5DITA

The fk1 domain of fkbp51 in complex with the new synthetic ligand (1r)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2s)-1-[(2s,3r)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ditA00
3UQAA 2ZQSA 2RURA 2RUDA 3PRBA 3UQIA 4DRJA 4TW7A 5D75A 1J4IA 1A7XA 3NRKA 2DG3A 4GIVA 3B7XA 2MLXA 4N19A 4BF8A 4TX0A 3LUOA 5HWBA 4DIPA 3NTPA 2KE0A 2ZR4A 4QIBA 2K8IA 2PV3A 3KAIA 4TYOA 4DRKA 4DZ3A 2XP8A 1D7JA 4DZ2A 2RUCA 4ODPA 3IK8A 3JXVA 1D7IA 3O5KA 2PPPA 4DRHA 1Q1CA 1BKFA 3O5IA 1FKTA 5HW8A 1FKKA 1YW5A 3EY6A 1J6YA 2ZQTA 4JFJA 3RGCA 5BXJA 3O5LA 4DRPA 4ODNA 4MSPA 4QT3A 4JFIA 3KADA 3CGNA 2KR7A 2PBCA 3O5JA 4TNSA 4JFMA 2AWGA 1J4HA 1FKHA 2DG9A 2PPOA 3O5FA 2KGJA 1J4RA 2M2AA 5HTGA 1D7HA 1TCOC 2FKEA 2XPBA 3TCZA 3OOBA 4ODOA 4MGVA 1KT0A 2PPNA 2XP5A 4ODMA 4DROA 5HT1A 3H9RB 3KZ7A 3O5QA 5HW7A 3UI6A 4IQ2A 3O5DA 1FKLA 3KCEA 2IF4A 1R9HA 2F2DA 3FAPA 4G50A 2Q5AA 2ZQVA 2F21A 4U86A 3WH0A 2XPAA 1EQ3A 2VCDA 3KAFA 2JZVA 2XP9A 2ZQUA 3MDYB 1FKSA 4W9QA 1FKRA 1ZK6A 1NMVA 3PRDA 4LAYA 4JFLA 3UI4A 2D9FA 2XP7A 1QPLA 4JYSA 2MLYA 1F8AB 5J6EA 1FJDA 1NMWA 2KO7A 2LGOA 3O5RA 1D6OA 4GGQA 2XP6A 4G2PA 2MPHA 2PV1A 4J4OA 4FN2A 2MNTA 4DRIA 2Y78A 1FAPA 4FAPA 1M5YA 2XP4A 4ODRA 1FKBA 4LAXA 2PV2A 3CGMA 1PINA 4JFKA 4DH0A 4ODQA 1ROUA 2LPVA 1FKFA 1Y0OA 3O5OA 3KAHA 2KI3A 1FKJA 2ITKA 2M08A 2KFWA 2RSEA 3IHZA 3ODKA 4TW8A 3KABA 1Q6UA 4DRQA 2RQSA 2DG4A 4O2TA 4QT2A 3UF8A 3IKDA 4DRMA 4R0XA 2M1IA 5HUAA 2VN1A 4W9OA 2XP3A 3NI6A 5B8IC 3IKGA 2N87A 1FKIA 1T11A 1QZ2A 2FAPA 3TC5A 1JNSA 1JVWA 3O5GA 3KAGA 1FKDA 2OFNA 3JYMA 5HW6A 4DRNA 1BL4A 2UZ5A 3KACA 3O5MA 4IQCA 1KT1A 4J4NA 5DITA 1U79A 4IPXA 2ZR5A 4DT4A 4TW6A 3TDBA 3VAWA 1B6CA 1FD9A 1Q6HA 1PBKA 5GPGA 1YATA 4ITZA 4U84A 3UI5A 5I98A 1JNTA 1ROTA 2L2SA 1P5QA 1NSGA 1Q6IA 2MLZA 3PA7A 3GPKA 4C02B 4U85A 2LJ4A 5DIVA 1EYMA 3UQBA 3O5EA 2RUQA 1F40A 3RFWA 1HXVA 4NNRA 2MF9A 3JYJA 4LAVA 5DIUA 4ODLA 2F4EA 4LAWA 4W9PA 1ZCNA 5HKGA 4ODKA 1C9HA 1W26A 2ZR6A 1L1PA 3O5PA 1FKGA 1N1AA 5HWCA 3I6CA 1QPFA 2LKNA
chains in the Genus database with same CATH superfamily
2RUDA 3UQIA 3W4RA 4TW7A 5D75A 4DRJA 5DO2A 1HKKA 2MLXA 4BF8A 4R5EA 3WD0A 4DIPA 3WD2A 4QIBA 2PV3A 3KAIA 4MNLA 4Z2IA 5DF0A 1E9LA 4MNJA 4DWSD 3JXVA 4UDMA 1BKFA 1E44A 1H0IA 3G6LA 4MNKA 1FKKA 4WIWA 1LL4A 1NWRA 2ZQTA 3RGCA 4HBOA 4ODNA 3KADA 2KR7A 4Z2JA 3O5JA 4WKAA 1FKHA 3O5FA 3RM4A 5HTGA 1J4RA 1E15A 1HJWA 3WD3A 1KT0A 4ODMA 5HT1A 3WD1A 1X6NA 3FAPA 2F2DA 4G50A 1FKRA 4W9QA 1EIBA 2D9FA 1QPLA 2MLYA 2KO7A 3EIPA 4L3NA 1M5YA 2EULA 2PV2A 1JNDA 1PINA 2LPVA 1Y0OA 3ALGA 3O5OA 2ITKA 2M08A 3ARVA 3WQVA 3KABA 1W9VA 5HUAA 3ARSA 4HBEA 3RM8A 1NH6A 3CHCA 2N87A 1FKIA 1T11A 2FAPA 