5DJ5A

Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
GAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Destabilization of strigolactone receptor DWARF14 by binding of ligand and E3-ligase signaling effector DWARF3.
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 90
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dj5A00
4UPDA 3V1MA 1VXOA 1XRLA 3LCRA 1HQDA 5DNWA 3H2JA 2QTBA 4O08A 1QIKA 3ICWA 1CV2A 1GXSA 1SCIA 4A16A 4C88A 3F9CA 1QTIA 4X6UA 3BWXA 1JU4A 1XZGA 4HZGA 1QIDA 3I1IA 3WWCA 1R88A 1EK2A 2WTMA 1SOMA 2EEPA 3DNMA 1IUPA 4DGQA 4HRYA 2JGEA 3STWA 3STTA 4KR0A 5YASA 5A7GA 2QR5A 1G4HA 3GUUA 4BAGA 2Z5GA 3DL4A 3G0DA 4C4YA 1A7UA 3KDAA 3G0IA 5EGNA 3FOBA 1XZLA 5JAOA 3PUHA 4UBJA 3R3ZA 4QWMA 3C8DA 5BWCA 1X2EA 5AIBA 2O7VA 2WFLA 2ACEA 1HPLA 5AKEA 3WYDA 2CBGA 5HK9A 1LPBB 2QXTA 2UZ0A 4K2AA 4GDMA 2WIFA 5LZ9A 4C01A 1WHSA 3DCNA 1X2BA 4P92A 3GZJA 1G42A 2BUCA 3H17A 3V1KA 2ROQA 2VAVA 4AO8A 4E15A 3M81A 3EQ7A 1FFAA 2EDCA 4X85A 4I3FA 1L7AA 2HA0A 4AZ0A 4C4XA 5AI0A 3WK6A 5AKYA 3AIOA 3W06A 5I8PA 4MQMA 4UHBA 1CUIA 3GELA 3F8SA 2W6CX 5AH0A 4FMPA 3ED1A 3W04A 4BRZA 2OG1A 4P93A 1C7JA 4LXIA 3V1LA 2C58A 3JYHA 1LPSA 5KBYA 2PBLA 4UBNA 4DSZA 4WDRA 4OUKX 3FLAA 3OTQA 5BOVA 4ROTA 3O95A 5CH3A 4C6HA 2DR0A 4J0GA 4FLMA 1WHTA 2WFMA 4FBMA 1CUUA 3IBTA 3B12A 1ODSA 3RLIA 3N0TA 1W75A 2P8SA 4QA9A 1VA4A 3F67A 1W4LA 1AC5A 4FNGA 1CUZA 1QO7A 5JZSA 5ALKA 2JIDA 2WHPB 2JGKA 4QE3A 4AMYA 2WHQA 2XMBA 2JGMA 3MVEA 2WLSA 3E3AA 3V1NA 3IIIA 4LIPD 2HU7A 2ZYHA 5FLKA 1TCCA 3MGAA 1Y37A 4QEKA 1ZD5A 5ALLA 4KE8A 3ZPXA 1UKBA 4OB7A 1XRMA 5AKIA 2AXEA 2HA4A 4Y2SA 5EHZA 4OD0A 1BROA 1VE7A 2JGFA 5EFZA 4BRSA 2WTNA 2CUTA 3WL8A 2HA6A 2FJ0A 4FOLA 5IKXA 3A2NA 4W1RA 2GYWA 4WCVA 5AKHA 3QVMA 4BYMA 5ALYA 1DWPA 2XMZA 4IH9A 1J1IA 5ALUA 5IVHA 1JFRA 3ILSA 1K8QA 1AMNA 5E2IA 4I19A 2DHEA 1E3QA 4BVLA 3D5EA 4ZRDA 1MX1A 4UFNA 5C7YA 1AX9A 5AKXA 2YXPX 5JARA 1DINA 2OPHA 4BDSA 5AI9A 2DSNA 2O2IA 1XLVA 1XRNA 3AINA 2XUIA 1H23A 3WMRA 5CMLA 1ZJ4A 3PICA 2OCLA 4MYDA 3LP5A 4B9AA 5A6VA 1XZMA 5ALMA 4QDUA 2FJPA 2HFJA 4DNOA 5CT6A 2XMCA 5K3BA 4H7FA 4HAIA 5ALNA 4RE5A 1Z68A 2QUBA 1VKHA 3DD5A 3R3VA 4H7EA 4PSCA 2CJPA 4QDXA 1QTRA 2OCKA 2XMDA 1H2XA 4W1SA 2WU3A 3I2IA 3WA7A 1UK7A 3R40A 1R1DA 3G7NA 1Q0ZA 4JUIA 1CUWA 1VXRA 3FBWA 5AOAA 3VISA 1XQVA 4UBKA 4Q34A 5CXUA 3D0KA 4BCBA 3WIBA 3V9AA 3FVRA 3PI6A 2HIHA 2AJ8A 4BZZA 1QIMA 1JU3A 5ALOA 4BP8A 4EBBA 4GW3A 1A8SA 3SX4A 1YB6A 4H35A 5JALA 1EA5A 2BKLA 4BC1A 4BDTA 4FLFA 4KRXA 4BATA 5CXXA 2YASA 2ZYIA 4K6KA 4AMZA 4FLEA 2Z3ZA 4OB6A 1FSSA 2OGZA 4IQ4A 3DDUA 3ESCA 4FFVA 3YASA 4F21A 2XUOA 5AM0A 4HXFB 4W63A 4G8BA 3D4LA 1E66A 2ES4A 2PSJA 6YASA 2OAGA 1MPXA 4EUSA 1QJ4A 3QPAA 1CVLA 3S8YA 4DLNA 5JAHA 3QMMA 1MAHA 4MJ3A 1ZIXA 3TEJA 3I6ZA 1Q84A 4B84A 1EVQA 1JJBA 3DS8A 2VJBA 2ZSIA 2DFPA 5ISMA 4FFWA 1ZI9A 3JW8A 4X71A 2CEKA 3IUQA 2YH2A 1GKLA 1JJFA 4AN1A 1CPYA 3VJLA 1P0MA 5T4BA 1GGVA 1EINA 3EIOA 4Y2VA 3BDVA 1UT6A 1QONA 4Z49A 1GZ7A 1BEZA 3BL8A 3NOXA 3HEAA 4V2IA 1F0NA 3WK5A 1R9MA 1QIJA 4ZGBA 1TCBA 1CR6A 2XQFA 2QT9A 3HI4A 3PUIA 4QLAA 4F0JA 1CUCA 1MX5A 3M3DA 2JF0A 3BXPA 1UZAA 1YSCA 2X76A 1P0IA 5A71A 4RE6A 3G9TA 1GPLA 1DU4A 1ACLA 1LPMA 3K6KA 4H7HA 4EB0A 1C7IA 4TVKA 2WM2A 5ALDA 5ALQA 2X8BA 4IHAA 1H22A 3A6ZA 3G9UA 1B6GA 1ZI8A 2PX6A 5AI5A 5AM4A 3D2BA 4UHFA 2ZSHA 1CUDA 1IUOA 5KREA 1W6RA 4MEAA 4XIIA 3LIPA 3I2GA 3R41A 2OQVA 1QIEA 4PQEA 4N8DA 1CEXA 3IUJA 3FVTA 2ACKA 5C8XA 3BF8A 4KE9A 4J0KA 3C6YA 3K2IA 1WPXA 2WUGA 2WFZA 5J3JA 4M0EA 2ZVDA 4DNQA 2PPLA 1G5FA 4L9AA 5AJHA 1O6GA 1ZIYA 2GBIA 1C4XA 4EA6A 1SCQA 2QS9A 3HXKA 2WU4A 4QLOA 3ANTA 4INZA 1KU6A 4P9NA 1OILA 1YB7A 5AI4A 1CUHA 1T4MA 3EQ9A 4N5HX 4U2DA 3IB3A 3QZUA 4DTCA 1SC9A 2XT0A 4H7IA 4IO0A 4ARBA 4KJXA 4W1QA 2XUAA 3FNBA 4CG3A 3ANSA 5AI8A 4KYVA 5DLPA 2OGTA 3C6ZA 5FOQA 1PJAA 3O4IA 5ALZA 1CUGA 2PSFA 3FSGD 5JYCA 2GBGA 4Q05A 3VJMA 4H18A 3W9BA 4U2FA 5ALRA 1G66A 4Y7DA 5ALWA 2DHDA 4HTAA 3TRDA 5JD5A 3KWJA 3M82A 2R8BA 5F4ZA 3ZLUA 4AXBA 5EIAA 4IH1A 3HJUA 2BJHA 3MUOA 1UK8A 5HF6A 2G4LA 2JBWA 1EB8A 1AKNA 1WM1A 3ESBA 3R3XA 3A70A 3H1BA 5A7HA 2RIPA 1L7QA 4JEIA 3D59A 4K6HA 2O2GA 3CXUA 4N5IX 1TK3A 1W1IA 5AO9A 1BE0A 3WWOA 3IUNA 2VF2A 2WIKA 3D2CA 4MWTA 3SK0A 2VA9A 3WWEA 4F60A 1WB5A 5LZ4A 2QVBA 1CUFA 1USWA 2B20A 5A62A 2XUQA 1QIIA 5LZ2A 3C6BA 3H2GA 5AM5A 2VSQA 2WG1A 3H2IA 3DJYA 1QIGA 4K5QA 2JGIA 3WKCA 4OCZA 5AKKA 1WCYA 4A5SA 1K5PA 5CH8A 4CCWA 1THTA 5ALGA 4MWSA 4X95A 2VQ6A 2QZPA 1UOQA 2V96A 3QPDA 1H2ZA 2K2QB 4X6YA 3LLCA 3QH4A 1XZJA 4XX1A 4DMCA 1DX6A 3C45A 3AIKA 1XKTA 3FLBA 2EDAA 4W1PA 1BN7A 2WHPA 5AK3A 3GA7A 4X90A 3VVMA 3G0GA 1J07A 1A8QA 3SC2A 4GWLA 1EDEA 1UFOA 5DTIA 2VJDA 1VJ5A 4CG2A 2ZYRA 1UWCA 3QITA 4HS9A 1VOTA 3CCBA 3P2MA 5K5EA 3F96A 4X91A 3K9BA 5EHNA 1HLGA 2E3JA 4AN0A 1YASA 1XQWA 1IZ7A 4UBIA 3RK4A 5C8ZA 2XUKA 2VJAA 3C8HA 2C7BA 3O9MA 4TGLA 4UFPA 2XDWA 4LXGA 4FKBA 3G9ZA 3FYUA 3D7RA 4EY5A 2OLEA 2XI4A 3WK4A 5CURA 1MNQA 4W9RA 3DL7A 4NZZA 5ALJA 4CFSA 5JD6A 2OGSA 1VA5A 3W05A 2GBCA 4C89A 1NU6A 3R0VA 3F97A 1PV1A 5FPQA 2WQZA 2RHTA 5LYYA 2V97A 1MO2A 4DM7A 4AQDA 3HABA 5ALXA 5AM1A 