5DJ7A

S. erythraea trypsin acyl-enzyme
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
230
structure length
230
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 56
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dj7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dj7A01
2AGIX 1VR1H 3BTFE 1ZLRA 4JK6A 3RXIA 1N1LA 5A0CA 1KSNA 3TJUA 2BTCE 4JCNA 1FI8A 1UK3A 4KTUA 1FJSA 3LH3A 7LPRA 1OPHB 2QF0A 2BLQA 5T6GA 4WMFA 3O8DA 2RA3A 3RMOH 2PW8H 2VWMA 1SGEE 1CGIE 1NM6A 1YC0A 2ZFQH 3Q3XA 1O5AB 3IWMA 3SHCH 1O3CA 2W5EA 4MNXA 2QF3A 3TJNA 3OU0A 2ZCLP 2BY5X 2ZG0H 1AUJA 2BQWB 1T8MA 3T25A 4CH2B 2P16A 1C9PA 5FX6A 3TH2H 1NZQH 4YO9A 1O3BA 1TX6A 2ZECA 2ZPQA 3URCA 1QNJA 2Z3DA 3V7TA 1EB2A 3TJVA 1LHDH 1EAUA 1SR5C 1GHVH 4TPIZ 1ZMJA 4CRCA 1GMCF 5DP3A 3TK6A 1GJ4H 2OQUA 1NRNH 2ZU3A 1D6WA 1V2ST 3FZZA 3P8OA 1GG6B 4IBLH 1Y3UA 3OYPA 5ESBA 1VCPA 1TBQH 3P92A 1F0UA 1SBWA 2VIQA 1AWFH 2BD8A 3QZQA 1TMBH 1NESE 1TPPA 1HAPH 3TJOA 1FZZA 2FX6A 3UNQA 4MNVA 3PV4A 3SI3H 1DS2E 1N6YA 1JXPA 2ILNA 3RMNH 1DXWA 2J92A 1HJAC 2PKSB 4ZHMU 1YKTA 4GCHF 1X7AC 1TOMH 1AFQB 3E91A 2ZC9H 3V12A 4GHQA 1A5IA 5E0JA 4B2AA 1V2QT 3ATLA 2QN5T 1AKSB 3L3TA 3PM3A 4UDWH 1ACBE 2FS8A 2ODPA 1TX7A 3S69A 3M5LA 2NU4E 3BTDE 2HOBA 4FUGA 1RTLA 2P8OB 1XKAC 1AU8A 4RKOB 2Y6TA 1ELDE 1GBFA 7GCHG 4AFUA 1A0JA 2QA9E 4WF8A 1TPAE 1FIZA 1AQ7A 5GXPA 1INCA 1YPMH 1HV7A 2OP9A 1XM1A 3ZYDA 3MU5A 1GBBA 4CHAC 2IOTA 1Y5AT 1EXFA 2Z3EA 1GHXH 3PWBA 1A5GH 3T2NA 5TCAA 1TQ7B 1V2WT 1C2KA 1NT1A 3TNTA 3ZZAA 1U6QA 4UFEH 1JWTA 4K1EA 1NN6A 1K1IA 2VH6A 3VB4A 1G30B 2EI6A 1SB1H 3RM2H 4HZHA 3A80A 3SGBE 4HTCH 4SGBE 4NWLA 1FQ3A 3KEEA 1VITF 5EGMA 5A2MH 1MTUA 4D7FA 1T7CA 1SOZA 1AN1E 1HAIH 2LPRA 4XOJA 2C8ZB 2J9NA 2ZTXA 4AX9H 1TMUH 1SGTA 1IQNA 1ELEE 2FOAA 1ZHMA 1HB0B 1HPGA 4Y0YE 2FDAA 4Q7YA 1ELVA 3ENSB 4U2WA 6CHAB 2SNVA 3GCTG 2GCTB 2Y5GA 2BDYA 4UFGH 1NROH 4ABGA 1FDPA 1G3DA 1SMFE 2FM2A 4O3TA 3IG6B 2V0BA 4B76A 2UUYA 4R8TB 5F8TA 1GG6C 1W7XH 2SNWA 5G4BA 1LHFH 3M37A 4U32A 4DIIH 3C1KA 3MNXA 2QXIA 2FIRH 5HMAA 1QBOA 3QO6A 3UPEA 1KTTB 2H2ZA 1AE8H 4KKDA 1GPZA 4QT8C 2J2UA 5DGJA 1DUAA 2GZ9A 1AWHB 2QIQA 3ZZ6A 2A0QB 2ANWA 3KQDA 5DP7A 1ZPCA 2TPIZ 3A8CA 3SJKA 5C1UA 3FAOA 4ABAA 2PKSC 1W13U 1HIAA 1TWXB 3SORA 4XSKU 2ZKSA 1GHWH 1AFQC 3LDXH 1HDTH 4NZQA 3F6UH 1V2JT 1IAUA 3UOUA 4ZH8A 1BDAA 4H4FA 2BD7A 3LGIA 1L4DA 1UTPA 1ZRKA 2A2XH 3UR9A 4FUEA 5T6FA 3RXKA 2BVRH 4AN7A 1FY3A 3GYLB 1V2TT 2D26C 1P09A 1EPTA 3M3SA 4VGCC 2A31A 1F7ZA 2I6QA 1SGQE 2JKHA 1O2GH 3RXVA 3TITA 1PFXC 1T31A 1DOJA 2CMYA 4JMYA 1K1LA 1Z1IA 1ARCA 3MWIU 3F9HA 4GHTA 4XDEA 1SHHB 1OWIA 2F9PA 4NG9H 3OX7U 2A45B 1V2PT 2OC7A 4J2YB 5TCCA 3QN7A 3LONA 1YYY1 4FU8A 2TIOA 1FAKH 3BG4B 3GDUA 4A5TS 4F49A 1LTOA 3UOPA 2TGTA 2AYWA 4ABFA 2W3IA 2QC2A 4WWYA 1PYTC 2XC4A 1QY6A 3SGAE 2IPHA 2ZQ1A 1FPHH 1W11U 1PQ7A 2ZDAH 1FXYA 2STAE 3PLKA 4AYVB 3MNBA 1P06A 1GJBB 5C1YA 1NS3A 3U1IB 5LGOA 1ZHRA 1O3JA 4YM9A 4FU9A 3RDZA 1O5GH 3LT3A 4NGAH 1C5UA 3SU1A 1IQJA 4K8BA 1C2HA 2ANYA 1V6DA 2BVXH 3MTYA 1QL7A 1EOJA 1Z8IB 5CHAB 1C1UH 2GCTC 1G3BA 5HM9A 3UNRA 5JYIA 2OC8A 2FXRA 3A8BA 1TGSZ 3I77A 4H6SB 1WV7H 1GHZA 1CGHA 2R0KA 2Z9IA 1OYQA 1O5FH 8LPRA 4RSPA 2ZDMA 1C5NH 2QV1A 3T62A 4CBOA 1EP5A 2H5CA 4K8YA 1C1VH 1OSSA 1QA7A 3QDZB 4INKA 1J16A 3RM0H 1MQ6A 1FY1A 5B6OA 5E0GA 1V2VT 2DE8A 1YM0A 1AE5A 1EAXA 3A83A 3D62A 1O5CB 2ZGJA 3FP6E 2ZHQH 2G4UA 4AG1A 2UUKB 3RXSA 3U1JB 3KNXA 1O3NA 1BQYA 1FLEE 4MLFB 1EJMA 1V2OT 1C1PA 4IN2A 4NA9H 5DG6A 2BQ7B 2IN2A 4TYDA 3OY5U 2A1DB 4ABIA 3NKKA 2AFQB 4X2YA 1P03A 4WH6A 2F9NA 7ESTE 2ANMH 2OBOA 3Q3KA 4NIYA 5T3HA 3FANA 5E0HA 2FI3E 1MZAA 5GWZA 3G01A 1BTPA 1CA0B 1C2LA 1GBIA 1O2TA 5ABWA 2HLCA 3I29A 3SV6A 4Y8ZA 3M36A 1K1NA 1IOEA 3BG4C 3EA8A 5PTPA 1C5ZB 4GAWA 2THFB 1ANBA 1ORFA 2BYAX 1ZRBA 3FVFB 1GBAA 2PTCE 1DSUA 1QB6A 1O5EH 4JYUH 3B23B 1O2JA 1IQEA 3DHKH 1MMJN 4ZUHA 2BB4A 1MD8A 3BV9B 3ATKA 2K1QA 2ZEBA 2ZF0H 3P17H 1P8VC 1EOLA 2OC0A 5E2OA 3AASA 1LHGH 1XUFA 1E34B 1EKBB 1HXEH 2QXHA 2XBYA 3QLPH 3S9BA 1A0HB 5DP8A 2ZGCA 1DWDH 3UTUH 3MH6A 5HYOA 3MFJA 3LPRA 1O2YA 2NWNA 5BPEA 5CHAC 4FUHA 1EPTB 4JZDH 2ZFPH 2ZTYA 2FOHA 4ZROA 4E7RG 5FPYA 1WSSH 3A86A 3URDA 1LPKB 3PMHB 1C2DA 2ZU5A 2NU0E 3ATWA 1KTSB 1GBJA 1HLTH 4IN1A 1C4V2 4B2BA 4X1QU 3D49H 1A3BH 1GL1A 2CGAA 1TYNA 4ISHH 1SOTA 4DT7B 1PQAA 5GCHG 2D8WA 4CRGA 1C2FA 1QURH 1S6HA 1SPJA 2FI5E 1O3KA 2P94A 4IC6A 1HAVA 1GHBG 2XC5A 4E06H 4IMQA 1O2VA 4BAKB 5C5OA 1AKSA 1GVZA 2PKAA 3V0XA 1P2MA 1SLVB 2AEIH 