5DITA

The fk1 domain of fkbp51 in complex with the new synthetic ligand (1r)-3-(3,4-dimethoxyphenyl)-1-f3-[2-(morpholin-4-yl)ethoxy]phenylgpropyl(2s)-1-[(2s,3r)-2-cyclohexyl-3-hydroxybutanoyl]piperidine-2-carboxylate
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structure-Affinity Relationship Analysis of Selective FKBP51 Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 5ditA00
1ZK6A 5B8IC 4TW8A 1A7XA 2MLZA 3UI4A 2ZQTA 2UZ5A 3GPKA 5DIVA 1HXVA 4G2PA 1P5QA 5HUAA 4JFKA 1D7JA 3JYMA 4ODLA 3IKGA 1D7IA 2FAPA 5HW8A 1BKFA 3UI6A 2JZVA 2F21A 3KACA 2Y78A 4U86A 1JNTA 1PINA 3B7XA 2DG4A 4DRQA 4BF8A 4DH0A 1J4HA 1Y0OA 4J4NA 1YW5A 1Q6UA 4JFMA 1Q6IA 2RUDA 4NNRA 1FD9A 4ITZA 3UQIA 4TYOA 3KADA 5J6EA 1D7HA 4JFJA 3RGCA 4DRJA 1T11A 1FKGA 2Q5AA 1FKBA 3NI6A 1FAPA 2LKNA 3O5JA 4G50A 4TW7A 1KT1A 4N19A 4U85A 1D6OA 4O2TA 2M1IA 1FJDA 2D9FA 1JVWA 1B6CA 4ODKA 3H9RB 4IQ2A 2ZQUA 2MLXA 4FN2A 4GIVA 4TNSA 3UF8A 3UI5A 3O5IA 4LAXA 5HW6A 4U84A 3PRDA 2KE0A 3IKDA 4DZ2A 1F40A 1FKRA 1L1PA 4DRIA 4DT4A 1FKSA 4IPXA 2KI3A 2PBCA 1EYMA 5GPGA 3ODKA 2LGOA 5HW7A 5I98A 2KO7A 2RUQA 4QT3A 3UQBA 2OFNA 4ODNA 2K8IA 2MNTA 3O5DA 2RQSA 2XP3A 4QIBA 1TCOC 2MPHA 2XPBA 3O5MA 3O5OA 4DRNA 2KFWA 3KCEA 4DIPA 3KZ7A 2LJ4A 2MLYA 2N87A 4MGVA 3OOBA 2XPAA 2XP9A 2PV1A 2M2AA 1QPFA 2ZQVA 1FKHA 1FKDA 3I6CA 1U79A 2PPNA 2ZR6A 4W9QA 3LUOA 1NMWA 3NTPA 5DITA 4LAWA 5HTGA 5D75A 4JYSA 3CGMA 4ODOA 4ODQA 2L2SA 2LPVA 2M08A 5DIUA 1BL4A 1ROTA 4JFLA 1ROUA 3IK8A 3WH0A 4DRKA 1F8AB 4QT2A 2MF9A 1JNSA 4R0XA 2F2DA 1FKFA 5HWBA 2PV2A 2VN1A 3IHZA 3TC5A 1QZ2A 2PPPA 3KAGA 3KABA 4GGQA 3JYJA 4TX0A 1Q1CA 5HT1A 1EQ3A 2DG3A 5HWCA 3JXVA 4TW6A 4IQCA 2F4EA 2DG9A 1KT0A 2XP5A 2XP7A 3TDBA 4MSPA 4C02B 3VAWA 1NMVA 3O5EA 2KGJA 2PPOA 2IF4A 2RSEA 3O5LA 3FAPA 2AWGA 2KR7A 1ZCNA 3O5QA 4ODMA 3TCZA 4DZ3A 4FAPA 1M5YA 1NSGA 4ODPA 2ZQSA 2XP8A 3KAIA 4JFIA 1Q6HA 4DRPA 3NRKA 4ODRA 4DRMA 1FKJA 3KAHA 1YATA 3O5GA 2PV3A 4LAYA 2XP6A 4W9OA 2XP4A 4LAVA 4J4OA 4W9PA 1N1AA 3RFWA 3KAFA 1QPLA 5BXJA 4DRHA 1R9HA 1J4IA 1FKKA 1FKLA 1FKIA 4DROA 2ITKA 2VCDA 2RURA 2RUCA 1C9HA 2ZR4A 3PA7A 1FKTA 1J6YA 3O5RA 3O5FA 2FKEA 3MDYB 2ZR5A 3EY6A 3O5PA 3UQAA 1W26A 3O5KA 5HKGA 3CGNA 1PBKA 1J4RA 3PRBA
chains in the Genus database with same CATH superfamily
3BMBA 3UI4A 2ZQTA 1HXVA 5HUAA 1D7JA 1D7IA 2G8ZA 3UI6A 2Y78A 4DWSD 4AY1A 1JNTA 1Y0OA 4JFMA 5DEZA 5J6EA 4JFJA 1FKGA 4P8VA 3O5JA 4G50A 1KT1A 4N19A 1FJDA 3PR9A 4O2TA 4L72B 3WL0A 5GPRA 4ODKA 2MLXA 1X6NA 4FN2A 3ALGA 4GIVA 5HW6A 4DWSC 2KE0A 1WAWA 2A3EA 2YBUA 1FKRA 4DRIA 3WKZA 4Z2IA 1SR0A 2KO7A 2RUQA 4QT3A 4ZS6A 4ODNA 3O5MA 4MGVA 4R5EA 4ZPVR 1EDQA 3OOBA 2XPAA 4URIA 3AS1A 1HKIA 3WD1A 1XHGA 2DPEA 