4UHHA 5CRIA 1TRHA 1U65A 4Y2JA 4MEBA 1TKRA 1BEEA 3FYUB 5AHXA 4L72A 5AP9A 2G5TA 4HRXA 1ACJA 1YR2A 3O9VA 1LBSA 4Q1VA 3O4JA 3C87A 1ZI6A 1QE3A 4BAUA 2IX9A 1XZKA 3KSRA 2VT7A 4X94A 1U2EA 2AJCA 3GROA 2BCEA 4M0MA 4RNCA 3G0BA 3QPCA 5HCUA 4UBLA 2OQIA 5CW2A 2WHRA 3STYA 5HF5A 4X92A 4LXHA 2VEOA 3O0DA 1S8OA 3GFFA 1LNSA 2W22A 4J0JA 4Y2YA 4WY5A 1A8UA 4E14A 5EIEA 5ALVA 5FV4A 3KD2A 3X3HA 2Q0XA 3WK9A 5DTJA 2ORYA 4DIUA 2D0DA 5ALPA 5HFNA 3AZQA 3H1AA 1MAAA 5C81A 4L3WA 4KEAA 4ARAA 3WYNA 2C5FA 2WILA 3QBJA 3W9UA 1JMYA 2XMSA 5JIBA 3RM3A 1QFSA 1LPNA 2OCGA 4D9JA 4QNNA 1NX9A 5JZBA 5K3EA 4BP9A 3Q8WA 2B9VA 5T4EA 2HDWA 1BU8A 2VT6A 3DKKA 4F5ZA 1MN6A 4GI1A 2HU5A 1CUYA 4N8EA 5HFAA 5SYMA 2Y2UA 3L1HA 4J0HA 1DQZA 5D7BA 3E4DA 3ZI7A 4RGYA 1F6WA 1CUXA 4YPVA 3MUNA 2R11A 1GQRA 1Y7IA 2WUEA 3ZLTA 1GKKA 2AJBA 4KACA 5AK6A 1CUJA 1AGYA 4ZV9A 1P0PA 3AIMA 1P0QA 1YS2X 4GBGA 4BBZA 4QDTA 1HDEA 3U1TA 2CKMA 3NWOA 5LP1A 4G1FA 4Y2PA 1JI3A 3AILA 1XKLA 3PF9A 4J3JA 1YCDA 2DQYA 3PF8A 5D3KA 2C0QA 3ZLVA 5DNUA 1YAJA 2Y6UA 3G02A 3WLAA 1I6WA 2VTVA 2Y1KA 4FBLA 5AOCA 4BTVA 4UFOA 3DYIA 3O4GA 4XJVA 4E11A 5AKZA 5A7FA 1TIBA 5K3AA 3WWDA 2XQKA 4DNFA 4KAFA 1M33A 4JYMA 1ODCA 2HL6A 5JAUA 5A2GA 3T52A 5JD4A 2O7RA 4DYHA 1IUNA 3PE6A 4KE6A 4G4GA 1OCEA 1TAHA 4AZ3A 1AURA 2PU7A 3UUEA 2NW6A 3F98A 1HBJA 1FFEA 3G9XA 1N5RA 4OU4A 3HSSA 4GXNA 1UKAA 3WZLA 4PW0A 3OPMA 5ALHA 1RYYA 5AM2A 4C4ZA 4YASA 4C87A 4WFIA 2QXUA 3FLEA 2CMFA 4OYYA 1DWOA 2PUJA 1UXOA 1W52X 4AB1A 4B6GA 4CIBA 2HFKA 3VKFA 5AKGA 1FFCA 2Z8XA 3VVLA 4GECA 2WSLA 1BS9A 1D07A 3RARA 1X70A 4J0DA 3WQHA 3DOHA 1XROA 3VJKA 1F0PA 5AI6A 1JT2A 2X5XA 2XLBA 2HA5A 3ZWQA 3W2TA 3I2KA 4N8SA 2GYVA 5JAPA 4TPKA 2XUJA 3WL7A 1CFJA 2GBFA 4BB0A 1HL7A 2HA2A 4FHZA 4H7KA 4ZWNA 1MT3A 4FNMA 4X93A 2FUKA 3B3QA 3IULA 5DNVA 2HRQA 5FRDA 1AZWA 1WB4A 2AJDA 3CN7A 1ZOIA 3FSGA 4HVTA 3WJ1A 5AIAA 4PV7A 1T2NA 1RWQA 1N1MA 3QMWA 2WIGA 4Q82A 3QMVA 4ETWA 1WB6A 4K6GA 1ZD3A 5DJ5A 2HHAA 1Q0RA 1LZLA 1ISPA 3WJ2A 1ZD4A 4HXGA 5HF9A 3WKDA 1B41A 1XRQA 3H04A 1GPNA 4CI9A 1MX9A 1L7RA 2XB6A 3TJMA 3SWWA 3HYSA 1E5TA 1DT3A 4U2EA 1LPPA 1OXMA 4XWGA 3E1GA 2ZJFA 1E89A 3BJMA 1J06A 1QFMA 4B7ZA 1R9NA 3I1YA 3OG9A 5AOBA 5AK4A 4FDMA 2WJ3A 1O6FA 2GYUA 5EHQA 1NU8A 2CB9A 3FWHA 3FYUC 2WUDA 2ZJ6A 2JEZA 4LYEA 2WUFA 4DSAA 4KE7A 3FYTA 3R3UA 1IVYA 4FWBA 1K6EA 2PL5A 3WKBA 2BUBA 2OCIA 1EH5A 4OU5A 3H18A 4Y2XA 3GBSA 1JKMA 3BJRA 1QZ3A 1YA8A 3PFBA 1XZDA 1N5MA 4BC0A 4DMFA 3BIXA 1H2YA 3OC0A 4ZXFA 1VZ2A 1LPOA 1EDBA 2JGLA 1AUOA 2RHWA 5T4HA 3KOOA 1FJ2A 5EI5A 1SFRA 1IZ8A 1ORWA 3WK8A 1YS1X 4L0CA 4HXEB 4OYLA 2XLCA 1XZEA 3AJAA 2XUFA 1WPRA 5E4YA 4B0OA 3WWPA 2I3DA 4EY7A 1DWQA 1U8EA 4G9GA 4PSDA 5BV7A 1XZFA 3KXPA 2WIDA 5K3DA 2Y6VA 4H7JA 5AKLA 1F8UA 5JANA 3HLKA 4G4IA 1ODTC 2QJWA 3FCYA 3HRHA 5JATA 1XZIA 3BIWA 1K4YA 5EIHA 3D3NA 4U2CA 2WJ6A 1BCRA 3LS2A 1VE6A 4U2GA 1EI9A 1CUEA 2HADA 1XZCA 1H2WA 2ECFA 2PKYX 3WKEA 4H0CA 4PO3X 4DMHA 1Q83A 2I78A 5IVIA 2C0PA 2PVSA 1LLFA 5CH5A 2BFNA 4JH0A 3C5VA 4DNPA 4BVJA 2VATA 5CT8A 5AM3A 1CQWA 2G5PA 4G4JA 3WA6A 2XMQA 1SCKA 5CTAA 2WFLB 1XLUA 4BZWA 4GHWA 4OSEA 4ZREA 5DWDA 3ESAA 2B61A 1W76A 3N2ZB 5HF8A 1EB9A 3I6YA 2XQJA 5FXMA 4BTLA 5LIPA 5I7UA 1GPKA 2H1IA 3E0XA 4S0XA 1CQZA 1ZGCA 4UHCA 3VDXA 2J3DA 4E46A 1ORVA 1GQSA 4WJLA 3CN9A 2J4FA 2BGRA 3T4UA 4H77A 3AUKA 1EHYA 1ETHA 1TCAA 2ZYSA 1YAHA 5LZ5A 1MJ5A 2IIVA 3OURA 4NS4A 3EBLA 2O2HA 4YK7A 1E8NA 2HRRA 4BVKA 3R3YA 4M0FA 4J0CA 4JYPA 5HQ3A 2GZSA 3I2JA 1CIJA 2QJRA 4BCDA 2H7CA 4DMKA 4XVCA 2CZQA 4Y2QA 2J3QA 3WK7A 2G63A 3STXA 1BRTA 1R4ZA 1E8MA 4WY8A 2BAGA 1BCSA 4QZVA 2I3ZA 2QUAA 5ESRA 3RKSA 5IH7A 4X97A 5BWBA 2HA7A 5DYYA 1EVEA 1KEZA 1KU0A 3I28A 1K63A 3KWFA 5HQ3B 1ZD2P 2WG2A 4MYSA 3UMJA 4ZV7A 5HKBA 2OAEA 4EY4A 1MTZA 3TGLA 2YYSA 1QIFA 5CT5A 1QGED 3AZPA 3BE8A 4ZI5A 1XLWA 2WKWA 3BF7A 3S2ZA 1A88A 5JASA 4WFJA 4YX9A 3H0CA 5ALIA 4Q3LA 5I9IA 3QYJA 1MU0A 5K3CA 1THGA 5FUMA 4NMWA 5LKRA 3DQZA 1XZAA 2XQIA 5ALFA 4UUQA 1AQLA 4G5XA 4EY6A 4B85A 3AZOA 4EY8A 1UK9A 2WJ4A 1QIHA 2XUDA 3STUA 5C8VA 4BCCA 4P08A 3IUMA 3Q0TA 3G8YA 4PSUA 3NGMA 4EHBA 3R3WA 3C5WP 2OXEA 5KWIA 3LIIA 4UBMA 4GEGA 5AKJA 1QOZA 3WIOA 1VZ3A 5ALSA 4Y2UA 3G0CA 2VJCA 3CCCA 4G9EA 1TQHA 3WI7A 2XUPA 5LZ8A 1FFDA 4IH4A 1XRPA 5FKJA 3BDIA 5ALEA 2Z3WA 5HKAA 3DLTA 4G8DA 3OOSA 5H3HA 3EF3A 1ZGBA 3C6XA 4BE9A 4KRYA 2H9YA 5DYWA 4EZIA 1YA4A 3I2HA 1CUBA 2PUHA 1CRLA 5LKAA 4BAZA 4H7DA 1CUAA 5E4TA 3AFIA 4Y9SA 5E4JA 3WKAA 4FTWA 1CUVA 4AX4A 4Y2TA 1DX4A 4B80A 5CBKA 2BGNA 1JMKC 3C70A 1XZBA 2FX5A 3O4HA 1LBTA 2Y2VA 2JEYA 1XZHA 4ITVA 3H19A 5FDFA 1LPAB 3ICVA 4CG1A 2C5GA 5T4FA 4J0IA 1R50A 2XQGA 3I2FA 4KAJA 4B83A 3HZOA 3JWEA 1UKCA 4Q3OA 4RPCA 2RAUA 2RI6A 5D6OA 2QM0A 5LLSA 4Y2RA 4UHDA 5K3FA 5FP0A 4MXDA 4QDOA 2HA3A 1CUSA 5CT9A 3WZMA 5KWJA 1QLWA 3DKRA 3DOIA 2GZRA 4MQLA 1GT6A 4J03A 4WDQA 1N8SA 4Q3KA 2BUAA 2HU8A 2ZJ7A 3PFCA 2I03A 2XMRA 3ESDA 4KAAA 4QDZA 2QMQA 2B4KA 2V98A 2J4CA 2Z8ZA 1CLEA 4PF1A 1EK1A 5FPPA 1JJIA 3IA2A 4X3CA 2WIJA 3PDCA 2IITA 4X7BA 3HC7A 5JADA 4X6XA 2PSDA 5K3FB 2QKYA 4GLBA 1EX9A 4B0PA 4PNZA 3U0VA 2XE4A 5IVDA 3L1IA 4CCYA 3L1JA 2QOEA 2DQZA 1DTEA 3IDAA 4BE4A 1J2EA 1LGYA 2JGJA 1R3DA 2HM7A 5CT4A 3C43A 3DEAA 4I4CA 5AICA 4NVRA 5JZ9A 5DYTA 3EQ8A 3H2KA 4CIAA 1DQYA 2D5LA 3VXKA 2PU5A 1XQYA 2V9ZA 2H7YA 4LYDA 4LKOA 1UOPA 2H7XA 1UOOA 5LZ7A 4CCYB 3B5EA 1IMJA 1HKHA 1ZJ5A 4UBOA 4WFKA 3STVA 4B81A 2WG0A 3ZV7A 4X00A 2XMGA 3DYVA 3FCXA 4QWWA 3UUFA 3WL5A 2RONA 4B9EA 4U2BA 1QO9A 3H2HA 2AJLI 2DHCA 1BN6A 5EHXA 3FAKA 4LHEA 1MNAA 1RP1A 3QM1A 4AO6A 1PFQA 3OM8A 1XRRA 5AK5A 2LIPA 3IVMA 4J7AA 5ALTA 2PSHA 4AO7A 1VLQA 2PSEA 2RGUA 1XFDA 3IURA 5SYNA 3HACA 1EXWA 1UK6A 4OB8A 4G8CA 3V48A 1E8DA 1LZKA 1EDDA 3A2MA 5D3ZA 1XQXA 1FFBA 1U4NA 3M83A 1Y7HA 4A23A 3D2AA 1ZICA 2PM8A 1DT5A 2QRUA 2XUHA 3I6MA 4B82A 2VAXA 1WOMA 2ONCA 2XUGA 3A2LA 5HZGA 5HK8A 3NUZA 7YASA 4JNCA 4UHEA 2C4HA 3WL6A 2DCMA 4OPMA 5IVKA