3QZRA 1GBEA 1D9IA 2Y7ZA 3H5CB 3P6ZB 4R0IA 1O3IA 4U30A 3RXGA 2HRVA 3ZV8A 1CT4E 3JZ1B 2ASUB 3HK6B 4FVDA 4NZLA 1FAXA 4BTUB 1ZGIA 5EXNA 3PTBA 2HPPH 7GCHF 3W94A 1NFYA 2SGFE 3TK5A 3STIA 1HJ8A 1JIRA 1MBQA 3RXFA 1BRCE 3BIVH 4JYTA 3RMMH 4X6PA 3SV7A 2UWOA 1QA0A 5DP4A 4BAOB 2WUBA 4UFFH 2J95A 2ESTE 1BIOA 1C2JA 2FESH 3C27B 4ASHA 2C93B 1SSXA 1NTPA 1HCGA 1O30A 1ELBA 2CF9H 2D1JA 3GCHC 4XE4A 3TU7H 1DWBH 3ZVEA 1ELFA 4Y8YA 4D76A 1AZ8A 1O3LA 1ETRH 1EZUC 4D7GA 1A4WH 3L33A 2XTTB 5JPMH 2XXLA 1P2OA 2HPQH 3A7XA 1AD8H 1V2UT 2XBVA 4BAQB 2P59A 4X8TH 2VGCB 4X1NU 1QJ7B 5AFYH 4AORA 1BTWA 4A1XA 4B73A 3HK3B 1LPGB 3P70B 3GCTF 3ZV9A 1SGDE 4ZXYH 1C1OA 4UD9H 1P2NA 3GY2A 4BTIB 2HNTE 3IITA 2FZZA 1O38A 3K2UA 4NSYA 2Q6DA 1C9TA 1IHTH 3BSQA 4X6NA 1AFEH 1TNJA 1QB1A 1K1MA 1EPTC 4TY7A 2ZU4A 1ID5H 1QBNA 1IQIA 4Y7AA 1LVOA 5DO4H 4AB9A 4I8JA 1FIWA 1GBLA 1QBVH 2DE9A 1ANCA 1KXBA 3VB3A 2R3YA 2ZHFH 1D3TB 1H1BA 1Y3VA 5EPYA 1Q31A 3SQEE 1O33A 1YPGH 1WOFA 4YESB 2BXTH 2Z3CA 2BD2A 2WINI 2ZI2H 3LGVA 3RXPA 5LPFA 1OP2A 2C8WB 2B8OH 3ATIA 1K9OE 3RXTA 2ZHWH 2BOHB 3E1XB 1XKBC 4GSOA 1UTNA 1L1JA 5K7RA 3KIDU 3M61U 2F83A 3E3TA 1HUTH 1O2XA 2H5DA 3A82A 3TH3H 5AFZH 3RUOA 3KQEA 2J38A 1O5DH 4FXGH 3RLWH 3SJ9A 2YNBA 2C8XB 4GLYA 1JBUH 2Y5HA 1B5GH 1N6XA 1THPB 1Z8GA 3SNDA 3M35A 1RRKA 1MZDA 1KYNA 3RC5A 1LVBA 4CBNA 1GVLA 1QHRB 4IGDA 1KLTA 4O97A 3FFGA 5JBTA 1C5YB 5EXLA 1P10A 3HGPA 1T8NA 4AZ2B 2PGBB 2ZO3H 3CP7A 2O8UA 2GT8A 1EP6A 2ZDLA 5EODA 3P95A 3RXEA 1QL8A 2GZ7A 3SU2A 4Y0ZE 4BAHB 1FUJA 4OS1A 2QY0B 5IYTA 2FS9A 3O8RA 1O35A 1EQ9A 1VCWA 1ZPBA 2GP9B 3BTEE 3KCGH 4NFFA 1QGFA 3GY6A 1GGDC 1K1JA 1PPFE 3ZZ5A 1C1WH 4NA7A 1XUIA 5SGAE 1P9SA 1SL3A 2BHGA 2VU8E 1CHGA 4NSVA 1YPHC 4AFZA 2WPLS 1P2IA 1HAVB 2VGCC 4LK4A 3UIRA 1JRSA 4GPGA 2PKAB 1BMLA 1PJPA 3LC3A 1GHAG 1ANEA 5L30H 1ZTKA 1W0YH 1G37A 2PLXA 1NU9A 1QRZA 1SFIA 2VVVA 2P93A 1F5LA 1UK4A 1OS8A 2PV9B 3KHVA 1A1RA 2Y80A 4MPUA 1SG8B 3SUGA 1CT0E 4OS7A 2QAAA 1J9CH 3EA9A 3RXCA 4ABBA 3BTQE 4INLA 4OS6A 1QRXA 1S0RA 2A5AA 3ODFA 4THNH 9LPRA 3F68H 3S7KB 2QCYA 1EZXC 1D3QB 1B7XB 1P3CA 2FWWA 1LKAA 1ZYOA 3QWCH 1P57B 1EB1H 1HAGE 1HAOH 5FBEA 3RU4E 3A7WA 1AVXA 4ISNA 5L2ZH 3KF2A 3EE0B 1DM4B 1G2MA 4KTCA 5J4SA 1Y3XA 1P2KA 1DSTA 4NIVA 3EDXB 3SUFA 1NRRH 3MHWU 3P8GA 4BOHA 4XFQA 1OWKA 4TWYA 1M9UA 5DK1A 1WU1A 1F92A 3W95A 5EQRA 1C5SA 3VEQB 1A3EH 4A7IB 3MO6A 2FPZA 2Z9KA 4FUJA 3RXLA 3AAUA 1BTYA 2ZWLH 1UTQA 1HNEE 4Q80A 1MCTA 4ZKOU 1H4WA 2WPJS 5A8XA 1DY9A 4WH8A 4ISLA 2XWBI 4Q7XA 2BY7X 3SU3A 3ELAH 3M7UA 5EPNA 1MU8B 2AGGX 4WY3A 2F91A 1C5XB 5EQQA 2KAIA 4MPVA 3PMBB 1HAXB 4YLQH 1ZTLA 5CE1A 1ZSLA 4K5ZA 1D3PB 1LQDB 2WPKS 3ZZ8A 2EC9H 1AVWA 7KMEH 2Q1JA 2B9LA 1BMNH 3GISB 2AS9A 1BJVA 3BF6H 4ABEA 4DGJA 1SLWB 1LCYA 3NK8A 3RP2A 5F6MA 2C90B 1CSOE 2R2MB 4E05H 2XBWA 3M3VA 1YBWA 2FOGA 1O2RA 1XUHA 1GDUA 1YLCA 3GY5A 2WPHS 5A8YA 1GJDB 1C5WB 4ABDA 2C8YB 3SHAH 3B8JA 1CO7E 1GI0A 4X8UH 3VGCB 3K6YA 1C5VA 5C5NA 2P8OC 5FAHA 3ZZDA 1GDNA 1BUIA 4YOJA 2J94A 2BXUH 1DVAH 5GPIB 2BVSH 4AGJA 1L1GA 5GDSH 3BG8A 1H8IH 2ODYB 3NWUA 1ZMLA 2YOLA 4JK5A 1DUEA 1IQLA 5GCHF 1K28D 4UFDH 5DKMA 1SGPE 1JOUB 1ZTJA 3ZZ7A 4DOQA 1RGQA 3LGYA 3M7QA 1O2IA 1GHBF 2Y5FA 4CRFA 1K21H 2DUCA 2Z9GA 4IW4E 4Y6DA 1XX9A 1L1NA 1BRAA 1O2WA 5ESTE 2ZGBH 1O3HA 3V13A 2G52A 3RU4D 5GIBA 1O37A 1LMWB 1SQTA 1BT7A 4X2XA 1MKWK 1O2ZA 4MPXA 3SUDA 2M5TA 1SFQB 3Q77A 4AOQA 4Q7ZA 3UUZA 2I6SA 4X0WU 3AAVA 3SQHE 1UTMA 3EA7A 3LJJA 3MOCA 1QCPA 1TAWA 1GI8B 1RTFB 1HFDA 1GBMA 2R0LA 1ETTH 6CHAC 1YGCH 2BD9A 3ZZCA 1FMGA 1GI5A 3V3MA 1TIOA 1VJAU 3QK1A 3TGIE 1KIGH 2BDCA 1UCYH 1C1NA 1PPGE 5AHGH 2AMDA 3RXUA 2NU1E 1TA2A 3LGUA 1SGYE 1BRBE 4JZIA 3ZZBA 3KGPA 2XWAA 2SGDE 3LU9B 3S0NA 3H7OA 3TLOA 3U9AH 3ITIA 1F5KU 3MU1A 5EQSA 1W8BH 1RXPA 1MTWA 4X8SH 1TOCB 1O3OA 4AG2A 1YPJH 4Z0KA 1DPOA 1KXCA 1T4UH 2P95A 4CR5A 4NIXA 3VB5A 4MVNA 3TH4H 4I8KA 1TNHA 3DUXH 4O03A 3RXOA 2WPIS 3D23A 1T8LA 3SJOA 1O39A 4MQAA 1NFUA 3VGCC 4DURA 1NU7B 1KXDA 1JRTA 4B71A 4Z6AH 1TPOA 1QR3E 2WYGA 1MQ5A 1GBHA 1HAZB 1CVWH 1CBWB 3RXMA 3GY8A 1QJ1B 1BA8B 1WQSA 1IHSH 4B75A 2BY8X 2F9UA 1RTKA 2FOBA 1WUNH 1NFXA 2VVCA 1P2QA 5E8EH 5A0BA 1YP9A 2WPMS 2C4FH 1ELTA 2GVFA 3BEIB 3PROA 2FODA 1A7SA 4INHA 1GCTB 1HBTH 4Y11E 4X1RU 4ISOA 4I32A 2KAIB 1TNLA 1B0EA 1C2IA 1QQUA 1EX3A 2PUQH 2BDHA 1DANH 1GJ6A 1SLUB 3S9CA 2IJOB 2SFAA 4ABJA 2H9TH 3BEFB 4K3JA 2G51A 2FO9A 3GY7A 2ZGHA 4YZUA 2O8LA 1YLDA 1MKXH 4CREA 3FZDA 2OC1A 1C5RA 2PFEA 1MTNB 1ZJKA 4M7GA 3A7TA 1O36A 1J17T 2UWLA 