5DJ5A

Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
b'GAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Destabilization of strigolactone receptor DWARF14 by binding of ligand and E3-ligase signaling effector DWARF3.
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 90
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dj5A00
1UZAA 3FYUC 3O0DA 4OD0A 3E3AA 2ECFA 4X7BA 5KREA 1NU8A 4DTCA 2XMCA 2OAGA 2WU3A 3HYSA 3BL8A 1JJBA 4QDTA 5AI6A 5T4BA 3D2CA 3H2JA 4IH9A 1IZ7A 2NW6A 4QNNA 3I2HA 4Y2QA 1NX9A 4PSUA 3WK7A 2O7RA 1MAHA 4OB8A 4J3JA 4PSDA 3B12A 1YCDA 1DX6A 5ALWA 3WKBA 3WWEA 3W05A 5ALTA 3ZI7A 3PF9A 1QIJA 3BJMA 3QM1A 4LIPD 1GT6A 3RM3A 3I2FA 1ZIXA 2V9ZA 1FFDA 4EUSA 3JWEA 1E8NA 4ZI5A 1UXOA 3AINA 2J4CA 5ALIA 4AB1A 1O6GA 3VISA 1P0QA 4C4ZA 5AO9A 3WWCA 2HA7A 5LZ4A 1WM1A 3FSGA 5LZ7A 1TKRA 3H1AA 1DINA 1HKHA 3WL7A 5KWIA 3IUJA 3H2HA 5BWBA 4KE8A 5AJHA 4Y7DA 1HLGA 2QVBA 1LPNA 4L3WA 4JNCA 3HXKA 1ISPA 2XUPA 2OQVA 4AO6A 1JJFA 5JD5A 1CUJA 3G9UA 3OURA 1NU6A 3LLCA 4J0CA 1VXRA 3FCXA 2JIDA 1EDBA 2OGZA 3LCRA 1CUXA 2VT6A 3TRDA 4MEBA 5ALGA 3V1MA 1QO9A 4C89A 4C87A 2O7VA 4WY5A 5EHQA 5ALVA 2WFLB 3D2BA 1XZFA 4XVCA 4BE9A 5AOBA 4MQMA 5AI9A 2HFKA 1E8MA 2WFZA 4JUIA 1SOMA 2XB6A 2Z8XA 2H7YA 3DKKA 2WUDA 3I6MA 4L9AA 2XQKA 3K9BA 2ROQA 2HFJA 3O9VA 2C0PA 2WUEA 2RGUA 2CBGA 5AI4A 2PSEA 1CR6A 2ZVDA 1QIKA 1YB7A 3SK0A 4AZ0A 1R3DA 1YSCA 3G0CA 2XUJA 5DNUA 4FLMA 4UHEA 1QTRA 3W9UA 5K3EA 3GELA 1U2EA 3DDUA 5HQ3A 1BEEA 3HC7A 3QITA 4IH4A 2WFMA 1VA4A 3N0TA 4B9EA 2QJWA 1XRNA 4BAUA 1QE3A 2Y6VA 3WMRA 4B85A 3WLAA 4GBGA 3VVMA 1LZKA 2IX9A 4MXDA 3DCNA 3EIOA 3R0VA 3DJYA 5HZGA 3WZMA 4UBIA 1QIEA 3H2IA 4U2DA 1GGVA 2ZSIA 4I4CA 3CCCA 4IHAA 1VOTA 2ORYA 1A8UA 5HF5A 2HL6A 1MAAA 3BDIA 3V1KA 5A7FA 4C4YA 4H35A 5EIEA 1T2NA 4UFOA 2C58A 4DMHA 3I1YA 4NVRA 2WJ6A 2XMRA 4MYSA 5AK6A 5AK3A 4CG1A 2H9YA 5AKXA 3F96A 1FFCA 3ANTA 3F8SA 1HBJA 1CUDA 5FLKA 5I9IA 2XQGA 1XZJA 1EVEA 5JD4A 5C81A 2JF0A 1C7JA 4K6KA 4ARBA 1QFMA 3STUA 5SYNA 5LZ2A 2Z5GA 1IMJA 1W76A 1AMNA 3HSSA 3OG9A 3DQZA 1YA8A 3TJMA 4CCWA 5FUMA 3MUNA 1QGED 2XUFA 1E66A 4P9NA 5JZBA 4OU4A 2HA4A 1BS9A 1CUSA 3WJ1A 1XZDA 3Q8WA 4WDRA 3C5VA 5HK8A 4AX4A 5DNWA 1A88A 3L1JA 5YASA 2LIPA 4HRXA 4N5IX 1MJ5A 3BF8A 1W4LA 2QM0A 3KWFA 2XQIA 1XRQA 3CCBA 3IUNA 4C88A 2IITA 5FDFA 3IULA 4F60A 1DTEA 5FOQA 2CUTA 4BDSA 5JATA 3KWJA 4RGYA 1WHSA 1LPSA 3I2JA 1K4YA 4LKOA 1CUBA 3G7NA 4HAIA 1VZ3A 1JMYA 1XLUA 1ZI9A 1H23A 1LBTA 5CT5A 3GROA 1AX9A 1XRRA 5JADA 5HFNA 3D5EA 1BE0A 3IA2A 1QFSA 3QYJA 2BUBA 5ALSA 4BVKA 4W1PA 3UUFA 1VE7A 5ALUA 1N5RA 5CTAA 5ISMA 4CCYA 4DNOA 2XUIA 2QXTA 4Y2XA 4Y2RA 4EY8A 3QBJA 3ESAA 4H7EA 2WHPA 2ZYRA 3F97A 3QPCA 2I3DA 1ZJ5A 3LIPA 5AM5A 3V48A 2D0DA 1Q83A 4Z49A 1RWQA 5C8VA 3D4LA 2W6CX 4IQ4A 2QT9A 5JANA 4B9AA 1R88A 2QJRA 5E4JA 3ZWQA 4AXBA 1RYYA 4AZ3A 1VA5A 5K3BA 4GXNA 5AI8A 4X00A 3EQ9A 3M3DA 4LXIA 4U2CA 1XQYA 2JGLA 4XWGA 2OGTA 2XMDA 1QIIA 2J3DA 3DYVA 3PFBA 2XDWA 2VQ6A 3AUKA 3DLTA 1A7UA 1XZMA 5AH0A 1QIGA 3AIOA 4MYDA 2PL5A 3WK9A 4J0KA 3V1NA 5EHXA 2VAVA 5K3FA 2E3JA 3DYIA 3RLIA 2HA0A 5ALOA 4G9EA 4AO8A 5AKHA 4G4JA 3ICWA 2ACEA 1F0NA 1M33A 4NZZA 2PSHA 3I2KA 5JASA 1J1IA 2C7BA 2VJCA 1W1IA 3R3VA 1BN6A 5DLPA 4C01A 3D59A 1AGYA 1THTA 3G9XA 2QOEA 2XMSA 5D3KA 2ZSHA 4GW3A 3MVEA 4B80A 3HRHA 5T4HA 3NUZA 1MPXA 1XZHA 3I6ZA 4J0IA 3STYA 1FFEA 4KAJA 5AK5A 4H18A 4J7AA 3R41A 5J3JA 1AURA 1UK7A 4ITVA 1XRPA 3DS8A 3VJKA 2DHDA 3PICA 1JMKC 4A5SA 3WL6A 4W1SA 2XMQA 2G63A 4ZXFA 1JI3A 1BCSA 3BWXA 5F4ZA 3RARA 3ZV7A 5CBKA 4MEAA 1CUFA 1ODTC 5HKBA 4P08A 3FWHA 3V1LA 1P0IA 1EK1A 1XRLA 4BTLA 2HHAA 2C4HA 3W06A 3WI7A 3C8HA 3GBSA 1VZ2A 1ACLA 1UWCA 2XUKA 1YS2X 4GWLA 4KYVA 1GPNA 1MNAA 4PV7A 1K8QA 4FNGA 5T4EA 4PSCA 3EQ8A 3W2TA 2WJ3A 4BCBA 5IVKA 2EEPA 2JEYA 3QMWA 2V96A 2XUHA 1MO2A 2OPHA 4E14A 1UK6A 1XRMA 2WTMA 2WQZA 4QWWA 5ALZA 2YYSA 1GKKA 2G4LA 3C5WP 3H2GA 2QRUA 4KE7A 5JIBA 1G4HA 4Q3OA 3CN9A 4I19A 2QUBA 1WB4A 4KJXA 5DTIA 3QVMA 1KU6A 4HVTA 5ALQA 2GYWA 4BCCA 4EY5A 1J2EA 5AM3A 2J4FA 2RHTA 2AJLI 4INZA 5D3ZA 2I78A 4J03A 5FPPA 4FBMA 3E0XA 4LXHA 4C6HA 4I3FA 3QPDA 1A8SA 2RIPA 4IO0A 3WK6A 4Y9SA 3M82A 3DOHA 2GBIA 2QKYA 3PFCA 3RK4A 1ODSA 2RONA 1E89A 3WK5A 2ZJ6A 5K3DA 4UHDA 2RAUA 2JGKA 4DGQA 2I3ZA 4FMPA 1F6WA 5LIPA 2WILA 3O4HA 4K5QA 5AK4A 1R4ZA 3K2IA 4QDOA 5CRIA 3N2ZB 3ESDA 4PF1A 4IH1A 3FOBA 2XLBA 1P0PA 4Y2UA 2XMGA 4NS4A 4BP9A 5AM4A 1DWQA 2O2GA 2P8SA 2WTNA 4Y2YA 1MN6A 1GPLA 1CUYA 5AKZA 5D7BA 2I03A 2WG2A 3WWPA 3IB3A 1JKMA 2H7CA 5ALPA 3O9MA 1GPKA 2XQJA 1UKBA 3O4GA 5CW2A 4LHEA 2X8BA 5ALYA 1N5MA 1TCBA 2WKWA 4GDMA 3YASA 4MQLA 1FFBA 3PUIA 3H0CA 3STTA 3HI4A 1E5TA 4E15A 1IVYA 2HA6A 3I1IA 3KSRA 1VXOA 3AIMA 5ALXA 1ACJA 1IUPA 3ED1A 4X6UA 2XLCA 3K6KA 2Y2VA 1MX9A 3VJLA 3D2AA 5DTJA 4UHHA 1U8EA 3X3HA 5JALA 1K5PA 3BXPA 3IDAA 2HRQA 1RP1A 4UUQA 4V2IA 2OCKA 3A6ZA 2V98A 3FVTA 4Y2PA 4BCDA 1DT5A 2CB9A 4K2AA 1JFRA 1W6RA 4OUKX 2X76A 4ZWNA 3QMVA 3FYUA 5AKGA 3BIXA 3KXPA 4B82A 2K2QB 4KE9A 3WKEA 1BN7A 3VVLA 1CUGA 5DJ5A 4NMWA 4EHBA 2YXPX 4FKBA 3STXA 3DOIA 5AHXA 2PSDA 2BJHA 2WG0A 4B7ZA 5EIAA 4X85A 4M0FA 1XQXA 2BGRA 4AMYA 2AJDA 