chains in the Genus database with same CATH superfamily
3KJGA 4QODA 1PG0A 4NQRA 2Y8EA 1VXOA 1J39A 2ZRLA 1M54A 5K0FA 2BFCB 5L3QA 1XRLA 3VH1A 2IEZA 2QPLA 1Y1LA 2CLIB 3BD7A 1SVIA 2E7ZA 4HI0E 1TO6A 4C0HA 3B36A 2KQUA 1XWWA 2PRIA 2OAQ1 3H3XA 5EVJA 1K8XB 1LFDB 1WXIA 2I1VB 5EWLB 5DNWA 2PXCA 3IUYA 2C8LA 3H2JA 1X74A 1X9GA 2XCLA 1UC8A 3U4IA 4PX2A 4XLLA 3TLXA 3JQQA 2P65A 1SCIA 1VBMA 3RVOA 4UTPA 1XPOA 1WMDA 1OAAA 4C88A 1T9HA 3GJ8A 2CLCX 3L07A 4FD3A 2G72A 3SDZA 1GDHA 1WDTA 1V95A 5JQGA 1QTIA 3I9V1 3COYA 3NKLA 4X6UA 1UL1X 3X1YA 4ACBA 4F7DA 5JSQA 4HZGA 1H3FA 3UO8B 2FMKA 5H3CA 1QIDA 1R0XA 1EK2A 3IRUA 2YJGA 4WESB 4I3HA 1YU6A 2FG7C 2NT3A 5KAPA 4DGQA 3JS5A 1Y5MA 3U1VA 2GMWA 4ROSA 3W6NA 4KITB 2J46A 1TU0A 2XXJA 5IZCA 4IIFA 4M9UA 2WWFA 3PQ3A 2B9EA 5FD8A 2Y1DA 3W6OA 1ESEA 4XYMA 3UWKA 5LUAA 1TM4E 1OU0A 4L95C 1QX4A 3EZ7A 4BJ5A 4CKZA 1MTOA 3DBLA 4J16C 4F9EA 3TIXB 3F78A 3O8OB 4XDYA 5YASA 5G1NA 4XDHA 4BAGA 2Z5GA 3KZXA 4BWYA 5IJWA 3RPEA 4BX9A 5CFRA 1TLFA 4C4YA 3UGJA 1RQNA 3DFUA 1N25A 2GXUA 1IBSA 3A1CA 3LC0A 3REQB 3IJRA 4MTLA 3VC7A 2PR2A 3N87A 4YT2A 1XZLA 3I5MA 3S70A 2UUPA 5KYNA 1LWOA 1J70A 3PIIA 2ZM6B 4Q9AA 4ZOQI 1KYXA 4HQFA 4QWMA 4Z4CA 1HTTA 4YREA 2FOLA 4WOCA 3MWGA 4Z9XA 4EMSA 4HB2A 2ZJ3A 1X2EA 3WLIA 3OQIA 1WL8A 3RGWS 2B6HA 2O7VA 3CWCA 1M1ZA 2GX6A 3UMSA 5E1BA 5KTKA 4YBRA 2GBLA 2A7XA 3PFGA 4KSBA 4MS3B 2FV8A 4R8VA 3AGQA 2OK8A 3NYQA 4KNWA 5AKEA 1MO3A 3AU9A 1Z17A 3RYFB 3ZWOA 4NHEA 3PXDA 1GAXA 5KYKA 1JT9A 2VRNA 3ITNA 4K2AA 4MRRA 2PYZA 3R8XA 2FWIA 5K4AA 3DSRA 4E1BA 4JI2B 1ZNQO 3FUVA 1A98A 4HAUA 2Q0HA 2QIPA 2WIFA 1I32A 4LE2A 4CR7A 2QQGA 2NU9A 2I7CA 1DAHA 4ID9A 4C01A 4R9UC 3UXEA 3Q8MA 5IKPA 3BBLA 2FWJA 4IBOA 5HMLA 3MS2A 1NLUA 2QLMA 2LE0A 3V6MA 2BUCA 3JVEA 3H17A 3V1KA 2ROQA 2VAVA 3D8TA 4AO8A 4ZARA 4IJQA 2DOKA 3V1UA 1FFAA 1UAYA 2EDCA 2FVYA 2FEOA 3Q6MA 1A0OA 4X85A 1U2ZA 4YUZA 1NVTA 3TTWA 2CXOA 4ZIRA 1U81A 3IT2A 2JA1A 3GARA 5A1TA 1M8KA 1KFBB 2H5IA 2JLXA 2IBSA 4URHA 5EGSA 4ACAA 2AOTB 2I4NA 2RH9B 1WABA 4GP6A 4C4XA 5AI0A 1JW9B 4NV1A 3WK6A 3EVTA 3QIAA 3CV3A 4CTMA 3WYBA 4TKLA 1JB1A 2P5YA 3AIOA 1XJWA 1LS6A 3AH8A 3L01A 1RQPA 3PS9A 4MQMA 4NAUA 1CNMA 1P6QA 4YRIA 2DEUA 2J48A 3H3FA 3BICA 5EQDA 4MV6A 2XCQA 3HBLA 1JUDA 1UPXA 3EUFA 3W04A 3TD9A 3W1EA 5ECYA 1GPDG 1PJRA 2OG1A 4UDYX 4ZANA 5FWAA 3V8QA 1MRZA 2FI1A 3NHBA 4QGSA 4RTKA 1ECLA 2X14A 2Y4OA 1C7JA 4KO1S 3E2IA 4L0DA 3LFHA 1XB2A 1XPUA 3OLZA 4GI2A 4DSZA 1JP7A 3E1SA 2GLUA 3KUXA 3ZTTA 4O4JB 3B3AA 3T5BA 1UMBA 1MORA 4Z2YA 1XPRA 1X7WA 2R6ZA 4AMBA 4EENA 1WXDA 1IQUA 3O95A 1O8BA 1H0KA 2JH9A 1XVVA 1ARZA 3LDFA 1PW5A 5A02A 2UVDA 5CB4B 1AQUA 2DR0A 3I2YX 3NATA 1Z8FA 1SBIA 3QVVA 1SBTA 2GO7A 1RJ9B 5FWYA 1OX6A 5AVUA 2QSUA 4TV8B 4WGFA 5TDHA 4L50A 1LRLA 2I2XB 3KXDA 4FFSA 3OLCX 1B7GO 1WHTA 4FBMA 3R7BA 3DVLA 5KVQA 1ZXXA 4FSHA 3LRTA 2NZWA 5G0WA 2XH8A 3IBTA 5E8JA 4ZTUB 2PXXA 3B12A 2N46A 3BRQA 3L7JA 2UZ4A 3PRJA 3RLIA 2ODWA 3AVYA 1AQIA 3DAOA 3P9SA 5KPDA 1ONNA 4DW8A 2PS1A 5DTEA 1R0LA 1AKQA 4Q3AA 1JJVA 2Z2ZA 3GH1A 4QYWA 4G0WA 4D42A 3M9WA 2HMAA 3HP4A 3OJWA 4ZGWA 3BWCA 1EK0A 3I32A 3PQEA 4P7BA 3AF0A 4RESA 2OA0A 1O9BA 1XV5A 1QGDA 4XASA 3TOCA 1VKRA 2VYCA 3IPXA 2XMBA 2JJ1D 1Y7PA 2JKYA 2OMEA 1CY6A 4QAQA 1DEOA 2QYTA 1KMNA 3LBIA 5H9VA 5B30A 1IK6A 1VL0A 3RSOA 2BR4A 3H1PA 1DG9A 3K1TA 3E3AA 2A84A 1HLPA 2Z8YM 3PDHA 1T2FA 2O2SA 3JARB 4OQQA 3N6VA 3R7LA 4F5DA 4LIPD 3K4PA 3SX0A 4DR1B 2ZYHA 5DIZA 1OT5A 2FW6A 3EMVA 2Q4OA 3BZWA 5FLKA 5BYJA 3V8VA 1T4BA 3WXMA 1BZYA 2GNAA 4O25A 1UFQA 3V32A 4TWAA 2IP4A 3TI9A 1RKBA 1LDGA 2VNIA 4ZP1A 5SZKB 2NVUB 5LIRA 2CSUA 5MFPA 1HFWA 1BVYF 3RS8A 3SE0A 1PUJA 4RO0A 2A1IA 2RKWA 4L9RA 3B3FA 3K96A 1HNWB 5HOQA 4YCDA 2AXEA 1W1WA 1UXIA 4ZMSA 1KY2A 1MIOA 3CNLA 1KS9A 3IOYA 3QJYA 4QXMA 3RD5A 5EHZA 3LL4A 2B1QA 2BTOA 3HYCA 4OD0A 5AW9A 3TDNA 5BPFA 2N42A 1BROA 1Z6PA 4B46A 1IAVA 2M6RA 2CF6A 2CUTA 1IFXA 4BQRA 1RI2A 2HA6A 2Z0MA 3MK31 4L3OA 4PX9A 1FS6A 3F6EX 3A2NA 3G5TA 1ZH6A 3SZOA 2GYWA 2A78A 2R1VB 4LXUA 4N3AA 1YZKA 3BA6A 2JLSA 5B37A 1Q92A 1FC0A 2ZUTA 1DWPA 4PVCA 1D1PA 2FWPA 2Y27A 3U4CA 4ZDIA 1Y80A 2ZITA 4AL4A 2Y68A 4JC5A 3A9WA 4Y30A 4OOFA 3TGWA 3TLAA 1H69A 3TXYA 4QJ3A 1CE8B 3DC2A 2PLRA 1J1IA 5ALUA 3UAGA 1JFRA 3CLUC 4EKNB 4B87A 5IVHA 2KB0A 2WC1A 1NMXA 1K8QA 3ROXA 1AMNA 5HTKA 4EGFA 3DE5X 4Q01A 1IY1A 2EKDA 2HNBA 3CW9A 4BVAA 3KKLA 1Y9EA 1E2FA 