3ZZ4A 2EI7A 1A46H 5F8XA 2ZFRH 2QXGA 3A8AA 5K0HA 1GI4A 3H7TA 1C1TA 1YPKH 4WVPE 3BTTE 1UCYE 4I8LA 3A7ZA 3A89A 4PROA 1QB9A 1C5PA 1G9IE 2WYJA 3NCLA 1C1SA 1PYTD 2Z9JA 1EJNA 1DDJA 1UO6A 4WXIA 2ZU2A 5AVDA 3LIWA 4NA8A 2Z9LA 3SU5A 3GYMA 5JB9S 4DVAU 2STBE 2VIPA 1VITH 4ISIH 1DITH 1LO6A 2AERH 1TPSA 2CHAB 3QX5H 2WUCA 1KY9A 1O31A 2GCHG 1RIWB 3CS0A 2V3HH 1YF4A 3ZVGA 3U8RH 1GHAF 1TGBA 3I78A 1W0ZU 5EW1H 3R0FA 2A32A 2WV5A 2VNTA 1FNIA 2GV6A 1GI2A 2A4QA 1IQHA 2A7CA 2VH0A 3M7TA 4MTBA 4NFEA 5FPSA 1P05A 3UY9A 1KDQB 3HATH 2NU3E 2GX4A 1CGJE 2GDDA 3ZVAA 1AB9B 1HAYB 1CBWC 4WMEA 1LHEH 1SLXB 2A5IA 4MNWA 1LQEA 2BD3A 4ZXXH 1TNIA 1NRSH 4LOYH 1CA0C 1XMNB 4MPWA 4BAMB 1G2LA 1HXFH 1L0ZA 1O3AA 1BZXE 2G5NA 2F9OA 2VIDA 2FYQA 5DP9A 1XUJA 2PGQB 1H9HE 1GCDA 4UONA 1FY5A 4I7YH 1Y59T 1GMDG 1OWEA 1D3DB 1S81A 2BDIA 1TE0A 4OS4A 2ZDKA 2HNTC 2ZHDA 2TGAA 2OINA 2AH4X 3T29A 1O3MA 1GJCB 1F0TA 1V2RT 1V2LT 3QGJA 3A84A 4X2VA 2G55A 4ZKNU 3UQOA 5IDKA 3MMGA 1BITA 3MNCA 4X2WA 1OOKB 2ZGXH 3UWIA 1OX1A 3N7OA 3DFLA 1HJ9A 4TY6A 2A7HA 2ZPSA 1S82A 1XUKA 5FX5A 1HJAB 2HALA 1P0SH 2SGEE 3ATMA 3RMLH 3GDSA 4WMDA 5FHTA 1TALA 1UCYK 6ESTA 1ZJDA 1TGCA 2GKVE 4Y76A 5H4IB 1Z6JH 1TONA 1GI7B 2PSYA 3TNSA 1NC6A 4X6OA 2BX4A 1F0RA 1ZGVA 2XC0A 1Y3WA 1OP8A 4Y79A 1H9IE 2VWLA 2EEKA 2VJ1A 2ZFSA 1S83A 3PWCA 2GTBA 1P02A 1DX5M 1VJ9U 5EW2H 4H6TA 3SU6A 4AB8A 2FMJA 4I31A 5A09A 3SV8A 1RIWC 3S9AA 1D6RA 1EZSC 3STJA 1FY4A 1MKWH 1SGCA 1IQGA 1BTHH 2BDGA 5HGGA 1GHYH 1FY8E 1UK2A 1J8AA 2R2WU 3UFAA 3ZVFA 1BHXB 1V3XA 1W14U 2B5TB 2ZNKH 1V2KT 2GD4B 1UMAH 1THRH 1UVTH 2CV3A 1THSH 5C67A 1E37B 2ALVA 2BDAA 3MU8A 4O9VA 2TGDA 2XCNA 2GT7A 4HGCA 3PTNA 1AUTC 3UR6A 1CHOG 1FPCH 2EA3A 4DY7B 1AB9C 1T4VH 1ELCA 5I46H 2SGAA 3L6PA 4AYYB 1GL0E 3WY8A 4FUIA 3EAJA 2FTMA 3PMAB 5JBCS 2SGPE 1FN8A 1L2EA 2BY6X 3GOVB 1OYTH 1YCPK 1TNKA 2AGEX 2ZFFH 3SO3A 6GCHG 3OTJE 3SNEA 3SV9A 3OSYA 3P8FA 1QTFA 4CRBA 2ODQA 3VXFH 4CH8B 2O8WA 1K1OA 2P3UB 1CU1A 2ZA5A 1ZZZA 4ZKSU 3F9FA 3VB6A 4D8NA 1MKXK 3SN8A 4YOGA 4DW2U 1A5HA 1TNGA 1A0LA 2RA0A 1LDTT 1UVPA 3LH1A 3LKWA 1P2JA 4OS2A 3TPIZ 4RN6A 1N8OB 1PQ5A 1GMHG 2OD3B 1VGCB 2LNCA 1O5BB 1EJAA 1V2MT 2FLBH 1GVKB 1O0DH 2A2QH 3M5MA 3RXAA 4E7NA 4H42U 2OXSA 5JB8S 1ELAA 1O3PB 4IMZA 4B74A 1BCUH 3O8BA 1BMMH 2O9QA 3PMJA 3U8OH 1EATA 3GCOA 2BD4A 1SHYA 4Y10E 1YPHE 1C2MA 1Z7KA 4VGCB 1XXFA 1Z8RA 4X8VH 1SQAA 1XXDA 5BRRE 4BNRA 1GBTA 1MAXA 5C3NA 1RS0A 5JDUB 1OKXA 1BB0B 2FOMB 1ABJH 1UHBB 4AGKA 1MAYA 8GCHG 2HNTF 1BRUP 2JETB 1AVGH 2ZCHP 3NUMA 3U69H 3NZIA 5CMXH 2BM2A 1BBRH 3SI4H 1C2EA 3ZZ3A 2G00A 1HGTH 2HWLB 1W10U 2CXVA 1Q2WA 2F9BH 2PUXB 3A7VA 3BTGE 3SNAA 1O2SA 3PLPA 1G32B 2VIOA 2VINA 4K69A 1ZHPA 1WQVH 1E0FD 1TFXA 2UWPA 5A8ZA 1DE7H 2ZP0H 1TGTA 2ZFTA 1AI8H 1ZMNA 2GMTB 1ESTA 1O2QA 3FP8E 1HAHH 1LVYA 4A1TA 1UTJA 1ELGA 4J1YA 1PPEE 1A61H 2BZAA 3Q76A 4OGYA 1P9UA 1TA6A 4I8HA 1J14A 2GGVB 4JYVH 4MG3A 4FUCA 2PTNA 1C4Y2 2NU2E 1O3FA 1E36B 1K22H 4I8GA 4Q2KA 2BZ6H 1AGJA 1XUGA 1FN6A 3T5FH 1OXGA 2GZ8A 3ESTA 3LC5A 2WV4A 4NWKA 5FCRA 3ZVBA 5EXMA 3A87A 3QGNB 3PYHA 3GCNA 3CS7A 1GJ5H 3MO9A 3BTKE 4ZKRU 1O2KA 2XNIA 3E90B 4DJZB 4JZ1A 5C20A 2TGPZ 2FOEA 2G8TA 2A4GA 1ABIH 1O2OA 3F9EA 1HYLA 2FI4E 3KQBA 1GI9B 1DWCH 1BMAA 2ZPRA 2ALPA 2YNAA 1W3CA 1N8OC 3M3TA 1C5MD 1S85A 2XRCA 1VGCC 3A85A 4UEHH 3VXEH 2P3TB 1NRQH 1Z71A 3PLBA 1NFWA 5FBIA 3RC4A 5JBAS 9ESTA 1UVSH 4X6MA 1UTLM 3MH5A 2W3KA 2XCFA 1ZSJA 1EZQA 2A7JA 4HFPB 2V3OH 1ESAA 1SGIB 3GDVA 1MH0A 1SGFA 2OQ5A 1ETSH 3M5OA 3LOXA 2G4TA 3UQVA 2FEQH 1TBRH 1MD7A 4Y71A 1ZR0A 1NY22 3RXDA 2B7DH 4ZHLU 1O2LA 1T32A 3VB7A 1O2PA 2FTLE 3LGWA 2GCHF 3PO1B 1GBKA 4TPYA 1IQKA 3R3GB 1C2GA 3MI4A 5ETXA 3BN9A 4OS5A 2AMPA 5A0AE 4LXBH 3JZ2B 3DA9B 1GMCG 3O8CA 1QJ6B 5FXLA 1BBRE 1MUEB 2JETC 3HPTB 3Q00A 2V35A 3BTWE 3T26A 2VIWA 4NIWA 2VVUA 1DLKB 2VWOA 3BTHE 2BX3A 2HVXA 3SOSA 8KME2 3SU4A 2H9HA 3UWJH 3RXJA 1AIXH 1QIXB 1YCPM 4ZMAH 1KDQA 1P12E 4ZHAA 2TBSA 4Y8XA 1SGNE 5LPRA 1UVOA 4JZFH 1BTZA 6LPRA 1DFPA 1Y3YA 1JMOH 1O2NA 2GMTC 2W26A 3UREA 3SZNA 4GUXA 2VIVA 1DWEH 3MNSA 1O34A 4YT7H 1Z6EA 1P3EA 1QQ4A 4IC5A 1O2UA 2BQ6B 4K1SA 1WYKA 4GCHG 3HKIB 1A2CH 3RLYH 3DFJA 3E6PH 1WTHD 1L4ZA 1UTOA 2XBXA 3VPKA 3RXBA 3RU4T 3S7HB 1GMDF 1Z1JA 1YPLH 1GJ7B 1KXEA 1CE5A 5EU8A 4ESTE 4XBCA 1W12U 2P3FH 3ZZ9A 1W2KH 1YPEH 1S0QA 2BY9X 2JH6D 2OBQA 3DT0H 3SBKA 3TGKE 1ANDA 1TQ0B 3K6ZA 2SGQE 1TB6H 4X1PU 1PPZA 4F4OC 1IQFA 2EI8A 3EQ0H 5I25A 4AFSA 3A88A 1AZZA 2UUFB 1NPMA 1VCQA 1S84A 1K2I1 3HGNA 4KTSA 4A1VA 1GJ8B 