5DJ5A

Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
266
structure length
266
Chain Sequence
GAKLLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable strigolactone esterase D14
publication title Destabilization of strigolactone receptor DWARF14 by binding of ligand and E3-ligase signaling effector DWARF3.
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 90
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dj5A00
4K5QA 1GZ7A 4PSUA 2JGLA 1QIHA 3O4HA 1XZEA 4EY7A 1XZIA 1H23A 3IBTA 5JZBA 1BCSA 4C4YA 2QUAA 3TGLA 3I2JA 1E66A 1CVLA 1H2YA 5CT6A 4P9NA 4UHDA 2FJ0A 4G4GA 3QITA 4YX9A 4FHZA 2HU5A 2WU4A 2XUKA 4Q82A 5EHNA 4Q3OA 3X3HA 1WPXA 4EA6A 5IVKA 1UKAA 3A2LA 1DU4A 2RGUA 3WKCA 4E11A 2PVSA 4H35A 1MTZA 1A8QA 1EB9A 2VAVA 4BP8A 2OG1A 4AX4A 1LNSA 1ZJ5A 4X95A 3RM3A 4XIIA 4QWMA 4Y2UA 2XDWA 4J0DA 5ALNA 2BGRA 1K8QA 4GEGA 1AC5A 1H2WA 2OQVA 4BATA 2XUHA 1JI3A 2GBGA 3H1AA 3U1TA 1FFEA 1KU0A 5DLPA 2WHPB 4WFJA 3F96A 1RP1A 2I3ZA 1UT6A 1P0PA 3I2HA 1GKLA 5C81A 3I6YA 4C89A 4X3CA 4AZ0A 2OQIA 1E89A 4OB8A 4ZI5A 2C0QA 2C7BA 5DNUA 5AKLA 4W63A 3VJLA 4DGQA 1MJ5A 3FYTA 3WK7A 3C5VA 4KE9A 5DJ5A 3C45A 4G5XA 5FPPA 4DTCA 1MO2A 2ZSHA 3L1JA 1FSSA 3CN9A 2XUFA 3AJAA 4WCVA 5AI0A 1EDBA 1YSCA 4KAAA 4B81A 3D0KA 4WJLA 4XWGA 2OCGA 2HRRA 4BC1A 3GUUA 1G5FA 4WDQA 5JAOA 1PV1A 3MUNA 5ALJA 5DNVA 1O6FA 3O9VA 4P93A 2Z8ZA 3OOSA 1HKHA 1GGVA 3GROA 4X6YA 5HKAA 5JADA 5JIBA 4TPKA 2OGTA 2VA9A 4KRXA 1W4LA 2YXPX 4F5ZA 1Y7IA 2G5TA 5AK6A 3IULA 3BL8A 4BAUA 4OD0A 4J0GA 3ZLUA 5EI5A 4X93A 3DL4A 5HK8A 3WL7A 2QT9A 1XZAA 2BCEA 5DNWA 3CXUA 3U0VA 2VJBA 4X85A 3NUZA 1R3DA 1QONA 3C87A 3WQHA 3S2ZA 5LZ4A 5A7FA 2VJAA 4L9AA 4I3FA 3I2GA 4AN1A 3FAKA 5HCUA 5ALFA 2BJHA 3CN7A 4H0CA 1SCKA 2O7RA 1CUCA 1QIDA 3HEAA 3GA7A 1YS1X 1CUFA 4EY5A 4J0KA 1WOMA 3BWXA 2JF0A 3YASA 3FVRA 4K6KA 2XLCA 4CIAA 5JAHA 4DNQA 1VJ5A 2WM2A 5CTAA 2OAGA 2QJRA 1CUXA 1DX6A 5ALDA 1OILA 4H77A 1LGYA 4DNFA 2CMFA 2Z8XA 2J4CA 5CW2A 2I3DA 1LPSA 4BRZA 1ORVA 1PFQA 3IUJA 3V1NA 1K63A 1AKNA 1EDEA 3WK5A 1X2EA 1SCQA 2QZPA 1XQXA 1AQLA 4X90A 4J0CA 5AIAA 2XMGA 3NOXA 4HXGA 2WG0A 1YR2A 2XQIA 3JW8A 4QE3A 1MX9A 1R88A 5EIAA 4LXHA 3O95A 4Y2RA 4DMKA 1EXWA 3LIPA 3IB3A 2W6CX 4C4ZA 1ACLA 3F67A 4HVTA 5JZ9A 4EY4A 4J3JA 5LIPA 2PX6A 2PU5A 3M3DA 1UK7A 4Y2QA 2JGFA 2PM8A 2QOEA 2LIPA 4B7ZA 3WA7A 4UBMA 1C7JA 2H7XA 5ALWA 3C6ZA 4OU5A 5FKJA 4KR0A 2QXTA 3HACA 3HLKA 4A5SA 1WPRA 1EB8A 5H3HA 1YAJA 4QZVA 4X6XA 5AKGA 1ZI6A 1M33A 2ACEA 1DTEA 1GPNA 4AN0A 4Y2YA 2HA0A 5HKBA 5IKXA 3LIIA 3DNMA 4M0EA 5A7HA 3EQ9A 1XKTA 1ZJ4A 2XMBA 2WUDA 2VAXA 4J0IA 5LZ2A 5JD5A 1CIJA 3FLAA 2X5XA 3KXPA 5CURA 4B0PA 1NU8A 3AIKA 1W1IA 4PO3X 4Q3LA 1GKKA 1EK1A 1XLWA 1XZBA 3D7RA 4UPDA 3OTQA 4MYDA 3SC2A 1CFJA 2QVBA 3OC0A 3IIIA 2HFKA 2RHTA 4KRYA 4A23A 4M0FA 4B84A 4E14A 4AO6A 5CT5A 2B20A 1EH5A 5BWBA 2K2QB 4ZV9A 5HQ3B 4UHHA 3DOHA 3FYUA 3KD2A 3T52A 5JAUA 3BF8A 3PE6A 4NVRA 5JD4A 2J3QA 1UXOA 4IH9A 4AO7A 1ZD5A 3FSGD 4BP9A 1P0QA 3GZJA 1BE0A 5FUMA 1R4ZA 3WWEA 5DTIA 1HBJA 2XUAA 3IUNA 3FYUC 1CQWA 4UFNA 1IUNA 3PF8A 3C5WP 4BTVA 4DMHA 2OLEA 2B9VA 5D3KA 4N5HX 4MWSA 1TK3A 3LLCA 4N8EA 5KWJA 2WG1A 3ESAA 3C6YA 1KU6A 1XQYA 4Y2PA 3G9ZA 3O4GA 4JNCA 1VZ3A 1ETHA 1ZI9A 1USWA 1XLUA 4H7FA 1WB6A 5AM2A 4OB6A 2GBCA 1XZJA 2CUTA 3WWCA 4Y2VA 3BJRA 1W52X 2B4KA 3I2KA 4BC0A 4X91A 1TRHA 1CR6A 2XT0A 4IH4A 3H04A 3K6KA 2HU7A 3ZV7A 4I19A 4QA9A 2FUKA 3N0TA 1CUAA 2RIPA 3ZPXA 1VXRA 4AZ3A 2HA4A 2RAUA 1IMJA 5HZGA 5AK5A 3A2MA 3C8HA 1LZKA 3F98A 4PQEA 3BIWA 1ISPA 4RPCA 4WY5A 4B6GA 2PSJA 2HA2A 3A70A 4BDTA 2OCKA 4HZGA 4KYVA 3STVA 1R9NA 3WKBA 1VKHA 3HXKA 5CT8A 1MAHA 4B83A 5C7YA 5I8PA 4F0JA 3B3QA 1I6WA 4CG2A 5EHQA 4NS4A 3DYVA 4BAZA 2CBGA 4U2FA 4WDRA 5AM5A 5K3DA 2XUOA 2XI4A 4JEIA 5FP0A 1P0MA 4JUIA 1T4MA 1EHYA 1EVQA 2V97A 4G4JA 2HA6A 3WZMA 4OU4A 1QIMA 3H1BA 1ZI8A 4UBLA 4W1RA 3WK6A 2J4FA 4ARAA 2HA7A 4B0OA 1QO9A 2PSFA 1D07A 5EGNA 2DCMA 5AKYA 3ED1A 1AMNA 4QLAA 3HJUA 5ESRA 5HK9A 4ZREA 1C7IA 4FLFA 1QIJA 4X92A 5AICA 3JYHA 3IDAA 4BDSA 5LZ9A 1LBTA 3QPDA 4N5IX 1H2ZA 3E3AA 3TRDA 4UBOA 5HF9A 1R1DA 1WM1A 4HXEB 2FX5A 5IVDA 1QIFA 5JYCA 2XLBA 4Y2JA 1F8UA 1CUGA 1FJ2A 3ZWQA 4BRSA 2FJPA 2G63A 3B5EA 1XRLA 4Y2TA 5K3FB 3SK0A 4ZWNA 4FLMA 1QIEA 4Q3KA 4RNCA 4U2GA 1JKMA 2W22A 3HSSA 4BE4A 4G8BA 3PI6A 3WJ2A 3LP5A 5FV4A 1DWQA 5AKIA 4MYSA 2UZ0A 2WFLB 2Z3WA 2CEKA 2JBWA 3A2NA 1TCAA 4YK7A 5JALA 1XZDA 1YB6A 1XZKA 1G66A 4ZXFA 4FTWA 4X97A 3BXPA 5C8VA 2H9YA 2VEOA 2O2HA 5ALHA 3RKSA 3EBLA 4KEAA 5LZ5A 1XRQA 1MX5A 5AKXA 4CCYA 3H19A 5C8ZA 5AP9A 4MQLA 5F4ZA 4F21A 2CZQA 1MNQA 5AOBA 5JANA 2XB6A 1W75A 5ALEA 1BN6A 2PKYX 1Q83A 3FOBA 2RHWA 5D3ZA 3I2FA 5HF5A 1MPXA 4G8DA 4EY8A 1N5MA 2WJ6A 4K2AA 4Y9SA 5AI4A 4LYDA 5ALYA 3FYUB 1MX1A 5D7BA 3VJKA 3ESCA 2BKLA 1WCYA 3WL6A 1SOMA 4H7DA 3H18A 5E4JA 1QZ3A 1OXMA 3VISA 1LPPA 3ICWA 3QYJA 4Y2SA 4UBKA 2G5PA 3P2MA 3H2GA 3LS2A 1ZIXA 4KE6A 3BE8A 1EK2A 2ZVDA 2R11A 2P8SA 1GQSA 4EB0A 1CUEA 5E4YA 4BVJA 4Q1VA 2PBLA 1JFRA 1N5RA 4BB0A 4FFVA 3R41A 4G8CA 2WLSA 3SX4A 1ODSA 4JH0A 4FBLA 1AX9A 1FFBA 3IVMA 1RYYA 4HS9A 3H2IA 3HABA 5AI9A 4AMZA 5EHXA 3G02A 4GI1A 4FFWA 5IVIA 3DQZA 2Z3ZA 