5DJ5A

Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
GAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Destabilization of strigolactone receptor DWARF14 by binding of ligand and E3-ligase signaling effector DWARF3.
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Probable strigolactone esterase D14
total genus 90
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dj5A00
1QIHA 4ETWA 5K3FA 3W05A 1A7UA 2DR0A 4FOLA 1ACJA 1VLQA 4U2EA 5JALA 4F0JA 3O95A 3R40A 2PU7A 1U4NA 4X71A 2WFLB 2J4FA 2J3QA 3FYTA 4PNZA 2XDWA 1W1IA 3C6XA 4BBZA 3C8HA 2XUIA 3W2TA 2HIHA 2WJ4A 1U8EA 2QTBA 1R50A 4AN1A 3V1LA 1J2EA 1J07A 4DTCA 1LPNA 3F9CA 2DHCA 3I2IA 2WIDA 2QT9A 1XRNA 3R3UA 5JZBA 2C0PA 1E8NA 3G0CA 5FP0A 1QIMA 5HFAA 1X70A 2HRQA 3STYA 4WY5A 5K3DA 3NGMA 3QPDA 4NVRA 1ODCA 2VSQA 1SOMA 1XZBA 3DOHA 1WPXA 1QGED 5KREA 2AJDA 2ACKA 4IO0A 4B80A 1LZLA 1XKLA 4MYDA 4NS4A 4EZIA 4XWGA 5ALFA 2BUAA 3DLTA 5AKHA 5AIBA 1BN7A 5CT4A 2BUBA 2Y6UA 4HTAA 4EY7A 3KDAA 1IVYA 1XZMA 1SCKA 1L7AA 2G4LA 1EB9A 5IH7A 2WFLA 3LP5A 1DU4A 1GT6A 4X95A 3T4UA 2HA7A 1THGA 3WYDA 2X5XA 4P08A 1AC5A 1CUWA 4EY6A 2W6CX 5CT9A 3HEAA 3QMWA 3CN7A 5AKLA 4HZGA 3WZMA 3K2IA 1JMKC 3F97A 3KD2A 2PSFA 2ZJFA 5AI8A 1YB7A 5ALPA 2J3DA 1CV2A 2OXEA 1UKCA 3O4IA 4BC1A 5HF9A 1ZD3A 4AO6A 5ALUA 1H2XA 5ALKA 3D7RA 3TJMA 4DSZA 1CUCA 3OOSA 1TKRA 1L7QA 4N8SA 1LPAB 2WG0A 3P2MA 4FNMA 4HAIA 2QKYA 1BU8A 1TAHA 1LPOA 5JZSA 1ETHA 4EB0A 3UUEA 5ALRA 4G1FA 3MGAA 2IITA 3RKSA 4E46A 1GGVA 1QIFA 4MWTA 1ACLA 4AB1A 4B7ZA 5E2IA 4WJLA 1BE0A 4BP8A 1EXWA 5FV4A 1U65A 2FX5A 1UK8A 4GEGA 1XZJA 5AKZA 1MAAA 3ZLVA 4U2DA 2E3JA 2HU8A 2VEOA 3SX4A 2BCEA 1LZKA 2WTMA 1DWPA 3Q8WA 5A7HA 4OB8A 5LIPA 2Z3WA 1XZGA 2HA3A 1F6WA 5JANA 2FUKA 4KE9A 4U2CA 3WA7A 5AI6A 1XQYA 5DYYA 4A23A 2XUQA 3W06A 1D07A 1NU8A 2RONA 3H2GA 3ICWA 1XROA 4BAZA 2V97A 1E3QA 4XJVA 2DHEA 2RIPA 3IA2A 3WYNA 3WKDA 5IVKA 3G9XA 3H2IA 2IIVA 3ANTA 3BF7A 4JH0A 1QIJA 1CRLA 4GWLA 1CUVA 2Z8ZA 1MAHA 1Q0ZA 5FPPA 5AKEA 2PPLA 3C5WP 3C43A 1SCIA 1EB8A 1B41A 1R9NA 3DOIA 2PSHA 4QDXA 1GQRA 3ESAA 5ALHA 4C87A 4FWBA 1ZOIA 5T4BA 3PI6A 4FLMA 2XB6A 5CT6A 3KWFA 1UKAA 4DGQA 4BVKA 1JKMA 3HC7A 2WHPB 2OGSA 4ZREA 2QUAA 3C8DA 4XX1A 5C8VA 4Q82A 3D3NA 3VJKA 5DYTA 4HS9A 1QIEA 3DDUA 1XRQA 2O2HA 2HFJA 2CUTA 2WTNA 3JWEA 1EI9A 5ALLA 3I6ZA 1Y7IA 2K2QB 4X6XA 3C70A 2RGUA 2PUJA 1CUXA 4XIIA 3G02A 1EH5A 2ES4A 2XQFA 4EY5A 3G9UA 1AUOA 2PSDA 2IX9A 1UK6A 5CXUA 2RI6A 1VZ3A 3FWHA 1ORVA 3HI4A 1HPLA 1XKTA 4Y2JA 2VT6A 1A8QA 2Y2UA 1CUUA 4K2AA 3WK8A 3W9BA 2OGTA 3WIBA 2LIPA 3KXPA 4B81A 3L1IA 1DQYA 2WG2A 5AICA 2DSNA 1XQXA 3SWWA 3I2FA 4PSUA 3B5EA 3KOOA 5BWBA 4HRYA 3QMVA 2Z3ZA 4X00A 4H7EA 2DQYA 1UZAA 4BRSA 4BZWA 5T4HA 3L1JA 1XFDA 1CUSA 3ESBA 1CR6A 3S2ZA 2UZ0A 3IB3A 3FCXA 3U1TA 2OCKA 1CUBA 4G9GA 5FXMA 2BKLA 1EDEA 1ORWA 3HRHA 4KYVA 3DQZA 5AI0A 3WZLA 2QUBA 4J0IA 4YASA 1N5RA 4QWWA 4WDRA 2RHTA 1ZD4A 4ZWNA 2XQKA 5LKRA 2H9YA 2WSLA 4UHBA 3EBLA 5HZGA 4F60A 4FFWA 2AJCA 2D5LA 4Y2TA 4FBMA 2AXEA 1JJBA 3AZOA 5JAUA 1CVLA 1VJ5A 1JI3A 4ROTA 4AZ3A 2XMQA 2JEYA 1ZI8A 4DMCA 5CBKA 1RWQA 1E5TA 4J3JA 3NWOA 1YS1X 4X3CA 2HA2A 5EFZA 1K5PA 4G8BA 2VT7A 4UPDA 3QYJA 1FFAA 4J0DA 3FLBA 4O08A 1DWQA 1XQWA 7YASA 3I2GA 1IUNA 1JJIA 4NZZA 2XUPA 4AQDA 4AXBA 2HU5A 1BEZA 4LXHA 2VTVA 1JJFA 3PUHA 2WM2A 4X94A 3SK0A 2CJPA 3WMRA 3WK5A 3WWOA 1YSCA 2VJCA 1W4LA 5A7FA 1ZJ4A 1GPKA 4BZZA 1QOZA 4W1QA 5DJ5A 3V1NA 1CUGA 4DNFA 3B3QA 1ZIYA 1E66A 1UKBA 5HF8A 3CCBA 5LKAA 4Y9SA 1HLGA 3QH4A 3AIMA 4C4ZA 3H2KA 1AURA 4PSCA 3H0CA 1E89A 4GW3A 2HRRA 1QZ3A 3EQ9A 5BWCA 5HK8A 3OPMA 4YPVA 2AJLI 2VJAA 3PUIA 1MTZA 2JGKA 5AM4A 1UXOA 1WCYA 4MQLA 2CEKA 2WILA 5ALOA 2G5PA 2PM8A 3K6KA 3EQ7A 3ANSA 3HSSA 5AM0A 4BC0A 5CW2A 2QM0A 3EIOA 1P0IA 3HZOA 1LLFA 2CZQA 1HKHA 5ALVA 2C0QA 3WJ2A 2GBIA 5EHQA 4Y2YA 2QR5A 5LZ4A 4LIPD 4UHCA 3OC0A 4WDQA 2Z5GA 4DMFA 2HA0A 1DX4A 5AM3A 1ZI6A 1H22A 1CUYA 1Y7HA 2QJRA 4G9EA 2OGZA 2GYWA 2PU5A 5BOVA 3RM3A 4A16A 3O4GA 1I6WA 4JYMA 1EDDA 1P0QA 3GA7A 4C01A 1MX1A 1YAJA 4C4XA 3PFBA 5AI4A 1YA8A 4GBGA 4X97A 4BAGA 2XMGA 3M3DA 1PJAA 3DYIA 4EY8A 2WQZA 2H1IA 4QLOA 3KWJA 4UBJA 2GYVA 4LXIA 1EHYA 4DLNA 3FLAA 4H77A 3WJ1A 2Y1KA 2JGMA 4UHDA 4X6YA 4YK7A 5CT5A 5LZ7A 3C45A 2DFPA 2ROQA 2V98A 4QLAA 1EINA 1O6FA 2C5FA 3G0GA 1LNSA 1NU6A 3AFIA 5DTIA 1XQVA 1IZ8A 4S0XA 5AI9A 5CXXA 4RGYA 3H17A 3BL8A 5EI5A 2I3ZA 4LXGA 4K6HA 1GKKA 1WB4A 1YB6A 3DYVA 1CLEA 4CG2A 1Q0RA 1UK7A 4UBIA 1GPNA 1PFQA 3AILA 4ZXFA 1R1DA 4IQ4A 4OYYA 5DWDA 3WL5A 4K5QA 1Q83A 2WFMA 4FKBA 4Y2SA 4Q3OA 4Y2QA 4B85A 5K5EA 5JAOA 2B61A 2JEZA 3ZWQA 3FBWA 4MWSA 3T52A 4CCWA 3ZLTA 3D2AA 5HKAA 3W04A 4EA6A 2PL5A 2XUKA 2B20A 4ZGBA 2O2IA 1ZI9A 1O6GA 5AOCA 2HADA 1QIDA 1G66A 4LYEA 4Q1VA 3WWCA 3D4LA 2DHDA 4B0OA 2ORYA 3AIOA 4KE7A 5AH0A 1QJ4A 3FYUC 3STXA 3FCYA 1JU4A 4H18A 1GXSA 4IH9A 1OCEA 3IULA 1YCDA 4E14A 3VISA 1AKNA 2WJ3A 3I1IA 3JYHA 1FSSA 5AHXA 3G9TA 2BAGA 3M81A 4FTWA 3PE6A 1TCBA 2I3DA 3AZPA 2PVSA 2JGLA 1LBTA 2WG1A 4PF1A 1LPPA 4DIUA 1FFEA 1QO9A 5HF5A 5AKXA 4HXFB 3BIXA 5JD6A 3DL4A 3H1BA 5C8ZA 4N5HX 2VF2A 5ALDA 3C6ZA 4C88A 3DS8A 3YASA 3D0KA 4HVTA 1TK3A 4G4IA 1A8UA 