4DWSB 3TC5A 1FKDA 5HW6A 4ZPVR 3KACA 3B8SA 4J4NA 1LL7A 1U79A 4IPXA 3VAWA 1Q6HA 1FD9A 2YBUA 1FFQA 4ITZA 3UI5A 1FFRA 5DIVA 1EYMA 3UQBA 2RUQA 2P4VA 1F40A 1GPFA 1HXVA 1W9PA 4NNRA 3CH9A 5DIUA 2F4EA 1ZCNA 4ODKA 4WKFA 3CZ8A 1FKGA 3UI4A 4QT2A 2RURA 3PRBA 2DG3A 4GIVA 1LG2A 2KE0A 4DZ3A 2XP8A 2RUCA 4ODPA 3IK8A 1D7IA 2PPPA 1NWSA 1Q1CA 3O5IA 1J6YA 3GU0A 4JFIA 3CGNA 1ZBKA 2PBCA 4TNSA 4WJXA 1J4HA 2DG9A 2G8ZA 2KGJA 2FKEA 3AS1A 4AY1A 4MAVA 2XPBA 2OLHA 1IX5A 2PPNA 4DROA 3H9RB 3O5QA 2PI6A 4IQ2A 3O5DA 2IF4A 1RD6A 2ZQVA 4U86A 1XHGA 2XPAA 1EQ3A 1SR0A 1ZK6A 2B5UB 3AS3A 5J6EA 1F8AB 2LGOA 1ZBVA 1W9UA 4GGQA 3ARYA 1E6PA 4FN2A 2MNTA 4ZPWR 4DRIA 1ZU8A 2Y78A 2O92A 2DT1A 1FKBA 4ODQA 1OWQA 1H0GA 2ETNA 2KFWA 2RSEA 1Q6UA 4MNMA 1UR9A 2M1IA 4ZPTR 2XP3A 4DWSC 2PN0A 3B9EA 4MTVA 3GTYX 1GOIA 3CHDA 2UZ5A 1ZBWA 1KT1A 2B31A 3AS0A 1UR8A 4DT4A 3TDBA 1E6ZA 1JCHB 1B6CA 2YBTA 4XAKA 1E6NA 4U84A 5I98A 1ROTA 2L2SA 1P5QA 4DRNA 3O5EA 3RFWA 3RMEA 3JYJA 4LAWA 1ITXA 3WD4A 1L1PA 1N1AA 5HWCA 4MPKA 3UQAA 4DWSA 5HBFA 1WB0A 3B7XA 2A3AA 2IUZA 4TX0A 5HWBA 1EDQA 3NTPA 4TYOA 2K8IA 4DRKA 1OGBA 1D7JA 4DZ2A 2DSWA 1E6RA 4DRHA 2FDMA 1FKTA 4Z2LA 3ARUA 5HW8A 3ARWA 3ARTA 5BXJA 4QT3A 3ARRA 2DSUA 4JFMA 2AWGA 2PPOA 1D7HA 1GUVA 1TCOC 2G41A 3OOBA 3WKZA 4MGVA 3ARZA 2XP5A 4Z2GA 5HW7A 3UI6A 1FKLA 2DPEA 2Q5AA 2F21A 3WH0A 2VCDA 1HKMA 2JZVA 1NMVA 4LAYA 4JFLA 4PTMA 1K9TA 4JYSA 4KQZA 1HJVA 4G2PA 2PV1A 1FAPA 4FAPA 4ODRA 3FY1A 3CGMA 4JFKA 1ROUA 3ARQA 1FKFA 3BXWA 1HJXA 1HKJA 1KFWA 2KI3A 1FKJA 3IHZA 3ODKA 4TW8A 2A3BA 3G6MA 4DRQA 2RQSA 2DG4A 3ARXA 2QF8A 4P8XA 4R0XA 4W9OA 5B8IC 3NI6A 2O9OA 4P8UA 1ZBCA 1QZ2A 1W1YA 4Q22A 2WM0A 1JNSA 1JVWA 3O5GA 5JH8A 2OFNA 3JYMA 2A3CA 4S3JA 4IQCA 3O5MA 1LL6A 4IT6A 2WLYA 1NWUA 2DT0A 3WL1A 4L72B 1PBKA 4ZS6A 2WK2A 5GPGA 4LGXA 1YATA 4KR0B 4S3KA 1NSGA 2MLZA 4U85A 2LJ4A 5GQBA 1O6IA 2DSZA 4QZVB 2MF9A 1JNEA 4LAVA 4ODLA 4W9PA 5HKGA 4HARA 3AS2A 1C9HA 3O5PA 1GRJA 3I6CA 1QPFA 2LKNA 4P8WA 2ZQSA 3RM9A 1J4IA 1A7XA 3NRKA 1VF8A 4N19A 4WK9A 3LUOA 2ZR4A 3O5KA 4WKHA 2A3EA 3B9AA 4URIA 1YW5A 3EY6A 4JFJA 4W5UA 3O5LA 4DRPA 3BMBA 4MSPA 1EHNA 1WNOA 4NSBA 2F23A 1ZB5A 4ML4A 3PR9A 2M2AA 2DT3A 1NWTA 3TCZA 1OGGA 4ODOA 3CHEA 3OA5A 1LJYA 3KZ7A 4NZCA 2WLZA 2AOSA 3ALFA 3KCEA 1R9HA 1LQ0A 1WAWA 2DT2A 3KAFA 2XP9A 2ZQUA 3MDYB 1FKSA 3PRDA 2XP7A 1ZL1A 1FJDA 1NMWA 3O5RA 1D6OA 4Z2KA 2XP6A 2MPHA 4J4OA 3B9DA 1X6LA 1LG1A 2XP4A 3WQWA 4DH0A 3KAHA 3WIJA 4O2TA 3WL0A 3UF8A 3IKDA 4DRMA 5DEZA 2VN1A 3IKGA 2ESCA 3KAGA 1W1PA 1BL4A 3PRAA 5DITA 2ZR5A 3ARPA 4TW6A 1HKIA 4Z2HA 1TFVA 3QOKA 2DSVA 1W1VA 1CTNA 3AQUA 1JNTA 5GPRA 1Q6IA 3PA7A 4C02B 3GPKA 4P8VA 1W1TA 4IT4A 1D2KA 1SYTA 3CHFA 3AROA 1XRVA 1W26A 2ZR6A 4LAXA 3FXYA 4Q7NA