1V2NT 3A7YA 1BHXF 3SJ8A 2PSXA 3QTVH 1ZPZA 3SNBA 4MNYA 1H8DH 1AHTH 5DP5A 1AO5A 2Z7FE 1DT2A 1F5RA 1GBDA 3MH7A 2G5VA 5F8ZA 3TGJE 1SGRE 3SJIA 4A6LA 1J15A 1GDQA 4D9RA 3MO3A 4O3UA 4B1TA 1BTXA 5DPAA 4DIHH 1SC8U 5HXFA 1BTUA 3A81A 3BEUA 2A4OA 2ZDNA 1MCVA 3LGTA 4HI3A 1VITG 1ARBA 2B0FA 3AW0A 4JZEH 4I33A 1GI3A 1PPHE 2FX4A 2C3SA 2ULLA 2FLRH 3PO1C 1YCPH 2GV7A 1LPZB 1T8OA 1SGFG 3E16B 4GVUA 2Q6GA 3SW2B 2OUAA 3QUMP 3F1SB 1RFNA 1BOQA 3U8TH 2CF8H 2ZQ2A 1G3CA 1BBRK 8ESTE 3RXRA 1Y5UT 2Y82A 3SV2H 4BXWA 4B2CA 1TX8A 1F2SE 3AVZA 3GCHB 4WJG2 2Z94A 1XVOA 1LHCH 4FUBA 3GY3A 1FV9A 4NCYA 2O8MA 3ZYEA 1DXPA 3U98H 1E38B 2ZIQH 3HKJB 3RXHA 5C1XA 5J4QA 1RD3B 2AIPA 5TJXA 1F0SA 1TLDA 4BXSA 1C4U2 2HGTH 2VWNA 1ZSKA 1P01A 1EAIA 2O8TA 3SUEA 2RCEA 1C1MA 3LJOA 4DCDA 4A92A 2BLOA 2D2DA 2UUJB 3RC6A 1SQOA 1CHOF 1KLJH 1OP0A 2ANKH 3EYDA 1P04A 1GBCA 2Z6BD 3SGQE 3M5NA 1MBMA 3ZVCA 1TRMA 3ODDA 3SU0A 1AY6H 1KXAA 1HIAB 2AMQA 4U01A 2ZTZA 2OLGA 6GCHF 2V6NA 1DLEA 1GI1A 4XBDA 4KP0A 5T6DA 2CJIA 1TBZH 2TRMA 4LZ4B 2BMGB 1TRNA 4BANB 1IQMA 1DICA 3E0PB 3GICB 1QL9A 1TGNA 2FOFA 3QTOH 1LVMA 4FU7A 2FP7B 4YOIA 3P8NA 4KELA 1DY8A 2F3CE 1NO9H 2J34A 3BTME 2RG3A 1EASA 4WXVA 2BD5A 1UJ1A 2QYIA 1Y5BT 1TMTH 1C1QA 4K2YA 4CRDA 2R3UA 1OWHA 2FYRA 1Q3XA 3F9GA 5AF9H 1PPBH 4CRAA 3FP7E 2ZHEH 1GMHF 2OCVB 3CENA 1C5QA 5EG4A 5LH8A 5FCKA 1VZQH 1JIMA 1TABE 1Y8TA 1KXFA 3KL6A 3Q3YA 2PHBA 1C5OH 3VFEA 4DG4A 5DJ7A 5L6NH 1QFKH 1SVPA 1W7GH 2W7UA 3K9XB 5GJ4B 1UVUH 1ZOMA 2XW9A 2A5KA 2Q6FA 2JH5D 1MTSA 2QXJA 3DD2H 4YTAA 1G3EA 1QRWA 4AFQA 5F03A 2JH0D 5C2ZA 2AIQA 1WTGH 2GDEH 4CR9A 2PR3A 2ZDVH 3T28A 2OTVA 5L2YH 1E35B 1LKBA 2ZZUH 4Y7BA 1OWJA 1GWAA 4SGAE 1S5SA 3RXQA 1CT2E 4YT6H 8GCHF 2BOKA 1WCZA 1UHBA 1Z8JB 1GCTC 3MU0A 2RDLA 2ZCKP 1CA8B 2BLWA 3D65E 1GJAB 1RJXB 3MU4A 4IS5A 1NRPH 3T27A 3TK9A 4BTTB 1PQ8A 1EAWA 4OGXA 1FONA 2CN0H 2G81E 3E0NB 1ESBA 1O3EA 2Y81A 3MYWA 2R9PA 1S6FA 1D4PB 3NXPA 1G36A 1MTVA 2PWXA 5EOKA 4ABHA 1O3GA 1WAYB 1GGDB 1MTNC 1XVMA 5FPTA 1O2MA 3MH4A 2H6MA 3A8DA 2FOCA 3TIUA 2W7SA 2J4IA 2XYAA 1B0FA 5HM2A 5DP6A 3AW1A 4TWWA 4UE7H 1PPCE 2VB0A 4RKJB 3EGKH 1UTKA 3PB1E 1SI5H 3K65B 1C5TA 3B9FH 1GI6A 5E2PA 1K1PA 3BIUH 4YLUA 3SNCA 1BJUA 2H9EH 1P11E 2ZU1A 3UNSA 2Y7XA 2H1UA 1AMHA 1MU6B 1TRYA 3ZVDA 1O32A 4K1TA 1O3DA 5JBBS 4FUDA 3E8LA 1EUFA 4D9QA 2F9VA 1C1RA 4XBBA 4K60A 3KN2A 4ZAEA 3GY4A 2A4RA 3KQCA 4KGAA 2QGRA 4FVBA 1OWDA 5LPEA 1HRTH 1KLIH 2BDBA 4LZ1H 4FUFA 1GJ9B 4MDSA 2CHAC 4X1SU 2BLVA 3TVJB 3OY6U 3NPSA 1CQQA 1H9LB 1WBGB 1O2HA 4CHAB 1C5LH
chains in the Genus database with same CATH superfamily
2AGIX 1VR1H 3BTFE 1ZLRA 4JK6A 3RXIA 1N1LA 5A0CA 1KSNA 3TJUA 2BTCE 4JCNA 1FI8A 1UK3A 4KTUA 1FJSA 3LH3A 7LPRA 1OPHB 2QF0A 2BLQA 5T6GA 2L6OA 4WMFA 3O8DA 2RA3A 3RMOH 2PW8H 2VWMA 1SGEE 1CGIE 1NM6A 1YC0A 2ZFQH 3Q3XA 1O5AB 3IWMA 3SHCH 1O3CA 3OEED 2W5EA 4MNXA 2QF3A 3TJNA 3OU0A 2ZCLP 2BY5X 2ZG0H 1AUJA 2BQWB 1T8MA 4ASUD 3T25A 4CH2B 2P16A 1C9PA 5FX6A 3TH2H 1NZQH 4YO9A 1O3BA 1TX6A 2ZECA 2ZPQA 3OFND 3URCA 1QNJA 2Z3DA 4FETA 3V7TA 1EB2A 3TJVA 4I86A 1LHDH 1EAUA 1SR5C 1GHVH 4TPIZ 1ZMJA 4CRCA 1GMCF 5DP3A 3TK6A 1GJ4H 2OQUA 1NRNH 2ZU3A 1D6WA 1V2ST 3FZZA 3P8OA 1GG6B 4IBLH 5HKKD 5C17A 3F2FA 1Y3UA 3OYPA 5ESBA 3ZIAD 1VCPA 1TBQH 3P92A 1F0UA 3MQKC 1SBWA 2VIQA 1AWFH 2BD8A 3DSGA 1TMBH 1NESE 3QZQA 1TPPA 1HAPH 3TJOA 1FZZA 2FX6A 3UNQA 4MNVA 3PV4A 3SI3H 1DS2E 1N6YA 1JXPA 2ILNA 3PV2A 3RMNH 1DXWA 2J92A 1W0KD 1HJAC 2PKSB 3N99A 4ZHMU 1YKTA 4GCHF 1X7AC 1TOMH 2YMSB 1AFQB 1H8ED 3E91A 2ZC9H 3V12A 4GHQA 1A5IA 5E0JA 1E79D 4B2AA 1V2QT 3ATLA 2QN5T 1AKSB 3L3TA 3PM3A 4UDWH 1UW7A 1ACBE 2FS8A 2ODPA 1TX7A 3S69A 3M5LA 2NU4E 3BTDE 2HOBA 4FUGA 1RTLA 2P8OB 1XKAC 1AU8A 4RKOB 2Y6TA 2F43B 1ELDE 1GBFA 7GCHG 4AFUA 1A0JA 2QA9E 4WF8A 1TPAE 1FIZA 1AQ7A 5GXPA 1INCA 1YPMH 1HV7A 2OP9A 1XM1A 3ZYDA 3MU5A 1GBBA 4CHAC 2IOTA 1Y5AT 1EXFA 2Z3EA 1GHXH 3PWBA 1A5GH 2WHXA 3T2NA 5TCAA 1TQ7B 1V2WT 1C2KA 1NT1A 3TNTA 3ZZAA 1U6QA 4F48B 4UFEH 1JWTA 4K1EA 1NN6A 1K1IA 2J5UA 2VH6A 1G30B 3VB4A 2EI6A 1SB1H 3RM2H 4HZHA 3A80A 4ACBA 3SGBE 4HTCH 4SGBE 4NWLA 1FQ3A 3KEEA 1VITF 5EGMA 5A2MH 1MTUA 4D7FA 1T7CA 1SOZA 1AN1E 1HAIH 2LPRA 4XOJA 3F0OA 2C8ZB 2J9NA 2ZTXA 4AX9H 4B6FA 1TMUH 1SGTA 1IQNA 1ELEE 2FOAA 1ZHMA 1HB0B 1HPGA 4Y0YE 2FDAA 4Q7YA 1ELVA 3ENSB 4U2WA 6CHAB 2SNVA 3GCTG 5HIYA 2GCTB 2Y5GA 2BDYA 4UFGH 1NROH 4ABGA 1FDPA 1G3DA 1SMFE 2FM2A 4O3TA 3IG6B 2V0BA 4B76A 2UUYA 4R8TB 5F8TA 1GG6C 1W7XH 2SNWA 5G4BA 1LHFH 3M37A 4U32A 4DIIH 