5DJ0A

Fc heterodimer design 11.2 y349s/k370y + e357d/s364q
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLTCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj0A01
1MFCH 3CFIC 3GSVB 3W0WA 1UZ6E 1MIML 2R2BA 5DJ0B 1NFDE 3U9UB 3VWJC 1J0IA 1NAKL 2VC2L 1CG9A 2A74B 4PV8A 5A2JH 3P0YL 3BP4B 3WFEL 4Y2DC 1PFCA 3MLXL 4KI5E 2E9BA 3FFDB 3CVHH 2NY1B 1A7BA 3ARXA 4CDGC 2HT4C 1KXVC 1NDGB 1FZKB 4I0CC 1M05A 3B5GA 1RZJC 2DJSA 3SKOA 3TYFA 1SJEA 3MGOB 2IG2H 2YA1A 3VRIB 4QY8A 1E4KA 3LHPL 4XHQA 1F58L 1KG0B 3OZ9L 3UP1A 2JCCB 5E24E 4YXLL 3KJ6H 3IDYC 3OJMB 4KZDL 1OPGH 3NABL 4I13B 2AJZB 3MJ8B 3B2VH 4DKFH 1AY1H 2DLTA 4XX1G 1SJXA 1A3RH 1U8QB 1EDQA 5ITFA 2FHBA 3IAQA 4NT6B 4BFGA 3MNZB 3MJ9A 3G6JB 3WS3A 1CD9B 4DEPB 15C8L 1N59A 2NYYC 2VDOH 4AEEA 4Z7NE 3V7AG 3QXWA 3S35X 3VE0A 1HQRA 3RY5A 1IC5H 1CR9H 1FVDB 4UAOC 5T3XD 1FRGL 4R4NC 2YEZB 1GSMA 4Q2ZB 4PJEA 2D31B 1Y0LA 3PWUB 2VIRA 1I1AC 1ZS8B 3SDDB 4HHAA 4KGLA 1A6AB 3ZLQC 1A3LH 5GZND 1V7ML 2CMRL 1OP5H 5AAMA 4NO5B 3N1QC 3EDJA 4BZ2H 3GO1H 1J0YA 5JTWA 5ESQA 3HKFA 1PSKH 6FABH 1S5HA 4PBWD 1AIFA 2PTVA 5C7XL 1KIRA 2PO6C 3DV4B 2J5LB 4WWKC 3O11B 3RTQA 1VFOA 2AJYH 4PJIF 1R3IH 1CGSH 5HDQL 1JGLL 3A6BH 3RGHA 5D70H 4ALAL 3V79C 4PJFE 4D0CA 4M1CD 1RUPL 2A0LD 3EFDH 4ZS7H 2QLVB 3C2AH 1D6VL 1TJHH 3LKRA 1RK0A 1Q9LB 5K9KA 3SQBA 3IFLL 3P4OB 5A16B 3SHSA 3FQRA 3U0WH 2NXZD 2DQTL 1BQLH 3R8BB 1FDLL 2DBLL 4M62H 2VABA 2XPGB 4LLYB 2VZ1A 5I0ZA 1AP2B 4DUVA 3EOAB 1KIQA 1N2RB 3RY4A 1A7NH 3GMPA 4PJXB 4BJLA 1G7LB 5CBEA 5FKAB 2R15A 5I1JH 3G08A 3IXTA 1G9MH 2GSIB 5JO5B 3C6LA 4R7NB 2ZOKB 2B0SH 3IF1A 5T1KA 3HZKB 3GFUA 2UV3A 1WC7B 2Y5TA 3LY6A 1FFPA 3GSNH 5FV2A 2AQ1A 2JJTC 4Y1AB 4XVUC 5DUPH 2BNRA 3M8OL 3HNSH 3QFDA 5C07E 3DX8A 3AB0C 5J13B 2DQFA 4XXCC 3UPRB 1I3UA 3L7FA 5D1ZB 3HC0A 2X5PA 4YUEH 1JPGA 3BUYA 2HG5B 1AGEA 1UB6B 3VG0L 4EI5C 1MFAL 2CKBB 4O4YH 4HX1A 1NMCC 1ED3B 3VJ6A 4CNIB 4K3GA 4HLJA 5AUMA 1S78C 3IS1X 3ULUH 3IAPA 1QD0A 3GI9H 3SBWA 2X10A 4QRSB 3WV0A 2OL3A 4JB9H 4ZUVA 3RHWF 1HKLH 1IZJA 2XA8H 4JPWL 3VFMB 5MENE 2PXYA 2R29H 5DI8A 5FO7A 3RWCB 5E2JA 5EIIA 4L3ED 3T1FB 4NBYB 1RIVL 4IMKC 3ARRA 4RDQF 4QRPE 2OK0H 4JRYB 5ESVA 1BREA 4MNGA 1K8IA 4HJ0C 3W9EB 4TQEL 1NCNA 4Y19A 4GG8A 4UQ2A 2DL9A 4S1RL 2QBWA 3HMXH 3UZQA 4GMTL 1G9NC 2QHRH 3CMOL 3GHEH 3LPGA 1VFUA 2BVQA 3BT2H 3OKEB 5J3HD 3TBVB 4PJCA 1H0DB 4PRIB 4S0TD 2MCPL 2E7CA 3BKMH 3QEUB 1JPST 5B3JF 4HCRL 4KY1H 3EYUL 2R69L 1TVBB 4Q97A 1JPFA 5EC1B 3MLWL 1A2YB 2HTLC 3OJ2C 1JE6A 5DS8A 4UNVA 1A6UL 4D94A 3BO8A 5F89B 1YYLH 1FYHB 3KYAA 3PV7A 1S7WA 3IETA 1NL0H 3TN0A 5C08D 2EH8L 1J5OL 1V8HA 3S36H 1G6RL 1PKOA 4U0RC 1JN6B 3H0TA 5B39A 1RULH 4G8EB 3P0VL 4LSSL 5DZOA 1VKXB 4OFVA 3W39B 3WUZA 3C09B 1CL7L 1KFAH 2BY2A 3UTTE 2Q8BH 3V6ZA 3L3IB 4X4XB 1NDGA 5FA3B 3HI5H 3U2SB 2WLYA 3VRIA 1HQ4B 2MKLC 1YJDL 5DHVA 1GH7A 1KG0A 2JCCA 5EB9A 5IMLB 2DTSA 3CFJB 4XCYB 5DMKA 2AJZA 2QADD 3MJ8A 5CJXC 4OLZL 3GKWH 1I1RA 5A2KH 1KBGH 4J3SA 1SYVB 2VL5B 4X9FA 1U8QA 5L2KA 4NT6A 2IAMA 3TLRA 5CJ5A 3P77B 4LKXB 4PJAF 1MHCB 4X5LA 2HWZH 4HF5L 4QRTA 4P4RB 1KN2H 3A6CH 2WBKA 4NWUL 2J8OA 4MXQD 1FVDA 4P0DA 2E6QA 3SOBH 3V4VH 2YEZA 1UACH 3S4SG 1ZS8A 2CKNA 3V6FA 4QHNB 5IW6B 4HZLB 2VXVH 1A02N 3RIAK 4OLYL 4B7IA 1PZ5A 5KANI 3MO1A 1TJGL 2FO4B 4G43B 3WXVH 2EKSB 2XN9B 4NN7B 4NO5A 5CWSA 4P46D 2CDFB 4YNYA 2E9JA 2UWEE 1RZIB 3F7QA 3TM6A 5T1MB 2XTJE 5GHWH 5IB4A 1NJ9B 2XKNB 5IFHL 1MF2L 3K3QA 2P7TA 4PJ9C 1RHFA 1MJ7L 2XG4A 2GSGA 2GEEA 3EUUA 5C0AB 2L4OA 4EI6A 1XCQA 1F2QA 5JW5B 1E4KC 5C2UB 4OI8A 3PWJB 3QUYC 3P4OA 5L9DH 1CBVH 1T1WA 1C08A 2ZSVA 3KPLB 1CFVH 4XNZC 1QR4A 2XPGA 5BV7B 4LLYA 1QNZL 1AP2A 1KN4H 3EOAA 1N2RA 5TPWH 4TNWF 3MV9D 4PJXA 1U8LA 2CSPA 1G7LA 1LP9E 4KK9D 3JWOH 4L9LA 5FKAA 3WD5H 2BOCB 3UJJH 7FABL 3FQNB 5CJ8A 5JO5A 2GK2A 1OAXH 1NFIA 3D3VB 1WC7A 5FXCH 2X4UB 2C3WA 4M6ML 1DBJL 4CMMB 3WE6B 5MI0B 3WIHA 5AAWA 4CADB 2GW5A 2XWTA 1T5XB 2EZ0C 4MWFB 2VLMD 3OMZA 4R3SB 5I30L 5HHVL 1WIPA 4WFGE 2HG5A 1UB6A 4XZUB 2CKBA 2HKHL 4FA8A 1ED3A 4M6AA 1MI5D 3G5VB 2J8UE 1UEYA 3IKCB 3ZO0A 1A7OH 5JHLL 4RMUA 4Z7WA 2DWEA 3JV5A 3ZSTA 1FG2B 1KACB 4HGKC 2X1XR 3JTSB 2F53E 1D9KC 4RFEB 4DFHA 3T2PA 4KRPC 5JA8B 4AL8L 4R9HA 1HHGB 1YQ2A 4TOYL 4RGOL 4GH7B 1UT9A 1FJ1B 3MLSL 1R5VA 1NGPH 2NY4B 3C60B 3MV7B 4JRYA 4NM4H 3W9EA 1VESA 4UIKL 1AQDB 1A4JB 4C4KT 3EOBB 3P4MB 1KGCD 5CEYB 3MLUL 3KG5A 3QEQB 3QDJE 4XTRD 3TIDB 5DVNA 2OJZL 4ZDHA 4DVRL 3TBVA 1FNLA 4OI7A 5IHUH 4HKZA 2D7TH 1RURH 4PIRF 3GMNB 1FL5A 4LQFL 3OF6D 1EFQA 5I18L 4XXDB 5DJ2A 1MVUB 4DGIL 5D1QB 3KVQA 3O6KH 2Y07L 1X5FA 3QQ4B 3D85D 4LCCA 4W6WB 5D7LE 5ACZB 2F58H 5E8OB 5D6CA 4I18C 4JPVL 5IROA 4NJ9H 3WSQL 4WEUD 2P5EE 1RZKC 4MNQA 1PG7X 1B0WA 4XAWH 1T1ZA 1A9BB 3U7YL 4G8EA 1HHIB 3C8DA 2RR3A 3W39A 4PUBH 4PRBA 3MYJB 4FQXC 1NGZB 5KS9F 2C7UA 3GUTA 3L3IA 2BX5A 1T83C 4X4XA 1O7VA 5FA3A 3U2SA 1D5BB 3FT4B 3WS6A 1YPZE 2X4RB 3WHXB 3VI4F 4J3UA 2B2XL 3VXSE 4R26L 4ZSOE 4XCYA 1GGTA 3EYQC 2OL3H 2QSTA 1SYVA 2VL5A 4NKDA 2EIDA 2E8YA 3P77A 3KR3L 4LKXA 1F3RB 4JM2B 1L0XA 4XMLH 3O3UN 4HS8H 2YBRB 4P5TB 4DK6A 2F8VA 5IVXB 3KYMA 4X7SL 4HKBA 4WI3A 