2JGJA 5AK3A 1YA4A 3G9XA 4FLEA 2DHEA 1CUUA 3NWOA 1L7RA 4QDOA 2JGMA 4Z49A 5AM0A 4NZZA 3K9BA 5AKHA 4Q34A 1AURA 3G0BA 2WSLA 3H2KA 4J0HA 2JGKA 4CCWA 5DYWA 3QBJA 1FFDA 1ZD2P 3D3NA 5FLKA 1J2EA 3VDXA 3EQ8A 5CT4A 1CUWA 5T4EA 1E8NA 3I6MA 4BZZA 1CV2A 3R3YA 5LKAA 3WYNA 3F9CA 2QUBA 3RLIA 2VT6A 4H7EA 2PSEA 3D5EA 1GPKA 1THTA 3Q8WA 2XMSA 4OYLA 2Y2VA 4RE6A 1CUZA 3QMWA 4LXGA 2JGIA 5BV7A 1ZOIA 3G9TA 2XMDA 3D2CA 3PICA 4D9JA 4X6UA 4ZGBA 1LBSA 3OM8A 4BBZA 1LPMA 5ALPA 1MNAA 4BCDA 2C58A 5HFNA 3T4UA 1YA8A 3FCYA 4E46A 1ODTC 1Q0RA 3QZUA 4FMPA 3G0GA 2ZYSA 1LZLA 2BAGA 4DYHA 1XZFA 5HF8A 4OSEA 2HA3A 3D4LA 2WHRA 3C6BA 3R3ZA 4BE9A 2HDWA 1CUHA 2JGEA 2DR0A 2V96A 4PSDA 4ETWA 3V1KA 2ZJFA 3KWJA 3N2ZB 1CLEA 4EY6A 3IUQA 3C6XA 2HL6A 2H7CA 2DSNA 3H2HA 3I1IA 4U2EA 2YASA 3G0DA 1S8OA 2O2IA 4J0JA 4B82A 3G7NA 2E3JA 4HTAA 1BU8A 2WJ4A 4PNZA 5ALKA 3M83A 1VLQA 3AFIA 5CT9A 2ROQA 4FKBA 5YASA 3W06A 4MJ3A 3WZLA 1UZAA 5K3CA 4QDUA 4DMFA 2WKWA 4J03A 4DMCA 3QVMA 5CXXA 2HA5A 3MVEA 1EX9A 3BIXA 1JMKC 1K5PA 3HZOA 2GYVA 2PPLA 1GQRA 4H7HA 3PF9A 5JASA 3HYSA 5E2IA 2WHPA 1IVYA 1XZHA 2BFNA 1VE7A 4DNPA 3RK4A 3WA6A 3E1GA 2VJCA 3QH4A 5CBKA 3FNBA 4EZIA 3A6ZA 3MUOA 2EDAA 1L7AA 4OYYA 4K6GA 1B41A 4W1PA 2AJDA 1LPBB 1WHTA 2AJ8A 1BRTA 2IITA 4OB7A 4QDZA 5ALGA 5AJHA 3FVTA 4NMWA 2BUBA 2B61A 1QIGA 3O0DA 1LPOA 1EINA 1UK9A 5CH8A 3TEJA 3O4JA 3AZQA 4U2BA 1N8SA 4OCZA 1U2EA 2Y6UA 5AIBA 3C43A 2BUCA 5CMLA 3S8YA 1MAAA 4AO8A 1VOTA 4WFIA 5T4FA 1UKBA 2XMCA 1E5TA 3ILSA 5AI6A 4WFKA 5AKZA 2WFZA 3STYA 3D59A 3GFFA 4C88A 4JYPA 4W1SA 3IA2A 5AO9A 3H17A 2CB9A 4QLOA 2DHCA 4PSCA 2XUDA 2WHQA 1ZIYA 1HQDA 5ALTA 3W05A 5A2GA 1FFCA 2OGZA 4X7BA 5FXMA 2GYUA 4L72A 1G42A 2DQYA 1QE3A 4INZA 4EBBA 5A6VA 3D2BA 4FWBA 3VJMA 2VJDA 4BVLA 1AUOA 4KAFA 2HADA 1JU4A 2BUAA 5FPQA 4LKOA 3VXKA 5ISMA 3B12A 1WB5A 3I6ZA 4IQ4A 4UHFA 2EEPA 2CKMA 4QNNA 2I78A 3QPAA 4YASA 2PL5A 1JU3A 3E4DA 2HIHA 4GECA 3KSRA 2AJCA 5LKRA 5A71A 3WL8A 3OPMA 1W76A 5AM1A 1CUDA 2XUQA 3BF7A 3AIMA 2WILA 2V98A 4UHCA 5LP1A 1EA5A 1ODCA 3R0VA 3AIOA 2GBFA 4XVCA 3ESBA 4ZV7A 3FLEA 3W2TA 1SC9A 1WHSA 2HU8A 1CEXA 2C0PA 3QPCA 2XUPA 3KWFA 1XRRA 4HAIA 2JEZA 4BZWA 4KE8A 3QMVA 4PF1A 5LYYA 5LLSA 3E0XA 5HFAA 2Y1KA 2WIJA 3I28A 1IUPA 1JJFA 4DM7A 4KACA 5BWCA 3WWPA 4KJXA 1KEZA 5JARA 2RONA 1QTRA 1BEZA 1DT5A 2I03A 4BTLA 5IVHA 3DKRA 2XQKA 5CH5A 2QJWA 3WKDA 2WUFA 4BCCA 4CIBA 2Z5GA 5LZ7A 3STUA 3RARA 3WIBA 1ZGCA 5KBYA 1AZWA 3NGMA 4GLBA 3V1LA 3QM1A 1ZD3A 2ECFA 2Q0XA 4V2IA 1Y37A 1W6RA 5JATA 1N1MA 4PV7A 1YS2X 1F0NA 1QO7A 3IUMA 5LZ8A 2WFMA 2XUJA 5FDFA 3I2IA 1VA4A 3F8SA 3WWOA 2ZSIA 2OCIA 3CCCA 4UHBA 1YB7A 5D6OA 4BCBA 1DT3A 7YASA 3BDIA 5K5EA 4HXFB 1A88A 4DNOA 5AOAA 2YH2A 3OURA 3DCNA 1VZ2A 4F60A 1YAHA 2ZYRA 4TVKA 5HQ3A 3D2AA 5I9IA 3WLAA 4U2CA 2JIDA 5SYMA 4BYMA 3EF3A 2C5GA 3AUKA 3CCBA 2D0DA 1G4HA 5HF6A 1CUBA 1XZGA 3R3UA 1NX9A 1YCDA 5T4HA 1F0PA 5K3BA 5ALMA 1E8MA 2C4HA 5AK4A 4CG3A 4G9EA 3L1IA 1OCEA 4H7JA 3M81A 2PSDA 3QMMA 2DFPA 5ALSA 4JYMA 2XMQA 2ES4A 1CUYA 5AKEA 1U65A 4AXBA 1UKCA 4N8DA 1F6WA 2XQFA 4UHEA 3M82A 5ALOA 2ORYA 1UOPA 4YPVA 2DQZA 4B80A 4XJVA 5T4BA 2VQ6A 1UOOA 1VA5A 3R40A 4AQDA 3FCXA 4CFSA 3GELA 3AZPA 2AJBA 1CRLA 1Q0ZA 1BCRA 4DSZA 4KE7A 4H18A 3K2IA 3TJMA 5AHXA 4Y2XA 1R9MA 3AINA 1DINA 2G4LA 3AILA 3PFBA 1CUIA 2WIGA 5DYYA 2EDCA 2QKYA 3STTA 1AGYA 2X8BA 3ZI7A 5AI5A 1U8EA 3DD5A 2ZYIA 1MN6A 4K6HA 1K4YA 3STWA 2PUHA 1CQZA 4B9EA 4EHBA 2CJPA 1E3QA 3G9UA 2QTBA 3JWEA 3DDUA 3MGAA 1RWQA 1DX4A 1BROA 2XE4A 1X2BA 5ALIA 1XKLA 4C87A 4X71A 1VE6A 3KDAA 5KWIA 1C4XA 4DSAA 2QXUA 5CXUA 2WG2A 1THGA 3FSGA 1MT3A 1XFDA 1CUVA 4LXIA 4UFPA 3GBSA 1DQYA 1P0IA 3FWHA 2HRQA 2QS9A 3HI4A 3WJ1A 1TKRA 1QIIA 4KAJA 4QEKA 3H2JA 3DOIA 5AI8A 1UWCA 3DKKA 4ZRDA 4Q05A 4X00A 1XZMA 5DYTA 2AJLI 1QFSA 5AKKA 3EIOA 1QFMA 3WKAA 1T2NA 3BJMA 2WIKA 4GXNA 5A7GA 3WIOA 1GT6A 1J07A 2GZSA 1K6EA 4I4CA 4W9RA 5EIHA 2VATA 2WUGA 2XMZA 5C8XA 4PW0A 2IX9A 2Y6VA 1H22A 4MQMA 5AH0A 2BGNA 4DIUA 2PUJA 2HM7A 1HLGA 4J7AA 4N8SA 1CUJA 4FNMA 3V48A 1QIKA 1EVEA 2OAEA 4OPMA 5ALUA 5JAPA 5K3EA 4XX1A 3W9UA 3PDCA 2GYWA 1Z68A 3WK9A 1H2XA 2NW6A 1GPLA 3F97A 1X70A 3STXA 4GBGA 2OCLA 3PUIA 1J06A 3O4IA 4C6HA 5K3FA 5ALLA 2D5LA 1U4NA 2PU7A 1Q84A 3AZOA 4QDTA 1TCCA 1XQVA 4B85A 2WIFA 1QLWA 2XQGA 4P92A 4FDMA 3G8YA 1JMYA 3R3XA 1O6GA 5SYNA 1TCBA 1CPYA 4IHAA 5E4TA 3BDVA 4AMYA 2WFLA 3PUHA 1ZD4A 1LPAB 4IO0A 1XRMA 1DWPA 2WUEA 4GHWA 2VSQA 1B6GA 3ZLTA 5ALRA 1BS9A 3ZLVA 1EDDA 4UBNA 4H7KA 4Y7DA 1BN7A 1NU6A 3WWDA 3DS8A 5I7UA 5EHZA 4LIPD 5AM3A 5CH3A 4HRYA 4TGLA 1CUSA 4G4IA 4CG1A 5K3AA 3OG9A 4C4XA 3WKEA 4S0XA 1LPNA 2H1IA 1XZCA 4MEAA 4M0MA 4AB1A 4B9AA 4MXDA 1QGED 3UUEA 4CCYB 4G9GA 2RI6A 4GWLA 3VVMA 4FBMA 2IIVA 2WTNA 3DYIA 2QM0A 4GW3A 3H0CA 4UUQA 5AM4A 4ARBA 3SWWA 2H7YA 1IZ8A 4RGYA 3V9AA 4GDMA 4G1FA 3IURA 3DEAA 3DLTA 4E15A 1XLVA 3O9MA 1XRPA 4ITVA 4UBJA 3Q0TA 2HHAA 3G0IA 4H7IA 2OXEA 5IH7A 2WIDA 2XUIA 2ZJ6A 4U2DA 3ANSA 5EFZA 1GXSA 2DHDA 2V9ZA 1TQHA 1ACJA 1SFRA 3WMRA 3LCRA 4O08A 1HDEA 3R3VA 4RE5A 2XQJA 3WK8A 1ZICA 3VKFA 3W9BA 1XRNA 1VXOA 1JT2A 1HPLA 1QJ4A 1LLFA 1XZLA 2HFJA 2GZRA 3HRHA 3I1YA 4HRXA 2R8BA 2QRUA 1UFOA 1HL7A 