5DJ5A

Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
GAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Destabilization of strigolactone receptor DWARF14 by binding of ligand and E3-ligase signaling effector DWARF3.
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Probable strigolactone esterase D14
total genus 90
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dj5A00
3EIOA 4EY7A 3QPDA 4INZA 1DQYA 2VAVA 5EHXA 3A6ZA 1TAHA 1VA4A 3KD2A 3L1IA 4K5QA 1PV1A 3D2CA 2G63A 4B0OA 3BWXA 3O4GA 4B82A 5HKAA 3PE6A 2HRQA 1E5TA 3OPMA 4J0DA 1ODSA 3ZWQA 4I19A 4M0EA 3KOOA 2YASA 4OSEA 5BOVA 4P08A 5IVKA 4XWGA 4PV7A 5C7YA 2RONA 2Z8XA 1EB8A 1UWCA 2JGEA 4B9EA 5ALOA 3IULA 3W9UA 2ZVDA 1B41A 5DWDA 3M83A 5AK6A 3N2ZB 1JI3A 1EA5A 1IZ8A 2PUJA 1CQWA 2YXPX 5HQ3A 4K2AA 1QJ4A 2XQIA 1Q84A 2J4FA 5K5EA 4W1PA 5JD6A 1YS1X 3ESBA 4IHAA 2HA7A 1MTZA 3WIBA 5I9IA 4YPVA 5AJHA 4B85A 2PX6A 1QFSA 2WJ3A 4BRSA 5KREA 5DJ5A 4X90A 5CT6A 1K5PA 4J0GA 5ALMA 1XRMA 3HLKA 1YSCA 2DSNA 1VE7A 5CXUA 2PSEA 3FAKA 3HSSA 1MX1A 1EVEA 1C7JA 3I6ZA 4UHCA 3PUHA 2GBFA 4RE5A 1PJAA 3WK6A 4B80A 1S8OA 3F98A 5LKRA 1QTIA 1QIMA 1HPLA 2WFMA 1U4NA 4CIBA 1W75A 4FDMA 2OG1A 1XZDA 1EK2A 4H7KA 1J1IA 1BCRA 1XZCA 4UBLA 3C87A 5K3BA 1R9NA 4UBOA 3R3ZA 1LZKA 1EDEA 1E8MA 4EUSA 1K4YA 3W05A 2WU3A 4J0IA 4HTAA 3ESAA 5ALPA 4A23A 1JFRA 3FYUB 1AKNA 5ALYA 3AINA 2BKLA 4B7ZA 4BTLA 2VAXA 5ALKA 5LZ7A 3HZOA 3E1GA 1HL7A 4AMYA 5ISMA 3G0BA 4FLFA 1EK1A 3GZJA 1H2ZA 2WFLA 1QONA 1CUZA 4G8DA 2Y6VA 1NX9A 4LYDA 3R40A 1VZ3A 3AZQA 1CVLA 2AJBA 4KACA 4OB6A 2AJCA 3O95A 4MWSA 5AI9A 5AKGA 2HHAA 4BDTA 5HFAA 4MQMA 4HZGA 3SC2A 4BAGA 2GYWA 4EBBA 4LKOA 2OAEA 1ZD5A 2I3ZA 3ICWA 4ROTA 1YS2X 2WJ6A 4FKBA 4RNCA 1NU8A 5LYYA 3IVMA 3R3YA 4N8SA 2I78A 3CCCA 3ZLTA 3DYVA 3C8DA 1JU3A 4MEBA 1CUXA 1IMJA 5CBKA 3LIPA 5DYTA 5AOAA 3B3QA 1CUGA 1M33A 4A5SA 3T4UA 4FOLA 4V2IA 5DYYA 2G5TA 2P8SA 1GXSA 2W6CX 4Q05A 1QE3A 1BS9A 2DQYA 1LPNA 3DOIA 4LXIA 3V1LA 1CV2A 3WIOA 1HBJA 1GGVA 1HLGA 2DHDA 2ZJFA 1AX9A 2WFZA 3IB3A 3H2IA 4C6HA 3HC7A 5AI8A 4C89A 4U2GA 2Q0XA 1BROA 5JZ9A 1UXOA 5DYWA 4FFVA 3R0VA 1UK6A 2WIJA 4KRXA 4Y2VA 4QDZA 4L0CA 1E66A 2YH2A 1LZLA 2V97A 1N1MA 1XZEA 3I6MA 5FLKA 4XJVA 1EVQA 4UHEA 4GECA 1MT3A 3WWCA 4DNPA 3Q8WA 3BF7A 4E15A 4WDQA 4J0HA 4PSUA 1N5RA 5D3ZA 3B5EA 4N5IX 3WKBA 5LIPA 1R1DA 3IBTA 4GWLA 2GBCA 3T52A 2CKMA 1RP1A 1Y7HA 3JWEA 4ZXFA 2HADA 5ALHA 1VE6A 2XUIA 2CJPA 4B81A 4FNGA 4MYDA 3G0IA 3OM8A 2YYSA 4H7HA 1QO9A 2X76A 1GQSA 1K8QA 4YK7A 4J0CA 1MPXA 4UUQA 3FWHA 4H7JA 2I3DA 4UBIA 1DQZA 1YR2A 3VVMA 5DLPA 4JH0A 1MX9A 4P93A 3DL4A 4EZIA 1ZD3A 3DOHA 3G0DA 4BCDA 4H7FA 3IA2A 4X6YA 1EDBA 1H2WA 4FHZA 4UPDA 1ZJ4A 4KR0A 4AZ3A 2HA4A 2ECFA 1XFDA 4OYLA 3G9ZA 1UKBA 2VF2A 3H2GA 4Y2UA 1YB7A 4OCZA 2FX5A 5J3JA 2PSDA 4DMKA 4KEAA 1LPOA 5A2GA 2GYVA 3P2MA 4QWMA 4D9JA 2WHPB 1CUDA 1QIJA 3WQHA 4H18A 4DMCA 3AFIA 1QO7A 2UZ0A 1IUOA 2WIFA 1LBTA 1XZBA 5IVDA 5EHZA 4DGQA 3FCYA 3A2LA 5E2IA 2O2GA 2DR0A 1WPXA 1MAHA 3CXUA 4KE7A 1EI9A 4BVLA 3PF9A 3AZOA 2WUGA 5HF9A 1VLQA 3H04A 2HA2A 5CT9A 3WK5A 1AMNA 4S0XA 3TEJA 2H7XA 2HRRA 2OAGA 4RE6A 3QITA 2GBGA 3LLCA 5KBYA 3C43A 1SCQA 1YAHA 2WIKA 3FLBA 4WJLA 3STTA 3RARA 3IUQA 3AILA 3V48A 1CUWA 1E8NA 2PU7A 5CURA 5E4JA 3D4LA 2VQ6A 2EDCA 1GKKA 2XMQA 3KWJA 2O7VA 4C4ZA 3WK8A 2VJDA 4G4JA 2HU8A 4PQEA 1OILA 4G1FA 1IUPA 3BJMA 4X00A 2HA6A 5FOQA 1GKLA 2Z3WA 2CEKA 3WKDA 5JANA 5AIBA 3BJRA 1FSSA 4WCVA 4BCBA 2E3JA 4EY5A 2C4HA 1YA8A 1DWQA 4RGYA 4Q3LA 3C5WP 3A2NA 3M3DA 3C8HA 1DINA 1CUIA 3TJMA 1DX4A 2C58A 3FYTA 4W1SA 2I03A 5AOCA 4GBGA 1TCCA 2OGTA 3N0TA 3WZLA 2QKYA 5JD4A 1G5FA 5ESRA 5T4FA 2XMGA 4X93A 1NU6A 1L7QA 1UK8A 1H2XA 1E8DA 3WYDA 1QZ3A 1A8SA 3G9TA 4Y2SA 3Q0TA 4CG1A 3F96A 1CLEA 2WU4A 5AOBA 1J2EA 3PDCA 2D5LA 5JATA 3FSGA 5AI4A 5CH8A 5T4HA 4WY8A 2QXTA 4FFWA 2WM2A 5E4TA 1TQHA 3GROA 3WK4A 1SFRA 1A8UA 2V98A 3R3XA 2JBWA 4AMZA 4DMFA 4C87A 2Y2UA 2WHPA 5K3DA 4C4XA 4X92A 2PSHA 5LZ9A 2WUFA 2O2IA 3F67A 2ZYSA 3WL5A 4HRYA 3LCRA 4BC0A 1BRTA 2WSLA 3HI4A 1H23A 3G7NA 4Q1VA 3H1AA 3D5EA 4E46A 4JYPA 4L72A 2ZJ7A 2JGKA 1F0PA 2OGZA 4FLEA 3HJUA 4XX1A 1XKLA 2RI6A 4LIPD 1J07A 4DLNA 1Z68A 1ZICA 1MN6A 5A71A 5HQ3B 1VJ5A 4QLOA 4JEIA 3WWPA 5HK9A 3BF8A 1DU4A 1XQVA 1QLWA 1EX9A 2ES4A 5K3AA 2WIGA 4I4CA 5AKJA 3FNBA 4EHBA 3DD5A 4Q3KA 1R88A 3QYJA 2WHRA 1TRHA 1THTA 1BN6A 1ORVA 4HRXA 4OU5A 4LYEA 2Z8ZA 5ALLA 2XQGA 3H17A 3G02A 4Y2YA 4CFSA 1AURA 4FBLA 3QBJA 4KAJA 2DHEA 5IH7A 4BYMA 2R11A 1XLUA 4ARBA 2XLCA 5ALUA 4X7BA 1E89A 3WK9A 1UZAA 4NVRA 1JMYA 2WLSA 3DKKA 4CG3A 1Q83A 3HXKA 3IUNA 3KWFA 5JARA 5DTIA 1XZHA 5K3EA 2DFPA 1EXWA 1ZGCA 5AKXA 2Y6UA 4X85A 3BIWA 4P92A 3BL8A 2JGIA 5JD5A 2QRUA 3I2JA 2HA0A 4C88A 1P0PA 2PSJA 2RGUA 1W6RA 2WG0A 4TVKA 1QIFA 2PKYX 3IURA 1XQWA 4HXFB 4ZI5A 2OXEA 3WI7A 2HFKA 1EINA 3GELA 2WG1A 3WLAA 3QMVA 4K6HA 3D2BA 5A6VA 2XMZA 4BCCA 4G9GA 1GPKA 1DT3A 4G4IA 2XQKA 4G8CA 3UMJA 3WL8A 1CIJA 4YASA 1HKHA 3CCBA 5BV7A 1ETHA 5AH0A 1QIGA 4F5ZA 1DWPA 1WPRA 4WFJA 1Y37A 1AC5A 1TKRA 2XUDA 1I6WA 3AIMA 2QUAA 2QTBA 5EIEA 4L3WA 1RWQA 4BE9A 3QZUA 2FJPA 2PL5A 3FCXA 2JGLA 4PSCA 3R3UA 2ZYRA 1IZ7A 5JAOA 5A7FA 