1WVZA 5EO0B 3T4YB 3NFNA 4L8DB 5HVGB 3VFGL 2NZ9D 4HG4J 1I7UB 1YMMD 4WRLA 4OZFG 5EOQL 5B38A 3MCLL 4JVPA 4UTAH 1CLZH 4QHNA 1BIHA 1UWGH 1INEH 3SDYH 5AG9A 4HFWA 2H6PB 3QCUH 3NZ8B 3QCVL 3CVIL 2Y23A 5GSRB 5IW3A 3BRFA 2FO4A 4YHLL 2OXGA 4P2OD 1QFPA 3O4LD 2B1HL 2DKUA 5CEZH 2LAGB 3K7UA 5FGBA 1ITBB 2ZCHH 3O45A 3ALWA 4LSRH 1HN1A 5F7KC 1CXLA 4G8FB 1ULVA 3LH2L 5FUOH 1T7XA 1S7RA 3FQWB 4K9EL 4PJ7E 4BZ1H 5ERWA 1AXIB 1P7KB 4YHKL 3DV6B 3C5ZC 3S37H 4LDEB 5C0AA 2DS4A 4NO2B 3VFUB 3NFSH 4AIXA 4QWWD 4Y2DB 2EDTA 4XVTH 5IWLA 3NPSC 4E0RA 1T03L 4IEFB 1G0DA 1IJ9A 2A9NH 3KPLA 1N8ZB 2IQAA 2F5AH 5JIKA 3D0VB 2GITA 3LS5H 3C08H 3QDGB 1NBVL 4WUUE 3ZTJG 4PRHE 3HRZB 2BOCA 2DQUH 4FFWC 4X5XA 3FQNA 2ZP0T 3H3PL 4EBQH 3FTGB 3DIFA 3KGRA 1ZT7A 1NANI 1CDIA 4DGYL 3O3BA 1G6RB 2P5WA 1EBAA 1KJMA 5D7JD 1FNFA 2DIBA 4YHZH 2WWMD 3MREA 4GAYA 4KI5D 2YN5A 1QFWM 5T3ZE 4NQCA 4MWFA 4O2FB 3F65A 4HULB 4R3SA 1MNUL 3B5TA 1AD9A 1RJYB 3LRSB 2GKIA 2XKUA 4N8VA 1ZHBB 3RDTC 4JY5H 3VXMB 4XZUA 2V2XB 2CJUL 4ETYA 2DLIA 4S1DC 4DW2H 3ZDZF 3EYSL 1JWMB 3IKCA 3CUPA 5C0DA 4B7LA 3Q6FB 4KC3B 3AMLA 3ZE2F 2IPKA 4OLUH 4LHQB 5IB5A 5IR1B 3JTSA 2E7LA 2XKSA 5HBBA 1UKSA 4RFEA 2I5YL 4BUHA 1HHGA 2JLLA 2WV3A 4ZOCA 3MV7A 4KH2A 5F7WC 1TTGA 3SE3A 2OZ4L 1TZIA 2XQYK 1J88A 4Q6IA 4U49A 1WJ3A 1A4JA 1F97A 4Y4FC 3EOBA 4Q7DA 3GI8L 2R56H 3P4MA 3L3GB 4KK8D 4UUJB 5CEYA 3QEQA 5FIEA 3ZHDA 4L9LC 1SY6H 3UZEA 3NCJL 3ULVF 3S3JA 3BUTA 4JY6B 4NJAH 4YAQB 2G75A 5EU4A 4LCWE 3ULSB 2BNQE 2XZAH 5E8EA 5DR5L 1DBBL 3HZMB 3WDIA 1F5WA 3LEYH 3QHZL 3MLVL 4HBCL 1Y18B 3BISA 1MVUA 5I6XC 4W81A 4K3JL 3RUGE 1RV6X 1KJ2L 2NNAB 2O93L 3QQ4A 3M17B 1P4LA 1Y6KR 5EPMA 4WO4D 4OZIE 1HHHB 3BHBB 5ACZA 1Q0YH 5E8OA 3EDKA 3ARPA 1JNHB 4L4TB 1MRCH 1QFHA 1I3GH 1V3MA 4P9MH 4XCCL 3PL6C 2HAZA 3BPNB 3WIHH 2FGZA 1J1PH 4L5FL 4MQSB 2D03L 4LAQL 4Q9RH 3TVMC 4HLZH 3DETD 1NGZA 5DD1L 1UM4H 2BVOB 4N0CC 1MJJB 4PRNA 1MEXL 4EI5B 4AENB 1CDGA 4WVRA 3RNKA 1LEGA 2KL6A 1D5BA 3FT4A 3UO1L 1NMCB 4X7DC 2W65B 2CKBH 2X4RA 1Q1JL 4LVEA 3KAAA 3LQAL 1OTUC 4YHMH 3HE7C 2DM4A 2QJDA 3S98A 4GS7C 4J3TA 4GXUN 4Z7VE 2X4SB 1D3CA 4PJ5B 2UUDK 5IFAH 3HI6L 1A47A 1P69B 5DT1L 2YHGA 4PYHA 5IQ7L 4UOW1 5C07D 4P5TA 1JNLH 4ORGA 4JFFB 2WANA 4GAGL 1T66C 5GJSH 1MCOH 3DMMC 3T4YA 4GBXD 1NDMB 2CO7B 5C6TH 3IFNH 3SO3C 5GGVY 3REWA 3ZZ1A 1SMOA 5I1AB 1K3IA 2ADFL 2DF3A 4IRSC 3TBWB 1IGIL 4NQDA 3HR5B 1W0VB 5F1IB 1P2CA 5MEND 4AH2B 4ZPTB 2FWOA 4R7DB 5GJTH 5IQ9B 1ORSA 2C3HA 2E3VA 4G8FA 4QRPD 1QVOA 3FQWA 3QUZB 1DVFC 3MYZA 3T0BA 5E8DL 3UYRH 1P7KA 3KS0H 1IEBA 4C57C 4LVNC 3VFUA 4U0RB 1G7HB 1I9JH 4LCYB 1HINL 1Z3GH 3EJZC 2I27N 1IAKB 1WBYB 3TJHC 2PR4L 3D0LB 2XXMB 3QDAA 5FDWB 4R4FL 3L5HA 4X9GA 5DD5L 4DGVH 1UYWH 5LXGL 1MCWM 3INUL 5CUSH 4LARH 2YPKA 3MRKB 2Z92B 3D0VA 4HCRA 1G84A 3RVUC 3QDGA 3NGBC 3ZSSA 3CPLA 4IOFC 4MJ6A 3L5XL 5INDA 3WXWL 2O5ZH 3DUUB 2PYFB 2Q20A 2DQIH 5K9OB 4FZ8H 3GSWB 4X6BA 4MLSA 3TWCH 5H35B 3OB8A 3TGXA 4G8IB 1G6RA 4AIZA 2BHUA 3KYNB 1CQYA 2LTQC 5B21A 4XI5D 3UTTD 5FHAL 1X5HA 1MRDH 1OAYL 3O8XC 4X6CA 5EU7E 3LRSA 4IMLB 4GKSB 1CFSB 4PP1C 2CLRA 1NBYA 1DSFL 4C56B 1YEDB 5C9JA 3ARGD 1G9EA 1L4IA 1P7QD 4XT1C 1OL0A 43CAA 3R06A 5JLZA 2R2CA 1A6ZA 5I1HH 5B22A 2FB4H 3MA9L 4LHJB 5KANG 1XF2B 4J6RL 2BOBA 5DQJB 2OXHA 1VACA 2HVJA 3LN5A 2VLJB 3FT2B 4HT1L 3RIFF 3R4DA 4YHOL 5M95B 1P4IH 2KPNA 5IOPB 3C5SB 2YSSA 2ATKB 2IANE 4G5ZL 5ANMB 2Q87A 1QRNE 2R23B 4AQOA 4PJ9B 5F7UA 3ZL4L 4LNRA 3VG9C 1DUYA 2IADA 3LKQB 3DRQB 2NW3B 3T8XB 4YDJB 2J8HA 5JR1H 5IF0A 4OLXH 2WW8A 1SYSB 5JNYB 3BFOA 3IDJB 4EIZC 4LSVH 3OAYH 4ZOBA 5IMMA 3WFBH 1OTTD 3OV6A 4TVPE 4Q0XL 1A14L 1ZLUK 2OBGA 4YAQA 1KJ3H 3ULSA 1PEWA 5GRVL 1KXQE 1AKJB 2B4CL 2IFFL 3LKNA 3PJSB 5BV7H 2XTJD 2ZPKL 4F7PB 4WI9A 1I1FA 5MERB 3FQXB 4YBLC 4IS6A 3RHWK 3AREA 2NNAA 3S3PA 1PD6A 4JFQB 1MIMH 1CFQB 1N7ML 5GS0C 4DJMA 5FF6A 5F7FA 4X6FB 5EULV 2BNRE 2KKQA 3JTTB 1GC1C 2ESVA 3SDXF 2VC2H 3S35L 4NQEA 5BJTB 5M94B 1ADQL 3ZE1E 4QTHB 4WFEE 5DMGD 3GBML 3UBXI 3L5WA 3LQZA 4R0LB 1F3DH 4WW2F 4U6HB 3UDWA 4YHIB 2R4RL 1XR8A 1HEZB 1UVQA 4KPHL 2VN7A 2WINA 5DRWB 1EJ6A 2EIEA 3GHBL 1ITCA 3OZ9H 4JDTH 1I85A 4YXLH 3MUGA 5HI5C 1MHHA 5E99H 4JQXC 3FFCB 5D1XA 4C54A 1JZ8A 1DBKL 3QZWG 4Q6IC 4KGJA 2Y4SA 5FYLL 3HG1B 3HNVH 3AFLA 1D9KB 4MNGE 2V5SA 2ZUSA 1S9XA 4D8PB 1I7ZB 1MQKH 3DTXB 15C8H 4JFFA 1VFAB 4RBPH 3QJHB 4H88H 3CFKB 5AWNL 5GRJL 4WFGD 1YEJH 3ORJA 1CCZA 5F7DB 4AZ8A 4HUWB 1KXTB 4PJCE 2H45A 5C0NC 2AQ2A 2ZUYA 5I1AA 3CC5B 2B8OT 3MXVL 4GO6B 3TZVA 4KKAD 5HPMB 1E28B 5F1IA 2XQBL 4YHNA 2VR5A 4R2GD 2F53D 5ACMA 4K7PX 2W59A 1U2CA 5SWSD 3TIEB 1CWVA 1T4KA 5KJRH 35C8L 1JPTL 3NCCB 4CJ0A 4HH8A 4WW1B 4MXVE 2Q76A 5EOTA 1CLCA 1RY7B 2XRAL 4WTXA 2NY6C 4I18B 1S9VB 1W72L 4NGHH 1FNEB 2P46B 4ALAH 4H8WC 4P23D 3QDJD 5ALCH 1G7HA 5C70A 4LKCA 4LCYA 2FLRT 4BQBA 1NGXB 1WBYA 2Z8VC 4K8RD 1D6VH 4F2MA 3IFLH 1YNTB 2ICCA 2DQTH 3MV8B 1WBZB 4HXAH 1DZBA 3X12B 4L8CA 1FDLH 2QQNL 3OR6A 4MD5B 3VI3F 4PJIA 4MAYD 4F37F 2Z92A 1U2HA 5D2LB 3VDCA 1R3KB 2EH7H 1S7QA 1IGCH 4MDJB 1OP3K 5L2KE 4NKMA 4NZRL 5D7LD 4TPRH 2V7HA 2Z31D 5K9OA 1RHHA 2YD4A 5BS0A 3VXOB 2JK5B 5HHXL 