chains in the Genus database with same CATH topology
2RUDA 3UQIA 3W4RA 4TW7A 5D75A 4DRJA 5DO2A 1HKKA 2MLXA 4BF8A 4R5EA 3WD0A 4DIPA 3WD2A 4QIBA 2PV3A 3KAIA 4MNLA 4Z2IA 5DF0A 1E9LA 4MNJA 4DWSD 3JXVA 1BKFA 1H0IA 3G6LA 4MNKA 1FKKA 4WIWA 1LL4A 1NWRA 2ZQTA 3RGCA 4HBOA 4ODNA 3KADA 2KR7A 4Z2JA 3O5JA 4WKAA 1FKHA 3O5FA 3RM4A 5HTGA 1J4RA 1E15A 1HJWA 3WD3A 1KT0A 4ODMA 5HT1A 3WD1A 1X6NA 3FAPA 2F2DA 4G50A 1FKRA 4W9QA 1EIBA 2D9FA 1QPLA 2MLYA 2KO7A 4L3NA 1M5YA 2PV2A 1JNDA 1PINA 2LPVA 1Y0OA 3O5OA 3ALGA 2ITKA 2M08A 3ARVA 3WQVA 3KABA 1W9VA 5HUAA 3ARSA 4HBEA 3RM8A 1NH6A 3CHCA 2N87A 1FKIA 1T11A 2FAPA 4DWSB 3TC5A 1FKDA 5HW6A 4ZPVR 3KACA 3B8SA 4J4NA 1LL7A 1U79A 4IPXA 3VAWA 1Q6HA 1FD9A 2YBUA 1FFQA 4ITZA 3UI5A 1FFRA 5DIVA 1EYMA 3UQBA 2RUQA 1F40A 1GPFA 1HXVA 1W9PA 4NNRA 3CH9A 5DIUA 2F4EA 1ZCNA 4ODKA 4WKFA 3CZ8A 1FKGA 3UI4A 4QT2A 2RURA 3PRBA 2DG3A 4GIVA 1LG2A 2KE0A 4DZ3A 2XP8A 2RUCA 4ODPA 3IK8A 1D7IA 2PPPA 1NWSA 1Q1CA 3O5IA 1J6YA 4JFIA 3CGNA 1ZBKA 2PBCA 4TNSA 4WJXA 1J4HA 2DG9A 2G8ZA 2KGJA 2FKEA 3AS1A 4AY1A 4MAVA 2XPBA 2OLHA 1IX5A 2PPNA 4DROA 3H9RB 3O5QA 2PI6A 4IQ2A 3O5DA 2IF4A 1RD6A 2ZQVA 4U86A 1XHGA 2XPAA 1EQ3A 1SR0A 1ZK6A 3AS3A 5J6EA 1F8AB 2LGOA 1ZBVA 1W9UA 4GGQA 3ARYA 1E6PA 4FN2A 2MNTA 4ZPWR 4DRIA 1ZU8A 2Y78A 2O92A 2DT1A 1FKBA 4ODQA 1OWQA 1H0GA 2KFWA 2RSEA 1Q6UA 4MNMA 1UR9A 2M1IA 4ZPTR 2XP3A 4DWSC 3B9EA 4MTVA 1GOIA 3CHDA 2UZ5A 1ZBWA 1KT1A 2B31A 3AS0A 1UR8A 4DT4A 3TDBA 1E6ZA 1B6CA 2YBTA 4XAKA 1E6NA 4U84A 5I98A 1ROTA 2L2SA 1P5QA 4DRNA 3O5EA 3RFWA 3RMEA 3JYJA 4LAWA 1ITXA 3WD4A 1L1PA 1N1AA 5HWCA 4MPKA 3UQAA 4DWSA 5HBFA 1WB0A 3B7XA 2A3AA 2IUZA 4TX0A 5HWBA 1EDQA 3NTPA 4TYOA 2K8IA 4DRKA 1OGBA 1D7JA 4DZ2A 2DSWA 1E6RA 4DRHA 2FDMA 1FKTA 4Z2LA 3ARUA 5HW8A 3ARWA 3ARTA 5BXJA 4QT3A 3ARRA 2DSUA 4JFMA 2AWGA 2PPOA 1D7HA 1GUVA 1TCOC 2G41A 3OOBA 3WKZA 4MGVA 3ARZA 2XP5A 4Z2GA 5HW7A 3UI6A 1FKLA 2DPEA 2Q5AA 2F21A 3WH0A 2VCDA 1HKMA 2JZVA 1NMVA 4LAYA 4JFLA 4PTMA 1K9TA 4JYSA 4KQZA 1HJVA 4G2PA 2PV1A 1FAPA 4FAPA 4ODRA 3FY1A 3CGMA 4JFKA 1ROUA 3ARQA 1FKFA 3BXWA 1HJXA 1HKJA 1KFWA 2KI3A 1FKJA 3IHZA 3ODKA 4TW8A 2A3BA 3G6MA 4DRQA 2RQSA 2DG4A 3ARXA 2QF8A 4P8XA 4R0XA 4W9OA 5B8IC 3NI6A 2O9OA 4P8UA 1ZBCA 1QZ2A 1W1YA 4Q22A 2WM0A 1JNSA 1JVWA 3O5GA 5JH8A 2OFNA 3JYMA 2A3CA 4S3JA 4IQCA 3O5MA 1LL6A 4IT6A 2WLYA 1NWUA 2DT0A 3WL1A 4L72B 1PBKA 4ZS6A 2WK2A 5GPGA 4LGXA 1YATA 4KR0B 4S3KA 1NSGA 2MLZA 4U85A 2LJ4A 5GQBA 1O6IA 2DSZA 4QZVB 2MF9A 1JNEA 4LAVA 4ODLA 4W9PA 5HKGA 4HARA 3AS2A 1C9HA 3O5PA 3I6CA 1QPFA 2LKNA 4P8WA 2ZQSA 3RM9A 1J4IA 1A7XA 3NRKA 1VF8A 4N19A 4WK9A 3LUOA 2ZR4A 3O5KA 4WKHA 2A3EA 3B9AA 