4MWTA 5JD6A 1TIBA 4OUKX 4UFOA 4C01A 1IZ7A 1FFAA 2ZJ7A 5ALZA 3WI7A 4FNGA 4L3WA 4MEBA 5J3JA 3UMJA 2PSHA 2O7VA 3ANTA 1A7UA 2AXEA 3WK4A 4ROTA 4LHEA 1YASA 3FBWA 5BOVA 4BAGA 2OPHA 1UK8A 1Y7HA 2XUGA 2VT7A 1DWOA 1L7QA 5ALQA 3HC7A 1XROA 5FOQA 1ORWA 4FOLA 2ACKA 3PFCA 1EI9A 4CI9A 1ZGBA 4W1QA 4BVKA 4X94A 3G0CA 5ALXA 2WTMA 2GBIA 1MU0A 2WQZA 4LYEA 3KOOA 2XMRA 4L0CA 1J1IA 3ICVA 3ESDA 2WJ3A 3DL7A 5AKJA 1TAHA 5JZSA 2OGSA 1DQZA 1A8UA 1PJAA 5CRIA 4EUSA 3UUFA 2WU3A 2QR5A 2ONCA 5AOCA 4IH1A 5DWDA 4QWWA 1BEEA 1JJBA 1QOZA 3C70A 1A8SA 2Y2UA 2YYSA 5DTJA 3WYDA 1XQWA 6YASA 4WY8A 5A62A 1JJIA 3W04A 4QDXA 5EIEA 1UOQA 3VVLA 2JEYA 3V1MA 3EQ7A 2C5FA 4UBIA 3C8DA 5KREA 1IUOA 1UK6A 2VF2A 1SCIA 2O2GA 2VTVA 1WB4A 2X76A 3L1HA 3FLBA 2J3DA 1R50A 2ZYHA 5ALVA 3R3WA 4P08A 1E8DA 3WL5A 4DLNA 4A16A 2QMQA 3DJYA 5FRDA 1QTIA
chains in the Genus database with same CATH superfamily
1PJRA 3OQBA 3OCVA 4G1CA 4JB0A 1N32B 5FORA 4IIBA 3PFIA 5DEOA 1N7IA 5EJ7A 4DSNA 1Z6XA 4JLBA 4R1NA 2JATA 1J22A 1KSFX 3DZKA 4XLTA 1P7VA 2DGDA 4RF2A 1XA0A 1XZIA 4Z9XA 3KPJA 1W5AA 4GYWA 5IARA 4DWOA 4EG1A 2ZB7A 3NPMA 4EDHA 1NP3A 1PZGA 3AHHA 5I7FA 1T35A 1E2DA 3B9QA 1N2CE 1R5BA 2A86A 5GM2A 3W7VA 1BMDA 4F6CA 5BUCA 3EGDA 1QHIA 2QTMA 4HVAA 4JCOA 4BNYA 1OFTA 2NSYA 2GPSA 3I12A 3KWMA 5KZMB 1Y42X 1E66A 4PGMA 4E3ZA 3ZHXA 1FIUA 3SM3A 2HI0A 1A9PA 1W36C 2QLTA 2X58A 3FTEA 5BVHA 2H08A 4URHA 1H94A 2DY0A 3MJDA 2ZWVA 4AG5A 2AZDA 4KQ9A 3I61A 3DDZX 4I9FA 2BT4A 4HT3B 3DT6A 3QITA 4PAWA 4XIGS 3KKLA 2FP3A 4EKIA 2HJ9A 2HU5A 1LK7A 3KL4A 3KQYA 4KXFB 3AY7A 2CLIB 4PQGA 5EUMA 3IV9A 3ZCUA 5LWQA 1W581 3IE1A 4OHWA 3RFTA 3DDHA 1OX4B 1P5JA 2ODAA 2QPTA 4R9RA 5C4IA 3JARA 2PGIA 4PY2A 2RE8A 1LC0A 2Y4NA 3O8DA 5CXQA 1XQ9A 2YY7A 5EPUA 4PIPA 4BBPA 4E7PA 2CXXA 3KPVA 4K9NA 1I9GA 1Q5PA 4EB3A 1WE2A 1CETA 4HXYA 1YQUA 3PNYA 4V0KA 3ZCQA 1DJMA 2BKAA 5IU6A 1LBEA 4PNPA 5EKSA 4H35A 3TN7A 2PS1A 1AQYA 2C99A 1RKVA 5TT1A 3G5TA 1DV2A 4Y1EA 5BW8A 2VAVA 1Z8FA 3L7LA 1UJ4A 4WOBA 4CM6A 1CQPA 3L1VA 3CMCO 2GZAA 3NOVA 3S2FA 3LUPA 1Y6QA 2P30A 1AS0A 3VR6A 1ZJ5A 621PA 2QY6A 2QIOA 3RSQA 4YECA 5CFZA 2CL7X 2Q5IA 3QRWA 3T5BA 3NKLA 4QHSA 4M89A 2AX4A 4WT7A 1Q1NA 4K8OA 1A97A 4QWMA 4A0SA 4DQKA 5MFPA 1VPWA 4J0DA 5ALNA 3R7WB 1PWEA 3FMFA 5BORA 1VCIA 4GZ3A 4RJ2A 1HORA 5GV8A 4BATA 1HY3A 2XTAA 2GMWA 3TECE 2PN1A 3CJTA 1DC3A 3GJ3A 2M6LA 2G08A 5DHSA 4MWZA 1ZPDA 5IAAA 2Y27A 4U2KA 3Q10A 1XJWA 2HF8A 2WVHA 3CF4G 3UMVA 1MVLA 2AXQA 1RBMA 4EW3A 5KOIA 1GSIA 4YLGA 1KJZA 1D0VA 4WHMA 4HNAA 2J3MA 3WDKA 3IELA 2H7VA 1ZG3A 2V7WA 4P34A 4WKOA 2QQ0A 2VIIA 2YWXA 2E1PA 3PVSA 4UM9D 4US1R 3THRA 3V2HA 1T6ZA 1JR3E 3GFQA 3PA8A 4UTVA 2B0CA 4QM7A 2AKYA 2Q7DA 3T7CA 4POAA 1SUPA 3HA7A 1F9EA 2YXNA 3IRUA 4X3OA 4YRAA 4WQMA 1UT6A 1YR7A 3ZXYA 3I6YA 1T3ZA 4D98A 2YXEA 3KTOA 2PA0A 2I4MA 4ZO4A 3UC9A 4X3CA 4AT1A 3NBUA 2UAGA 1YRQA 5FOWA 2WMYA 1VPDA 3MRXA 1V6AA 2C7BA 2PAAA 4WKNA 1JFFA 1FYEA 2FRDC 4QAJA 4XSHA 1DIGA 1C1HA 2IQ5A 3MMNA 4PZPA 4DGQA 3A9WA 3FYTA 2TSYB 2ODWA 1F48A 1WHTB 4KE9A 1IWPB 4QDJA 2ZYTX 4R2LA 2PMCA 4KSBA 2BLNA 1C3OA 2DECA 4M0PA 5DJ5A 3H4MA 1OV6A 3U81A 3AGQA 5C52B 4GXQA 3T4EA 3BPSA 3AESA 4IDEA 3UGJA 3R5HA 4HNRA 3TI9A 5K0LA 2CUZA 3IGFA 2E6KA 2ZSUA 2OFOA 5FYQA 3AJAA 1NBMA 1GXSB 4QOIA 2JLXA 5ELXA 4KLCA 3U7FB 1XCMA 1YSCA 2WSMA 4HEA6 5EWLB 3BOSA 3E58A 3LU1A 3B70A 3RLFA 4XYBA 4U0JA 3QEOA 4TMYA 1Y8RB 3W2GA 1JXOA 2ZE8A 5KS2A 4ZVUA 3G7UA 1KYIA 2C3YA 2NTEA 2OCGA 3D4NA 2EHJA 2HMUA 3PGLA 4KQ1A 4WSOA 2J9XB 2ZCJA 1G5FA 3DVAB 3HN2A 4B3HA 1PV1A 1X7ZB 1DAGA 1ZM2A 2PZMA 4I9HA 4C5BA 4MP3A 4L5IA 1L4MA 4ADSG 4ND1A 1SQ6A 2L0XA 3H2BA 3ON5A 1M6WA 4HAVA 3TBKA 3UWPA 1XXHB 1DAKA 3C1AA 4DV6B 1HKHA 1CCWA 1GGVA 2H8GA 5A3SA 2RG7A 4YS6A 2X5NA 1R0LA 5DLYA 4E13A 2OKGA 2ZJ8A 1DOHA 4TVBA 5JADA 5JIBA 5JYBA 2ISQA 3G13A 4KRXA 3O2SB 5DNAA 3UATA 2XYPA 3L04A 5I6DA 2OD9A 1UBCA 3TUIC 4C2BA 2WWYA 3LQKA 1SEVA 4Q01A 4HDNA 3SQDA 2ZRDA 3NGLA 1CXZA 4Z8YA 2YV5A 4L15A 4LWZA 1W73A 3WV5A 4LY9A 3QBTA 3BL8A 4UEJA 2W8ZA 2C3OA 3HBJA 1PV2A 4OA5A 1XMSA 4W7SA 3UK1A 3GJRA 5DDIP 5IVPA 1TJ3A 5F2OA 1Q3KA 5J2TB 1RR6A 3DL4A 4O4HB 2JJ2A 4MUGA 5KVAA 3AWIA 1IDN1 5AD1A 1DG9A 3Q3HA 2O57A 3HKCB 5FWNA 2XDYA 4EZBA 2IYWA 4CLEA 4D25A 1SCBA 1MQSA 1NQTA 2B6NA 1FDIA 1U81A 2VYFA 3MWYW 4X85A 1W36D 2PO5A 1Y80A 4M8LA 3RNLA 3VUFA 1O5OA 3H4TA 3RH0A 4LWQA 3WQHA 4DIEA 5F7OA 5IMBA 1ZDMA 4Z1MD 1CY8A 2DFKB 5DBOA 4M9CA 2BBWA 3MUEA 3I2GA 5EQJB 3FAKA 1K1EA 1NSYA 2C3UA 2YZ7A 4B31A 4GZ6A 1UANA 3GJ0A 2BJHA 3NAZA 3CN7A 2IBSA 4ZZ1A 1SCKA 2O7RA 1QIDA 4IMIB 4KZPA 1OJ7A 4U00A 4TV9B 2P6PA 5IXSA 4BX0A 1TECE 4ZQHA 4P0QB 3BQNB 3HM2A 2EJCA 3RC8A 3UJ3X 3ZGXA 3K0KA 3BWXA 2JF0A 3TR5A 1DG1G 1D2RA 3UUGA 2ZE7A 4E3WA 1GZ3A 2C92A 1US8B 3A4YA 1R74A 3OJXA 2IEIA 5JQWA 1S4QA 3WE7A 2AJTA 2R87A 4RDHA 5G0TA 3ZOKA 3O82A 2IOYA 4K6KA 3M8KA 5EIXA 4G67A 4RHUA 1T1IA 1ZHHA 3OJFA 4CMJA 1C8BA 2I2WA 5IXJA 2PWBA 4LF7B 1JXMA 2WM2A 3L7NA 4G36A 1FDUA 3E9QA 2OFFA 1KAGA 2UXBB 4KVZA 2VPYA 1PS0A 3L40A 3PWKA 5TQVA 2BMJA 3FPJA 1BJRE 2BE7A 1HSZA 2IZOA 4BVEA 4GP9A 5JJCA 5LL6P 3QEAZ 1OAAA 3UJ9A 4PQYA 2CMFA 1MOPA 3LJKA 4YAFA 4XSGA 5DTMA 2VTBA 4OHFA 