1R50A 2HU7A 1X70A 4B0PA 2XUDA 1XLVA 1YA4A 4BRSA 4QA9A 2JBWA 4JH0A 2AJBA 2Y2UA 4MWTA 5HQ3B 3WWOA 5AKKA 1H2ZA 5AOAA 3GFFA 3F9CA 5LKRA 1TAHA 3TGLA 4X90A 4UBNA 4MWSA 4YASA 4JYPA 4L72A 1CQZA 5ALNA 1MTZA 2OQIA 3AZOA 1O6FA 1UOQA 2ACKA 2VEOA 2WUGA 1CUEA 3NWOA 4EA6A 2DHCA 3I2IA 2Y1KA 1WPXA 1VLQA 5AIBA 1UFOA 3VKFA 4DSZA 1ETHA 2DR0A 3G02A 1H22A 1Q0RA 1XZBA 4UHCA 4G8CA 4EB0A 5A71A 3ZPXA 4BP8A 2PUJA 1R9MA 2YH2A 4X3CA 3G9ZA 2XQFA 4E11A 4YPVA 1WB5A 2XUQA 4EY6A 3A2NA 3TEJA 4H7IA 5HKAA 5JAOA 3WYNA 2RI6A 4JYMA 2CKMA 5HFAA 1QJ4A 3C45A 1GZ7A 3VXKA 2JGEA 3WL5A 1Y37A 1TK3A 2CZQA 1VKHA 1WB6A 3IUQA 4DMFA 4EY7A 4TVKA 4UHFA 5ALRA 4Q1VA 3A2MA 1TCCA 5AM1A 3EF3A 1A8QA 4G4IA 4H7FA 1LPOA 2GZRA 3STWA 5ALKA 1KEZA 3LP5A 3WZLA 4H0CA 4RE6A 2VT7A 1H2XA 4P92A 4DLNA 3BIWA 3NGMA 4K6HA 5JARA 3W9BA 1THGA 1F8UA 4AN0A 3CXUA 4E46A 5JAPA 3G0BA 1LPBB 4M0MA 3OC0A 2OCLA 4B6GA 2C5FA 4BDTA 5C8ZA 2QR5A 4J0GA 5ALEA 5DWDA 5ALHA 3R3WA 1UOPA 1KU0A 1OXMA 3H04A 4BYMA 2C0QA 1CUZA 1ZICA 3C6BA 5IKXA 2PBLA 4GHWA 3P2MA 1TIBA 3PUHA 3FLEA 3O4JA 1N8SA 3U0VA 1PFQA 5ALLA 4CCYB 4X6YA 3BE8A 5JAHA 3C6YA 1SCIA 4AMZA 2XUOA 1LPMA 4Q34A 4Y2JA 2WHPB 3A70A 4BVLA 1TCAA 5CXUA 3AFIA 1CUWA 4H7KA 3UUEA 2QUAA 2FX5A 5LYYA 4ZREA 3VDXA 2OLEA 4KR0A 1AQLA 4N8SA 4PNZA 1SCKA 1FSSA 3PI6A 4FBLA 5JD6A 2QMQA 2XUAA 1C7IA 1HDEA 1MX5A 4K6GA 2OGSA 4Q3KA 2JGMA 4L0CA 2VTVA 4BC1A 4ZV9A 4KAAA 5FRDA 4B84A 2WU4A 3PDCA 2HRRA 2D5LA 5EI5A 3R40A 3WA6A 3DKRA 4Y2SA 1YAJA 2OXEA 4W1RA 4LYDA 1T4MA 5K3FB 1CIJA 2QXUA 4WDQA 3S2ZA 1EDEA 1SC9A 4UBOA 1ZOIA 4HXEB 2WM2A 4FWBA 3FBWA 1PJAA 3F67A 5A7GA 3AIKA 4KEAA 1YASA 5K3CA 4OU5A 2HIHA 1G5FA 4FHZA 1IUOA 5A7HA 4CI9A 5AOCA 1J07A 2BUCA 4OSEA 2GYVA 1GXSA 3AZPA 4AO7A 1UT6A 2JGFA 3DL7A 1H2YA 2HA5A 3C70A 2ES4A 2WJ4A 5T4FA 2HA2A 3ZLTA 1ORVA 3EQ7A 1N1MA 3WA7A 2WUFA 5LZ8A 3PE6A 4ROTA 2DHEA 2DFPA 1JJIA 1BROA 1EH5A 1VJ5A 5AP9A 3IBTA 1ZGCA 1I6WA 5HF8A 2UZ0A 1GQSA 4UFNA 3AZQA 2GZSA 1EK2A 3WIOA 4RNCA 4EBBA 4PQEA 4FOLA 1WOMA 3FNBA 1EINA 5SYMA 2V97A 2JGJA 2J3QA 4GLBA 1JU3A 3I2GA 1DWOA 4J0HA 3BJRA 5AKIA 1UKCA 1CLEA 4BB0A 3EBLA 1CUCA 2CEKA 5FP0A 4UBKA 1QOZA 1CUUA 4HTAA 5C8XA 5ALFA 4KRXA 3KOOA 2HA3A 4S0XA 1DQZA 4TGLA 5ALDA 4TPKA 1P0MA 3E1GA 2Y6UA 3OPMA 3SX4A 3G0IA 3ESCA 4WFJA 5BOVA 3HLKA 3WKCA 2XT0A 5LLSA 1XQWA 4UPDA 2HU5A 4BZZA 3FSGD 4WFKA 3BF7A 1L7QA 1L7AA 4N5HX 1HL7A 2WIGA 3OM8A 6YASA 4G1FA 5I7UA 4CIAA 4DIUA 3H2KA 4H7JA 3JW8A 5CURA 1G66A 1ZI6A 1USWA 4N8DA 1LNSA 3C87A 1JU4A 3KD2A 2WLSA 2XUGA 5IVDA 1EHYA 2AJCA 3S8YA 1B6GA 5E4YA 3C43A 4CG3A 3MGAA 5KWJA 1BCRA 1R1DA 1QIDA 3WKDA 2PSFA 1K6EA 1R9NA 5ALMA 1EB8A 2HDWA 2R8BA 2B20A 4CG2A 2Z3ZA 1Y7IA 3I6YA 1XZIA 5KBYA 4UFPA 2BGNA 1CFJA 5AI5A 2WHQA 5AI0A 3IIIA 2PX6A 3FCYA 5K5EA 1LGYA 1MNQA 3L1IA 5IH7A 5LP1A 2C5GA 2VF2A 3FVRA 4FLFA 1ZD5A 2PPLA 1CUAA 3HJUA 3IVMA 2PKYX 1ODCA 2WFLA 3H19A 3G8YA 4OYLA 4HRYA 4X94A 1OILA 5EFZA 1EVQA 4D9JA 3HABA 1ZD3A 4BATA 1LLFA 1C4XA 4W63A 4X92A 5BWCA 1X2EA 1Q0ZA 3H17A 1E3QA 1WPRA 4F21A 1LBSA 1J06A 3JYHA 2Z3WA 1E8DA 2QTBA 4AN1A 4BC0A 4FFWA 4X93A 3ZLVA 3ICVA 2VATA 1OCEA 5ESRA 1BU8A 2X5XA 1QZ3A 3D0KA 4UBJA 1ZD2P 3B3QA 2GBFA 1XZLA 3QMMA 4HS9A 3BDVA 4Y2VA 5C7YA 1ZJ4A 3WIBA 2XMZA 3FLAA 4P93A 3DEAA 4Q82A 5AKEA 4WFIA 3WKAA 3KDAA 3QPAA 4ZV7A 3H18A 4U2EA 5EHNA 4FNMA 4A23A 2HADA 4ZGBA 5JYCA 5A2GA 1D07A 1DU4A 2EDAA 3ESBA 1CUIA 4BAZA 5CH3A 3M83A 3OOSA 2G5PA 1DT3A 4KAFA 3R3YA 1UK8A 1JT2A 3FYTA 4CFSA 3Q0TA 4DSAA 2B4KA 1CV2A 3AILA 4OPMA 3T4UA 1TRHA 1X2BA 4PW0A 3FYUB 3GUUA 3D7RA 3WL8A 1W75A 2YASA 4KE6A 2GYUA 4CIBA 4DYHA 1F0PA 5D6OA 5BV7A 5AM2A 1YB6A 2H7XA 2FUKA 3H1BA 2W22A 1L7RA 1Y7HA 1XZCA 1HQDA 3LIIA 4G4GA 3ILSA 5FXMA 4XJVA 1QONA 2WIJA 3E4DA 1QO7A 5CT6A 5CT8A 4O08A 1XZGA 5K3AA 2XE4A 1ORWA 4J0JA 4X91A 1Z68A 2QZPA 4XX1A 4QDXA 4BE4A 3O4IA 5FPQA 1LPPA 4JEIA 3G0GA 1QIHA 3SC2A 2R11A 2DSNA 4QZVA 4GI1A 3DL4A 1YS1X 1WHTA 1ZD4A 4BZWA 5HF6A 2VJDA 2VAXA 2VSQA 4XIIA 2WIDA 4B81A 2GBCA 5LKAA 1U65A 4GECA 5E2IA 4EZIA 3C6XA 5CXXA 1YR2A 1AKNA 1IUNA 1U4NA 5JZSA 2G5TA 3RKSA 4U2FA 1EDDA 3WJ2A 4ARAA 3AJAA 4EY4A 3OTQA 5EIHA 3QH4A 5I8PA 4UHBA 1S8OA 2IIVA 3UMJA 4DNQA 5IVHA 4LYEA 2Z8ZA 3LS2A 4BBZA 4UBMA 4BVJA 5AKJA 4WJLA 2OCIA 1EI9A 1SCQA 4FLEA 2WHRA 2CJPA 3FAKA 1W52X 5AKLA 2BKLA 3PF8A 5DYWA 4BTVA 3O95A 1QTIA 2O2IA 2EDCA 2BAGA 2WSLA 3R3ZA 2PU5A 4Q05A 5IVIA 3IURA 4DMKA 5AICA 1MT3A 2H1IA 3WK4A 4LXGA 7YASA 5AKYA 2AJ8A 1XKLA 1XFDA 1YAHA 3C8DA 2OCGA 1BRTA 4KACA 1EA5A 4QDUA 1ZI8A 4QE3A 3B5EA 5FV4A 3C6ZA 5CT9A 1UOOA 4QWMA 1MU0A 1HPLA 3HEAA 5H3HA 4X97A 1AZWA 2QS9A 1CUHA 3STVA 2PM8A 4Q3LA 4H7DA 4M0EA 1FFAA 5DYTA 1ZGBA 4F5ZA 4AQDA 4YK7A 4RE5A 2B61A 3HZOA 5E4TA 4YX9A 2DCMA 2PSJA 4BAGA 1EB9A 1UKAA 1DX4A 5JAUA 4OB6A 4W1QA 5EHZA 3GA7A 2XI4A 3DD5A 2VA9A 4FTWA 2HU8A 3WWDA 1UK9A 1BEZA 1AUOA 2BUAA 4G9GA 1XZEA 1VE6A 5CH5A 1DWPA 4HXFB 2OAEA 5LZ9A 1EX9A 4G5XA 4KRYA 1LPAB 3F98A 4G8BA 4OCZA 1DQYA 4X95A 4H7HA 2CMFA 1MX1A 3L1HA 1AC5A 5ALJA 2OG1A 2JEZA 3D3NA 5DNVA 3NOXA 4C4XA 1XZKA 1QIFA 3WK8A 2XMBA 4OYYA 1XZAA 5CH8A 3IUMA 5A62A 1CEXA 1G42A 5DYYA 4WY8A 1IZ8A 4BRZA 1XQVA 3ANSA 2ZJ7A 3M81A 1QLWA 2ONCA 3VJMA 1LZLA 1TQHA 2BFNA 4MJ3A 2BCEA 5HK9A 1B41A 3SWWA 3WYDA 1CQWA 3MUOA 4B83A 2DQZA 3ZLUA 4A16A 5EGNA 2WG1A 5HF9A 1XROA 3FLBA 4PO3X 3R3UA 4DM7A 2VJAA 4ETWA 2AXEA 3V9AA 4Y2TA 2FJPA 3W04A 2B9VA 4H77A 1CRLA 2FJ0A 1CUVA 2ZYIA 5A6VA 1CPYA 4FDMA 1H2WA 3QZUA 4OB7A 1SFRA 4DMCA 3WQHA 1WCYA 4DNPA 1FJ2A 5AM0A 1GKLA 5AIAA 4QDZA 1EXWA 4X6XA 4QEKA 1XLWA 2GBGA 2ZJFA 3A2LA 2ZYHA 2Q0XA 5JZ9A 1QIMA 4RPCA 2HM7A 4DNFA 2ZYSA 3GZJA 1GQRA 4W9RA 4HXGA 1Q84A 2DQYA 4B0OA 5LZ5A 4U2GA 4G8DA 4HZGA 4X71A 3T52A 2WIFA 3U1TA 4FFVA 1XKTA 3HACA 2PVSA 2O2HA 4WCVA 4F0JA 2PUHA 3R3XA 2VJBA 4ZRDA 5FKJA 4UBLA 2JGIA 1K63A 4QLOA 1ZIYA 3G9TA 2RHWA 5CMLA 2PU7A 3CN7A 2WIKA 3G0DA 5CT4A 4N8EA 4J0DA 1PV1A 3DNMA 4GEGA 3I28A 4U2BA 5HCUA 4QLAA 1CVLA