5GIOE 3RS0A 4NOKA 1MCZA 5IKMA 4RZQA 3U61B 4P31A 1CHNA 2WT4A 5EE9A 1VYHA 1PT5A 1Z6GA 2J9YB 2P5SA 3RODA 5JNVA 2H52A 4EHDA 5CD9A 3EZ2A 2XKJE 4QPZA 2E85A 4O0LA 4ND5A 4KMOA 3TG2A 1B73A 3PJRA 2E4UA 4L8FA 2NZYA 1H6BA 1R15A 1Z25A 5AW2A 1DINA 5B6PA 4BZQA 5AOVA 3EXEA 2Z2YA 2FXVA 1CCWA 4YAJA 1KSHA 1VJCA 3ELBA 1A27A 3NXSA 3TF5A 4RY2A 3Q12A 3M8KA 2K7ZA 3K0CA 3WSVA 5JQWA 2ZB8A 2V59A 2PGIA 3AINA 2FSIA 2PXAA 1GR0A 3R5XA 4GZ3A 1WXGA 1DC6A 2ZYUX 3IKVA 2BGMA 3EZNA 4U7GA 5BPHA 3HMKA 1PT8A 3H6HA 2J85A 4RTPA 2H9AA 2ZJ5A 2DFKB 4NU0A 1QH8B 1L4YA 2O57A 3F90A 5C8DA 2WMYA 4MOWA 4MYDA 2OCLA 3GOHA 1AN9A 2WAXA 2VSNA 3LK7A 3F73A 4B9AA 3BULA 1WDMA 5A6VA 4RACA 2MYUA 2HPAA 1U1IA 2PY6A 3JTEA 1KDZA 5LB4A 2AHRA 5IULC 4D9CA 2GNOA 10MHA 2R9VA 4LDPA 2HFJA 3I9FA 4TT3A 4DNOA 2JJ8A 2W7TA 3ND5A 3IAS1 4IIEA 5FADA 1RHQA 2D3WA 1FDIA 5K3BA 3T7SA 1RZRA 2HLDA 2RH4A 1ZH0A 2COUA 4LF6B 5TR9A 2BT4A 3K05A 3GDWA 2XNSA 2EL9A 4PZCA 1A9TA 2D2XA 3HBJA 5ALNA 1U8ZA 3NBXX 4RE5A 4A8JB 2JI8A 5DPMA 3DD5A 4TYQA 3E3MA 1UBJS 2XB4A 4K8OA 1CQIA 2IYEA 4G3XA 3C3KA 4XEHA 2YDXA 3K32A 4PFKA 4WN9A 5JFTA 4Q93A 1QVVA 4PSCA 2CJPA 4G9BA 3U49A 1ZUNA 4LZWA 1B43A 4PCVA 5F3RA 4CLXA 5JSZA 4JBHA 2OY0A 4XGNA 1O3YA 5CB0A 1ZBQA 3BE5A 4ARUA 1YZLA 1GSIA 3C24A 4W1SA 3UJ9A 4WCDA 3GAZA 2PHZA 2YRFA 3QKTA 1HE8B 4URUR 2PZEA 5CA0B 5KHAA 1UK7A 4EPXA 3RU3A 1TW3A 1DS6A 3SPXA 4U6QA 1ULSA 1E2PA 5TQ0A 4EHHA 1OAOA 3F6YA 3PGXA 1QOPB 2II6A 3GT4A 3IQGX 5ED4A 3CRVA 2ZB2A 1DAMA 5EZYA 1XWFA 1BKYA 1BMQA 5FA6A 2D0OB 2IL1A 1K6MA 4XDGA 5DU2A 4AP5A 1N1EA 3D0KA 3DLPX 2BZGA 1US8A 3FVRA 2Y1OA 2BKAA 3PI6A 4TV8F 5AVKA 4ZDKA 2HIHA 3LFUA 1IHDA 1YVDA 1IBRA 4HBGA 5H1YA 3AT1A 3LM8A 3I01A 2OYSA 3FVWA 3IEPA 4H3VA 1QIMA 4YBZA 4KXXA 3TTSA 2GPAA 3HXQA 4QARA 2O4UX 4ZVTA 4XYBA 2QZ9A 1A7KA 4CG0A 4EZBA 3KNZA 3T94A 5FPKA 1M5RA 4GW3A 3SX4A 3A2KA 1YB6A 4FXOA 4RJLA 2LBPA 3KTAB 3QLTA 2QQEA 2ZJYA 4ZODA 3DVAB 4OLJA 5LOVA 2HGSA 3Q7SA 5D01A 1AN0A 3NVAA 1E5QA 4GX0A 4GR5A 3DZFA 1J5PA 3ORRA 4P86A 5I8ZA 4DARA 4NDAA 5E9JA 1K1EA 4ZU6X 1AKTA 4BC1A 4DLXA 2V7XA 4BDTA 3HB7A 3BIOA 4PYMA 5CLQA 1I1NA 4B35A 3T5PA 1W29A 2OO3A 4RLFA 2C78A 1W4AA 5AW7A 1L8OA 3FETA 3ZJTA 1A2QA 1KZ7B 4JLVA 1F1BA 2VAWA 1JSZA 2QMOA 2YASA 4MS4B 3ADKA 3PZRA 6CHYA 2ZYIA 3CTPA 1V7PC 4K6KA 3T1OA 4C7KA 4IG4A 5CM9C 1N3LA 2FG6C 3BWDD 3QX7A 3W4KA 5IN4A 2GYYA 2LDBA 4IVNA 1QUEA 2J9RA 3SD7A 3SFZA 3A28A 3RAPR 4L78A 3R5SA 1NMYA 3QX9A 1KSFX 2K87A 3SXPA 4K6OA 4Q1DA 1P6XA 4CKBA 2YV4A 3YASA 4WUTA 3VVBA 1RPAA 2PMWB 1UXGA 3E03A 3RHFA 1KGDA 2ZTUA 3WRVA 5KJFA 3CRRA 3P7MA 2GXAA 2QLBA 3D4LA 2OBLA 2QDXA 4IIHA 3T8YA 3NMUF 2R8OA 4CEHB 2H57A 4BO6A 5SYAA 1ADBA 4Q9HA 1XHEA 3H3JA 4C2AA 1V37A 3B6IA 2IYSA 1QJ4A 3OMLA 3LWNA 5BXQC 1RWMA 4ZYLA 3N2GA 1ESDA 3S8YA 3ERCA 1JR6A 1XJQA 2GKOA 2R66A 3LO8A 1RHUA 1VMKA 3SEZA 1OT3A 2SKEA 3WRXA 3QMMA 5LFAA 1W581 1KJQA 2CLFB 2FZEA 2PA3A 3JVVA 2Z5VA 2H2IA 4WVFA 3TEJA 4NZ9A 3TLZA 2IEBA 3K9FC 3G2MA 4Y2GA 2GK6A 1MBZA 4CLEA 3A4TA 5JRZA 3OIFA 1N6NA 3DS8A 3TVYA 1RWBA 2VJBA 5JO0A 3LC2O 4GS5A 4JI0B 1QORA 5GM2A 5J4KA 4YDHB 3CINA 1ZI9A 5K0SA 3UCEA 1AZSC 4HVAA 4M36A 4Q16A 2WP8J 1REQB 2GEUA 2WM9B 5IRCD 3AB7A 4I55B 3PXUA 1KAOA 1JKFA 2GARA 2JGDB 3KUKA 3F8TA 4A6EA 1GKLA 1JJFA 1PBNA 1OD6A 3UH1A 5B7NA 4CEIA 2D5IA 4Q7KA 1PE0A 1S96A 4M8NE 3T4XA 4ER5A 5LQNA 2EC5A 1WRBA 2H6EA 3GEMA 3KXIA 3DOJA 4D25A 1P39A 5F2KA 4L07A 2W2LA 2IZ0A 2X13A 3PNQA 4IZHA 1PR6A 4QFBA 1L7EA 3NHZA 4N7JA 2R2AA 1OV4A 1O95D 1FXUA 1FDSA 2JATA 3LV8A 2RCYA 4HXYA 2CFTA 2Q50A 4Z49A 5KVVA 2F1RA 1BEZA 3TBHA 4EM6A 3NHJA 1P9OA 3BL8A 4CEJA 5F3WB 1OF1A 4WJZA 1KIMA 3HEAA 2FUG6 4NU8X 1BX1A 1GQFA 1NKSA 2OP1A 3IAAA 3WK5A 1R9MA 3AUAA 1HXHA 3BMOB 3FSRA 1QIJA 3KLBA 3FXAA 3MUEA 3CUUA 3MTGA 3NIBA 5FB3A 3EXHB 4ECEA 4ZGBA 5TARA 1CR6A 4KNVA 5DSZA 1WO8A 5CYPA 4KFUA 3TKYA 4YMSA 2QT9A 3PUIA 1DXYA 1W0CA 3QXXA 1OWLA 4OJYA 1LSJA 4K2HA 4BMZA 5BSKA 3UKDA 1JEEA 4JQSA 2Q9CA 1JEOA 3L6BA 5KHLB 5DHUA 3P9XA 4EGSA 3RBXA 5EIWA 3GMDA 3ZH9B 1N2EA 1FQOA 1GU7A 2GBLC 2Q9UA 3IQDB 4GYKA 4RVOA 4FUQA 4DR2B 2JF0A 3QQPA 4KR2A 3IP1A 1YSCA 2X76A 1QHHB 5AT1A 4OKSA 5MF6A 4XSGA 1SWVA 3NWEA 4K9PA 1E1RA 1XDUA 3FDXA 4JLOA 4GKKB 3AFGA 1BD4A 1TJ3A 4MCJA 4HFJA 3G9TA 3K16A 3OF2A 1SBZA 3PWKA 4BX2A 2EX0A 3ER8A 5TQJA 5K2OA 1SUPA 3ELYA 2CXPA 4QGGA 2RBGA 3MBKA 3OC6A 1GPLA 3QVGA 4KX5A 4RWEA 3WBBA 4B3GA 5IT0A 1F6DA 3FDJA 5ECWA 1QHEA 2F3SA 4K8RB 1V2GA 2P2SA 3EVDA 1PDVA 4CDMA 3I0ZA 1C7IA 1MC1A 4EB0A 1MC8A 1JG1A 1GUYA 1T2UA 2JCYA 2X8BA 5ALQA 3AKYA 5CJ2A 1BHO1 1V26A 2GLTA 3EQZA 3N0WA 3QG1A 1BHQ1 1O5OA 3DO5A 3H4VA 2PQMA 3QTTA 4PO8A 2H59A 4AKIA 1X1SA 2WNSA 3C3EA 3G2LA 3N76A 1R6TA 4PZYA 1K0UA 3MM4A 1GG9A 2D62A 2I80A 3K70D 2RGRA 1J8VA 2QZSA 3TLGB 3UWSA 1IIBA 1P73A 4RA6A 1CUDA 1KRHA 1Z5VA 2REOA 2WU8A 2YN2A 3IERA 4NV3A 2QA5A 4B09A 4MRMA 3W5IA 1M8PA 3JAWB 2JEOA 3BREA 1QJCA 1DQSA 3HO6A 4OG2A 4PAGA 1JHUA 1N9ZA 2AFHE 1T24A 3WV5A 3FFWA 4B7AA 5KNCD 1O97D 4OLBA 2PKCA 2R97A 5KNBH 4ZVUA 1E59A 3EH2A 4URZR 1XA4A 1M8GA 5E0OA 2ATEA 1Z26A 3A6LA 5DYGA 5WRFA 3SBXA 1MEEA 1JEAA 3V5NA 4EG3A 1KRXA 3FKQA 4L15A 3T1NA 3IUJA 5IWCA 