3WZMA 4O08A 2QUBA 3HYSA 4LHEA 4BDSA 3QH4A 4BZZA 4MYSA 4J03A 4BZWA 1D07A 2J4CA 1XZGA 4EB0A 1AUOA 3WL6A 1MJ5A 2XMSA 4CCYB 3GUUA 1XZKA 2QOEA 3STUA 1XKTA 3DJYA 2WQZA 1MX5A 4BVJA 2QMQA 4OD0A 5I8PA 4QNNA 3F9CA 5ALTA 2K2QB 2QM0A 1WHSA 4IH1A 5AKYA 5AM4A 2BUCA 4GI1A 1CUHA 4DNFA 4DIUA 1HQDA 4MXDA 4WDRA 1CPYA 1KU6A 3K6KA 3G0GA 3OG9A 5IVHA 3OC0A 4U2CA 4J7AA 5ALQA 4X6XA 3WJ1A 3VKFA 2HA3A 3WK7A 1XRPA 4KAAA 3HRHA 2HDWA 3U0VA 1VXRA 3CN9A 4K6GA 5FXMA 1LLFA 3ESDA 3DLTA 2IITA 5EHQA 5AKZA 2AJDA 1W1IA 2GZRA 2ACKA 3I6YA 2G5PA 4IQ4A 3G8YA 1BE0A 3GA7A 1KEZA 1ZOIA 1XLWA 5LP1A 5AM3A 5ALDA 3H2KA 4EY4A 1F0NA 5CT8A 5EIAA 1U2EA 1AGYA 4Q3OA 3WWEA 1CR6A 4XIIA 3VXKA 4XVCA 3NOXA 3SX4A 1U65A 2PPLA 1BU8A 4G4GA 1IUNA 4DYHA 2BFNA 1R3DA 5JAHA 4EY8A 4MQLA 5BWBA 1SC9A 4PO3X 1IVYA 2ZYHA 5HF5A 3GFFA 4OPMA 4J0KA 1CFJA 4FBMA 4DNQA 5FP0A 2D0DA 3DYIA 2WJ4A 1QIDA 3L1JA 3I2GA 1SCKA 1TIBA 4HVTA 1UOQA 2XMBA 1ODTC 1A7UA 1C7IA 1JMKC 1ZD2P 5SYMA 3BDVA 4X95A 5EIHA 4EA6A 1ZI9A 3WYNA 3NGMA 4QZVA 5AI0A 2ZSIA 1YA4A 5C8VA 2B9VA 2WILA 3WKEA 4PW0A 4MWTA 1FFCA 2VSQA 3PUIA 5HKBA 1CUJA 3DCNA 5JZSA 4X91A 1K6EA 2HM7A 4ZV7A 1AQLA 2CZQA 4TGLA 5HCUA 4U2DA 5CMLA 2X8BA 5LZ8A 4H7IA 2DCMA 4WY5A 5DNUA 3AIOA 1R50A 4NS4A 3WKCA 5AIAA 4ETWA 3EQ8A 1XZMA 3DDUA 3R3VA 1G4HA 3VISA 4CCYA 3O9VA 4BTVA 2ONCA 5D3KA 4C01A 3V1NA 2QXUA 1XRLA 4CG2A 4BATA 3EBLA 5CT5A 3F8SA 2OGSA 2ZYIA 3RM3A 3EQ7A 2OPHA 5AI5A 2JGFA 3KSRA 4GLBA 1T2NA 2XUAA 3BXPA 4W1RA 4OU4A 5LLSA 4CI9A 3R41A 4X71A 5AKHA 5LZ5A 2R8BA 3S2ZA 3C70A 1A8QA 1AZWA 1X2BA 3VDXA 2CB9A 1N8SA 5ALRA 3LS2A 2B61A 3B12A 1LPBB 3BE8A 2HFJA 3CN7A 5DNVA 1EDDA 5IVIA 1UOOA 4KYVA 5DTJA 4G8BA 4LXGA 4U2BA 1XRQA 3SK0A 1Y7IA 1SCIA 4BE4A 1VXOA 4H0CA 4F21A 3OOSA 4X6UA 3A70A 4I3FA 5AM5A 2PM8A 4ITVA 1Q0RA 3TRDA 5ALWA 1MO2A 5EI5A 1GZ7A 4QDUA 5K3CA 3VJLA 3K2IA 1FJ2A 4BP8A 1RYYA 3FSGD 1XZIA 1MNQA 3G9XA 4FLMA 5ALIA 1EB9A 3NUZA 3I1IA 4Y2QA 3DEAA 4RPCA 2NW6A 2WUDA 2VATA 3D3NA 4MEAA 5CH3A 3WJ2A 2DQZA 3D59A 3WMRA 3ICVA 4A16A 2RIPA 1K63A 5KWIA 5SYNA 2XLBA 4Q34A 5JAPA 3AIKA 4AZ0A 2C0QA 5AO9A 3W2TA 3C45A 5E4YA 4B0PA 2QZPA 1ODCA 3ANTA 1CUSA 2JGMA 4DNOA 1JJIA 3QMMA 4IH9A 3FLEA 3RLIA 5JASA 3MVEA 3D2AA 4DSAA 2XQFA 5D6OA 2WIDA 1CQZA 4QA9A 3MGAA 4N8DA 3WWOA 2FUKA 4Q82A 2PBLA 5A7GA 5FPPA 1YB6A 4C4YA 4Y7DA 2HIHA 3C6ZA 1WB5A 5AK5A 4CCWA 2VEOA 3EF3A 4H77A 3EQ9A 5AM2A 2PSFA 4UBNA 2OCGA 4AO6A 3G9UA 1R4ZA 2J3QA 5ALJA 4BBZA 4DM7A 4LXHA 4UBKA 5F4ZA 4ZV9A 4DTCA 2H9YA 2BCEA 2XT0A 3SWWA 1W76A 2C7BA 2XMCA 1YASA 1UKAA 4HXGA 2XMDA 5JYCA 4X3CA 2XUQA 3E4DA 3ZLUA 2BAGA 1LNSA 4QWWA 1BEZA 1T4MA 3OURA 4FMPA 3I2HA 3ESCA 3V9AA 5FUMA 1CUEA 2BGRA 3OTQA 2VTVA 3ED1A 3QPCA 3O0DA 3O4HA 4X97A 1OXMA 2OQVA 5AKEA 3DL7A 2XUKA 5D7BA 1XROA 1XQYA 3VVLA 3MUNA 3ILSA 5CW2A 5BWCA 5C8ZA 4HXEB 5C8XA 3H0CA 4YX9A 3FOBA 2LIPA 1TK3A 1X2EA 5HZGA 2JEYA 2HL6A 3FBWA 4KJXA 4ZRDA 2XUHA 5FRDA 4QLAA 4AB1A 3C5VA 1BCSA 2BUBA 2HA5A 2ORYA 3AZPA 1FFBA 4KRYA 1JJBA 1QOZA 1ZIYA 4UFNA 3STVA 2ZJ6A 5ALZA 1UFOA 4AXBA 3FVRA 1P0MA 4K6KA 3D7RA 2CMFA 1MU0A 4OYYA 5ALXA 2QT9A 2VT7A 1ZI8A 2G4LA 4CIAA 2XUPA 3FVTA 4HS9A 4EY6A 1OCEA 5ALGA 1UT6A 3I2IA 5KWJA 1WM1A 1XLVA 2VJAA 1FFAA 1F6WA 3K9BA 4ARAA 2PVSA 3V1KA 1QIKA 5AK3A 1P0IA 5FV4A 3S8YA 5EHNA 3W9BA 5FDFA 4AO8A 3HEAA 3JW8A 5DNWA 3H1BA 4W9RA 2XI4A 4GW3A 5JALA 1VKHA 2B20A 4UHBA 5HF6A 1LBSA 1LPMA 2WKWA 1QIHA 1ACJA 2GBIA 1J06A 4N8EA 3DS8A 3W04A 5HK8A 2C5FA 3ZLVA 1FFDA 4FWBA 5I7UA 2WFLB 4AQDA 3I2FA 5AKIA 1H2YA 1VA5A 2AJLI 1XQXA 1MNAA 2XMRA 2VT6A 4UHFA 4BB0A 2WHQA 5AK4A 4IO0A 4J0JA 1ZD4A 1JKMA 1JU4A 1JJFA 1XZLA 2H7YA 3I2KA 3IUJA 5CTAA 3IDAA 4Y2XA 4NZZA 2HU7A 4H35A 5ALSA 1U8EA 4Y2TA 2QVBA 1VOTA 2OCIA 4GEGA 5HF8A 2Y1KA 4BVKA 5JADA 2AJ8A 3NWOA 2XUJA 3L1HA 2O2HA 5FKJA 4Y9SA 3M81A 5C81A 5LZ2A 4JNCA 5CH5A 1WB4A 3PICA 5IKXA 4F0JA 3QMWA 1HDEA 3O4IA 5A62A 5AM0A 4H7EA 1G66A 3E3AA 1O6FA 5AP9A 2FJ0A 4BP9A 1EH5A 4BAUA 3YASA 2OQIA 1QIIA 4UFOA 1UK7A 2QR5A 1BEEA 2BGNA 4UHHA 3LIIA 4E11A 4BC1A 3X3HA 4P9NA 4QE3A 7YASA 3DNMA 4UBMA 4H7DA 3M82A 1W4LA 2ACEA 3ZI7A 4FNMA 4UHDA 4AO7A 2IIVA 5AKLA 4MJ3A 4KE8A 2XUGA 1WOMA 5ALEA 3JYHA 5LZ4A 1GT6A 1CUVA 2XUFA 4PF1A 1ZI6A 3VJKA 1C4XA 1WCYA 1H22A 1TCAA 4PSDA 2XE4A 1E3QA 3VJMA 3DKRA 3V1MA 3MUOA 3WKAA 1ACLA 1P0QA 6YASA 1MAAA 1ZIXA 4B6GA 4Y2PA 3WWDA 2RAUA 3PI6A 2W22A 4B84A 1VZ2A 4QDTA 1R9MA 5AI6A 1UKCA 5FPQA 4OUKX 4AX4A 1CUCA 4WFIA 2AXEA 4ZREA 1XRNA 1CUAA 1USWA 3HABA 1FFEA 4U2EA 2XUOA 1GQRA 4W63A 3O9MA 2IX9A 2ROQA 1CUFA 5EFZA 2EDAA 4G9EA 2RHWA 4W1QA 4UBJA 2WTMA 2WUEA 3HACA 4BRZA 5AKKA 4J3JA 1CUYA 3H18A 1O6GA 3G0CA 2Z3ZA 2EEPA 3ZPXA 3C6XA 1WB6A 3FYUC 3WL7A 2V9ZA 1ISPA 1JT2A 3H2HA 5YASA 1UOPA 1N5MA 3FYUA 2J3DA 4QDXA 4NMWA 1A88A 1UK9A 1WHTA 3R3WA 3WA6A 4JYMA 4M0MA 1ORWA 2OCLA 2WG2A 1BN7A 3KDAA 1B6GA 2X5XA 2HU5A 1ZJ5A 1TCBA 4L9AA 3F97A 2ZSHA 4BAZA 1SOMA 1X70A 3DQZA 5HFNA 3ZV7A 4M0FA 4X94A 1XZJA 4U2FA 2OLEA 1LGYA 5JAUA 3C6BA 4FTWA 4IH4A 2XB6A 3RKSA 1KU0A 4GDMA 3UUFA 5AICA 3AJAA 2RHTA 3STXA 1DWOA 3BIXA 4QEKA 1DT5A 4B9AA 4F60A 4AN1A 5LKAA 2O7RA 5K3FA 2QJRA 3E0XA 4KE6A 3ANSA 1YCDA 4PNZA 1LPPA 1GPNA 3RK4A 5ALNA 