5CH8A 4J0KA 3SC2A 5EIEA 4H7DA 1IUOA 3X3HA 2GBFA 1MJ5A 2XUFA 5CH5A 5FKJA 4BE9A 1XZAA 2HDWA 4FMPA 3BXPA 4KRYA 5DNUA 2X76A 4F5ZA 4X85A 3PF9A 4D9JA 1SC9A 4TGLA 5I9IA 3W9UA 5ALXA 2XUDA 5AK3A 1TQHA 4QA9A 1L7RA 5HQ3A 4UHHA 1AGYA 2WJ6A 2XQGA 3A2NA 1MNQA 5D6OA 4DNOA 3VVMA 2RHWA 3PF8A 2J4CA 1UK9A 2OQIA 2AJBA 4QDOA 4Q3KA 2ZYIA 2G5TA 5JADA 3ZV7A 5I8PA 2VQ6A 3HACA 2R8BA 1CPYA 1TIBA 4AZ0A 3C6YA 5EHNA 1G4HA 1G42A 2WUGA 4I3FA 5C8XA 4NMWA 1CUAA 3BIWA 4LHEA 4QZVA 1XRLA 2HU7A 5JD4A 2XQJA 4DSAA 2BGRA 2X8BA 1VE6A 4WFKA 2HA6A 1CIJA 3G0BA 5EHXA 1C7JA 4OB7A 1BRTA 1BROA 3OURA 2NW6A 4CG1A 4F21A 2PBLA 3UUFA 1VA4A 1QLWA 2Z8XA 3IDAA 2C58A 4X91A 1W52X 4E11A 3DCNA 5H3HA 3EF3A 5LZ2A 3H1AA 3D59A 3R3ZA 1TCCA 4BB0A 1CUFA 1F0PA 4QDZA 3FSGD 4KACA 1ZICA 1LBSA 5LLSA 2XI4A 2WUDA 4ZV7A 3C5VA 1ZJ5A 3TGLA 5JYCA 2XMZA 4OB6A 1YA4A 4X90A 4UHFA 3VVLA 3VDXA 1G5FA 4GDMA 1GZ7A 4H7KA 4KE6A 4WFIA 1EDBA 1YS2X 4E15A 4CG3A 2H7CA 3FLEA 4CCYB 1YAHA 5AKKA 4P93A 4DNQA 1A8SA 2O7VA 2V9ZA 4W63A 4H35A 4M0FA 3IVMA 1AZWA 1LPBB 4CFSA 1BCRA 1R88A 1W76A 4AO7A 3WL6A 4Z49A 4ARBA 2WHPA 5T4EA 1VXOA 4IH4A 1J1IA 3DKRA 4HXEB 4KEAA 1IZ7A 2VAVA 2R11A 5D3ZA 5J3JA 3RARA 5ALYA 5D7BA 2WIJA 2HA5A 4PV7A 3AUKA 3BE8A 5I7UA 1ODSA 2OAEA 3R0VA 1BCSA 4GECA 5DNVA 1ZGCA 4HXGA 2XUJA 5E4TA 5LYYA 5ALGA 3LIIA 1OILA 4KRXA 3AINA 4DM7A 5AP9A 2BGNA 3V9AA 5HQ3B 2H7XA 1QTRA 3PFCA 5IVIA 2W22A 4OCZA 1FJ2A 4FBLA 1VXRA 4Y2UA 3D2BA 3LCRA 4K6GA 2Q0XA 1XZDA 1T4MA 4RE5A 4KAFA 4J7AA 2DCMA 3QITA 2I78A 4QDTA 3IUQA 4FNGA 3IIIA 1P0PA 2WUEA 2XUHA 5K3FB 4Q05A 4KR0A 4X93A 5IVDA 4IH1A 4EBBA 5KBYA 5CH3A 4MEBA 4FLEA 3RK4A 3R3VA 2GZSA 5LZ5A 1QIIA 2QRUA 2PSJA 3TRDA 3E1GA 1K4YA 1VKHA 2OQVA 4I19A 1XZHA 3G8YA 2XE4A 4UFNA 3MVEA 1W6RA 1KEZA 3C6BA 4Y2XA 2JBWA 3STWA 4B83A 3I1YA 4J0CA 4ZI5A 1UT6A 3D5EA 4PQEA 2RAUA 2XMDA 1MNAA 4G4GA 4EY4A 4OD0A 5SYNA 2WLSA 1LGYA 2B9VA 4TVKA 4FDMA 1UFOA 4G5XA 4OUKX 1N8SA 1UOQA 2BJHA 4XVCA 4BTVA 2GBGA 2GZRA 3ILSA 3I6MA 1QONA 2WKWA 5LZ8A 5JATA 1Z68A 3R3WA 1QE3A 3M82A 4PO3X 1WPRA 1MX9A 1Y37A 1EX9A 3M83A 2ZYSA 3G0DA 4EHBA 3QPAA 5K3BA 5KWJA 2ZJ7A 3K9BA 3NOXA 4MXDA 1SFRA 5IVHA 4UBLA 3VKFA 2QZPA 1U2EA 1CUZA 5DNWA 1GQSA 3GFFA 2QMQA 2C7BA 2OCIA 3STUA 5AJHA 4FLFA 5K3EA 4WY8A 1M33A 3CXUA 5K3AA 1VZ2A 2XT0A 3QZUA 4W1SA 4FFVA 4L72A 4JUIA 4B9AA 2BUCA 4H7IA 5FPQA 3WLAA 3BF8A 4Y2PA 2XUOA 3HYSA 3E4DA 3G7NA 5HF6A 3H2HA 3N0TA 1DQZA 4H7JA 2P8SA 3IBTA 2BFNA 1MU0A 4L0CA 1WM1A 4GHWA 3QMMA 3L1HA 5AM2A 1Q84A 2FJ0A 5ALTA 1BEEA 2JGEA 4LKOA 1X2BA 3DJYA 5K3CA 2QXUA 2XUGA 1B6GA 2C5GA 2AJ8A 4TPKA 1BS9A 4BP9A 3OG9A 4QWMA 1C4XA 1VOTA 3IUJA 4OSEA 3MUOA 3WK7A 4J0HA 1XRPA 1ZIXA 3A2LA 2HA4A 4BDSA 3WI7A 5CURA 5JAPA 1FFDA 3ED1A 5A6VA 1DT3A 1XZCA 1QIKA 5ALJA 4BTLA 2CBGA 1ZD2P 1XLUA 4Y2VA 1MN6A 4BCDA 4BVJA 4Q34A 3O4JA 1XZKA 1QTIA 5ALEA 3HLKA 2QOEA 4CIBA 5AI5A 4AN0A 1AMNA 4QEKA 5JD5A 1XZIA 2G63A 2GYUA 2WU3A 3FSGA 4ZV9A 4L3WA 1XZFA 4H7HA 4CI9A 1UOPA 4BAUA 3OM8A 5AOBA 2ZYRA 2OAGA 1WHSA 1HL7A 1TCAA 4Q3LA 4GI1A 3FAKA 4J0GA 5IKXA 1JFRA 3G0IA 3GUUA 1CQZA 2HFKA 4ZRDA 1JU3A 1HDEA 1CFJA 3VJMA 5ALMA 1C7IA 4UBKA 3WK9A 1KU0A 2OPHA 3ESCA 4RE6A 5T4FA 5FUMA 4BATA 4N8DA 1NX9A 1BN6A 4B0PA 2VA9A 3I2HA 1H2WA 2QVBA 2H7YA 3LLCA 4UBNA 5CTAA 4PW0A 1IUPA 1UWCA 1UOOA 5AK5A 5EGNA 4G4JA 3RLIA 6YASA 4OU4A 4BRZA 4HRXA 1F8UA 5C7YA 2XLBA 4BDTA 4QDUA 1K63A 3WL7A 5AM5A 3WIOA 4DNPA 2OG1A 3FVRA 1EVEA 1K8QA 2QJWA 5AM1A 2JGFA 3AIKA 4BYMA 2ONCA 4L9AA 3WKAA 3F67A 5C81A 3IUNA 1FFCA 4MJ3A 1YR2A 3R3YA 4JEIA 4G8DA 3H18A 1X2EA 4MYSA 2HHAA 2O2GA 2PUHA 3WKBA 1THTA 3LIPA 1W75A 1E8DA 3E0XA 2YXPX 3C87A 3I2JA 3U0VA 5HK9A 1GKLA 3N2ZB 4BCBA 3B12A 3V1KA 5FDFA 2XMRA 3O4HA 2CB9A 3A6ZA 4W9RA 1IMJA 4JYPA 1T2NA 1FFBA 4U2BA 5BV7A 4MEAA 4M0EA 4DYHA 4FHZA 3D2CA 3O0DA 1XLVA 3CN9A 1MO2A 2ZJ6A 4KJXA 1CUJA 3ICVA 4AX4A 1YASA 1MT3A 3BJMA 5YASA 5E4YA 4KE8A 5JZ9A 1R9MA 2CKMA 1J06A 2OLEA 5EHZA 3IUMA 3BWXA 5ALWA 1VE7A 4CCYA 5HCUA 1ODTC 1AX9A 4G8CA 1SCQA 1WOMA 5A62A 2ZYHA 1CEXA 4U2FA 1CQWA 5HFNA 4B84A 4B6GA 3BDVA 1DT5A 3H2JA 4M0MA 3ZLUA 3F98A 5HKBA 4U2GA 4BVLA 5FOQA 4Y2RA 2FJPA 1QFSA 5CT8A 4B82A 3V1MA 4QE3A 2JF0A 3WK6A 3FYUB 3I6YA 3R41A 5AOAA 4INZA 1EA5A 5JASA 1WHTA 3WWEA 2QS9A 5A2GA 3S8YA 2XMBA 5ALZA 2WHQA 4W1RA 3PDCA 3GZJA 4KAAA 3F96A 4OPMA 1F0NA 3HABA 4J0JA 4UBOA 1RP1A 2O7RA 2YYSA 5DLPA 2WHRA 4Y7DA 3OTQA 5EIAA 2JGJA 2GBCA 2PKYX 1JMYA 2WFZA 2PX6A 2WIFA 2YH2A 4H7FA 3ZI7A 1GPLA 3QVMA 2ACEA 2EEPA 4V2IA 5D3KA 1H2YA 5AKYA 4N8EA 3BJRA 4BE4A 5DTJA 5ALQA 3I2KA 2WIGA 3WL8A 1TRHA 4AMYA 3VXKA 1E8MA 3I28A 4ITVA 3UMJA 1QIGA 4P92A 1DTEA 1DINA 3EQ8A 3LS2A 1XZEA 5AKIA 1H2ZA 3H04A 2OCLA 5AKGA 2Y2VA 1N1MA 1CUIA 3QM1A 4X7BA 5ALIA 4UFOA 1LPSA 1LPMA 2EDAA 4RPCA 3FYUA 3KSRA 1XZLA 5F4ZA 4QNNA 2I03A 5JIBA 3WWPA 3BDIA 1EK2A 1EK1A 5ISMA 4H0CA 1PV1A 2B4KA 1R3DA 1CUDA 3DL7A 2DQZA 3DD5A 3F8SA 4YX9A 4MQMA 3WK4A 1WB6A 2CMFA 5A7GA 3WWDA 4J03A 3A2MA 2EDCA 2ECFA 1A88A 2ZSHA 1N5MA 4PSDA 3GELA 1MX5A 2HL6A 3DNMA 4KAJA 1P0MA 4DMHA 4IHAA 4LYDA 5KWIA 3CCCA 5E4JA 5AIAA 2ZVDA 1HQDA 4X6UA 3WKCA 3JW8A 2Y6VA 1HBJA 4UHEA 3AZQA 4RNCA 4AO8A 4ARAA 4UUQA 1ZGBA 2ZSIA 