3L1KA 2YBDA 2C3UA 4UTNA 1U3GA 4NJEA 3OCXA 2D7DA 1QH1B 1D2HA 3T99A 4UE6A 3S44A 5C8XA 5H16A 4FB5A 2H63A 3QTLA 1XZ8A 5CLJA 3N9IA 2PRJA 2PZBA 2QDKA 4J0KA 4JA0A 4PYNA 2XRZA 3A14A 3CNOA 1I0LA 1WPXA 3K2IA 4AG3A 4AZSA 3PCTA 1C3EA 2HMSA 2WFZA 4QVKA 4F4UA 4M0EA 5DYIA 4NYMQ 3CRZA 3QVKA 3ANYB 4R40A 2W4MA 1X1BA 4IAOA 3PNKA 4L9AA 4UM7A 5AJHA 2GJ9A 3DB2A 2O4CA 4ZRNA 1Y8QA 2Y05A 3WB2A 3TRFA 1GZVA 1N7IA 1QRTA 3MWFA 1O6GA 2AOUB 4LHVA 3QLEA 3BXHA 4LV6A 1D1QA 4BWFB 1C4XA 1GCIA 1Y9DA 3BVPA 4H9GA 1T3LA 4Q7QA 5ABPA 2QRQA 5U4QA 4LJ9A 4PLHA 1F38A 3ANTA 1P74A 1SUDA 1YVUA 3KUUA 3Q85A 2IUYA 5BWCA 2ZBGA 4RFSB 1OH8A 2DLNA 4FEYA 5EUQB 3DDSA 4B3JA 4E4YA 5I5EA 4RIEA 3DMNA 3VKHA 1YB7A 2LNDA 4BNWA 4QASA 1ORTA 4X54A 1MB3A 3GLHE 2Y93A 2Z6QA 3PTZA 5DM70 1P4SA 2OXTA 3EQ9A 5C46F 3HVHA 2P9EA 2VAPA 1TO1E 3LAWA 1K0FA 4NFYA 4U2DA 4D26A 1QYWA 2NPFA 2JCGA 1JR2A 3OI7A 2QX4A 4N6GA 4LOHA 3KQLA 1X87A 1ZOPA 4KJXA 4ARBA 4IHQA 4W1QA 4NLLA 1FS4A 2AZMA 5HM8A 4YMVA 2GWHA 4K9NA 3BPSA 3ANSA 5EWMB 3SGLA 1T26A 3RVKA 4KYVA 3WAGA 5DLPA 5JO9A 4BBAA 4BIIA 3PX2A 3C6ZA 2QTVA 2O8EB 1KXZA 1FUYB 4B34A 4G97A 2QGNA 4YP1A 4Z9YA 1UDRA 5DOVA 3RYHA 4D9IA 1K7EB 2GCNA 2XRFA 1NF8A 4H15A 4WRRA 4XUGB 2X5KO 4RTJA 2PSFA 2WQ7A 2VRCD 4HMPA 5FUBA 2PMCA 3HYTA 3U80A 1RYZA 821PA 5JYCA 4LWQA 4N03A 3DG9A 1W73A 1AF4A 1KIFA 1E1MA 2Q2WA 2WAOA 3INTA 4UVDA 5GGYA 4YMHA 3ABSB 4OFWA 4A0SA 2X3FA 4MNTA 4RTNA 4OXXA 4BNIA 4Y7DA 2DZDA 1F2DA 2OTCA 3FHOA 4H27A 1PS9A 1Z7BA 5CNJA 3WGVA 5KDOA 5EP2A 2DHDA 2F8SA 3TRDA 4PAWA 5MGBA 1JDPA 3KWJA 3QKUA 3MHPA 3LX4A 4DC0A 1KEKA 1UFKA 5F4ZA 2FSPA 1Y1PA 5C8YA 3ZLUA 3WLEA 1EXMA 1HE2A 1XA0A 3LP6A 4BLWA 4RCZA 1SO8A 1X1TA 1VFPA 3K8OE 4XEUA 3TLJA 4AF8A 2CBXA 2CMHA 3NRCA 2C2OA 4LY6A 1JVNA 3IEUA 1DC3A 1FQWA 2X86A 3FMOB 4IH1A 3V80A 2OE2A 3HJUA 5LU9A 1UK8A 3KQMA 2JBWA 2OZVA 3H5IA 2TMDA 4BVEA 3ESBA 2OD7A 1KOFA 3R3XA 1RPZA 3O03A 1KE2A 3UW1A 1VSQA 3H9EO 3HDJA 3Q40A 2DFTA 4L51A 3KYCB 3CZRA 4XUDA 1L7QA 1KH2A 4ZVVA 4EF6A 4OBXA 1GFSA 3LQQA 2B83A 4K6HA 4HDRB 1QGZA 2PAAA 5I4CA 4L4ZA 3AERA 2O2GA 1C1HA 4IDDA 4OL0A 1XMOB 3PDUA 4IX1A 1TK3A 1KI2A 2COKA 3G2OA 4TL9A 4Q9LA 2IWHA 3CVJA 4PTYA 5FUYA 3VSBA 1JB9A 3G8DA 3IUNA 2HR1A 2XOKD 3IBFA 3GG9A 4CUJA 4DSUA 5MHTA 1WB5A 2D5AA 4MVWA 4TMYA 5KNDH 4YHBA 1S2GA 5EXPA 4EELA 5CB8A 2B20A 4KXLA 5B6JA 5JI2E 2BGWA 3OPXA 3BMQA 4EY3A 2JIOA 4F8YA 3PGVA 4FCWA 3PCXA 4RJJA 5EJMA 4D4LA 1OXUA 3K0CC 3RC1A 2NQ8A 1X1QA 3FRIA 4L8VA 2IYQA 4TMVA 4KPFC 5FI0B 4BEVA 1UPCA 4HB0A 3IQWA 3RT7A 4JP5A 3C6MA 1N7HA 2CDAA 1SQFA 3QI7A 1QIGA 2JGIA 4GZ6A 4OCZA 4Y7CA 3P32A 1D4OA 5G1PA 3S27A 3AV3A 2DC1A 5KC9A 1VHDA 1FMFA 3RWMB 1BWSA 2AQIA 1ZN8A 4JGGA 4DWOA 4AZWA 2XAAA 1JG3A 3D1JA 1M2JA 2A9RA 2RHRA 2ATVA 4X95A 3I9LA 2EOAA 3ZCPA 1KJNA 3QPDA 5THXA 1ZC4A 3GX1A 2AN3A 2L82A 4WW0A 2K2QB 2R48A 3UMVA 1QS0B 3H2SA 3QBEA 3N5CA 4EUKA 2V3VA 4H4EA 5JMTA 5JW6A 3OT1A 3PHIA 3IPLA 4B1FA 1U0RA 4X6YA 4DA9A 2HWWA 3K6RA 1RWPA 1DUIA 1EFPB 2YQZA 5E7QA 3SZGA 1CY4A 2DT8A 4JENA 1KY3A 3G5MA 3LMKA 4YIHA 1I4LD 4MLCA 2RK4A 1P3Y1 1TJPB 5IDQA 5EMMA 4PX5A 1OH7A 4ZI7A 2E5LB 2EDAA 3HKDA 1RI4A 2ALJA 5LXTB 4ZO4A 2BF4A 4JBIA 3V7YA 3SBDA 4NBRA 5F7XA 1H2HA 4X90A 1EWQA 5FBHA 4AC9A 1J07A 3ZQJA 1ZGHA 2RHBA 3SC2A 1AHPA 4MP8A 3PDWA 1KAMA 1KOLA 4EHFA 5JZOA 1DJPA 1NJ1A 1NN1A 3U48A 3L4EA 1NI5A 2C4NA 3I4CA 4L8WB 5BYAA 4B6RA 3IUSA 2HCTA 5CHEA 3NASA 2IIQA 4HQ0A 1OAOC 1U9CA 1BOOA 1SUIA 5FJJA 3F3MA 5K6RA 2ZYRA 4TM7A 1UBGA 1UWCA 5DI3A 3V3KA 4W7SA 1A9YA 3BAZA 4J29A 1DE0A 4NYJQ 5CP8A 5K5EA 2W2KB 3WBKA 1EE1A 5JZMA 1KBZA 1EM6A 3PXEA 1HLGA 3C7CB 4GI3A 2E3JA 5H83A 2GLXA 4ZQGA 3GLIE 1W19A 1YASA 3DR5A 4AWAA 1CQXA 3EVBA 1IZ7A 4UBIA 3EISA 5DHFA 3RRNA 3QV2A 3N0XA 5EG5A 1FSPA 1S5PA 2OBNA 3CX8A 3C8HA 2C7BA 3O9MA 4TGLA 1OB5A 1WU7A 5JY1A 1KORA 3ENVA 3R5TA 4UFPA 4C4RA 3EAFA 4K9SA 4HYYA 3G8AA 5EHIA 2AQ8A 5LBIA 4DIKA 3DEHA 3KJFA 4JK3A 4LXGA 4NMXB 4MQBA 4FKBA 3G9ZA 4NONA 1ZM3A 1LQTA 3NT5A 3ZQKA 2G1AA 2B1RA 2X1LA 3BSYA 2OLEA 4QGBA 1U8AA 3AUYA 3K09C 2Z43A 4NZNA 2C5SA 3PQCA 3KSUA 3G2NA 4Y0AA 2UXDB 1MNQA 3T3EA 3DL7A 1Q14A 1P8AA 2X7JA 4KQKA 4MJXA 5JCJD 2H54A 2OXIA 4LGMA 1KDRA 2OGSA 4MP3A 1U2TA 2L19A 1RZRD 2PUFA 3INRA 1NVMB 1V7CA 1Y4ZA 1K7CA 2PYIA 3GIDA 4C89A 1PV1A 2Y1GA 3S8MA 1JA0A 2RHHA 2A0KA 2VDWB 3TJRA 3D3JA 2RHTA 4PZPA 1N0UA 4F7WA 4JJAA 1QF9A 4DXDA 5LYYA 1ZMTA 3OE7D 4V0LA 4IRUB 4V0ME 2YXBA 4TYYA 3TKLA 5E95A 4AQDA 3TPCA 2RI1A 5ALXA 3ILVA 1WW3A 5AM1A 5IG2A 1OH5A 4M8KA 3CNQS 3O7MA 4IGFA 4F1KA 1U65A 2J08A 5KTYA 3ISJA 2WKRA 5K0EA 2JFZA 2COEA 1ANKA 4MEBA 4KN9S 3A0UA 3IKTA 2AWOA 1KVUA 1Y4AE 4R9NA 1A5SB 1KYWA 1U0FA 2QSJA 4FDVA 1RWOA 4L72A 4PY2A 1TOAA 4HRXA 4FIZA 1ACJA 3S2YA 4ARVA 1APBA 4PPNA 1QBKC 2I8AA 1I3OA 3II6X 2CNLA 3MCZA 2J1LA 1EDOA 3DHYA 4RMHA 3O9VA 1LBSA 1ODIA 4RL4A 2QTMA 5AMXA 4OHOA 4Q1VA 5F9HA 4RDCA 4ZHSA 3C87A 3ER9A 2QVZX 4AY2A 5IMSA 1CD5A 1QE3A 1Y81A 2O8BB 2TECE 4CI9A 1XGKA 3LDAA 4E1AA 2IX9A 1K7FB 3WG9A 1DEXA 3KKOA 2FA9A 1HG1A 2EX1A 1YIAA 3N74A 3PTLA 3PE4A 1U2EA 4X94A 3OKFA 2BCEA 5CAEA 4M0MA 4RNCA 1HFEL 4D6YA 3DMRA 1FSZA 1JZSA 3LPMA 4BLQA 1P3JA 4YWHA 1KK3A 2HQBA 