4W9QA 3FY1A 5DITA 4JYSA 3CHCA 4ML4A 2M08A 5DIUA 3ARVA 4PTMA 3GU0A 4ZPWR 4R0XA 1E6ZA 1FKFA 1LJYA 2VN1A 3TC5A 2PPPA 4TX0A 3JXVA 3RM9A 2F4EA 2DG9A 3CHDA 2A3AA 3VAWA 1NMVA 1W1YA 2KGJA 5DF0A 3O5LA 2A3BA 5DO2A 2AWGA 3WD2A 3TCZA 4NZCA 4HARA 2DT1A 1E6NA 1OGGA 4Z2GA 4LAYA 2XP6A 4W9OA 4W9PA 1N1AA 1H0IA 5BXJA 1FKLA 1LL6A 3B9AA 4Z2KA 2DSZA 4MNKA 3ARTA 3O5FA 1GOIA 3ARRA 2FDMA 4JFIA 3B9EA 4HBEA 1A7XA 2UZ5A 3GPKA 2AOSA 1P5QA 3AROA 4JFKA 4ODLA 3JYMA 3IKGA 4ZPTR 3ARSA 1PINA 2QF8A 2F23A 4J4NA 2WK2A 4NNRA 2IUZA 1JNDA 3WD3A 1D7HA 1W9PA 1FAPA 2LKNA 2WM0A 2WLYA 3UI5A 3CH9A 3PRDA 1WB0A 3OA5A 1OWQA 1F40A 1L1PA 4DT4A 4NSBA 1EYMA 2DSWA 5HW7A 2P4VA 2OFNA 4IT6A 1TCOC 3AS0A 1LL4A 3KCEA 3KZ7A 1ZBCA 2XP9A 3CZ8A 2PN0A 3I6CA 1U79A 1UR9A 2ZR6A 1NMWA 4LAWA 1LG1A 1EHNA 4ODQA 3AQUA 1HKJA 4Q22A 1BL4A 4L3NA 3ARUA 3WH0A 4QT2A 4MNJA 2PI6A 3JYJA 3WQVA 1EQ3A 2DG3A 4XAKA 4TW6A 1ZBKA 2XP7A 1ZL1A 4MSPA 2B31A 4WK9A 3WIJA 1W9VA 3ALFA 1ZCNA 4S3KA 4WKFA 1X6LA 3G6LA 4ODPA 3ARPA 1Q6HA 4DRPA 3CHEA 1HKKA 1ITXA 3B8SA 1D2KA 3ARWA 3O5GA 2XP4A 4LAVA 3KAFA 1QPLA 1R9HA 4DROA 1C9HA 1OGBA 3EY6A 1W26A 3CGNA 2EULA 1PBKA 1J4RA 4TW8A 2MLZA 3ARZA 1HJXA 1SYTA 5HW8A 1BKFA 2JZVA 2F21A 4U86A 3B7XA 3AS2A 4DRQA 4BF8A 1W1VA 4DH0A 1NWSA 1Q6UA 4QZVB 1Q6IA 1FFRA 1FD9A 4ITZA 3GTYX 4MNMA 3KADA 3RGCA 1JCHB 4LGXA 2Q5AA 1NH6A 4U85A 3G6MA 2D9FA 1JVWA 3RM8A 4IQ2A 4Z2JA 4TNSA 3B9DA 4LAXA 1GRJA 1FKSA 4IPXA 2KI3A 2PBCA 3ODKA 3UQBA 4MAVA 2ETNA 2XP3A 4QIBA 2MPHA 2DT2A 3EIPA 4DRNA 2KFWA 3RM4A 1E6PA 4DIPA 4MTVA 2MLYA 3RMEA 1HKMA 1RD6A 1QPFA 4WKAA 1UR8A 2PPNA 1EIBA 4Q7NA 3NTPA 5HTGA 3WL1A 5D75A 4ODOA 2L2SA 2LPVA 2YBTA 4JFLA 4HBOA 4DRKA 1F8AB 4P8XA 1JNSA 2F2DA 5HWBA 2PV2A 3IHZA 1QZ2A 3KAGA 1E6RA 3KABA 1Q1CA 4WJXA 4Z2LA 1JNEA 5GQBA 3W4RA 5HWCA 5HBFA 4P8UA 1E15A 1GUVA 2PPOA 3FXYA 2IF4A 3FAPA 2DSVA 4ODMA 4DZ3A 1M5YA 4MNLA 2DT0A 1HJWA 3QOKA 4ODRA 4DRMA 1FKJA 3KAHA 1YATA 2PV3A 3BXWA 4J4OA 1XRVA 1FFQA 4DRHA 1ZBVA 1LL7A 1W9UA 1FKIA 2RURA 4MPKA 2ZR5A 3O5PA 3UQAA 2WLZA 3O5KA 5HKGA 3PRBA 1ZK6A 5B8IC 5DIVA 4G2PA 1WNOA 3PRAA 2FAPA 2O9OA 3WD4A 4S3JA 3KACA 2DG4A 2O92A 1O6IA 2DSUA 3ARQA 1J4HA 1CTNA 2ESCA 1GPFA 1YW5A 2RUDA 1E9LA 3WD0A 4P8WA 3UQIA 4TYOA 3ARXA 4DRJA 1KFWA 1T11A 1FKBA 3NI6A 4TW7A 1D6OA 1ZB5A 2M1IA 1B6CA 3H9RB 2OLHA 2ZQUA 3UF8A 2A3CA 3O5IA 1NWRA 4UDMA 4U84A 1TFVA 3IKDA 4DZ2A 5JH8A 5GPGA 5I98A 2LGOA 4IT4A 2K8IA 2MNTA 3O5DA 2RQSA 4WKHA 2XPBA 3O5OA 4WIWA 3CHFA 1NWTA 1K9TA 2LJ4A 2N87A 1ZU8A 2PV1A 2M2AA 2ZQVA 1FKHA 1FKDA 1HJVA 3LUOA 3WQWA 1W1TA 4KQZA 3CGMA 1VF8A 4DWSB 1ROTA 4Z2HA 1ROUA 3IK8A 4W5UA 2G41A 2MF9A 1W1PA 4GGQA 5HT1A 4KR0B 4IQCA 2B5UB 1KT0A 2XP5A 3AS3A 1LQ0A 3TDBA 1IX5A 4C02B 3ARYA 3O5EA 2DT3A 1H0GA 2RSEA 2KR7A 3O5QA 1NSGA 2ZQSA 2XP8A 1LG2A 3KAIA 3NRKA 3RFWA 4DWSA 1E44A 1J4IA 1FKKA 2ITKA 2VCDA 2RUCA 2ZR4A 3PA7A 1FKTA 1J6YA 3O5RA 2FKEA 3MDYB 1NWUA 4FAPA 1ZBWA
