  2PPO A;  4DT4 A;  3CHD A;  2XPA A;  1WB0 A;  3AS1 A;  1UR8 A;  2ZQU A;  4DWS B;  2PPP A;  2VCD A;  4ZPT R;  1JND A;  1FKF A;  3UI4 A;  1FFQ A;  1NMV A;  3ARX A;  4WKF A;  2FAP A;  3IHZ A;  4C02 B;  1KFW A;  1T11 A;  1NH6 A;  4Z2H A;  3ARP A;  4DRJ A;  4P8X A;  4JYS A;  3UQA A;  2RSE A;  2D9F A;  5I98 A;  1QPF A;  4Z2L A;  1WAW A;  4DWS D;  1D2K A;  1NWR A;  1LL4 A;  5JH8 A;  2OLH A;  3CGN A;  1XHG A;  4GGQ A;  3O5E A;  3ARQ A;  5BXJ A;  4ZPW R;  1FKS A;  3RGC A;  4MTV A;  3KAC A;  2PPN A;  3AS0 A;  1FKD A;  4DWS C;  2XPB A;  3KAH A;  3KAD A;  1GUV A;  1FKK A;  4ODR A;  1JNT A;  2DPE A;  1FKL A;  3ARW A;  1E6N A;  2LKN A;  3ARV A;  3WD0 A;  1B6C A;  5GPR A;  1HXV A;  1E6R A;  2WLY A;  4G50 A;  3WH0 A;  4DWS A;  4J4O A;  3TDB A;  3RFW A;  1HKI A;  1FJD A;  3O5F A;  1PIN A;  2XP4 A;  1LL6 A;  3OOB A;  2F4E A;  3QOK A;  1E15 A;  4NNR A;  2FKE A;  2DT0 A;  1IX5 A;  1YAT A;  4NZC A;  3NTP A;  3WQV A;  2Y78 A;  1A7X A;  3O5D A;  3TCZ A;  3AS2 A;  3WD4 A;  1D7H A;  4P8V A;  4W9O A;  4ODP A;  4DIP A;  1OGG A;  1BKF A;  3GPK A;  1ZU8 A;  3WD1 A;  1FD9 A;  1ZB5 A;  1JNE A;  1W1Y A;  1D7I A;  3NI6 A;  4JFM A;  4LGX A;  5DIV A;  1X6L A;  3WL1 A;  2ESC A;  1FKG A;  2MLZ A;  5HUA A;  3W4R A;  2JZV A;  1HJX A;  4DRI A;  1W26 A;  2LGO A;  2MLX A;  1D6O A;  1TCO C;  1F8A B;  3KAI A;  4HBO A;  1K9T A;  4JFI A;  3O5P A;  4GIV A;  1J4I A;  1Q1C A;  2DG3 A;  1FKI A;  3B9E A;  3IKG A;  4DRM A;  3BXW A;  1E6Z A;  2XP3 A;  5DEZ A;  2LJ4 A;  4ODK A;  3CHC A;  2WM0 A;  2YBT A;  2IF4 A;  1HKK A;  3MDY B;  5GPG A;  3UQI A;  2ZR5 A;  1EDQ A;  4ZS6 A;  2PV2 A;  1E9L A;  3ALF A;  2ZQT A;  1ZBW A;  1OWQ A;  1W9P A;  3CHF A;  3RM8 A;  2M08 A;  2MNT A;  1H0G A;  5DO2 A;  2K8I A;  5HW6 A;  2F2D A;  3UI5 A;  4QT2 A;  3JYJ A;  1NSG A;  2XP9 A;  1F40 A;  1L1P A;  4DRP A;  4W9Q A;  3O5K A;  4U86 A;  1KT1 A;  2MPH A;  4DZ3 A;  4W9P A;  4NSB A;  3KCE A;  2IUZ A;  2DSZ A;  3ARR A;  1X6N A;  1W1T A;  4ODN A;  2RUD A;  2YBU A;  1WNO A;  4TW6 A;  3FY1 A;  4TX0 A;  1ZCN A;  1VF8 A;  2KFW A;  4IT6 A;  3JYM A;  4HAR A;  1TFV A;  1P5Q A;  2DT3 A;  4URI A;  1ROT A;  4QT3 A;  4Q22 A;  2WK2 A;  1HJW A;  4R0X A;  3CZ8 A;  2G41 A;  2A3E A;  4WIW