4URIA 1YW5A 3EY6A 4JFJA 4W5UA 3O5LA 4DRPA 4MSPA 1EHNA 1WNOA 4NSBA 4ML4A 1ZB5A 3PR9A 2M2AA 2DT3A 1NWTA 3TCZA 1OGGA 4ODOA 3CHEA 3OA5A 1LJYA 3KZ7A 4NZCA 2WLZA 2AOSA 3ALFA 3KCEA 1R9HA 1LQ0A 1WAWA 2DT2A 3KAFA 2XP9A 2ZQUA 3MDYB 1FKSA 3PRDA 2XP7A 1ZL1A 1FJDA 1NMWA 3O5RA 1D6OA 4Z2KA 2XP6A 2MPHA 4J4OA 3B9DA 1X6LA 1LG1A 2XP4A 3WQWA 4DH0A 3KAHA 3WIJA 4O2TA 3WL0A 3UF8A 3IKDA 4DRMA 5DEZA 2VN1A 3IKGA 2ESCA 3KAGA 1W1PA 1BL4A 3PRAA 5DITA 2ZR5A 3ARPA 4TW6A 1HKIA 4Z2HA 1TFVA 3QOKA 2DSVA 1W1VA 1CTNA 3AQUA 1JNTA 5GPRA 1Q6IA 3PA7A 4C02B 3GPKA 4P8VA 1W1TA 4IT4A 1D2KA 1SYTA 3CHFA 3AROA 1XRVA 1W26A 2ZR6A 4LAXA 3FXYA 4Q7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQA A;  2ZQS A;  2RUR A;  2RUD A;  3PRB A;  3UQI A;  4DRJ A;  4TW7 A;  5D75 A;  1J4I A;  1A7X A;  3NRK A;  2DG3 A;  4GIV A;  3B7X A;  2MLX A;  4N19 A;  4BF8 A;  4TX0 A;  3LUO A;  5HWB A;  4DIP A;  3NTP A;  2KE0 A;  2ZR4 A;  4QIB A;  2K8I A;  2PV3 A;  3KAI A;  4TYO A;  4DRK A;  4DZ3 A;  2XP8 A;  1D7J A;  4DZ2 A;  2RUC A;  4ODP A;  3IK8 A;  3JXV A;  1D7I A;  3O5K A;  2PPP A;  4DRH A;  1Q1C A;  1BKF A;  3O5I A;  1FKT A;  5HW8 A;  1FKK A;  1YW5 A;  3EY6 A;  1J6Y A;  2ZQT A;  4JFJ A;  3RGC A;  5BXJ A;  3O5L A;  4DRP A;  4ODN A;  4MSP A;  4QT3 A;  4JFI A;  3KAD A;  3CGN A;  2KR7 A;  2PBC A;  3O5J A;  4TNS A;  4JFM A;  2AWG A;  1J4H A;  1FKH A;  2DG9 A;  2PPO A;  3O5F A;  2KGJ A;  1J4R A;  2M2A A;  5HTG A;  1D7H A;  1TCO C;  2FKE A;  2XPB A;  3TCZ A;  3OOB A;  4ODO A;  4MGV A;  1KT0 A;  2PPN A;  2XP5 A;  4ODM A;  4DRO A;  5HT1 A;  3H9R B;  3KZ7 A;  3O5Q A;  5HW7 A;  3UI6 A;  4IQ2 A;  3O5D A;  1FKL A;  3KCE A;  2IF4 A;  1R9H A;  2F2D A;  3FAP A;  4G50 A;  2Q5A A;  2ZQV A;  2F21 A;  4U86 A;  3WH0 A;  2XPA A;  1EQ3 A;  2VCD A;  3KAF A;  2JZV A;  2XP9 A;  2ZQU A;  3MDY B;  1FKS A;  4W9Q A;  1FKR A;  1ZK6 A;  1NMV A;  3PRD A;  4LAY A;  4JFL A;  3UI4 A;  2D9F A;  2XP7 A;  1QPL A;  4JYS A;  2MLY A;  1F8A B;  5J6E A;  1FJD A;  1NMW A;  2KO7 A;  2LGO A;  3O5R A;  1D6O A;  4GGQ A;  2XP6 A;  4G2P A;  2MPH A;  2PV1 A;  4J4O A;  4FN2 A;  2MNT A;  4DRI A;  2Y78 A;  1FAP A;  4FAP A;  1M5Y A;  2XP4 A;  4ODR A;  1FKB A;  4LAX A;  2PV2 A;  3CGM A;  1PIN A;  4JFK A;  4DH0 A;  4ODQ A;  1ROU A;  2LPV A;  1FKF A;  1Y0O A;  3O5O A;  3KAH A;  2KI3 A;  1FKJ A;  2ITK A;  2M08 A;  2KFW A;  2RSE A;  3IHZ A;  3ODK A;  4TW8 A;  3KAB A;  1Q6U A;  4DRQ A;  2RQS A;  2DG4 A;  4O2T A;  4QT2 A;  3UF8 A;  3IKD A;  4DRM A;  4R0X A;  2M1I A;  5HUA A;  2VN1 A;  4W9O A;  2XP3 A;  3NI6 A;  5B8I C;  3IKG A;  2N87 A;  1FKI A;  1T11 A;  1QZ2 A;  2FAP A;  3TC5 A;  1JNS A;  