5LP1A 4X92A 5CMLA 5AO9A 5DYWA 5CRIA 3G9ZA 4GXNA 3V48A 1AQLA 1QFMA 3QPCA 4DMKA 3AJAA 3WA6A 3A70A 3PICA 3HJUA 1WB5A 3O9VA 1R4ZA 4A5SA 1S8OA 2XUAA 5SYMA 2OCGA 2JGIA 4AMZA 2VJBA 4OYLA 5FLKA 2D0DA 3DKKA 3VJLA 1K6EA 1XRMA 3QBJA 1VA5A 4GLBA 5AK6A 3MUNA 3FVTA 1XLWA 5ALNA 2V96A 4BCCA 4K6KA 1OXMA 2JIDA 3ESDA 3GROA 1DWOA 5AK4A 4C89A 2YASA 4EUSA 3FOBA 4I4CA 4N5IX 3HXKA 4UBMA 5FRDA 4C4YA 2C4HA 3O9MA 2XLCA 4P9NA 1H23A 3DEAA 3ZPXA 1CUHA 2WUFA 1CUEA 3STVA 1XRRA 4WFJA 1KU6A 3WQHA 3IURA 5LZ9A 4W1PA 1USWA 4WCVA 3FNBA 2XQIA 5EIHA 2WU4A 3WKEA 2VAXA 3STTA 1ZD5A 2XMCA 2PSEA 3TEJA 2WIKA 1ISPA 1EVQA 3NUZA 1RYYA 1QO7A 1JT2A 3Q0TA 4UFPA 5JARA 3R3XA 5ESRA 4CIAA 5JAHA 4JNCA 1DX6A 2VJDA 5AKJA 4C6HA 5ALSA 3GBSA 2HM7A 1MPXA 3E3AA 4OU5A 4B9EA 5A71A 2XMSA 2VATA 2QXTA 3H19A
chains in the Genus database with same CATH superfamily
3PGJA 3BHNA 1T26A 5EC8A 3ETHA 2Q9AA 1MORA 5ECGC 5F5NA 5AJYA 1KQOA 3K0FB 1A7UA 2R8YA 1P3Y1 4FOTA 4FOLA 1ACJA 1EK5A 2JKZA 3L0CA 3VUFA 2W6QA 5E6SA 3T1YB 1VLQA 4U2EA 4BBPA 1NW5A 5JALA 3WNDA 2H0RA 1J1ZA 1TEXA 3O95A 3HUFA 3OPNA 1UP7A 2LKCA 3NASA 2Z5LA 1YDWA 3RBZA 4Z51A 1GPUA 2A14A 4NBSA 5AW8A 3PX2A 1OI7A 4X71A 4UUAA 1KJZA 3BICA 1T5HX 2J4FA 3HKDB 4J43A 2YQZA 4QULA 4R2HA 2VF5X 3BXFA 3KKOA 4IUYA 1I10A 2QGFA 1G20A 2P4QA 2Y99A 1YQGA 4DLRA 1GKYA 1YS6A 3EIUA 1NNLA 1IZ0A 1JHUA 2AHRA 3C6XA 5KU7A 2P3QA 2HT6A 2JHFA 1FYWA 1ZMTA 2GR9A 3Q6IA 2HIHA 4Q3AA 5KU1A 2UUBB 1ECGA 4PGAA 2EX0A 3IGFA 1I80A 3WGZA 1TECE 1WQ1R 1PP4A 1DJQA 2Q41A 5EMMA 2JPDA 4RD1A 3COSA 3PQ7A 3H75A 2H65A 3TLMA 3L8DA 4F4JA 1J2EA 4O4IB 5FBWB 4IGKA 2OM6A 4ZQFA 1U8XX 4I2NA 2F9FA 4I50F 4K26A 4AP5A 4HWSA 1OWPA 4E33A 3F9CA 4B45A 4ZK2A 1BS1A 1W5FA 3OOWA 4NCNA 3BXZA 5JQGF 3H99A 3HXQA 3KSBC 4YGYA 3JXEA 3R3UA 4RH0A 5KSPA 3LOUA 1NNEA 1JALA 4CETA 3ANNA 3GYBA 2GF2A 2CL5A 1E4EB 1U28C 2C04A 2C9MA 1BSVA 1GUZA 1KGSA 3AHFA 5F76A 1GADO 3STYA 5A3JA 4NVRA 3IVAA 2X2PA 4WUVA 3OQNA 2QRKA 1D5WA 1G6HA 1RMTA 3H0EA 4Q7MB 1LX6A 2B4TO 1SOMA 2C4VA 3LKZA 4GPBA 1L5YA 5KREA 2HU2A 3TQSA 2CNNA 1T6YA 4IO0A 1VL8A 4MYDA 5JROA 4RFSB 1KEUA 4GOND 4QXOA 1H69A 2GILA 5AKHA 3UOWA 1U5BB 2EGGA 2Y1CA 1BQEA 4C0JA 1E63A 5AIBA 6NULA 1M0SA 4HYQA 1BN7A 2ZCUA 3DYBA 3CNNA 2VXCA 3MS7A 2GTIA 4IS2A 1GL7A 1VRVA 1HE5A 3K92A 4Z9YA 2YV1A 4XQEA 5FNVF 4EY7A 3ENQA 4NSNA 1IVYA 4IZIA 1XZMA 1SCKA 1U7XA 2DCUA 3E9DA 3HKEA 5H4HA 4A8HA 1EB9A 1C4WA 4G0YA 4Y18A 5IAKA 3WB9A 3DKPA 3H5NA 3Q87B 4DJJA 5M5BA 1AB5A 2PMBA 4MS3A 1G2OA 1NYRA 2YKGA 3S5JA 4CIWA 3AR9A 3VQTA 1H3EA 3LP5A 4F85A 2O2JA 1CYDA 1J39A 4AKTA 2F62A 1ZM2A 5HYVA 4G9BA 4QD3A 4V0RA 5IKMA 1LY1A 2H7VA 1DOHA 1BYIA 4KXFB 5D84A 5DOZA 5JBIA 2AX4A 1OLUB 3AR4A 3BRWD 4WZBE 3WMEA 2H2GA 3AGPA 3KEGA 3CFYA 1YUNA 3BTSA 4QXMA 1G1MA 4CTNA 3HXTA 1Q0QA 3T4UA 1THGA 5E3IA 3HUEA 3PQ6A 4ZICA 1VM6A 1LRLA 2DBQA 4FFRA 4R2LA 4E7PA 2X5XA 2BI7A 4N65A 1T0BA 1JEOA 1YULA 4FYPA 1AC5A 3ZCQA 4ZVOA 5AJZA 2Y1DA 4ZCRA 1UM9A 2FK7A 2FPIA 1FVHA 3EGOA 2R9VA 3QQ5A 3D4BA 4HZGA 2NNWB 4FW9A 5BN5B 1WEKA 3O8BA 4AS1A 5EIOA 1JZTA 3EVZA 2H9AA 2IZ5A 2OO7A 3GCWA 3ZUGA 5CEEA 2FFQA 2QDKA 1LU9A 2XHZA 3KTAA 5ALPA 2BEUA 2EG5A 4MAAA 5BYBA 3PVZA 2ISSD 4CFSA 1M0WA 2VTBB 4RACA 2BGMA 3CR7A 1WKBA 4RCZA 2YWGA 2GD0A 3LSYA 5SY6A 3DZDA 1JYSA 1K7YA 1Z0JA 4HEQA 2NUAB 2O0MA 1HKUA 1XMIA 5TPWA 3ZHUA 3L8ZA 3NIBA 2I7VA 3TJMA 4D46A 1EUDA 1HDCA 1Q1QA 2FDXA 4MH0R 4HQRA 1GQ2A 1PL0A 2QLJA 4PSVA 4WACA 3UOGA 2FSUA 4D7AA 5CVVA 3DFZA 5IP5A 3ZCPA 1DC7A 3OJFA 4D3YA 2ID8A 1TQ4A 1OR8A 2VSYA 4NFSA 3QHQA 4BNGA 1LPAB 4KHZA 2QD3A 1MO6A 1G5TA 3KAJA 5B30A 2OMEA 1AK2A 2A35A 3P0FA 4G85A 2XRZA 1KP3A 3IO3A 1USUA 2RFLA 3C3MA 4K9RA 3AUUA 3FNQA 2Y66A 1QQ7A 2VUSA 2VPQA 4KQXA 3QLUA 3UUEA 4HDOB 1MJNA 2FZCA 1EZ1A 2WQ7A 1ZH6A 1M34B 3PPYA 2QNRA 2RK4A 5I7FA 4KMSA 3RKSA 3FWKA 4X3OA 3EXFA 2BW0A 4MWTA 2HO4A 3IJPA 1ZW1A 4A0RA 4EHNA 2QNBA 4B34A 1QV7A 2PH3A 2EFCB 3NH9A 4MAFA 3D3WB 4EATA 1WUHS 4MHTA 4B3JA 4AECA 1ECPA 3O1LA 1UWVA 1MO5A 1Y3DE 2KE5A 3PXDA 1RAAA 4P33A 1Q77A 3MZ0A 1U1EA 1VG8A 3CR8A 1GZVA 1JR3A 3OOYA 3PUXA 4DXAA 4F04A 5MGBA 1V5IA 3UMBA 3BK1A 4U7DA 1XCOA 1U2TA 1VRWA 1MAAA 3GR6A 3OM1A 3TW0A 5KQLA 4ZU3A 3V4SA 3VUEA 3DOCA 2GN1A 3T5PA 2PUAA 2Q9CA 4FN5A 5LXTF 3RC2A 4EABA 2ZB4A 3IT2A 1Z8FA 3BTOA 3SX4A 3LX4A 4YCJA 1U3TA 1JIQA 3QF4B 4P6VF 4XARA 2CDAA 3T7AA 1I9GA 1NMSA 3PD1A 4WHMA 5A7HA 4E2XA 6CHYA 1O8CA 1YU9A 4PLHA 3LZ6A 1M76A 2H31A 1JR2A 4N7RA 3RBXA 5LIPA 3GP8A 1XZGA 1HOXA 1F6WA 5JANA 1YCFA 2FUKA 1Z16A 4KUGA 2BFWA 2E4XA 4O29A 1XQYA 2J45A 2Q3DA 5DYYA 3Q3IA 2GCEA 4TVKA 3JARA 2EQ5A 5LN1A 2VHXA 4L5AA 4CLXA 5C3UA 3PX7A 3H2GA 1C9NA 4XA8A 3ICWA 4BAZA 3PNVA 1U3VA 2ZZKA 1P6XA 2BDEA 4BRUA 3GUYA 1IMOA 3WYNA 2WAMA 1MLDA 3BZWA 4NV3A 4EKYA 3ENKA 3HN2A 4UE3S 5IJ0B 4I1PA 3ICCA 4G4SO 4Q4HA 4MWCA 1IC6A 5A4AA 3SYNA 4MWZA 3KQPA 4BJ6A 3A1SA 5IVKA 5J2UF 4ZTBA 3F49S 1W48A 2GJ9A 4Z99A 4ZVPA 2DH6A 1ADYA 3VH3A 4RY0A 1C2TA 3W79A 4XYLA 1PAUA 1R00A 4AM8A 3DGFC 3GLVA 1LWOA 2DT5A 4TRRA 5C1PA 3B7WA 4DQVA 4CVNA 1PGPA 4EJ6A 2AOTA 5CEFA 1MAHA 1NRJB 1NW7A 4HQOA 3V2IA 5AKEA 1SXJE 1B23P 4L0QA 3I64A 1CDZA 3TJRA 3LLUA 3SU8A 1KA9H 1RQRA 