chains in the Genus database with same CATH superfamily
4DQDA 1NVGA 5L4NA 1WABA 3CUKA 3O0DA 5EJAA 1WAMA 1SZCA 1T8SA 2ECFA 1FX0B 1QCZA 1VIAA 2VOJA 3MYRA 1THZA 4MUFA 4P5DA 4X7BA 3ZUGA 3BXOA 2WWHA 3IR6A 2R6HA 3PYXA 5M04A 3ZZMA 3VAYA 1U1GA 1SCUB 1WF3A 5T4BA 1WKVA 1CZHA 2EFYA 4MR8B 4M21A 4GE3A 4R6XA 5CA1A 3G5AA 2Q50A 4N3CA 1O6ZA 2FWRA 4XXHA 3QTTA 2ZSKA 1UH5A 3IUSA 1Z5VA 5A4AA 1BXZA 3H2JA 1TVKB 4XJXA 1IZ7A 3KPVA 3FZQA 3Q2IA 4PX5A 5FBHA 4TKLA 4QNNA 4JHLA 1NX9A 3OIWA 1S2LA 1U31A 1Z6YA 2WSSD 4OB8A 4LF9B 2X1HA 3O90A 5D86A 4DLPA 3GC6A 3PNSA 1Y5NA 3K4QA 1XEXA 3AEQB 4K87A 1O94A 3RDPA 3U2QA 4C22A 3P1JA 2IHNA 3UPTA 2F9LA 3G59A 3FKSA 3ZQUA 1DADA 3T7KA 4W5RA 2VBFA 3S1LA 1JEQB 1VPWA 2AB0A 4BJ6A 1QYVA 2CLEB 3MGCA 5ALTA 1TVCA 3PSHA 3OX2A 4U7HA 4YPOA 4R68A 2Z9DA 2CMHA 3CUWA 2ZSJA 5INTA 5KTRA 3G2KA 3FAZA 3KS9A 3LDGA 4BWVA 4X62B 5EZYF 1E2PA 2P9EA 3EFOB 1TM4E 4EG0A 2I91A 1TD9A 2BFCA 2WF7A 5BRJA 4P0QB 1I10A 3C0KA 3ZKWA 4C0HA 1RADA 2E1RA 3PS9A 4LTNA 5MDHA 3GT7A 2ATVA 2CKDA 1KJWA 1DC6A 2VG8A 3BH7A 2E9SA 3K0CA 4H16A 2QX4A 3NDJA 4X1IB 5EZ5A 4AQ7A 1ZIXA 1G6Q1 3U4GA 4MQ6A 1ILWA 1KEWA 4I55A 5IAKA 1I7SB 4S24A 2A9FA 4ENSA 2B92A 3B8HA 3DZKA 3ND8A 3PYLA 3U4AA 1U8UA 4MMXB 3LJKA 3OE4A 1UXOA 2NAPA 2R44A 2VNHA 3NYWA 3FN4A 4FHGA 4PYOA 1FYVA 5SYAA 3BBPA 1ZH6A 3ZWVA 4GMXA 2H7VA 2VF5X 2R8RA 3F78A 4CWAA 2O4CA 1G8MA 4MO2A 1KZ4A 4I6EA 1L4UA 1ZC3A 1DBQA 1TT5B 1O95A 3WWCA 2O3QA 2CWDA 5LZ4A 1H42A 2OR3A 1DUIA 1JIIA 1Y42X 3Q3HA 4Y18A 5F7OA 5LZ7A 1G8KA 3JAWB 3KAKA 3H1AA 2REXB 1HKHA 1KETA 2YWEA 1W85B 2E0IA 3FGOA 3IUJA 5J2TF 4CCAA 4KI7A 5KWIA 2I1VB 2W2NA 4EB8A 4ISBA 3DXYA 1YI1A 3KB1A 3QVLA 4KE8A 2PQ6A 3S1AA 2O5EA 1BSVA 4RY8A 2PV0A 4KLCA 2BFAA 2NSLA 3IPCA 2ORWA 4WZ6A 2P6UA 1DELA 1P9RA 4X8HA 4AKGA 4XVRA 2HSEA 4J7XA 4G0NA 4M1KA 1AQUA 1M34B 3P9KA 4JEMA 2IY8A 3M7IA 4V39A 4XIJA 2P2YA 3VR5D 1B0UA 1L0BA 2X6QA 3PQFA 5KTOA 4PAWA 3PL1A 1TJYA 4LGCA 5EQDA 5GIOE 3PQ7A 4RTQA 4N76A 4NESA 1GSAA 4WX2B 1SUEA 4JGBA 4XLZA 1VSUA 1N3IA 2HV9A 3LCRA 4GC5A 4QJ4A 4ZMSA 2W71A 3A4VA 1ESZA 1TD1A 5C51B 2VT6A 3OZRA 2E4WA 1RWPA 2Z5LA 4MEBA 4N40A 5JH7B 2IPNA 3AGQA 1QO9A 1S02A 2IHZA 2P9BA 1LFAA 2BM0A 4ZVQA 4C89A 1JG3A 4KW7A 5TPZD 4HNTA 3TRHA 4NONA 2DU8A 5ALVA 3RC2A 2VJQA 5G0WA 4YONB 1Z4IA 1AO3A 1DO2A 3IHWA 5JSUA 3PV0A 2IUFA 3ROEA 2PKWA 5E3HA 1Z8FA 4XVCA 3P32A 2BEVB 3WYAA 2JIBA 5AOBA 5HKOA 1KERA 2GEUA 3DGFC 3HHEA 4C4OA 3KYDA 4ZIRB 2ZBPA 5BSRA 2O2XA 5DMXA 1KWKA 4C0WA 2HTFA 5KX5B 5HSGA 3RS8A 3AHJA 1H5NA 4G0XA 2FZWA 4B7UA 2ZTHA 2ERCA 3F8TA 2H7YA 3PSAA 4O8CA 2O1EA 2PUAA 1KFKB 1L5QA 3UMGA 2D8MA 2ROQA 5FLYA 4X1KA 2VQDA 3HGTA 2MSLA 1W1WA 1ECCA 1PR9A 2V7VA 1DSSG 1BXRA 1TEHA 2CBGA 2OYSA 1POXA 1Q16A 4FC7A 4FKMA 5AI4A 2AE1A 1RPZA 4F8EA 1HGXA 3RSFA 3TGWA 5KNDD 1ZK3A 3OLYA 5EP3A 2CXXA 4E5YA 3ZH9B 1AH2A 2X5KO 2Z6QA 3SK0A 3LY5A 1YQEA 1OBFO 1YSCA 1RM5A 4FLMA 1NBWB 4JKYA 1D4FA 3VNAA 4F85A 4IS3A 4UHEA 3SLGA 1QTRA 2DT5A 2YKGA 1OU0A 1VJ0A 2QLJA 3B6JA 4IG9A 2YZGA 4S1VA 5AQEA 3DDUA 2XYPA 3EVBA 1NQVA 2Z08A 5HWSA 4HNSA 1N7HA 3LC2O 4A2CA 3D5QA 3GNTA 4E5DA 4EG6A 3B1KA 3E2PA 4TWRA 1JWLA 2J46A 3LZ6A 4JFAA 3NTUA 5LMNB 1JT9A 2VDKB 1RHQA 3LKDA 4BO5A 2IHKA 1MLDA 3RUPA 4B9EA 3TE7A 2OYCA 3BB4A 4TYMA 4ECAA 1EMDA 2SKCA 2QJWA 3F9RA 1EM6A 2P2SA 3PHBE 1QGDA 4QASA 3IL2A 4MWGA 1L7MA 2R2AA 4EUEA 2WJIA 2PZMA 1K06A 1R6UA 1T1EA 2Y6VA 4E08A 3FTCA 4QBGB 1Y7LA 2EGGA 4MR9B 3UC5A 4F9TA 1Z4LA 4JXJA 3VVMA 5KJCA 3LLVA 4Q1BA 1PTJA 1PL7A 2N0SA 3RQIA 3IDOA 3JCZA 2OCXA 2WE7A 4J2OA 4MXDA 4WLOA 3JZMA 4ZAZA 4G56A 2KI5A 3VMFA 4CKBA 1RBZA 1NR1A 1GZ5A 3AI1A 3I83A 4URHA 2FPUA 3CZMA 4U7TB 2Q21A 3EODA 2C96A 3RUCA 2OFXA 3T3NA 2WDPA 1G8JA 1GGVA 1UBTS 3DLHA 4U3JB 1GLNA 5L3RA 5IJ9B 4HDRA 5SICE 4I08A 4KITB 4I9HA 4X66B 3CCCA 1T0BA 1YFKA 2O0MA 4LJ9A 1VRVA 4KPFC 1DKPA 1M7GA 2ORYA 1YQUA 8ABPA 4D96A 3RF7A 2BFMA 5HF5A 2Q4RA 1OXBB 2GKGA 3P0FA 4LVNA 4RA9B 4XE5A 3WSVA 3V8RA 1Q3HA 1O9BA 1DCTA 4I1PA 2ET6A 4OSOA 1J2UA 1Z8DA 4C4YA 3UBMA 2QMUA 3WYFA 5CFRA 4EG8A 3NBXX 4B3XA 1T2NA 4UFOA 5E6SA 3FPEA 1HV8A 1Z5OA 3KHSA 3NETA 1RWBA 3R5XA 5K0LA 3W4KA 2QD1A 4HX2A 4KFRA 3D64A 4KV7A 2IXEA 2PX8A 4AVYA 4CM4B 3EIHA 4QPDA 5IJZA 4O4HB 5FOWA 2PUBA 4DMHA 2JAXA 4O2LA 2NG1A 2QZ9A 4YAOA 1N5LA 2WJ6A 1C1YA 2PL1A 3H4TA 4GMHA 1JR4A 2ZYGA 1H0HA 3ZGZA 4WCFA 1GTJ1 1KHTA 4QHSA 1HTBA 4MYSA 3ADPA 3EFEA 