1JVW A;  3O5G A;  3KAG A;  1FKD A;  2OFN A;  3JYM A;  5HW6 A;  4DRN A;  1BL4 A;  2UZ5 A;  3KAC A;  3O5M A;  4IQC A;  1KT1 A;  4J4N A;  5DIT A;  1U79 A;  4IPX A;  2ZR5 A;  4DT4 A;  4TW6 A;  3TDB A;  3VAW A;  1B6C A;  1FD9 A;  1Q6H A;  1PBK A;  5GPG A;  1YAT A;  4ITZ A;  4U84 A;  3UI5 A;  5I98 A;  1JNT A;  1ROT A;  2L2S A;  1P5Q A;  1NSG A;  1Q6I A;  2MLZ A;  3PA7 A;  3GPK A;  4C02 B;  4U85 A;  2LJ4 A;  5DIV A;  1EYM A;  3UQB A;  3O5E A;  2RUQ A;  1F40 A;  3RFW A;  1HXV A;  4NNR A;  2MF9 A;  3JYJ A;  4LAV A;  5DIU A;  4ODL A;  2F4E A;  4LAW A;  4W9P A;  1ZCN A;  5HKG A;  4ODK A;  1C9H A;  1W26 A;  2ZR6 A;  1L1P A;  3O5P A;  1FKG A;  1N1A A;  5HWC A;  3I6C A;  1QPF A;  2LKN A; 
#chains in the Genus database with same CATH topology
 2RUD A;  3UQI A;  3W4R A;  4TW7 A;  5D75 A;  4DRJ A;  5DO2 A;  1HKK A;  2MLX A;  4BF8 A;  4R5E A;  3WD0 A;  4DIP A;  3WD2 A;  4QIB A;  2PV3 A;  3KAI A;  4MNL A;  4Z2I A;  5DF0 A;  1E9L A;  4MNJ A;  4DWS D;  3JXV A;  4UDM A;  1BKF A;  1E44 A;  1H0I A;  3G6L A;  4MNK A;  1FKK A;  4WIW A;  1LL4 A;  1NWR A;  2ZQT A;  3RGC A;  4HBO A;  4ODN A;  3KAD A;  2KR7 A;  4Z2J A;  3O5J A;  4WKA A;  1FKH A;  3O5F A;  3RM4 A;  5HTG A;  1J4R A;  1E15 A;  1HJW A;  3WD3 A;  1KT0 A;  4ODM A;  5HT1 A;  3WD1 A;  1X6N A;  3FAP A;  2F2D A;  4G50 A;  1FKR A;  4W9Q A;  1EIB A;  2D9F A;  1QPL A;  2MLY A;  2KO7 A;  3EIP A;  4L3N A;  1M5Y A;  2EUL A;  2PV2 A;  1JND A;  1PIN A;  2LPV A;  1Y0O A;  3ALG A;  3O5O A;  2ITK A;  2M08 A;  3ARV A;  3WQV A;  3KAB A;  1W9V A;  5HUA A;  3ARS A;  4HBE A;  3RM8 A;  1NH6 A;  3CHC A;  2N87 A;  1FKI A;  1T11 A;  2FAP A;  4DWS B;  3TC5 A;  1FKD A;  5HW6 A;  4ZPV R;  3KAC A;  3B8S A;  4J4N A;  1LL7 A;  1U79 A;  4IPX A;  3VAW A;  1Q6H A;  1FD9 A;  2YBU A;  1FFQ A;  4ITZ A;  3UI5 A;  1FFR A;  5DIV A;  1EYM A;  3UQB A;  2RUQ A;  2P4V A;  1F40 A;  1GPF A;  1HXV A;  1W9P A;  4NNR A;  3CH9 A;  5DIU A;  2F4E A;  1ZCN A;  4ODK A;  4WKF A;  3CZ8 A;  1FKG A;  3UI4 A;  4QT2 A;  2RUR A;  3PRB A;  2DG3 A;  4GIV A;  1LG2 A;  2KE0 A;  4DZ3 A;  2XP8 A;  2RUC A;  4ODP A;  3IK8 A;  1D7I A;  2PPP A;  1NWS A;  1Q1C A;  3O5I A;  1J6Y A;  3GU0 A;  4JFI A;  3CGN A;  1ZBK A;  2PBC A;  4TNS A;  4WJX A;  1J4H A;  2DG9 A;  2G8Z A;  2KGJ A;  2FKE A;  3AS1 A;  4AY1 A;  4MAV A;  2XPB A;  2OLH A;  1IX5 A;  2PPN A;  4DRO A;  3H9R B;  3O5Q A;  2PI6 A;  4IQ2 A;  3O5D A;  2IF4 A;  1RD6 A;  2ZQV A;  4U86 A;  1XHG A;  2XPA A;  1EQ3 A;  1SR0 A;  1ZK6 A;  2B5U B;  3AS3 A;  5J6E A;  1F8A B;  2LGO A;  1ZBV A;  1W9U A;  4GGQ A;  3ARY A;  1E6P A;  4FN2 A;  2MNT A;  4ZPW R;  4DRI A;  