3C1KA 3MNXA 3AK5A 2QXIA 2FIRH 1EFRD 5HMAA 1QBOA 3QO6A 3UPEA 1KTTB 2H2ZA 1AE8H 4KKDA 1GPZA 4QT8C 2J2UA 5DGJA 1DUAA 2GZ9A 1AWHB 2QIQA 3ZZ6A 2A0QB 2ANWA 3KQDA 5DP7A 1ZPCA 2TPIZ 3A8CA 3SJKA 5C1UA 3FAOA 4ABAA 2PKSC 1W13U 1HIAA 1TWXB 3SORA 4Q63A 4XSKU 2ZKSA 4TT3D 1GHWH 1AFQC 3LDXH 1HDTH 4NZQA 3F6UH 1V2JT 1IAUA 2J98A 3UOUA 4ZH8A 1BDAA 4H4FA 2BD7A 3LGIA 1L4DA 1UTPA 1ZRKA 2A2XH 3UR9A 4FUEA 5T6FA 3RXKA 2BVRH 4AN7A 1FY3A 2L74A 3GYLB 1V2TT 2D26C 1P09A 1EPTA 3M3SA 4VGCC 2A31A 1F7ZA 2I6QA 1SGQE 2JKHA 1O2GH 3RXVA 3TITA 5FL7D 1PFXC 1T31A 1DOJA 2CMYA 4JMYA 1K1LA 1Z1IA 5C0UA 1ARCA 3MWIU 3F9HA 4GHTA 4XDEA 1SHHB 1OWIA 2F9PA 2LP6A 4NG9H 5GNDA 3OX7U 2A45B 1V2PT 2OC7A 4J2YB 5TCCA 3QN7A 3LONA 1YYY1 4FU8A 2TIOA 1FAKH 3BG4B 3GDUA 4A5TS 4F49A 1LTOA 3UOPA 2TGTA 2AYWA 4ABFA 2W3IA 2QC2A 4WWYA 1PYTC 2XC4A 1QY6A 2OK5A 3SGAE 2IPHA 2ZQ1A 1FPHH 1W11U 1PQ7A 2ZDAH 1FXYA 2STAE 3PLKA 4AYVB 3MNBA 1P06A 1GJBB 5C1YA 1NS3A 3U1IB 1SKYE 5LGOA 1ZHRA 3OEHD 1O3JA 4YM9A 4FU9A 3RDZA 1O5GH 3LT3A 4NGAH 1C5UA 3SU1A 1IQJA 4K8BA 1C2HA 2ANYA 1V6DA 2BVXH 3MTYA 1QL7A 1EOJA 4B6EA 1Z8IB 5CHAB 1KMHB 4ZCNA 1C1UH 2GCTC 1G3BA 5HM9A 3UNRA 5JYIA 2OC8A 2FXRA 3A8BA 2AHME 1TGSZ 3I77A 4H6SB 1WV7H 1GHZA 1CGHA 2R0KA 2Z9IA 1OYQA 5C94A 1O5FH 8LPRA 4RSPA 2ZDMA 1C5NH 2QV1A 3T62A 4CBOA 1EP5A 2H5CA 4K8YA 1C1VH 1OSSA 1QA7A 3QDZB 4INKA 1J16A 3RM0H 1MQ6A 1FY1A 5B6OA 5E0GA 1V2VT 2DE8A 1YM0A 1AE5A 1EAXA 3A83A 3D62A 1O5CB 2ZGJA 3FP6E 2ZHQH 2G4UA 4AG1A 2UUKB 3RXSA 3U1JB 3KNXA 1O3NA 2RDEA 1BQYA 1FLEE 4MLFB 1EJMA 1V2OT 1C1PA 4IN2A 4NA9H 5DG6A 2BQ7B 3OTPA 2IN2A 4TYDA 2QF5A 3OY5U 2A1DB 4Q4LA 4ABIA 3NKKA 2AFQB 4X2YA 1P03A 4WH6A 2F9NA 7ESTE 2ANMH 2OBOA 3Q3KA 4NIYA 5T3HA 3UB0A 3FANA 5E0HA 2FI3E 1MZAA 5GWZA 3G01A 1BTPA 1CA0B 1C2LA 1GBIA 1O2TA 5ABWA 2HLCA 3F0PA 3I29A 3SV6A 4Y8ZA 3M36A 1K1NA 1IOEA 3BG4C 3EA8A 5PTPA 1C5ZB 4GAWA 2THFB 1ANBA 1ORFA 2BYAX 1ZRBA 3FVFB 1GBAA 2PTCE 1DSUA 1QB6A 1O5EH 4JYUH 3B23B 1O2JA 1IQEA 3DHKH 1MMJN 4ZUHA 2BB4A 1MD8A 3BV9B 3ATKA 2K1QA 2ZEBA 2ZF0H 3P17H 1P8VC 1EOLA 2OC0A 5E2OA 3AASA 1LHGH 1XUFA 1E34B 1EKBB 1HXEH 2QXHA 2XBYA 3QLPH 2J98B 3S9BA 1A0HB 5DP8A 2ZGCA 1DWDH 3UTUH 3MH6A 3FKSD 5HYOA 3MFJA 3LPRA 1O2YA 2NWNA 5BPEA 5CHAC 4FUHA 1EPTB 4JZDH 2ZFPH 2ZTYA 2FOHA 4ZROA 4E7RG 5FPYA 1WSSH 3A86A 3URDA 1LPKB 3PMHB 2IPQX 1C2DA 2ZU5A 2NU0E 3ATWA 1KTSB 1GBJA 1HLTH 4IN1A 1C4V2 4B2BA 4X1QU 3D49H 4M9FA 1A3BH 1GL1A 2CGAA 1TYNA 4ISHH 1SOTA 4DT7B 1PQAA 2RFKC 5GCHG 2D8WA 4CRGA 1C2FA 1QURH 1S6HA 1SPJA 2FI5E 1O3KA 2P94A 4IC6A 1HAVA 1GHBG 2XC5A 4E06H 4IMQA 1O2VA 4BAKB 5C5OA 1AKSA 1GVZA 2PKAA 3V0XA 1P2MA 1SLVB 2AEIH 3QZRA 1GBEA 1D9IA 2Y7ZA 3H5CB 3P6ZB 4R0IA 1O3IA 4U30A 3RXGA 2HRVA 3ZV8A 1CT4E 1S6LA 3JZ1B 2ASUB 3HK6B 4FVDA 4NZLA 1FAXA 4BTUB 1ZGIA 5EXNA 3PTBA 2HPPH 7GCHF 3W94A 1NFYA 2SGFE 3TK5A 3STIA 1HJ8A 2EY4C 1JIRA 1MBQA 3RXFA 1BRCE 3BIVH 4JYTA 3RMMH 4X6PA 3SV7A 2UWOA 1QA0A 5DP4A 4BAOB 2WUBA 4UFFH 2J95A 2ESTE 1BIOA 1C2JA 2FESH 3C27B 4ASHA 2C93B 3WWFA 1SSXA 1NTPA 1HCGA 1O30A 1ELBA 2CF9H 2D1JA 3GCHC 4XE4A 3TU7H 1DWBH 2KCPA 3ZVEA 1ELFA 4Y8YA 4D76A 1AZ8A 1O3LA 1ETRH 5KEDA 4YXWD 1EZUC 4D7GA 1A4WH 3L33A 2XTTB 5JPMH 2XXLA 1P2OA 2HPQH 3A7XA 1AD8H 1VKYA 1FX0B 1V2UT 2XBVA 4BAQB 2P59A 4X8TH 2VGCB 4X1NU 1QJ7B 4ACAA 5AFYH 4AORA 1BTWA 4A1XA 4B73A 3HK3B 1LPGB 3P70B 3GCTF 3ZV9A 1SGDE 4ZXYH 1C1OA 1W0JD 1P2NA 4UD9H 3GY2A 4BTIB 2HNTE 3IITA 2FZZA 1O38A 3K2UA 4NSYA 2Q6DA 1C9TA 1IHTH 3BSQA 4X6NA 1AFEH 1TNJA 1QB1A 1K1MA 1EPTC 4TY7A 2ZU4A 1ID5H 1QBNA 1IQIA 4Y7AA 1LVOA 5DO4H 4AB9A 4I8JA 1FIWA 1GBLA 1QBVH 2DE9A 1ANCA 1KXBA 3VB3A 2R3YA 2ZHFH 1D3TB 1H1BA 1Y3VA 5EPYA 1Q31A 3SQEE 3U28C 1O33A 1YPGH 1WOFA 4YESB 2BXTH 2Z3CA 3WWBA 2BD2A 2WINI 2ZI2H 1BMFD 3LGVA 3RXPA 5LPFA 1OP2A 2C8WB 2B8OH 3ATIA 1K9OE 3RXTA 2ZHWH 2BOHB 3E1XB 1XKBC 4GSOA 1UTNA 1L1JA 5K7RA 3KIDU 3M61U 2F83A 3E3TA 1WDIA 1HUTH 1O2XA 2H5DA 3A82A 3TH3H 2WSSD 5AFZH 3RUOA 3KQEA 2J38A 1O5DH 4FXGH 3RLWH 3SJ9A 2YNBA 2C8XB 4GLYA 1JBUH 2Y5HA 1B5GH 1N6XA 1THPB 1Z8GA 3SNDA 3M35A 1RRKA 2KCYA 1MZDA 1KYNA 3RC5A 1LVBA 4CBNA 1GVLA 1QHRB 4IGDA 1KLTA 4O97A 3FFGA 5JBTA 1C5YB 5EXLA 1P10A 3HGPA 1T8NA 4AZ2B 2PGBB 2ZO3H 3CP7A 2O8UA 2GT8A 1EP6A 2ZDLA 5EODA 3P95A 3RXEA 1QL8A 2GZ7A 3SU2A 4Y0ZE 4BAHB 1FUJA 4OS1A 2QY0B 5IYTA 2FS9A 3O8RA 1O35A 1EQ9A 1VCWA 1ZPBA 2GP9B 3BTEE 3KCGH 4NFFA 5DSFA 1QGFA 3GY6A 1GGDC 1K1JA 1PPFE 3ZZ5A 1C1WH 4NA7A 1XUIA 2XNDD 5SGAE 1P9SA 1SL3A 2BHGA 2VU8E 3OE7D 1CHGA 4NSVA 4RT1A 