1AB5A 2UZ1B 1UMBA 3WLFA 4QG7A 2ZTUA 4A6DA 2ESRA 1FU8A 4O4LB 1B8PA 1T2FA 4CG1A 2H9YA 2IEGA 5JWRA 3EW7A 2QI9F 1DC7A 5C80A 2PD3A 3DNFA 1UAAA 3OETA 4XB1A 2PD4A 3GP3A 5FLKA 3N3AC 3GJRA 5EYPA 5I9IA 3RKUA 5JD4A 3K9CA 1FNSA 4UM9B 3R7NA 1AGXA 2V6MA 4ARBA 3SS7X 2O3TA 3PVSA 4LBWA 4OKIA 4N3AA 1T9KA 5SYNA 1DDOA 5IUKC 5LZ2A 3Q5GA 1Z73A 2R6GA 2Z5GA 4EO9A 2HEGA 4DPKA 4EVRA 1IMJA 1HLPA 1W76A 3FHOA 3MMPA 1AMNA 1K7SN 1R5NA 2X2PA 2HQRA 4LEIA 4UCWA 3I61A 3EPRA 3IP7A 2I62A 2H29A 3TEMA 5BSGA 1T35A 1X0XA 3IS3A 3R6GA 2IZZA 4URUR 4E0BA 2IXDA 3FR8A 1YO6A 3EYAA 3O93A 4IHQA 1GAWA 4YMGA 4YHHB 2EFHB 2YFHA 3L0BA 4NC9A 5K3OA 1TQ6A 2O3JA 4KBYA 4BN4A 5FUMA 4RULA 4W8OA 1CJVC 4ZZ0A 3N2NA 1SCAA 1SXJB 5CGQB 2CVHA 2ZIGA 3HO1A 4Q4AA 1WHTB 1ZUD1 1IZ9A 1GNRA 2A30A 1P5ZB 1LY1A 3OP4A 5BSVA 1NNEA 1IY8A 3R1IA 3EFHA 4B6OA 4ZZ2A 2V55B 2P90A 5CJ2A 1NJGA 1VCNA 2B7CA 3H8VA 3THXB 4MMZB 4B32A 5JZBA 1JW9B 4PGFA 4OU4A 1PZHA 2WOOA 3CIFA 2WE8A 1B0ZA 1Y3HA 3Q8WA 2QP4A 3I1FA 1O5TA 4M22A 4V0NA 5HK8A 3C3DA 4C3VA 2IS2A 3B1YA 4NH0A 3OJCA 5LQNA 3JVIA 4OHUA 4XX0B 1GAXA 4B3SB 4UDYX 3WDMA 2OFWA 4BLPA 4C2BA 2GZ2A 3IBYA 5JS8A 1U2QA 3CZ5A 2F17A 2YYZA 3N7UA 3EIUA 2O1XA 1F5NA 3NONA 2PGNA 4WK6A 5IULC 3BRWA 1VPEA 3UWSA 2ZCJA 1XRQA 1EWYA 1WPGA 2RGNC 3CCBA 3IUNA 4C88A 5FDFA 4KR3A 4F60A 4JU9A 1DTEA 3TRKA 1YRHA 4MR7A 2WM8A 2WZDA 5F3RA 4HNUA 3HA7A 3DOCA 2PS0A 3B1ZA 4UZSA 1XJQA 2G9VA 4P3OA 4XSGA 5JATA 5L6LB 3PFFA 3CT4A 4UASA 1UDXA 1WHSA 2R87A 3UN1A 1KVRA 1ZRHA 3RH0A 1AF7A 2XUZA 3CUTA 5MFPA 3KOUA 3PDUA 1ZD9A 4UAVA 3ASVA 4EEKA 3EZLA 1YDHA 2RJNA 3UOWA 1K4YA 5BY2A 5JS6A 4LKOA 3G7NA 1DE0A 4IIVA 2OV3A 1X7XA 1ND6A 2XDQA 1XAJA 4QXPA 4KXWA 4RKEA 3X0DA 5JBNA 1EVZA 1V1MA 4KVZA 3EPLA 5CT5A 3P0JA 4WLFA 5HG0A 3SJAA 4RDIA 3MWYW 3SZMA 3IALA 1XRRA 5JADA 4NEGA 1C7RA 4FMDF 4OSPA 4QBIA 5ILQA 2WYOA 2PZLA 3IA2A 1NMEA 3RFCA 5KYNA 3CINA 1QGUA 2BUBA 3Q5DA 3DVQX 5TY0A 4DWJA 2CNLA 5AVRA 2XBLA 4GSKA 4TL9A 4W1PA 1A4UA 5FUXA 2BZ0A 5ALUA 1FIUA 3M1AA 2WD7B 3K96A 2NTVA 4QXAA 5ISMA 4MQEB 4HH0A 4DNOA 1G2OA 2XUIA 3S2EA 1A71A 3IKJA 2P2DA 1GT91 2QY6A 3AT1A 4PLWA 2AW5A 2K5UA 3MRTA 4PXAA 5FYQA 1U7DA 4RVCA 4LDNA 4I14A 2ZYRA 3VNBA 5AVWA 4YFVA 2DERA 4DCCA 2I3DA 4C43A 1Y81A 2WSMA 3E8XA 1TKAA 3HUTA 4FIZA 1DXQA 4YAJA 5FX2A 4JUDX 5I48A 1GADO 2QLLA 1TTPB 3KB2A 4YO7A 2ZXUA 4EYQA 1V11B 3IIKA 5JHGB 3GD7A 1PDWA 2A0KA 2D0DA 3C3AA 1Q83A 3NJ8A 4NEQA 2HB6A 4QODA 4AMBA 1Y6GA 4KDRA 4ZAGA 2BL4A 3HVUA 2W6CX 4CNBA 3DE2X 3WNQA 3UBTA 4KPYA 3R9KA 1EFPB 3LCCA 1BWQA 2FLVA 2Q1WA 2QT9A 3HJAA 4I4TB 1N2XA 4V0QA 2QJRA 4F4DA 5E4JA 4GPD1 3GVIA 9LDTA 4MKZA 3M3DA 1KIAA 2FW9A 3GXBA 4QOHA 3DMPA 1AK1A 3FWNA 4LQLA 1AGPA 3K31A 4JZYA 2D7DA 3WLHA 2HT6A 3Q1LA 2FSUA 1H0SA 1EXNA 1PVDA 4ODIA 4WECA 1E2NA 4MLCA 5GONA 4QPNA 1M9NA 5JEDA 2G36A 5KYUA 1SB9A 1FLNA 3WC4A 1COWA 1QIIA 4BV9A 1LLQA 1D1SA 3H42B 1FW8A 4RVNA 1MJGM 5JT1A 1Q77A 3FCSB 4MARA 4RQBA 4RW0A 2YJZA 2YYAA 4GKBA 1E9SA 3DLTA 3FMIA 3IPXA 2YS6A 2QGNA 4BO7A 4EB6A 1Z5NA 4P35A 1KH2A 2X5JO 4MPDA 3IV9A 4EI8A 3TGPA 1DC5A 1NOIA 3ICOA 3L18A 3NHUA 3OJOA 4KDEA 4MUEA 2FLWA 3ENWA 4YUAA 2OORC 2I54A 3ZV6A 3DLPX 4G97A 4BGVA 4PVCA 3SBXA 4ZV4A 1CWUA 1TXGA 2J0UA 1QOPB 2LPMA 3AHIA 3GJZA 1OTYA 3HYCA 4UE6A 5JPIA 1LDEA 4IICA 1UBJS 3L8FA 1TT7A 1W19A 3RSHA 5BN5B 4ZYTA 1JZQA 5E2AA 5JAZA 1L5OA 2VAVA 1QZXA 1MQ9A 3H5WA 3NPMA 2EIXA 3MCTA 3OF5A 4L8WB 4YP9A 4C04A 1CF2O 1RD4A 4FB4A 4EDHA 4IGFA 4AO8A 4MW2A 1H1LA 3D7SA 4H4DA 2XV1A 1QF6A 3UTDA 3WSWA 5GV7A 2UAGA 4OVKA 5B36A 5BPFA 1SUBA 4RS4A 3WRYA 5MN5A 4DKJA 1N34B 4QTTB 4L7VA 3E1KA 1N2GA 4MW9A 4OGGA 2ACEA 4LVOA 4R83A 1M33A 4R9SA 1WZEA 3SKYA 3S2UA 3I2KA 3NM6B 4GX1A 3L7YA 3RHTA 1REQA 1YRQA 3HL0A 3N8NA 3S68A 4Y6QA 2GF9A 4R9NA 1H3NA 4OHCA 1ABFA 4S1NA 2GNOA 1EGAA 2CNNA 2G71A 1A9YA 1W36D 2CDAA 3H6GA 2FPGA 2JHCA 3D8SA 1U0OC 1T1SA 4RPIA 3RJZA 2JJQA 1FS6A 3Q7EA 4PO8A 3G9XA 4WT7A 4ZO7A 5TSDA 1U2DC 2PVPA 1PV4A 3S1AB 1R2QA 2FWAA 1D2AA 1U9IC 2V7UA 1J9EA 4OHKA 4UATA 4UDNA 4DDVA 1E2UA 5D3KA 1KDOA 5A05A 3EX7C 2FW1A 1R8XA 2ZSHA 4GW3A 5KHAA 3HTXA 4HSEA 3D4OA 3NS7A 1QHYA 2W2MA 4PLTA 3UK0A 3O8CA 2XCSB 1FFHA 4GPAA 2Y71A 4EBFA 2IU6A 2DH5A 1E3IA 3GFGA 2VNSA 3HRHA 1F7VA 2ZVQX 4BE7B 4OHMA 3QEMA 2COUA 5B2ZA 3ZUPA 2H4JA 4KVAA 4HFJA 1L5ZA 2FW6A 2BBWA 3NP9A 5FQNA 2D2FA 1TLTA 1U80A 4LOHA 3U26A 4J7AA 4DA6A 5C7OO 4LJKA 3M9WA 3B9PA 3K2BA 4EHAA 5DWVA 3W7AA 2WF9A 1I4OA 1BWPA 1P3JA 1XRPA 3IEIA 1Q44A 4KIJA 2BCJQ 2DHDA 1VRCA 3GVXA 1U94A 4KN6A 4WV3A 4XFJA 1ZIDA 2P3QA 4RTNA 4M9SA 3K4HA 4AKTA 5BYAA 3I3SR 3K09A 1D2CA 1Q14A 2JI9A 2JIRA 3RIEA 3VPXA 3BSSA 1K1EA 1ZM2A 2CK3A 2JI7A 2WU8A 1WXHA 3U0BA 4E1AA 1KC3A 1E7QA 3N58A 1FQKA 1VBMA 1BCSA 3UAGA 3UMYA 2YQ5A 3C6QA 3ETCA 3KR1A 3L7OA 1B2RA 4G0VA 4E13A 3WS7A 1A4IA 1JDBC 1VL1A 4LTMA 5AW5A 2ZYUX 3RHFA 1USKA 3ORFA 4RJ2A 4F9EA 2W7TA 2DY1A 4R8LA 4MEAA 2BI8A 3ZE2B 3B38A 1KKLA 3FMVA 4HQRA 4PZCA 4DN6A 3UMMA 4C03A 4DG9A 3K9FC 1Z5PA 2Y9PB 1KDVA 4P08A 5JH7F 4FGWA 4N0EA 1JXQA 2QD4A 3K9QO 1KJQA 3DTYA 3T4EA 4F56A 1USVA 2IXGA 1YR1A 2Y0PA 1UC8A 3HFSA 1EK1A 4NNOA 1XRLA 2J07A 4KQEA 3JASB 4PNPA 2HHAA 3W8DA 4F93B 