1CJMA 2YFKA 5FB3A 4GIBA 2QJOA 1OXSC 5D2CA 1CP2A 1NDHA 3LGSA 5HE9A 1OX4A 1KZ4A 4X64B 4C4SA 1GSIA 4KIGA 2OT3B 2A9FA 2ZYAA 3T0GA 3DE7X 5D6NA 1L4FA 4MGKR 5LB2A 3K1JA 3A1WA 4ND5A 4FFBA 4XB2A 2ET6A 4TWZA 3MCTA 5ECDA 2X0FA 3WP1B 1L4YA 1HETA 4D5EA 3K8ZA 3M1LA 4WA7A 3B9BA 2XB6A 4GZMA 5D51S 2A57A 4MGIR 4K88A 1GQYA 1KO4A 1PHRA 2BKXA 2WKSA 4NQZA 1VLLA 1YZHA 4TQ9A 4HXYA 5ELLA 3UW1A 4AY5A 4BV3A 4O3FA 1PUJA 4MICA 5H3CA 3M7IA 4G25A 5TXGA 3TYXA 2QUAA 5JXWA 1B43A 2IZ7A 3MJEA 3D3NA 3VJKA 5EYPB 1MJGM 5CNIA 1XAIA 5IFLA 5TMPA 4EJFA 3CVYA 5AW9A 4BMNA 2QP3A 7REQB 1E1KA 2DLCX 2HLNA 3CXRA 3ETCA 4Y1EA 3MW8A 1DHRA 4X8LA 5H0IA 1YU6A 1JTFA 3EVTA 4HQNA 4C14A 2Z56A 2HFJA 1NVTA 2C1ZA 1W73A 1KK2A 3FI9A 1NJ6A 3JWEA 3L0PA 3PWKA 4QREA 4R1PA 3S2YA 5LNK6 4S05A 4DYDA 1V4VA 3PQ8A 4YGXB 4CMBA 5DE3A 3UUGA 3I6ZA 4UPVA 1Y7IA 2K2QB 5I8ZA 4CTJA 1X9HA 5H9WA 4AX8A 4HPJB 2QT0A 2C61A 4X1IA 4GX5A 3LTNC 4AU1A 1IHUA 2PGDA 2GLUA 4Z2AA 2BIFA 4LZOA 1JSLA 3ZC3A 1MX3A 1MQ9A 1UEJA 1VSBA 3LVFO 3H8SA 1DV2A 2AWNA 4ARZB 5F3RA 1XPOA 1Q7BA 5A04A 1ZXBA 4LQCA 2XQFA 1NUHA 1U0FA 3WDLA 4WBXC 4JJAA 2B98A 1GZ6A 5IDQA 3QUSA 4O0MA 1AUOA 2B2NA 1J5EB 1MC1A 3Q9SA 3DDWA 3KQYA 1UK6A 4P2GA 3RU9A 3ZVRA 4AIIA 2H52A 1KJIA 5IF9A 4IFTA 4M1TA 3IV6A 3NOVA 4N3GA 1JB1A 5DTRA 2RI6A 3EHDA 3ETDA 1D2EA 1GTZA 1I0ZA 3Q3VA 2WTBA 3I01M 4N1AA 5K6TA 2HJ9A 3HI4A 4FMDB 3KOWA 4Y2JA 3PITA 5G41A 4M21A 3ZCRA 1P91A 3RYFA 4RSRA 4N18A 1FS4A 4BBJA 4Z53A 2H1HA 4W8OA 4NENB 3DV0A 4ZZ3A 4GG1A 3TLCA 1MO3A 1VIDA 3F78A 1HMPA 1VIAA 3W9BA 6PFKA 5DB4A 1Z62A 1P9LA 3DEHA 4OI0A 2G1UA 2OGTA 1QFYA 2UUCB 1G9SA 1PT5A 3UPDA 1GPMA 4WXYB 1NV9A 6ABPA 3CF2A 5A4DA 5KSYA 4QICA 3DJFA 1FQOA 4GPIB 1D4ZA 1HDGO 2HJWA 4HNGA 2GCOA 5FLEX 1XPUA 2X6QA 1QK5A 2BFAA 2Q5CA 4P53A 2H8KA 3I2FA 1E6MA 2ORVA 4XM0A 3T9BA 1XDWA 3MGCA 4RY9A 1T6ZA 3KOOA 1K9VF 1E2MA 4RCYA 2NNLD 1UBTS 5T64A 4HRYA 4BB6A 1A97A 2C83A 2HWXA 2Z3ZA 3FMOB 3N7AA 2COEA 2JAXA 1XQ1A 1V16A 3DTNA 4EEKA 2H18A 4P81A 2BP7A 5CDFE 3AVVA 4HLQB 4ODIA 2I4RA 1NFQA 2ACVA 1DGQA 5ITZA 2DQYA 2P77A 4BFZA 5CA0B 1PJTA 2GHTA 2VBCA 3HCWA 4LWPA 1G9XA 1GDHA 4PNEA 3UAGA 3LK7A 1NQWA 2R7KA 3GOQA 5G40A 4DSNA 1I4LD 1CQIA 1OZAA 1SC3A 4TQGA 4BRSA 4TL6A 3DPUA 3GT0A 4D43A 1OJLA 3A8TA 1KC1A 1ACMA 2ZPAA 3FTNA 2VWHA 3DR5A 3PFWO 1YBMA 4LOHA 2XGGA 3COVA 2I4MA 1RLJA 2LIVA 2UZ0A 3F3YA 1RKQA 4IXDA 1XAHA 1EIZA 1LK0A 3A3OA 3OO0A 3QE3A 3UAZA 3G89A 1SY7A 3G68A 4NAHA 5FXMA 5JZOA 4Z0TA 1G7SA 5BWOA 3EEBA 3UHAA 2ETXA 4PZYA 1ORWA 1OH8A 3A6DA 2VLIA 3CNEA 4FD3A 5KTYA 5DXFA 3QW2A 4M0KA 1QHHA 2Q3LA 3KT8A 5DHAA 3DQZA 3WZLA 3DL2A 4F4CA 3QK7A 3H8JA 2V45A 4LBZA 5SZJA 4EB6B 3IX7A 5F9HA 1Z2OX 4J0IA 4YT5A 3ZDDA 2QVXX 4KN9S 5TQ2A 1KSHA 2Q4BA 4QWWA 1G60A 5C34B 4OK6A 3RF7A 1NASA 4WN9A 3KXLA 2AE2A 3NM4A 1VLHA 1TAUA 6AT1A 5LKRA 1MC8A 1KMHA 3PEVA 2L82A 2NZ8A 3GAZA 4L5YA 1TL7C 5HZGA 1C81A 2ADOA 3FRJA 3AF2A 3QNMA 1SWVA 4XYEA 2LCIA 5BNTA 2AJCA 4Y2TA 3TZCA 3LY5A 1FRQA 5CFPA 4MUGA 2YXBA 1VHWA 2NSJA 2OHOA 1X1TA 3AB8A 5CUQA 3SVTA 5JAUA 1X1DA 3KJNA 1JI3A 4MA0A 1UZMA 3ZHTA 1YRBA 1QYCA 2F1KA 2Q3MA 2XMQA 1E4VA 1OAKA 4I2VA 4NOMA 2J3JA 3STHA 3UZUA 1RJWA 3W9YA 4BLSA 2NUTA 4DBLC 1X80B 3ASVA 3GJ0A 1O8BA 2KS6A 2SCUA 5T6MA 4B75A 4J3JA 4R05A 4JB3A 2VT2A 3V8RA 1TMOA 3I6BA 4BVFA 1TQ8A 2FNAA 2R7AA 1XTQA 4QXQA 4ZVSA 2ADMA 1RRVA 3I42A 4CPDA 4D8UA 4DT1A 5BR7A 1FDVA 1K5PA 4G8BA 2Y92A 3SNHA 3HDGA 1B0AA 1RAGA 1JKFA 2VT7A 4L85A 4M0PA 4F92B 3BMNB 1A5AB 3QYJA 1TW3A 4RV9A 3U3ZA 2P5YA 4K28A 1FFAA 4HJRA 4CHTA 2AN1A 5AJUA 1XQWA 4ZN6A 3A1TA 2CUNA 3I2GA 4LOAA 4QPNA 3GZTB 2WU1A 1IUNA 1T5IA 5ER9A 2JLRA 1JJIA 5B57C 2VBIA 3EB9A 2FKAA 4DNXA 2QY6A 2Q6VA 2XUPA 4AXBA 2NZWA 1TU0A 3MYYA 3AHHA 3KE8A 2ICAA 3DAFA 3AL3A 2A9RA 1EFKA 4G6ZA 4TLAA 1CXZA 5EY5B 1DEAA 2D1TA 4DPKA 1JJFA 1F6BA 2X0DA 6LDHA 3SK0A 1RWVA 3VSCA 5J1SB 2CJPA 3HCPA 3HR7A 2UZ1B 3IHLA 1U0SY 4MW4A 2Z2ZA 3WWOA 3RYCA 1M8JA 4DUGD 1KFBB 1YSCA 4C06A 1CHDA 3E61A 4JDUA 4LDPA 3HGQA 1A2QA 3RAPR 2OECA 3PTAA 3O4RA 1B1AA 3PNQA 3ZXXA 4EAQA 4DUYB 1E20A 2GNOA 3AFMA 3BD8A 4HQFA 2OUIA 4MUJA 4PG4A 5IKOA 1HDOA 2ZXEA 1LW7A 3GHYA 1OT5A 1RLIA 1ZOPA 2V65A 3N53A 1GPKA 5JJBA 1ZGGA 2VTBA 4DB2A 2V6GA 2REQB 4IQ8A 2BEUB 2KLBA 1HH4A 2QRHA 2M6LA 2FRDC 2AC2A 1VJGA 3ELBA 3OC6A 1ML4A 4FGSA 2WVAA 4KNVA 3ZWCA 3A4MA 1WV1A 1CUGA 4M89A 1ORRA 2HIMA 2DXIA 3DULA 3H86A 3KLOA 4DNFA 4YRIA 5K0FA 3KUXA 3ON5A 1E66A 1O95C 1MBZA 3CX6A 4MB0A 2PJUA 4BMXA 5LPNA 1UKBA 1XTVA 3OF3A 4PZCA 2O54A 3I58A 5LKAA 2P5SA 3I72A 4KQ6A 2FMHA 4IRUB 3V1YA 2FPIB 3P20A 3EQ6A 4CTKA 3ROXA 2Y93A 2JCVA 1HLGA 3QH4A 2J9ZB 4Y6RA 3U44B 2J46A 1YK0A 4IJVA 2XHEA 2HBZA 2YXDA 3GWGA 2ZGVA 3OTIA 4IFIA 4RKYA 4JI8B 5KEIA 1S8NA 5L6MB 4M0UA 4OQDA 4WSOA 1IN5A 1E89A 3TZHA 4D81A 4M6WA 3EQ9A 5BWCA 4DUGA 1B3BA 1IWPB 5CYFA 5JSYA 3W78A 1DRJA 5DIFA 1JUDA 2I3GA 1RHUA 2WIAA 3MBOA 3NDJA 4WV3A 4I1VA 1JQJC 5K8IA 2CLHB 2DKOA 3RW9A 3K73O 2IOQA 4PBRA 1TIKA 2ECKA 3CH5A 2WV9A 3M9LA 3RRJA 3ML1A 4FK8A 2P9TA 4RMGA 1E1QA 2D4AA 4JJ7A 2Q3JA 4GYJA 3C4QA 1GGEA 3BYZA 5J2UB 3BBLA 1OKKA 4MRAA 2C5SA 4M3NA 3VNUA 5CG1A 1TK9A 2UVDA 4K2HA 4URHA 4W4TA 1G8SA 4S12A 3LHIA 