chains in the Genus database with same CATH topology
3UI4A 2ZQTA 1HXVA 5HUAA 1D7JA 1D7IA 2G8ZA 3UI6A 2Y78A 4DWSD 4AY1A 1JNTA 1Y0OA 4JFMA 5DEZA 5J6EA 4JFJA 1FKGA 4P8VA 3O5JA 4G50A 1KT1A 4N19A 1FJDA 3PR9A 4O2TA 4L72B 3WL0A 5GPRA 4ODKA 2MLXA 1X6NA 4FN2A 3ALGA 4GIVA 5HW6A 4DWSC 2KE0A 1WAWA 2A3EA 2YBUA 1FKRA 4DRIA 3WKZA 4Z2IA 1SR0A 2KO7A 2RUQA 4QT3A 4ZS6A 4ODNA 3O5MA 4MGVA 4R5EA 4ZPVR 1EDQA 3OOBA 2XPAA 4URIA 3AS1A 1HKIA 3WD1A 1XHGA 2DPEA 4W9QA 3FY1A 5DITA 4JYSA 3CHCA 4ML4A 2M08A 5DIUA 3ARVA 4PTMA 4ZPWR 4R0XA 1E6ZA 1FKFA 1LJYA 2VN1A 3TC5A 2PPPA 4TX0A 3JXVA 3RM9A 2F4EA 2DG9A 3CHDA 2A3AA 3VAWA 1NMVA 1W1YA 2KGJA 5DF0A 3O5LA 2A3BA 5DO2A 2AWGA 3WD2A 3TCZA 4NZCA 4HARA 2DT1A 1E6NA 1OGGA 4Z2GA 4LAYA 2XP6A 4W9OA 4W9PA 1N1AA 1H0IA 5BXJA 1FKLA 1LL6A 3B9AA 4Z2KA 2DSZA 4MNKA 3ARTA 3O5FA 1GOIA 3ARRA 2FDMA 4JFIA 3B9EA 4HBEA 1A7XA 2UZ5A 3GPKA 2AOSA 1P5QA 3AROA 4JFKA 4ODLA 3JYMA 3IKGA 4ZPTR 3ARSA 1PINA 2QF8A 4J4NA 2WK2A 4NNRA 2IUZA 1JNDA 3WD3A 1D7HA 1W9PA 1FAPA 2LKNA 2WM0A 2WLYA 3UI5A 3CH9A 3PRDA 1WB0A 3OA5A 1OWQA 1F40A 1L1PA 4DT4A 4NSBA 1EYMA 2DSWA 5HW7A 2OFNA 4IT6A 1TCOC 3AS0A 1LL4A 3KCEA 3KZ7A 1ZBCA 2XP9A 3CZ8A 3I6CA 1U79A 1UR9A 2ZR6A 1NMWA 4LAWA 1LG1A 1EHNA 4ODQA 3AQUA 1HKJA 4Q22A 1BL4A 4L3NA 3ARUA 3WH0A 4QT2A 4MNJA 2PI6A 3JYJA 3WQVA 1EQ3A 2DG3A 4XAKA 4TW6A 1ZBKA 2XP7A 1ZL1A 4MSPA 2B31A 4WK9A 3WIJA 1W9VA 3ALFA 1ZCNA 4S3KA 4WKFA 1X6LA 3G6LA 4ODPA 3ARPA 1Q6HA 4DRPA 3CHEA 1HKKA 1ITXA 3B8SA 1D2KA 3ARWA 3O5GA 2XP4A 4LAVA 3KAFA 1QPLA 1R9HA 4DROA 1C9HA 1OGBA 3EY6A 1W26A 3CGNA 1PBKA 1J4RA 4TW8A 2MLZA 3ARZA 1HJXA 1SYTA 5HW8A 1BKFA 2JZVA 2F21A 4U86A 3B7XA 3AS2A 4DRQA 4BF8A 1W1VA 4DH0A 1NWSA 1Q6UA 4QZVB 1Q6IA 1FFRA 1FD9A 4ITZA 4MNMA 3KADA 3RGCA 4LGXA 2Q5AA 1NH6A 4U85A 3G6MA 2D9FA 1JVWA 3RM8A 4IQ2A 4Z2JA 4TNSA 3B9DA 4LAXA 1FKSA 4IPXA 2KI3A 2PBCA 3ODKA 3UQBA 4MAVA 2XP3A 4QIBA 2MPHA 2DT2A 4DRNA 2KFWA 3RM4A 1E6PA 4DIPA 4MTVA 2MLYA 3RMEA 1HKMA 1RD6A 1QPFA 4WKAA 1UR8A 2PPNA 1EIBA 4Q7NA 3NTPA 5HTGA 3WL1A 5D75A 4ODOA 2L2SA 2LPVA 2YBTA 4JFLA 4HBOA 4DRKA 1F8AB 4P8XA 1JNSA 2F2DA 5HWBA 2PV2A 3IHZA 1QZ2A 3KAGA 1E6RA 3KABA 1Q1CA 4WJXA 4Z2LA 1JNEA 5GQBA 3W4RA 5HWCA 5HBFA 4P8UA 1E15A 1GUVA 2PPOA 3FXYA 2IF4A 3FAPA 2DSVA 4ODMA 4DZ3A 1M5YA 4MNLA 2DT0A 1HJWA 3QOKA 4ODRA 4DRMA 1FKJA 3KAHA 1YATA 2PV3A 3BXWA 4J4OA 1XRVA 1FFQA 4DRHA 1ZBVA 1LL7A 1W9UA 1FKIA 2RURA 4MPKA 2ZR5A 3O5PA 3UQAA 2WLZA 3O5KA 5HKGA 3PRBA 1ZK6A 5B8IC 5DIVA 4G2PA 1WNOA 3PRAA 2FAPA 2O9OA 3WD4A 