1YPHC 4AFZA 2WPLS 1P2IA 1HAVB 2VGCC 4LK4A 3UIRA 1JRSA 4GPGA 2PKAB 4DT4A 1BMLA 1PJPA 3LC3A 1GHAG 1ANEA 5L30H 3SYJA 1ZTKA 1W0YH 1G37A 2PLXA 1NU9A 1QRZA 1SFIA 2VVVA 2P93A 1F5LA 1UK4A 1OS8A 2PV9B 3KHVA 1A1RA 2Y80A 4MPUA 1SG8B 3SUGA 1CT0E 4OS7A 2QAAA 1J9CH 3EA9A 3RXCA 4ABBA 1COWD 3BTQE 4INLA 4OS6A 1QRXA 1S0RA 2A5AA 3ODFA 4THNH 9LPRA 3F68H 3S7KB 2QCYA 1EZXC 1D3QB 1B7XB 1P3CA 2FWWA 1LKAA 1ZYOA 3QWCH 1P57B 2KFWA 1EB1H 1HAGE 1HAOH 5FBEA 3RU4E 3A7WA 1AVXA 4ISNA 5L2ZH 3KF2A 3EE0B 1DM4B 1G2MA 4KTCA 5J4SA 1Y3XA 1P2KA 4XD7D 1DSTA 4NIVA 3EDXB 3SUFA 1NRRH 3MHWU 3P8GA 4BOHA 4XFQA 1OWKA 4TWYA 1M9UA 5DK1A 1WU1A 1F92A 3W95A 5EQRA 1C5SA 3VEQB 1A3EH 4A7IB 3MO6A 2FPZA 2Z9KA 4FUJA 3RXLA 3AAUA 1BTYA 3DCLA 2ZWLH 1UTQA 1HNEE 4Q80A 1MCTA 4ZKOU 1H4WA 2WPJS 5A8XA 1DY9A 4WH8A 4ISLA 2XWBI 4Q7XA 2BY7X 3SU3A 3ELAH 3M7UA 5EPNA 1MU8B 2AGGX 4WY3A 2F91A 1C5XB 5EQQA 2KAIA 4MPVA 3PMBB 1HAXB 4YLQH 1ZTLA 5CE1A 1ZSLA 1E1RD 1D3PB 4K5ZA 1LQDB 2WPKS 3ZZ8A 2EC9H 1AVWA 7KMEH 2Q1JA 2B9LA 1BMNH 3GISB 2AS9A 1BJVA 3BF6H 4ABEA 4HG6A 4DGJA 1SLWB 1LCYA 3NK8A 2JDID 3RP2A 5F6MA 5EJ1A 2YMSC 2C90B 1CSOE 2R2MB 4E05H 2XBWA 3M3VA 1YBWA 2FOGA 1O2RA 1XUHA 1GDUA 1YLCA 3GY5A 2WPHS 5A8YA 1GJDB 1C5WB 4ABDA 2C8YB 3SHAH 3B8JA 1CO7E 1GI0A 4X8UH 3CNRA 3VGCB 3K6YA 1C5VA 4RI0A 5C5NA 2P8OC 5FAHA 3ZZDA 1GDNA 1BUIA 4YOJA 2J94A 2BXUH 1DVAH 5GPIB 2BVSH 4AGJA 1L1GA 5GDSH 3BG8A 1H8IH 2ODYB 3NWUA 1ZMLA 2YOLA 2JIZD 4JK5A 1DUEA 1IQLA 5GCHF 1K28D 2QE7D 4UFDH 5DKMA 1SGPE 1JOUB 1ZTJA 3ZZ7A 4DOQA 2WPDD 1RGQA 3LGYA 3M7QA 1O2IA 1GHBF 2Y5FA 4CRFA 1K21H 2DUCA 2Z9GA 4IW4E 4Y6DA 1XX9A 1L1NA 1BRAA 1O2WA 5ESTE 2ZGBH 1O3HA 3V13A 2G52A 3RU4D 5GIBA 1O37A 1LMWB 1SQTA 1BT7A 4X2XA 1MKWK 1O2ZA 4MPXA 3SUDA 2M5TA 1SFQB 3Q77A 2KCOA 4AOQA 4Q7ZA 3UUZA 2I6SA 4X0WU 3AAVA 3SQHE 3KYGA 1UTMA 3EA7A 3LJJA 3MOCA 1QCPA 1TAWA 1GI8B 1RTFB 1HFDA 1GBMA 2R0LA 1ETTH 6CHAC 3PRBA 1YGCH 2BD9A 3ZZCA 1FMGA 1GI5A 3V3MA 1TIOA 1VJAU 3QK1A 3TGIE 1KIGH 2BDCA 1UCYH 1C1NA 1PPGE 2WV9A 5AHGH 2AMDA 3KYFA 3RXUA 2NU1E 1TA2A 3LGUA 1SGYE 1BRBE 4JZIA 3ZZBA 3KGPA 2XWAA 2SGDE 3LU9B 3S0NA 3H7OA 3TLOA 3U9AH 3ITIA 1F5KU 3MU1A 5EQSA 1W8BH 1RXPA 1MTWA 4X8SH 1TOCB 1O3OA 4AG2A 1YPJH 4Z0KA 1DPOA 1KXCA 1T4UH 2P95A 4CR5A 4NIXA 3VB5A 4MVNA 3OAAD 3TH4H 4I8KA 1TNHA 3DUXH 4O03A 3RXOA 2WPIS 3D23A 1T8LA 3SJOA 1O39A 4MQAA 5EJZA 1NFUA 3VGCC 4DURA 1NU7B 1KXDA 3WW7A 1JRTA 4B71A 4Z6AH 1H8HD 1TPOA 1QR3E 5HIZA 2WYGA 1MQ5A 1GBHA 1WXRA 1HAZB 1CVWH 1CBWB 3RXMA 3GY8A 1QJ1B 1BA8B 1WQSA 1IHSH 4B75A 2BY8X 2F9UA 1RTKA 2FOBA 1WUNH 1NFXA 2VVCA 1P2QA 5E8EH 5A0BA 1YP9A 2WPMS 2C4FH 1ELTA 2GVFA 3BEIB 3PROA 2FODA 1A7SA 4INHA 1GCTB 1HBTH 4Y11E 4X1RU 4ISOA 4I32A 2KAIB 1TNLA 1B0EA 1C2IA 1QQUA 1EX3A 2J97A 2PUQH 2BDHA 1DANH 1GJ6A 1SLUB 3S9CA 2CK3D 2IJOB 2SFAA 4ABJA 2H9TH 3BEFB 4K3JA 2G51A 2FO9A 3GY7A 2ZGHA 4YZUA 2O8LA 1YLDA 1MKXH 2M2AA 4CREA 3FZDA 2OC1A 1C5RA 2PFEA 1MTNB 1ZJKA 3N7DA 4M7GA 3A7TA 1O36A 1J17T 2UWLA 3ZZ4A 2EI7A 3F3BA 1A46H 5F8XA 2ZFRH 2QXGA 3A8AA 5K0HA 1GI4A 3H7TA 1C1TA 1YPKH 4WVPE 3BTTE 1UCYE 4I8LA 3A7ZA 3A89A 4PROA 1QB9A 1C5PA 1G9IE 2WYJA 3NCLA 1C1SA 1PYTD 2Z9JA 1EJNA 1DDJA 1UO6A 4WXIA 2ZU2A 5AVDA 3LIWA 4NA8A 2Z9LA 3SU5A 3GYMA 5JB9S 4DVAU 2STBE 2VIPA 1VITH 4ISIH 1DITH 1LO6A 2EQNA 2AERH 1TPSA 2CHAB 3QX5H 2WUCA 1KY9A 1O31A 2GCHG 1RIWB 3CS0A 2V3HH 1YF4A 3ZVGA 3U8RH 1GHAF 2KM0A 1TGBA 3I78A 1W0ZU 5EW1H 3R0FA 2A32A 2WV5A 4FOUC 2VNTA 2W6JD 1FNIA 2GV6A 1GI2A 2A4QA 1IQHA 2A7CA 2VH0A 3M7TA 4MTBA 4NFEA 5FPSA 1P05A 3UY9A 1KDQB 3HATH 2NU3E 2GX4A 1CGJE 2GDDA 3ZVAA 1AB9B 1HAYB 1CBWC 4WMEA 4P02A 1LHEH 1SLXB 2A5IA 4MNWA 1LQEA 2BD3A 4ZXXH 1TNIA 1NRSH 4LOYH 1CA0C 1XMNB 4MPWA 5DN6D 2GJGA 4BAMB 1G2LA 1HXFH 1L0ZA 1O3AA 1BZXE 2G5NA 2F9OA 2VIDA 2FYQA 5DP9A 1XUJA 2PGQB 1H9HE 1GCDA 1NBME 4UONA 1FY5A 4I7YH 1Y59T 1GMDG 1OWEA 1D3DB 1S81A 2BDIA 1TE0A 4OS4A 2WZQA 2ZDKA 2HNTC 2ZHDA 2TGAA 2OINA 2AH4X 3T29A 1O3MA 1GJCB 1F0TA 1V2RT 1V2LT 3QGJA 3A84A 4X2VA 2G55A 4ZKNU 3UQOA 5IDKA 3MMGA 1BITA 3MNCA 4X2WA 1OOKB 2ZGXH 5B6LA 3UWIA 1OX1A 3N7OA 3DFLA 1HJ9A 4TY6A 2A7HA 2ZPSA 1S82A 1XUKA 5FX5A 1HJAB 2HALA 1P0SH 2SGEE 3ATMA 3RMLH 3GDSA 5EIYA 4WMDA 5FHTA 1TALA 1UCYK 6ESTA 1ZJDA 1TGCA 2GKVE 4Y76A 5H4IB 1Z6JH 1TONA 1GI7B 2PSYA 3TNSA 1NC6A 4X6OA 2HVYB 2BX4A 1F0RA 1ZGVA 2XC0A 1Y3WA 1OP8A 4Y79A 1H9IE 2VWLA 2EEKA 2VJ1A 2ZFSA 1S83A 3PWCA 2GTBA 1P02A 1DX5M 5KGOA 1VJ9U 5EW2H 4H6TA 3SU6A 4AB8A 2FMJA 4I31A 5A09A 3SV8A 1RIWC 3S9AA 1D6RA 1EZSC 