2C5GA 2V96A 3BDIA 3O4JA 1Q0ZA 4TPKA 2QJWA 3PFBA 1CRLA 4Z49A 2XQJA 2Z5GA 3WA7A 3UUEA 4DSZA 1PFQA 3QM1A 4Y2JA 1L7AA 2VA9A 3AUKA 2PUHA 1QFMA 2DHCA 5T4EA 2GZSA 5K3FB 1W52X 2VJCA 3I28A 2OCKA 2CUTA 4ZGBA 1YAJA 3H19A 1G42A 3I1YA 3W06A 4JUIA 4ZWNA 3TGLA 2JEZA 3D0KA 1DX6A 1CUBA 3GBSA 4UFPA 3PF8A 3H2JA 5JIBA 3LP5A 1GPLA 2PU5A 3FLAA 2BJHA 1QIEA 1QGED 3QPAA 5AHXA 1L7RA 3U1TA 5CT4A 1EHYA 4E14A 2JF0A 1XZFA 3IUMA 4WFKA 2C0PA 4GXNA 4AN0A 4DMHA 5ALVA 2CBGA 1XZAA 3IIIA 5JZBA 2QS9A 4KE9A 3STYA 2Y2VA 1ZGBA 2WTNA 2B4KA 2GYUA 4OB8A 4B83A 4Y2RA 3STWA 4N5HX 1LPSA 2VJBA 2H7CA 5A7HA 1XRRA 2XDWA 1F8UA 4G5XA 4KAFA 2JGJA 3A2MA 4HAIA 4QDOA 3C6YA 5T4BA 5ALFA 5EGNA 1CEXA 5CRIA 4GHWA 5AM1A 1DTEA 3PFCA 2H1IA 3KXPA 5CXXA 3QVMA 1THGA 1CUUA 4OB7A 2JIDA 5H3HA 1LPAB 1QTRA 2BUAA
chains in the Genus database with same CATH superfamily
1OV6A 3U4GA 4TXNA 4JXZA 2QRJA 4YYZA 2DOKA 2GJAA 2J5XA 3BGIA 4MKXA 2GERA 3WDSA 4E03A 1DQYA 2X0EA 1HFKA 1R0BA 1VB5A 2VAVA 3P1JA 1I2CA 2Y77A 1L5SA 5EN4A 3X2EA 5FHQA 4D4JA 5DM0A 3O03A 3HY4A 3C3MA 2G9ZA 3S2GA 4UEWA 3D0QA 3H2BA 4QTTB 3T8YA 4KWEA 3WMGA 4C2TA 2P5UA 3L1IA 3DMFA 5KC9A 3AFNA 3NT4A 4K5QA 1X38A 5B2ZA 3D2CA 1R9JA 3GJ4A 3VA7A 5KNCH 3QEAZ 2HCRA 2G63A 1T36B 2G06A 2WPDA 5D51S 1VPDA 2HSZA 3O4GA 3DONA 5DRYA 5FFMA 5HTKA 2ZBDA 4B82A 4HNUA 1DKQA 1E5TA 4QYSA 2BBWA 4BJ6A 4YJ3B 2CHUA 3QLJA 2HCBA 2DHRA 3KTFA 4J0DA 1ODSA 5AJXA 2FWBA 5J63A 2C3MA 4QFCA 5JY1A 5C1IA 1X9HA 1R4MA 1EUCA 4I19A 4QPDA 1Z45A 4TKUB 2ERXA 2QWXA 1DAFA 3KOOA 4MA4A 3FOZA 1E5QA 5AUPB 2WF7A 3SXUA 3QTTA 3C5CA 2HHLA 4IQGA 4P08A 3F90A 5TX7A 1NP6A 4PLCA 1SB8A 1P80A 4KNVA 3ZWAA 2PE5A 4R2XA 1L8OA 4KN5A 5TVGA 4C4SA 1B0ZA 1QP8A 2W6QA 5IVKA 1HK7A 4EJ6A 4DJTA 4HO1X 2FPGB 5C7YA 1M72A 2I4NA 3ZDDA 4P7GA 4MDEA 3RVSA 3LKBA 2JHGA 1JG1A 2O0MA 3MEQA 1Z5NA 2RONA 4MWBA 1RC0A 2Q1YA 1UWCA 4WESB 1WXWA 2ZRJA 5ALOA 1JHXA 3W9UA 1KEWA 2CMHA 2XOKA 1V9LA 3CT4A 1A3CA 2V6FA 4YMHA 3ENVA 4D99A 3KVRA 8LDHA 2X2FA 4CTKA 1U7UA 4F6LA 1U4SA 3P2IA 3GUZA 4NBNA 5DULA 1M1YE 3QENA 4WZAE 2WVHA 1ZNWA 3MJRA 4OQQA 5DN6A 1U3GA 3D2LA 3GK3A 2IGBA 3CBQA 1R16A 4INAA 5D3MA 3UGKA 2YXBA 2BVNA 2W48A 4P0TA 3Q7IA 5FFFA 1VCMA 1TUEA 1X9IA 1Z6YA 2REBA 3GMSA 5EE9A 2VDJA 4HGZA 1IZ8A 2PUJA 3DE4X 1EFDN 2DLNA 3TH5A 3ZGZA 4LHSA 4OGGA 4OGFA 5HQ3A 4ISCA 4WLUA 2D2VA 4XEUA 5DISB 4NULA 3WV4A 1NBIA 4CETA 1I3KA 5JYEA 5JJCA 1Z13A 5F5LA 2I6FA 3LRXA 3OCYA 1PTJC 5JHHB 2R1ZA 3PS9A 4CM4A 1Z4KA 3QF4A 3PIIA 2IOYA 3T0FA 1KP9A 5EMKA 1WO8A 4P81A 4G81A 3QPVA 3WLHA 3H86A 5DSZA 3K09A 4AF6A 4IIXA 3RIXA 3ZDEA 1LFAA 1EIWA 4YXFA 3I01A 4ER0A 4XTCS 2H51A 3K94A 3KYBA 3PDIB 2JG3A 3WQBA 5AJHA 2Y0PA 3RJ5A 3ENWA 2PX6A 1QFSA 1PZEA 2WJ3A 3ANYB 2DWPA 2Y1CA 3U31A 5KREA 3KQKA 2EKBA 1J70A 1ZAKA 2GVDC 4IXWA 4X90A 2EXXA 1UINA 1PEKE 3DA8A 2VXCA 1PJSA 4O3FA 4WHMA 4ZICA 1Q57A 3A27A 3MPOA 1K2WA 5ALMA 2IHYA 2H1CA 4Z8YA 5BNTA 3D5QA 5KVSA 2GZAA 2YJNA 3TTVA 2DSNA 4O6VA 5IT9A 4WN9A 2IHTA 1PR3A 1YKSA 2CVPA 1PR0A 3PUKA 3P2JA 2J31A 1XA4A 5I4BA 1YQXA 4NH4A 4WZBB 1SIBE 3O8OA 2CDAA 4UREA 2L18A 2Q27A 3I6ZA 3V9PA 4DAOA 1U98A 2NNLD 4UHCA 1I4DD 3QQPA 3EGEA 1WSWA 3I05A 2GBFA 3W6UA 1RI1A 3GZNB 3R4VA 1ZM7A 2Q8NA 3HB5X 2OXIA 1OGIA 1N4DA 2WF9A 1H9AA 3TQTA 2GHQA 2C3PA 2XWBF 3PPIA 3WK6A 4B80A 4PQFA 1S8OA 2H2GA 4BQQA 3EPHA 2L0XA 5BSRA 5D01A 1B8VA 3QLTA 3BGVA 3F98A 4FZRA 1KFEB 3ZY6A 1K86A 4CIVA 1QCZA 5LKRA 4G0WA 3BJEA 1OR8A 2IYAA 4IX9A 5NULA 2ZI6A 1F48A 3A0RB 5HW0A 4PZLA 1H2HA 3OIYA 2FEKA 2ZZNA 2WFMA 2BF4A 1DG3A 2PY6A 1H8HD 1M2NA 1MH1A 2BFFB 2P6UA 2X3YA 3H9QA 3HSKA 3LCVB 4B76A 5JJLA 2P2DA 4XDYA 1EK2A 4Y1RA 1J1IA 3ZCQA 4IKEA 1LF0A 3PXXA 2H11A 4J91A 3EZNA 4NABA 3FMPB 3H65A 3AVTA 3PPXA 2YWHA 2RGGA 3N0VA 5K3BA 5JQGA 4A0GA 5L3QA 3AP3A 1NONA 3L8DA 3R3ZA 3R44A 2O0KA 5FEUA 3KQOA 4TVSA 1ZMBA 2RH5A 2XKJE 3DNPA 3SYLA 3WGZA 4BFUA 1VTKA 3GLTA 1ULHA 1NQWA 5C7LO 4QKQA 3ESRA 2A5YB 1NFQA 1ZYUA 4JITA 2GX6A 3W05A 4QARA 1TA9A 5JSUA 4J07A 1E6LA 1MXHA 1ZN9A 2CDRA 4J0IA 4LE2A 3ETEA 3GA5A 5AHRA 4W5HA 2G8LA 4Q6BA 2P68A 1OFUA 5ALPA 3RSSA 5IJ9A 3PGKA 4CKXA 2WJVA 3ROKA 1MX3A 1PJ8A 3EH2A 1JALA 5CDUA 1QHHA 4HZIA 2VRBA 3P19A 1WVMA 3JRNA 3P0HA 3Q7PA 1NC3A 4QODA 4WW0A 2VA8A 2VP4A 3U19A 1OI3A 2YC4C 2DC1A 2JFPA 3QPBA 4YROA 1M2EA 3LKDA 1KPIA 2R4TA 1P31A 3KEQA 4LS3A 3UGQA 1JVSA 4RVOA 2FW7A 2KPOA 2LV8A 3LOPA 2MINA 5DK6A 1N5KA 3G0BA 4FE3A 4GUDA 4TKMA 1XPUA 2J9FA 2DUMA 3GAMA 5I9LA 4D3FA 3PHGA 5JI2E 5I7OA 2RCYA 1SBNE 4M83A 5CA1B 4Q37A 4MRPA 1H2ZA 1RLTA 3BZUA 3UUWA 3UA3A 2GUWA 1QH1A 1I7LA 5E7JA 1J2UA 2YMQA 4JAVC 4NCAA 2B4RO 3MINA 5I9BA 3UB3A 5BVGA 3AZQA 2QL9A 4OB6A 1TU3A 3CVVA 3ZU2A 1DC5A 3ZZNA 2AJCA 2BGLA 2YHBA 1AM4D 1VRVA 3TECE 4EGAA 2YN4A 1VMDA 5AKGA 5AVSA 1E63A 3N2LA 4FB4A 1E79D 1YNOA 2VDKB 2X1HA 2OYCA 1MPTA 2IHVA 5DM4A 2QBYA 5H4GA 2BFBB 1RRKA 3I2YX 4HZGA 4MQMA 5DHAA 5CFZA 3FPGA 5TQ2A 2FP4B 2PUBA 4BAGA 3SQLA 1JQAA 2Q5HA 3A6EA 4FHGA 4B3RB 3M1AA 2Y67A 4LKOA 4JP1A 3BAFA 5CPFA 2OO5C 3NW9A 1GNRA 2HV8A 3UB4A 4YBZA 2FSSA 3ZQJA 3AEKA 2OV4A 3CZRA 3RIYA 4ROTA 2FR8A 2Z1DA 3W4IA 1N1DA 3LZDA 2ZRAA 4DM4A 1K6MA 4RZ3A 1W29A 1Z9BA 4OG2A 1W44A 2V7PA 