4S3JA 3KACA 2DG4A 2O92A 1O6IA 2DSUA 3ARQA 1J4HA 1CTNA 2ESCA 1GPFA 1YW5A 2RUDA 1E9LA 3WD0A 4P8WA 3UQIA 4TYOA 3ARXA 4DRJA 1KFWA 1T11A 1FKBA 3NI6A 4TW7A 1D6OA 1ZB5A 2M1IA 1B6CA 3H9RB 2OLHA 2ZQUA 3UF8A 2A3CA 3O5IA 1NWRA 4U84A 1TFVA 3IKDA 4DZ2A 5JH8A 5GPGA 5I98A 2LGOA 4IT4A 2K8IA 2MNTA 3O5DA 2RQSA 4WKHA 2XPBA 3O5OA 4WIWA 3CHFA 1NWTA 1K9TA 2LJ4A 2N87A 1ZU8A 2PV1A 2M2AA 2ZQVA 1FKHA 1FKDA 1HJVA 3LUOA 3WQWA 1W1TA 4KQZA 3CGMA 1VF8A 4DWSB 1ROTA 4Z2HA 1ROUA 3IK8A 4W5UA 2G41A 2MF9A 1W1PA 4GGQA 5HT1A 4KR0B 4IQCA 1KT0A 2XP5A 3AS3A 1LQ0A 3TDBA 1IX5A 4C02B 3ARYA 3O5EA 2DT3A 1H0GA 2RSEA 2KR7A 3O5QA 1NSGA 2ZQSA 2XP8A 1LG2A 3KAIA 3NRKA 3RFWA 4DWSA 1J4IA 1FKKA 2ITKA 2VCDA 2RUCA 2ZR4A 3PA7A 1FKTA 1J6YA 3O5RA 2FKEA 3MDYB 1NWUA 4FAPA 1ZBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK6 A;  5B8I C;  4TW8 A;  1A7X A;  2MLZ A;  3UI4 A;  2ZQT A;  2UZ5 A;  3GPK A;  5DIV A;  1HXV A;  4G2P A;  1P5Q A;  5HUA A;  4JFK A;  1D7J A;  3JYM A;  4ODL A;  3IKG A;  1D7I A;  2FAP A;  5HW8 A;  1BKF A;  3UI6 A;  2JZV A;  2F21 A;  3KAC A;  2Y78 A;  4U86 A;  1JNT A;  1PIN A;  3B7X A;  2DG4 A;  4DRQ A;  4BF8 A;  4DH0 A;  1J4H A;  1Y0O A;  4J4N A;  1YW5 A;  1Q6U A;  4JFM A;  1Q6I A;  2RUD A;  4NNR A;  1FD9 A;  4ITZ A;  3UQI A;  4TYO A;  3KAD A;  5J6E A;  1D7H A;  4JFJ A;  3RGC A;  4DRJ A;  1T11 A;  1FKG A;  2Q5A A;  1FKB A;  3NI6 A;  1FAP A;  2LKN A;  3O5J A;  4G50 A;  4TW7 A;  1KT1 A;  4N19 A;  4U85 A;  1D6O A;  4O2T A;  2M1I A;  1FJD A;  2D9F A;  1JVW A;  1B6C A;  4ODK A;  3H9R B;  4IQ2 A;  2ZQU A;  2MLX A;  4FN2 A;  4GIV A;  4TNS A;  3UF8 A;  3UI5 A;  3O5I A;  4LAX A;  5HW6 A;  4U84 A;  3PRD A;  2KE0 A;  3IKD A;  4DZ2 A;  1F40 A;  1FKR A;  1L1P A;  4DRI A;  4DT4 A;  1FKS A;  4IPX A;  2KI3 A;  2PBC A;  1EYM A;  5GPG A;  3ODK A;  2LGO A;  5HW7 A;  5I98 A;  2KO7 A;  2RUQ A;  4QT3 A;  3UQB A;  2OFN A;  4ODN A;  2K8I A;  2MNT A;  3O5D A;  2RQS A;  2XP3 A;  4QIB A;  1TCO C;  2MPH A;  2XPB A;  3O5M A;  3O5O A;  4DRN A;  2KFW A;  3KCE A;  4DIP A;  3KZ7 A;  2LJ4 A;  2MLY A;  2N87 A;  4MGV A;  3OOB A;  2XPA A;  2XP9 A;  2PV1 A;  2M2A A;  1QPF A;  2ZQV A;  1FKH A;  1FKD A;  3I6C A;  1U79 A;  2PPN A;  2ZR6 A;  4W9Q A;  3LUO A;  1NMW A;  3NTP A;  5DIT A;  4LAW A;  5HTG A;  5D75 A;  4JYS A;  3CGM A;  4ODO A;  4ODQ A;  2L2S A;  2LPV A;  2M08 A;  5DIU A;  1BL4 A;  1ROT A;  4JFL A;  1ROU A;  3IK8 A;  3WH0 A;  4DRK A;  1F8A B;  4QT2 A;  2MF9 A;  1JNS A;  4R0X A;  2F2D A;  1FKF A;  5HWB A;  2PV2 A;  2VN1 A;  3IHZ A;  3TC5 A;  1QZ2 A;  2PPP A;  3KAG A;  3KAB A;  4GGQ A;  3JYJ A;  4TX0 A;  1Q1C A;  5HT1 A;  1EQ3 A;  2DG3 A;  5HWC A;  3JXV A;  4TW6 