3STJA 1FY4A 1MKWH 1SGCA 1IQGA 1BTHH 2BDGA 5HGGA 1GHYH 1FY8E 1UK2A 1J8AA 2R2WU 2K8IA 3UFAA 3ZVFA 1BHXB 1V3XA 1W14U 2B5TB 2ZNKH 1V2KT 2JJ2D 2GD4B 1UMAH 1THRH 1UVTH 2CV3A 1THSH 5C67A 1E37B 2ALVA 2BDAA 3MU8A 4O9VA 2TGDA 2XCNA 2GT7A 4HGCA 3PTNA 1AUTC 3UR6A 1CHOG 1FPCH 2EA3A 4DY7B 1AB9C 1T4VH 1ELCA 5I46H 2SGAA 3L6PA 4AYYB 1GL0E 3WY8A 4FUIA 3EAJA 2FTMA 3PMAB 5JBCS 2SGPE 1FN8A 1L2EA 2BY6X 3GOVB 1OYTH 1YCPK 1TNKA 2AGEX 2ZFFH 3SO3A 6GCHG 3OTJE 3SNEA 3SV9A 3OSYA 3P8FA 1QTFA 4CRBA 2ODQA 3VXFH 4CH8B 2O8WA 3F2HA 3W1EA 1NBMD 1K1OA 2P3UB 1CU1A 2ZA5A 1ZZZA 4ZKSU 3F9FA 3SZEA 3VB6A 4D8NA 1MKXK 3SN8A 4YOGA 4DW2U 1A5HA 1TNGA 1A0LA 2RA0A 1LDTT 2QF4A 3F2GA 1UVPA 3LH1A 3LKWA 1P2JA 4OS2A 3TPIZ 4RN6A 1N8OB 1PQ5A 1GMHG 5T1VA 2OD3B 1VGCB 5CDFE 2LNCA 1O5BB 1EJAA 1V2MT 2FLBH 1GVKB 1O0DH 2A2QH 3M5MA 3RXAA 4E7NA 4H42U 2OXSA 5JB8S 1ELAA 1O3PB 4IMZA 4B74A 1BCUH 3O8BA 1BMMH 2O9QA 3PMJA 3U8OH 1EATA 3GCOA 2BD4A 1SHYA 4Y10E 1OHHD 1YPHE 1C2MA 1Z7KA 4VGCB 1QZ8A 1XXFA 1Z8RA 4X8VH 1SQAA 1XXDA 5BRRE 4BNRA 1GBTA 1MAXA 5C3NA 1RS0A 5JDUB 1OKXA 1BB0B 2FOMB 1ABJH 1UHBB 4AGKA 1MAYA 8GCHG 2HNTF 1BRUP 2JETB 1AVGH 2ZCHP 3NUMA 3U69H 3NZIA 5CMXH 2BM2A 1BBRH 3SI4H 1C2EA 3ZZ3A 2G00A 1HGTH 2HWLB 1W10U 2CXVA 1Q2WA 2F9BH 2PUXB 3A7VA 3BTGE 3SNAA 1O2SA 3PLPA 1G32B 2VIOA 2VINA 4K69A 1ZHPA 1WQVH 1E0FD 1TFXA 2UWPA 5A8ZA 1DE7H 2ZP0H 3FOAA 1TGTA 2ZFTA 3NRLA 1AI8H 1ZMNA 5C0TA 2GMTB 1ESTA 1O2QA 3FP8E 1HAHH 1LVYA 4A1TA 1E1QD 1UTJA 1ELGA 4J1YA 1PPEE 1A61H 2BZAA 3Q76A 4OGYA 1P9UA 1TA6A 4I8HA 1J14A 2GGVB 4JYVH 4MG3A 4FUCA 2PTNA 1C4Y2 2NU2E 1O3FA 1E36B 1K22H 4I8GA 2V7QD 4Q2KA 2BZ6H 1AGJA 1XUGA 1FN6A 3T5FH 1OXGA 2GZ8A 3ESTA 3LC5A 2WV4A 4NWKA 5FCRA 3ZVBA 5EXMA 3A87A 3QGNB 3PYHA 3GCNA 3CS7A 1GJ5H 3MO9A 3BTKE 4ZKRU 1O2KA 2XNIA 3E90B 4DJZB 4JZ1A 5C20A 2TGPZ 2FOEA 2G8TA 2A4GA 1ABIH 1O2OA 3DSOA 3F9EA 1HYLA 2FI4E 3KQBA 1GI9B 1DWCH 1BMAA 2ZPRA 2ALPA 2YNAA 1W3CA 1N8OC 3M3TA 1C5MD 1S85A 2XRCA 1VGCC 3A85A 4UEHH 2LELA 5KECA 3VXEH 2P3TB 1NRQH 1Z71A 3PLBA 1NFWA 5FBIA 3RC4A 5JBAS 9ESTA 1UVSH 4X6MA 1UTLM 3MH5A 2W3KA 2XCFA 1ZSJA 1EZQA 2A7JA 4HFPB 2V3OH 1ESAA 1SGIB 3GDVA 1SQRA 1K0HA 1MH0A 1SGFA 2OQ5A 5CHBA 1ETSH 3M5OA 3H09A 3LOXA 2G4TA 3UQVA 2FEQH 1TBRH 1MD7A 4XRNA 4Y71A 1ZR0A 4TSFD 4RT0A 1NY22 3RXDA 2B7DH 4ZHLU 1O2LA 1T32A 3VB7A 1O2PA 2FTLE 3LGWA 2GCHF 3PO1B 5EJLA 1GBKA 4TPYA 2F4LA 1IQKA 3EE7A 3R3GB 1C2GA 3MI4A 5ETXA 3BN9A 4OS5A 2AMPA 5A0AE 4Z1MD 4LXBH 3JZ2B 3DA9B 1GMCG 3O8CA 1QJ6B 5FXLA 1BBRE 1MUEB 2JETC 3HPTB 3Q00A 2V35A 3BTWE 3T26A 2VIWA 4NIWA 2VVUA 1DLKB 2VWOA 3BTHE 2BX3A 2HVXA 3SOSA 8KME2 3SU4A 2H9HA 3UWJH 3RXJA 1AIXH 1QIXB 1YCPM 4ZMAH 1KDQA 1P12E 4ZHAA 2TBSA 4Y8XA 1SGNE 5LPRA 1UVOA 4JZFH 1BTZA 6LPRA 1DFPA 1Y3YA 1JMOH 1O2NA 2GMTC 2W26A 3UREA 3SZNA 4GUXA 2VIVA 1DWEH 3MNSA 1O34A 4YT7H 2PP6A 1Z6EA 1P3EA 1QQ4A 4IC5A 5IK2D 1O2UA 2BQ6B 4K1SA 1WYKA 4GCHG 3HKIB 1A2CH 3RLYH 3DFJA 1YWUA 2IJD1 3E6PH 1WTHD 1L4ZA 1UTOA 2XBXA 3VPKA 3RXBA 3RU4T 3S7HB 1GMDF 1Z1JA 1YPLH 1GJ7B 1KXEA 1CE5A 5EU8A 4ESTE 4XBCA 1W12U 2P3FH 4F55A 3ZZ9A 1W2KH 1YPEH 1S0QA 2BY9X 2JH6D 2OBQA 3DT0H 3SBKA 3TGKE 1ANDA 1TQ0B 2KX4A 3K6ZA 2SGQE 1TB6H 1MABB 1PPZA 4X1PU 4F4OC 1IQFA 2EI8A 3EQ0H 5I25A 4AFSA 3A88A 1AZZA 2UUFB 1NPMA 1VCQA 2HLDD 1S84A 1K2I1 3HGNA 4KTSA 4A1VA 1GJ8B 1V2NT 3A7YA 1BHXF 3SJ8A 2PSXA 3QTVH 1ZPZA 2XOKD 3SNBA 4MNYA 1H8DH 1AHTH 5DP5A 1AO5A 2Z7FE 1DT2A 1F5RA 1GBDA 3MH7A 2G5VA 2W6ID 3FN8A 5F8ZA 3TGJE 1SGRE 3SJIA 4A6LA 3FO8D 1J15A 1GDQA 4D9RA 3UAIC 3MO3A 4O3UA 4B1TA 2JJ1D 3PRDA 1BTXA 5DPAA 4DIHH 1SC8U 2KCAA 5HXFA 1BTUA 3A81A 3BEUA 2A4OA 2ZDNA 1MCVA 3LGTA 4HI3A 1VITG 1ARBA 2B0FA 3AW0A 4JZEH 4I33A 1GI3A 1PPHE 2FX4A 1YY3A 2C3SA 2ULLA 2FLRH 2YMSD 3PO1C 1YCPH 2GV7A 1LPZB 1T8OA 1SGFG 3E16B 4GVUA 2Q6GA 3SW2B 2OUAA 3QUMP 3F1SB 1RFNA 1BOQA 3U8TH 2CF8H 2ZQ2A 1G3CA 2KR7A 1BBRK 8ESTE 3RXRA 1Y5UT 2Y82A 3SV2H 4BXWA 4B2CA 1TX8A 1F2SE 3AVZA 3GCHB 4WJG2 2Z94A 1XVOA 1LHCH 4FUBA 3GY3A 1FV9A 4NCYA 2O8MA 3ZYEA 1DXPA 3U98H 1E38B 2ZIQH 3HKJB 3RXHA 5C1XA 5J4QA 1RD3B 2AIPA 5TJXA 1F0SA 1TLDA 4BXSA 1C4U2 2HGTH 2VWNA 1ZSKA 1P01A 1EAIA 2O8TA 3SUEA 2RCEA 1C1MA 3LJOA 4DCDA 4A92A 2BLOA 2D2DA 2UUJB 3RC6A 1SQOA 1CHOF 1KLJH 1OP0A 2ANKH 3EYDA 1P04A 1GBCA 2Z6BD 3SGQE 3M5NA 1MBMA 3ZVCA 1TRMA 3ODDA 3DSPA 3SU0A 1AY6H 1KXAA 1HIAB 2AMQA 4U01A 2ZTZA 2OLGA 6GCHF 2V6NA 1DLEA 1GI1A 4XBDA 4KP0A 5T6DA 2CJIA 1TBZH 2TRMA 4LZ4B 2BMGB 1TRNA 4BANB 1IQMA 1DICA 3E0PB 3GICB 1QL9A 1TGNA 2FOFA 