1FXWA 4MPDA 1K88A 4ZT4A 3DXZA 4YS6A 4QOSA 1NU8A 2K2WA 1R0YA 3UK1A 2QTFA 2IKSA 4DXHA 2PUGA 3N8IA 4DCNA 3BA1A 2IZ0A 4C08A 4X1OA 1U0EA 1WMDA 2WJWA 4NQRA 4XX0B 4FJ1A 1B7GO 3FRHA 2FEWB 2C4MA 1N2HA 3PKJA 2XT6A 4JOCA 4MS3A 3LUBA 4RGQA 1UKZA 1A69A 1KEUA 3Q8XB 1L4UA 3R6DA 4Z0NA 3UT0A 3OQ6A 3G59A 3LPLA 1I30A 5CNKA 2VJQA 1L7XA 1PGNA 3P9XA 4PRZA 1IMJA 5CBKA 1W88A 5DYTA 3VR6D 3ZLJA 3B3QA 2ZW9A 1G6KA 1SC1A 2YS7A 3OA0A 4FOLA 2XTAA 3T4UA 3V80A 4EO9A 5ESWA 4PU0A 2H3EA 4GQBA 3TLJA 4BVEA 1GXSA 5EYPB 4CN9A 3GHYA 5CD1A 1SPBS 3MIZA 4WVLA 1NHWA 1U2QA 2FW1A 3W0LB 3RUPA 3DHEA 4F4HA 1QE3A 5H59A 2IHZA 3ZCRA 1BS9A 2V55B 3EXFA 5D1HA 1LPNA 2PGXA 4NPAA 2GBLA 2H1LA 5KDOA 2BKXA 4P0QB 1G7CA 4Z1MA 3TNLA 5JTTA 3DAYA 1P8JA 4I99A 3GD5A 7AT1A 1NNEA 5A5FA 2CUZA 4BFZA 1GVNB 4JELA 2VQSA 5CX4A 1GCAA 1H5NA 4OP1A 4F2PA 4KMMA 4NY1A 3H0EA 2C57A 2WFZA 1X77A 3PUYA 2PGNA 4UQPA 4DB2A 3MYRA 3PVCA 5FUXA 3TRJA 3HC7A 1KZYC 1EDZA 3DHYA 4RHUA 3UTDA 2HU2A 3VZDA 4C89A 2IH4A 4GZLA 4DLYA 5REQA 1GG2A 4A10A 3T61A 4AU1A 2Q0XA 4MKHA 1BROA 5JZ9A 1UXOA 3P9KA 3W8DA 3THYA 4A9AA 3ZHXA 4XUEA 5DYWA 3SMVA 1NQUA 1G2OA 3K9HA 4PBTA 4QXMA 4D46A 3FZNA 1T9CA 2QNIA 3DMHA 2WIJA 2ZOSA 1YB1A 4BOYA 4EI7A 4LDAA 1W7AA 2WJZB 4YCDA 1ECPA 3D3KA 2AOUB 2YH2A 3A10A 2CNOA 3WYAA 1LZLA 2E6KA 2R4QA 4II2A 4NG5A 3RREA 5AVOA 4WN9B 5EJ9A 2MYPA 3RHSA 2JH3A 2HV9A 3DTTA 3FTFA 3NJRA 3O6VA 3EA5A 1C41A 2GEVA 2XW6A 4ZOLF 4ZO8A 4XJVA 3OZCA 4GWGA 1Q17A 5F5NA 3A9RA 4UHEA 2VBGA 4ETNA 4PCAA 3WWCA 3WE7A 2AN4A 5C32A 4DR5B 2JIQA 2Q2OA 5LMUB 4AJOA 3WXBA 2FZVA 4M4SA 4I1SA 3NI2A 5F3WB 2NU7A 4F6CA 4F8JA 3VX4A 3ZHCA 3L6OO 1SQ5A 2JJ8A 4H3HB 2PN1A 3LX5A 2IYYA 1KZ1A 1DKUA 3LYHA 3THRA 4GE0A 4TYNA 1NJ1A 4J0HA 1CYDA 2O8DB 4JU8A 4KX5A 1ESMA 1Z0IA 1TF5A 4JLUA 4RACA 3RIEA 1FTSA 1A95A 2VP5A 5D1NA 1R1DA 3WHIA 4MX8A 2XD9A 3ODGA 3NANA 2AD5A 3ITEA 3UZUA 1UBRS 1X7ZA 3Q9SA 1M1UA 1P4HA 2GBCA 4ABTA 3T52A 1Y7HA 1IWBB 2R66A 4IHJB 5BWMA 2JBAA 3JWEA 2HK7A 2NO0A 3GLIE 1Y9EA 4R81A 1ZC4A 3ETDA 3T4PA 3VR5H 3PEVA 4TMFA 1NOJA 4JQSA 4QREA 1D6NA 4N3NA 4X7PA 4AQ7A 2PJRA 5B1IA 4G5HA 4JC0A 4RFSA 1DJQA 1KYXA 2NXEA 4ZI3A 1JJAA 8OHMA 1G9TA 4HGQA 4MVJM 4J9UE 4OHWA 3NHYA 3TD2A 1L3IA 3IV7A 4RQAA 3P0FA 4TXMA 3U9LA 3MTDA 3RSGA 3UC5A 3QELB 1KKUA 3UHPA 4AS3A 1RS0A 3F6BX 3HXMA 1F8XA 1RXEA 4HDKB 1AQIA 4H7HA 1QO9A 2BEVB 3AY7A 1DIAA 2X76A 3SHTA 3JYOA 4KL8S 1GQSA 1D6MA 1I6KA 4M1ZA 3VDMA 4YK7A 2ETVA 5IDVA 4DLUA 1YIOA 2XYPA 2WAYA 1D7OA 1W5AA 2W0SA 1KQOA 2GXSA 3IKTA 4PZ0A 1Z5OA 3FE2A 2I3DA 4I4TA 3BVPA 4AFNA 1O0SA 2FV8A 1XD2A 1XL1A 4Z0PA 1L4EA 2EZ8A 3A4YA 3NVAA 4PLWA 1YTLA 2AG1A 5IK2A 4AJPA 1HT0A 3E3LA 3G8DA 4EB6B 1O6CA 4Q4AA 4BX9A 1Z5UA 3RIGA 4Y7CA 5C80A 3BICA 3DL4A 3EQ6A 4KPUA 1E3DA 5E38A 1ZD3A 3DOHA 3WB9A 3VC2A 4ARUA 3TRKA 2P9CA 3BD7A 3IA2A 4D9EA 1K5GA 4IJQA 3K3PA 4LW8A 2BT4A 2G9VA 3JRWA 4HWSA 4TLDA 1B2RA 4X6YA 4DPKA 2CY0A 3WLIA 2I6QA 1H2WA 2P9YA 1ZHOA 4P4TA 1ZJ4A 4KR0A 1UL1X 3FJYA 2HA4A 2FRDA 2WV7A 4IV5A 5TS2A 5HX7A 3RLFA 3ZV6A 1JDNA 3PCXA 2I2CA 3PC3A 4HCJA 4LYJA 5HJ7A 1XHFA 2VDLB 2WYHA 1EG7A 4OHUA 1UKBA 4BN5A 4FC6A 4OHCA 1YB7A 5CG2A 2OHGA 2O8BA 2PSDA 4C7XA 3MAJA 4KDRA 4DMKA 3RUEA 1A1VA 3JQGA 5A2GA 5A0TA 3L0IB 3P2MA 1HE1C 1C7QA 3KLNA 4B4DA 1PL6A 3K5HA 1HE3A 2QUJA 4GWKA 1HI9A 2YJGA 4WBSA 1WZ2A 4R1OA 4EO4A 4EHIA 4KR2A 1YJBA 2DQSA 4CRWB 1I36A 2H2HA 3THWA 3FHTA 2XE6A 2UZ0A 3AFIA 4MWEA 1JRLA 4TZ6A 5JJIA 4K2HA 3JATA 3I01M 4JT2A 5JV5A 1ADYA 3X43A 1LBTA 1XZBA 2C94A 2CNLA 3RFTA 4MIEA 2V7WA 4R7GA 1SZPA 2IUSA 5CK4A 2BKAA 2DKOA 3HJCA 3N6VA 4FPXA 4WBXC 3A2LA 2F3QA 4Q02A 2I7DA 2O2GA 4S35A 1V8BA 2QRKA 3OZUA 4LVCA 1NM5C 1XEAA 3GRYA 3L4SO 4ZVTA 3BGDA 1WPXA 5EINA 2GCEA 4DIOA 2QI9C 2LDBA 3ILVA 2VUSA 5K3SA 3S55A 5J2UA 1A2BA 4LY0A 2AW5A 2QL5A 4I50A 1F4LA 2HIMA 2AGVA 3DWFA 4MV7A 4D9IA 3S2SA 4Z53A 4DUGD 2K7FA 1ADBA 3WK5A 2BZGA 3LXMA 4GYKA 1ZCFA 4LQLA 1K6XA 4RVSA 2FFBA 3D8HA 2FR1A 3COZA 2PGLA 4B4KA 5K4GA 2HRRA 4RE6A 4B48A 4LC0A 3F9IA 3GGDA 4UC0A 4QFMA 3E9ZA 2HQ1A 4EA8A 5IJ9B 4N6OA 1EZ1A 1E0AA 2A9OA 5E1OA 1C8VB 4X5OA 3MGCA 3C43A 4XFJA 2CZCA 3K71B 3SYNA 3ZUGA 3AERB 3OO1A 4KXLA 3FOFC 1SCQA 4YB8A 5F52A 1JQBA 2FP4A 3H5LA 4C3OB 3PCTA 3HVUA 2AFHB 2OFXA 3I37X 3GB9A 4RK4A 2AN5A 3R9WA 3CVOA 2DBYA 3AILA 3ZZTA 4BKQA 1IOWA 5CXSA 4KPEC 2CVFA 4JLDA 1G7RA 5H02A 3BXOA 2C8LA 2H1HA 1IWOA 2HWUA 3BDAA 3HCFA 4TV8A 3V8RA 3RHFA 3WS7A 7ADHA 2E18A 5EZQA 1U7PA 3FGOA 2PMKA 4UM7A 1ZONA 1FUUA 1L8LA 4ZEOA 4REOA 1E9SA 1QYCA 1GZDA 3BCHA 4MVJE 3QE9Y 1PVOA 1T10A 2HJRA 3BQMB 4ZAZA 2HU8A 3RAGA 5HOQA 1OILA 4G1FA 3TCXB 3UH0A 1YJAA 4BEVA 2YIVX 4DB4A 4CM8B 2QQEA 3KOYA 1VBKA 4PG5A 4J2OA 1VI5A 1CNFA 2O1WA 4CMJA 3DQQA 3PGLA 4HAOA 2ZJ4A 4K9KA 5A5DA 2AHRA 3TR6A 3C48A 2DPGA 5HJ2A 1K9VF 1Q14A 4E2FA 3LXXA 1I13A 4MP3A 4DADA 1W0KA 2Y3IA 4OFWA 4WNAA 5AIBA 2UKDA 3BJRA 4O4IB 4FW8A 2VP6A 3I61A 2ZIXB 3K1ZA 4QAQA 2IV2X 1L5OA 1OXBB 2E3JA 2FUG1 4HH3C 4EY5A 1IEQA 2IEBA 1U2TA 2X4LA 3ONNA 2MHCA 4JJZA 13PKA 5IF3A 3L5OA 5JS2A 1C1XB 3ED5A 4R51A 3M4ZA 1DWQA 1FS5A 4UXJA 1TYDE 2OBLA 4JI2B 4Q3LA 3IUSA 3A2NA 3I9KA 3L6EA 2ODWA 3G8AA 4FFSA 5CP8A 5F64A 3DMTA 3I04M 1S7CA 