1ZU8 A;  2Y78 A;  2O92 A;  2DT1 A;  1FKB A;  4ODQ A;  1OWQ A;  1H0G A;  2ETN A;  2KFW A;  2RSE A;  1Q6U A;  4MNM A;  1UR9 A;  2M1I A;  4ZPT R;  2XP3 A;  4DWS C;  2PN0 A;  3B9E A;  4MTV A;  3GTY X;  1GOI A;  3CHD A;  2UZ5 A;  1ZBW A;  1KT1 A;  2B31 A;  3AS0 A;  1UR8 A;  4DT4 A;  3TDB A;  1E6Z A;  1JCH B;  1B6C A;  2YBT A;  4XAK A;  1E6N A;  4U84 A;  5I98 A;  1ROT A;  2L2S A;  1P5Q A;  4DRN A;  3O5E A;  3RFW A;  3RME A;  3JYJ A;  4LAW A;  1ITX A;  3WD4 A;  1L1P A;  1N1A A;  5HWC A;  4MPK A;  3UQA A;  4DWS A;  5HBF A;  1WB0 A;  3B7X A;  2A3A A;  2IUZ A;  4TX0 A;  5HWB A;  1EDQ A;  3NTP A;  4TYO A;  2K8I A;  4DRK A;  1OGB A;  1D7J A;  4DZ2 A;  2DSW A;  1E6R A;  4DRH A;  2FDM A;  1FKT A;  4Z2L A;  3ARU A;  5HW8 A;  3ARW A;  3ART A;  5BXJ A;  4QT3 A;  3ARR A;  2DSU A;  4JFM A;  2AWG A;  2PPO A;  1D7H A;  1GUV A;  1TCO C;  2G41 A;  3OOB A;  3WKZ A;  4MGV A;  3ARZ A;  2XP5 A;  4Z2G A;  5HW7 A;  3UI6 A;  1FKL A;  2DPE A;  2Q5A A;  2F21 A;  3WH0 A;  2VCD A;  1HKM A;  2JZV A;  1NMV A;  4LAY A;  4JFL A;  4PTM A;  1K9T A;  4JYS A;  4KQZ A;  1HJV A;  4G2P A;  2PV1 A;  1FAP A;  4FAP A;  4ODR A;  3FY1 A;  3CGM A;  4JFK A;  1ROU A;  3ARQ A;  1FKF A;  3BXW A;  1HJX A;  1HKJ A;  1KFW A;  2KI3 A;  1FKJ A;  3IHZ A;  3ODK A;  4TW8 A;  2A3B A;  3G6M A;  4DRQ A;  2RQS A;  2DG4 A;  3ARX A;  2QF8 A;  4P8X A;  4R0X A;  4W9O A;  5B8I C;  3NI6 A;  2O9O A;  4P8U A;  1ZBC A;  1QZ2 A;  1W1Y A;  4Q22 A;  2WM0 A;  1JNS A;  1JVW A;  3O5G A;  5JH8 A;  2OFN A;  3JYM A;  2A3C A;  4S3J A;  4IQC A;  3O5M A;  1LL6 A;  4IT6 A;  2WLY A;  1NWU A;  2DT0 A;  3WL1 A;  4L72 B;  1PBK A;  4ZS6 A;  2WK2 A;  5GPG A;  4LGX A;  1YAT A;  4KR0 B;  4S3K A;  1NSG A;  2MLZ A;  4U85 A;  2LJ4 A;  5GQB A;  1O6I A;  2DSZ A;  4QZV B;  2MF9 A;  1JNE A;  4LAV A;  4ODL A;  4W9P A;  5HKG A;  4HAR A;  3AS2 A;  1C9H A;  3O5P A;  1GRJ A;  3I6C A;  1QPF A;  2LKN A;  4P8W A;  2ZQS A;  3RM9 A;  1J4I A;  1A7X A;  3NRK A;  1VF8 A;  4N19 A;  4WK9 A;  3LUO A;  2ZR4 A;  3O5K A;  4WKH A;  2A3E A;  3B9A A;  4URI A;  1YW5 A;  3EY6 A;  4JFJ A;  4W5U A;  3O5L A;  4DRP A;  3BMB A;  4MSP A;  1EHN A;  1WNO A;  4NSB A;  2F23 A;  1ZB5 A;  4ML4 A;  3PR9 A;  2M2A A;  2DT3 A;  1NWT A;  3TCZ A;  1OGG A;  4ODO A;  3CHE A;  3OA5 A;  1LJY A;  3KZ7 A;  4NZC A;  2WLZ A;  2AOS A;  3ALF A;  3KCE A;  1R9H A;  1LQ0 A;  1WAW A;  2DT2 A;  3KAF A;  2XP9 A;  2ZQU A;  3MDY B;  1FKS A;  3PRD A;  2XP7 A;  1ZL1 A;  1FJD A;  1NMW A;  3O5R A;  1D6O A;  4Z2K A;  2XP6 A;  2MPH A;  4J4O A;  3B9D A;  1X6L A;  1LG1 A;  2XP4 A;  3WQW A;  4DH0 A;  3KAH A;  3WIJ A;  4O2T A;  3WL0 A;  