A;  4IQC A;  2F4E A;  2DG9 A;  1KT0 A;  2XP5 A;  2XP7 A;  3TDB A;  4MSP A;  4C02 B;  3VAW A;  1NMV A;  3O5E A;  2KGJ A;  2PPO A;  2IF4 A;  2RSE A;  3O5L A;  3FAP A;  2AWG A;  2KR7 A;  1ZCN A;  3O5Q A;  4ODM A;  3TCZ A;  4DZ3 A;  4FAP A;  1M5Y A;  1NSG A;  4ODP A;  2ZQS A;  2XP8 A;  3KAI A;  4JFI A;  1Q6H A;  4DRP A;  3NRK A;  4ODR A;  4DRM A;  1FKJ A;  3KAH A;  1YAT A;  3O5G A;  2PV3 A;  4LAY A;  2XP6 A;  4W9O A;  2XP4 A;  4LAV A;  4J4O A;  4W9P A;  1N1A A;  3RFW A;  3KAF A;  1QPL A;  5BXJ A;  4DRH A;  1R9H A;  1J4I A;  1FKK A;  1FKL A;  1FKI A;  4DRO A;  2ITK A;  2VCD A;  2RUR A;  2RUC A;  1C9H A;  2ZR4 A;  3PA7 A;  1FKT A;  1J6Y A;  3O5R A;  3O5F A;  2FKE A;  3MDY B;  2ZR5 A;  3EY6 A;  3O5P A;  3UQA A;  1W26 A;  3O5K A;  5HKG A;  3CGN A;  1PBK A;  1J4R A;  3PRB A; 
#chains in the Genus database with same CATH topology
 3BMB A;  3UI4 A;  2ZQT A;  1HXV A;  5HUA A;  1D7J A;  1D7I A;  2G8Z A;  3UI6 A;  2Y78 A;  4DWS D;  4AY1 A;  1JNT A;  1Y0O A;  4JFM A;  5DEZ A;  5J6E A;  4JFJ A;  1FKG A;  4P8V A;  3O5J A;  4G50 A;  1KT1 A;  4N19 A;  1FJD A;  3PR9 A;  4O2T A;  4L72 B;  3WL0 A;  5GPR A;  4ODK A;  2MLX A;  1X6N A;  4FN2 A;  3ALG A;  4GIV A;  5HW6 A;  4DWS C;  2KE0 A;  1WAW A;  2A3E A;  2YBU A;  1FKR A;  4DRI A;  3WKZ A;  4Z2I A;  1SR0 A;  2KO7 A;  2RUQ A;  4QT3 A;  4ZS6 A;  4ODN A;  3O5M A;  4MGV A;  4R5E A;  4ZPV R;  1EDQ A;  3OOB A;  2XPA A;  4URI A;  3AS1 A;  1HKI A;  3WD1 A;  1XHG A;  2DPE A;  4W9Q A;  3FY1 A;  5DIT A;  4JYS A;  3CHC A;  4ML4 A;  2M08 A;  5DIU A;  3ARV A;  4PTM A;  3GU0 A;  4ZPW R;  4R0X A;  1E6Z A;  1FKF A;  1LJY A;  2VN1 A;  3TC5 A;  2PPP A;  4TX0 A;  3JXV A;  3RM9 A;  2F4E A;  2DG9 A;  3CHD A;  2A3A A;  3VAW A;  1NMV A;  1W1Y A;  2KGJ A;  5DF0 A;  3O5L A;  2A3B A;  5DO2 A;  2AWG A;  3WD2 A;  3TCZ A;  4NZC A;  4HAR A;  2DT1 A;  1E6N A;  1OGG A;  4Z2G A;  4LAY A;  2XP6 A;  4W9O A;  4W9P A;  1N1A A;  1H0I A;  5BXJ A;  1FKL A;  1LL6 A;  3B9A A;  4Z2K A;  2DSZ A;  4MNK A;  3ART A;  3O5F A;  1GOI A;  3ARR A;  2FDM A;  4JFI A;  3B9E A;  4HBE A;  1A7X A;  2UZ5 A;  3GPK A;  2AOS A;  1P5Q A;  3ARO A;  4JFK A;  4ODL A;  3JYM A;  3IKG A;  4ZPT R;  3ARS A;  1PIN A;  2QF8 A;  2F23 A;  4J4N A;  2WK2 A;  4NNR A;  2IUZ A;  1JND A;  3WD3 A;  1D7H A;  1W9P A;  1FAP A;  2LKN A;  2WM0 A;  2WLY A;  3UI5 A;  3CH9 A;  3PRD A;  1WB0 A;  3OA5 A;  1OWQ A;  1F40 A;  1L1P A;  4DT4 A;  4NSB A;  1EYM A;  2DSW A;  5HW7 A;  2P4V A;  2OFN A;  4IT6 A;  1TCO C;  3AS0 A;  1LL4 A;  3KCE A;  3KZ7 A;  1ZBC A;  2XP9 A;  3CZ8 A;  2PN0 A;  3I6C A;  1U79 A;  1UR9 A;  2ZR6 A;  1NMW A;  4LAW A;  1LG1 A;  1EHN A;  