5CW2A 2QR2A 3T41A 2HQOA 2VNKA 3CX8A 4IEIA 4QTXA 1EQUA 2ZTUA 2AFRA 4I4TF 3IT2A 4F2PA 5FOTA 1VECA 1JBQA 5FV7A 1U9CA 3HVJA 1TJPB 5KKAA 2C3MA 3WK5A 1X2EA 4E7OA 2Y05A 4LHYA 1E2MA 2PGAA 4G5SA 4BE7B 5AIAA 2BOVA 4IIJB 5AW6A 5KJEA 3N74A 5IDYA 1NUAA 4XOUA 1Q0PA 3OPXA 5IK2A 3WYBA 1Q0TA 2FK7A 4N4AA 1STOA 1W0JA 1OQAA 3FMIA 1S02A 4MTCA 4NBNA 5G4KA 3FFBA 2JFVA 3QE3A 1R6XA 2P0YA 3Q0IA 4N0DA 5JCJA 1RWVA 4YMUA 1MV8A 2YXLA 5DE3A 3G6WA 1WHSB 4TKMA 3FJ1A 1GPAA 1SRQA 1NUPA 2QI9F 3LIPA 2FFJA 2W6CX 4ZQGA 1U5CA 1VYHA 3CUEF 4GKAA 2A9QA 5JBNA 1JLLB 1ACLA 1JLKA 1X8XA 1TGYA 1Y5LA 1SBQA 1SQSA 3D2LA 2W6MA 3O26A 4ANFA 3PJEA 1BKSB 5JZ9A 2TRSB 3QV1A 2ZYVX 3DAOA 4YDQA 4XR4A 2A9PA 4EY4A 5KCMA 2ZETA 2QTGA 1CRWG 5EZYB 5LA6B 4GPEA 4I8XA 5CDFA 4Y2QA 2PM8A 1EX6A 1T9KA 1YK1A 3JYPA 3B85A 3IQWA 2Q2QA 3SZ3A 4XB2A 1B8VA 2IYOA 2ZE5A 1C7JA 1DQNA 1HDYA 2WVAA 3C6ZA 1BMFD 4FHGA 1QH9A 1S8AA 1NASA 3AUFA 3KPWA 4IL5A 1Y1SA 2ALJA 2Q8QA 3E6AA 4X7RA 4L02A 5D84A 4LCJA 4KR0A 2DUNA 3GEIA 2PRSA 2QXTA 3FRIA 4BB6A 1JWLA 1JR6A 1SXIA 3GYGA 4MOWA 1LCIA 1M10A 4L5AA 5EE3A 1OHHA 1GFZA 1T9DA 4TSRA 4A5SA 2BBSA 3HO6A 5CVTA 3VC3A 4FEEA 2JBAB 2B5VA 3CRNA 5H3HA 3MJTA 1YAJA 5CNJA 4AMBA 3WO0A 2ZT6A 1RWOA 2ISCA 3GLSA 1VFNA 3K1ZA 3U6BA 4IJKA 1U9JA 1ZI6A 4JT2A 3RF7A 4OHKA 4AN0A 4BV2A 3U17A 1OZ0A 4QUKA 4CDMA 4Y2YA 421PA 1KKUA 2LNDA 1MF7A 4YONB 5HKBA 3TW6A 2JJ1A 5JQGA 2ZYAA 3CR8A 2Q4TA 2J7KA 2F1RA 1R0ZA 3LIIA 2DPYA 3AH8A 4X1KB 1MAVA 4UE2A 1T91A 8AT1A 1JQEA 3AP1A 3O8RA 3AP3A 1F2UB 2QBYA 2GAAA 1KEPA 4HQNA 3QIAA 4CV1A 5DW0A 4D8TA 1CC1S 1ENPA 1ZJ4A 1L3IA 2VAXA 2GBLC 2ZJ0A 5DK4A 1U3TA 5BP7A 3SYKA 2CV0A 2IYLD 3HKEB 5TT0A 1QFZA 1FFGA 1WG8A 2ZRCA 2F1KA 4CTNA 1MD9A 1B6RA 3LOPA 3OE7A 4Q9DA 2C2XA 1Y4SA 4AKHA 2X5XA 1FRVA 1WW2A 1TMYA 3FPAA 4X20B 5ECWA 5H02A 1QX3A 1ZBQA 4UVEA 3SVTA 3ROQA 5BSGA 1R7RA 1QS0B 3C97A 3KZVA 4AM8A 3F9RA 3E9ZA 1DJOA 1A72A 1YR6A 1AKMA 3NDJA 5IWCA 1B4DA 3LWDA 4MYDA 3SC2A 1JUDA 1XTQA 2OSBA 3ZCTA 4LXYA 4BQQA 2BFAA 2HTEA 1SAYA 2J3IA 2VH2A 2VRCD 1ONNA 4IGKA 2DFDA 5EKTA 4B6FA 2HIGA 4KQ2A 3IOCA 2HFKA 1GP2A 1OREA 1A27A 1XTIA 3BRCA 3P4UA 4KRYA 4Y1RB 4A23A 2XOXA 3L8ZA 1CJSA 2EZTA 3F7NA 5CT5A 4AQ7A 1EFRD 4DXHA 2A1UA 4IVPA 1R00A 521PA 4CEHB 3DPUA 1EH5A 1RPNA 1U2GC 1XCGB 4D9FA 1NVFA 1T1GA 2MDTA 3AFHA 2P2LA 3DXYA 4ITRC 4RMIA 4C7BA 3IQZA 2FNAA 4ZV9A 1HNZB 2YHAA 4F4JA 5JAUA 3T52A 4BJ5A 4NVRA 4MR8A 1R8JA 3FCSB 1HLDA 2YJGA 5T8KC 4PXAA 2XT6A 3RSLA 2G67A 1B42A 3GBPA 3M33A 2RKOA 3I72A 3SR0A 3WRYA 1Y3BE 1GGEA 2QP3A 2G5GX 3BSYA 3G2NA 3OTOB 2HXYA 3HPRA 4D1YA 5DIZA 1ZD5A 3V8BA 4QGSA 2GD0A 2M6RA 4BP9A 5BSKA 5CK4A 5T6BA 1BE0A 1HT0A 5JC8A 1OOEA 1TF5A 2C2HA 4LMPA 2MYTA 4CKWB 1EQ2A 5FUMA 2AFIB 4CDNA 1MR3F 4MVJM 5A6SB 3QKRB 1M75A 1TC2A 1JG2A 1FP2A 1U04A 3LCUA 2O14A 3CXRA 4DABA 2FSIA 1OIVA 1UMDA 4R3UC 4TWJA 5CLJA 4YRNA 3HJHA 3KSBC 1U0GA 2IV7A 4EW2A 1CQWA 5C3MA 4D82A 1NXPA 1I6KA 4J94A 1GZVA 1YJ5A 4ARUA 1J09A 1U2DA 1Z6TA 3AEQA 3C3BA 3LCMA 3PF8A 4J91A 2VOJA 1CY7A 1KJ9A 4ND8B 4WLEA 4TYWA 5BV2P 3QLTA 2CNLA 3IUYA 1ANKA 2BHLA 2ZE6A 4DIKA 2GASA 3TRJA 3FX2A 4LNHA 1U6IA 2X3UA 1WCXA 3AR7A 3IMEA 5B1YA 1ZD8A 4DLVA 3R4VA 4FS8A 3GUZA 1QHXA 3JQFC 3TINA 2Z9DA 5IEJA 1W0CA 2P0AA 1Z5ZA 2H57A 2O2JA 5JH7F 4M1TA 4TQUS 4TTVA 4B2PA 3LLCA 3CZMA 3LY5A 2COUA 3R2JA 4GUAA 3RT7A 2I91A 3PNLA 5CM2Z 3CSDA 3RC9A 3ND8A 3TMAA 4N0PA 1YVUA 2JCYA 2P11A 3IT3A 4JC8A 2FPKA 4GWKA 4MP8A 2AYYA 1SUDA 2G70A 1WP4A 3FWZA 1D2AA 1UM9A 1YI0A 4IDPA 4O4IF 1KRWA 1PZXA 3FOZA 3PPVA 4CI0B 1CZNA 3NWJA 3UBMA 3I9OA 3IMGA 4MR9A 2GETA 2D2FA 3O4GA 4JNCA 5K1ZA 4K87A 1USWA 2Y1EA 1KFBB 1GPUA 3SHQA 1U5BA 4KQIA 1YZQA 2PXCA 2QTVA 2CUTA 1F2TB 5F21A 4EF5A 3A1VA 4JITA 2R79A 4LRQA 1EJ2A 3P2KA 1E2HA 1IXSB 3WHIA 3SI7A 3CVVA 2B4KA 2BM9A 4MULA 2I29A 5H4GA 1NBME 2VRNA 2WWTA 3TLYA 3ZE6A 3U9SA 1OFUA 3R8XA 4BC0A 4GDFA 1TRHA 3GB9A 2W00A 3CMMA 1Q3HA 3H04A 3T1YB 2NIPA 1M7BA 3ZKAA 4WL0A 5E1BA 4JI5B 4BO9A 1Q2UA 3JX9A 3TR6A 5JSFA 3RG2A 2NQTA 3PIIA 2W2LD 3U49A 1JKXA 1JTFA 3Q12A 5DGCA 3M49A 1NSFA 4IOMA 4ZT5A 2V5AA 4DG8A 3HWWA 3KHTA 4HH1A 5EJGA 3H5TA 3HKDB 4YAJA 2WU8A 2QW0X 2YWHA 3BRWD 3BKWA 4G09A 2YOFA 4IRUB 2AQ8A 4EKDA 4NHEA 3ZXUB 4L7VA 1RPAA 5IT0A 2ODPA 1QH1A 2QRQA 4O3FA 1IMJA 1L1EA 4OLHA 4F1WA 1MFPA 3A2MA 3K8ZA 3EXG1 4M53A 1D1QA 2ZUVA 4XASA 3SS7X 3QFSA 4LJRA 4HDOB 5JAZA 1TQ8A 3BIWA 1ISPA 5B64A 4H4EA 1C29B 3GG2A 1VP3A 4D9GA 3H87A 4WY5A 4Z9FA 3GZNA 3LDAA 2PSJA 4ZYZA 2XIJA 2VP2A 3KKKA 5JNVA 2HIMA 1MC8A 2C2BA 4B6JA 2OCKA 2R65A 1R9NA 3INRA 1G291 3BZBA 5JFOA 2PH1A 3ROZA 1MAHA 3VR3A 3OX3A 1K97A 4N3AA 4AJKA 2F59A 5M2QA 1KC3A 3CLKA 1QZXA 5H5JA 1Z16A 1YOBA 3AHFA 2ZQYA 3U44A 2XWJI 2GHRA 5EHQA 4NS4A 3DYVA 4BAZA 4CDRA 3VHQA 4U2FA 1SO8A 3HKBB 3FCUB 4WDRA 5AM5A 1V1JA 4QFDA 1HE3A 3SLGA 4QSMA 5K3DA 4BO5A 1WMBA 2WWXA 4UW9A 3PS9A 2P5YA 4PTLA 3QF4B 2OO5C 4FDUA 2R97A 4HB4A 4QU5A 1BGXT 2W0MA 1TU4A 2O3JA 3IODA 2XYHA 4MV1A 3BE6A 1UXGA 4J3NA 3WMGA 4EO9A 5IJZA 4XX0A 2RC5A 2BGMA 5FUQA 1PR3A 2C54A 4G4JA 2R0QC 4PQFA 5D5PA 4F7DA 1XEFA 2IYSA 3WB2A 3UXEA 2I5PO 4FR5A 5LYJF 3DFKA 4WVFA 2I4IA 3MPOA 1KE2A 1X8KA 3CWCA 5U4XA 2XJ9A 4XYGA 1Z8HA 