2WVHA 4MQLA 4IY1A 4ND1A 3LU1A 1ADGA 1H8HA 2RAFA 2WILA 2EWWA 5AHOA 5ALOA 3EGDB 5IANA 3PGA1 2X1HA 3BGWA 1V6CA 4FFMA 4LGCA 4HUQA 5E7QA 3UC5A 5LXTA 1Z8DA 3E2PA 1ESZA 1Q5PA 2EZ8A 2X4IA 1XU7A 3RB8A 2IDZA 2OHHA 3EEFA 1HQKA 3JRWA 2GZMA 4ZOQI 2AFIA 3HZOA 4NCKA 1TM7E 2XVMA 1JWBB 5DTMA 3TKAA 4JYZA 2OVBA 2ZJ5A 4C78A 5BMVF 5FHRA 3V9PA 4MDYA 3WAJA 1HKHA 5AW3A 1DV1A 1SXPA 4PQGA 1PLJA 1RT9A 1XTUA 2C0QA 3ADBA 4DV0B 4XGNA 2P8JA 3AIIA 3LTEA 4DQDA 1Q15A 1UKZA 4YP6A 5F77A 3R7LA 3DTTA 1VL0A 1ZHHA 2VF7A 5CVEA 2JJ1A 5D5PA 4P3NA 1Q0TA 1VCHA 2WAYA 2YVKA 3WMWA 4LIPD 5AXBA 4TKLA 5DN6D 1PNQA 4IZOA 5J59A 1G5PA 3G5AA 4IJWA 2RJOA 2IVFA 1KYWA 3QU5A 2R4UA 3NUQA 1Z15A 2OBYA 1U4OA 1IEXA 4GE3A 1ZI6A 2JIPA 1EFHA 2RGXA 2DJIA 3PFNA 1CUYA 2QPAA 4YCSA 4O4IA 2BEKA 3OQMA 2QROA 1QRRA 3RS5A 3RTCA 2QJRA 1X39A 2AG6A 4ESOA 1N1GA 5JG7A 3ZI0A 3VZBA 1B8PA 4MGEA 5K51A 3GPDG 2GN4A 2VWQA 1MIHA 2MSEB 1RXWA 2GD6A 2OK7A 1EDDA 1P0QA 2ZSDA 2RGYA 4JYMA 1RXCA 4DV5B 4C4XA 4Q21A 1YAJA 3F2VA 3I5YA 3PFBA 1FVXA 3HDQA 2F9MA 2R00C 2V7BA 3WL4A 5DGXA 3ZU5A 3W5IA 2C54A 4IMIB 3NKLA 3ZCVA 1FVFA 4GBGA 1EBBA 4MMZB 3W1WA 4BAGA 2VP9A 2V7QD 2XYGA 3PB3A 4OP1A 4TWRA 2PS3A 3RODA 4IHKA 4OTZA 2ZE5A 1IJKA 4KVFA 4EY8A 3DYIA 3ABIA 3FPSA 4L1KA 3LT0A 1E3DA 2H1IA 3KSAC 3KAKA 4C07A 3PENA 4MITA 3DGEC 3WHLA 4F4FA 2EGHA 4WZ6A 4OAPA 1UT5A 1UPCA 3A4LA 3QVXA 1JWAB 3JATB 2EL9A 2EHJA 4IIDA 4UBJA 4E1VA 1IYZA 2CBZA 3KV3O 3RO7A 3FLAA 4OGGA 3NS7A 2Y1KA 3RFUA 1UFRA 2WQ6A 2JGMA 4RO0A 3QX7A 4YK7A 5CT5A 3QE9Y 4FFBB 5LZ7A 4Z54A 2DFPA 4HDNB 2ROQA 2J59A 4OL0A 1EINA 5EA2A 4WTOA 1Z34A 2OENG 3D7SA 3MGGA 4M9SA 1LNZA 1PL7A 1NLZA 1HFKA 1Z74A 2G0AA 2GASA 4N12A 3R2JA 1ILWA 4UM7A 4V1CB 5EZ5A 3RSLA 3WX0A 1F4VA 2DSTA 1QKKA 3I83A 4OFWA 1RABA 4Z4HA 3PQ5A 4UE2A 3WLTA 3RJ9A 3QXXA 3R8FA 5EXSA 5J43A 4DN6A 3LUFA 1YR9A 3BL8A 3SBEA 3U4QB 3I04M 3SG0A 3EOBI 3KEMA 4LXGA 4Y67A 4B4WA 2ZW9A 5IMSA 3JR3A 1U2QA 4K6HA 1IIBA 3NM6B 3P9XA 4EVIA 5L51A 1ONOA 3TECE 4AYTA 3AHGA 1N34B 4PQRA 4AN4A 4EG6A 2KBEA 1WG8A 3QWFA 4KXYA 1XK6A 5A9RA 2UUPA 5F52A 2XE8A 3GLKA 3TSOA 1Q0RA 3KC2A 3UWMA 5IJ0A 1OUMA 4JLWA 1V4BA 4I14A 1QS0B 4CDRA 4RTPA 1LDBA 1EVKA 5H8WA 1TK2A 1RCFA 4ZXFA 4OA5A 3B1YA 3RGGA 7MDHA 3EULA 1FU7A 1D03A 3G17A 3PC6A 4ZYUA 2FVYA 3A1NA 4UTNA 4E5DA 3JARB 1ULTA 3WL5A 1V7CA 4K5QA 5ER6A 3PP8A 4BASA 1MZPA 1Q83A 5A06A 1P45A 4F71A 2B2XA 3T8YA 2IBTA 4M1YA 2IY9A 4GMDA 1KMNA 4QELA 1EXMA 4LI0A 2VSNA 3ZGOA 5JAOA 3CUEF 2ZIXB 2JEZA 2GARA 2F55A 1FXUA 1WBJB 2A3RA 2N1MA 1XNJA 2RGAA 3DHNA 4G5QA 1R5BA 1V5EA 3W9SA 5IDXA 3L4KA 1AY0A 3N8DA 4CCWA 1WCWA 1I3OA 3UH1A 5EXXA 2BTQA 3EYAA 1QM5A 4O2LA 5HQJA 1PFWA 3FCUB 3ORSA 3L01A 3ROPA 2VJMB 4YAFA 2BV3A 3ME5A 1Z2CA 2OCXA 3S7ZA 1Z6YA 2XUKA 4X9XA 3IILA 3ZDBA 1R64A 5IC6A 3ZDCA 1TLTA 1NG1A 4U2KA 2AYYA 1UMDA 4NCBA 4P0TA 4KN8A 3TRIA 4LF9B 1K9SA 1WUIS 3BE6A 1ZI9A 3FGPA 1O6GA 4XZ3A 3DCIA 4MVCA 5AOCA 4B3MB 4CV2A 2HMUA 4M9UA 1QIDA 3JY6A 1P62B 3QE2A 3HL0A 3T5AA 4JLKA 5DLQC 2I91A 4UUOA 1QYVA 2PX2A 3HCFA 1HURA 5HZMA 2FUG6 2C7VA 3K16A 1I32A 3ZQUA 5A4IS 3HUUA 2ORYA 3A7DA 4MUMA 2NSLA 5DMXA 2G04A 4FB5A 1H3NA 3AYZB 2FZGA 5AH0A 3OPVA 1EWYA 1GPH1 1XEFA 4MPJA 1V8OA 4V0QA 2BSQA 1SKQA 4IHJA 4BMOB 5IZCC 1GXSA 1HO3A 1KO7A 2LP4Y 4TV8A 2QTVA 1RZRD 2P79A 2J32A 1TJPB 1ZNWA 2XOKA 3AUXA 3VJRA 1SBZA 5F2OA 1E3WB 3AP3A 4GX1A 2X0EA 1B6TA 1VP9A 4OQXA 1NJ1A 3R7DA 3VISA 4F91B 2D1YA 4FHEA 5LQRA 1QR6A 4MCHA 2NYVA 1GNRA 2P9YA 4MCIA 1JB9A 5F7ZA 3S55A 3GRAA 1JN0A 3RR2A 1USVA 2V6FA 4PHFA 3ZH9B 5DM0A 3M81A 1A8PA 2FDRA 2H6EA 2Z58A 4FTWA 2FA9A 4D8XA 4RJ2A 1QVRA 3BRQA 1ZY2A 2EYUA 2AVNA 2FSVC 2I3DA 3AZPA 5GY7A 4FYXA 4TS1A 4OF4A 5IM4F 1ML3A 3MMNA 1IY9A 3I32A 5FH9A 1WU8A 2NUBA 2ZUSA 2NO9A 3QUTA 3DA8A 4KYUA 3S1AA 3ITKA 2B3TA 4QNMA 1YACA 2AKAB 4FOSA 5DNYB 1M34E 3NRJA 3F3MA 4C9BA 1LPPA 2PKCA 3AUFA 3EXG2 4V3BA 4DIUA 5HF5A 1MQSA 1QK4A 2NPIA 1X7ZB 3K15A 3VKHA 3BCHA 3P8ZA 3HVIA 3ZW7A 4KIFA 1S8AA 2WW8A 2OXFA 2JJYA 5JYBA 1EAYA 4HXFB 3KKNA 3P9NA 4KMOA 1YZ3A 1TUBB 4EYSA 1US8B 4KSBA 1D2MA 2BFPA 4F5DA 5KYWB 2XA1A 3EXAA 2IZOA 4C88A 2QVYX 1RLMA 1MV8A 3CHYA 1TK3A 5HOQA 2OZPA 3GRRA 2AD5A 3MTAA 1U0TA 4CLOA 3DXXA 4UTVA 2QLBA 1MH1A 1NBAA 3LWDA 3M6VA 4J0KA 2WYIA 4KR3A 4IIUA 4D25A 4CCAA 2ZQYA 3AOGA 5CB6A 1QHFA 3QVTA 1IUOA 3IUEA 3X3HA 2RKOA 2O0KA 5JLJA 3N74A 4B6PA 4KQWA 1VCNA 2XCLA 1XP8A 5FR1A 5ES3A 5FKJA 2VPPA 4DV1B 5A0FA 3JWHA 5CX1A 3T12A 4N49A 4FMPA 4MYRA 3WBBA 2AN4A 2H48A 1Q1NA 2GFIA 3A26A 3CF4G 4MS3B 2OBLA 3TM5A 4PANA 1KHHA 2GEUA 2H4HA 3PNYA 3KZXA 4F5ZA 3KYBA 1SXJD 3QVJA 5L3RA 3JYOA 2CHGA 4XVRA 2J30A 1W8IA 4DDHA 4CMIB 4UVIA 2EX4A 3FA2A 2OL4A 4Y6QA 2J33A 3VM6A 2UV8A 5I9IA 3HJAA 5G4KA 3VR6D 1W1UA 3LY8A 5ALXA 1FNSA 1ZEMA 4WZAA 5AK3A 4A2WA 1DKPA 4LSMA 8ADHA 2GRUA 3NC4A 1PR9A 2UYQA 4EF4A 1R18A 3DOEA 3CH6A 1L1EA 1RC0A 4LZPA 3TE6A 5HQ3A 3SIWA 4QC2A 3L8HA 1RHMA 1MNQA 3NTQA 5TY0A 1HA3A 4GUAA 1K5GA 1CJVC 4NU6A 3S8MA 4KP7A 3THRA 3ZY4A 2NXCA 4DNOA 2VJQA 3VVMA 4HVLA 3AR8A 1RRKA 4B1FA 4G81A 2EFHB 1UK9A 3ZY2A 4INAA 1ZL2A 4KPUA 1OY1A 4M37A 4B79A 4WNIA 4WJKB 1H0RA 1I14A 4MUEA 3KT0A 4Q3KA 5DLDA 3AJRA 2NVWA 2C9YA 