2ZB7A 3MMXA 3NWPA 4KL8S 3W2EA 4EZEA 2F4VB 2VYND 2NV0A 1VRWA 2NPIA 2Q2OA 4QUJA 4RVFA 2OQIA 1UMCA 1FBNA 1JNYA 3H6GA 4FUTA 4P4SB 2E4XA 3GT3A 3RR2A 1RE1A 3ME5A 3H0KA 4ZO8A 2C5HA 3ESXA 5AJYA 1RLJA 2BWJA 2FFBA 4WXPA 1ACMA 2PKQO 4WLVA 3RIYA 3MTBA 4OM7A 4OQEA 4KMMA 4Y2YA 4QU5A 1PL6A 1PS8A 4F11A 3HUEA 2CFSA 1D03A 2JKVA 3PC6A 3BD8A 3Q1LA 4JIGA 3S6JA 5EIEA 2H1CA 4M76B 1ORHA 3MFYA 3GGGA 3SC3A 2JFOA 1II9A 5BNTA 3NHWA 1GILA 1F4LA 2NTEA 1ONOA 3PJEA 1RT9A 1WA5A 3NRBA 2Z5FA 4FP9A 1CKEA 1M8JA 4ZVNA 2NXCA 4GPD1 2HSZA 2C99A 3MJEA 4DIOA 3AVWA 5HFNA 2ET6A 5TC4A 1H2EA 1N2BA 3E2MA 3H1AA 5C81A 3HMQA 3U56A 3ZDEA 4X24A 2REQB 5BT9A 1MC4A 3PDJA 3URMA 2VFAA 2C5FA 3AJDA 3RGGA 2VPTA 3RC7A 4LQLA 4MR7A 2WWYA 1A69A 5ARDA 2DUNA 3QBJA 3W9UA 5JASA 5KS2A 3LVBA 1KEPA 2CFOA 2XEDA 3LPNA 3VAZA 4CM5A 4Q9DA 1CS0A 5L4NA 5CX1B 1QFSA 5DRYA 1ZKMA 2QTGA 3VPFA 4HDMB 1N2CB 3E22A 3DTNA 4QNNA 4HDQB 5JZBA 5E2AA 5B1DA 3Q4GA 2JD2A 2ECKA 3LGXA 4JYCA 4BP9A 2QVYX 3HH8A 4LMBA 2HDWA 3DKKA 2EBUA 4FMBB 4UCFA 5DP1A 4EO4A 1P5FA 4BMNA 1L1EA 1MN6A 4GI1A 4GQAA 5GJCA 3TSWA 1ZR2A 1NMEA 3DVRX 2CHUA 4OI1A 2IVFA 4PNPA 5SYMA 1ADJA 1Y34E 2GFIA 4HGOA 3L1HA 4HWSA 3T7CA 3NRJA 4EEXA 4ESVA 1GQ2A 4J0HA 1Y8ZA 3NHPA 1DQZA 1AUVA 2QMYA 3WTCA 2ZWPA 4G2NA 1EVJA 3MTEA 3U3OA 7REQA 1HDXA 1RRKA 5LQJA 1TI7A 5JMOA 4TUYF 4ZYYA 1QG0A 3FDFA 2O52A 4HDKA 4YS6A 1F6WA 2IQ5A 3WGJA 1SCAA 2SKCA 3C3PA 4DA4A 2B82A 2O2XA 3JQ8A 2R11A 3OE4A 4X84A 1ND5A 3AR5A 2NVBA 5L3RA 4X64B 5DHTA 4HNRA 1XQ9A 1FMTA 1XK7A 2WUEA 3FI9A 4RF4A 3JAKA 1XVTA 4KACA 3ZLTA 4ZEVA 3OQOA 3WXBA 2A86A 5JH7B 1A1VA 3ETEA 3Q2KA 4I1SA 3WLTA 5EJ5A 5KMGB 1Z08A 4ZV9A 4Q47A 4OXRA 1M73E 1YRQA 1GT91 1Z33A 4H3SA 3AIMA 1O54A 1P0QA 1UEXC 2DBYA 1GTG1 1WQ3A 2I22A 2FFHA 4BBZA 2PGLA 3ZWXA 4QPNA 2RGGA 4I4TB 2V54A 3MQ2A 5EXDA 5A05A 1RWKA 2I7TA 1O95A 3IPCA 3TRIA 3NWOA 2L17A 1ZIOA 1P33A 2H11A 3TO5A 4FT2A 3HFSA 2I6SA 1JI3A 2UYOA 3TSOA 4ZDJA 4P3XA 5DYNA 3BHMA 1ZJJA 4J49A 2X15A 2Z98A 1A5ZA 1G7SA 3DGFC 4PHTA 4UU8A 3PF9A 3ZYZA 3VKGA 1GSHA 1EM8A 3OE1A 3Q7QA 4LY9A 4OBWA 1FP4A 1AKUA 4L4XA 2UYCA 2C0QA 4IMPA 1XBTA 2QGFA 4J2HA 4PZDA 2XB2A 5DNUA 2HMUA 5CVVA 1YAJA 2FPSA 2O3UA 2OVFA 4CJXA 5L6MB 1CTQA 3JVDA 1ABEA 1X1RA 2R6GA 4ZT4A 3WLLA 2Y1KA 3O26A 4WXEA 1G8YA 3VPXA 1GUDA 2OFOA 2JAXA 1V35A 3I0NA 1J9ZA 2BFFA 5EP4A 4UFOA 2P90A 5SICE 3DDWA 3DZBA 4NFSA 2J6IA 1F6BA 1P2FA 1ZWKA 4RPIA 1YQEA 4ZCQA 1HNNA 1V7QA 3OLVA 4MUMA 4X45A 3PPWA 5AKZA 2ZS7A 1BS1A 4RANA 3DA8A 4UNPA 4BQSA 4DNFA 4ZYZA 1F7VA 2PTGA 1CULC 4II3A 4K86A 4WL0A 5A9SB 4JVNA 2C7VA 1K2VN 2YQ5A 1E1KA 2YFHA 1R0SA 1LTKA 1TM3E 1ZGGA 4GQIA 4AJNA 4H1WA 3DW3X 5JAUA 1RE0A 4UC0A 1C9NA 1JTFA 1BS2A 1LW7A 1QZUA 1WE2A 2GHIA 3A9TA 1U8CB 2H08A 1SCNE 1G60A 2R85A 3B6EA 2VPXA 3PC2A 4GGOA 4HPJB 5FYDA 2P9QA 3NGXA 4AKTA 4B3MB 2IKQA 1JHQA 1RP7A 1PZXA 4ZJYA 4PO9A 3T7EA 1OCEA 1E5DA 3CX4A 3NDJA 1JVBA 1NW6A 3T54A 5JAZA 1XTJA 1GN8A 2LDXA 4I9UA 4EW3A 3I4LA 5GVSA 1EE2A 2HF9A 2EARA 4Q1CA 3X1JA 1G3IA 1RC0A 2REBA 4GOND 4HDNA 2J4DA 1AH2A 1O8CA 1G2IA 4CM3A 3MC1A 3GHYA 5DT2A 4YRJA 2QWXA 3UYLA 2XY4A 2IUFA 2X0DA 4C9BA 3ZYCA 4MO2A 3LT0A 2J0EA 4HEA1 2PD6A 2WDZA 3KM0A 3OETA 1QQ7A 4KVAA 4QEDA 5BV8A 3AEUB 3GFTA 3EWSA 5KNCA 4GKBA 2R4TA 2BBSA 3IKMB 1KJIA 1DTWB 1TU4A 2C2HA 3HSSA 4JXKA 4L75A 4OU4A 1YS9A 1MQAA 4WA8A 3WRYA 1G5HA 4EKDA 4ID3A 1E2UA 1E1CA 5ALHA 1PUIA 5HJEA 2VF7A 2Q1TA 1HTWA 4K3UA 4PLYA 4YP5A 4ZT2A 3UB3A 4C3ZA 5KOHB 4NNJA 2ZUDA 4F6CA 1MW8X 1GL3A 4WUVA 4AUMA 3QKIA 3AR9A 3DP7A 3TXXA 3ZV4A 2Z1NA 4C7XA 2CMFA 1UF9A 2PZ8A 2GR9A 1OZGA 3WIUA 4ARZB 3AKCA 4B6GA 4CIBA 1H3NA 1Z5WA 2O8DB 4OHRA 1IK4A 2JLAA 4I81A 2HIAA 4WTOA 5A9TA 1Y8CA 1PFUA 3KJIA 3MJCA 1Y3DE 3INYA 2XE8A 4RD0A 5AKGA 3RIHA 3SNHA 4Q1BA 4D6XA 7ABPA 1YL7A 2Z8XA 4DUGD 1G3QA 2J67A 3HHPA 1IVSA 5FI5A 1VCNA 1M0WA 1NULA 4GECA 4KDCA 1X1DA 2ZIAA 2PJRA 4JY7A 3F6CA 5EZSA 2DUJA 4EHIA 3TQHA 2WSLA 3MELA 4CIWA 1E94E 4JX8A 4URWR 3CTMA 4WD3A 4YDRA 1VB5A 4J0DA 3CPSA 1P8JA 3T3NA 1F06A 3HXPA 2QRHA 2NO6A 4DDHA 5M5BA 3HA7A 3NH6A 3P26A 1KQNA 3FWYA 3FPFA 1QCZA 3I64A 3FG9A 2OB1A 4Y9RA 4YUWA 1Z4MA 1EUCA 1OFTA 3ZCXA 1KL7A 2ZJAA 5DRTA 1JQKA 5T4BA 3RTCA 4YAKA 2XLBA 1DBRA 2X5XA 2DQKA 4MWCA 5HGXA 4XWAA 1AKRA 3WE7A 2RHGB 2HA5A 2QJOA 5B2FA 4RTLA 5BVGA 1URPA 1Y0BA 3INNA 3W2GA 1ISMA 3I2KA 2EKZA 3KYDB 5F2EA 5BWOA 1Y4UA 4JGIA 4KYIB 3HPRA 5JLAA 4TPKA 1ZM2A 2XUJA 1M6VA 3C5HA 4PG8A 4JI8B 1CFJA 3IIJA 3R8CA 4BB0A 2VRWA 3I73A 1HL7A 1P0FA 1VMDA 5IHXA 1L5LA 3ZBPA 5KSOA 1AK1A 4JWKA 1QHGA 2C5BA 1EE9A 3OWXA 3EZ9A 5ESXA 1AA9A 3IULA 3EARA 4WKBA 1L8AA 3GJQA 2HRQA 3WC4A 2WW8A 1GO2A 1X7ZA 5D86A 2D06A 5FTKA 5I7SA 3CZ4A 1KY4A 2NNLD 2WEKA 3R0IA 2EEZA 4IG9A 4BMSA 3CN7A 4BP1A 4QJIA 4OXKA 1RKXA 1D04A 4P5DA 4UM5A 5JSUA 1HQKA 2VRCA 2C92A 1YRWA 4IJUA 1G8JA 1J33A 4JI5B 2BFBA 2DBQA 1B14A 3AJ8A 3NBQA 3U3DA 4EA8A 2Q3HA 3GJYA 3KTDA 4EHJA 3QMWA 2BGTA 1L0BA 1X13A 4NC9A 3DW1X 4EYOA 4YDSA 4KPYA 3ND7A 4ZO9A 1GTZA 1SHTX 1WB6A 2CWWA 4WNAB 4B76A 4EL5A 2ZUSA 2ZKLA 4GRAA 3TFWA 3IBSA 4CMKA 1E7YA 1N0WA 1ISPA 2D2VA 2I66A 2VS1A 2XAUA 3LOQA 3GF4A 4L2IA 1PL0A 4HXGA 3MN1A 1DPGA 2EJWA 4IDQA 4W7IA 