1ODFA 2PSFA 2WT9A 5DF1A 1C9NA 4DOMA 1T36A 5EGNA 4CNBA 2IH4A 2ZXEA 2JARA 3D6JA 3UB2A 4KQ6A 3RUFA 1Y6GA 3HJUA 3EODA 5FJJA 2ZZKA 3BH7A 1DC5A 2ASEA 1E2NA 2H18A 2V5VA 3CRVA 2IJGX 3KVYA 4FLFA 2YFYA 2JCVA 3BB3A 4LG1A 4V02A 3F6RA 3T38A 1W30A 1Z2PX 2IIQA 2W2QA 1HZZC 3JYHA 3P9SA 4MI3A 4R31A 2SCUA 3T5TA 2FPGA 3RASA 2WC1A 1AN9A 3HB7A 2HGZA 1BA2A 3QPDA 4YT2A 5BUZA 2G80A 1U6JA 3EVNA 1H2ZA 3E3AA 4B8YA 2JDID 2NZXA 3FETA 5DBGA 1E96A 1R15A 1NQUA 2I54A 2QD1A 4DMRA 2OHVA 1NXXA 3RF6A 2NVBA 4HXEB 3N2GB 4GBED 1JWAB 1VJRA 4YQEA 5ESWA 1EP2B 5C0OE 3QE0A 4E2YA 4EI9A 5FT9A 4YJGB 2XLBA 3TQRA 1ST2A 1XA4A 2QR3A 3AFNA 4M1YA 1F8UA 2QRPA 3GLHB 2W70A 4YJ2A 1FJ2A 1ZAKA 2EBUA 3MMZA 5L3RA 3AL0C 4BX3A 1DJPA 1JHVA 3WGTA 1XRLA 3ZCVA 3WICA 3OA2A 1TA9A 1E9RA 4HV4A 2PA3A 3I8OA 1OF1A 4Y2TA 1AGXA 4B8ZA 1TZKA 2BRUA 3KQUA 3AJEA 1ZRMA 2W8BB 3HB1A 1EE1A 1RBYA 4ZVPA 5EQDA 3L7IA 4ZWNA 4OUDA 5TNXA 5LPNA 2DWUA 4DDVA 4AD8A 2R6HA 5J4LA 1YDGA 1MORA 1RI5A 1JKMA 3HCEA 4LEIA 2QMHA 4LW8A 1QH8B 5J5CA 4F06A 5BWLA 4HQ0A 4BV8A 3RJ9A 3SQOA 1JDVA 2PD6A 2GCPA 2F3PA 4IX9A 2EQBA 1GUAA 3MCTA 3PI6A 3ITNA 4GZLA 1HFKA 4FKZA 4I2NA 2GSDA 1HEIA 4YBRA 5KYKA 5FNVF 2RGXA 2VHJA 3IVXA 2L17A 3Q15C 5L6LB 1T1SA 2JI4A 4CNQA 1XDGA 3JTMA 1Q95A 3JQAD 3OESA 4FBGA 4N5DA 3ILYA 2CEKA 1PGOA 3VPGA 2VDJA 2Z43A 4IZHA 4P4UA 4OJYA 4BNXA 2AQIA 5CNMA 4YK7A 2FSFA 1OXTA 1TTHA 2VZ8A 4KWIA 5EXDA 2JLUA 5DX8A 5JFTA 3OE1A 2V8BA 3IEPA 4GPAA 3BXPA 2B4RO 2IYYA 1ZNQO 3AL3A 5C8YA 3EC1A 1C0KA 4MWOA 2HCTA 2JB9A 1YCFA 4ZCRA 5A2QA 1HM5A 1VKZA 2F3RA 3AJ8A 4E5DA 2HH9A 5LZ5A 3CNHA 4RD4A 1U7HA 2X2OA 3KTAA 4K9DA 2W6ZA 1Z45A 3EVFA 4FWIB 3PNPA 5C8ZA 2Z5VA 2F8LA 1KVSA 1T4CB 1OGIA 1J0XO 3EE6A 4RDCA 4C5CA 1RYZA 1V7QA 5TJ9A 3FI9A 2NUTA 4C6TA 4CVNA 1U80A 2I7TA 4KV9A 5HRAA 4RV4A 2FQ1A 4DE5A 5KNBA 1YZHA 3KZMA 3SXPA 2J0EA 1KFJB 1W4BA 1WVGA 2PYDA 3RBAA 1U0TA 1ECPA 3HE3A 2C9BA 3IDFA 3SQLA 1NXVA 4HB2A 2BCJQ 1NVGA 2QEQA 3GRZA 2IF0A 2ZCUA 3I5XA 4BWVA 2QX4A 1LDNA 4DG5A 5DH9A 2XWPA 2JA2A 1GR0A 3CNLA 2X22A 3DGEC 3MTEA 1G2PA 3EZNA 2RHWA 1SZJG 3NHPA 1OX6A 4UAJA 5IC5A 4KPUB 3UB4A 2C4TA 2OZEA 3COPA 1KAHA 4PHHA 4F3CA 1RXUA 2NTNA 3G5LA 4OL0A 5LNK1 5ADHA 3ZUGA 3P0FA 3UC5A 4DA6A 2REQB 1L5VA 1T2DA 1UOEA 2V6GA 3QLEA 4RD0A 1P7ZA 4BQPA 1KORA 2CMKA 4TVOA 4MNTA 5KNCH 4NDAA 4Y9SA 2DF8A 3MTJA 4P5EA 1GL7A 3FGZA 1AO0A 4FM9A 2HMAA 2AZMA 4EYKA 4OJTA 1EUDA 2ONJA 2I6XA 3F6PA 3KTDA 3VZSA 5H3CA 1L5RA 5E1MA 3L6OO 1SBNE 2D2VA 1WCYA 2Q3LA 3WL6A 1IFXA 4P4SB 5K4AA 2N46A 1A2KC 1RE0A 3I04A 2E5WA 1M1YA 3AKYA 5HDQA 1MZPA 1R2QA 1MJHA 4MW4A 3K0CA 4Q4CA 1Y4AE 1QZ3A 5CDSA 2QM7A 2RGCA 1J49A 4GX1A 1OVGA 4UZFA 1YTLA 5DIFA 3TVDA 3PV0A 3ZN2A 4WCFB 4AN1A 1VHDA 3N9IA 4ZOEA 2IEDA 5GWXA 2QRMA 2Z4TA 2CL6X 5AJTA 4U7JA 1ABEA 2HXSA 4FX5A 2R44A 4Y2SA 5CDGA 4RIIA 1W29A 3JYQA 5CB4F 4G0VA 3PQEA 1HNWB 3BSWA 4RPIA 2I6TA 1H4QA 4MWBA 2O8DB 4B33A 5TMBA 2B1JA 1ZIXA 3R44A 3S2IA 1T26A 1PHPA 1WETA 2BFBA 3UANA 4JJAA 3RS2A 5L3SB 3FG9A 3HV2A 2IPOA 1VE3A 3F3SA 5HKKD 4LI0A 4AJLA 4CM8B 2O8BA 2J33A 2ID9A 2IWHA 3MZ0A 3IRVA 1GU1A 4FGWA 2FHPA 4P3XA 4P80A 2DH6A 3FOEC 1U28C 3AF3A 9LDBA 3PJDA 3BD8A 2GVNA 1N1EA 2R8EA 3KYDB 3LUGA 3I6IA 1CUEA 1FBNA 2Z4SA 4ZHQA 2WJVA 1W8DA 1AF4A 1W96A 3GLGB 1EXDA 4OP2A 5LDHA 1F6BA 1H5NA 1JPVA 5IFLA 2I4OA 3OOJA 4Q1VA 4TSFD 3VDMA 3K1AB 4KODA 3K0FA 3QVTA 4HDMA 4URZR 1Y9EA 5FQOA 3H0KA 2BZGA 2GKSA 5ARDA 3U13A 2CCJA 3ZXIA 2BH2A 2XNHA 1W94A 4BB0A 4FFVA 3T9DA 2OSVA 1GRNA 2C9OA 4LJ5A 3H7AA 3CRMA 2Z56A 3GJYA 4HDRB 4NYIQ 5FH9A 2CVPA 1E1LA 4G2NA 1DAOA 3OCJA 3AJ9A 3PWZA 1AN0A 1TI7A 3DPSA 3NEYA 4HAWA 4OREX 5EUBA 3GMIA 3ACDA 4UPEA 2ICAA 5JVDB 2DYKA 4ARVA 4K6CA 4AMZA 2ZUFA 2A5JA 2FMUA 4DQUA 2EZ4A 5EHXA 5B3LA 3N28A 2CFOA 4RA9B 4C0AC 2YUIA 3VI4B 2YJ3A 3KVOA 2C84A 2GPWA 3SVLA 2ORED 2ODBA 2YC2C 1P6QA 3BFXA 1EVLA 3D31A 1BKDR 4AYTA 1G19A 5DGIA 1VL8A 2GXUA 2GI4A 1IOLA 4FJ0A 1B1AA 1CR0A 2BLLA 2QG4A 2V9CA 4NOLA 2CXSA 4QVGA 2JI8A 4TTAA 1U0BB 2YFKA 3FYSA 3LCCA 4FSHA 2RGWA 5JNUA 1RXVA 4QOEA 3ZIAA 4A91A 3V4FA 2QRVA 2Z83A 5EMLA 3F1LA 1G20B 4XWYA 5CA1B 4CTMA 4PX2A 3FHCB 2I22A 1D1PA 1XCOA 3L41A 3LRPA 5AQEA 3VYUB 4QDOA 4WN9B 2JGMA 4Z49A 2CV1A 4WZBB 5ENVA 1WWKA 1UFQA 2YZKA 1J8FA 3K15A 2FWRA 4UVHA 2AHRA 3NIFB 3ZWCA 3K9BA 3IKTA 1MCZA 4JP2A 2VWPA 2GAOA 1AURA 2N42A 3G0BA 2V59A 3RU2A 1A4UA 5DP1A 1XPOA 4B40A 4J0HA 4GD3Q 2JVIA 4LUCA 1VBMA 4URFA 4CMHA 1M34B 1RT9A 2QQFA 3DW1X 4CCWA 2A30A 4MV8A 5LOVF 3CUUA 1FFDA 4FCWA 2PIAA 2Y0PA 4WX2B 1ZD2P 3QEKA 4NYMQ 3VDXA 1YI8A 3JWPA 5AW7A 5CT4A 2GAJA 4Q7EA 3L0SA 4WV3A 1N8KA 3AXSA 5K6AA 4II7A 1X7WA 4D5EA 2QPAA 5EE0A 1U0NA 1QX4A 3EWIA 3O93A 3R3YA 3WYNA 3CE6A 1E5LA 2A78A 1SUIA 4Y6LA 2GN2A 2W6NA 4K9KA 1G21A 2DSTA 2C2KA 2QUBA 4N7BA 2VT6A 3WYAA 4AXXA 2J5BA 1A9ZA 5KQMA 3URMA 2F6RA 2QNIA 5LB2A 5A3JA 1TDJA 2Y76A 4M9ZA 3CPSA 4W9NC 5FEMA 2DAPA 3FTDA 4NV0A 3DZCA 5CA0B 3HR7A 3HUFA 2A67A 4UEQA 1THTA 4GX5A 5E7MA 4CIWA 2I3BA 3GFVA 1VJ0A 4D6YA 4FU0A 1W48A 3V3TA 4L4UA 1NR5A 2NO5A 2P6RA 2XMSA 3GRCA 4BUZA 3H0EA 1DBRA 4Q6WA 2VJLA 4E09A 3VOSA 4RTKA 1EWTA 5EMKA 4DY6A 3LW8A 3ZWMA 1KPHA 1K3TA 2C98A 2OBYA 4MV9A 4CLRA 1XHFA 