2P5ED 3KPMA 1CIDA 2JF1A 2X6MA 3VWJD 1NGYB 1CT8A 3KYNA 1FSKC 4F9PC 3O3DA 3BN3B 2DJ4A 5TQ2H 1WK0A 3M8OH 5KZCB 2PTTB 4PY7B 5EIVA 3T4AB 2UYLA 1CFSA 3EFFB 1BX2A 3NA9H 1BBDH 3UMTA 2HLFC 1H5BC 1YEDA 4E42A 3VG0H 2NY0C 4OJFL 3VXSD 1VHPA 5DUML 4PJDB 2JB6B 5GGVL 1KEGH 3IJHB 4R96B 1MCCA 2NXYB 1EZVY 3SY0A 3VW3L 4BSJA 1XF2A 4OV5B 4HZAA 4XP1L 1J0HA 5FCUL 2QKIB 2ARJA 4N9OB 4I5BB 4HWBH 1RIVH 3TO2B 4H20L 4HGMA 2EDRA 3BX7C 4G6AC 1MJUH 1LO2H 3I3EA 3QWRD 3LKQA 3DRQA 2NYYD 2NW3A 3C5ZB 2BY3A 3T8XA 4N5UA 4TQEH 4YZFE 5C0BA 4LU5L 5L88H 3VWKB 5JNYA 4M7LH 4S0SD 4JZJA 3CMOH 4QOKB 5DHYA 4ZG1A 3VFWB 3IDIA 1KIPA 3C8KA 3NPSB 4FTVB 1NCBL 1J8KA 1I1AD 4P5MB 3AS0A 4RGNB 5DC9B 5HI3C 3LPFA 1MVFA 1AKJA 3PJSA 3TT1H 1MHPH 5K9QI 4F7PA 1HH6B 1RZJH 2AGJH 5MERA 1NC4B 3FQXA 1BZ9B 3MRRB 3RJDA 4F3FB 4RAUA 1CLYL 1NCWL 1NCTA 4JFQA 2O5YL 2PO6D 4YR6B 1W0WB 3FRUB 1AQKH 4WWKD 1I7TB 4X6FA 5DWUH 1CXIA 3OJVC 4ZD3H 1JF1B 2BSTA 1J5OH 4PGZA 1G6RH 4GXUM 4XPAL 2C1OB 5FGCE 1KPRB 3DURA 3P0VH 3FO2B 4NYLB 3IDXH 1A1MB 5F7LB 1KCLA 3O9WA 1CL7H 1DE4A 3RDTB 4XPHL 2VLKB 1VCAA 5ABDE 4WUUD 5EORH 4Z7WE 5HDBE 1HEZA 5I8EB 1N6QH 2A9MH 3T2OA 5GSVA 5F88B 5LWYL 1F6LL 3I9GH 3GIZH 3BQUB 2Y7QB 5SWQB 1Z9OA 1KLGA 1HWHB 2ZCKL 5T5NF 3AUVA 1T1XA 1H3UA 5HXMA 3IVKB 3FFCA 3W9DA 4K23H 4J23A 5LAXB 3BEVB 3O6LH 3UYOD 4GLRH 4GRWF 1BVLA 1P53A 5T3ZD 1B4JL 3LDBB 1PYWB 3DTXA 1ZANH 2HFGH 4HF5H 4IRJD 4X9BA 2X40A 3HC3H 4E41A 3BIBX 1OOAA 1P4BL 2X4PB 4HWUA 1FAIL 5I75C 4HUWA 3BEWB 1LNUB 4ZQKB 1DEEB 5K59F 3IS0X 3BGFB 3CC5A 4K55A 2VTFA 3ZDYE 5FYJE 4FOMA 4M3KB 3OXRB 5B4MC 5LGJA 4PJAA 4OLYH 5J9PA 1KTLA 1P1ZB 1TJGH 4OFKA 1S78D 4U1KB 2P24B 2FEDD 2FD6H 4RQQB 4JFDB 3T0EA 1CZ8L 3FN9A 4RMWA 5I6XB 3PQYE 2IPUG 4MNQE 5C71A 1MF2H 5KSBF 1F11B 3BZDA 3VU2A 3PABA 3MROA 4N0YL 3UDWC 4L29B 3VH8B 1ODAA 1S9VA 4L3AA 4RFNC 1J11A 3GJFA 4TTDC 4OB5H 5LJYH 3QIBB 4XRCA 1DQLL 5CMAB 4I3SH 1PKQA 3PWPB 3AM8C 4U6TA 1I85C 4LLUB 1F4YL 4LCWD 1HK6A 2BNQD 3KLDA 1YNTA 3PF2A 5IJKC 3FHQA 3SGEI 5D1XC 1WBZA 3X12A 3BMVA 2VAAA 4QO1A 4I2XA 5D2LA 1R3KA 2RBLA 2HKFL 2YK1H 3JWDL 1YEFL 3P73B 4KV5F 1WAAE 2XNAA 4AEFA 2AXGA 2W60B 2DIAA 3QFJA 4X98B 4MDJA 4MZ3A 4LCIL 1KJ2A 5LGHL 2PW1B 3HE7B 4XHJC 2HT3D 3ILQC 2HTLD 2H8PA 4ZUTB 4GS7B 4NHUA 3I50L 4JFOA 1WFUA 5GS1C 1XGTB 4NO0A 3BIKB 3EYVB 4L4VE 4RX4D 1FO0L 5DJAA 2PTTA 4PY7A 2F54B 5I30H 1OGTB 4Y4KC 1AGFA 4X8JA 3S5LG 4J12A 1G9NH 3B83A 1AXSB 1JFQL 3NCYS 4JN2B 4IRSB 1WEJL 3RVXD 1HHKB 2JB6A 1OM3H 4R96A 3MLTB 2NW2B 1KB5B 2O26U 4I0PA 4OV5A 5ACLA 1JTPA 2XA3A 4WEBH 5DZNA 2YMXL 5ICYA 3B9DA 4AL8H 1JBJA 4I5BA 1DVFB 1QSEB 1T89A 1IL1B 3B9KC 3ZKND 1MCEA 1WZKA 3LZFL 4PGBA 3QXTA 4TSCL 2VDKH 1ZA3B 3B2UD 4PJGF 2NCMA 1L6ZA 2CDEA 4WHCA 3VWKA 1AHWC 5I15L 3D39E 1JTOA 1IAMA 1BOGB 4QOKA 25C8L 2AP2A 4J7RA 3MLUH 3VFWA 3ZT6A 4FTVA 2MTPA 1EEUA 2APXA 1SVZA 2NX5B 1GZPB 4BUGA 4MQ7B 2ADGA 1FH5H 2OR9L 4G42A 3GMRB 5ITBL 1MCPL 1Z9SA 4G6FB 2N4IA 1M71B 1RFDH 4ZS6C 3N06B 4ZO8A 2E9IA 3HNTH 1U9KA 4XNMA 2CK0L 3ZT7A 5I18H 2F19H 2OCFD 4O2CA 4F3FA 5J11C 2F74B 2P5WE 3QEHA 4HIEA 2GHWB 1MFBL 3EJYC 4NC2B 1UC6A 3BKYH 3FRUA 1X4ZA 4XBPA 3SGJA 1I7TA 3GGWA 3KYOB 1UCBL 3D9AH 3V7MA 4NQCE 1W72B 2X41A 4F7MB 5EUOB 2LTQB 1KPRA 4POZD 1E0OB 3UTPE 5H94B 5EZJB 3I84A 3ECBA 4LLDB 1IEAA 1WISA 4YPJA 2PW2B 1UA6H 3QUYD 2CIIB 5BZDB 1OSPL 4OIIL 3O0RL 1JGVH 2VLKA 1PLGL 3BPOC 5I8EA 5E4IA 5F88A 1FIEA 1RZ8A 2HFEB 5E6IA 1X5YA 3BQUA 1M7DB 1YC7A 2O61B 1MLBA 1LK2B 1OWRM 4UIMB 2QR0B 1RJLB 5CZVL 4XP6H 4Y5XC 3VXRE 1ACYL 5FB8B 4HFUL 5DYOB 4MD4B 4POUB 3GNML 5KS9A 2VE6A 4KMTH 2DYPB 3KR3H 4ZPVB 2DKMA 4LOUC 5KG9A 1YEHL 1PYWA 3U0TB 3VRJB 4X7SH 3CDCA 4O9HH 3Q1SH 3BH9A 5E7FA 3BEWA 1IILE 5I8OL 5EOQH 2H9GB 3P9LA 3X13B 4K94C 3WBDA 5DD0L 4KHTL 3HC4L 3QCVH 3CVIH 3RTQD 3QNXB 4MB4A 3VFPA 2EXWD 4YHLH 2P24A 4BK5A 4LLQB 3LS4L 3CSYA 4LMQE 1J1OL 5CEXB 1C7SA 2B1HH 5EU5B 1MCDA 2IAND 5J1TC 4Y16A 4E9LA 4JZNB 1QRND 4OAWB 5HJ3B 3HG1D 3LH2H 5DEGB 3MCG1 3PHOA 4KRPD 2BVPB 1F11A 1C12A 3O9WC 4OSUH 3WUWB 1D6EB 3WN5B 1IAIL 4U7SA 3MCKB 4LVHC 1LEIB 4JG1H 5D7IB 3QIBA 4S1QL 3NBNA 1GOGA 2YWYA 3HN3A 4TVPD 2V2TB 3PWPA 5DA4A 1BF8A 5BRZB 2BERA 2FATH 5CCKH 4BH7A 1A7PL 3DLQR 3B3IB 3UBXG 1XF4B 1FGNH 2IH1B 3C6LD 3VFSB 4JQVC 3KPSB 2JE8A 3I75B 5T1KD 1FVCB 3D5OF 4KQ3H 5ICXB 3I2CL 5GZOD 2AI0L 3P73A 3EO9L 2K7PA 3TPKA 2W60A 3WHE0 1JZ3A 4MA1C 1ZLWK 1OCWL 2V2WA 2BNRD 1AXTL 4FFZL 1IC7L 3OHXB 2RGSA 1KIUA 4OZHB 4DGYH 3EYVA 5HHPB 4JAMA 3MV11 4WFED 1ADQA 5HYEA 3LEXA 3OXSB 1ZLVK 3V0WL 5B8CB 1Q0XL 2FECL 1F4XH 3MQIA 4DN4L 1NLBH 1MNUH 4NQDE 2VXQL 2GFBB 2HVKB 4NOBA 2ZCLL 1D5XB 1R0AL 4FQXD 2AV1A 5BVJB 3TT3L 1AXSA 2PXYD 3O2VH 1FBIH 1QFWH 3DYMA 2BHZA 32C2A 4NC1C 3D69A 3CXDL 3TNMA 3EYSH 1BQHB 3BPLB 1OAUL 1OD7A 4DCQA 4JDZA 1X7QB 4JFEA 1FL6A 1GOFA 4J3WA 1GIGL 1I9RL 1SJHB 4IIQC 3RRQA 1V3LA 5TH2A 2P45B 4XMKL 3LIZL 3OKKB 3A6OA 1QSEA 3PWLB 3CLEL 3UJTH 5J1SC 3TBYB 4GJTB 1I9IH 1U58B 2FZ3B 2FIKB 2NY6B 4ODSH 4XPTL 5DD6B 5FM5M 5KVFL 2OZ4H 2OJEB 2X9YA 2Y36L 2HN7B 3HAEA 3OKNB 1RZKH 2G60L 1FE8H 3GI8H 4JREC 3T2QA 1BOGA 2VR9A 5C0CE 3ROOB 2NX5A 5DJZA 3LVEA 5IW1B 