4RAOA 4YMVA 4LECA 4LV6A 4OQMA 4OK3A 3HO1A 2VUHB 5AVUA 1JLLA 1I1OA 2OLJA 1CPYA 3DHVA 5JRDS 1XLTC 2AE1A 4CM8B 3EAQA 1QZUA 4TLDA 1G42A 3SXJA 3ZKAA 1VE3A 4X3PA 2CB0A 3HZZA 4XEHA 4CL8A 3P27A 2A92A 5MFPA 1PSWA 3TMAA 2PKQO 1ECLA 4LHEA 1ZSVA 4IIBA 2QEQA 2I6TA 1JPNA 4D3SA 1XRLA 2VJOA 2HMTA 1PV4A 1OIWA 1COWD 5JD4A 2XQJA 4GQIA 4QPCA 2ZXFA 1WXGA 3ZU4A 1ZM4A 3AMVA 5LUBA 1PJCA 1U2RA 1V4NA 3BTUA 3F90A 5GONA 4WFKA 1H0SA 4K9SA 5FA8A 5CPBA 2UXDB 4E3WA 1CIJA 4D9EA 1T3TA 2OYRA 4F86A 4EO4A 1E9VA 4OFBA 5EKDA 4AS2A 1YFZA 3E6AA 1SOVA 1E1LA 3P0IA 4PLPA 3V4PB 2XODA 1T0UA 3ACDA 3ESZA 4OG2A 1SBIA 1QVVA 3UCEA 4YUZA 4US2R 2Q3FA 3UGKA 1JECA 1QX4A 4ENVA 1BX0A 1M2HA 2ZJ4A 4JI5B 4P36A 1N0HA 5DFAA 5F1PA 3UUFA 1I7DA 1MB4A 1U94A 2H2AA 4MI6A 5HBGA 3T95A 1JR3D 2JI7A 5IZCA 2WJYA 1E2QA 1A4RA 3GJ7A 4WKGA 5FF9A 1Z63A 3IDAA 5JJ5A 4LHSA 2P2ZA 3RSCA 3DAOA 3DMFA 3KLNA 3WRYC 4PXYA 4E11A 4XM1A 3LKBA 5DGCA 1GCIA 1GPWB 1LV7A 3FNFA 2YRWA 2NOAA 2OXRA 1ZNXA 2QRZA 3O47A 4D6PA 3A14A 1V95A 3WOHA 2XCTB 1J0BA 1T4CB 5CM9C 3TLGB 3D59A 1K6MA 1QCZA 1Z0SA 2QTFA 1POWA 4ZI2A 3L7NA 5ERGB 1KH3A 3H9JA 1NAIA 3H1EA 4Y9TA 3ZH2A 2BMFA 5I9TA 4YCLA 4DKXA 5JCPA 2WWTA 3KZKA 3LUKA 1AHPA 3AQ4A 2W6PA 1VBMA 4FZ5A 2IYUA 4LJRA 5KKNB 2DR2A 3T3GA 4RC9A 3ELYA 4QDZA 3E9EA 1CEQA 2WPDD 3W6PA 3FSGD 4KACA 5FTWA 4YAEA 2ZJZA 1W4ZA 1FFHA 4BFLA 2A9OA 4Q9NA 1RKUA 1YRYE 1X15A 3E9CA 3GMDA 3PX3A 4HR7A 4K3UA 1AS2A 3CEHA 2Q1SA 5C2JB 1ZJ5A 2Q5FA 5FUWA 2YHIB 1P1HA 2IIQA 5JYCA 1E9SA 1AUVA 1R5NA 4LE2A 3PC7A 4OB6A 1KYVA 4N3BA 3DE0X 2G7MC 1USGA 5EIFA 1Z6AA 3VVLA 4EG3A 2PXXA 4HFNA 9ATCA 2P4EA 1Z5ZA 3EGXA 1PUIA 1SUEA 1NMZA 4ZT2A 5FWAA 1G5FA 2DY1A 4ZHQB 4WLOA 4CXMA 4Z0HO 2H3EA 3W8EA 2VOEA 4IWNA 3HJBA 1QG4A 2JFGA 1AF7A 2R5FA 3DW3X 5JVDA 2OLKA 3D6VA 4NJOA 1EDBA 3VZCA 1SUFA 1VCIA 4EGCB 1U11A 1C8LA 1XEWX 4K9PA 3ZNNA 4QQRA 3K96A 3GEIA 3JZDA 2CXQA 3MOSA 4K46A 4RPJA 4J6FA 5AKKA 2CLCX 2O1SA 5G53C 1E9DA 1U63A 3GGDA 2V9ZA 4PFQA 5EJ9A 4H35A 2BOVA 3GQBB 1P9OA 5FTJA 4QUEA 4B6OA 4G24A 5GVSA 1AZWA 1BCRA 4EDFA 3V4FA 1DTWA 1XWFA 2YBEA 5HUHA 4OJTA 4N6OA 1SIWA 4U3JA 4OHOA 2WU0A 4N3AA 1M6WA 4IVRA 1Q44A 2A78A 4D8VA 4ZJZA 5CJPA 1PHPA 2CL6X 3NFRA 2QUKA 1ULZA 4O4LB 1HEIA 2ZRIA 1P2GA 5T4EA 2UZ4A 1U4SA 2QZ4A 3AEQA 1Q1AA 4UMEA 2Z8YA 3ENWA 3SKVA 2QHXA 2VYND 4BNDB 4WPGA 4CIVA 5KYYA 3ABOB 4DLTA 1JDUA 1A27A 3PXBA 1Q7CA 3DKRA 1FPMA 1U2DA 3OLVA 4HXEB 1IZ7A 5FPYA 5B12A 1G7RA 2PRZA 3H5OA 5J1TB 4XWOA 3AERB 5D3ZA 5J3JA 1XX6A 1CLUA 2OK8A 3C41J 3T1NA 3IPXA 1KTVA 2WD9A 4WKCA 3V2UA 4MPTA 5CLHA 4FHDA 4QYWA 3RJZA 1QKIA 1TM3E 5ALYA 2HF7A 5DT9A 1IM2A 4DWOA 1L5NA 1PS8A 4MR7B 1BVUA 1U81A 4FJ2A 1BXZA 4O4JB 4OQPA 2QN7A 3TINA 4R9RA 1UJ6A 1M1ZA 1BAPA 4IDBA 2YVUA 2CLKB 3HWWA 1SNYA 3P9KA 3L0DA 4HTFB 2KW5A 1ODSA 2FG6C 4WZZA 5T3YA 3WIEA 2EQAA 2MJLA 2GK6A 4UM9B 4L4UA 4AWAA 4F4UA 1I2AA 3SDBA 2A4KA 3ZZ0A 2JAPA 3VPFA 3PNPA 1IRIA 1ZGCA 5DNVA 1L3BA 5KNDH 5KYXB 2R1TB 1IM8A 1C4KA 4JFAA 3ONWA 5KYUA 3LIIA 1KNXA 3HB9A 1KXZA 1G2QA 1V3TA 1ZOOA 1OILA 4KRXA 3AINA 3B48A 1Z6ZA 3LBNA 4PLVA 5AW0A 3L04A 4ZANA 2BGNA 4D44A 4DXDA 4C5AA 1F0YA 2YQ5A 1LLQA 5JJLA 2H7XA 2ZSEA 3A9WA 3CE6A 2V8OA 4ZOAA 1D09A 4BX0A 1JFVA 4CF6A 2F3TA 3DDCA 3MN1A 4OCZA 2PVCA 1ZD9A 2X23A 4LQDA 1NVUQ 1GVNB 1RE0A 2CDCA 4QYIB 3B3FA 1SG0A 2IUTA 2HOQA 4EZEA 5HS4A 3UB4A 3F8WA 1YHZA 4IKEA 4UE6A 3UT5A 2NV6A 3BGDA 3GDOA 2C2OA 1VHDA 4EB8A 2Q0XA 1Y1RA 1ZJYA 2IZ0A 3JSAA 1XTJA 3SC6A 3R9WA 4ALIA 3W5DA 3LT5A 1EU1A 1BXRB 3FPCA 3KB6A 4KAFA 5HCNA 3SXUA 2C00A 4MKHA 4LNHA 5HWSA 1ZEJA 3U7QB 1F38A 5GOTA 2IW1A 2CF6A 2PGIA 3CVOA 3HCAA 4OJMX 3HYLA 4QDTA 4YAWA 3ASZA 2VH2A 3KLPX 5EZ6B 2IV7A 4C0SA 4IOJA 3K2QA 3MB5A 1P1RA 1M2FA 4RJLA 4TL8A 5KJ6A 3IIIA 2DFVA 3O92A 2C29D 3CISA 4K03A 4LXUA 5AVKA 3RT9A 1ZUNA 5K3FB 4GLLA 3ZQ4A 4E6PA 5A4KA 4TVOA 2DHQA 3U7GA 4KWHA 4AULA 3F7MA 2Z08A 3W5CA 3OE4A 4PLYA 5CLGA 1F8FA 1VPWA 1BJKA 1GUBA 4CNBA 5G1OA 2XXAA 4MEBA 4PC2A 4ARIA 4M1ZA 3IQWA 4AWXA 3M2TA 1B2LA 4RK4A 2GZSA 1X0XA 4HLUA 5LZ5A 4AURA 2C7OA 3K3PA 2IYAA 4DOMA 1DELA 2F7SA 2MU1A 3I5UA 1W4BA 2DFTA 5KNBD 1J7KA 2OZLB 2C2ZA 3EGVA 3FR8A 1UBJS 2QYOA 4MYUA 3AR7A 4ON9A 1RCTE 1O96A 1Z5PA 2XE4A 1XTTA 2FW7A 1YRHA 4RAQA 2Y1OA 5KQMA 1KEZA 1UM8A 1TX4B 1ZH0A 4Y2XA 3U4HA 2FOLA 2PT7A 2X3FA 1M0TA 1PYOA 3B6MA 3UAVA 5CDGA 2PAFA 3EQ2A 4B83A 3I1YA 3EYWA 1DIAA 5C46F 2P7IA 4FIZA 2J7KA 3ASUA 5DGIA 2FP4A 2FZLA 3KZOA 4RKWA 5SICE 1RM4A 4PQEA 2XMDA 3TQCA 3WLQA 4KZPA 1Y8RB 1Y8RA 1PK7A 2GESA 2GKOA 1XHFA 2C4KA 4I5EA 4PICA 1MNAA 5JFOA 1LA2A 1YQUA 4RPGA 3TB6A 2HMSA 2FP4B 3Q6NA 3QFSA 3BULA 1ONBA 1LGYA 2B9VA 4UCXA 4UC0A 5CA1A 5CB4F 2IHKA 4OXXA 1QWOA 1U31A 4QRDA 4OLAA 2E21A 4OUKX 5KHLB 2P91A 1L1RA 3DWFA 4RIGA 3GLIB 4YJGA 1NHWA 1SU8A 3PIRA 4NU0A 2JC3A 2A9VA 4U63A 1N2ZA 1R9GA 2OZLA 3MWLA 2O3RA 2X4LA 3BVPA 2YJGA 3QKSA 1G8GA 1QONA 3JZAA 3R23A 2WKWA 3AESB 3ZX4A 3PXEA 1Z68A 4ZHSA 5KVAA 4X61A 2XXAB 2DFKB 1RPTA 1X92A 4REQB 5EP1A 1Y37A 4N82A 4F9FA 3ROQA 3IQEA 3KS9A 3N05A 4MR9A 1WB9A 4B8YA 2PGJA 3O1IC 2RCYA 4Y0AA 4BP3A 1P2DA 4B3DA 4JU8A 4EHBA 5K3BA 1N0WA 2H4YA 2Q2WA 1M1YE 4ZALA 2A0YA 5CGQB 2LNDA 3TI7A 4YBRA 4RYLA 