4TT3A 2RHBA 4H1UA 5EMJA 3EGOA 1TM4E 3LLSA 1E1NA 2EEZA 3DE5X 3Q2KA 1EP9A 1YI1A 1YNSA 1P8JA 4RAOA 3Q98A 2QTWB 3NEJA 4WPGA 3WFZA 4CMEC 1TIKA 4BBZA 3RIMA 2BE9A 1LPMA 1ZGZA 2H4FA 2CVHA 1RZUA 3FIUA 1YHNA 3JRNA 3KS9A 3OF3A 4OJNA 3WNVA 2IYRA 1NQXA 2PE5A 4A8JB 3L3BA 4EAAA 3PJRA 1PUXA 1HDRA 1PGPA 1E77A 3AGPA 2FEOA 3FCYA 4KK4A 2BSQA 2PVPA 2C95A 4O1IA 1G7TA 4DARA 1KTIA 3L8EA 2G4VA 3E8MA 3NG1A 1PW7A 1FE8A 1NQWA 3HR4A 2YFQA 3DWIA 4K28A 2LV8A 1NY6A 3F5DA 4P7FA 4LJSA 1ZOLA 1UC5B 4TM8A 4DYHA 2DQ4A 1QRDA 1TZJA 2NYVA 1XTPA 5HP4A 1ETUA 4GICA 1HDZA 3CKLA 1FU4A 4HFMA 3ZTYA 1N3IA 4JOCA 4AKEA 2O8FB 2P79A 4OSEA 3X2FA 3FOWA 3BL6A 5EEGA 3IL2A 4UUBA 1P45A 2N1MA 5F2EA 3TLBA 2VLBA 2VH5R 2E2WA 3HUDA 4MX8A 4DADA 3OBBA 1CUHA 2NU6A 3BMCA 1JBKA 4EJ0A 5JROA 1SZPA 2JGEA 5CDFE 2V96A 5GMOA 1JAZA 2QROA 2ZJFA 3RQSA 5HX7A 3BGWA 4AJ4A 1KOFA 1RHMA 2IV2X 3AR9A 3EMDA 4TXMA 1G6HA 1SY7A 3DBLB 3ZDQA 5H3LA 4OXRA 1EQAA 4MV7A 4RVFA 2HUPA 4DQDA 5MHTA 3ZW8A 1N57A 1P9RA 3UV6A 3Q6IA 1VIVA 2CE2X 5HTKA 4F8YA 4O1MA 4P36A 4NAVA 3UOGA 4HYEA 3RWMB 2XE8A 4Y30A 3F6YA 4EGQA 1UKYA 3CJQA 5EAIA 1BCSB 4FFLA 1T1EA 3EPJA 4ECAA 2QT1A 3G0DA 3GGDA 4C7VA 3AVXA 4UOQA 3BB4A 1N2SA 3G2MA 2NV6A 1A8PA 5JS6A 4QOGA 2QJOA 3BC1A 4WNYA 1K86A 3JVVA 4YCSA 5H9WA 2WK1A 4JVLA 1LA2A 2X0DA 4B82A 2HPVA 3G7NA 3PDIA 5DYIA 1EX7A 1IY8A 2WR8A 3D8SA 1ZHFA 1O95A 3ND7A 3PGVA 4MJLA 3KCNA 2ZRLA 3H3XA 1SU4A 1BU8A 2J3HA 4J43A 1YU9A 3N7AA 5G53C 1ONSA 3TW4A 2PWPA 2JLQA 1HDGO 4DVGA 1RLIA 2CFCA 1GA4A 3W6PA 2ONYA 3QI7A 3BIOA 1P7PA 3GLTA 4A6DA 2NVWA 1VLQA 1W47A 1AB5A 3AFIA 3MT7A 4NC9A 3R7AA 4Q93A 2VYNA 2IHZA 2X6RA 3FCCA 3VU8A 4AS3A 5CCEA 3P9XA 5CT9A 5YASA 4I99A 1C4KA 2CT8A 4BXOB 2BM0A 1UZAA 5E6SA 1R0YA 1U7DA 1YNOA 4AG6A 3A6KA 4C4TA 5BWOA 4RY2A 5H81A 1RQGA 2IIPA 2UYQA 2IP1A 4EI2A 4BVGA 1KI9A 1RMYA 3HH8A 4REQB 5B2ZA 4DMCA 3HY6A 3ND5A 1QB7A 3QVMA 4DA7A 3H86A 3SKXA 2PQMA 3N2NA 5H4HA 1EX9A 3BIXA 4PYNA 4ZD6A 4RXUA 4HUTA 1E2QA 3MINB 4GPBA 3QVXA 1JMKC 2C8VA 4FD2A 4YEDA 1F14A 2ZTHA 4BNTA 3SGLA 3LC7O 1N6RA 3RFFA 2NSHA 1GQRA 2CBZA 4F04A 4H7HA 5JASA 1L8QA 4HNGA 1A76A 4MWEA 5ERXA 4C9BA 3WHKA 2IXFA 3ENKA 3FR7A 4QUBA 5CPBA 1J1ZA 1GGKA 2WHPA 2UVDA 3A9CA 5AW5A 3SAJA 3D8RA 5L51A 3QJ5A 1ZH8A 1U7UA 3MAGA 5JPIA 3TX2A 1SOUA 4F1JA 1T9HA 3TQOA 4GPZA 5EKUA 4F96A 4IDFA 3D0RA 3RK4A 1JEAA 3P5BA 2D0OB 1ZC3A 4NE2A 4EW6A 2O3RA 4ZT7A 2I7XA 3ZCPA 4C2UA 2O1EA 2AE1A 2BEWB 1DXHA 4R7GA 1U8ZA 4IVRA 3KJNA 4JUDX 3ANLA 3B5IA 1L7AA 3B9PA 1RJEA 5FHRA 4L50A 2AOTB 3SF8A 3ZWDA 2EKDA 3AETA 3JPYA 4GP7A 4JBLA 1POWA 1RJWA 1XWWA 1Z08A 2NWQA 2QUHA 3JU3A 3AJDA 1B0ZA 1LPBB 1OD6A 1N0HA 1BRTA 3HU2A 4PZ9A 3TAUA 5KSYA 2IITA 3TRKA 4OB7A 5BN5A 3IEUA 4KNYA 1U1FA 3FVTA 2E48A 4NMWA 1B8PA 3S2UA 2Q1YA 3H5AA 4KBFA 4RSRA 4YAWA 1WOYA 3NHYA 2BUBA 5ICEA 4JOQA 1QIGA 3O0DA 10MHA 4IZIA 1LWOA 2VZ0A 4HGRA 3ZWNA 1LPOA 3OUTA 4X44A 4RVDA 5CH8A 5IX8A 4J6EA 4FEYA 1YR1A 1RWMA 2FPPA 3OIFA 4IOLA 1JLSA 4U2BA 2BFDB 1N8SA 1GZ4A 3X2SA 2P3LA 1T9GR 2VG8A 2BUCA 3I0NA 4JR2A 5CMLA 4ZVOA 4I3HA 2NVUA 4YIHA 3ZVNA 4JEMA 3HXOA 3OX1A 3AF6A 3OJLA 2O3QA 3O0TA 2QPOA 1R9JA 4BFUA 4LRUA 1DEXA 1BW9B 1M1YE 2BFCB 2DM6A 2P67A 2AYXA 3TOCA 3V2UA 4ZO8A 1DCTA 4MDHA 5P21A 1MAUA 2VEDA 2ATXA 3D3EA 2GJ4A 5T4FA 4CM9D 2XMCA 3ZWVA 1E5TA 5A4AA 4TMXA 3MS7A 1F9AA 1AD2A 1VCOA 4EOGA 4WFKA 3UBTA 2XYVA 2YMMA 4FFNA 2PHZA 2WFZA 4DC1A 1K5DA 3TIFA 3SYTA 5BQFA 5CDHA 1PF7E 5EWMA 4M54A 3T9FA 4EGFA 3LQ1A 2CLCX 1XDWA 2FZ5A 2II6A 1S3IA 3AUSA 3DMDA 4P3NA 4NYJQ 5E8RA 3CZ9A 1QG4A 1IIRA 5DP2A 3AF2A 4C88A 4ER0A 1XWIA 5L95A 2XGOA 4GE0A 3IA2A 5AO9A 3TD2A 4QBTA 1XWFA 4DRZA 3LD9A 4XUDA 2RHRA 5KKCA 1TVMA 3HJBA 3RU3A 1RAEA 3D7SA 3JAWA 5ELMA 1AQ6A 5KYXB 2NO0A 2D1TA 2ZROA 2EYUA 4KXVA 4B2IA 4Q3AA 3OHSX 5BSEA 1LXCA 2W83A 2X8JA 1DE0A 4XVRA 2AZTA 3CZ5A 3TDNA 1PR6A 1PS9A 1ZIYA 3HYTA 1NONA 1KOJA 5ALTA 5EP2A 5HE8A 1JI0A 1X1TA 1FFCA 4EG6A 4NLLA 1N7HA 2GYUA 1A9YA 4L72A 2OLKA 3CUVA 3FPSA 4L0DA 5EERA 3PHBE 3VHXB 3WXMA 4BTEA 1I4OA 4DA9A 1S5PA 5A6VA 3U5ZB 13PKA 1NJFA 1Y4ZA 4Q4HA 3O75A 5DGXA 3A2KA 4FWBA 3VJMA 2YR0A 4BVLA 3OEYA 2PFSA 2WHXA 2HADA 3OZDA 4FUTA 4YWHA 4WE3A 1OT5A 3SE7A 3LT4A 2ZWAA 3ONFA 4G5FA 1B1CA 2Y0CA 1S2IA 1PQ4A 2BUAA 3BWEA 4FX2A 1JEDA 1JS1X 1UZNA 2HEGA 4U6QA 1ZEJA 3FMOB 3VXKA 1X9HA 4FE4A 5AVQA 4W5RA 1Q20A 2FPIA 4MPTA 3BX1A 3QOWA 3SICE 4RTPA 4QPCA 1D1TA 4HYYA 1FX0A 2EEPA 3PPXA 3NT2A 1KIMA 3NNNA 3LHKA 4QNNA 3H9GA 1FQWA 3E4DA 3L8DA 3JVEA 1MRSA 4U8GA 3V7YA 3ZDBA 4N03A 2IU4A 1SURA 2OWDA 5EA2A 1V96A 3I9LA 1ZY2A 4UM8B 3P2OA 3VKVA 4KHZA 4E6PA 1HT2E 1X7YA 2J85A 3EG9A 5B1SA 2GN6A 1JQBA 4OAOA 3PQ8A 4PLHA 4MAAA 5TPZD 4TXJA 4QXMA 3DW3X 1W76A 3LHFA 1P1CA 3OPMA 1U0SY 4QG7A 3KVRA 1OZHA 4S04A 1ZMRA 2ZI7A 3FDJA 4IIUA 3H8SA 2EXXA 4QXRA 1YB1A 4IQGA 2PUDA 3CF4A 3KLBA 1SKYE 1ZZEA 4N82A 2PUEA 4D0LB 3LZCA 1HT3A 4W5OA 3ZE8A 2IEGA 5HKOA 1FXSA 4PLWA 4HLCA 5A1JA 1QG6A 1K6MA 1MVNA 4C07A 1OFGA 3AIOA 4BMOB 4E4TA 4ZV7A 5H80A 3E15A 1EBBA 4LRWA 3A27A 3HS3A 3QXGA 4NBWA 1UF9A 1Y7PA 4JLOA 2O7QA 1FQOA 3K2BA 3NDBB 1V11B 3MF4A 1LFDB 2W2TA 5DULA 3QPCA 3MTAA 1A5ZA 2OBMA 1YJBA 1KYWA 3L9WA 1WD5A 2V45A 4AUEA 4QKQA 