2RGDA 2VYNA 3QJ5A 1VZ2A 2JHAA 1ACLA 4ZJYA 1GRRA 1SQGA 4PC7A 2MR5A 3RF6A 4GWLA 4MRRA 3OIVA 3Q9NA 1MNAA 3EXFA 4IDFA 5B4TA 5LMZA 2XGGA 3KU1A 2Z95A 5NULA 1PVVA 5T4EA 4B4OA 5B58C 5H5JA 1NY6A 1E7SA 5EZQA 2EARA 3W2TA 3SHVA 1EXMA 3AOGA 1QE0A 3HNPA 4PLHA 5K0GA 5GVSA 5JHHB 5JE8A 4EHIA 4TM7A 2EEPA 3GB9A 2V96A 2XUHA 3FDJA 5LQSA 1NI3A 2IHTA 4L8GA 3RASA 4LF6B 2ALJA 2W9XA 4IVRA 1QQ5A 3I0MA 3Q9SA 2HQOA 4HAZA 3LZCA 2QIOA 2B3DA 3IQEA 4M8LA 1B0PA 3LCUA 4RPLA 3VU0A 1T0UA 4CYMA 2FE4A 1P18A 1SQFA 3CLRD 4FGLA 3CO5A 3OUZA 1LK5A 1K7EB 3AUAA 2ZLBA 3PQ6A 1T1IA 3GU3A 1SBTA 1VLJA 2DPXA 2YYSA 3C5WP 3P9QA 4W82A 1KEKA 1B16A 3M9LA 4KE7A 4HSGA 3SVTA 2WYIA 3PCXA 1G4HA 2F55A 3MNFA 4GKJB 1L5KA 4TYPA 5CR9A 4I19A 3V8EA 4BASA 5LBIA 4RLHA 2QUBA 3OESA 3MT7A 4PIMA 4HX5A 2RKBA 4C4TA 4PC2A 3GJ0A 2AJLI 2C42A 3I8SA 1FP1D 4F04A 4FC6A 5EXEA 3AJRA 3VHXA 4Z3KA 1X0VA 1C1DB 2EW1A 2ARKA 3W5VA 1DZIA 3TSYA 1G60A 4CFZA 2JFVA 3DMDA 3LT0A 3ONNA 3E5RA 1VLVA 4KSCA 2GN4A 4WKNA 4ER7A 2X15A 3HXOA 1NONA 2G17A 3UATA 1GGNA 4NU0A 3OCCA 2ZWIA 4WASA 1M2JA 2C8JA 3C24A 5D8DA 4FFNA 1QH1A 3I6BA 5H70A 3QPDA 3CUEF 4AM8A 2NZVG 4HWOA 3EOZA 4DM4A 3EVZA 3PDIB 4TTAA 5A3JA 2XE7A 4JC5A 3CHYA 4HYEA 4JJAA 4Q9NA 1YGYA 4N03A 5IJ0A 3IRVA 4MLDA 4BX2A 2Q41A 4AF6A 3PC6A 4IJWA 2BFWA 1G20A 1X1RA 2QE7D 3M82A 3D6TB 4XUGB 3SJUA 3K2EA 1SM4A 3EE6A 4HWSA 1G20E 2GBIA 5KAPA 5THQA 1Z4OA 2IODA 5LOVB 2BM1A 1T2AA 4RL6A 3W8NA 4I5FA 1DG3A 2UYQA 3PFCA 4E7PA 3M1IA 5DIZA 3TIFA 1L5RA 5JSQA 2C7PA 2J5XA 2C3MA 2ID9A 4GQAA 1NJ1A 4EJSA 5E3IA 1YKGA 3EG9B 3TLZA 3PXCX 4EW1A 1JGTA 4OJYA 3WK5A 2Z2YA 4JLVA 5IXSA 3MELA 3M49A 1N1DA 1ZG3A 1XPRA 5F76A 4LYYA 4ZTUB 3QF4A 1N6IA 1YVUA 2Y0EA 3I4LA 4HRVA 3R8CA 1NXWA 4PYIA 5BQ5A 1UEJA 2AEEA 3C3KA 4WZAA 2XW6A 2XRZA 1F6WA 4D99A 1SZDA 2WILA 4WZAE 4CLEA 1ZWLA 3FGPA 3O4HA 4HGRA 3OKFA 5CA1B 2C95A 1CVIA 1P7CA 4LJYA 3TRFA 4O4HF 1DJMA 4QDOA 2X86A 3N2ZB 2PBFA 1YK1A 2YMPA 2WJJA 4NU6A 4PF1A 4F84A 4IH1A 1C1HA 3NFYA 1M7HA 2WWIA 3MOIA 4G8JA 1G4AE 2HN9A 3KAQA 1OR8A 2JEOA 2TMGA 1YE8A 4OQ4A 1GCIA 4NICA 2C7GA 2NSJA 3HO6A 4O4LF 3OLQA 2QG4A 3BWDD 3GRCA 3DJFA 4BP9A 3CLSC 3G82C 1XEXB 3OU2A 4N3GA 3A9WA 2WWVD 5LJLA 1R00A 1YXMA 3BG5A 2GZHA 3O8OA 3U5TA 4FW9A 2O2GA 2P8SA 2P8JA 1EYZA 4Y2YA 3SOPA 1ZUWA 3ACDA 3S2GA 3QMPA 2NUAA 1YMVA 4PM4A 3QLVC 2BOVA 1WD7A 2BEJA 1CDEA 3ND7A 2WIAA 2BDUA 2QN3A 2BFCB 3GFQA 1I0IA 2WG2A 3HXLA 4MVJM 5F1OA 1LQTA 1XWWA 2BSAA 3HFGA 3IR5A 3UJ7A 3WLPA 4BJHB 2AN5A 5B3KA 3ZDYB 1Q95A 2H4ZA 2H7CA 2F3PA 3QWAA 2UXBB 4KH0A 4BFSA 3ZYCA 2XQJA 1T4CA 3IUYA 5CW2A 3PWZA 4LHEA 5LDGA 3VC7A 5A4DA 4NK4A 2CHGA 3Q2KA 3QHAA 5DOVA 1LEHA 1N5MA 2AF3C 4GDMA 1RSZA 4I55B 4B47A 3THSA 1U8XX 4KFSA 3BD8A 5G1PA 3GUYA 4KXFB 4YRCA 3IGFA 4K81B 2W8BA 3FZYA 3UA3A 2NO6A 4N47A 4D3XA 3KUCA 2HW8A 3OLXA 4HEHA 2PMCA 2BKAA 4GPEA 1CB0A 3AIMA 4KXLA 1VIDA 1ACJA 4KR6A 2AZXA 2RJ3A 4J16C 1E20A 4WH0A 4R2JA 1IUPA 2YWHA 1S8NA 1XMIA 3IE0A 1AGRA 4D97A 3K6KA 3VYSB 2OHXA 2HDNB 2IW3A 4DXAA 4DMLA 4PRYA 4UMVA 4D3DA 1U8EA 2YW2A 5F1PA 5CYGA 2IYAA 2X4GA 4ESOA 4E21A 3VR4A 1K5PA 2OQRA 3GHHA 1M2GA 5E1MA 2R1ZA 1WO8A 3QUSA 4FXOA 4ZRNA 4MRMA 1JLSA 2B98A 3TR0A 4C5AA 1RP1A 1WUHS 3SY8A 3IMCA 1QR2A 4IDPA 4QU9A 4XYGA 2IYZA 3VKUA 5K6AA 4JJZA 3E22A 2VLBA 3PPXA 4REQA 2OCKA 2WV7A 4MI9A 1WY5A 2H85A 2G5CA 1B74A 2FSVC 2QRVA 3TSZA 1QO0A 1I4LD 1T9BA 1SOWA 3I5XA 3FVTA 1K6IA 3WRXA 5FH9A 121PA 2JH9A 2QRMA 4KMOA 3AETA 2CB9A 2XH8A 3AVTA 2E5FA 3DM9B 3DXFA 1ZMBA 4DPLA 2DC1A 3WGUA 4DB2A 1MO3A 5JJCA 5C8DA 1ZJJA 1BFKA 2QAIA 2JLUA 1OD6A 1N9GA 5CFLA 1XMQB 1ZN8A 2FGJA 3NVDA 4R1SA 4E5VA 4TXNA 4KQJA 3NNDA 1SD5A 2ZJ3A 1QP8A 1CDZA 2VEDA 2WMOB 4HZIA 3DFMA 4RV4A 3TBHA 3WO1A 2PE5A 5DHFA 5A9SA 1ST2A 4ZN6A 3KXPA 3MJHA 2FDCA 4B82A 2HJ9A 3H99A 3QI2A 4QJIA 3TLCA 4KE9A 4ZEVA 5GOZA 3IO3A 3V32A 4ENRA 1E2HA 2Z09A 1CUGA 1T8WA 2PLWA 3KYDB 4M89A 1GUBA 1QG6A 1QZZA 2CJYA 1IU9A 2BM9A 2VF4X 3O74A 4R0NA 5AMXA 2GHQA 1F9EA 3TSOA 4EHBA 5ILOA 3U60B 5FB3A 2XRFA 4G5OA 4IEIA 1NBMA 4LJAA 3B5IA 1WCV1 2WG0A 3MZ0A 3M4XA 5JCZA 2A92A 3KQTA 1TJ3A 4X85A 1NBME 1XJ5A 4LXTA 5KQPA 1UADA 3DF9A 1O97D 4CKWA 3VR6H 4HAWA 4I9FA 4X1KB 4MS1A 3OFSA 4RJTA 2BGRA 4W6ZA 1BXRB 2H1SA 4WACA 3WLJA 1FFYA 5M5BA 1IBMB 3UXYA 1QYIA 3K1AA 1SXJD 3QVVA 4GZLA 4N12A 4CZ2A 3J80A 1RZ3A 1NWCA 5F12A 2FW7A 2OB2A 3HEMA 4FR5A 3UK1A 1VJCA 5L3ZA 4R2LA 4HVCA 2XKKA 1AKMA 3VZRA 4C6HA 3KT3A 4DBZA 221PA 3ITEA 4B3GA 1XNHA 2GX6A 1H2EA 4URXR 4FFPA 1LCIA 4RIIA 4FT2A 4I4TF 3HBFA 3ZVKA 4KYUA 1E7RA 1HL3A 2AS0A 4JH0A 4WZBA 4WOJA 4BFXA 5MHTA 3EEIA 4J6FA 1JJAA 5DGTA 3SQMA 4KIWA 4E94A 1NI4A 4WZBE 2OWDA 1RKXA 4EFDA 4ER0A 2J30A 4ER6A 2EAUA 4UBNA 4QM6A 1HDRA 3G2IA 2I6SA 4R98A 2QSYA 1N6PA 2PA3A 1DJPA 4R54A 3CEHA 5CHEA 1QRDA 1YDFA 1ZKMA 3EOBI 4MQFB 5AW2A 3EUEA 5K0EA 3DL0A 4IZHA 5LC1A 4K88A 1FMTA 1GA6A 2EQAA 2G40A 2ZBGA 3BWCA 3N7TA 4KVFA 5EP1A 4HTFA 1E4OA 2CVZA 1HOTA 4R5MA 3RYIB 3D6FA 3CURA 3LXXA 2ACKA 3OQIA 2B25A 4BMOB 1CUEA 4LZLA 4BMCA 4BX9A 4CKBB 4EATA 1U1CA 2YR0A 3OZDA 1UC5B 2DHCA 1O3YA 3I2IA 3N9IA 1O77A 4R84A 2OKCA 5IJXA 5ENZA 1P44A 1D6JA 1OZ0A 1BMFD 3O7MA 2ZRKA 5A3QA 1VLQA 4H7PA 