4ODQ A;  3AQU A;  1HKJ A;  4Q22 A;  1BL4 A;  4L3N A;  3ARU A;  3WH0 A;  4QT2 A;  4MNJ A;  2PI6 A;  3JYJ A;  3WQV A;  1EQ3 A;  2DG3 A;  4XAK A;  4TW6 A;  1ZBK A;  2XP7 A;  1ZL1 A;  4MSP A;  2B31 A;  4WK9 A;  3WIJ A;  1W9V A;  3ALF A;  1ZCN A;  4S3K A;  4WKF A;  1X6L A;  3G6L A;  4ODP A;  3ARP A;  1Q6H A;  4DRP A;  3CHE A;  1HKK A;  1ITX A;  3B8S A;  1D2K A;  3ARW A;  3O5G A;  2XP4 A;  4LAV A;  3KAF A;  1QPL A;  1R9H A;  4DRO A;  1C9H A;  1OGB A;  3EY6 A;  1W26 A;  3CGN A;  2EUL A;  1PBK A;  1J4R A;  4TW8 A;  2MLZ A;  3ARZ A;  1HJX A;  1SYT A;  5HW8 A;  1BKF A;  2JZV A;  2F21 A;  4U86 A;  3B7X A;  3AS2 A;  4DRQ A;  4BF8 A;  1W1V A;  4DH0 A;  1NWS A;  1Q6U A;  4QZV B;  1Q6I A;  1FFR A;  1FD9 A;  4ITZ A;  3GTY X;  4MNM A;  3KAD A;  3RGC A;  1JCH B;  4LGX A;  2Q5A A;  1NH6 A;  4U85 A;  3G6M A;  2D9F A;  1JVW A;  3RM8 A;  4IQ2 A;  4Z2J A;  4TNS A;  3B9D A;  4LAX A;  1GRJ A;  1FKS A;  4IPX A;  2KI3 A;  2PBC A;  3ODK A;  3UQB A;  4MAV A;  2ETN A;  2XP3 A;  4QIB A;  2MPH A;  2DT2 A;  3EIP A;  4DRN A;  2KFW A;  3RM4 A;  1E6P A;  4DIP A;  4MTV A;  2MLY A;  3RME A;  1HKM A;  1RD6 A;  1QPF A;  4WKA A;  1UR8 A;  2PPN A;  1EIB A;  4Q7N A;  3NTP A;  5HTG A;  3WL1 A;  5D75 A;  4ODO A;  2L2S A;  2LPV A;  2YBT A;  4JFL A;  4HBO A;  4DRK A;  1F8A B;  4P8X A;  1JNS A;  2F2D A;  5HWB A;  2PV2 A;  3IHZ A;  1QZ2 A;  3KAG A;  1E6R A;  3KAB A;  1Q1C A;  4WJX A;  4Z2L A;  1JNE A;  5GQB A;  3W4R A;  5HWC A;  5HBF A;  4P8U A;  1E15 A;  1GUV A;  2PPO A;  3FXY A;  2IF4 A;  3FAP A;  2DSV A;  4ODM A;  4DZ3 A;  1M5Y A;  4MNL A;  2DT0 A;  1HJW A;  3QOK A;  4ODR A;  4DRM A;  1FKJ A;  3KAH A;  1YAT A;  2PV3 A;  3BXW A;  4J4O A;  1XRV A;  1FFQ A;  4DRH A;  1ZBV A;  1LL7 A;  1W9U A;  1FKI A;  2RUR A;  4MPK A;  2ZR5 A;  3O5P A;  3UQA A;  2WLZ A;  3O5K A;  5HKG A;  3PRB A;  1ZK6 A;  5B8I C;  5DIV A;  4G2P A;  1WNO A;  3PRA A;  2FAP A;  2O9O A;  3WD4 A;  4S3J A;  3KAC A;  2DG4 A;  2O92 A;  1O6I A;  2DSU A;  3ARQ A;  1J4H A;  1CTN A;  2ESC A;  1GPF A;  1YW5 A;  2RUD A;  1E9L A;  3WD0 A;  4P8W A;  3UQI A;  4TYO A;  3ARX A;  4DRJ A;  1KFW A;  1T11 A;  1FKB A;  3NI6 A;  4TW7 A;  1D6O A;  1ZB5 A;  2M1I A;  1B6C A;  3H9R B;  2OLH A;  2ZQU A;  3UF8 A;  2A3C A;  3O5I A;  1NWR A;  4UDM A;  4U84 A;  1TFV A;  3IKD A;  4DZ2 A;  5JH8 A;  5GPG A;  5I98 A;  2LGO A;  4IT4 A;  2K8I A;  2MNT A;  3O5D A;  2RQS A;  4WKH A;  2XPB A;  3O5O A;  4WIW A;  3CHF A;  1NWT A;  1K9T A;  2LJ4 A;  2N87 A;  1ZU8 A;  2PV1 A;  2M2A A;  2ZQV A;  1FKH A;  1FKD A;  1HJV A;  3LUO A;  3WQW A;  1W1T A;  4KQZ A;  3CGM A;  1VF8 A;  4DWS B;  1ROT A;  4Z2H A;  1ROU A;  3IK8 