4LLVB 4YDVA 2CPCA 5HHNB 4TULH 4W68A 3FAWA 4XMPL 3MLRL 1M71A 1CS6A 1DBBH 5GQBA 4KTEL 3TN0D 3ARYA 5F7NC 2E7MA 4NFBA 5F72S 4HBCH 4N0UA 4MS8C 3ARDB 2W9LA 2F74A 3DGGB 1HWGB 4K3JH 3NIGE 1R5WB 3GB7B 4G7YH 3IYLW 1FZMB 4IDJH 1MLCA 4KUCF 4JCLA 4JRXB 2H2PD 1J86A 3LV3A 4X6CE 5DQ9B 4F7MA 5EUOA 1YEIH 5BO1L 1CGVA 1MOEA 2HYMA 4HXBL 4KTDL 3E3QE 5H94A 5FO9B 4YQXL 3QSKB 1QLEH 4LAQH 4Z5RA 5DD1H 4MXWL 3MACH 5C8JB 4UMGA 3HPLA 3HZYB 1NMBL 1H5BB 4GG6B 4ZAKA 4MDIA 2NY0B 4OCNC 5L2KD 3VFNB 2IAMD 2Y1VA 1N3NB 5L6YL 3U46A 2VH5L 3LQAH 4LPUA 4UIMA 4M6NH 1VFBB 4JPKH 4NCDA 4FFWD 5CGMA 2AK4B 4MD4A 2A6JA 2XWBA 1KCKA 4WI5A 4MAUH 5GRUL 5CS7A 4A6YB 3QJFB 5IQ7H 4NQVA 3BRDA 3VRJA 1EIBA 1RU9H 3HA0A 4FQPA 3ULUF 4HD9A 2YC1B 4LRNL 1B3JA 1RIHH 2XZZA 4HJGB 2A83B 4X6DE 4LMQI 1MCBA 3N50A 3H42L 2H9GA 3MLPA 3H9HA 5F7MC 4EN3C 5D2NA 5KSAC 3W5NA 2ADFH 1NGQL 2JIXD 3DVNB 1XAUA 4N0RA 1CDUA 3KDMA 1CD1A 3SGJC 4S1DD 1S7VB 3RQ3A 3PP3K 1KNOA 4NUJB 1H8NA 5K9QG 4KXZH 3JUYA 3SDCA 4JZNA 5D8JL 5HJ3A 1KCRH 3WDHA 1RJZB 2ESVE 1WZMA 2BVPA 4NQEE 4LSTH 4DKEH 3WCYA 2GCYB 2R0KL 1AGBB 3V8OA 1D6EA 3RNQA 2EC9T 3QI9B 2GJ6A 3OPZH 5B3NA 1K2DB 4M00A 4Y0GA 1X44A 4Y4FD 1HINH 5T1DL 5EWIH 5BRZA 5T1LA 4F33A 5KSUB 1FFOB 1LK3H 2LVEA 3B3IA 2IH1A 1YDPB 2OSLA 3KPSA 3I75A 1NBZB 3INUH 2P8LB 3ZKXC 4P9HL 5E94B 4FABH 1QLRB 5I1CH 4U1IB 4UZGA 1PEZA 1CDCA 4HS3B 4KKCD 4OZGF 3WXWH 1KLUA 3WNNA 4ZTPL 5F9JB 1DQTA 3UTSB 1KB9J 4JFFE 2C3XA 4YBQD 5JW4N 5JUEH 5MP6H 5IG7A 5HHPA 5D5MF 4HV8B 2Z8WC 5DEZA 3WJLA 3OXSA 5B8CA 1CVRA 3BJLA 1QPPA 3PL6D 4RISH 5IV2A 3GEWB 3RWFB 1OAYH 3FHAA 2GFBA 2HVKA 1UZ8B 4HPYL 3TVMD 2Z4QB 3ILPB 5KN5B 4H26B 4N0CD 2IQ9H 1EEZB 4FQJH 4EOWH 2FJFB 3OB0K 4LRIA 3HMWH 4M43H 2F5BL 1RZGA 1L0QA 1GZQB 3QPQC 2K1MA 4F37K 5IB1A 3DBXA 5CJBA 5CIPA 4LHUD 5B39G 3PGFL 1X7QA 1OTUD 3BE1L 3RX8A 3S3SA 4HT1H 4YHOH 4ESKA 4UU9B 5C09A 4GW5B 4X7CC 2UZIH 3RA7L 3PWLA 4H25A 3FQTA 4ETQB 3PGCB 5D72L 3VA2C 4LFHD 2FZ3A 4ONFH 4RFNB 2OJEA 3HS0B 3UJIL 2XY2A 2HN7A 5D71L 5FAAA 3DMMD 1I1YB 1BVKA 4M1CC 2A0LC 4RCAA 1UJTA 1QFUL 4WI2A 3MRCB 1CGUA 5FYJD 1DBAH 4PJIE 4XCEB 3EOYG 1YEGH 3QNZB 5F3HB 1WZ1L 3CSBA 4Q0XH 3FONB 3STZB 2NXZC 1T7ZA 2Q3ZA 4P57B 1P9MC 5J7CC 2B4CH 2AKRA 2J88H 2EEDA 3MRBB 2CLVB 2OYPA 2ZPKH 1CL7I 3Q6GL 3X3GL 4NRXA 5BS0E 3PQYD 5ALBH 4MNQD 3ARDA 3IU3B 1QHOA 5CSZA 1MFCL 3VGAC 1N7MH 1S8DA 3HZVA 5GS1B 4HUUA 4JRXA 3RWJA 4EUPB 3FJTA 1ZMYA 3PXJA 4WGVB 3OGCB 4MCZB 3DECA 1ADQH 4GLRI 5FO9A 4XPGH 3HE6B 3TJHD 4Y4KB 1CFTB 3HZYA 4OLEA 3HFMH 5D7SL 3RZWA 1WUNT 4HKXA 5FFLA 3CVHL 4I3GA 2GK0B 3WLBA 4P2QE 3VFNA 2BVYA 4OQTH 1IC1A 4RA0C 2AJVH 2NR6C 3RVUD 4XCFH 5DJ6B 1TITA 4FFVC 3WKMH 5TJWK 1XF5B 4IOFD 2EO1A 1KB5H 3QNYB 3AVEA 4YK4C 4MJIA 1OPGL 4L4VD 5FYLH 2BXYA 3GMQA 2NY5L 4PJEF 1DUZB 4DKFL 4YE4H 1FO0A 3QJFA 1A3RL 2BSRA 1U93A 3MXWH 5C0BE 4IM8A 3B9KB 4JGJA 5F6IC 5JHDB 3F5WA 5AWNH 5GRJH 4WENB 2VDOL 1KELL 3RWGA 1PX3A 1AHWB 3O8XD 3KLHC 4HUVA 2DMCA 4PP1D 5IHBA 1M1SA 3DVNA 4OIAA 1M7XA 4TUKH 3MXVH 2DOCA 1DFBL 2AQ3A 2H2SD 1S7VA 2XQBH 2DDQH 3ULVC 5DJCB 4NUJA 1A3LL 3DUSB 5F21B 4NP4H 5C3LD 3V95A 3KLAB 4BZ2L 3GO1L 3UXFA 6FABL 1PSKL 4HLZG 1BZ7B 4K71C 4NN6C 4PLKC 1JPTH 3MRQB 2PYEA 1RJZA 5J11B 3LD8C 4DN3L 5DUBB 5BW7A 4ZO7A 1U3HB 1FZOA 4G6JH 2GCYA 2DN7A 5B3JE 5JW4Q 2XRAH 3QI9A 3D39D 2R8SL 1W72H 1CGSL 3AXLB 1NCCH 3QUKA 3D2UB 3QXAB 3A6BL 4NQXB 5D70L 1HKFA 5CD3B 3RWHB 4JE4B 4WCYL 3C2AL 1KOAA 3EGSB 3SCMA 4OCSH 4ODHH 2BNUB 2NY3B 4IJ3C 1FFOA 3FT3A 4WEMB 3NVQA 5T3XL 3RVVD 3U0WL 1NC2B 3QH3B 2Y5EA 2P8LA 1BQLL 4YLQT 4D9QE 1PJ9A 3ARBA 2H41A 4M62L 3FO9A 2P5WD 4WUKL 3MUZ1 5EZIH 1FP5A 1A7NL 1J8HE 2DWDA 3SJVD 4NZRH 4N68A 2QADC 4NQCD 4Y5XB 4JFXB 5I1JL 1UKTA 1FLRH 3UTSA 5IMOB 4OF8A 4E41E 3UTPD 4XNUH 5HDLA 4YFLF 2RB8A 3TBSB 5E1AA 2V7NB 3OR7B 4QHKJ 3LKSB 3GSNL 3O6FA 2ICEA 4U7KA 4P2RA 5I74C 2BCKB 4HC1H 4NUGH 1J05B 3EZ8A 4MXQC 3ILPA 2GTZA 1DN0A 4PJAE 4OM1H 1BJ1J 5KN5A 4HIIB 5J06A 2NTFB 3QG7L 2CUIA 4YUEL 5I19L 2GY7B 3SPVA 5I16B 3DVGB 1NGWB 3T0EE 4O4YL 3LN4A 4ZTOH 4D2NA 3VXRD 1HSBA 3GI9L 1JVKA 3HUJB 1EVUA 5DDHB 4LF3B 4QT5B 4JB9L 1HKLL 3FOLA 2XA8L 5HYQB 2VQ1A 2R29L 1I75A 1I1CA 4GW5A 4OV6F 1VB9A 4S1SH 5FYKE 5E2TH 2R1YB 4NRYA 3PGCA 5GS0H 3GRWH 1PKQE 4CVXB 2OK0L 3EKCA 3V9FA 1GC1H 5BOZG 4MGXA 1XF1A 4XAKE 2J3SA 3CZFB 2YR3A 4I2XE 4PJ8A 4XCEA 4HKJB 2YPLE 5F3HA 5C0ND 2QHRL 3GHEL 3STBA 3ZYOA 1XIWB 3FONA 3BT2L 2VKXA 4UILL 3QFJE 1K4CB 3LRHA 3V7AE 4ZFFB 3CFBB 3RWIA 4FXGB 5KOVC 4QRRA 5EU6B 2KH2B 3MRIA 3BKML 4Z8FH 4KY1L 4AEIH 4QHLB 4PREB 4MA1B 4Z9KB 1QSFB 1T2JA 3C5JA 5JXEA 1MSPA 1U41A 4OCRH 4KJPC 3KHQA 1YYLL 5GGTH 4X6EB 5JZ7D 2YWZA 1UFUA 3QCTH 3OGCA 3DXAD 2Q86B 3MLYL 3QIUB 4G6KL 3S36L 5C9KA 5HYJA 1IGYA 3N85L 3BKCL 2JCCF 1RULL 3HE6A 1UJ3C 4M48L 4G9DA 4PV9A 5CLTA 4PGCB 1IEHA 4I3RL 3GSOB 2VJXA 3LRGA 3DI3B 2Q8BL 1FFNB 3BD4A 3G6JF 3F58H 1BBJB 1UGNA 3HI5L 5LCVH 1XGYH 4XNQA 2ZCKH 4XPBH 1WTGT 1YY9C 3DARA 3L7EB 3QNYA 2OX5A 5LVEA 1K85A 4QRQB 3GKWL 2BSSB 1DUZA 1TENA 1ZT1B 1EO8L 5FYJU 2EE2A 3E0GA 1Q9KB 4HWZB 5L7XH 4NQDD 5D7KE 2HWZL 2IFGA 4LPCA 1KN2L 3KXFB 4H8WH 5T5FH 3GSRB 1LMKA 