3UNXA 4C6TB 5I5EA 3W5DA 4KFTA 3H2ZA 5FTWA 1QHXA 1O6BA 3D7SA 3M3DA 4RO0A 2VRCA 3LBFA 5BN4A 4FXPA 1DX4A 3FYTA 1FP7A 1E58A 1TLFA 4MR7A 1CIPA 4O4LF 3LQRA 1O5IA 2ZUBA 2XWPA 1Z37A 3GU3A 1LDMA 4QUHA 3WGQA 4DCVA 1TCCA 3N7UA 2WC1A 3OJOA 2QNBA 4BX2A 3U61B 1FFWA 3KQNA 1P4GA 1ZXBA 3E2IA 4PANA 4X93A 3BTVA 4NJMB 5K51A 4PX9A 4ZU1X 2B4AA 3A25A 2VSXA 3CW2A 3ZCXA 1JZTA 4YP9A 4PR0A 1XCPA 1NULA 2C5EA 4GGPA 1E6WA 1PCXA 1EFUA 1KKMA 1KOGA 1H2XA 3D3WA 3IHTA 2QP9X 2BKEA 2ZRGA 4F2DA 2WYUA 1C0EA 1CB7A 5EYPA 2P3QA 2JZNA 4Y3UA 1HC7A 3GFGA 3KWMA 3NNNA 4AICA 3I0ZA 1WMEA 4B7CA 1E2GA 1A8HA 5LIRA 2PKCA 3A1WA 4KVZA 4ZDKA 4ZZ0A 2WU4A 1KVRA 4LDZA 1Z15A 5GJCA 1T8WA 1L9XA 5JHGB 4LZAA 1SQFA 3Q2KA 3QFTA 4MWZA 5DI9A 2D5LA 3HZZA 5FUQA 5KYYA 4DUYB 2E4VA 1SCBA 1EXMA 4JS0A 1KJJA 2FVXA 1JXAA 5BQPA 3SZGA 2AYXA 2IS4A 1NZJA 1LX6A 1PJLA 4DCPA 5A0FA 5T4HA 4WY8A 3D9QX 3RSOA 3V46A 1N0VC 4PSAA 3HEBA 2NU7B 2NAPA 2J41A 1IK4A 2FMXA 4MV3A 1SIUA 2PX4A 3HFGA 1K0FA 3L4KA 2LCIA 4R8RA 1A9YA 4DFDA 2CFTA 3ZHRA 2G7ZA 4A73A 1LJLA 1EGVB 1JDTA 4Q3EA 4D9BA 4QPNA 1EFVA 2FK7A 3SIRA 3KAJA 5CVDA 2ECQA 4GE3A 2O1EA 3WK4A 2WHYA 4EEZA 5BURA 3MWEB 5KQMA 1EEXB 1RPNA 3X1XA 2PZAA 2Y1GA 4KPUB 1O95D 1SR8A 4NZ9A 1VJCA 1PTKA 2R85A 4R3UC 2DEUA 2Q41A 2QMHA 3MWLA 2P4SA 2RKBA 3ZXIA 4C87A 1M2VB 4O1MA 2VPIA 4CEJA 1RYBA 3AR5A 3HVHA 2D13A 3CUUA 2AXPA 4WMLA 4HUTA 2FX2A 1P7PA 3SJBA 4K9NA 3EOBI 1VLHA 3UCFA 1Z25A 4HVCA 5CFNA 5HTOA 1VKJA 2DF8A 2R1VA 3ITDA 1ZNQO 2HPHA 2HJVA 3O47A 4DA8A 4JROA 2Q3CA 3HP1A 4KIFA 2F1KA 3QP9A 2CLMB 3RC2A 2HWYA 1U3UA 2C03A 1WCXA 4S12A 2FPIA 3QUQA 3ZVNA 4E32A 1IH8A 3UK6A 3PFWO 2CJXA 4JY7A 3MT7A 1UR5A 3ETLA 3NC0C 4GPD1 4JLNA 4MEJA 2WJHA 3D7KA 5I9NA 2CCJA 4HRYA 4NBRA 3SCZA 3U2QA 3LCRA 2R97A 1KO4A 1I5RA 3Q41A 4QNMA 5LFAA 4AJ4A 4PSVA 3T7JA 4POOA 2GCGA 2QRZA 1WHSB 4X20B 1AK9A 1E1DA 1ZK4A 3Q85A 2UU9B 3RQIA 2HYDA 4FJ2A 2ZJ7A 2M9MA 2BE9A 3TQQA 1CHNA 4C6SA 4IHJA 1Y81A 3LK7A 1FZQA 2JAPA 1G2IA 3M3HA 5EE0A 4RS3A 3HJUA 4XX1A 2HMAA 4HQRA 4Q4AB 5BT9A 1E1LA 4LIPD 1J07A 2RK4A 1Z68A 1YQUA 1Z5WA 4PFJA 3F3MA 2P4EA 4G1EB 1V8PA 4ZT6A 4OKIA 1MDFA 4LF9B 2YC2C 2WPNA 4TV9F 1E0DA 4K9LA 4YVFA 4IHQA 1W2HA 3LPMA 4QQ8A 5EIOA 4ZTUB 2JGNA 1FDUA 3NEPX 4RZXA 2ES4A 4LY6A 1YB4A 3PHJA 4HUQA 4V2UA 1KYWA 2OL4A 3UATA 4FVTA 1I3OA 1N2SA 2D0PB 4FE4A 4ZYYA 3QWIA 2BONA 3VSAA 4Q3KA 2HO5A 4E0BA 4E7OA 4EFMA 5M2QA 3ZXSA 4Y6RA 2W8ZA 2UYYA 3SJUA 3M6FA 3MCTA 3AKEA 3L7NA 5B7QA 4IF4A 3Q8KA 3H84A 5CVTA 1G59A 1T29A 3AHEA 4O2AF 4BWGA 1ACMA 1J39A 1ULUA 1OTXA 4QFBA 1Q0TA 1C0KA 1NJFA 3H17A 3EDCA 3O8BA 3G02A 4Y2YA 3TZ6A 4LOKA 4BRWA 1LI4A 1NFFA 4CF4A 3G5AA 1U1DA 3ISVA 3Q1KA 4FBLA 3QYFA 1TQ4A 3C39A 3VSCA 2XRFA 2EOAA 2EKPA 1LNZA 1EP9A 3ZWPA 4DABA 1IN7A 1KYZA 3M1IA 3BBPA 2FMKA 1XAGA 2RC6A 3GT0A 2BGGA 1EESA 3GCXA 1KOLA 1MBZA 1ODIA 2G5GX 2O48X 5T67A 1PDVA 2KM1A 5IK2D 1G41A 2R6AA 1YIAA 1E5LA 3SVLA 2MIIA 1J2RA 2QV7A 5HMLA 4YGYA 1B3BA 2RGBA 3OM0A 5F5XA 3VDRA 2ATXA 2ZRCA 3MRSA 4AKIA 3T95A 1FYXA 5F1KA 4DLLA 3FPEA 4PG8A 3BXFA 2GHRA 3ZZ0A 3P9PA 3IX7A 4HB4A 1IB0A 3OTHA 2IYNA 1XCBA 3AKYA 1JMYA 4EPTA 1BQEA 4TLLB 2EGHA 4CG3A 1Q83A 2OORA 1FFYA 2FZGA 4F84A 4HGOA 7GPBA 1JPNA 2F62A 1VCNA 1XZHA 1C4WA 5K3EA 1X87A 3FMGA 1HEYA 1SVWA 4PHFA 2VYFA 2JLRA 2W42A 4IDGA 5B12A 2IHNA 2ZIXA 1GRRA 3LJKA 4JOSA 1SELA 5AKXA 1T1JA 3E0QA 5KOIA 3TJRA 2BV3A 1Z4PX 1H2RS 3K9GA 3NHSA 3PIDA 4U6QA 1G2QA 4Y9RA 2QF7A 1K08A 3K70B 1HTBA 4EY3A 3VH3A 5JD5A 1OH7A 1OW3B 3OFKA 3NX4A 4ZHQA 1WABA 2HA0A 1P0PA 4N5MA 4C88A 1W6RA 2BH9A 2WG0A 3VYTB 5BXYA 5CLGA 1TB4A 3PXDA 2DHQA 4Y6PA 4TYPA 2Z4SA 3IAS6 1M2OB 2FLWA 3ASVA 5DFAA 4ZI5A 4YQFA 2OTCA 2DGDA 1XHEA 3DZKA 4KKVA 1U5BA 3WRWA 5ECWA 2A5DA 3Q87B 1ZEMA 2YWGA 4N65A 2CJYA 3B3AA 5AJUA 3WG9A 4B43A 2FK8A 2JFGA 2XYHA 4BMSA 1E2KA 4Q7KA 4F1WA 5K45A 1NUTA 3WLAA 2ZQ5A 2Q6IA 4L8YA 3CEPB 3NOQA 4NI5A 1NLFA 4D4IA 2KJQA 2P90A 3AV0B 1L5RA 3KD3A 3LUKA 3WB0A 3QEKA 2XMZA 1TIKA 1TJ4A 4P32A 3TVDA 4PX3A 1U2DA 3MD0A 2HWKA 3EW7A 1GPKA 1Y4DE 2H8KA 1D0VA 4MJ7A 5A1JA 3KELA 4FFMA 1MB4A 1FQJA 1Q21A 2GAFA 3NH6A 4HRAA 2C99A 2XCOA 4P4NA 4E7PA 2QGNA 2ZXEA 1L7BA 4G8CA 1ZEJA 2R6GA 2WAMA 3E9DA 2AVNA 2C5LA 4MP6A 3UMJA 2FSPA 2XF8A 3KXIA 4F2HA 1NLMA 1YQTA 3ZK7A 3EWIA 4MVJA 5EUBA 1ETHA 3DVAB 2QTWB 2FZ4A 2BDTA 1QIGA 1GR1A 3ETCA 2CCGA 3G2OA 1DWPA 4NIMA 1WPRA 2B0JA 1KRWA 1Y37A 3CV3A 3D3EA 1T5BA 3HBAA 3MD9A 4Y1EA 1R2QA 4ZEXA 4EKYA 2J7PA 4UNRA 4ACAA 4R54A 2WICA 1WSDA 5KYWB 3PWTA 4FEYA 2X40A 5IDXA 5IZCA 4TV8B 1HQKA 2O19A 4L3WA 2WD8A 3HU2A 4BE9A 3QZUA 3KU1A 4OHOA 1EP3B 1O5OA 3KBBA 4ZQIA 4A2PA 3UGJA 4KXUA 1C7EA 2FJPA 3IV9A 3KDPA 3ZK9A 4CKWB 4D8TA 5BVHB 1GPUA 2PV7A 4OLHA 4B7UA 4PSCA 1UJMA 3GY0A 1KHHA 4ENRA 3A1CA 1GPJA 4HGPA 3AHDA 5SY9A 4C3ZA 5JXHA 3JQQA 2GEUA 5GVRA 3BFJA 3SP1A 1PEDA 4BGIA 1D3AA 4PZZA 5TC4A 2Z30A 4ZO6A 1NSYA 2LE0A 2XYRA 2J09A 3K6SB 3HYSA 2CK3A 3CZCA 3WMXA 3QH4A 2BMWA 5GOZA 1KY3A 1H5UA 1D5CA 1QGDA 1WLSA 4HMOA 2HX1A 3O3CA 2PIDA 5ILGA 1R8QA 5JCJA 4KW7A 3U4AA 4EB0A 1XRSB 2RKOA 5JRDS 5FEMA 1B8OA 3KT0A 5BY2A 3ZWVA 3WL6A 2OGWA 3VRHA 4MINA 2XMSA 4N7RA 4IQ8A 2PRIA 4EGFA 1ILWA 2PDAA 3GUUA 2QOEA 