A;  5DIT A;  3ARO A;  2M1I A;  4ITZ A;  2ZR4 A;  4S3K A;  3O5R A;  3O5I A;  1GOI A;  3WD2 A;  3B8S A;  1EIB A;  1FAP A;  5HKG A;  1OGB A;  1HKJ A;  1FKJ A;  3RM4 A;  4L3N A;  3WL0 A;  2PI6 A;  3TC5 A;  4IQ2 A;  4QIB A;  4O2T A;  4FN2 A;  2AOS A;  1PBK A;  4G2P A;  1CTN A;  4MPK A;  4FAP A;  3B9A A;  4PTM A;  4DH0 A;  2O92 A;  3ALG A;  4TYO A;  4DZ2 A;  4IPX A;  2G8Z A;  5D75 A;  2RUR A;  4N19 A;  1QPL A;  2QF8 A;  4LAV A;  1FKT A;  1JVW A;  1ZBV A;  2Q5A A;  4KR0 B;  3O5G A;  1ZBC A;  2PBC A;  2M2A A;  2KI3 A;  3VAW A;  1W1P A;  2A3A A;  4ODQ A;  2XP7 A;  2PV3 A;  3AS3 A;  4S3J A;  4MNL A;  1NWT A;  4TW8 A;  1N1A A;  4MNK A;  1ROU A;  5DIU A;  3OA5 A;  1J4R A;  4MNM A;  3KAB A;  3IKD A;  1J4H A;  4Z2J A;  4W5U A;  1QZ2 A;  2WLZ A;  4DRH A;  3PRB A;  4J4N A;  2ITK A;  3CHE A;  4HBE A;  1GPF A;  4WKA A;  3O5L A;  4U84 A;  3UI6 A;  4DRK A;  1FKB A;  1KT0 A;  2RUC A;  3ARU A;  1R9H A;  3PRD A;  5HW7 A;  3CGM A;  2XP8 A;  4L72 B;  2MF9 A;  5DF0 A;  1Y0O A;  5HWC A;  2UZ5 A;  2DG9 A;  5HTG A;  4Z2K A;  1JNS A;  2ZQS A;  2RQS A;  1M5Y A;  3PR9 A;  3LUO A;  1W1V A;  1NWU A;  1W9U A;  1EQ3 A;  1XRV A;  4LAY A;  1W9V A;  1LG2 A;  3PA7 A;  4DRN A;  2FDM A;  2F21 A;  4Z2G A;  2ZQV A;  3I6C A;  4P8U A;  1NMW A;  3ARY A;  3CH9 A;  3G6M A;  4Q7N A;  1D7J A;  3O5J A;  1U79 A;  1LG1 A;  4P8W A;  2KR7 A;  3G6L A;  4LAX A;  1RD6 A;  4DRO A;  4ODL A;  1YW5 A;  3RM9 A;  3KAG A;  5B8I C;  4WK9 A;  3PRA A;  2DSU A;  4MNJ A;  1SYT A;  2XP5 A;  3B9D A;  1BL4 A;  4ZPV R;  2AWG A;  2VN1 A;  3EY6 A;  2XP6 A;  3O5Q A;  1J6Y A;  4TNS A;  3ARS A;  2RUQ A;  4WKH A;  2OFN A;  1Q6U A;  4JFL A;  2B31 A;  4Z2I A;  1Q6I A;  4LAW A;  2DT1 A;  1FKH A;  4ODO A;  1LL7 A;  2PV1 A;  4BF8 A;  3ARZ A;  4XAK A;  4ML4 A;  3WQW A;  3RME A;  4JFJ A;  1EYM A;  3JXV A;  3FXY A;  2MLY A;  4JFK A;  4WJX A;  1ZBK A;  2DSW A;  1O6I A;  2DT2 A;  4MGV A;  4IT4 A;  3NRK A;  2KE0 A;  4MAV A;  4U85 A;  1HJV A;  2O9O A;  3KZ7 A;  5HBF A;  1ZL1 A;  3WD3 A;  2L2S A;  1ITX A;  3WKZ A;  1FFR A;  2ZR6 A;  3ART A;  5J6E A;  1Q6H A;  4IQC A;  4ODM A;  3ODK A;  1EHN A;  4DRQ A;  2KGJ A;  1C9H A;  3IK8 A;  1SR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...