3QO0B 1PZUB 3SOBL 3V4VL 3CSPA 4TSAL 4X83A 1UACL 2HLFD 1U8JB 4APQB 4ONHB 3ME0A 3QRGH 2UY6A 1EHXA 3E6FB 5L0QC 4U1GC 1ND0B 3S6CA 3ZDXF 2R9HC 3DUSA 1CLOL 5BVPL 1I8MB 1XR9A 3WXVL 1FNGB 1XF3B 1BFOA 1K8DA 1BZ7A 1MELA 1CFBA 2AEWA 3MRQA 4NQTA 4MX7B 1Y6NR 1T20B 5DUBA 5L8LB 3LSOB 4QF1B 4GXVL 2QQKL 3RU8H 4ODUB 5EZLB 4BQ9A 4YFDB 1MFNA 4G6AD 3EOTL 3S34H 4PGEA 5C0CD 1TNMA 3JWDC 3GMOB 3D2UA 5KAQF 4NM8H 5CP7B 3P40A 5JW4M 1JK8B 4PJXF 2D7NA 3EGSA 2VWEC 4LSPH 1F4YH 2CDGA 1RUAL 2R1XA 3KPPA 4RMRA 1EFXB 3FQUB 5HI3D 1CBVL 1SVCP 4N8PA 1EH9A 4WW2C 1QLFB 1A7QH 2HKFH 5AZEL 4M8VA 1YEFH 3FCTB 4F57H 4Z7UB 4XWGL 1X5XA 5KS9E 5LGHH 1CE1H 2CRYA 4FP8H 5HHME 3WD5L 1E4XH 4JFXA 2ZNXA 5E8NA 3UJJL 4P3DB 4PG2A 3U9PL 4WHYH 3G5ZB 1NAMB 4KMLB 3VI4E 2IALA 1A64A 1ZOXA 2ZUXA 1OAXL 3OKMB 4KKBD 4A6YH 3E8UH 2V7NA 3N1PC 5GS2H 2B5IB 3WYRA 1J05A 3DX6B 3S88H 1NEZA 1N5AB 2BMKB 5C2BH 2YZ8A 5HY9B 1OT1A 2NZ9C 5EO1B 4YEFA 4G80B 1BQUA 1JFQH 1WEJH 1I8IB 4EJ1C 3DVGA 4EVNB 4R90L 5E0QA 2NPLX 3S96A 1EXUA 3TPUB 1UH2A 4ODXB 1INDL 1NSNL 3MRNA 3RGVC 3IDMB 5TDNA 4QTIH 4QXGH 1WSST 5AD0A 5A2LH 4PS4L 3SCMC 2IPUK 2R1YA 3K2UL 2P44B 2G2RA 3WEXA 5JQHC 1PG7H 3LZFH 5E70A 3BGMA 4NCC2 5EN2A 3ARBC 4NM4L 4UINH 3WNOA 5LQBL 4QWWC 3RL1B 1HILA 1KEMH 4HKJA 3RKPA 1HDMB 1F02I 1XIWA 4Z0XA 5SWZE 2M2DA 2BJMH 3ARED 4ZUUA 2NLJB 5GPRA 5B4MD 3H9ZA 4CMHC 1RUQL 4UDUA 3ZKXB 5IHUL 2HH0L 5F8QC 4FXGA 1RURL 1HYRC 4PJGA 2ESVD 5E00A 2FNBA 2H26A 4NQED 4J4PC 1B0RA 4U1HA 2C26A 4CU8A 3C87A 2VRAA 5HGAB 3RWEB 3ES6B 3BYYA 1UCBH 2XI9A 3TA3C 4RMTA 1MREH 1QPXA 4GRLC 1L7IH 3AY4C 2F58L 3MRMB 1DLHA 4Y7MA 1OP5K 1ZVSB 3QIUA 4NJ9L 2QTEA 3O2DL 3A67L 4XAWL 2H3NB 5DK0A 4KJYB 4U6VH 3MUY1 1T0PB 2JTDA 1BFSA 4OIIH 4PJHB 4WY7H 3GSOA 2P47B 2W0KA 4JHWH 5D1XD 2A73A 5ENWB 5F9WB 2XG5A 3QDHA 1RZ7H 1FFNA 1N6VA 4DKDC 4JFEE 1A4KB 3GM0A 5MEQB 5K33A 4JR9H 2B1AL 3L7EA 5CZVH 2ORBH 1ETZB 2BDNL 3NTCH 4P2YA 3RY6C 4CKVX 3ILQD 1UEMA 4RWYH 4MJ2A 1K4DB 4XVJL 3ZDZE 1BQSA 5L8KB 1U8KB 4QRUA 1O5DT 5TF0A 3Q5TA 3ZE2E 5TFSL 4KXZI 3IKKA 3TZVD 1T22B 2N1KA 4XMLL 1ZVYA 3KPTA 4HS8L 3L5JA 4URTB 3KXFA 2X4OB 2Z93A 5DGRA 3GSRA 3D87B 2FLBT 2O5XL 3QO0A 5I8OH 1LE9B 3VDBA 4MSWB 4YHPB 1S7SB 3V6BR 1U8JA 4APQA 4NO3A 5DVMA 4UTAL 3MC0A 1CLZL 4LPXA 4ONHA 5DD0H 3SKMB 4FQQB 1BJ8A 1INEL 2NXZB 3HC4H 5I1EH 4N0UE 1ND0A 3S4SB 4G9FE 2VDNH 3ZHKA 4P3CL 1FFRA 2DLHA 5E5UB 4JGMA 4YPGA 5D93C 1FNGA 1IE5A 3WMSA 3ULVE 2AEPL 5J6GB 4V2BA 5DRZB 3VGEA 4O51B 2ZCHL 3DVFA 1T20A 3KJ4C 2FDBP 4LSRL 3VGAB 3V0VB 3LSOA 1INQB 4QF1A 3HCVB 1L7TL 4ODUA 4Z77B 3GJEA 1LVEA 4P49A 5DSCB 1XFPA 5GGSB 4EUPH 2VDLL 1C7TA 3S37L 1CN4A 4M03A 4S1QH 2MJWA 3AC0A 2ITCA 5E4EB 4FHBD 1TZHB 1C5DB 5J57B 5IJVB 4XVTL 2VO5A 1JHKL 1EAPB 4U1MB 4U6XB 3FQUA 2I24N 2XZQH 1JWSA 5BS0D 4WV1C 1QLFA 4U1SA 2GJJA 1WICA 4OLWH 3I2CH 4W4OC 5FA4B 1UB5B 1T80A 2AI0H 1EO7A 2F5AL 4Z7UA 5HYFA 4ZS6D 1RUKH 4L3CB 3QIWA 3C08L 4Z7QF 3N0PB 5FGSA 1LO5B 2PKDA 3I3BA 2YD5A 4KRMB 4FFZH 3KPNA 1BGXH 2LVCA 3V6OA 2R4SH 1KLFA 5J12C 4EBQL 5I9QC 2X44D 3OKMA 4L3EB 5I1IH 2RIKA 4Z76A 5F6IB 3OAUL 1Q0XH 3NCYP 5D2NE 1RZFL 4YHZL 5F96L 5I17A 3JWNC 1UM5H 3PGDB 4XNXL 3DX6A 3MZGB 4OZGB 4NFDA 2VXQH 2BMKA 4GBXC 5GISH 5HY9A 4YFEA 4U6YB 1WWAX 4P2QD 3CVHA 1S7XB 2I60L 4TN9A 3B43A 3X11A 1LWRA 5TF1L 4KK5D 4EVNA 4TUJA 3VXUA 1AD0A 4DVBB 3DSFH 3C8HA 3O4OB 4EEEA 1U91B 3TPUA 1OAUH 3HHRB 4AMKH 4ODXA 3F7VB 2F9BT 4AG4H 1H3VA 4OLUL 3IDMA 4NN6B 5C0BD 1GIGH 4QCIA 2GJ6E 1I9RH 3BP7B 3QG6A 4HIHB 4PRPE 2AJUH 3ARWA 3LD8B 4FMKA 3IJYA 3LIZH 4RNRA 3BZEB 4QXUL 5I76B 4H0IA 2KZ1B 5JPMA 5KVFH 2ZG3A 4XPTH 4QEGA 4WU7B 1U36A 1CYGA 5BRZE 4KKNA 4YC2C 3UC0H 4UOW0 3EBAA 4GW1B 4KMQA 3BIAX 2R56L 2LABA 5DMIH 4MMZC 4ELMB 4XGZB 3MJ6A 4QYOB 5IESH 4IJ3B 1SY6L 4Z7OF 3WHE1 3CNKA 4HGWB 4NJAL 2YUXA 2XZAL 2VOTA 2E6JA 3VD5A 4KTEH 2C5DC 1JGEA 1ZLUH 1LD9A 1SEBA 2I07B 3CFEA 5L8JB 2XXCB 3LEYL 1CDYA 2I9LB 3W81A 3B9EA 5IB2A 2QADB 5HGAA 9CGTA 2WBJC 1UXSA 1A8JH 3ES6A 4U2ZA 1LDPH 5JIIA 3O9WD 1IT9H 4HMCA 1ZE3C 2X4TB 4XVSL 1JUFB 1Q0YL 2A6KB 1KPVB 5IFJA 1MCHA 3REVB 1KT2B 7CGTA 1C8PA 4KTDH 3W11D 4UV4L 2P8PB 1JHTB 4YQXH 3CDFA 4EQ2A 2MPAL 2VISB 1J1PL 2DQDL 3H2WA 4MXWH 5JPNB 4Q9RL 3DPBA 5ENWA 2ITDB 1KCVH 4MA7H 4YGVB 4K94H 5JIHA 1OHQA 2WM0A 4JM2F 3ARGC 1J8HD 1U8IA 5IVXF 2HJLB 5DURD 5EU6D 2ZOLA 4WFFE 5L6YH 4JJ5B 4B50A 4GAFB 5C09E 2FCBA 1ETZA 3OQ3B 5HVHC 4P46B 1FG9C 1E27A 4E41D 3GMMB 1I8LA 1G1YA 3GKZA 4HH9A 3TO4C 4I77H 1U8HB 4GQ9H 2AJ3B 4D9LH 1BIIB 3NAAL 3L3OA 5IFAL 2Q8AL 3GSNA 4P5KB 4ONGH 4S11A 4LRNH 3IDNA 3ROLB 1J7VR 5JA9A 3NFPB 1MCOL 1CIUA 1M4KA 1LE9A 5I8KL 3BOVA 5ADOL 3L1OH 1H3XA 2EYRA 2X70B 3IFNL 4P4KC 4PBVC 1NGQH 3RZCA 5GIRB 1VEMA 3SKMA 4Y8AA 2X89A 2EXYC 3S7GA 3QUXA 2I25N 4E5XB 5IVNA 1KTKE 3MV9B 5FYKD 5GJTL 2A6IB 5DRZA 4O51A 4LP5A 4MNHA 5DEFB 2R0KH 3P9MA 4NPYB 1MHEB 1YN6A 4XAKD 5HTSA 3UYRL 1ZA6A 4FG6C 1MY7A 2F8XC 2OTPA 2YPLD 3I02A 5ILTH 5T1DH 1TZHA 1QZ1A 3QFJD 1Z3GL 1QKZL 4TNVF 1EAPA 1IGJB 3SDXE 1JV5B 4HK0B 3PHQA 1D5MB 4MMXC 2DLFH 2VWEE 4Y4HC 3WFHB 5E8PA 1EEYA 4O2EB 3V0AC 3G5YB 5CUSL 5I73C 4NO0D 4MJIE 2GJZA 1MI5B 3MRGA 