4MW4A 4RKYA 1Z0FA 4O5AA 1YA6A 4LOHA 5KTNA 4TT3A 3SF8B 2YDYA 3HJFA 3ASUA 2WQZA 3FLMA 2QMQA 1I5EA 4QNNA 1SVLA 1JR4A 1P60A 2OD7A 4ECAA 1BMFA 4IZIA 2UYCA 3H99A 5EG5A 2C2XA 4F5YA 4MS1B 4OQFA 1N8TA 3UFXB 2HMSA 3CGWA 4YJ3A 3DXYA 1JAXA 5GOTA 4G5RA 1WHSA 2E89A 5J2TA 3Q3GE 3T9AA 2PQ2A 5BN1A 1C9DB 1UAGA 3AR8A 5GZ6A 2SCUB 2F2TA 2BUCA 3D31A 3JQCA 4GYJA 3RVLA 4EKGA 5ER6A 1SN7A 2H52A 4HMPA 4FK8A 3O83A 4I36A 4U6NA 1DAIA 2PWZA 1I01A 4H9GA 4J0QA 4NJMA 4OHVA 2WNIA 1ZPDA 2C84A 1IBLB 2LNDA 4PS1A 3K6KA 4YAFA 2H7VA 4KDCA 3WLJA 1OBHA 2V8OA 1M54A 4FX5A 1KWKA 1U02A 4IFTA 1WBJB 1MZPA 2ZJYA 3NMUF 3OC0A 5FLXA 2AMVA 4QUKA 4K9RA 2C95A 1AK1A 2FEXA 2AH5A 3G2JA 2PKEA 1M8KA 3D7NA 4A0QA 4CV2A 3INGA 4WKBA 2XXAA 2UUBB 3T3MB 3AOEC 1RWWA 3W6OA 3C6QA 2BL4A 1YF3A 4YRDA 3TW4A 2IS1A 2JIRA 4D97A 5H8WA 5HM8A 1XRPA 1KFCB 4UNNA 3HRHA 5BRAA 4IBOA 2NYVA 3F8TA 1XCGB 2UDPA 4FOPA 5GADl 3ZNNA 1VXRA 3KHKA 4OP2A 2AOTA 1TU0A 1L7NA 5FXMA 1K97A 1LLFA 3OY2A 1M7GA 1NLZA 4XVHA 4EEXA 1PJ3A 3DLIA 3ESDA 4BNXA 4US2R 1L1QA 1WDMA 4TSRA 4UAVA 1CE8A 1UEXC 2QTRA 1RD4A 2OQRA 4I1OA 1G8YA 2X0JA 1EVIA 1YACA 2AJDA 2I62A 3LZCA 2HMWA 3QE0A 4L4UA 3GGSA 4PHCA 5HKLA 3I6YA 1ECCA 3LD9A 3B9BA 3HHPA 2G5PA 3B6IA 3KZOA 1M2JA 4JI1B 2M1ZA 3O2QB 3GA7A 4CIWA 5CLLA 3L0BA 2Z43A 1TZBA 4WK4B 4AUKA 1VSTA 3CH6A 3R5TA 3IOBA 2FDXA 2JZOA 4A0SA 3B9RA 2AMYA 3K4QA 1ICIA 4BNHA 3OOWA 5AM3A 4EX7A 1C9NA 2ODQA 1R15A 2O2CA 3ENQA 1ESNA 3T1TA 2IJGX 2JFVA 2WZCA 3TS1A 5IG2A 3NHBA 4UNSA 4A8TA 4G1BA 2HIGA 3GAFA 3GPBA 2Q4OA 4IJKA 3RAFC 3GFBA 3BXXA 4HK4A 1T3LA 3P7MA 2E4AA 3V4PB 3WDLA 2XCRB 4TL9A 1J0EA 2CL5A 3HKCB 2IEAA 3SX4A 1F9AA 3GLSA 2NUTB 3IDSA 5HGXA 1MP0A 1WXIA 4G0OA 5IBRA 2PPLA 2ZE8A 2LCQA 2C92A 3K73O 3V2IA 4QU5A 3BWMA 2W70A 3UWPA 4DYHA 4JJFA 4IAOA 2OAQ1 3UOWA 1R3DA 3D6JA 3LWZA 1DO0A 5GZ3A 3GZTB 2BSQA 5BWBA 2I7TA 1QU3A 4XD7D 4EP1A 4WKNA 3SS7X 1G16A 1UBJS 1VRCA 5HF5A 5LMCA 3M1YA 2X0NA 4J0KA 4REQB 1JHZA 4KFRA 4J6FA 4A8PA 1RFLA 4DNQA 1C9EA 3UJ9A 3DYIA 2WJ4A 3IEXA 4TKLA 1AY0A 2XB8A 3HY3A 4ZU6X 3SEFA 3ER9A 4YMVA 1U8CB 2RH9B 3B1ZA 3EXG1 2QD3A 4FUTA 4NOKA 3FBTA 2OO7A 5DXJA 5JU6A 3GVHA 3KCNA 4B40A 5CA1A 2WWFA 2FGKA 1FU4A 2IYQA 5TF4A 2NUPA 3AKZA 4MRMB 3M0EA 1DCMA 1E92A 3DHNA 1SHTX 2ONJA 3ZC3A 4BU1A 4ZVLA 4NAHA 3ZHSA 1J4AA 3LT4A 4EA6A 3K0CA 4PYQA 3G2IA 3TPFA 1YRLA 2WMYA 1OE0A 2H1SA 3VH2A 4E13A 5IX8A 3BMQA 4RABA 5AI0A 3VPDA 1FTQA 1S02A 2MSKA 4BGEA 4CTNA 1XOIA 1N2CB 2ZJ3A 1RBQA 4I08A 1XL0A 4R6WA 2WILA 3AF4A 3TTUA 3IUBA 4ND8A 1OVMA 5CJJA 4UU0A 3I5XA 4K9MA 1MB2A 2HAEA 3PHLA 4CM3A 2GA9A 1AOXA 2WNSA 3RODA 2X23A 1KVUA 4LMPA 5HKBA 3H9GA 1R0CA 1CUJA 1NASA 3DCNA 5JZSA 1DIHA 3C7CB 3LSYA 1W36B 4OQYA 3U3JA 3QIAA 2HPVA 4YJFB 5HE9A 1T5LA 1PFWA 5LP6C 4ZV7A 5DIZA 5A3VA 3RUIA 1JTEA 2H1OA 2OA0A 1U3FA 4K26A 3Q2IA 1L5GB 1JH8A 1NPDA 1QV9A 4TGLA 4GDFA 1NLUA 2X7JA 3CEAA 5AXBA 5E6SA 2DECA 4GLOA 5CMLA 4ZOQI 5E0KB 3A6KA 4PAWA 5FNVA 2X8BA 3MCUA 2I3GA 3KYDA 3KZ1E 2FEOA 2J9FB 1R50A 5AIAA 5G0TA 5B6IA 4G01B 3DJFA 3W79A 5DH9A 3DE5X 3UWSA 1Y1SA 1RPAA 4EGQA 3UW3A 2VXOA 4CCYA 4AULA 4RJKA 4EX6A 3G7SA 2F3RA 1R7RA 2Y93A 2ONCA 4CZ2A 4D5GA 1SAYA 5ANRB 4M7OA 3DDOA 3UBTA 3HFJA 4QYIA 4K28A 1IRIA 1LTHR 2GWHA 4O8CA 3W5HA 4O2BA 4R2JA 1XYYA 5J5CA 3T1OA 5CT5A 3FDIA 1HYEA 4X24A 3RS4A 4AMVA 1DTWB 5KYTA 3U4QA 1HT1E 1E7QA 3IESA 4GLBA 3GV0A 4WK6A 5FI3A 1DOAA 4J2HA 3IKJA 3NATA 3TSCA 4O5OA 2YMPA 3WGUA 4L5YA 5DHRA 1ZK1A 2VOEA 3OPXA 4YMWA 1YWGO 4ND5A 3PI7A 4BMOB 1Q1EA 3BK1A 4X71A 1Z88A 2R8BA 3JWJA 4ES6A 1A8QA 1MF7A 4LV5B 3H11A 1UFQA 2C5HA 2I66A 3CE6A 1S4QA 4E2WA 5B7GA 2FPUA 4NFYA 5CLJA 1HFJA 4WBNA 4BYGA 4RLQA 2GB4A 3GRAA 3JD1A 4CKWA 2QIPA 3B12A 3LUCA 4GMDA 1G5HA 4RIHA 2NIPA 1P5FA 3IMEA 4TTSA 3TXAA 1XMVA 3C3BA 4FEAA 1OFIA 3DDSA 2GAJA 1AHNA 3T9DA 1EFPB 3K9QO 4CF3A 3UHFA 4NJOA 2AOUA 3PJRA 3SDZA 3RVOA 5DTJA 4BS9A 3VDNB 4CM5A 1CDDA 1W581 4G8BA 3SC4A 5BRNA 3R7WA 1RRVA 2OSBA 2QR2A 3G1TA 4JN6B 2FRDC 4P4UA 2XXAB 1Y7IA 4IWXA 4JEUA 1SCIA 3X1JA 2ZWIA 4C0LA 1VXOA 2XADA 3N0WA 4JXKA 4F21A 1JHPA 2ZSKA 4RENA 3K9WA 3CF4A 4MICA 5KVAA 4M1QA 1FJGB 3VPGA 1WVGA 4X6UA 4AY6A 2IYFA 3A1TA 3C7DB 2GFQA 1ZINA 4C7KA 1VCHA 1Z6PA 5L6LB 4EK9A 2QUHA 2QDKA 4TVBA 1DVRA 2QZ9A 1UXIA 3F6CA 1ENOA 3PHIA 3ID6C 3KJGA 3K0HA 3H5IA 1N78A 4V3BA 5EI5A 4DOMA 4EY6A 1GZ7A 1U7HA 2QB5A 2AFIE 4LNHA 3PE3A 4I9FA 5K3CA 1YQWA 3IDZA 3RG2A 3VJLA 3HKEB 4KWIA 1BE1A 3ZHQA 1Z47A 3P9CA 3RNLA 3V7FA 1RC8A 4RDIA 1N36B 1FJ2A 3ZU3A 3DEJA 3LQKA 4BP8A 1MO4A 3K7EA 5AR1A 4GIBA 2CLCX 1T2UA 3CLSD 3QHQA 9GPBA 3FSGD 1B6RA 1PR2A 3P71T 3ZE0B 4G0UA 2J08A 4R31A 3I3OA 4AYXA 5ALIA 4RPGA 4AJ9A 1DEHA 1VJTA 2CFRA 4CMHA 1EB9A 3NUZA 4GOXA 4LSGA 1RRGA 1KK0A 2CJFA 4D41A 3NHWA 1S01A 4UUNA 2W7TA 2AQIA 4K3UA 3S1AA 1JEDA 5E1MA 3DEAA 4RPCA 1KJYA 2P9EA 3FFTA 2I3BA 1RWMA 5FWYB 5A9SA 4EENA 5CNJA 3RK1A 4GM0A 3F6SA 1NBWB 2L19A 1DJPA 4J0FA 4CKEA 1OAOA 2D54A 3D8TA 4M38A 1NQOA 1FLDA 4HB2A 3GC6A 4BLUA 3UAXA 4A16A 2CLSA 3CW9A 3MOGA 3A6LA 3OZDA 4GUAA 4WA8A 3OZWA 4EHJA 3W34A 4FR5A 2O7NA 1JYFA 3AIKA 5K0GA 3UXYA 3CLRC 4RPIA 3RFUA 2JJ1D 4B4VA 2BJVA 3N74A 5B7NA 5FO0A 2EL9A 3ABOB 4KI7A 1JR3E 3II6X 