5L3SA 4LY6A 2FZVA 3NANA 4DCMA 2HK7A 2BFEB 2OE2A 5LNK1 3RV4A 2A6PA 4CMJA 2FZGA 4HDRB 3LE8A 3TQQA 4B8ZA 1SQ0A 7MHTA 2JFYA 3EF1A 4JQOA 4UXJA 1Z3CA 4BKMA 2ZJ0A 1FNMA 4DSZA 5I7HA 1ETHA 3S8MA 2J3IA 3G02A 3ER6A 4LBVA 3SDBA 4S35A 4B3BA 3IKLA 1XZBA 1I2DA 1CZUA 4NSNA 4B2PA 5FBZA 1E6UA 1NXXA 2A0WA 3Q15C 1OFVA 2W2LD 2ZI3A 1V39A 3Q87B 4CT0A 1L5HA 2AR7A 2LZ0A 3M5WA 4DDUA 2R84A 5B30A 3QLJA 4BUJA 3R6DA 1Y9JA 2ZBEA 1DFGA 4NV1A 4PHHA 2GO7A 4R69A 5E6SB 1LX6A 1V8FA 3EZFA 1QBGA 4PHGA 3IAM6 4BP8A 5JUWA 4G1CA 3ZCSA 2QMEA 3IQXA 1S89A 2AYYA 2X0EA 3RUDA 4HT3B 1KWGA 4LCEA 4EENA 3GPCA 2ANBA 1NATA 1SD1A 2IELA 1KQNA 4F11A 3EVAA 3WGLA 1WB5A 2PKQP 3VVCA 4D4HA 4F9FA 4JLOA 3RROA 4WCFB 2D1YA 4TTVA 2JLAA 1XD8A 2XUQA 4U9HS 4M1MA 1UOEA 1H3EA 1B8UA 1U9CA 1UJBA 1UMBB 1DLJA 2H2WA 1PJQA 2HMSA 1NVEA 1SQ5A 4N7JA 3SEFA 1NQTA 3ONWA 3FNFA 3FZGA 4P38A 3GLVA 3ZBPA 3OJ0A 1R8YA 1PYDA 3FOZA 4LY9A 1E77A 4LJSA 2WT9A 2ZUBA 5EYPB 3MD0A 4EW3A 2KMLA 1GZ7A 1ZQ9A 3B7WA 3C45A 3MUEA 4I1UA 3VXKA 1P2GA 2X1MA 4HPWA 4BBAA 2IDKA 2JGEA 2FEMA 3W90A 4TS4A 1OJLA 3LECA 3F2VA 4HQLA 4HQNA 4Y9UA 3KLNA 5KNCH 2CZQA 2QN9A 3RVDA 3HV2A 1ZM9A 2XNDD 3K9WA 1GUAA 5JDIC 1RQRA 3IUQA 4UPVA 2G08A 2HLPA 2EHDA 4P33A 2ZXEA 5FI5A 3RSSA 4BNDA 5LSAA 2Q7XA 3OTOB 1IXZA 4QAJA 5D84A 1O0BA 4GG1A 1XPUA 2VJMA 5DE3A 4CEJA 2J59A 3L9XA 3V2IA 1UWKA 1EJ0A 2H5IA 2V8BA 4LPSA 1SQSA 4HCJA 1PWYE 2ZAGA 2A1IA 3NWEA 3UC9A 1SU6A 4OHBA 4TZ0A 3LKBA 3GLQA 1GRVA 3KLMX 4Q3DA 2UYGA 3AFHA 1QHGA 4G4IA 4B7AA 3A3NA 5JXHA 1GZUA 4OL9A 3T3EA 3WG9A 4YCMA 4H7FA 4KV9A 1JG6A 4S2UA 2OVBA 1KKUA 1ZVQA 2ZJ4A 5ALKA 2JFNA 3OHMA 1KEZA 4YJDA 4G23A 3FPLA 4EVIA 2YWDA 3EWIA 4RE6A 3ZCRA 3LVRE 3REOA 5T41A 1T9AA 1KP9A 2VNKA 4P92A 3V7WA 5LNK6 3NM4A 4CLRA 2R62A 2OL4A 2CD9A 3I6QA 4UM8B 4YQZA 4ZGWA 3UAOA 5FYDA 3SYMA 2Q07A 3GX1A 1KDYA 1KO5A 1N5KA 4PCLA 3A32A 1YS4A 1MB3A 2JFBA 3I4FA 4K6HA 4TWAA 4C0JA 4Q3EA 1KZ7B 4GZ5A 4D3FA 5M2QA 4O4IA 1AHHA 1QGZA 2P7HA 4BP1A 4PHCA 1YZUA 4NFYA 1FEZA 3B70A 2AG8A 5I01A 2VLIA 4QOFA 1KDZA 3VU9A 4G07A 4MR7B 1QV7A 4R1UA 4EI7A 5K0FA 1L8AA 2OV4A 1SD2A 1Z7EA 4DV3B 4P4LA 1QNLA 2AE2A 4A4DA 5IFLA 4Y6RA 4DAOA 2JRCA 3Q10A 2PFKA 2VZ9A 1P1KA 4GSLA 5HHTA 1WHSB 2XDAA 2ZREA 3F73A 3TX6A 4MRVA 5BV2P 4QQFA 5C8ZA 5EIWA 4Q01A 1X39A 5DWDA 4J43A 4N0PA 5BORA 3VPGA 4LX0A 4ZO4A 5ALHA 3VSAA 1OY1A 2B78A 2O0HA 2N42A 4FK8A 4Q7LA 2E87A 3QLUC 4FWIB 1HQYE 4HC4A 1X7XB 2LCIA 4TOIA 3LHKA 4HN9A 2XDQB 4GM4A 1KU0A 1L7VC 1OXMA 4NOJA 5EPEA 1XVTA 1V1MB 3PR2B 5EP2A 5F2KA 3DKIA 4KGVA 4C0KA 1FBTA 2OGWA 3H04A 4YMIA 3H1FA 1K2WA 2J7KA 1TO6A 5HZHA 3O8NA 1YV9A 1NN3A 3CWQA 1ZKDA 3GY0A 4LRYA 4TTQA 1TUGA 3ZJ5A 3FLEA 1V71A 5EIOA 3GRPA 1JPNA 3QXXA 4H1TA 4Z7JA 1NSTA 5EIXA 4KMMA 1DLIA 4N0DA 2I76A 1K27A 1ZHFA 2H2IA 2HJSA 3PHJA 1K7YA 5H81A 5CFMA 5DOZA 2QW0X 3FFTA 3LMKA 4EW6A 3A70A 4MV1A 1HT2E 1UQTA 1TM5E 2XTAA 1RDFA 2QTAA 4N6GA 3L5KA 4QDJA 4HAUA 4Z4HA 1JIKA 1JEJA 3R6LA 4H3VA 5I9MA 2YRWA 3TUIC 1RI1A 2CBZA 4OBWA 3TTSA 4XR9A 3BXZA 4PS1A 4DIKA 2XRMA 4JX8A 5FWDA 4MP8A 4TS1A 5LP6C 1FDIA 3ZHUA 2ZYDA 5THXA 2QUAA 3QU4A 4HMPA 4AQYB 2VN8A 4GM0A 1A9TA 1C2YA 3C41J 3URMA 4WXEA 2C3YA 3VDXA 4IJMA 3PHGA 1W581 5LOVF 3CU5A 4QBTA 3ZJ4A 3HYLA 4NI5A 4FE3A 3G9QA 3A6EA 5IWAB 4JKOA 4LF7B 1VYTA 4AS1A 3W2HA 1XUOA 1KTVA 3QI7A 1E0SA 4CMEC 4L8VA 4YMLA 2YWBA 3KQNA 3BSFA 4MOWA 4K9NA 3FHJA 3BCRA 3IBFA 3U61B 2J9FA 3EYWA 2PUFA 2DFNA 4D8VA 3UAZA 4XUEA 4ON9A 1FLVA 3N2LA 2DCUA 5GONB 4C07A 1FNBA 2I80A 4Q3KA 5KYUB 3Q3GE 3UJ3X 1PFVA 1JQDA 2VTVA 5KOYA 2L18A 5JISA 5FRDA 4K9RA 1GILA 5MGNA 4IX9A 2BFDA 4KXVA 4CF5A 1G6KA 2W98A 5DVZA 3JWJA 5CA1F 4P7FA 4BQSA 2WMYA 3EAGA 2DFDA 3R40A 4W5OA 1ZO8A 2IPOA 4GDFA 2PJUA 3L3BA 4P4SA 1Q92A 2J0UB 5EZYA 1VPLA 2REOA 3DM5A 4H6PA 1S3SA 4L0QA 4TTRA 5EJIA 3W9SA 1T0HB 1WTCA 2KS6A 3WTCA 2OXEA 4E12A 5L40A 2A2ZA 4LYDA 2FUG1 1IM5A 1MABA 4P0TA 3DBOB 1VHQA 5I9BA 2GLXA 4IQFA 1FRFS 1WZUA 1XTZA 5DGXA 1EFCA 5A03A 4YY3B 1EDEA 1TTHA 3LBNA 1GFZA 4BNJA 1H1LB 2VNAA 1PWHA 3KWLA 1E4EA 1UCFA 2QGFA 2GA8A 2HOQA 2X7HA 3L7LA 1PJAA 3LRPA 4XM1A 4XWKA 3VSDA 1V96A 1D4OA 2PWPA 4Q93A 2RGNA 4M1EA 4NEHB 4E6PA 4FEGA 4HN2A 3HDQA 4EMSA 4F12A 1OKKA 4ZCIA 3AUJB 4FE7A 1FJGB 2CDBA 4FHZA 5A7HA 2I0FA 1REQB 2H4HA 3NBYC 1OWMA 3B78A 2AVDA 5J5AA 4CI9A 3TCNA 1J07A 5LD2C 5HDQA 2XADA 3IPAA 4DIMA 3M3HA 1IJFA 4ND3A 2E89A 4IM7A 2FPGB 3TG8A 3MWFA 5FD8A 4YJHA 3CF4A 2X9QA 3NOOA 5FTJA 1Z28A 4ENWA 2WSIA 4U6NA 1MX3A 2UVPA 1C7FA 2ENWA 2HPAA 3IP5A 2O8BA 4I55F 4GH5A 1HMYA 5I47A 1R0XA 3JSXA 1LLUA 1NVVQ 3V4ZA 2H52A 5A4JA 3SLRA 1L5WA 4GFDA 4LMBA 1M74A 4TSFA 1V37A 5FBKA 3QFHA 2BMEA 5L4LA 4DDKA 2FRXA 2HA2A 2XQVA 2RIRA 1H8ED 1IZ0A 3QEMB 4JJ4A 1I7NA 1IOZA 1RHRA 2Q2VA 3EDRA 3A37A 1N1MA 4UKDA 3WA7A 2VHWA 2XGJA 4AW9A 4KHPB 2P9HA 1P8JA 4HO1X 1L3CA 4F46A 3RB8A 2IE0A 3PE6A 4ROTA 3VAZA 1G6OA 2Z2XA 1ZM4A 2CLCX 1ADGA 3PLRA 4G5FA 2A5DA 1TYDE 3MT8A 1K8ZB 4RZUA 3OWOA 2EW8A 3QUBA 4L4SA 2GCOA 1W2GA 3IBTA 4M53A 1ZGCA 4OHYA 1G21A 3UK2A 2HMWA 2Q6VA 1PZFA 3FYHA 2VTBA 1TL7C 4MS4A 4NMXB 1G21E 4YQEA 4LSZA 3DWIA 3N2GA 4FKZA 2Y1WA 5EMLA 1BCSB 3KQUA 3PPYA 2IYNA 3AZQA 3CH4B 1W5SA 5DBGA 