2ZP1A 2FFHA 1GD1O 3NEPX 1G21E 4WWHA 2B30A 5BWMA 1WEHA 3AVPA 4TWIA 3BL5A 1G60A 3U1BA 2O8CB 3LHSA 3TSYA 4O2RA 1T29A 5FOQA 1VCNA 2PTHA 4QJIA 1IDOA 3UEOA 4F5EA 1H1DA 1NNLA 4WIAA 4JS0A 2WIJA 3GVPA 3QKSB 2VXYA 4U9HS 1X0VA 4BS9A 5FL7A 4A8PA 4BN4A 3A6JA 3VO9A 1GNRA 1LNZA 2IW3A 2BBTA 5KTOA 1U94A 3LVBA 4PZLA 2DFVA 3SQWA 1JJFA 1DKPA 1H69A 2W7TA 3GOQA 4DM7A 1K66A 2EZUA 5DGDA 5IN4A 1N2EA 5DBIA 4PE5B 4F45A 4KACA 3DTVA 1PG5A 1OXVA 3W6ZA 4BO0A 4CKXA 2P65A 2PKQO 5JSUA 1EE9A 2YJZA 1HYBA 3DP7A 4KIFA 4R2WA 2BGGA 3FUWA 2FR0A 1P74A 4PSVA 1QTRA 2Y1DA 4BFLA 4CE6A 4HNSA 4BTLA 2VNSA 1V9SA 4ZMSA 3KZOA 5DHFA 3WIVA 1IM8A 3UMFA 4D4JA 3KSMA 4O4LB 4POOA 4ALMA 1VRCA 1O2DA 3TJZA 3E9EA 3WKDA 1JHMA 3O8QB 3QVLA 3RUIA 1REQB 3S1AB 4J7CA 2Z5GA 3FNIA 3FRJA 3QPUA 3IOMA 3OZTA 4F93B 3R8FA 3O4FA 1EUQA 1ZGCA 1LSOA 4IUBS 4AICA 4HDSA 5BW5A 3L5KA 4IW3B 1KERA 3HZRA 4YR7A 4IRMA 3I32A 4UJ5A 1RP7A 3WRWA 4J4HA 4V2IA 3UHAA 3RIGA 1Y37A 1LDMA 3ZGNA 5EKXA 2QX6A 3LAWA 5FD8A 4RHCA 1DEAA 4KI0A 5CG1A 1DKOA 3A10A 3ND6A 3AG6A 3L93A 4PV7A 3I42A 5F12A 3LWZA 1ARZA 4AUKA 1PJQA 5LZ8A 1X42A 3RD5A 1NHGA 1RZ3A 3KE9A 1IRIA 3Q41A 4US2R 1QMPA 3TVTA 3HP1A 2WD9A 5FDFA 2REXB 1QAMA 1EGAA 3RYIA 4BMVA 3F8SA 1GDTA 2PV0A 5BYAA 1I7SB 2OQRA 1AY0A 2HLDA 4YRDA 1XLTA 4EHJA 1RPTA 1AOXA 3A1DA 4BNUA 2EOAA 3NJRA 3ZQ6A 3FF1A 1SELA 1W19A 2NSLA 5LLDA 3TM4A 5HMMA 4GX2A 3CVUA 3RODA 4M83A 4QELA 3CCCA 4PYOA 4UHBA 5CFMA 1Q7TA 1XDDA 1I2DA 1XFAA 2BIFA 3II6X 5EQTA 3WMFA 4EHAA 4EQ6A 5AVYA 3G2PA 1Y3AA 4BCBA 2SNIE 5JEDA 1DT3A 1XYYA 2O6LA 2IUYA 4F1KA 1KQFA 5BQ5A 3BDIA 5THKA 1N5JA 3NIWA 3THYB 1NJ1A 4HDKA 4S05A 2VHCA 3PXBA 4HTFA 4PFJA 1M0EA 3IMCA 1EA7A 2XZDA 3DTNA 4YP5A 1ENZA 3PIRA 1L4BA 4M0LA 3VPHA 4YRMA 9ABPA 3A31A 3O8OB 2Q5CA 4D9BA 2W93A 2IPNA 5HQ3A 5CGZA 1U1CA 2C82A 2BPOA 4YJ3A 4U2CA 1BWRA 1WQ4A 3GARA 5AYVA 5ITZA 1NR1A 1R37A 4CIBA 2ECPA 3KUDA 1YJAA 2ZKLA 3AUKA 1ZKMA 1T8SA 1GUDA 2QD4A 4B3TB 5I47A 4RD6A 1YH3A 2N3ZA 4CM4A 4ZDWA 2EHDA 3R3UA 2HCFA 4NEQA 4QBHA 5K3BA 3EY4A 3DUFA 3P2JA 4DIMA 2BWJA 5EEHA 5IYZA 2C94A 5F3RA 2NAFA 1FYXA 3MCVA 1E8MA 3G59A 2BEUA 2OOKA 4RF5A 3EZFA 5J9FA 2EBHX 1OCEA 4Q1CA 3M81A 1XJ0A 3FHLA 3PNBA 2PSDA 3EPPA 3QMMA 4FGSA 4IXDA 2J5RA 1FU8A 2C31A 4L8LA 3VU1A 1KDOA 3FWYA 4JYMA 5ALSA 4AAYA 3GUCA 3OQHA 1Y0BA 4HFNA 4NDZA 3TDMA 4EDFA 1NQOA 1WABA 6REQB 5FBVB 4L8VA 4EHKA 1IEQA 4P2GA 2PFGA 3AR8A 1L5HA 1VPEA 5FBZA 3SDSA 1YZYA 3C6KA 2ZJYA 4C0JA 1W6UA 2Y67A 4OJMX 1E99A 3P0HA 4N8DA 3BWBA 1R0CA 1XT6A 3FPFA 1KZ6A 3M82A 2FOLA 3OUZA 4XAQA 5ALOA 2ORYA 5CNIA 5GJCA 1U99A 1UOPA 5JR3A 3KAPA 3ZXXA 4ZTUB 3AVTA 1XEXA 4ZAWA 1WQ1R 4YPVA 5K8IA 2H1SA 1PWYE 1XJCA 3K0BA 4F11A 4ZMBA 1IXYA 3QTBA 2VQ6A 2GZMA 1UOOA 5I4BA 4OHUA 2ECQA 2J08A 4GGOA 4CKBA 4BO1A 3EA5A 3GT3A 3R40A 2CN1A 1LW7A 4E2WA 4ND3A 4AQDA 5D3MB 4AYWA 5A02A 2HF2A 4V1CA 2WB2A 4AK9A 5KYYB 3GMTA 2HT6A 2A0WA 3D4PA 3MWEB 3AZPA 2FP4A 3BFPA 4PZEA 3N7UA 3WBJA 1JJ7A 1DSSG 3JR7A 3SFVA 3WWZA 1SHJA 1ZXBA 1CRZA 2OCDA 4YAUA 3NIGB 1YBAA 1UXKA 1GRQA 4ZO7A 4YC7A 1ULAA 4M0DA 3QHQA 2ZJ1A 4U8HA 1M2EA 4U9UA 3R5TA 4AKTA 2JG3A 1X7DA 1JXQA 3K2IA 3AUYA 3H83A 3ZKWB 1B8NA 1ZMOA 1D03A 2OBBA 4Y2XA 3T9EA 3AINA 2A88A 1P60A 1XX6A 3AILA 3FFTA 1NIPA 3AV3A 3GCDA 4PBTA 1WSDA 3BRSA 2HBYA 3AMVA 4ZC8A 5FB3A 1YS7A 2FRXA 2FUNB 1JWBB 4TTRA 2QG9A 3DB1A 3E22A 1P62B 1DOZA 1BXRA 1P1HA 4PTZA 4ZT4A 4JEHA 4JUCA 4RTNA 1JZQA 2R2AA 1U8EA 4N1AA 3N0RA 4B75A 3ZHBA 1W0KA 1R27A 1HC7A 1U3WA 4IIYA 3HFRA 1PT8A 1COWA 3GP3A 2FR1A 2I76A 3V3KA 2WYVA 5JS2A 1RAGA 3F8TA 4LMBA 3TW0A 2QMYA 3STWA 4WKPA 2OUIA 1YXMA 1WVIA 3AEZA 2ZQ5A 3NORA 4XUCA 1KVUA 1PEKE 3BWDD 2UUOA 2PX4A 4TL7A 4MUAA 1L4UA 3TSWA 1EFVA 3RC3A 3V46A 2Q4DA 2VDNB 1QAQA 2QTBA 2YC4C 2ZDGA 1GTZA 3E81A 4DUGA 3IVRA 3U7EB 2SKEA 1O97D 3QVKA 4HO1X 4JBWA 4DJTA 4HR7A 5EJFA 1YT5A 1RWQA 2X86A 2AOWA 4CR7A 3DZDA 5IKEA 1DX4A 3CNOA 3I4FA 3IYLW 3V8MA 1FRFS 3UF0A 1VKOA 5BQ3A 1OGJA 1VJTA 2AC7A 2BHNA 4FS3A 4Q7KA 4A73A 2OMKA 4JXXA 4B3BA 1H3FA 4UAGA 5FA5A 5JUWA 1B73A 2QHXA 2QM8A 1Y33E 1RBQA 4H60A 1E2IA 1Z7GA 2FB9A 4JQOA 3T1VA 1F38A 1P44A 1QGOA 3OWXA 4DLKA 2QXUA 4X66B 2O4CA 4NE7A 4O5OA 2HPHA 2LZ0A 1T0PA 2CDRA 2ZIUB 4IDDA 4PBRA 3SJAA 2GPBA 3GEGA 5I3CA 5AOVA 5K45A 2QAGA 1GGNA 1QGAA 2Z6UA 1MC5A 2GEFA 4L9WA 1THGA 3FSGA 1WMSA 4IVQA 1C8KA 4TMZA 5FNZA 1Y8QB 2RGRA 3ID6C 4NH0A 2COKA 3W8EA 1V8BA 1E9BA 4LXIA 3H2SA 4RZ2A 4HH3C 3VZDA 1T6BY 2YV4A 2ZUBA 3OO0A 3EXIB 1RWPA 4IIGA 1KQGA 1PEDA 3KZNA 2GH1A 4KQGA 3ZG6A 3FZYA 4NZ9A 3K73O 3F90A 3QWBA 4PR0A 3EPLA 2YN4A 2IHBA 3ZDDA 1LDGA 4KAJA 3C6QA 4QVIA 3DOIA 3G3EA 1K7EB 3I2YX 4JWTA 5HSGA 4X1IA 4HB3A 4MHSA 1SD2A 1KOGA 4DLBA 1YACA 1O94A 2B25A 2XNDD 2WAXA 3R0JA 3UTDA 1UWKA 4EJ6A 1YJ8A 3OIUA 4U5XA 5TF4A 2BSAA 1MB3A 5JJKA 1XKQA 1NE7A 3C5HA 3EIOA 2GTIA 2ZRHA 4K7JA 3BTOA 1WS6A 3BXFA 3Q8XB 4YJ2F 1YE3A 2R4UA 1M2HA 1PJ8A 5HTOA 1W49A 4GXNA 1GN9A 4I4CA 5CCXA 2O2XA 5DI3A 5EIHA 2ERCA 3OKCA 2QZZA 1CQIA 1JG3A 3I3OA 2WAMA 4G0YA 4IINA 1DRVA 1SHZA 1I5RA 2EZ9A 3CH7A 2VXCA 3IPRA 3MT9A 2E37A 2OXFA 3FKSD 4GXTA 4IUCS 2XMZA 1CZUA 3OU6A 4QQKA 2BTQA 2P2SA 1D8AA 3AOEA 3PNSA 4MQ6A 4AN4A 4EEXA 4I55B 