4RJLA 3MTQA 4B0PA 1NTOA 1PZFA 3UY4A 1ODCA 3LAWA 1XWFA 3I0MA 2YJ4A 4IM7A 1EWTA 1CUSA 2JGMA 3NRCA 2JFQA 4DIDA 4DWVA 2GNOA 2XEDA 3DE6X 4BFSA 2WHXA 2LW7A 4I5EA 4L57A 1F6DA 2XB2A 2FZ5A 1Z5PA 3PHHA 2IOFA 1C7RA 1ZY2A 3C15C 3Q3HA 4IH9A 1KAHA 2ON6A 3HCCA 1ZSNA 4FFRA 2C3OA 4LE1A 3VPFA 1GU7A 3G89A 3VR6H 5IT5A 5JASA 3SBDA 3IYLW 3MVEA 4X63A 4O63O 2FHPA 3GLRA 2JATA 3HM2A 1RKQA 1DQRA 3KUXA 3EAFA 5KVVA 4CIDA 1DIGA 1REQA 2W8BA 1OPRA 4QA9A 1SKYB 4L15A 4HFJA 4F5DA 4Q82A 2PBLA 1MQ8B 3L7LA 4MRMA 5FPPA 4G0ZA 3REFA 1NVAA 2A5FA 4UW9A 2W6OA 4MULA 2ODNA 4S0ZA 2CV2A 4FYWA 1ZLYA 2XTMA 1QB7A 3L6UA 3TR0A 4ARZA 4C0BA 3EQ9A 4NE2A 2R84A 2PSFA 3ZDXB 5G02A 1CR4A 1D7AA 5J1TB 1S2IA 3QU5A 1I2AA 1JR3D 1PW7A 4HNAB 4JJIA 5LCXA 3HA3A 2W2KB 2AZ4A 5FWDA 3TX2A 4DN6A 2I8AA 4BBZA 4DF3A 2YNMA 4LXHA 2BWJA 2CXQA 5G40A 5LBUA 2JIMA 3NNDA 5TQJA 2HJGA 1JDUA 2C3UA 3ZWOA 5DHUA 4E5UA 1E2BA 3EEIA 3ITKA 2A9RA 4JJGA 1WXDA 4DTCA 1A9QA 1NT2A 4CIAA 1KC3A 1NQTA 3B6ZA 4FNAA 4NMXB 1V8DA 2ZS7A 5E6UA 5ICCA 5L53A 5KKAA 4MWCA 1PSWA 1T9GR 1N6RA 1W76A 3UJBA 5DNCA 4E4YA 3D6HA 1RSZA 3CNHA 4M1YA 2WSMA 1UJ5A 1YASA 4J16C 1M5TA 3O75A 1UQUA 5THXA 1PWZA 4M54A 3MQFA 5LYJB 3P0EA 5JYCA 4I4TB 2VHZA 2XUQA 1ULAA 3MWYW 3V4ZA 3E4DA 4LUCA 3IJPA 2ZSJA 4N9QA 4ZVRA 3FZGA 3WLFA 1ZD9A 3ZLUA 4H1WA 1X7DA 4U5QA 2FPSA 4J75A 1QCDA 4UCWA 1T4MA 1HZZC 2V74B 3OURA 4LWPA 4QOGA 3ESCA 1FSZA 5DRTA 1HEUA 4I4LA 4KO1S 1VIAA 5FUMA 1KEPA 2BHRA 3LYAA 1ATZA 1VE5A 3ED1A 3FPKA 4OM7A 1MO3A 4RZUA 4OREX 3VH4A 5IABA 3GI1A 3QPCA 1KOJA 3R4CA 4Q9NA 1XC7A 2P5YA 2Q50A 3ZS8A 4B6JA 2DR2A 2F8TA 5HBGA 1FLAA 2Q07A 3EVEA 4TLMB 2JLXA 2F8SA 4NWIA 1DIOB 2WW8A 4PIVA 3OWXA 2AK2A 2I55A 2QN8A 4REMA 1MRSA 1MGPA 1ZH4A 3D3JA 1HMYA 3DL7A 3ZOZA 1IIRA 2CDBA 4ENWA 5EC8A 1XROA 4FSDA 2GM4A 1XQYA 4W7HA 3DE2X 2WSSA 3MUNA 1BKYA 5CW2A 4M0CA 1R6XA 4MUEA 4CLHA 5C8ZA 4CLRA 3CSUA 3U4QB 3JQ9A 3E5MA 3VTFA 1DAPA 4X8HA 4A2WA 4YHHB 1OD6A 4NKRA 4XDHA 2VNHA 4YX9A 5KU7A 1IHDA 3KNZA 5A06A 2Z4TA 1B43A 1QH8B 2ZUFA 5M29A 1RM5A 3PYMA 1USGA 4IUYA 1QO0A 3PZRA 1RDFA 2HL6A 3K05A 4PM4A 1K8XB 2JLVA 1A2QA 2CNBA 2QRMA 4D9KA 2ECKA 2BZ0A 4QLAA 4YC7A 3O91A 1ADCA 5ESXA 1VSQA 3IPCA 1YCGA 3AHIA 4OA8A 5FNVB 3DO8A 3BCSA 3MMXA 3DE0X 3A4NA 5I7SA 2W2TA 1QOZA 1ZIYA 3G2LA 4UFNA 4D9MA 2UXDB 3CJRA 3PB3A 5KTRA 4R3WA 2O4UX 4G5QA 5JRJA 1IULA 1XU7A 3AB7A 5EIBD 4DCOA 5KZMB 5F77A 1ZOLA 10MHA 3BORA 3JVEA 4CBVA 1OAAA 2P6MA 3TVTA 4RGBA 2WWRA 2CYCA 3KFVA 2I9KA 3GW8A 3OE5A 3VMFA 4KH1A 1KMCA 5ALXA 2VT7A 1TGVA 2G4LA 1EMDA 2GAOA 1WDWB 1K0UA 3FVTA 3QE4A 5BW5A 1Z83A 2DR3A 1OCEA 2RKWA 5ALGA 3QA9A 4YP7A 5TPWA 4PICA 1F14A 1UT6A 4AI6A 4H17A 4TMXA 2ZSDA 1XLVA 2C9MA 2PZMA 1FFAA 1M2HA 1X1DA 3SJAA 1F6WA 3CM0A 1N9KA 2G76A 1Q7EA 2NVBA 1EIZA 5A4DA 2A78A 3PD0A 2MR6A 3C3CA 5FADA 4QUJA 1X7WB 2P1DA 3GDOA 3CQ9A 4IGKA 4MWGA 4MYCA 3ZCSA 1V39A 3JAWA 2H00A 3QNWA 1L1RA 1S5PA 2AD1A 1O97D 2WHEA 1PGOA 1DX9A 1SZCA 1GSOA 2LBPA 2WMNB 1JIKA 2ZIUB 2ZWVA 4GP6A 3W9BA 3JW8A 1L4LA 5DNWA 2CDCA 1KPGA 4ZYTA 1KJQA 3ETGA 3LU1A 3BUSA 1A27A 1BX3A 1NNI1 3IEKA 1D04A 1DAMA 2R1TB 1V11B 3KLMX 3PEFA 1SB9A 2LDXA 4P7BA 4XOUA 2UYGA 1T0PA 4IILA 3JQAA 1D9XA 3D1LA 1EXNA 4KZKA 4NF2A 5J4HA 1PD1A 2YWJA 3EQ2A 3GT3A 4YY3B 2HGZA 5JISA 2MSDB 3PUXA 1J42A 2WB4A 4A8JC 1ZIOA 3VTKA 4F4UA 1EFKA 2H16A 3F78A 5CIQA 1SUEA 3FPJA 1XO1A 3R5JA 1DC4A 4R1UA 1NW9B 4W4TA 2WB2A 1W5TA 2O8DA 2WKWA 1WSBA 3CH5A 2AG5A 3O8QA 3V6LA 4NAVA 2ZXUA 1OREA 3CIOA 3OFNA 4Y6GB 1A5ZA 1C8BA 2QMYA 5AVXA 4N8EA 3W04A 1BC5A 3HJGA 3PC8A 4EFDA 3IMCA 2WU1A 2X8JA 4DSUA 2GN0A 3E3NA 4BB5A 3SZMA 5T7BA 1Z6GA 1P5HA 1V3QE 4QEDA 4YRKA 2VPXA 3NHLA 3S99A 1H2YA 3AUAA 3FYDA 3FFAA 3M6MD 4UZFA 1F38A 4L78A 2AJLI 5BQ5A 3SHWA 3ZBUA 1KE2A 1PQ4A 3HB1A 3GL9A 4DA0A 3ELDA 6GPBA 6AT1A 1O9GA 2GZHA 1UDXA 3WLPA 1YU9A 2NTVA 1KEVA 2Q6LA 3EXIA 2F8LA 1KQ3A 1ULSA 2HKIA 1NYRA 2Q5IA 2WKPA 2WA2A 4J0JA 4LVOA 4QXOA 4C7BA 1DUIA 1JKMA 1N7JA 4F06A 5CVUA 5I51A 2ZPUA 5CA0A 5MN6A 1IM8A 2HF2A 2ORWA 5IWAB 5K7SA 4N5LA 3E8MA 3SHFA 2ZETA 2R00C 3R7WB 1XMSA 1OLSA 4RW0A 2L82A 3HK2A 1CEYA 5GM1A 2WIBA 5EKXA 1NNUA 3MCVA 4OJMX 1DIBA 5DTEA 5JDCA 4CHTA 3H5TA 4R8VA 5FR2A 2ZRPA 3A1UA 3GVCA 2F1RA 4OLBA 2UYOA 4HNAA 4GEGA 5IT4A 1UMBA 3RO7A 2Q5LA 1U9IC 2PFKA 1LKZA 3BG5A 3NRJA 2NAFA 1MG5A 4URUR 2RGXA 4ACBA 4LDQA 4F3NA 2AJ8A 3OKAA 5DGDA 3R9XA 3L1HA 4YDQA 4MW1A 2JAWA 2JIOA 4Q4JB 1NLYA 1JWLA 2VNAA 4TN1A 3E23A 1L5ZA 2C78A 1EJ0A 1P5JA 1U1EA 2VI5A 2ZJOA 3H9CA 3MTEA 4NYJQ 4OV6B 3S29A 3TBHA 3BXHA 2QG4A 2OBFA 3A3YA 1AA9A 3H6GA 4JCOA 3RUHA 1J2TA 2PH3A 3K8OE 4L16A 4Y9SA 3MA0A 2ZE6A 5BORA 1H1TA 1OUMA 1FP2A 2VS1A 3M81A 1N7HA 4O29A 4PRKA 3ZNQA 5LA6A 3G9QA 4QECA 4TWIA 5LZ2A 3VKHA 1PJZA 2GZ1A 3LLUA 5IKXA 1X42A 3KEMA 4XXHA 1Z0ZA 4LQCA 1QDEA 4XQGA 5C4IA 4YJ2A 3QMWA 4KQWA 3ZV5A 5DGIA 4KK4A 1WZCA 1HDEA 2IT1A 3UT5B 5A62A 1VYTA 1YQQA 5FV7A 2XKBA 1L4BA 4NEQA 4U7FA 5JE8A 1GAXA 2W8BB 2DPLA 3BMXA 3HCBA 1AZLA 3BRSA 2J3LA 3A4VA 1NRXA 1VI2A 3I6QA 4G41A 1ID1A 3SI7A 3JU3A 3G2QA 3P9IA 1UPFA 3PX2A 1IFXA 1QIIA 2PPVA 3RV3A 4ZK2A 2QORA 4L28A 2CHQA 2NGRA 2WYVA 1US8A 2QR5A 4J4TA 4AKHA 1NG1A 2AWOA 2H65A 2Z56A 3AF0A 