1APBA 1AKEA 1BKDR 1EK2A 1XCPA 2E7ZA 2RCNA 2X14A 3EDMA 4K6CA 4U5XA 3COWA 5DIFA 3WIOA 5AUQA 2CLMB 3IILA 2W2VA 1ZNXA 1E1KA 1Q2XA 2LDXA 4PFJA 4P58A 1OGJA 5KTPA 2V97A 2D0IA 1DOZA 3DFZA 2N46A 3JAKB 3L7NA 3CONA 4HAXA 4NCIA 4A0SA 1M2KA 1O94D 1RABA 2GJKA 2P67A 2QUKA 2ZRMA 4PZ0A 2OFFA 3MTQA 4E07A 2XVXA 1OC4A 2A1UA 2BISA 3FKSD 3BJRA 1VL5A 3VBEA 5CG1A 2FUG6 3COSA 1UKCA 2DH6A 2NNWB 5CYPA 4CF7A 4RABA 1DAKA 5F77A 4CMBA 3JRWA 3KB8A 5AHOA 4YRMA 4EYOA 5CVDA 3AK4A 3GDGA 3AB7A 2Q5FA 4DXHA 4UBKA 1UKVY 1MB4A 1E64A 2Q29A 2EYUA 5A4IS 5FLXA 1ADFA 1QOZA 1C4OA 4RQTA 3RTBA 1CUUA 1M73E 1U2GA 4HTAA 2Q62A 4Y1EA 3SPXA 4ZQHA 1NBIA 2BGUA 5I7VA 2C3UA 2PV7A 3A3KA 5B37A 3SF0A 3WX0A 2D1TA 4N6OA 3WP0A 4DWWA 5KWSA 3GJYA 3BXXA 4LGVA 3WNZA 1M5RA 1DHTA 3X1WA 2PKQO 3VUFA 1VIVA 5CUQA 1RI3A 3OPNA 3EA4A 3CFYA 2OORA 3LBIA 1OXKB 1RWXA 2V59A 5BQFA 2OXIA 4A2PA 4I9UA 4RCVA 1ZHHA 3JARA 1VL2A 1C3OA 3ZVRA 4FFOA 3ULKA 3IERA 3U44B 2O2ZA 3R9XB 4WIAA 2C1ZA 1K08A 5BSTA 4L57A 2DZDA 3ESCA 4WFJA 4FS3A 3TYXA 2ZZKA 1H3FA 4K9KA 2C92A 3KPYA 4D6PA 4FI3F 3W79A 5LYJA 4D57A 4D4JA 2C2KA 2W2XA 4F4HA 1ZFNA 3MBIA 4F7DA 4S05A 1H1DA 1GVNB 3ELBA 3PL5A 1ICEA 4WFKA 3IOEA 4JLJA 3F9IA 3LDAA 1PT5A 2R7MA 3N53A 1VLZA 2HGZA 2NACA 4IWXA 4PCVA 4Q4DA 4QGGA 3RTCA 5I7UA 3SIPA 5IBCA 1U8FO 3VHXB 2A59A 1Y33E 3GJ6A 1GGHA 4MW0A 3SR4A 1Z7GA 1FTNA 2QPTA 2ZM6B 2H9IA 3H2KA 2CVFA 3HB4X 3M33A 3OMLA 2WJPA 2WTBA 5BURA 1EJ6A 1ZH2A 1G66A 1H69A 1J25A 3K6RA 2EU8A 4OQYA 1OV4A 4FOPA 1WB9A 1QDLB 5CW1A 1U9IA 4AWBA 1QH1B 4RACA 1MOZA 3AP1A 1ZA2A 1JMVA 4YLEA 1HYHA 3EWSA 3WWYA 4UEWA 3HPQA 5IC5A 1RXWA 1Y5LA 3HXPA 2AJCA 3BM5A 5E95A 4YMHA 4LJRA 1G20B 4H4CA 3V7UA 1B6GA 3ER9A 4V2UA 5E4YA 3P71T 2LV8A 3GRKA 1D5WA 3VNVA 2RHHA 4BGEA 3QXHA 1BCRA 2YVQA 1L1EA 5EUQB 3JQAA 3AWIA 4F92B 2YXLA 4EG5A 3W5CA 1XTPA 5F1KA 3UJHA 1G8SA 2PSFA 3WKDA 2R8OA 4H27A 4EJSB 1EGQA 1UBFA 3ENVA 1NFQA 5BMOA 2OM2A 1ECLA 4EUFA 4RQUA 4PANA 5J23A 3K30A 3HM9A 4HWRA 3D7KA 1HQCA 3W8EA 3IYLW 1N8NA 2B94A 2HDWA 3NBQA 2R8BA 3QF4B 1CXZA 3RG2A 3X2SA 3FPSA 2RSLA 3D7LA 4OQNA 1SPBS 3ZXIA 1Y7IA 1UMKA 4Z4FA 4WZAB 2IEZA 2EZ8A 1E2MA 2GKOA 2D8AA 2BGNA 4R51A 1MJGA 4CMAA 1BYIA 1VHDA 4WADA 1N3LA 2NZWA 3ZGLA 3QE4A 5TX7A 1T4DA 3H2ZA 1DEKA 1QC5B 3FCYA 3ILVA 3K1ZA 3NTQA 1LGYA 4EYKA 5MN6A 5IH7A 2C5GA 5M3BA 3MQFA 1DCFA 2HNAA 4RD4A 4MWCA 2D06A 3FPAA 4NY1A 1EE1A 3LO5A 3VU1A 1IJKA 4UARA 1ZD5A 4FB5A 2P68A 3CM0A 1CUAA 4V03A 2QK4A 3JSAA 3L4BC 5TQ2B 1XVLA 3HWWA 1ODCA 2IYPA 5CP8A 4JDPA 1AT1A 1T4BA 4KPEC 4QUKA 1JNYA 2JFZA 4YI5A 3KETA 1NKVA 4L4XA 1XRJA 4X94A 4Q19A 1R0KA 2BEKA 3O8OB 4CM3A 5EFZA 3S29A 1E6KA 3KG2A 4DC1A 3VU8A 3T5CA 4AN4A 1KI4A 5H7XA 4B6RA 4BATA 1C4XA 4N1AA 3OX3A 1TUIA 1DXYA 1HDIA 2F90A 3D3WA 1OX6A 1R6AA 2RG1A 3NORA 2ODAA 1K4KA 3PD7A 4KQ2A 1XBTA 2NUAB 3WB9A 1RJWA 1X1TA 4JMLA 2RB4A 5EXPA 2PZFA 3E7WA 2AL7A 3KJZA 4YQYA 3B52X 3UMCA 1HRKA 3ZE8A 4AYTA 4D45A 3ZWBA 1HA3A 2EWVA 3URKA 5GJVC 2GSDA 3JQEA 4CKXA 3KZMA 4X9XA 4F21A 4HGPA 2O7NA 1BA2A 3AXSA 3PXXA 1J06A 5DEIA 5ERXA 4ZJUA 4NZ9A 4F8YA 1JBEA 4JV5B 4TSRA 1O87A 1QGAA 2A5FA 1T4CB 2XJ9A 1P0CA 3VPHA 1PS9A 4QT0A 5JNVA 4LBZA 3ZLVA 2L19A 3GPBA 4CKEA 1UBHS 1T2CA 3Q6NA 5JMTA 1UJ2A 2AMVA 3GFPA 3PC8A 3V7FA 2YRXA 2B8WA 4DYDA 1U2RA 1YBFA 2BF7A 2J9GA 4DUGD 7ABPA 3ZX4A 5ESRA 4DSUA 1BU8A 4CIDA 2VXYA 1H93A 2ZIWB 1QUEA 2W8BB 4W6QA 4YRDA 4RTJA 1PEYA 4Q4HA 2ZULA 5IZCC 1VHJA 2FVYA 2QUIA 3BDVA 4ZAXA 4Y2VA 2R0QC 1ZJ4A 4RENA 3NHMA 1OH5A 3WIBA 4RLFA 4CF6A 2XMZA 3CF2A 3FLAA 3IDSA 3R7LA 2XHEA 2F1IA 3L8ZA 2DTXA 4XARA 2BBTA 4QVIA 1XKXA 2BP7A 2YTZA 5D85A 3LUKA 4GR9A 3VH3A 3AEXA 4TXHA 3O3NB 1N57A 2Q4TA 2R66A 2ZAOA 3B3AA 4RH3A 2VJKA 5B1SA 1PTKA 3HVHA 2QDXA 1YS9A 1DO8A 1XG5A 2EGUA 2O07A 3HCBA 1I6LA 5EHNA 4EA7A 4EGCB 5JXGA 4FNMA 4A23A 3OTWA 4UOZA 2HADA 3HKDA 4ZVLA 4L02A 4GI5A 1J0AA 3QEKA 4P86A 4B4WA 2A88A 4U9UA 5A2GA 4JI7B 3K72B 2PXAA 4MRMB 4U00A 1D07A 1DU4A 3SDSA 3W2IA 1P9WA 4PQYA 5IH3A 5HR5A 2WJHA 2EDAA 3E22B 4L75A 3WLIA 1LVUA 1CJMA 2HNBA 3VTKA 2QRVB 4GQBA 3VZSA 4FCWA 3L4JA 1QP4A 4UVEA 5CVTA 3M83A 4EA8A 4BVEA 4V0OA 3PNPA 2IYVA 821PA 3IE1A 3AETB 3HDTA 4KAFA 4ENUA 1OX4A 1OLOA 2DQSA 1KPHA 4O02B 4DA9A 4CFSA 3ZR4B 3PFGA 4LMAA 2NO0A 2LD4A 5IS2A 4P7BA 2F8TA 1N9GB 3Q0TA 2AUMA 4Q1CA 3IHLA 1UPBA 2GT1A 1E1QA 4OPMA 3U31A 2PCLA 2R8YA 5COBA 1TRHA 3KSZO 3NHSA 4NYJR 4DV2B 2Q2WA 3EC7A 1DIRA 1X2BA 4I1VA 2DUNA 3JQ8A 1I7QB 3AR2A 1RLJA 3H2BA 3HADA 4CRWB 3N74A 3R4CA 1HEIA 4HAVA 2LCFA 2YASA 3MG9A 3R3SA 3BH6A 3IQZA 4P2GA 1TUBA 4QJ5A 2Y67A 4CIBA 4DYHA 1LC3A 3IT1A 3NDIA 4M9RA 2HIGA 4ECEA 3CJTA 5JWHA 5CFQA 5IT4A 1M2VA 3MS7A 5D6OA 2GFHA 1JA0A 5AM2A 2FEKA 4MZXA 4CKWB 2QTNA 2H7XA 4YR7A 2GVDC 4WBXC 1VI2A 4MS1B 3PX7A 5TS3A 2DWCA 3WIEA 1O5OA 1VBNA 4BNFA 1XZCA 4EX6A 3K1AB 2VQSA 4YJFA 4TTTS 3NIFB 5FXMA 5GVRA 1DCMA 1QO7A 1KMMA 4E51A 5CT8A 3Q7QA 4A27A 1EM8A 1OWNA 3G6KA 1NVTA 1N2EA 3QJGA 4K03A 2PS3A 4QQKA 4QNMA 3W9YA 5E8JA 3SSMA 5EMJA 1Y8QA 3A9TA 4KK3A 4JR0A 3O8QA 1KAEA 3DTVA 1V3TA 1A2OA 1W0CA 1ABBA 3FFBA 4WZBB 1W8DA 4RK0A 2F67A 3G5MA 4RK7A 3QLVA 3CKKA 2Z9CA 4BO8A 1NI4B 2G4VA 3ZW9A 1Q3TA 2JIZA 4FEAA 