4L3CA 1IVLA 4RZCA 4NQSA 3NCMA 4EZMA 2O5ZL 5GS3A 4ELKB 2DQIL 4WJ5A 3QXUA 1OP3H 3TWCL 1FZJA 4L3EA 2R0WH 2DQJL 5IBUG 1YEEH 1J10A 4IOIA 3AAZA 4FQHB 4OZGA 2V5TA 2G9HB 3FOMA 2BY0A 4GSDH 4PJBB 4HPYH 4L8SC 1MRDL 3IRPX 2Q7YA 4I0PD 4NZTL 3FB8B 3H7BA 5DO2D 1S7XA 4MD0B 5KVMC 3PWNA 3QXDA 5KSVB 4TUOB 3IFPA 4DVBA 3N1MC 2P48B 4U1GB 2PYEE 2PF6A 1T0NB 3BW9B 4R2GC 3KYKH 5F8RC 3F7VA 3O2WH 4BQ6A 5I1HL 2FB4L 5IHZB 1FYTA 3BP7A 3GSUB 4HIHA 2LQRA 3MRJB 3IDGB 5D7KD 2BRQA 5D72H 3D85B 4OBSA 3KLSA 2BRRH 5C08A 1ZHNB 4GT7A 5D71H 4EDXA 5KVDH 2BFVH 1S9WB 3CFDB 5F6HI 5JR1L 4AY0A 4F8TA 4LVOC 2R2HB 3ARFC 3QIWC 3MBEA 4M9OA 4TRPL 5IM7B 4Z78A 4EN3D 4XGZA 5KSAD 4KJWD 3WFBL 2DRUA 4HGWA 1WV7T 1KJ3L 1MWAL 4MAYC 2BY1A 5SV3A 3EAKA 2D2OA 2BVEA 2M8XA 4Q6YA 5BV7L 4JLRB 1HSAB 1JMZA 1UM6H 1URLA 1WFTA 2I9LA 4OFIA 4CBPA 4X4ME 5GGRB 3VI3E 2Z31C 2ADIA 3ZTNL 3EO0B 1AGDA 1P84J 3KPQB 4P2RE 1NAMH 5FO8B 2A6KA 1KPVA 4G7VL 3VD3A 2HJKB 2VSCA 5SX4H 3PWVB 3IXAB 1R5IA 5J4MA 5E6ID 1JHTA 3MNVB 5D9SA 2AV7B 3SQOH 4F9LC 2R0ZL 3V8CA 4TTGA 5HYSA 5E1HB 1ZHLB 1VPOH 4UOJA 1YMMB 3CDYA 4I9WE 2ITDA 5D7SH 4WIQA 4YGVA 4I4WA 2FGWL 1EHLH 5HPOA 4GKNB 4PRAA 2HJLA 2VQUA 5HHMD 3CDGB 4K7PH 4JJ5A 4M5ZL 4WGWB 1BFTA 3O3AB 2ZUQC 4P2OB 4JDTL 3O4LB 2D0HA 5E99L 1T1YB 3RGVB 5F9OL 4NKOA 2NY5H 2UZYB 2AJ3A 1GCFA 3HNVL 3F6IA 1T21B 4GRMA 5D6DC 3D25B 1MQKL 2E7BA 1NCDL 5DD3H 4W4NA 5DJXB 4QHUB 5CGYC 1KELH 5I1KH 3IGAB 4DWHA 4H88L 1TJIH 4UDTB 2X05A 3HB3D 2YD8A 1YEJL 3BP5B 4K3DL 4XBGA 4ZXBC 5TDOB 4JVWA 2D9QB 2X70A 3KWWB 1ZTXL 5GIRA 4UQ3B 4Y16D 3A0OA 4QRRE 1YYML 2XFXA 1IM3A 1DFBH 2FH8A 3P4LA 5E9DA 4ISVB 5IEHB 3QPQD 4Q74A 4CMHB 5TE7L 3SDAA 2Y06H 4OCYL 3M1BB 1V7NH 3MRLB 2Z91A 5IMKB 3MV9A 1MCWW 2OQJA 3Q2CA 5ECJE 1NFDB 3K80A 4DN3H 5CJQL 5KJRL 4JFPA 5DJYB 5JOFA 5HYJE 4M61A 2C1PB 4WHTB 1GGUA 2V6HA 1CI5A 2JJSA 2R8SH 2Z8RA 4AQ1B 4NGHL 1QEWB 1AO7A 4RIRB 5D7JB 5ALCL 5KW9L 5SWZD 4MA3B 4WCYH 2P43B 4DTGH 4OM0L 4H5SA 1IGJA 2FJHB 1G9MC 4PRDB 1EA9C 4Y5YC 1JHLH 2VLRA 5T3XH 3VFTB 4HXAL 1JRHH 3WFHA 1AJ7H 3GZKA 4GKOA 4HK3J 3EIFA 4WUKH 1H3WM 3QDME 4KJQD 2EH7L 5HSFA 1IGCL 1H15B 3UTQA 1F8TL 4PLJC 4TPRL 4YBHA 1BAFH 2MHAA 5JQ6L 4LCUB 3L3JA 1A9EB 2BXZA 1KV3A 1OAQH 2GT9B 4IRJC 2LAAA 3R8QA 3O2DA 1A5FL 1DBMH 5TQ2L 4FQHA 3ULUC 1IFHL 4GRWE 3HTLX 2L7UA 1F4WH 4N1HB 5EOCH 4JEGB 3OX8B 4J3OC 2LFGA 3H9SA 3QG7H 3NA9L 1BBDL 5FYKU 2X42A 3IFOA 4K8RL 5I19H 1DDHB 4U3XA 3MFFB 3ZHLA 1FORH 1RIUH 2NR6D 1XGQA 1T0NA 1KEGL 2JELL 3SE4C 2OMBA 5K93A 4FFVD 4YXHH 5GRZA 4UT6L 5K59E 1EK3A 5EBMA 2FEDC 2XACC 5D93B 2FL5B 2IH3A 2Y6SC 4K7FB 1NUGA 4CRPA 1JYXA 3GSUA 1IKNA 3MOBL 5CINH 3MRJA 2BZDA 1HYSC 1SEQH 1S5IH 4LDLB 1L0YA 2KUTA 4HQQL 4HWBL 4WO4B 4PJFB 5CFHA 1CGTA 4Y5VC 1CICC 1MJUL 1LO2L 4G3YL 3T1WA 1ZHNA 4DZ8B 2CRZA 4KDTC 1S9WA 3CFDA 1OAZH 2R2HA 5KSBE 5IB3A 5L88L 3KLHD 4M7LL 4JG0L 4G9FD 1GL4B 2VERN 4UILH 4WV1B 3WO4C 3ULVD 5FECB 3P4NB 4ZUWB 1JZ5A 3G6AA 1MH5A 5ISZA 3TT1L 1MHPL 2FR4B 1BD2A 1HSAA 2PETA 1RZJL 2AGJL 4PLKD 3GSVA 4CVUA 2HT3C 2H32B 2QSVA 2NTSP 4KV5E 4HIJB 4N8CL 4RA3A 1V05A 1BM3H 2ARWA 1AQKL 5DJ0A 5I9QB 1BJ1H 5DWUL 3U9UA 2J6EH 4ZD3L 4ZAKD 1AFVH 2EC9U 4BQ8A 5C07B 1A0QH 3MLYH 3PWVA 3IXAA 4G6KH 3HLAB 2A74A 3N85H 4N1EA 3BKCH 2MQCA 4YDKL 1EJOH 3BP4A 4KRNA 4M48H 2PCPB 3T3PF 4PGJA 1RK1B 4GBXB 3IDXL 4XP5H 1XGPB 1YMMA 1S3KL 4I3RH 3FFDA 3D1MC 4LIQH 1R3JB 2LE9A 3RVXC 4BSWB 3VH8G 1FPTL 5EORL 1N6QL 1FZKA 2A9ML 3BZ4B 2ZKHH 3DX9B 3GIZL 3I9GL 3MGOA 5MENB 4P2OA 4YO0B 1ES0B 3STLB 3H6JA 2D0FA 4K23L 1MCFA 4XCNB 4QRPB 3O6LL 1EO8H 3NH7H 1ZXQA 4DOHE 1T6WA 3MNZA 1XT5A 3G6JA 5DC4B 3ZKNC 1ZANL 1AR1C 2HFGL 4YC2B 3V4UH 3B2UC 3IGAA 3HC3L 3SE9H 2EDFA 2H1PH 5T33H 4YHYB 5TDOA 3QQ3B 1IAII 3KWWA 4TSAH 1ZGLP 3ALPA 4Q2ZA 4RAVB 2D31A 3PWUA 1DQQB 3SDCD 2JJVA 3SDDA 4PJGE 3F8UB 3VD7A 3HR6A 1JJUA 1A6AA 3OWEA 1KENH 1CLOH 5BVPH 2GJ6D 1QA9B 4NC0B 4PRPD 2DBJA 5IMKA 3LN9A 2FD6L 2PN5A 1T5WB 2FRGP 4ZUSB 3UX9B 1H8OA 2VDPH 2X4NB 1UWXK 4GXVH 5T1LD 3DV4A 3BRGC 2QQKH 4M1GH 1QBML 1D7FA 3O11A 4W6YB 4AT6B 2J4WL 2B20A 1N4XH 3EOTH 3L6FB 5D2LF 3K4AA 1QEWA 4B5EA 5D7JA 4POZC 4OB5L 3PG2A 4AEHL 5SV4A 4MA3A 1LQSR 1Z6JT 3UTTB 5ID0B 4I3SL 3JWOC 1SY6A 4IOSD 1RUAH 1Q9LA 4PRDA 5A16A 2FECI 5F7EH 1MWAB 4WI7A 1NLDH 1AC0A 3F12B 2HJFB 3MZTA 5AZEH 3EZJB 3Q48A 3ARGB 1UH4A 1BLNB 1P7QB 4M7KL 2YK1L 4XWGH 3WNMA 3HAEG 1H15A 5FM8A 2GSIA 3U9PH 4R7NA 2ZOKA 4FQ1L 4Q9CA 1ZLWH 3HZKA 1A6TB 4HW6A 4LPVA 4KJPD 4BH8B 2XY1A 3KXFE 4KAQL 2BSED 4PJDF 1CDBA 1A6WH 1HH9B 4RMVA 1OW0A 2ZSWB 5EU7C 4Y1AA 3L3DB 3SDAC 3U36B 4GOSA 1PQZB 3UPRA 2EYTB 2CIKB 1ZLVH 3OX8A 5D1ZA 5DFWH 2ZUTA 2R2EB 4WFFD 1CF8L 1G9NL 5C09D 4R90H 2EO9A 2VDRH 4CNIA 2BK8A 2CLZB 1PY4A 3RTQC 2UWEB 2EXWC 1OM3L 5AG8A 4NNXB 2EDXA 1XZ0B 1ONQB 1YY9D 1INDH 2FL5A 2XTJB 4QRSA 1XGRB 1NSNH 3VFMA 1X5IA 3E6HB 4KVCL 3RWCA 4PS4H 4WEBL 4UTBH 4HWNA 3EO1B 3K2UH 1OGAE 3T1FA 4WO4A 4PGDB 4PJFA 1ZWIB 2C4XA 1NBQA 3BPCB 1B90A 4NZJA 2VDKL 3KPRE 5HHOE 5JDJA 2X7LB 4XP9H 5LQBH 5SX5H 1ZGLM 1TQCC 2YZ1A 3OKEA 4JVUA 1GHFH 5EBWB 3VGDA 3C6LC 3IDUA 4JHAH 1RUQH 1FH5L 1H0DA 2HH0H 3N9GL 4PRIA 4ZUWA 5JOPE 