2QD2A 3SXJA 3W5SA 1OYWA 2G9NA 5FNVB 4M9QA 1ZU4A 3HKEB 1DCFA 1WDLA 4HFNA 5REQB 3LQ4A 2H1HA 1XRQA 1NI4A 3K2QA 3H04A 2DHQA 3BCHA 1BYIA 1R16A 3VSDA 4KWCA 3SQMA 2ZZMA 4V0QA 2XB6A 3LHSA 4ZCRA 3SWWA 4IDFA 5IH3A 2G4CA 3R3SA 4JJEA 4N18A 5EWJA 2KBEA 4MCHA 1LPPA 1EXDA 2E37A 1OXMA 3HPQA 3OIUA 3H87A 5LDGA 1L6RA 4JUAA 1JGTA 1W5BA 5JCPA 4MB0A 2CFIA 1IH8A 3EGDB 4Q24A 3WLMA 3ZHVA 4QELA 2JI7A 4F06A 5KTTA 1EFAA 1IB6A 1J06A 4Q1EA 2P77A 3DXXA 3IB6A 1KPHA 2AW3A 1FX0B 4K9DA 3GMSA 1W2GA 3HVKA 3MGGA 4IINA 1U31A 4PZUA 4B7ZA 2Q5QA 1PEYA 4P34A 4XB2A 2XOKA 4HLQB 5F1PA 1ISFA 3PB3A 1I9CA 3P96A 4GOOD 3G68A 4ZJUA 2ZSFA 3CX6A 2ZWIA 3TZKA 3I42A 2HSJA 4MV1A 4BPRA 5K7SA 2PE5A 1O6FA 3FW1A 1J00A 2BE7A 2DCUA 3PQFA 1Y5LA 5C1OA 2GYUA 2IA5A 4FILA 2W98A 3SM9A 2OR3A 3EAQA 3SLGA 4EL0A 4QQRA 5HCIA 3TZQA 3E3OA 4KQJA 1HLDA 3VV2A 4RIFA 1DWUA 1KVSA 2IP1A 1HE5A 3QLJA 4KLZA 1V8DA 1V3TA 4MWZA 3JYNA 1L5WA 2WUFA 4DSAA 4TYWA 4NH4A 3FYTA 5L4SA 3K15A 1VPEA 3EFOA 5EJ9A 3QE9Y 1IVYA 3VPDA 1IBKB 4LBZA 2OFFA 3EOAI 2WJJA 3DE6X 4G85A 3CIOA 1CEYA 1O96A 1P60A 1YBMA 3WKBA 1Y63A 1WUIS 4MR9A 4WEOA 1RZ3A 2XCIA 3K9LA 2BUBA 1CF2O 4YVFA 1R0YA 1XEXB 3Q7IA 1U2DA 4BX3A 1YHYA 2DKOA 2EP5A 1QPBA 3NEPX 1U5BA 4O1HA 5FR2A 4M98A 1U3FA 3IDFA 1EH5A 3MGCA 4GF5A 3U5TA 1DRKA 1KGSA 3FB4A 3RQSA 2ERYA 2Q2VA 3QVLA 4OU5A 4PBRA 4YQEA 4QBGB 2V6JA 3FPJA 3W8DA 3GBSA 3EWIA 5EMLA 3PFBA 3CNEA 1XZDA 1GEGA 2IELA 4ZPXA 1N5MA 4CIXA 3UCFA 3HSYA 3BIXA 1XP5A 3VYTB 2XUZA 3JZAA 3FKJA 1RAAA 3E9ZA 2B34A 5A4JA 3OF3A 5JVDB 1AUOA 3LCCA 3I62A 4KQ9A 3S1LA 4CODB 1RYEA 5T4HA 4ALMA 4EB8A 1BWQA 1D1SA 1FJ2A 5EI5A 2D8AA 4EITA 4OX9Y 2DSTA 2LIVA 1IHUA 1JEDA 3ZD7A 4FI3C 1KE1A 2GERA 4YCAA 3TNYA 1NXVA 2ZJBA 3DZIA 3ZJYA 2QUIA 4W8GA 4YRRA 1JSXA 4UZEA 1WBJB 1Z8DA 4A6XA 1OXTA 1QQ5A 2PWZA 4W8HA 5IDYA 3WK8A 4TWRA 4UNRA 4DQXA 1Y1SA 1ONBA 1N5KA 2ZTLA 2XLCA 1XZEA 4GXQA 3AJAA 2XUFA 2O19A 5BSHA 3PEYA 3PD7A 2FDCA 2NU7A 1DQRA 1WPRA 3AYZB 2FEMA 1XIVA 4HF7A 4PE5B 4YGXB 5E4YA 1OR8A 5TQ2B 3M6FA 3B7PA 5IT5A 1EUDA 1XN4A 2ON6A 2Q9AA 2VF5X 4GMXA 4XX0B 3RF7A 3NFRA 3SF8A 3UJCA 3VOTA 3JD1A 4BFXA 4DCJA 1LB1B 1U8EA 3GCZA 1GAWA 2Z1DA 1K3UB 1GZDA 3G6WA 3LZDA 1NN0A 1WWKA 3F9IA 2V7WA 1PGOA 2WVJA 4IDBA 3AFNA 2XIQA 1XEAA 4N82A 1T0BA 2OV4A 3F5FA 4WERA 1WPQA 2WIDA 3I4FA 1E1NA 4UTOA 5TPWB 4UM9B 3ZR4B 2LTAA 3HKCB 4FE7A 4OSOA 2C2YA 3EPLA 1Y8AA 2C4UA 1RCTE 2G25A 4IDAA 2EG5A 3CISA 2VZ0A 2ZB3A 1E1YA 2ZRIA 4Q02A 3FCYA 3HKBA 2HNKA 1JLLA 4QQFA 2Q28A 3BGSA 3FWNA 3QMPA 3FZNA 3RT1A 1XZIA 1KDVA 2M98A 4ZOBA 1KERA 3OTGA 1SKYB 4HWGA 3TNJA 2NZVG 1U7HA 1BFDA 1HMPA 2N3ZA 3CF6R 3FF1A 4XH9B 1Y8RA 2R2GA 1I3LA 5LA6B 2ZSKA 1C2TA 5JCJA 1SY7A 1N6HA 4LYFA 1KI6B 3GFSA 1GITA 1H8HD 1QGUA 5THQA 1EEHA 1R74A 1N36B 4GPAA 1XZCA 4HC4A 5DV9A 3VR6H 2ECFA 4G0ZA 4BPBA 2FPUA 2C31A 1D2MA 1KDPA 1K6JA 3T4EA 2IYPA 1PG2A 4ALLA 4UU0A 3I9OA 2O48X 2VC2B 4DMHA 1AHIA 1JIXA 1ML3A 2CD7A 1UZMA 3EA5A 1R64A 1X77A 2PVSA 3GNLA 3OE7A 4WK6A 3GCXA 5IVIA 3RRZA 4A8HA 1F51E 3W5UA 2QRJA 1DELA 1LLFA 1Q20A 1QANA 5CH5A 4P32A 2NXWA 1G5TA 4KO8A 4XWOA 1JR3E 3R4VA 4QLBA 1W85A 1AQ6A 3CLHA 3CRMA 1I2CA 4E4RA 3EXIA 2C20A 1RXWA 5K09A 3U4HA 1F0YA 3A32A 2H5LA 4IF4A 4M6WB 3H2YA 4D3ZA 4WIAA 1K5DA 1W4RA 3O1HB 1GNVA 3QYAA 5AW0A 4MP6A 3QY0A 1Q0LA 2IU3A 1VYUA 3BMNB 3JQFA 5TX7A 3WSWA 2OGUA 4ALIA 1XO1A 1NZDA 2HJWA 3DEIA 1AT1A 1C7QA 4RF3A 4Q9KA 5CK4A 2XMQA 2DH6A 5K2MA 3TMYA 1C8BA 1VKZA 3R7NA 4OUDA 2GJ8A 1NVWQ 4L9WA 4OIFA 3UGTA 4BZWA 1MP0A 3I92A 4GGPA 4KCGA 4TWJA 4D41A 3GFGA 2IXGA 4EGQA 3A4LA 2B61A 4E51A 4QT4A 3KFLA 3F47A 3QBVA 3IJEB 5JPCA 3JSXA 3NC4A 4WH0A 3SYLA 3C1OA 4JI3B 5IT9A 5ESDA 3BEDA 5FXMA 3UMYA 1JAZA 4MVCA 4AMUA 2VWQA 5I7UA 1JE1A 4Z8XA 5GAJA 4OHWA 5E6SB 3F0TA 2DULA 2J6BA 1ZGCA 2M2IA 2PX2A 3A6HA 1LI5A 2VYNA 4N0DA 3VDXA 2J3DA 3OCJA 3JPWA 1U5AA 3DLCA 3TMKA 4GX1A 4JKOA 1DXOA 2J4FA 3B53X 4D3FA 5LYJB 1QV6A 2FWNA 3BUSA 4QSHA 4EDFA 2FOIA 1SA0B 1ISJA 2BCJQ 3MG9A 1O95C 1B16A 3HR8A 4H77A 3X1KA 4CQJA 2HWUA 2AFHA 3E5NA 3PNMA 1IN1A 3AUKA 2FPOA 2W0MA 4MVJI 5KQGA 2P2GA 3N75A 3QU9A 5HIJA 4CIDA 3FPCA 4DRYA 2BFDA 3G1TA 5J9FA 3GDGA 4NK5A 4NS4A 4ES6A 1PW7A 3EBLA 2O2HA 4FKZA 3LPCA 4F5EA 1MABB 4LBVA 2HRRA 4QBFA 3KK0A 4NECA 3GAMA 4P38A 5BUSA 4Q4AA 1ZA2A 2ECPA 4BVKA 6GPBA 2UZ1B 4M0FA 2CWDA 5HQ3A 4BO8A 1QH0A 3GEEA 3KVNA 4IZIA 3ANMA 3QRWA 1KQ3A 4DCOA 3TPFA 1L5FA 1Q1QA 2SECE 4X7PA 4B6JA 3CO5A 4P0TA 2RGDA 1NF9A 2MHCA 4OJQA 5CA1F 3I2JA 1HV8A 1ZJWA 1TQDA 2P2DA 4BCDA 2I65A 2H7CA 1PQYA 2AWNA 3ZUPA 3BT7A 4XVCA 2BR5A 4Y2QA 1F8XA 2F9MA 3FFAA 5T5QA 3UJ7A 3WK7A 5I48A 4MPPA 5KYWB 2OHHA 3N28A 3E48A 1JIQA 5CVUA 5B7GA 4WY8A 3P9YA 1DKUA 3ADDA 3Q11A 4IOKA 2QE7D 3PPVA 2PJZA 5K51A 4BNTA 4JB2A 5CEEA 5DX1A 5ES4B 1OXKB 4LMPA 4QZVA 1R10A 3F3YA 3H1EA 2WIAA 3L7LA 4L22A 1F0KA 3GLHA 2ZS9A 2GXSA 1I3MA 2QUAA 1T25A 4EUFA 2BEWA 2AZXA 5ESRA 4TV9B 3RKSA 3EPPA 5HX7A 2VH1A 5BWBA 5JVDF 3L84A 2HA7A 3PHLA 4M22A 3C5CA 4NBSA 5L3ZA 3W90A 2FQYA 4YYEA 4E5SA 4MGKR 1KU0A 1K63A 4MICA 2RGCA 3UENA 1FRNA 3K70C 2CNKA 2QSZA 3ZX4A 1NP7A 1Z28A 3WLPA 2GK7A 2WG2A 4MYSA 4KK4A 3VZPA 1CP3A 1NJ6A 3NDPA 4MKRA 2GEJA 3C3BA 