3UF8 A;  3IKD A;  4DRM A;  5DEZ A;  2VN1 A;  3IKG A;  2ESC A;  3KAG A;  1W1P A;  1BL4 A;  3PRA A;  5DIT A;  2ZR5 A;  3ARP A;  4TW6 A;  1HKI A;  4Z2H A;  1TFV A;  3QOK A;  2DSV A;  1W1V A;  1CTN A;  3AQU A;  1JNT A;  5GPR A;  1Q6I A;  3PA7 A;  4C02 B;  3GPK A;  4P8V A;  1W1T A;  4IT4 A;  1D2K A;  1SYT A;  3CHF A;  3ARO A;  1XRV A;  1W26 A;  2ZR6 A;  4LAX A;  3FXY A;  4Q7N A; 
#chains in the Genus database with same CATH homology
 2RUD A;  3UQI A;  3W4R A;  4TW7 A;  5D75 A;  4DRJ A;  5DO2 A;  1HKK A;  2MLX A;  4BF8 A;  4R5E A;  3WD0 A;  4DIP A;  3WD2 A;  4QIB A;  2PV3 A;  3KAI A;  4MNL A;  4Z2I A;  5DF0 A;  1E9L A;  4MNJ A;  4DWS D;  3JXV A;  1BKF A;  1H0I A;  3G6L A;  4MNK A;  1FKK A;  4WIW A;  1LL4 A;  1NWR A;  2ZQT A;  3RGC A;  4HBO A;  4ODN A;  3KAD A;  2KR7 A;  4Z2J A;  3O5J A;  4WKA A;  1FKH A;  3O5F A;  3RM4 A;  5HTG A;  1J4R A;  1E15 A;  1HJW A;  3WD3 A;  1KT0 A;  4ODM A;  5HT1 A;  3WD1 A;  1X6N A;  3FAP A;  2F2D A;  4G50 A;  1FKR A;  4W9Q A;  1EIB A;  2D9F A;  1QPL A;  2MLY A;  2KO7 A;  4L3N A;  1M5Y A;  2PV2 A;  1JND A;  1PIN A;  2LPV A;  1Y0O A;  3O5O A;  3ALG A;  2ITK A;  2M08 A;  3ARV A;  3WQV A;  3KAB A;  1W9V A;  5HUA A;  3ARS A;  4HBE A;  3RM8 A;  1NH6 A;  3CHC A;  2N87 A;  1FKI A;  1T11 A;  2FAP A;  4DWS B;  3TC5 A;  1FKD A;  5HW6 A;  4ZPV R;  3KAC A;  3B8S A;  4J4N A;  1LL7 A;  1U79 A;  4IPX A;  3VAW A;  1Q6H A;  1FD9 A;  2YBU A;  1FFQ A;  4ITZ A;  3UI5 A;  1FFR A;  5DIV A;  1EYM A;  3UQB A;  2RUQ A;  1F40 A;  1GPF A;  1HXV A;  1W9P A;  4NNR A;  3CH9 A;  5DIU A;  2F4E A;  1ZCN A;  4ODK A;  4WKF A;  3CZ8 A;  1FKG A;  3UI4 A;  4QT2 A;  2RUR A;  3PRB A;  2DG3 A;  4GIV A;  1LG2 A;  2KE0 A;  4DZ3 A;  2XP8 A;  2RUC A;  4ODP A;  3IK8 A;  1D7I A;  2PPP A;  1NWS A;  1Q1C A;  3O5I A;  1J6Y A;  4JFI A;  3CGN A;  1ZBK A;  2PBC A;  4TNS A;  4WJX A;  1J4H A;  2DG9 A;  2G8Z A;  2KGJ A;  2FKE A;  3AS1 A;  4AY1 A;  4MAV A;  2XPB A;  2OLH A;  1IX5 A;  2PPN A;  4DRO A;  3H9R B;  3O5Q A;  2PI6 A;  4IQ2 A;  3O5D A;  2IF4 A;  1RD6 A;  2ZQV A;  4U86 A;  1XHG A;  2XPA A;  1EQ3 A;  1SR0 A;  1ZK6 A;  3AS3 A;  5J6E A;  1F8A B;  2LGO A;  1ZBV A;  1W9U A;  4GGQ A;  3ARY A;  1E6P A;  4FN2 A;  2MNT A;  4ZPW R;  4DRI A;  1ZU8 A;  2Y78 A;  2O92 A;  2DT1 A;  1FKB A;  4ODQ A;  1OWQ A;  1H0G A;  2KFW A;  2RSE A;  1Q6U A;  4MNM A;  1UR9 A;  2M1I A;  4ZPT R;  2XP3 A;  4DWS C;  3B9E A;  4MTV A;  1GOI A;  3CHD A;  2UZ5 A;  1ZBW A;  1KT1 A;  2B31 A;  3AS0 A;  1UR8 A;  4DT4 A;  3TDB A;  1E6Z A;  1B6C A;  2YBT A;  4XAK A;  1E6N A;  4U84 A;  5I98 A;  1ROT A;  2L2S A;  1P5Q A;  4DRN A;  3O5E