A;  4W5U A;  2G41 A;  2MF9 A;  1W1P A;  4GGQ A;  5HT1 A;  4KR0 B;  4IQC A;  2B5U B;  1KT0 A;  2XP5 A;  3AS3 A;  1LQ0 A;  3TDB A;  1IX5 A;  4C02 B;  3ARY A;  3O5E A;  2DT3 A;  1H0G A;  2RSE A;  2KR7 A;  3O5Q A;  1NSG A;  2ZQS A;  2XP8 A;  1LG2 A;  3KAI A;  3NRK A;  3RFW A;  4DWS A;  1E44 A;  1J4I A;  1FKK A;  2ITK A;  2VCD A;  2RUC A;  2ZR4 A;  3PA7 A;  1FKT A;  1J6Y A;  3O5R A;  2FKE A;  3MDY B;  1NWU A;  4FAP A;  1ZBW A; 
#chains in the Genus database with same CATH homology
 3UI4 A;  2ZQT A;  1HXV A;  5HUA A;  1D7J A;  1D7I A;  2G8Z A;  3UI6 A;  2Y78 A;  4DWS D;  4AY1 A;  1JNT A;  1Y0O A;  4JFM A;  5DEZ A;  5J6E A;  4JFJ A;  1FKG A;  4P8V A;  3O5J A;  4G50 A;  1KT1 A;  4N19 A;  1FJD A;  3PR9 A;  4O2T A;  4L72 B;  3WL0 A;  5GPR A;  4ODK A;  2MLX A;  1X6N A;  4FN2 A;  3ALG A;  4GIV A;  5HW6 A;  4DWS C;  2KE0 A;  1WAW A;  2A3E A;  2YBU A;  1FKR A;  4DRI A;  3WKZ A;  4Z2I A;  1SR0 A;  2KO7 A;  2RUQ A;  4QT3 A;  4ZS6 A;  4ODN A;  3O5M A;  4MGV A;  4R5E A;  4ZPV R;  1EDQ A;  3OOB A;  2XPA A;  4URI A;  3AS1 A;  1HKI A;  3WD1 A;  1XHG A;  2DPE A;  4W9Q A;  3FY1 A;  5DIT A;  4JYS A;  3CHC A;  4ML4 A;  2M08 A;  5DIU A;  3ARV A;  4PTM A;  4ZPW R;  4R0X A;  1E6Z A;  1FKF A;  1LJY A;  2VN1 A;  3TC5 A;  2PPP A;  4TX0 A;  3JXV A;  3RM9 A;  2F4E A;  2DG9 A;  3CHD A;  2A3A A;  3VAW A;  1NMV A;  1W1Y A;  2KGJ A;  5DF0 A;  3O5L A;  2A3B A;  5DO2 A;  2AWG A;  3WD2 A;  3TCZ A;  4NZC A;  4HAR A;  2DT1 A;  1E6N A;  1OGG A;  4Z2G A;  4LAY A;  2XP6 A;  4W9O A;  4W9P A;  1N1A A;  1H0I A;  5BXJ A;  1FKL A;  1LL6 A;  3B9A A;  4Z2K A;  2DSZ A;  4MNK A;  3ART A;  3O5F A;  1GOI A;  3ARR A;  2FDM A;  4JFI A;  3B9E A;  4HBE A;  1A7X A;  2UZ5 A;  3GPK A;  2AOS A;  1P5Q A;  3ARO A;  4JFK A;  4ODL A;  3JYM A;  3IKG A;  4ZPT R;  3ARS A;  1PIN A;  2QF8 A;  4J4N A;  2WK2 A;  4NNR A;  2IUZ A;  1JND A;  3WD3 A;  1D7H A;  1W9P A;  1FAP A;  2LKN A;  2WM0 A;  2WLY A;  3UI5 A;  3CH9 A;  3PRD A;  1WB0 A;  3OA5 A;  1OWQ A;  1F40 A;  1L1P A;  4DT4 A;  4NSB A;  1EYM A;  2DSW A;  5HW7 A;  2OFN A;  4IT6 A;  1TCO C;  3AS0 A;  1LL4 A;  3KCE A;  3KZ7 A;  1ZBC A;  2XP9 A;  3CZ8 A;  3I6C A;  1U79 A;  1UR9 A;  2ZR6 A;  1NMW A;  4LAW A;  1LG1 A;  1EHN A;  4ODQ A;  3AQU A;  1HKJ A;  4Q22 A;  1BL4 A;  4L3N A;  3ARU A;  3WH0 A;  4QT2 A;  4MNJ A;  2PI6 A;  3JYJ A;  3WQV A;  1EQ3 A;  2DG3 A;  4XAK A;  4TW6 A;  1ZBK A;  2XP7 A;  1ZL1 A;  4MSP A;  2B31 A;  4WK9 A;  3WIJ A;  1W9V A;  3ALF A;  1ZCN A;  4S3K A;  4WKF A;  1X6L A;  3G6L A;  4ODP A;  3ARP A;  1Q6H A;  4DRP A;  3CHE A;  1HKK A;  1ITX A;  3B8S A;  1D2K A;  3ARW A;  3O5G A;  2XP4 A;  4LAV A;  