4YT4A 1XX6A 3MBIA 1SXIA 3RVNA 2F3QA 4UREA 3RBZA 1MTZA 3N70A 3VU8A 4P3OA 1C3VA 1O97C 1N0HA 1ZFNA 1D4ZA 3BGOS 4NBUA 5C0OE 2ZIUB 3SFVA 3WRYC 4F9TA 3GNQA 4MLZA 2RAFA 4MV9A 1FPMA 2PFGA 5T57A 2VF4X 1NXPA 4ZOCA 5GY7A 3N8NA 4ZQEA 2RGWA 3OZVA 1GV0A 3M7IA 2VYQA 4XCXA 1D0IA 3U19A 1ZUD1 3NJ4A 2XDQB 4Y3UA 4QBHA 4AUNA 4Z7OB 5DKFA 2FSUA 1SBYA 1A88A 3RFCA 1G19A 4MO9A 4I4NA 3RWOA 1GZ4A 3VYVA 2CE2X 4YX9A 2AG8A 5LXTF 3IOCA 5CUQA 3WLKX 1XDBA 1ZD9A 2C4TA 2VYVD 1RKVA 2G40A 2XHZA 2A57A 3R0XA 3TZHA 4J7CA 3T1QA 1DDOA 3OZRA 1AGPA 4BKPA 2XNKA 4NICA 3NEJA 2A67A 1W46A 5JJBA 2B2XA 4ZQBA 3FSJX 2NN3C 1G1MA 5LKRA 1AUQA 1L1QA 2C59A 1UJNA 5GJVC 1E62A 2I67A 2JH3A 1CQJB 2XQIA 3C74A 3MAJA 3X1MA 5FWNA 1KFKB 3REGA 1HQCA 1I7QB 1RWNA 2YJ6A 1OBVA 3PPIA 2IV7A 4FS3A 4UHJA 4ZOLF 3MCWA 4WJKB 1I9GA 1TK2A 4EY8A 3U7HB 5COAA 1UK9A 4RHXA 2D0IA 5BWLA 1W93A 2YICA 3HZHA 1QFZA 2QXYA 1Z6ZA 1AXEA 1DJOA 3HYLA 2RI0A 1XU4A 3PJFA 4R01A 1HSZA 2ILVA 3H5VA 4J94A 4M1ZA 4O2BB 1D2GA 3IUMA 3Q0TA 3M9XA 1JBEA 4GT1A 3MMSA 3NGMA 4DJJA 4DJDC 5ITZA 4LDNA 3DDZX 3H5LA 4G0OA 1DZ3A 4MB6A 4EHLA 1T2VA 2JJQA 1R6UA 3CH5A 3ISTA 3COJA 4GEGA 3MCTA 3GN1A 3WJ7A 5LBUA 5AKJA 3C4QA 3ZDBA 4MZDA 1KETA 3EVZA 2G3YA 5MDHA 1SBQA 4PCUA 1GFZA 1WSWA 221PA 2QTHA 2OKGA 4I08A 5KC8A 1PU2A 3U7QA 1EJ0A 4RTRA 4RTOA 1T8RA 4Z4GA 3T61A 1XDWA 1AQJA 3E0QA 4AFNA 1MZVA 2FUG1 4C0AC 3UATA 2YWRA 4L28A 4Y98A 1VJTA 1T13A 2DXIA 2I6QA 1N2XA 1QM5A 2VDQB 4I1VA 4Z54A 6AT1A 4G9EA 3TIIA 1BA3A 2CVFA 3EIEA 2XUPA 2ACWA 4FX2A 3WI7A 2X9GA 1KMHB 3OCVA 4MPRA 3C8ZA 1H4VB 4IGIA 4P84A 4K46A 3BDIA 2AFIE 4TYMA 1Z0AA 5DK4A 5FKJA 2EFEB 2GKGA 5BN4A 2G6BA 4C07A 1IXRC 1TEHA 3IP5A 4CMBA 4G8DA 2VL7A 4M1OA 3SMVA 4BASA 4XQGA 4TTPA 4U9IS 2EWWA 4A1FA 3IOEA 3C6XA 1PNQA 2DFVA 4BE9A 3FSEA 4ZHQF 5HRUA 2IYAA 2AN9A 2E4YA 1F3LA 1L7XA 2JHFA 3RF6A 1H5QA 2BZ1A 1SIOA 1Z74A 3IV7A 3JZDA 4EA7A 3L79A 1CRLA 4C6TB 3LY7A 1ZMBA 1Z2CA 2QSYA 3DE0X 1CUAA 4H7DA 4WACA 2SBTA 1R5BA 2IPAB 3DM5A 5A0FA 1GG2A 5E4TA 4D9GA 3QFRA 5TJ9A 4NPAA 2D6FA 4HQOA 1VHQA 3A9VA 4CV3A 4EHNA 3C41J 2N0SA 4QU8A 2VWPA 2H92A 5D2CA 4CM8A 4QXRA 5D00A 1C3XA 4FMDF 4FHDA 1O87A 4PO1A 2ZRHA 1FA9A 2C84A 2H48A 3ODGA 5DDIP 1PJ4A 2O50A 1I2BA 5FPHA 1WXXA 4JLWA 1XNJA 5G53C 1OI7A 1YGYA 1XEFA 4ZN6A 3C70A 2OHIA 3ZVLA 1GAQA 2B4QA 1DZIA 3VOSA 1G20B 2Y2VA 3BXXA 1I33A 4S1WA 5AVSA 3B7GA 3GT7A 5I9TA 4LBWA 4UUNA 2X58A 2H4JA 4XQ0A 5CPFA 4OJNA 3P9QA 4RY0A 3AEQA 3PQ4A 3GLQA 4K6CA 4KPUA 3SHWA 1NNEA 3R9XA 2P30A 3OJLA 4DG8A 1D6NA 3DMPA 2VO1A 3HZRA 1YOVB 5GMOA 5T4FA 1Q3HA 3NETA 2XQGA 1FU7A 1C0EA 1UR5A 2Q5LA 3ZE8A 5BR4A 3HZOA 2D5BA 3HXMA 1ZMXA 1PR0A 5B3LA 2ZU0C 3VR5H 1N6RA 3ZV3A 3GLIA 4PX3A 1T3HA 4Q3OA 1DG1G 3SJ7A 2REXB 1Z4KA 1BA2A 2FRVA 1A76A 4UVEA 3P5SA 3M1IA 5KUTA 5F7ZA 3PT5A 4FM9A 4EOGA 1MDBA 5D6OA 3AI3A 3ZY5A 1PEDA 4KHPB 2FP4A 3QFSA 4RKWA 4JQOA 5B1HA 1U2DC 1Y89A 4MKXA 1HO3A 1LLQA 1E32A 4ZK2A 4QM6A 1JQJC 1JHZA 1K8YB 5I7AA 3A31A 1Q77A 3ZBUA 1CUSA 5C3MA 2NUTB 1BDBA 4IILA 5BR8B 2GAOA 1JVSA 3DOIA 3VR4D 5I8WA 4H31A 1D4FA 1YJAA 4OGGA 5DHQA 3DHNA 3AM3A 3PPXA 1D6MA 4FJ2A 5BSTA 1E7QA 3K6SB 4YAIA 1G7CA 2WOOA 4KRFA 3QVJA 1RJGA 3KTFA 2BUAA 1YMVA 2PIDA 3COPA 4ZAVA 1N9GB 2ZJ7A 2VHCA 2B98A 2AZDA 2XF2A 2XMRA 3HJRA 3PUZA 4AJ4A 4RNDB 4UMDA 3NO4A 3KT6A 3HNOA 1SCBA 2QMQA 4GMDA 5KVAA 1UPUA 4YONB 1KBOA 4GFDA 4G65A 4TL7A 4YAOA 3B9PA 1BGXT 1JPNA 1R3UA 1SUSA 1U9YA 2EQAA 3MSXA 4BMCA 5CIYA 3D0OA 5ER6A 4MPTA 4V0MA 1A9ZA 3ZDQA 3CR8A 2HH9A 3ROMA 4DM4A 1JJIA 3E2PA 4HUQB 1L5SA 1FDRA 5BSMA 2FZVA 2Q0SA 2PD3A 3AESB 2DTDA 1JR3D 1O4VA 3H0EA 1IN8A 3G2HA 4O1MA 4XM1A 5IBQA 4MS1B 1G5IA 2IY7A 1GV1A 4X7BA 2EV9A 3RTBA 3F9RA 4X6XA 4JDUA 4CMCA 1VIAA 4DNXA 5K3FB 4BECA 1VDMA 1XXHE 2PCLA 4FN5A 4R1OA 3TSZA 1OFUA 3COWA 2OCYC 5HUHA 2P6RA 4GLBA 2A0FA 5LCXA 3RSCA 4DZRA 1EX9A 1SK8A 5FOWA 1W5TA 5EMJA 3RUIA 4LYAA 1Y98A 2XE4A 3JQ6A 2GJ4A 3L1IA 4KWEA 4FYKA 1ETUA 1SN7A 3L1JA 5JDIA 4GPZA 5H8WA 1T9GS 4Q6BA 4K1LA 4Z9BA 3U81A 2J9FA 2WLTA 4HN4B 2R8RA 5DHRA 2YOHA 2H4XA 2ZT5A 4BE4A 4KIGA 1J2EA 3NC0C 1P81A 2LPMA 1G16A 2ZAMA 3R44A 5C5DA 1LGYA 2P62A 2C2KA 2CDBA 2QK4A 2CDCA 3O9ZA 4KH0A 3ZXUB 4LJ5A 4FR2A 5C51B 3KQSA 3AVXA 2WFAA 1KKMA 1RXIA 1NBOA 3A6EA 3CPJB 4I4CA 5DBGA 1USGA 2JCBA 1S8AA 3CB2A 3MERA 3OKPA 4O2BF 3NEAA 4MRVA 1RS0A 1VBNA 3HGTA 3V55A 3ZNPA 1PO7A 4ZYWA 5AD1A 5L45A 3PXGA 1R6AA 2BEVA 1NHGA 4M3NA 4R1TA 5DMXA 5DYTA 1A50B 1ICEA 3EQ8A 1V16A 4C05A 4Y1GA 5JZ9A 4ASUA 4OBEA 5TB5A 1HFKA 2PU5A 3VXKA 5DTQA 1XQYA 2EU8A 3O82A 4IWNA 3P0IA 1SXJE 4C7JA 1NASA 3HCBA 4DLAA 3QSYA 1M1YB 1TVKA 2GPSA 3B6JA 4LYDA 5B3JA 4D56A 3BD9A 2HRDA 2VK2A 1UOPA 2Y1WA 3I72A 4WA7A 5HJ5A 4KYUA 3EZXA 5LZ7A 1I0IA 1NXOA 4UASA 3Q8KA 5BWMA 1IMJA 1GNQA 1PAUA 4WFKA 421PA 1SHZA 4XXHA 2Q6LA 4B81A 1M2NA 3ZV7A 4XQCA 5E7JA 2XMGA 3DYVA 3ZW9A 3GGDA 2OV2A 1Q1BA 5C7LO 2RONA 3JD3A 3NYIA 4BN4A 2FH5B 4R8SA 1FB5A 2HWKA 2RJ3A 3QW2A 1F2UA 1CJKC 4BNDA 1ZCBA 1TT7A 4L6CA 4FONA 3JQFC 3O93A 1YE3A 3GFBA 5HIIA 5AJUA 3L8FA 3IVGA 3FHJA 1PFQA 3OM8A 1GPAA 1KMIY 4L3VA 3K9HA 4P2GA 1G17A 5GVRA 3UKOA 5BMVB 5BN3A 3LG2A 1Q1ZA 3WLNA 3VVCA 1OHHD 3BTOA 4HSGA 4M8LA 1RBMA