A;  3RFW A;  3RME A;  3JYJ A;  4LAW A;  1ITX A;  3WD4 A;  1L1P A;  1N1A A;  5HWC A;  4MPK A;  3UQA A;  4DWS A;  5HBF A;  1WB0 A;  3B7X A;  2A3A A;  2IUZ A;  4TX0 A;  5HWB A;  1EDQ A;  3NTP A;  4TYO A;  2K8I A;  4DRK A;  1OGB A;  1D7J A;  4DZ2 A;  2DSW A;  1E6R A;  4DRH A;  2FDM A;  1FKT A;  4Z2L A;  3ARU A;  5HW8 A;  3ARW A;  3ART A;  5BXJ A;  4QT3 A;  3ARR A;  2DSU A;  4JFM A;  2AWG A;  2PPO A;  1D7H A;  1GUV A;  1TCO C;  2G41 A;  3OOB A;  3WKZ A;  4MGV A;  3ARZ A;  2XP5 A;  4Z2G A;  5HW7 A;  3UI6 A;  1FKL A;  2DPE A;  2Q5A A;  2F21 A;  3WH0 A;  2VCD A;  1HKM A;  2JZV A;  1NMV A;  4LAY A;  4JFL A;  4PTM A;  1K9T A;  4JYS A;  4KQZ A;  1HJV A;  4G2P A;  2PV1 A;  1FAP A;  4FAP A;  4ODR A;  3FY1 A;  3CGM A;  4JFK A;  1ROU A;  3ARQ A;  1FKF A;  3BXW A;  1HJX A;  1HKJ A;  1KFW A;  2KI3 A;  1FKJ A;  3IHZ A;  3ODK A;  4TW8 A;  2A3B A;  3G6M A;  4DRQ A;  2RQS A;  2DG4 A;  3ARX A;  2QF8 A;  4P8X A;  4R0X A;  4W9O A;  5B8I C;  3NI6 A;  2O9O A;  4P8U A;  1ZBC A;  1QZ2 A;  1W1Y A;  4Q22 A;  2WM0 A;  1JNS A;  1JVW A;  3O5G A;  5JH8 A;  2OFN A;  3JYM A;  2A3C A;  4S3J A;  4IQC A;  3O5M A;  1LL6 A;  4IT6 A;  2WLY A;  1NWU A;  2DT0 A;  3WL1 A;  4L72 B;  1PBK A;  4ZS6 A;  2WK2 A;  5GPG A;  4LGX A;  1YAT A;  4KR0 B;  4S3K A;  1NSG A;  2MLZ A;  4U85 A;  2LJ4 A;  5GQB A;  1O6I A;  2DSZ A;  4QZV B;  2MF9 A;  1JNE A;  4LAV A;  4ODL A;  4W9P A;  5HKG A;  4HAR A;  3AS2 A;  1C9H A;  3O5P A;  3I6C A;  1QPF A;  2LKN A;  4P8W A;  2ZQS A;  3RM9 A;  1J4I A;  1A7X A;  3NRK A;  1VF8 A;  4N19 A;  4WK9 A;  3LUO A;  2ZR4 A;  3O5K A;  4WKH A;  2A3E A;  3B9A A;  4URI A;  1YW5 A;  3EY6 A;  4JFJ A;  4W5U A;  3O5L A;  4DRP A;  4MSP A;  1EHN A;  1WNO A;  4NSB A;  4ML4 A;  1ZB5 A;  3PR9 A;  2M2A A;  2DT3 A;  1NWT A;  3TCZ A;  1OGG A;  4ODO A;  3CHE A;  3OA5 A;  1LJY A;  3KZ7 A;  4NZC A;  2WLZ A;  2AOS A;  3ALF A;  3KCE A;  1R9H A;  1LQ0 A;  1WAW A;  2DT2 A;  3KAF A;  2XP9 A;  2ZQU A;  3MDY B;  1FKS A;  3PRD A;  2XP7 A;  1ZL1 A;  1FJD A;  1NMW A;  3O5R A;  1D6O A;  4Z2K A;  2XP6 A;  2MPH A;  4J4O A;  3B9D A;  1X6L A;  1LG1 A;  2XP4 A;  3WQW A;  4DH0 A;  3KAH A;  3WIJ A;  4O2T A;  3WL0 A;  3UF8 A;  3IKD A;  4DRM A;  5DEZ A;  2VN1 A;  3IKG A;  2ESC A;  3KAG A;  1W1P A;  1BL4 A;  3PRA A;  5DIT A;  2ZR5 A;  3ARP A;  4TW6 A;  1HKI A;  4Z2H A;  1TFV A;  3QOK A;  2DSV A;  1W1V A;  1CTN A;  3AQU A;  1JNT A;  5GPR A;  1Q6I A;  3PA7 A;  4C02 B;  3GPK A;  4P8V A;  1W1T A;  4IT4 A;  1D2K A;  1SYT A;  3CHF A;  3ARO A;  1XRV A;  1W26 A;  2ZR6 A;  4LAX A;  3FXY A;  4Q7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...