2K87A 2Z2XA 3EY9A 3M4XA 4EENA 1Q20A 4FCWA 2IE8A 3K9BA 1WP4A 4B4UA 1XDSA 2PBZA 1F12A 4MXDA 1DIHA 4JYBA 3WDKA 2QVLA 3N70A 3FB1A 3OWHA 3PHHA 4LTMA 2PGAA 4LQ4A 5KTOA 1D04A 5MFZA 4ALNA 4CL0A 2FK8A 3MPUA 2CXSA 5DNWA 5L8VA 1MV5A 5D5HA 1GQSA 4DZZA 3U6BA 4K6FA 3BDAA 2C7BA 1YS9A 4WL0A 4RYDA 2ZBRA 1C1DA 2P2GA 2ZIUB 3TS1A 3QOYA 4GD3Q 3HBNA 3TXXA 4NRDA 1MXHA 5AJTA 3STUA 5CCEA 4FLFA 5G0WA 2AEJA 3T7JA 3Q8MA 4KO8A 1U0GA 3T1TA 3H42B 2G1AA 4Z7OB 4IIVA 3Q7EA 1SD5A 1GGKA 2KI5A 2I8AA 4HWRA 1YIAA 2PMKA 2QRMA 1U8ZA 3AJ8A 4TZKA 5DULA 5EJ6A 5HVNA 2XT0A 2YUTA 2WV7A 3QZUA 4OHZA 4R5MA 4AQYB 4RD6A 3K9FC 4P54A 4EJ2A 3AHJA 5EXTA 3VC2A 3OA2A 4ZAVA 2QE7D 3WLAA 3N75A 1XMSA 3RC8A 4Y2PA 4HAVA 1LRKA 2XUOA 1ULSA 5B58C 3JQBC 4PG5A 1G2PA 2O20A 1QQ5A 1T4GA 1GCUA 4M49A 2GYYA 2Z4RA 4KXVA 1WTAA 5HF6A 5H80A 4DR4B 3DDOA 3V7FA 1L7VC 4H7JA 2O05A 1P31A 3CJQA 2PR7A 3GJ3A 4OYHA 1W0CA 5KYXA 4RM3A 3I76A 1VSUA 3I1JA 4C43A 1FFYA 1RPJA 1IN7A 1MU0A 2QRVB 1JH9A 1WM1A 3O1HB 2GK7A 3QMMA 3FE2A 5L7WA 3AO0B 5G2OA 1R16A 3DLPX 2J07A 5EHGA 1UADA 1LKZA 2XVZA 2Z6QA 1E79A 4RWZA 4RTJA 1Q84A 5ALTA 3X1WA 2ONZA 1BEEA 1SH7A 3TIVA 2JGEA 3UKDA 5MN6A 3DP9A 5K3CA 1G5QA 3P9RA 4B3HA 1JQKA 2ZWOA 4IX9A 3TKYA 3RSFA 3UW3A 1SVUA 3LG2A 4NYJQ 1GDDA 1TVMA 3T94A 2IC5A 2FHPA 3E5MA 5H83A 3UEOA 1WDLA 2QR3A 1B6GA 2VJYA 2C5GA 2AJ8A 4TPKA 5IJAA 2NVOA 2FF5A 4BEJA 2VDQB 5DLYA 4LZWA 2ZTSA 4A36A 4CF5A 3DLIA 3COZA 4MEJA 1XALA 3ZDRA 2F1RA 2M9MA 3ESXA 2IS2A 1IQ0A 1PGNA 1ULHA 1X77A 1Z22A 3N3AC 2VXYA 5A5EA 3EZ9A 4MVJD 1LDMA 4GZ3A 1QPZA 5GIPE 3IR7A 3A2LA 2EFYA 1P4HA 2RI0A 4OI2A 4BDSA 3WI7A 1OWNA 3MMPA 3GBVA 2BSAA 3AKDA 3E7FA 4QO7A 3TQOA 5I7RA 4N0MA 3FTFA 5FNZA 2CKDA 3E9YA 1U8FO 4YCCA 4Q12A 4QM7A 1DT3A 1JJ7A 2D2XA 2EFEB 4NK4A 3T9DA 1Z83A 4GEKA 5ALJA 4BTLA 2CBGA 2ZIGA 4ER3A 1E0SA 3M4NA 2H1SA 4RDXA 5KAMA 2C2YA 1V2HE 2VJNA 1TADA 1XLUA 1QNFA 4BLRA 3II6X 1Y7PA 4EMTA 3K5PA 2AOUB 3ITEA 1RTKA 2CMDA 1M74A 3A04A 4M55A 3UV6A 3HVJA 3QPBA 4H6WA 3NBKA 3T1QA 4AKHA 3GZ4A 1XZKA 3NB0A 5LA6F 3MRTA 4X1YB 4G63A 4IV5A 1QHIA 4F1JA 2QOEA 2HHCA 1FB5A 2E6UX 3MD9A 3P97A 3D4OA 2HRCA 3CG0A 3K1AA 2IH2A 3BMQB 5CPFA 1BG6A 1KVSA 2ECOA 1P18A 1RI2A 3EGXB 4OHWA 1JEDA 4WOCA 4UAVA 4XCXA 3WGYA 1E1DA 3B82A 4O2RA 1ZLYA 4ZV9A 4CU2A 3B13B 1RQNA 4BO3A 3SVLA 2ZR8A 3PG5A 5THQA 3OSZA 3C5EA 4RUKA 2VZ9A 2XCRB 2JBHA 2VP2A 1S3FA 5I7AA 1JSCA 5F35A 1QFZA 3KE9A 1KIFA 1CY6A 3TWOA 4CQLA 1OFTA 1UOPA 2AL7A 2GT1A 4GKKB 3V2GA 3L0OA 3IBCA 3IP3A 4JBWA 3T9FA 5E1MA 1XYGA 2IODA 1RAHA 4TMYA 1WHSA 3IRUA 1L5KA 1I30A 2VRWA 4HNTA 1EGHA 1ADCA 3N0RA 2IPLA 5EMJA 1V5GA 2P0EA 4G0QA 3PC3A 3L6DA 1A8HA 1RP7A 2TECE 3IBYA 2X58A 3MJRA 3N86A 4HSEA 4LHXA 2CCKA 5L7YA 3W8FA 1CQZA 2ZSFA 4ESVA 1E6UA 2BM0A 2WVGA 2AQ8A 3UJ9A 4CLRB 1PT6A 4GU5A 2YZMA 1R27A 4TUYA 4H1VA 1K27A 5CG2A 3KQNA 1T4CA 1SA0B 1VL2A 3K0SA 1NX6A 1R10A 1AKMA 1C7IA 1NR7A 2XAUA 2QY9A 3ETNA 4IJKA 4JCCA 4UBKA 5BMOA 1N0IA 4OOFA 5PNTA 4CJXA 3ECAA 3F71A 1CRPA 4WW0A 4ARCA 1ES9A 1GPJA 1T34A 2CFRA 2J9XB 3KL4A 2ASEA 4FNAA 4RWEA 3MG9A 4E2YA 1NXXA 2Q1XA 2OBBA 5DCYA 3RKUA 2I4OA 3DCJA 1VJTA 5FUMA 1TJ4A 1U3UA 2GSDA 2F43A 1NX9A 1BN6A 2VA9A 4GMFA 4XUCA 1UPTA 1OGJA 3MMSA 4HDMB 1VL1A 3FR7A 4PW0A 4M38A 1GPAA 3A1CA 2XNCA 1F2TA 4NH0A 5J4KA 3I1FA 2IHTA 2ATEA 4RSHA 4UUNA 1JDZA 2GD2A 2C3OA 2D3TA 1EEHA 1HWYA 4G4JA 5AK5A 3RLIA 4BMYA 2G1JA 3V4OA 4OU4A 3ZHZA 5BORA 2JLUA 5TDHA 2W8BA 3LYAA 1RZVA 4CEJA 2PWBA 3L7BA 4HRXA 4M1SA 2BJVA 1L3CA 3B7PA 1ZDMA 2A1UA 3JQCA 2ZIEA 3DE3X 3DM9B 3OIGA 4L08A 4XD7D 3R5TA 1ORIA 3NBMA 2QM8A 4PC1A 1UKEA 4HX2A 4Z4CA 1B93A 1JIIA 4PO1A 5K0TA 3V1UA 4FM9A 4M1QA 3INTA 4OX9Y 1KI9A 2CE2X 4QDUA 1K63A 4QGSA 3WL7A 1AKRA 5AM5A 3HG7A 1AQNA 1E62A 4Y0NA 5SV2A 4JUFA 3FVRA 4EYEA 1U6KA 2J6CA 3LH5A 2QUZA 4G65A 1VE9A 4PPQA 1EVEA 1K8QA 1QDUA 3WYCA 3Q11A 4II7A 1E0DA 3F6SA 1BCSB 4BVJA 1M2JA 2FKNA 2AA3A 4QNRA 3CEPB 1A50B 3T9AA 4BYMA 4MVJP 1D1TA 1VKZA 2E1PA 3F74A 2VF8A 4N7MA 1GUFA 4FE7A 3WGOA 4C3ZA 1X9GA 4EWLA 5M04A 4RVUA 4U8GA 4MQFA 3MCWA 1JSZA 5JZVA 1GARA 2ZYGA 2LRHA 5B2FA 2QL5A 3FBGA 2E9SA 4JDPA 4L8WB 1ATZA 1I7NA 2CFSA 5GZ3A 1R4NA 2YV3A 3P45A 4UNPA 4B3BA 1P2SA 3KYDA 2E4UA 3LIPA 1FLVA 4HX5A 4Z1MD 4YMSA 2YXPX 4DF3A 3V6MA 2WSSA 3I73A 1FTSA 3N2ZB 1PGOA 4RS3A 1O89A 2HI0A 1VLJA 1A4XA 3KUCA 4OQFA 3B38A 4NAUA 5GAJA 1Q14A 2QW8A 3IQHX 1N9GB 4LJ6A 4UATA 3V1KA 1DIGA 1F5NA 2IZ6A 2ZRBA 1CJKC 1O54A 1X7XB 4QFDA 1WZNA 4TZTA 4A10A 1TQDA 4RTOA 3WLFA 1HDIA 2FCRA 3VBEA 3CUKA 2O8EB 5EP2A 3ZWWA 1M73E 3NAQA 2QV7A 3RHSA 4DHEA 4BN5A 4U2BA 1QUFA 4CMIA 1T1RA 4KHPB 3Q0IA 4I66A 1DMSA 4BIIA 3G2MA 3QY0A 5KVCA 1RKXA 3GT4A 4GLJA 3JQ8B 1ESEA 5HUQA 1IN6A 3EH2A 5P8WA 1AKUA 2ZTMA 3OD1A 3S4YA 3HLYA 5ELMA 4QOIA 4AX4A 1MRSA 1X1EA 1E4YA 2E89A 1YASA 1MT3A 5YASA 4XAQA 4KE8A 4YV0A 5JZ9A 4ITRC 4LSZA 4J75A 4IIJF 3E81A 4KRGA 4BNZA 1JHRA 5BMVA 2EIHA 5I4IA 1X86B 3QW4B 3WRVA 1KVUA 3BWXA 4BO0A 4H15A 4MLDA 4PX9A 4CCYA 1H1LB 1GG8A 1AX9A 5HCUA 3UANA 1H6BA 1NF2A 1YC2A 3I9KA 5EEHA 2FPGB 3A9RA 1R0WA 1KI7A 4G8CA 5EE9A 1UINA 2D1SA 3ANYB 1SCQA 1W46A 4MRVA 4HDAA 5F73A 3VBCA 2WSSD 1MOPA 1TEHA 1MIOA 2DBYA 1KI6A 1I6MA 3KIPA 