1DTUA 2C4FT 2R9HD 5GZOC 2IMMA 1LP9B 5DFVD 1UADC 3QEUA 1RFDL 4V1DE 3HNTL 1TVBA 3IJSB 5EC1A 4Z6AT 1GXEA 2F19L 2PTUA 1A2YA 3JVGA 3QO1B 2VB5A 3BKYL 5F89A 5HI4D 4PY8J 1IAOB 3BVNB 3D9AL 5EIQA 5C07A 4ZOAA 4MQTB 1JN6A 3O2DH 3A67H 5C0IB 4KZEH 1QACA 2PCPA 1VKXA 3SBWC 3VXUE 3NN8B 1UA6L 4XH2B 4MJID 2WMPA 1JF6A 2PXYC 1JGVL 2R1WB 4I0KA 2J8UB 2LU4A 2VYRE 2UZXB 3WUWG 1RUMH 3TFKD 5HDOA 5IKCB 1FNSL 3DX9A 1CXHA 2MWCA 4BFEA 5MENA 1HQ4A 4R2GB 2F53B 1WT5A 2B1AH 1CDJA 4G8GE 5IMLA 4YO0A 2BDNH 2SEBB 3CFJA 3FB7B 5ESAB 3STLA 4ZODA 5SWSB 1G6VK 4XP6L 4XVJH 3B4NA 4QRPA 1H3TA 2D4FA 1MRFH 3H3KA 3QPXH 1MJ8H 5TFSH 4KMTL 1MHCA 4HEPG 1R24B 4P4RA 4O9HL 2BHYA 3Q1SL 4P23B 3QDJB 5J1AB 1T04B 2X4QB 2O5XH 3JV6B 3QQ3A 4ZYKB 5I0DA 1DQQA 3ESVF 3UTZB 2K3TA 2PYED 5INCB 5IW6A 3ZT5A 4HZLA 3D18B 3VFVB 1OARH 1AGCB 4MAYB 4P3CH 3P30L 4G43A 1QA9A 2EKSA 2XN9A 3LB6C 3TN0C 1F3JB 1FN4B 2CDFA 5I1GH 2AEPH 1I7RB 1RZIA 3PP3H 4YIQB 5E7BA 3RGVD 4ZUSA 1VA9A 5T1MA 4U05A 5D7LB 2Z31B 2X4NA 3K81A 1NJ9A 3SCMD 1L7TH 2XKNA 3VXPB 5J8OA 2P5EB 3BDBA 4OSUL 3L6FA 2H2PC 2NY1C 3VWJB 2VDLH 1BQHG 4IBLT 5DJ8B 3RBSA 3ARBD 4W6XB 3VGFA 4JG1L 3DROB 4RMSA 3ARTA 3S97C 5E08L 5JW5A 1RJCA 5IT2L 1CXKA 3I6KB 1JHKH 3PWJA 1B6DA 1H3PH 2FATL 2G5BB 4HBQA 5CCKL 1EUUA 1Q94B 1FGNL 1WCBB 1YPZB 2ENYA 2DM7A 3VXSB 4KQ3L 1KTDB 1P7QA 4ZSOB 2IAMC 4XB7A 2QSCL 4N0FB 1JZ4A 5FOJA 4DEPC 3SKJH 3FB6B 3K1KC 4J4PD 3TH4T 3O6FD 4P2RD 3IDYB 4CUCA 4MCYB 2GY5A 4BH8A 3TA3D 2P8MB 4GRLD 3TH3T 3D3VA 1PG7W 2X4UA 2ID5A 4CMMA 1HH9A 3WE6A 3OAUH 1HOCB 4DZBB 1RZFH 5F96H 4XNXH 4I9WD 4CADA 4GAJH 1T5XA 1F4XL 1NLBL 3FKUS 2EDJA 2CIKA 1VEOA 4UAOB 1C1EL 2R2EA 4PB9L 2I60H 3ULUE 1IQDB 5TF1H 1I1AB 3H7LA 3O2VL 1FBIL 1QFWL 3P9WB 2CLZA 3S5LB 3G5VA 1MFEH 2UWEA 4NNXA 1P6AB 1XGRA 4JGUA 3L3KB 4OKVB 1FG2A 2OI9C 4PJ7B 3LAFA 4AK1A 4M9PA 2Q3AA 4PJ8D 4X5WB 1F00I 2PO6B 4X7TB 4QXUH 4WWKB 4PGDA 3UJTL 1T2QH 4LSQH 1FJ1A 1I9IL 3C60A 2EIBA 5FHBH 3T77B 4ODSL 2VZ3A 5HHQB 2X7LA 4QRRD 1AQDA 1RZKL 1FE8L 4KHXH 1FAKT 3WL9B 3MRDB 4Q58C 5SX4I 3TIDA 4KWUA 1JL8A 1Z9LA 4Y5YB 1GAFL 5JXED 4WUUB 4TULL 3SGKA 4PRHB 1WCQA 3GMNA 5EUOF 5HGGS 4FRWA 4X7EC 5JW3L 4KKCC 5HYJD 4BK4A 1GGBL 1RQ5A 4XXDA 5BZWB 4KI1A 5D1QA 5E2UH 1JTTA 4G7YL 1HCVA 3HPJB 4IDJL 4YBQC 5D1ZC 4XVSH 4OZGE 4CW1B 5BMFL 4UV4H 12E8L 4IRJB 1YEIL 5JIPA 1JGUH 2R39A 2XWJB 5I1DB 1A9BA 2QQLH 2MPAH 1JNNL 4L8BB 1HHIA 5F1NB 3ARZA 2DQDH 1QLEL 3AB0B 5D5ME 3MYJA 5C0FB 3MACL 3QDMD 3U83A 4JN1H 1Q9OB 2DI7A 2HTKC 5IKCA 1FYTE 4Z95H 5DTFB 3WHXA 5D96C 1VDGA 1U95B 2XQYG 3PDDA 4M6NL 5SWSA 4JPKL 4DK3A 3BZFB 5C08E 3NAAH 4MAUL 3GSXB 4BFBD 2Q8AH 5K9JL 1F90L 4JM2A 5IVXA 2YBRA 2W07A 1RU9L 4P23A 1RIHL 3QDJA 4U1LB 5J1AA 5EO0A 2X4QA 4ZYKA 5I8KH 5ADOH 4L8DA 5KVGL 1D5IL 2EEBA 1EMTH 3V4PL 1I7UA 4LCWB 4JM4L 3UTZA 2BNQB 1T7WA 5INCA 2CGRH 2H6PA 3NZ8A 3QT2A 1J12A 3WO4B 1AGCA 5GSRA 1YNKH 2AK1L 4QXWA 4LCCC 4PLNC 5D7IF 3AROA 4X4YB 1F3JA 3W0WE 5IROC 3RUGB 1FVEB 4YIQA 1JRHI 4JPIB 1JF5A 4OZIB 4FZEH 1VGEH 1KCRL 1IKFL 1HXMB 5C6PB 1K5NB 1K9TA 2H32H 4HWBA 3VXTB 3H9YA 4LSTL 3C09C 1FL3B 4DKEL 5GGUB 2QHLA 3NIFF 3VWJA 1UG9A 3DV6A 3OPZL 1IGFH 4MYWB 1GPOL 1OY3B 4H1LB 1S9YB 4NO2A 3WS6C 4Y2DA 5CHNB 1QKZH 5EWIL 2VLLB 5DRXB 1LK3L 4OZHF 1K3ZA 1WCBA 1YPZA 2X9XA 1FCGA 1N8ZA 3SE8L 4NHCH 3QWOB 3BD3A 3B6SB 3EDEA 4FABL 5I1CL 4MHHI 1DL7L 3HRZA 4Z7VB 3EDFA 5GRYA 1JMXA 3BSZL 3FTGA 2WBJD 2VDMH 1WIOA 2QL1A 3MRFB 3AMKA 5HVWA 2YA0A 5JUEL 4JANB 2DQJH 2RJMA 5MP6L 4PG9B 3I6GB 4DZBA 3VRLF 4PJEE 4O2FA 5DGQA 3QUMB 5C0JB 1XH3B 4RISL 1ZLSL 3HI1B 5E9DE 3BN9C 4NZTH 1RJYA 3NZHH 1N64H 3L95B 1YY8B 1ZHBA 1DQDL 5EU3B 5FGBC 1FC1A 1YECL 3VXMA 2IQ9L 4FQJL 4EUPG 1U3JA 2V2XA 4EOWL 4UI2A 3MMEB 3HMWL 4M43L 2H2SC 3VXQB 2R2BB 1JWMA 3CH1B 3Q6FA 3L3KA 1MFDL 2FX8H 2X1PA 4OKVA 5IR1A 3F7RA 1CG9B 3DVIA 4MA8L 2WAHA 3G6DL 3TO4D 3MRHB 4X5WA 1PAMA 2PO6A 5IWLC 2UZIL 4X7TA 4WWKA 1AO7E 4QHKI 5DZLA 3W82A 3EHBD 2ERJC 2XIDA 4ONFL 5DK3A 5BV7C 4MB5A 2VLRE 1TVDA 4X7FC 3TYFB 1SJEB 3NCFB 3L3GA 4TRPH 4UUJA 1DBAL 3MRDA 4P4KD 1YEGL 2C9AA 1EO5A 3K4ZA 3MODL 3QUYB 4UT9H 5CAYB 2VQTA 3RVVC 4JY6A 2OM5A 2EXYD 1MWAH 3OKYA 3WO3B 3MJ7B 4XNZB 1RI8A 5ITFB 2J88L 3HZMA 5T5NG 3DOSA 2MFNA 5ALBL 3WS3B 5MI0C 1Y18A 2FX7L 4GMSH 2V9QA 1WITA 4WWID 2DAVA 5FCSH 5H37H 3ZTNH 1HQRB 3M17A 2FEEI 2NZIA 1SMAA 4GG6F 1HHHA 2DM3A 3BHBA 1HXYB 1XEDA 4G7VH 2VIRB 4FG6D 2V9TA 1JNHA 3PDOB 4L4TA 4HHAB 4K3HA 3Q0HA 1KGCE 2JJTA 2DTMH 2XWJA 5I1DA 3EW3B 3H9SE 4OBRA 1WBXB 1JI2A 5F1NA 2R0ZH 4PP2B 4XPGL 4LPTA 4XXCA 4WTZA 5ESQB 1S5HB 2BVOA 4LLAA 1MJJA 5FYJL 2E7LC 2FGWH 3HFML 4Y4HD 1AIFB 4P59L 5LG1A 4EI5A 4AENA 2A6DB 1KIRB 2W65A 2VXSH 2NY2D 4OQTL 2IGFH 4M5ZH 3RTQB 2AJVL 4FN0A 4XCFL 3WKML 1U95A 1Q8MA 4L9DA 3SE3C 1KB5L 5F9OH 2IANB 2X4SA 1QRNB 4PJ5A 2DI9A 4UT7H 3GSXA 4KRPB 5CD5D 3T04D 4YE4L 3ZYJA 2FHCA 3LKRB 2CRIA 1RK0B 1X5JA 1NCDH 4O58H 3MXWL 4Y19E 5F7HA 3FQRB 3CFCH 2EIZB 4JO3L 2VABB 4K3DH 1Z5LB 2GAZB 1Q38A 1PBYA 1AE6L 1NDMA 5F1KC 1ZTXH 3GMPB 4XPFH 2DMKA 1YYMH 5ISZE 5CBEB 3TBWA 4TUKL 1BD2E 3G08B 3IXTB 5CEZE 3HR5A 5AZ2H 3C6LB 1W0VA 5T1KB 5TE7H 4HWEL 2DDQL 4AH2A 4OCYH 