2HSDA 4D9BA 1WCXA 2WD8A 2A33A 1QG0A 1P1JA 2H5JA 2A58A 3HY6A 4RXTA 2YRFA 1QIHA 4ZT4A 3G85A 3OCUA 3SC2A 3VDRA 1D0SA 3EEFA 5GONF 3BRWD 2VQFB 1I2CA 2G8LA 4R2WA 3CSDA 2WJAA 3O82A 1ZUIA 4EA9A 4IBOA 13PKA 1IHDA 2HC9A 5CVEA 5F2EA 3SYLA 4OHXA 3CNNA 2V7EA 4HTFB 3T7IA 2VJDA 4FGSA 4BZWA 2PJZA 2QRHA 3ZWAA 2IU3A 4I46A 3RRXA 4KXYA 2F59A 5A5FA 2B2NA 1IN7A 3DMNA 3MGGA 4EL5A 5ABPA 5LKAA 1JFVA 3EXIA 5E2IA 3C5HA 3RUEA 1UZNA 2A3RA 3NAQA 2DTDA 1TAGA 2CXHA 5THKA 3CF6R 1AY0A 3TN7A 1IUNA 4YT4A 5JZSA 2PUDA 4CGZA 1E2FA 2G5TA 2JGDA 2NO5A 1Z2OX 3TB4A 5HM8A 5L3SB 2D1QA 3NJ4A 4GSYA 2I6UA 1EDDA 1PS0A 4RUKA 1V0JA 5ERYA 4MS3B 4IJKA 4J16A 4LQDA 1U9ZA 1TQ2A 3NW9A 1R9JA 4EY4A 1KBZA 3IXMA 3OTQA 1D2EA 4RD2A 1ZX1A 5EIHA 4TKMA 4RH0A 3EMBA 1LBQA 4AU1A 5I8PA 3S40A 4F38A 3EUWA 1MC1A 4JXKA 1GAQA 5CVVA 1OJ7A 2PUGA 1SUCA 3TLAA 3ZHYA 2Q1YA 5TQ0A 1L5HB 2Y1XA 2IIVA 3L2OB 4EB3A 3UMJA 3HFRA 4ZVVA 1SCDA 4LYEA 2QJOA 4DNQA 1QTQA 2JLVA 2F6RA 3TZLA 2RHBA 3ZGVA 1I0ZA 2FEXA 3AB3A 1HDXA 2VJYA 2X2OA 4BVJA 2CNDA 2FMXA 4ENTA 2DGDA 1UBGA 5T6MA 4JJEA 4FWTA 2R5NA 4BNLA 1QBKC 1U3FA 3AH8A 1FVXA 3L0CA 5K45A 3P2EA 2OCIA 3EIXA 4LZAA 3K3PA 3K73O 4MQ4A 4OP1A 3V8PA 4KRFA 1SVNA 3RFUA 3FF1A 1JE0A 4I5GA 2CJPA 3LXMA 2VSOA 4JS0A 3UV3A 1Z16A 2BKLA 3IH5A 4RPHA 2I4TA 4DMRA 4ZYVA 3LL4A 3BMNA 3KJFA 3E53A 4MGYR 3REFA 3WIVA 2HGSA 4JK3A 2XVMA 2WU0A 3N59A 2C5HA 2EDCA 5B3LA 1MRZA 4M8IA 4WJKB 3R3ZA 3SJZA 1XA0A 1KQ3A 3P0EA 3PKZA 3ROQA 2POCA 1JSLA 2YIVX 4DMKA 3ZHQA 4CEIA 3DE4X 4CIWA 3GZ4A 3TW6A 521PA 3TOCA 1RM0A 2XE8A 1YBMA 4HDNA 3UJBA 3WK4A 4B6PA 1ZSNA 2W42A 4MDHA 4R8MA 7YASA 4W5NA 1SG6A 1N0VC 1PZXA 2R1UA 4IYJA 2WF6A 3SD7A 5KQSA 2BRUA 1U7TA 1Z37A 1HZJA 4LXXA 3CH5A 5FA5A 2OCGA 2JA2A 2ZT7A 2XBUA 2VPZA 1X74A 1P73A 4FQ7A 1BH2A 1XDDA 4FJ2A 2G1JA 2G1KA 1QG4A 4Z1MA 3TXYA 3VOSA 1GTSA 1WXIA 2FRDC 4MVJA 3WGJA 1E7MA 3B5EA 1TIPA 1OH8A 2GM4A 2ZJAA 2EJBA 3AL2A 4JKIA 2RI0A 4MVJE 2R6JA 2VJMB 4CEJB 1OA1A 2YDXA 3E82A 1NF9A 1ZA1A 2L69A 4CEHA 3PUXA 4I5IA 1P80A 2B7BA 1GUYA 3G89A 2BFOA 4WY2A 4E4YA 3W5IA 5BN4B 1YGPA 1WS6A 2IJGX 3ZH2A 3LW7A 4RADA 3RVJA 1MVLA 1KXJA 2REBA 4Z9AA 3ZI4A 1E3WA 2Q0SA 2VSYA 3GJ3A 1DG9A 4H7DA 3U4MA 2O8EB 2C78A 2OC9A 4IIEA 3FGNA 3GGOA 3JQDA 4LWPA 3BHJA 2GJSA 3ORYA 4HAOA 5DYTA 2P2ZA 3K94A 5JS1A 3SN6A 2AYZA 1MOQA 1PGOA 3DZJA 1O08A 4YK7A 1JLLB 4CMHA 4CLRB 2X42A 4OQDA 4Z0HO 2PWZA 4M86A 5FBRB 1KS9A 1OBVA 2DTEA 3EGWA 3BDAA 4UQPA 1TVEA 3A25A 3IVCA 1N7GA 1NT4A 5HIJA 3D5TA 2PQ0A 3AM5A 3GEEA 4P53A 5ED0A 4IJ6A 1KMIY 4IFIA 4Q3NA 5T3YA 4LE2A 2H1VA 3NJRA 2OOKA 4O4IB 1ONSA 2OO5A 2WZCA 1DX4A 4KPGA 4ZKDA 1VPDA 3A1SA 1TYZA 1FA9A 2NUPA 2WY2D 5F33A 2PCJA 3VU9B 5EHZA 1CY8A 5L7TA 4AIIA 4UREA 5JYDA 3LPMA 2XI4A 3BL5A 4QO8A 2VSNA 8AT1A 1JLMA 4WBNA 3SHFA 4JNKA 5FADA 2CSUA 3USES 1PS8A 3ETEA 1SH7A 1EQUA 4Z86A 2RGCA 1AE1A 1GQ2A 2FSFA 3DAOA 2BUAA 4AKEA 1SVMA 3HP4A 4YRZA 1PK9A 3AJDA 1MVNA 1D1PA 3BWVA 1LTHR 3EZXA 1GQYA 5IAGA 1OT3A 5KKCA 3VV2A 4PBRA 5KZMB 4G5XA 1PQWA 4DLSA 1CRQA 1OFGA 4C0QC 1MV8A 1TTQB 3DW3X 4G1VA 4KRYA 4EW2A 3W3ZB 2QNRA 3AUUA 4TL8A 1O57A 1Z2AA 3F98A 4G8BA 4OCZA 3R77A 1DQYA 1K8RA 3KEGA 1T5SA 4H6WA 3WYCA 3OZSA 4FM9A 3BD7A 4YGXB 3B20A 3LKVA 1ZRNA 3KX2A 5E4FA 2CMFA 2HSWA 1MX1A 3LPCA 3L1HA 3OE5A 4FU0A 3ZHOA 1AC5A 5I4CA 5IYZB 5KYGA 4WRRA 2OG1A 3TXXA 3A1EA 2F2TA 3NR2A 1IY1A 2RAVA 3WGGA 3D3NA 4E33A 2NPIA 1P2VA 1P7VA 2H92A 1P19A 2CK3D 3U4QA 1V3VA 4FSXA 2XA9A 1G38A 3SHOA 1PGJA 3WK8A 2Y92A 2HHJA 2EZ4A 1XZAA 4OHOA 3AESA 2FZ4A 3C1AA 1Z18A 2OV6A 4EZBA 1CEXA 1U5AA 3DDZX 3X2FA 1M5UA 1OBCA 1PZEA 3CMMA 3ZHBA 2YQZA 4BRZA 2QTCA 1XQVA 3ABQB 1RPNA 1ONPA 3QIAA 4XYMA 5JECA 1YR7A 5JXIA 1G8PA 3DHEA 4QJBA 1V8OA 1MA3A 4FXPA 1IBCA 1N77A 3R0IA 3ZY2A 1B0AA 2ONCA 2PYZA 1VE9A 2BDTA 4K8OA 4MK4A 1R66A 3L6BA 5EN4A 3IXQA 3VJMA 3K70D 1LZLA 1E96A 1TQHA 2BFNA 3FF4A 3DEFA 4HWKA 4MJ3A 4PYJA 2CFTA 4O3MA 2J9FB 4PG4A 2XF2A 3PEEA 2VYND 2WP0A 1T10A 2PZGA 3OFNA 1W5FA 5EE1A 5M7EA 4MQ5A 3FOAA 5TF0A 3UYKA 3SWWA 1MFZA 3BKXA 3PX2A 3ZZNA 5ICFA 3LC1O 3EARA 1ISRA 3KKNA 2EQ5A 1HFJA 2XYVA 3MIZA 3MUOA 4LQCA 3BJIC 4B83A 4BMVA 2IYSA 1AHIA 3VUEA 5EJ4A 2BFDB 3BQNB 5J5CA 3WL4A 5L3QA 5CG2A 3ABIA 3PNQA 2DOKA 3AMVA 5EGNA 1T8YA 1GZSA 2E55A 2VS1A 2FZLA 3GRFA 5HF9A 1MFPA 2XB9A 3FE2A 3QRWA 4Z4IA 1VL8A 4TXMA 4P4SB 2BEWA 3C97A 5EZYB 1U6JA 4DDWA 3KTAA 3L77A 1LI4A 4ND8A 1GZDA 5G0TA 4ETWA 1UBSB 3V9AA 5D1HA 5J59A 2JD0A 2E6KA 4EHDA 5JRZA 2B9VA 1EFTA 3W7VA 5FJJA 2JANA 1Z26A 4J1SA 1N33B 4MIEA 2HPZA 1BDBA 4EGQA 3IBCA 1RVV1 4LWQA 3S7TA 1XAGA 3QZUA 1E4EB 5ES4B 3CQ9A 2C1XA 3TRIA 5K05A 3MT9A 1VCOA 2SKDA 3DWFA 1NPDA 1P8AA 1Z22A 2G9ZA 2OC4A 4C7JA 3RABA 3UQYS 5EJ9A 1X9IA 3SZLA 1II9A 4YMWA 4GZ6A 2NSDA 3LOUA 5ETJA 1BMDA 1PLKA 1YRYE 2O6HA 3GH3A 3KT0A 5DV9A 4D9MA 3DBRA 1X86B 4GMFA 1RT9A 1EWVA 2GILA 2IYTA 2OO7A 1GKLA 1Y82A 3AVOA 3BIFA 3RYFA 3MCZA 2VTEA 5HTKA 3QVKA 2KLHA 2QN1A 1GL3A 3AVXA 1A4XA 1NUAA 3I39X 5DBIA 1Q0HA 3GDHA 3GLTA 1DI0A 3A2LA 3AR3A 4YJHB 4OAQA 2Q0XA 4KQ1A 3DHVA 3K15A 2B5WA 4RPCA 5DLQC 2ID4A 1LK0A 4BJ5A 2O8BB 4CMCA 4ZVSA 3EOAI 3H1EA 3IP9A 4R2MA 3CLTC 3TOVA 2PDAA 2IUTA 4PX9A 1NUSA 4WNYA