3KAF A;  1QPL A;  1R9H A;  4DRO A;  1C9H A;  1OGB A;  3EY6 A;  1W26 A;  3CGN A;  1PBK A;  1J4R A;  4TW8 A;  2MLZ A;  3ARZ A;  1HJX A;  1SYT A;  5HW8 A;  1BKF A;  2JZV A;  2F21 A;  4U86 A;  3B7X A;  3AS2 A;  4DRQ A;  4BF8 A;  1W1V A;  4DH0 A;  1NWS A;  1Q6U A;  4QZV B;  1Q6I A;  1FFR A;  1FD9 A;  4ITZ A;  4MNM A;  3KAD A;  3RGC A;  4LGX A;  2Q5A A;  1NH6 A;  4U85 A;  3G6M A;  2D9F A;  1JVW A;  3RM8 A;  4IQ2 A;  4Z2J A;  4TNS A;  3B9D A;  4LAX A;  1FKS A;  4IPX A;  2KI3 A;  2PBC A;  3ODK A;  3UQB A;  4MAV A;  2XP3 A;  4QIB A;  2MPH A;  2DT2 A;  4DRN A;  2KFW A;  3RM4 A;  1E6P A;  4DIP A;  4MTV A;  2MLY A;  3RME A;  1HKM A;  1RD6 A;  1QPF A;  4WKA A;  1UR8 A;  2PPN A;  1EIB A;  4Q7N A;  3NTP A;  5HTG A;  3WL1 A;  5D75 A;  4ODO A;  2L2S A;  2LPV A;  2YBT A;  4JFL A;  4HBO A;  4DRK A;  1F8A B;  4P8X A;  1JNS A;  2F2D A;  5HWB A;  2PV2 A;  3IHZ A;  1QZ2 A;  3KAG A;  1E6R A;  3KAB A;  1Q1C A;  4WJX A;  4Z2L A;  1JNE A;  5GQB A;  3W4R A;  5HWC A;  5HBF A;  4P8U A;  1E15 A;  1GUV A;  2PPO A;  3FXY A;  2IF4 A;  3FAP A;  2DSV A;  4ODM A;  4DZ3 A;  1M5Y A;  4MNL A;  2DT0 A;  1HJW A;  3QOK A;  4ODR A;  4DRM A;  1FKJ A;  3KAH A;  1YAT A;  2PV3 A;  3BXW A;  4J4O A;  1XRV A;  1FFQ A;  4DRH A;  1ZBV A;  1LL7 A;  1W9U A;  1FKI A;  2RUR A;  4MPK A;  2ZR5 A;  3O5P A;  3UQA A;  2WLZ A;  3O5K A;  5HKG A;  3PRB A;  1ZK6 A;  5B8I C;  5DIV A;  4G2P A;  1WNO A;  3PRA A;  2FAP A;  2O9O A;  3WD4 A;  4S3J A;  3KAC A;  2DG4 A;  2O92 A;  1O6I A;  2DSU A;  3ARQ A;  1J4H A;  1CTN A;  2ESC A;  1GPF A;  1YW5 A;  2RUD A;  1E9L A;  3WD0 A;  4P8W A;  3UQI A;  4TYO A;  3ARX A;  4DRJ A;  1KFW A;  1T11 A;  1FKB A;  3NI6 A;  4TW7 A;  1D6O A;  1ZB5 A;  2M1I A;  1B6C A;  3H9R B;  2OLH A;  2ZQU A;  3UF8 A;  2A3C A;  3O5I A;  1NWR A;  4U84 A;  1TFV A;  3IKD A;  4DZ2 A;  5JH8 A;  5GPG A;  5I98 A;  2LGO A;  4IT4 A;  2K8I A;  2MNT A;  3O5D A;  2RQS A;  4WKH A;  2XPB A;  3O5O A;  4WIW A;  3CHF A;  1NWT A;  1K9T A;  2LJ4 A;  2N87 A;  1ZU8 A;  2PV1 A;  2M2A A;  2ZQV A;  1FKH A;  1FKD A;  1HJV A;  3LUO A;  3WQW A;  1W1T A;  4KQZ A;  3CGM A;  1VF8 A;  4DWS B;  1ROT A;  4Z2H A;  1ROU A;  3IK8 A;  4W5U A;  2G41 A;  2MF9 A;  1W1P A;  4GGQ A;  5HT1 A;  4KR0 B;  4IQC A;  1KT0 A;  2XP5 A;  3AS3 A;  1LQ0 A;  3TDB A;  1IX5 A;  4C02 B;  3ARY A;  3O5E A;  2DT3 A;  1H0G A;  2RSE A;  2KR7 A;  3O5Q A;  1NSG A;  2ZQS A;  2XP8 A;  1LG2 A;  3KAI A;  3NRK A;  3RFW A;  4DWS A;  1J4I A;  1FKK A;  2ITK A;  2VCD A;  2RUC A;  2ZR4 A;  3PA7 A;  1FKT A;  1J6Y A;  3O5R A;  2FKE A;  3MDY B;  1NWU A;  4FAP A;  1ZBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...