4ZPTA 4R7DA 2Y5TB 3AS3A 3RUGA 4NP4L 1NEZG 5IQ9A 1FFPB 1OGAD 2LU3A 4JPIA 4YH6A 2AEQH 4OZIA 2P49B 1DEDA 5CJQH 2BNRB 1K5NA 3QFDB 1EVTC 2N56A 3QUZA 1WIUA 1OLLA 4KQ4L 4DUWA 4G6JL 4HUKB 1FL3A 3KPRD 5GGUA 5HHOD 3WFDL 3L7FB 2VITB 5JZ7C 4RX4A 2AW2A 1AGEB 1RVFH 2PNDA 1NCCL 4G6MH 1S9YA 4HX1B 5KW9H 5AUMB 3TC9A 3ARFD 3QIWD 4OM0H 5CHNA 1IAKA 2VLLA 1J0JA 5JOPD 4OCSL 4ODHL 3D0LA 4ZUVB 4FQXB 5FDWA 2EDYA 4V1DD 2PXYB 5FO7B 5DI8B 1CK0H 2JCCE 3TBTB 3VGGA 4M4PA 3RAJH 3MRKA 3S9DB 1V5JA 5EIIB 3B6SA 5C0GB 5H8DA 2OLDA 2AAVA 3GJFK 3ET9F 3VFOB 5EZIL 2YD7A 4P5TC 5JXAL 1BMGA 2YPVH 5J6HB 4MNGB 3DUUA 4JZOB 2PYFA 1F8TH 1S7TB 2FX9L 3G6JE 1FV1B 3GSWA 2IJ0C 1FLRL 4GG8B 5E2WH 5H35A 4UQ2B 5JQ6H 3KPOB 1EX0A 2VZOA 4JANA 2VN4A 4G8IA 4PG9A 1C5BH 4CN6A 4XNUL 1ACZA 3I6GA 1A5FH 3VXUD 4PJCB 3JXAA 1IFHH 2JJWA 4HC1L 3HI1A 4NUGL 5CKAA 3CMGA 4IMLA 4GKSA 5IK3B 5EU3A 4OM1L 4K8RH 4C56A 5DHXB 2L7JA 4LSUL 5DS8B 3MMEA 4G8GD 3VXQA 3BO8B 3CH1A 2JELH 3MPCA 4ZTOL 4UT6H 4OGAC 4J8RB 1S7WB 3IETB 1W0YT 4EKXA 3TN0B 4TNWK 2B7DT 5DQJA 1R3LB 2VLJA 3FT2A 3MOBH 3MRHA 3H0TB 3ZDXE 5B39B 2Z35B 5IOPA 3C5SA 2ATKA 2JKXA 4S1SL 5ANMA 5EBLB 4HQQH 5E2TL 2R23A 2GIYA 4PJ9A 5DVKA 5GS0L 3GRWL 4G3YH 4YX2H 3V6ZB 3OSKA 2DL2A 5CGYD 2APWA 4YDJA 1GC1L 5DJDB 2QV2A 4CU7A 3FN0L 3TV3L 1SYSA 3SKNB 4ZXBD 3IDJA 4JG0H 2E27H 1GGIH 5DHVB 1JZ6A 2AJXH 4NNYB 3J7HA 1MCLA 3QUYA 1TIUA 2BC4B 5DMKB 5HGHB 4PJXE 3LMJL 3MJ7A 2EDQA 5L2KB 1N0XL 2IAMB 1CU4H 5JORB 3AGVA 4QRTB 4Z8FL 4AEIL 3GK8H 5IVZB 1JYWA 4KDWA 4N8CH 1CFQA 4YFLI 4MVBC 4Y89A 1HXYA 2VXUH 4OCRL 4Y1AE 3E3QC 3T0WA 5FM4A 5GGTL 4KKBC 3JTTA 1X4YA 4KUCD 3PDOA 3V6FB 4FMFA 1TTUA 3QCTL 5BJTA 3MOAL 1FNAA 4ODTH 3K4DA 5KTEH 2EICA 4YDKH 1YJDC 5CP3H 5GRXG 3THMH 1WBXA 1PZ5B 4QTHA 4PP2A 1U8MB 3MO1B 3GSQB 2QEJA 1IM9D 1S3KH 3B8YA 4R0LA 5CWSB 4U6HA 4LSDA 4YNYB 4YHIA 4M7LT 3DX7B 2JIXB 2IPTH 1FPTH 2A6DA 4PRHD 5IB4B 4LASL 1BHGA 3F58L 5DRWA 3GDBA 4J3XA 2P7TB 5LCVL 1XGYL 4XPBL 1K6QL 3BD5A 4LQ1A 2ZUUA 2IANA 2OI9B 2GSGB 4PLJD 4EI6B 1QRNA 2ICES 4JRYE 1XCQB 3HG1A 1D9KA 3DO3A 2X1OA 3K1DA 4QKXB 4D8PA 1I7ZA 3RZCD 4C83B 4Y2OA 4KROD 3BP6B 1HHJB 1DP0A 1T1WB 2EIZA 1OWWA 2YRPA 3ARVA 1C08B 1VFAA 5L7XL 2X89D 2ZSVB 3QJHA 3CFKA 1G1CA 3QUXD 3ULUD 4CVWA 1Z5LA 3MFGB 2GAZA 5F7DA 4H8WL 5T5FL 4Y4FB 1PVHA 4PRIE 1KCSH 1U8LB 4L9LB 4ONOA 1BECA 4FQ2H 3AREC 5HPMA 1E28A 2YUVA 4HAGA 3QRGL 3ARSA 4F8QA 1NFIB 4GKZB 2DJUA 4ORZC 2Y6SD 2A1WH 4JFYB 3TIEA 3IT8D 3G9VA 3BPNC 5HGDB 2RHEA 4WW1A 2XWTB 1HYSD 1QBMH 1T0MB 2J4WH 1BEYH 3CSGA 3RU8L 3FB5B 5FGCB 2VITA 1CICD 2OZ4A 4I18A 3S34L 5T3ZH 1FNEA 4EQ3A 3ESUF 2CD0A 2HP4A 1JPSH 2DMBA 4NM8L 1ZVHA 4AEHH 1X4XA 3PL6B 4L1HA 4NDMB 1NGXA 5FUCE 3U30C 4LSPL 4Z7WB 2DWEB 3H8NA 3TVMB 3DI2B 4FQXA 1U8NB 3MV8A 3CJJA 1T83A 4MD5A 3TBTA 5J0BA 4M7KH 1A7QL 5C0GA 2X2YA 4PB0L 3VFOA 4F57L 4HPOH 5D96B 4FQCH 1R5VB 2X1QA 4LHUB 3U4EB 5J6HA 3KNBB 4JZOA 1CE1L 4FP8L 1S7TA 1E4XL 1FV1A 4FQ1H 3WLWC 1GGCL 4OD2B 3VXOA 2JK5A 5DA0B 2RAMA 1KCUH 2AABH 4OCXL 3KPOA 5DC0A 5GRVK 1NGYA 4KAQH 4J3VA 4A6YL 5I8CB 1KC5H 3E8UL 3TZVC 4Y88A 4ZDHB 4JO2H 2EDBA 4J2XA 4NWTH 3D48R 3HUJF 1DLFL 4HKZB 3DMMB 4XNYL 3S88L 3T4AA 1FL5B 5C2BL 2AXFB 5IK3A 2KQMA 3SO3B 3EFFA 4U3HA 1FYTD 1CF8H 1DANT 5DJ2B 2XN9E 5JW4R 5TDPB 2QQQA 3QUZC 4TSBL 4PJDA 2ZG2A 3IJHA 2P42B 4LCCB 4J8RA 4QNPF 1ORQB 5D6CB 1RPQA 3PQYB 3MGTB 3OAZK 4MNQB 1R3LA 4KVCH 4K3EH 2QKIA 2Z35A 1T1ZB 4QTIL 4QXGL 3MBED 1NCAH 5EBLA 5C0AE 3TO2A 1JNJA 4PRBB 2FYYB 3K0WA 1T7VA 1TXKA 2C7UB 1PG7L 1AR1D 3GUTB 2ICWJ 2ARJQ 3C5ZA 4YXKH 4LVNB 5DJDA 4UINL 2R0LH 3BKJL 4H1LH 3SKNA 3OBAA 2GYSA 1OSZB 2AJSH 1KEML 4U0QB 1IGTB 4NNYA 3IU4L 4P5MA 2BC4A 5HGHA 3UZVB 1OVZA 1MPAH 4U4BA 4DQOL 2BJML 3D6GA 2DD8H 3W0WD 3T0XA 3N9GH 3O3EB 2VUOA 4XC1L 3U4AA 4NKDB 5JORA 1HH6A 3NGBB 1NC4A 1BZ9A 3MRRA 3KYMB 5IVZA 4HKBB 4MHHG 1CD8A 3D3VE 1OAKH 2VZVA 4JFHE 4L4VB 1W0WA 1EGJH 4YR6A 3NFNB 5IUSA 3ZE0F 1GRWA 4Z7QE 1MREL 1JF1A 5B38B 1L7IL 3VCLB 1M7IB 4HFWB 4MJ4A 2C1OA 1OB1B 2FSEB 4NNPH 3TCLB 1U8MA 3FO2A 4NYLA 3CLFL 3GSQA 3QUMH 4U6VL 1A1MA 4QXTB 3O8XB 1X6LA 4WY7L 3DX7A 3RDTA 1EHAA 2JIXA 1KYOK 2APVA 1QRKA 3L3HB 3O45B 4JHWL 1BWMA 4FFYL 4KK5C 1RZ7L 1FNSH 1S7RB 1WLHA 2Y7QA 2DICA 3K2MC 5SWQA 4KRLB 5ERWB 4RMQA 3E1F1 4JR9L 3IVKA 4YJZL 3BAEH 2ORBL 5DK2B 3NTCL 1TETH 5LAXA 3JV4B 4RWYL 3BEVA 3MV7E 2M1KA 1OTSC 4JZJC 3UPAA 1GJIA 4OKDA 4C83A 4E0RB 3BP6A 5A43C 1HHJA 2WK2A 4RGMC 2ERJB 3T65B 5E9DD 3D39B 4ODVL 3QEQE 1YN7B 4JCMA 3VG9B 1Q72H 2IQAB 2D7PA 2X4PA 3SDAD 2GITB 3QBTB 4Y4FA 1LNUA 4ZQKA 1DEEA 4OCLC 4K9EC 4X5XB 1F13A 1FGVH 3OXRA 4ENEC 5I1EL 1CE6B 1P1ZA 3DIFB 1ZT7B 3P30H 2VDNL 4GKZA 4U1KA 4YGAB 2P5WB 3O3BB 4RQQA 4JFDA 4JFYA 1KJMB 3MJ9H 5M7QA 3P11L 1AO7D 2HFTA 4C58B 3SJVB 4Z7OE 4LGPB 4GAYB 3MREB 4YBLB 5HGDA 4A2LA 4NQCB 4X80L 1T0MA 5TE4H 2W9EL 1AD9B 4R0LC 3FB5A 2V9RA 4N8VB 4L29A 2VLRD 5DLMH 1UXWB 3VH8A 4Z7UF 4OF5A 3W11C 4BSVB 1B2WL 2V17H 2I9TB 3PL6A 5E08H 5CMAA 4NDMA 3CUPB 5IT2H 5C0DB 4LLUA 4M6OL 3TVMA 4AIOA 4KU1A 2IPKB 1U8NA 5IB5B 2EDWA 4M1DH 2XZQL 4NN5C 5TE6H 2XZCH 3NIDF 4OLWL 5E03A 5SWSE 3I3DA 2QSCH 2VUYA 4FNLH