4D98A 1P8AA 4V02A 3N0XA 3A9VA 3NHUA 5E2BA 3UAGA 2FRVA 3LIIA 3EHDA 3PRYA 2Z3VA 2ZU6A 1QG6A 4IUDS 4FQ5A 4BC1A 2B3DA 2JH9A 1NPTO 4WECA 4XUDA 1XEWY 1RLOA 4F45A 4PAMA 3TLKA 3V4OA 4DG8A 1XV5A 3O7MA 4P33A 3TZCA 3M82A 4ZZ3A 2EG9A 4XR4A 4E09A 3ONEA 1XZ8A 2ACEA 4AMBA 1PWXA 3ZY2A 5EJIA 3W1EA 2JGDB 4FKZA 3TE6A 1CP3A 3E9EA 4RY0A 4AO7A 1G6Q1 4NENA 5IW8A 1WNFA 1T15A 2OHHA 4Z8XA 3HJNA 3GEIA 3Q7TA 1E3MA 4M99A 3NTOA 1XEWX 2L2QA 4KE8A 4AK9A 4R98A 221PA 2VKTA 1OT5A 2R5NA 3SG0A 5C5IA 4Z86A 1WOMA 2WSBA 3R0IA 4TWAA 5FTMA 3MGKA 2PZJA 1P61B 2XYQA 4CTMA 3FWKA 5ALEA 4RA6A 1H4QA 3KSUA 1XEFA 5DCUA 3A1EA 1YQDA 5H81A 4M3NA 1P39A 4ILKA 3CSDA 2OEPA 2YL2A 2GKOA 3G49A 3RRMA 2HSGA 1N2CE 2VFAA 3OJ0A 2AKYA 1GGMA 4HQNA 4N9WA 3G85A 3OX4A 4LBYA 5BQFA 1XXHB 1M0EA 3AETB 4C0XA 3TEFA 2PAAA 4N12A 1R64A 4YT4A 3DKRA 3CH4B 3EAQA 1JFVA 1Z26A 2OCXA 2Q46A 2I91A 3CISA 5DN9A 3MSCA 3NM4A 3CLVA 3I5AA 1WXFA 2D3WA 5DNEA 4IGAA 3L49A 5F12A 2IVZA 1ZIXA 5DYIA 3M5WA 4Y2PA 4WD3A 1Q0UA 1NVVQ 3TTYA 3IQWA 4HL6A 2Y9PB 4OI0A 1YFZA 1OLUB 4B84A 1HA3A 1R9MA 2JCXA 3DPSA 3CRZA 4CMEA 1MB9A 2EBUA 4CLOA 2X5OA 3D7MA 3IXMA 5IP5A 3JD3A 3IEIA 3OT4A 3RVPA 3GZNA 3SY8A 3TLCA 4EUFA 1S4MA 1XRNA 3ANNA 5GGXA 1QVAA 4ATNA 1YGPA 3B89A 3FKJA 4LWQA 2MOKA 2BJWA 1DE0A 3GFVA 4ZHQB 2RHLA 4L9RA 4U2EA 2XUOA 3I8SA 1D1TA 1Y6QA 4BO1A 3VNBA 4UM8B 2C1EA 4KXQA 4DLAA 3E35A 3USES 4GKKB 1E6KA 2AG0A 3UAOA 5HPYB 2QVCA 2YXNA 3O8LA 3PGXA 4FYXA 4HAVA 3K2BA 1CUFA 2Q5JA 1OH6A 1M9NA 2G0TA 3GPIA 5TRTA 1J8YF 1T3TA 4CN8A 3HBFA 2P2ZA 5IEJA 3CVYA 1E4OA 1NDUA 3INTA 4F9EA 5C35A 1ECFA 2EW1A 3DZJA 3O4RA 4QL3A 1S2OA 2Z08A 1TLTA 2WUEA 3GO4A 4JD5A 5G0UA 3TXYA 1B1AA 1K89A 1H4TA 2A9PA 2G4CA 3V34A 4BRZA 5IJWA 5EE5B 2R6CA 3IPXA 4D4LA 2RJ3A 3C3XA 1YI0A 1VKNA 1DJOA 3ZGVA 3ZKWA 3PUWA 3HUDA 1M0TA 3G0CA 2EF0A 5FTNA 3WP1B 4AZ3B 1I94B 4INJA 1OWMA 3T35A 4R16A 1KZ9A 4H59A 1RAEA 3L8YA 4PO8A 3NYWA 4LN1A 3NYRA 5C5EA 2R2AA 1VDZA 2FPXA 1E4VA 1WETA 4V03A 1ISPA 3A6FA 1GTZA 1Q19A 1K3UB 2E5WA 4TL7A 4TRJA 1F4PA 2HHJA 3OQVA 5JO9A 4YCCA 1WMSA 1U0HC 2J3DA 2Q9BA 2XOEA 4QHTA 4PTYA 5EZYB 2F7SA 2YVUA 4C0JA 4MVWA 5IXSA 4WGFA 4WXPA 1KR5A 1Q16A 2QZSA 5DDIP 3TW6A 1BGVA 4QVKA 4B1FA 3FHLA 8GPBA 1TUBB 1GN9A 1Q0SA 1HQYE 5TARA 2CL7X 3LVQE 3THXB 4N7JA 3V00A 4PCUA 3DULA 1L5KA 4QOJA 3C4VA 1DG1G 1XQ9A 3HXPA 5CA0B 1VFPA 4IYJA 3TMYA 4M1WA 1K7SN 1DNPA 2PL1A 4X65B 2O59A 1DTSA 1EFCA 4DMMA 4BAZA 3B1WA 3DQZA 2X0IA 3AKCA 1E61A 4YRCA 2HYIC 1OPXA 1SG9A 1BRMA 2OZPA 4OA5A 3OLVA 1Y0BA 4YT5A 5HFNA 2COUA 2DMRA 1F1JA 5DKFA 4M0FA 4UTVA 4FR0A 5DHTA 3B9PA 2RJOA 1T9ZA 1OLOA 3FBGA 2PZGA 3GBPA 2ZJ1A 5A05A 1MC8A 2D1YA 3RRNA 2GHTA 3KKPA 5K05A 2FSVA 1E79A 1OBCA 2ZR8A 5KOYA 3VZCA 3ORHA 5IWCA 4ND7A 5DHQA 2ZEJA 1F2TA 2AV6A 4P82A 3BQNB 4GKBA 3UUFA 3OZGA 5T64A 1ZNXA 1YHNA 3BRWA 2D2EA 1YRHA 2FSVC 4MS1A 1DWOA 1VIMA 2PH7A 3EXEA 3PENA 2D2XA 3S3TA 1KBZA 2P41A 3IP8A 5A02A 1DT5A 2GGSA 3AEKB 1N2GA 2O7RA 4X0EA 5K3FA 1RQRA 4OI4A 5BR8B 3GG9A 2MSWA 4MVJF 4E33A 3DMTC 3I42A 3PL1A 3PX3A 3OLQA 3UC9A 5AVWA 3RK4A 4ZA2A 2G9UA 3TL3A 1ZJJA 2D7JA 3LT0A 1AN0A 4Q66C 1E0KA 1H0HA 1ZUHA 2IPMA 3BDIA 3I5MA 3PRHA 4Q15A 5B1SA 4O1IA 4M98A 3PFBA 4XWOA 2XECA 4G65A 4U0JA 4KFCA 4GXRA 4TT8A 5E1BA 1BCRB 1Z34A 1CYEA 3AY3A 4LXTA 2E5FA 3NVDA 3QRWA 4KIUA 1IDOA 4R8SA 4YCBA 5CBPA 1L7AA 2VA9A 3PNQA 2W2MA 1E4EB 3VR4A 4XA8A 1W88B 3LC7O 3L6RA 4MQBA 1VE1A 1QFMA 1OC4A 2WAOA 4XLLA 2FPPB 1WULS 1W52X 3HCEA 3MBIA 3ZV4A 4BUZA 4G1UC 3ZVKA 3E7XA 4UNIA 1YDEA 3MJTA 2BCGY 1UZNA 1V7CA 2GM9A 3WYFA 2AOTB 3D81A 4GOOD 2WUVA 2QQ0A 4CMAA 1YAJA 3NHFA 2NLOA 1G42A 1OBVA 3TTTA 2HUPA 1BIFA 4JUIA 4FFBB 2PQ6A 1BH2A 4ZWNA 4YRGA 5SZIA 3TGLA 2PTHA 5GAJA 5MFPA 2JCBA 2ZS9A 1IL0A 3AVQA 4OMUA 1W25A 5F2OA 3F5QA 3GIDA 2QLBA 3LY9A 3S68A 3UPDA 4BKUA 4DR1B 4LYHA 2Q7XA 5IRCD 4P0PB 1AIPA 1KAMA 2LR0A 4OHXA 5JNUA 2RDMA 4FSXA 3QX7A 3X2SA 1XDUA 4UFPA 3SBXA 1HNNA 2RGNA 4AJ1A 3OM1A 5P21A 2O3UA 3PIRA 4B4OA 2P6OA 2YTZA 1Y3BE 1I10A 1JVNA 2A94A 1PT9A 4ZOLB 1JSZA 2Q3HA 2Z2XA 3OKFA 3T3GA 5CLHA 1Z4JA 3WL4A 2HB6A 4A6DA 4DMRA 4ZGGA 1IBRA 5JAIA 3U44A 1QK3A 1ULBA 3R0JA 2JIZD 1T4GA 1E6EA 1G0NA 3ZE6A 6LDHA 1GGNA 1EEHA 3EGVA 3OD1A 3QPAA 1V43A 3BKXA 4TS9A 3WYCA 5AHXA 1L7RA 4EB8A 1G2PA 3T1VA 2CF5A 1GZUA 3H9UA 4DSOA 1DRUA 1ZM3A 3AFGA 1LX7A 3IBSA 3HEMA 4ZEWA 4GPIB 1EHYA 4E14A 1ULZA 4TTPA 1ZP6A 2JF0A 3JASA 4Z3OA 1XZFA 2AE1A 2PVCA 1LNQA 2PRSA 3U4IA 1UWLA 4GXNA 4AN0A 2NSHA 2YINC 2B94A 3F73A 4W5NA 3QEJA 2JA1A 2CBGA 2DBVO 3IVGA 4MA0A 4Q3DA 5C5CA 5JMTA 3ZHUA 1BD3A 1R4NB 4LK3A 1VDMA 1YHZA 4PYOA 2QMZA 3ZZUA 2QLFA 1DLIA 1FIUA 2EQBA 4RK5A 2VJOA 1QR6A 3KSDO 1EVJA 4OB8A 4B83A 1QAQA 3T5MA 2GVZC 3AJ8A 3Q7SA 4LDPA 5EXPA 2VJBA 4YPFA 1GUZA 4OTZA 2CL6X 4Q4HA 2QPTA 2OHIA 3V7NA 3TGWA 2HWXA 1Q74A 1JECA 4HTFB 4QU9A 1JA9A 1Z33A 5IKMA 1EX6A 3TSZA 4KMRA 5EHIA 2VSFA 2YY6A 4HAIA 4X54A 4QDOA 5AVVA 5IASA 3NVKI 3C6YA 2CEAA 2Z0MA 2BGTA 2H4HA 3DOFA 5LQJA 5ALFA 4YRBA 4FEGA 3JS5A 1QK4A 1A8IA 3BB3A 5T5QA 5B55A 1PK7A 1XTSA 2Y1EA 3QVGB 5G41A 4GHWA 4RK6A 3A06A 1DTEA 2GF2A 3BA6A 1LC0A 4FE7A 3HCWA 2WQ6A 3IH5A 5M3BA 1XMQB 4QGBA 3RRBA 1RT9A 1XTIA 2J7PD <