4R41A 4WMLA 2CMKA 4NICA 3W90A 1ZO8A 1YJ8A 1TUGA 2NAFA 3NBAA 2IEBA 3BUSA 4QECA 4Y6OA 5BNWA 4GKBA 4U7HA 1P6UA 5G3ZA 4E2ZA 1YE8A 2BBOA 1ONNA 3BDVA 1YIDA 4WIAA 5D87A 1O95D 1M54A 2P6UA 4ND7A 4UEQA 4WERA 4R7GA 5TGTA 2CY0A 5L4NA 1SCJA 1WXQA 2GM3A 2QMUA 3ZLUA 4M0DA 3GDGA 4YQZA 1Z0KA 5B7GA 1RIIA 1NZFA 1RZRA 1IL0A 3JAKA 4ZAXA 5C53B 2FJPA 2OKGA 1QU2A 2FLKA 3U4AA 3GCXA 3J81k 4EHDA 1RWMA 2NQ8A 2JAUA 3WGUA 3EUWA 3S1AB 4LZZA 2BR3A 2HO5A 4XI9A 1V26A 5IT5A 5JNSA 2BF7A 1W2HA 1H94A 4DJTA 4QE3A 2JF0A 1K6IA 4YJDA 2O7QA 3EXEB 2UXCB 2YOGA 1TYZA 3H9QA 3CMCO 4RD0A 5FUQA 1VHJA 2V1UA 2XX3A 4OLBA 1CK4A 4EG8A 1L6IA 3R41A 3RTBA 3ETGA 1J33A 1QGUA 1V2GA 1YV9A 3OCYA 2PZEA 4IV8A 2PFSA 3DZIA 2O07A 3QBTA 1EP9A 4DCUA 1YRAA 2DBVO 1DQRA 1GT91 4CM3A 2QTTA 2X86A 1DIBA 4JL8A 2JGDB 3QGMA 1KK0A 4JR0A 2BMJA 3UXMA 1VLVA 3U4GA 3KSMA 1JJVA 1GXSB 4TV8B 3O8QB 2PGLA 3NI2A 3G79A 5EWJB 1RWBA 3PPWA 4RFLA 4MW5A 1V43A 4D4MA 5ICGA 3TMKA 2Y0EA 1ZK3A 2ERCA 3CLSD 2JAHA 3RC3A 1MFPA 1IUKA 3PHIA 3F96A 3NVAA 4OPMA 4ND8A 4EECA 2QVCA 4HK4A 3QFRA 4GAEA 4R2WA 5IM4A 4KI0A 1XCMA 4NPHA 3W8DA 5GJVC 3FWNA 4DEXA 3CSSA 3U26A 3BD7A 2GA8A 4L2IA 2HLDA 4YPFA 1YL5A 2Q7OE 1CS0B 3G5TA 3Q85A 4F7DA 2OGUA 3NHZA 1B76A 3R6WA 1O0BA 1XE3A 2FWNA 3ZZ1A 5FOWA 3WB0A 4W9NA 1PT7A 4NZPA 3ZHCA 2HGZA 2GM5A 3HU5A 1S7GA 1Z45A 5FOVA 2JI9A 2WFZA 3MILA 2J9RA 4GICA 4B43A 2IKQA 3TCNA 2PZ8A 1F17A 2OHGA 4V2IA 2QYSA 3FIUA 2JH8A 2AKEA 1G4UR 1MB2A 2G80A 4ZA2A 5HZKA 1EUCB 1KI3A 3GUCA 3T35A 5K6RA 1Y9JA 4ZYWA 2QD2A 4DLSA 1RVV1 2ANBA 5ALQA 3WNCA 2FMXA 1UXGA 3F4LA 1WX1A 3HBAA 4CKEA 2BFOA 3K5HA 1L5WA 1X87A 2W6ZA 1J70A 2PLNA 1K2WA 2ZSKA 2O1WA 3TQQA 3QE0A 3ED5A 1P39A 1YI0A 3W3AD 1BGXT 2P5UA 4TMVA 1TLFA 1ZQ9A 5CLLA 4OXRA 3IMCA 1MVLA 2GUWA 3NBXX 6Q21A 2X5NA 1YS4A 1RTTA 2AR7A 1BS2A 1ZUIA 3QEMA 4GRAA 4BNMA 5C7IO 3AVUA 2WWIA 2BC9A 3SMVA 1QIGA 4P92A 4AJPA 2DJ5A 2B1IA 2GAFA 1FBNA 2AD1A 4L75A 3R77A 1A7JA 2I2BA 1XZEA 5FAKA 2ADFA 2J41A 4QHYA 3RFXA 3UC9A 3H04A 3NJ8A 4BLOA 5DIZA 2GLXA 3K4QA 1SVWA 3L92A 3CGGA 2AXQA 2ON6A 2QAJA 4RLQA 4BO5A 3TPFA 3ZTYA 2EZ9A 5JNUA 2BH2A 1M75A 1N3BA 1WHTB 4M7PA 3RTEA 1QC5B 5BV2P 3FOFC 2IPXA 3OUTA 5TS3A 1YTLA 3QLVC 1E7SA 1QH1B 5E0OA 3BXHA 4L5BA 3JASB 2BZGA 4X7BA 2FV8A 2HW8A 1KMQA 3CKKA 1E2IA 1LPSA 2W6OA 4J07A 1Z2PX 4YWHA 2OG2A 4IGIA 2ZWAA 4Y98A 2X0JA 5REQB 2CJXA 3H16A 3BAFA 3KSRA 3B89A 3N07A 3U13A 3THWA 1F7UA 3JALA 1QGZA 1YNSA 3GJZA 3W6UA 2BHNA 2R4QA 1OPRA 3H4MA 5FBZA 3WWPA 2CLEB 2IIPA 3QOXA 4OHUA 1EK1A 2C98A 2W5UA 5EWLB 3GAAA 2G3YA 3AF3A 1IY0A 2VEDA 3K7EA 2D62A 4BU1A 2B4KA 3GRPA 2I3BA 2VHJA 3V4ZA 4EUFA 2IBSA 1Z0AA 3CUTA 1IHPA 1NMQA 1N7IA 1X1SA 3L7JA 2P2YA 3Q10A 4BO9A 1AK9A 2QIPA 5GGYA 4B4DA 4B2IA 1KQGA 2OWDA 4Q03A 4YX9A 4BNIA 1DKRA 1PNTA 2P9ZA 3DVQX 3WAGA 3EZNA 4KW7A 4DMUB 3WK4A 4DEYA 3S28A 2P67A 2PRSA 4GNRA 4HDNA 5A7GA 5CDTA 1Y48E 2HWYA 3A2MA 3O31A 2EDCA 3J7AC 4U6SA 4R3NA 3IAM6 3BMXA 2ZSHA 5AXCA 4JUCA 4JX9A 1F20A 1S1CA 1R0XA 1T3ZA 2GM9A 2VK1A 1L7NA 2WF7A 1JT9A 1N5MA 1S01A 3E3MA 4M22A 4BNWA 4PSDA 3ZBTA 5JC8A 3ADPA 1KMMA 1QYWA 4BGEA 2WINI 3DNMA 4RHTA 2E18A 3OIFA 4LBYA 4A2QA 4DMHA 2BF4A 3GIWA 3OQVA 4GVLA 4N41A 3T99A 1UJNA 4O2AB 3DMDA 5F1YA 5E4JA 4Z5XA 2HYIC 4RKRA 3JW8A 1EQ2A 2GXQA 2Y6VA 3L4BA 1I01A 1EFTA 1HBJA 1WW2A 2ZRKA 3MTQA 2EATA 2Q4OA 3O26A 1W581 3I09A 3JZFA 4GH5A 4M53A 4PVCA 2GO1A 3NDPA 1FNNA 2GPNA 3VOAA 3F6RA 4XVHA 4RQTA 4UUQA 2BMEA 4DYVA 2IS4A 1W9MA 4LVCA 2QN8A 1HMYA 1N75A 1QQTA 4LYFA 4AY4A 2X9NA 5ICEA 4BMZA 3ZWOA 1VDMA 3G9ZA 1ARZA 1X1BA 4GXNA 5BNIA 5BSVA 1NVMB 2I4NA 1EESA 1HLPA 2HTFA 2X7JA 3G85A 3LP6A 3V48A 1XV5A 3AQIA 1W5TA 3L8CA 4PY2A 3SM3A 2RH4A 3ZDQA 3E8XA 3ADKA 1H2AS 1QG6A 3MCVA 3MCUA 2D0PB 2BGUA 3QPCA 4IWYA 4R2JA 4DMKA 2HHHB 1H05A 1P8AA 3P0EA 4UUBA 4UDOA 1V1RA 1SURA 2C3YA 3E84A 4ZI3A 2PXAA 3DFIA 4D4HA 4B3SB 2WWHA 3RSZA 1NMYA 2FPSA 4PZUA 4YJFA 3QTBA 1WB5A 3WLSA 5KQPA 3BCSA 1QTQA 5JRZA 2CLFB 3EMDA 2JIZD 4FEAA 1KPIA 3GFOA 3GFQA 2ZXUA 1A69A 1LB1B 4TTJA 1ZRNA 3NHRA 1N1DA 2W2QA 4AYWA 2OCGA 1GL3A 3EQZA 4KYIB 1H3FA 1UJ4A 4YVFA 1DIOB 5GONF 1QV9A 1W1WA 2VJBA 3CZAA 4AMZA 3CZMA 4IDAA 4UCQA 4CMJA 2YWBA 3THYB 1V8ZA 1FNBA 2XB4A 1L5QA 2BMVA 1WRBA 2QI9C 3L0ZA 2NXEA 5EJ2A 1SCUA 2GN6A 3QVGB 3GP3A 4NOKA 1LVGA 3RRXA 1XRMA 2GZDA 2IXBA 2AFIB 1XU9A 3EGCA 3GQVA 3QBJA 1DMRA 1V25A 3GFSA 2X41A 3VSDA 4YPOA 2BPOA 3JAMA 2IP4A 3HKCB 3F5MA 5K3OA 2ZRAA 3CW9A 1G8AA 3WBFA 1UC9A 2ILVA 3BTVA 3CRW1 3C6MA 4OSPA 4MIKA 1PT8A 2V96A 3LBAA 4XFKA 3ZGZA 1M2VA 3AEUB 1X3LA 3ANLA 3QEAZ 1J1UA 5CDHA 5IKEA 2BYTA 2JS7A 2YIDA 2JIDA 3ESDA 3DAYA 4GMXA 1W96A 4QUDA 3PUZA 5JAIA 3LDGA 1DWOA 3IBGA 3DP7A 1NDUA 2NN3C 3I2YX 3KO8A 1NWHA 1CY0A 1S9HA 4HYYA 3P71T 5C7LO 4UBMA 5IWCA 2FSIA 2CVFA 2C4HA 4EL5A 3FVVA 4PNHA 1K4MA 2AOVA 4EHLA 1OAOC 4D9BA 3PZRA 3CB2A 2Z9CA 5B4VA 1I3NA 4OIFA 3C85A 5EQJB 3WLEA 2HNKA 1CUHA 2G0NA 2P1DA 4F45A 1AQUA 3RS9A 1II8A 4KOAA 1BH6A 2JJ1D 5NULA 4CQMD 5H4GA 2CZCA 1KU6A 5C1IA 4E5MA 2VG8A 2YN4A 3VR4A 1QTNA 1HNNA 1U04A 3IURA 3EMBA 2D0IA 5LZ9A 2GHIA 4FGWA 5HCIA 3U44A 5BSTA 4KQ1A 1P4RA 2D0OB 4TTAA 1USWA 4WCVA 5I9BA 5JU6A 2NU7B 1QWSA 3R5KA <