4DPKA 2W42A 1H22A 1ZNWA 4PZZA 1I2CA 2XVZA 3QLUA 3DAHA 5AH0A 3FI0A 2BGNA 3TK1A 2B7BA 1CQXA 2P9GA 2M6SA 1G9XA 2YJNA 4DIUA 4F3YA 3C8ZA 4UNQA 2CYAA 2QV0A 3NTUA 3PU6A 3W6OA 1N2GA 2C5EA 3PG5A 2VWGA 1F4PA 4CEIB 4HNQA 4HWRA 5DSZA 3UJDA 3VU0A 4F84A 1I1NA 2X0IA 3ZUPA 3WAGA 3OA0A 3PUZA 1QYRA 3BD6A 4FNMA 3MTDA 4YCJA 3TO5A 4XGIA 4X45A 5L3QA 1NFRA 2QUIA 4RPGA 5DASA 2ZRFA 4KGXA 3NTLA 1FP4B 4K40A 5EVCA 5LJLA 1N77A 1V4VA 2CHUA 4F56A 1ELOA 1Z7WA 3UV3A 1NBAA 4FOTA 4UTOA 5FI1B 3H42B 3JAKB 3VA7A 2QGFA 1L1QA 4PX3A 1EE2A 5CLGA 2BMFA 2DC1A 1Z68A 1Q0QA 1Z7BA 2B9EA 4FKMA 3DHNA 3IP8A 5IFKA 1ZSYA 2PKRA 4R2HA 4PHFA 4J2OA 3ESZA 1CDOA 2QU8A 3DMGA 3QXJA 4TWZA 4WOPA 5C8YF 2P2NA 3L8FA 1J0DA 5IM5A 4Z7JA 1UEIA 3KB6A 1RIIA 1UFVA 1U7WA 2ID4A 3L05A 4JSTA 5FYDA 4WOKA 1O9BA 4EMUA 1CZLA 1D0SA 1X74A 1LFAA 2EP5A 2QM3A 4GS5A 3UQZA 4C04A 4F46A 5IZCA 3QJGA 5KNCD 3AZOA 2F1OA 1D0IA 1VB5A 2XYRA 4MVJI 4B85A 4EG0A 1B43A 2WIFA 3EWAA 2NM0A 3FDIA 1QQBA 4PEVA 4NXMB 1QLWA 5EOVA 1AH2A 1ZNYA 1DTSA 1TEZA 1NVVR 3G8YA 4LVCA 4MITA 3IQDB 2EJVA 2FUG6 3PRJA 5IKOA 3V4PB 1T5BA 3DVLA 3EZYA 1TCBA 3EZ6A 5CX1B 3L6BA 2YQZA 3MLEA 3VPBA 4IHAA 4KUGA 1R8QA 1U31A 4L07A 2J9YB 1W8IA 2HQRA 4CKCA 1BRMA 2WFLA 3PUHA 3QG5A 4BKQA 4MUXA 1R0XA 2ILTA 4RGVA 3PWSA 1DADA 1XRMA 2G0TA 4ERNA 1C0PA 1FLVA 2EYQA 1O96B 1SVKA 2VCYA 3KOYA 2VUSA 5D00A 2WUEA 3OTGA 2BFFB 2VSQA 3ROEA 2Q5FA 2RK4A 4K6MA 3K6SB 1J1UA 3Q9NA 1EFCA 1QHFA 3ZGVA 3RUDA 4QBGB 1N6NA 3HTXA 2FF5A 2L69A 5D3QA 1LU9A 2RK3A 2C7QA 4KCGA 3CT4A 4Y7DA 2F7SA 3MWJA 3K6RA 5I7UA 1AK2A 2B1GA 1NATA 4CPDA 3R0XA 1C7QA 1YWGO 4GOJA 1MPTA 4LIPD 1FUEA 4RHYA 4HRYA 3OWOA 4U7FA 5CH3A 3UWOA 4HQFA 2NZ8A 3HYLA 1RQ2A 5CYOA 4IQFA 3UENA 4EHBA 3COVA 1OT3A 4NV3A 4EPYA 3DE4X 4C4XA 3VH1A 3EVAA 5ICFA 2PKEA 2YWFA 4LTNA 2JAXA 1CSEE 1TF7A 3BILA 4DDTA 3P2IA 3H2YA 2VCEA 4B9AA 3CVYA 4RJLA 3ORSA 4C7OA 1QGED 3V34A 1IWBB 1ULSA 2HV8A 3UUEA 1PAUA 1KVRA 5TLSA 1XMVA 4RFSA 1FP6A 4RZHA 3UAZA 5ILGA 1IBMB 2GDJA 1IBCA 3B53X 1EUCA 3FUUA 4UTNA 1NXWA 1ZVKA 2WTNA 5IWAB 3TD9A 4ARSA 2CHEA 4PZAA 1FVXA 1UBRS 3TD6A 4ARBA 1G8KA 3EEFA 1NFFA 3S5UA 4QNRA 2VYCA 4CIXA 1IZ8A 2V54A 4RGYA 4X6LA 4ABYA 1VSBA 5DN6A 1TF2A 4RUKA 3ITDA 2J6IA 4KDEA 3VAZA 3NBZC 2JAWA 2N0SA 4LJLA 1IXRC 4D3DA 3IURA 2IXEA 5IJ9B 4E15A 4ESHA 2VCHA 3O9MA 3N5KA 4Q3CA 4P32A 1Z2CA 1I4WA 3ASZA 4UBJA 4ZHQF 2IELA 3Q0TA 4IO1A 1JVBA 3WS7A 1S7GA 1UT5A 2H4WA 3ZD9A 5BWNA 1U0JA 2JD2A 2OXEA 4KIGA 4OBXA 1R0WA 3WLQA 5GGXA 2YL2A 1T8PA 5JWHA 1NUSA 4HLNA 3GW8A 4I5EA 4ZANA 1XTTA 4CG0A 1P2SA 3WBBA 5EFZA 2OESA 1GXSA 4I36A 5FHQA 5B3AA 5G0SA 1Z7EA 2NUPB 2V9ZA 2ZXFA 1AE1A 1XJ5A 2CK3D 2EX4A 3OLCX 1ACJA 1SFRA 2IDJA 3BQ9A 3KP1A 1Q57A 2YHIB 3CZQA 5EXSA 5AXAA 3WMRA 2AI1A 2I1WA 4NMLA 3V1YA 4MHOA 5A4MS 5EPOA 4G97A 4WBNB 2ZJAA 4DEXA 4YPOA 3F3YA 4I1YA 3U4QA 4AC9A 3KQSA 5I45A 1IY1A 4ND2A 1JIJA 3JQ9C 1JT2A 3K0HA 2P9HA 3BXGA 3RSCA 3W0LB 4BBAA 2O59A 2DT5A 3SZOA 3IS3A 4DCCA 1M5TA 2EFYA 2AN4A 2B8NA 2G88A 1E6KA 2E18A 2J3KA 3AI3A 3IV7A 3TXAA 1XZLA 1ZIOA 1MXHA 4WADA 1E0SA 3HN6A 4ML3A 3FMVA 4XB1A 2CYBA 3HRHA 3L07A 3WLRA 3I1YA 4HRXA 4PFKA 1GV1A 1A1VA 3HZZA 2E55A 3GQVA 3LHIA 4CQMA 1R4NB 2QRUA 4W5HA 4BP3A 2HHHB 3O3MB 4FYIA 3T3NA 1M2WA 1RQRA 2RGNC 4MWTA 1AHPA 2CFRA 5JD6A 3LTNC 3K16A 4Z0HO 2GJKA 1AUQA 2IU6A 2I2BA 5BT8A 3EZ7A 4BB5A 2JS7A 2ZJ7A 1P2DA 4S3MA 3WI7A 4EL0A 3LX6A 3C85A 1DIRA 2V9PA 2AR7A 4HY3A 4L3WA 4NU8X 1SQFA 3QUCA 2CF5A 4MEBA 4MKFA 1OYVA 5E9QA 3D64A 5EE5B 3UJAA 2QLLA 5G0UA 1A95A 1AU9A 3T0IA 4HSEA 4GVPA 4AIRA 2O7VA 5HGJA 5TXGA 4ROTA 2DQKA 1E7MA 2ODNA 4JC5A 4NZOA 5JJBA 1Y7HA 2JGDB 3RVLA 5JXJA 1IAQA 3T7EA 4JSYA 2ZUSA 4O2LA 4KQMA 4DQLA 1KH3A 1DWOA 1YJQA 4OBWA 4H3VA 3IQFA 2C4KA 2FX3A 5E6UA 4EECA 2GXSA 2QTFA 4J8PA 4BV3A 3VHRA 4HN9A 2H00A 5JNWA 5CDUA 1DS6A 1U0LA 4YUVA 3GK3A 3OHPA 1NDUA 5JSZA 1DNPA 1P29A 5EJ8A 1T3GA 3L5OA 4URYR 4AZWA 4DZTA 5F98A 3WGUA 4DREA 4PG4A 1GV0A 3M6FA 4W4TA 1G18A 2YIJA 3JASA 3IBSA 3MS4A 3IXLA 2WTMA 2XNKA 3TLCA 1HTBA 3NBFA 1MU0A 1HE2A 2WQZA 3AEKB 2CZGA 3OOEA 4FYHA 4LYEA 5EG5A 4BN5A 1VC2A 5F7XA 3EULA 3U7IA 4BQRA 1IONA 1I7PA 3TYXA 1J1IA 4TRJA 4H1WA 3HO8A 2IS4A 2C1ZA 2R7LA 4TMFA 1UZMA 1Z0ZA 3LUCA 3U4MA 1V1MA 4H6VA 1TAHA 1M3SA 3LRXA 3WP1B 3TEMA 1YZVA 1A8UA 4YVFA 2B8EA 5LC1A 3DLHA 1Y6ZA 5CRIA 3HB4X 4J16C 2YWJA 5DOZA 2DTDA 3G8CA 3UUFA 3WGLA 2C2ZA 4YCMA 2OAP1 2Q4BA 1WBBA 2Q2NA 1GEGA 3G1WA 4R8VA 2WNHA 4A26A 3PX2A 4AUNA 3BFKA 1NLUA 1R8XA 2FMFA 3DOCA 4Y98A 1RRMA 1WV1A 4NBRA 1GARA 1UBJS 1N2IA 1QB8A 2JHFA 4NCKA 5BQXA 4WI1A 5DKFA 1TD9A 3LQ2A 3JV7A 2XVYA 2PMKA 2QNRA 3NP9A 4F72A 5KYUB 1XMIA 2IOHA 3NBMA 4GPTA 3D3WA 2D7CA 5GQSA 4Y6PA 5AXBA 3C70A 4GMGA 5WRFA 1NBEA 3N0WA 3RUEA 3QPBA 4UEKA 1A8SA 4LY0A 1J20A 2X9LA 4UQLA 3N75A 4QO7A 2HRCA 2B37A 1JKJB 1SBIA 5JMTA 3H4IA 5M7EA 1FNNA 2GUWA 2VP3A 1BD4A 3BH6A 2XEDA 3BK1A 3K4HA 4PLGA 4UZEA 2HUNA 5DTJA 5EP3A 1YIAA 3T5CA 3ZWPA 4DLAA 2X15A 2DKOA 2FW9A 3WYDA 3BTSA 3KJXA 2XB9A 2AGVA 5G0VA 4QODA 2ZM5A 5CR9A 2PT6A 5EJ4A 5A9RA 1DPFA 1PDVA 3BXXA 1KJ8A 4INPA 5A4KA 4XPIA 4DUZB 1DO0A 1S1MA 1UJNA 2C4MA 2NACA 4HZUA 5KAMA 3VVLA 1CF2O 1I6LA 3KOWA 4KIUA 4QJ5A 2WD7B