3QTOH 1LVMA 4FU7A 2FP7B 4YOIA 3P8NA 4KELA 1DY8A 2F3CE 1NO9H 2J34A 3BTME 2RG3A 1EASA 4WXVA 2BD5A 1UJ1A 2QYIA 1Y5BT 1TMTH 1C1QA 4K2YA 4CRDA 2R3UA 1OWHA 2FYRA 1Q3XA 3F9GA 5AF9H 1PPBH 4CRAA 3FP7E 2ZHEH 1GMHF 2OCVB 3CENA 1C5QA 5EG4A 5LH8A 5FCKA 1VZQH 1JIMA 1TABE 1Y8TA 1KXFA 3KL6A 3Q3YA 2PHBA 1C5OH 3VFEA 4DG4A 5DJ7A 5L6NH 5F53A 1QFKH 1SVPA 1W7GH 2W7UA 3GS9A 3K9XB 1UVUH 5GJ4B 1ZOMA 2XW9A 2A5KA 2Q6FA 2JH5D 1MTSA 2QXJA 3DD2H 1YLNA 4YTAA 1G3EA 1QRWA 4AFQA 5F03A 2JH0D 5C2ZA 2AIQA 1WTGH 2GDEH 4CR9A 2PR3A 2ZDVH 3T28A 2OTVA 5L2YH 1E35B 1LKBA 2ZZUH 4Y7BA 1OWJA 1GWAA 4SGAE 1S5SA 3RXQA 1CT2E 4YT6H 8GCHF 2BOKA 1WCZA 1UHBA 1Z8JB 1GCTC 3MU0A 2RDLA 2ZCKP 1CA8B 2BLWA 3D65E 1GJAB 1RJXB 3MU4A 4IS5A 1NRPH 3T27A 3TK9A 4BTTB 1PQ8A 1EAWA 4OGXA 1FONA 2CN0H 2G81E 2VBCA 3E0NB 1ESBA 1O3EA 2Y81A 4OM9A 3MYWA 2R9PA 1S6FA 1D4PB 3KQ5A 3NXPA 1G36A 1MTVA 2PWXA 5EOKA 2K0QA 4ABHA 1O3GA 1WAYB 1GGDB 1MTNC 1XVMA 5FPTA 1O2MA 3MH4A 2H6MA 3A8DA 2FOCA 2KZ4A 3TIUA 2W7SA 2J4IA 2XYAA 1B0FA 5HM2A 5DP6A 3AW1A 4TWWA 4UE7H 1PPCE 2VB0A 4RKJB 3EGKH 1UTKA 3PB1E 1SI5H 3K65B 1C5TA 3B9FH 1GI6A 5E2PA 1K1PA 3BIUH 4YLUA 3SNCA 1BJUA 2H9EH 1P11E 2ZU1A 3UNSA 2Y7XA 2H1UA 4P00A 1AMHA 1MU6B 1TRYA 3ZVDA 1O32A 4K1TA 2V3MA 1O3DA 5JBBS 4FUDA 3E8LA 1EUFA 4D9QA 2F9VA 1C1RA 4XBBA 4K60A 3PV5A 3VG8A 4AC9A 3KN2A 4ZAEA 3GY4A 2A4RA 3KQCA 3N7EA 2QGRA 4KGAA 4FVBA 1OWDA 5LPEA 1HRTH 1KLIH 2BDBA 4LZ1H 4FUFA 1GJ9B 4MDSA 2CHAC 4X1SU 2BLVA 3TVJB 3OY6U 3NPSA 1CQQA 1H9LB 1WBGB 1O2HA 4CHAB 1C5LH
chains in the Genus database with same CATH topology
2AGIX 1VR1H 3BTFE 1ZLRA 4JK6A 3RXIA 1N1LA 5A0CA 1KSNA 3TJUA 2BTCE 4JCNA 1FI8A 1UK3A 4KTUA 1FJSA 3LH3A 7LPRA 1OPHB 2QF0A 2BLQA 5T6GA 4WMFA 3O8DA 2RA3A 3RMOH 2PW8H 2VWMA 1SGEE 1CGIE 1NM6A 1YC0A 2ZFQH 3Q3XA 1O5AB 3IWMA 3SHCH 1O3CA 2W5EA 4MNXA 2QF3A 3TJNA 3OU0A 2ZCLP 2BY5X 2ZG0H 1AUJA 2BQWB 1T8MA 3T25A 4CH2B 2P16A 1C9PA 5FX6A 3TH2H 1NZQH 4YO9A 1O3BA 1TX6A 2ZECA 2ZPQA 3URCA 1QNJA 2Z3DA 3V7TA 1EB2A 3TJVA 1LHDH 1EAUA 1SR5C 1GHVH 4TPIZ 1ZMJA 4CRCA 1GMCF 5DP3A 3TK6A 1GJ4H 2OQUA 1NRNH 2ZU3A 1D6WA 1V2ST 3FZZA 3P8OA 1GG6B 4IBLH 1Y3UA 3OYPA 5ESBA 1VCPA 1TBQH 3P92A 1F0UA 1SBWA 2VIQA 1AWFH 2BD8A 3QZQA 1TMBH 1NESE 1TPPA 1HAPH 3TJOA 1FZZA 2FX6A 3UNQA 4MNVA 3PV4A 3SI3H 1DS2E 1N6YA 1JXPA 2ILNA 3RMNH 1DXWA 2J92A 1HJAC 2PKSB 4ZHMU 1YKTA 4GCHF 1X7AC 1TOMH 1AFQB 3E91A 2ZC9H 3V12A 4GHQA 1A5IA 5E0JA 4B2AA 1V2QT 3ATLA 2QN5T 1AKSB 3L3TA 3PM3A 4UDWH 1ACBE 2FS8A 2ODPA 1TX7A 3S69A 3M5LA 2NU4E 3BTDE 2HOBA 4FUGA 1RTLA 2P8OB 1XKAC 1AU8A 4RKOB 2Y6TA 1ELDE 1GBFA 7GCHG 4AFUA 1A0JA 2QA9E 4WF8A 1TPAE 1FIZA 1AQ7A 5GXPA 1INCA 1YPMH 1HV7A 2OP9A 1XM1A 3ZYDA 3MU5A 1GBBA 4CHAC 2IOTA 1Y5AT 1EXFA 2Z3EA 1GHXH 3PWBA 1A5GH 3T2NA 5TCAA 1TQ7B 1V2WT 1C2KA 1NT1A 3TNTA 3ZZAA 1U6QA 4UFEH 1JWTA 4K1EA 1NN6A 1K1IA 2VH6A 3VB4A 1G30B 2EI6A 1SB1H 3RM2H 4HZHA 3A80A 3SGBE 4HTCH 4SGBE 4NWLA 1FQ3A 3KEEA 1VITF 5EGMA 5A2MH 1MTUA 4D7FA 1T7CA 1SOZA 1AN1E 1HAIH 2LPRA 4XOJA 2C8ZB 2J9NA 2ZTXA 4AX9H 1TMUH 1SGTA 1IQNA 1ELEE 2FOAA 1ZHMA 1HB0B 1HPGA 4Y0YE 2FDAA 4Q7YA 1ELVA 3ENSB 4U2WA 6CHAB 2SNVA 3GCTG 2GCTB 2Y5GA 2BDYA 4UFGH 1NROH 4ABGA 1FDPA 1G3DA 1SMFE 2FM2A 4O3TA 3IG6B 2V0BA 4B76A 2UUYA 4R8TB 5F8TA 1GG6C 1W7XH 2SNWA 5G4BA 1LHFH 3M37A 4U32A 4DIIH 3C1KA 3MNXA 2QXIA 2FIRH 5HMAA 1QBOA 3QO6A 3UPEA 1KTTB 2H2ZA 1AE8H 4KKDA 1GPZA 4QT8C 2J2UA 5DGJA 1DUAA 2GZ9A 1AWHB 2QIQA 3ZZ6A 2A0QB 2ANWA 3KQDA 5DP7A 1ZPCA 2TPIZ 3A8CA 3SJKA 5C1UA 3FAOA 4ABAA 2PKSC 1W13U 1HIAA 1TWXB 3SORA 4XSKU 2ZKSA 1GHWH 1AFQC 3LDXH 1HDTH 4NZQA 3F6UH 1V2JT 1IAUA 3UOUA 4ZH8A 1BDAA 4H4FA 2BD7A 3LGIA 1L4DA 1UTPA 1ZRKA 2A2XH 3UR9A 4FUEA 5T6FA 3RXKA 2BVRH 4AN7A 1FY3A 3GYLB 1V2TT 2D26C 1P09A 1EPTA 3M3SA 4VGCC 2A31A 1F7ZA 2I6QA 1SGQE 2JKHA 1O2GH 3RXVA 3TITA 1PFXC 1T31A 1DOJA 2CMYA 4JMYA 1K1LA 1Z1IA 1ARCA 3MWIU 3F9HA 4GHTA 4XDEA 1SHHB 1OWIA 2F9PA 4NG9H 3OX7U 2A45B 1V2PT 2OC7A 4J2YB 5TCCA 3QN7A 3LONA 1YYY1 4FU8A 2TIOA 1FAKH 3BG4B 3GDUA 4A5TS 4F49A 1LTOA 3UOPA 2TGTA 2AYWA 4ABFA 2W3IA 2QC2A 4WWYA 1PYTC 2XC4A 1QY6A 3SGAE 2IPHA 2ZQ1A 1FPHH 1W11U 1PQ7A 2ZDAH 1FXYA 2STAE 3PLKA 4AYVB 3MNBA 1P06A 1GJBB 5C1YA 1NS3A 3U1IB 5LGOA 1ZHRA 1O3JA 4YM9A 4FU9A 3RDZA 1O5GH 3LT3A 4NGAH 1C5UA 3SU1A 1IQJA 4K8BA 1C2HA 2ANYA 1V6DA 2BVXH 3MTYA 1QL7A 1EOJA 1Z8IB 5CHAB 1C1UH 2GCTC 1G3BA 5HM9A 3UNRA 5JYIA 2OC8A 2FXRA 3A8BA 1TGSZ 3I77A 4H6SB 1WV7H 1GHZA 1CGHA 2R0KA 2Z9IA 1OYQA 1O5FH 8LPRA 4RSPA 2ZDMA 1C5NH 2QV1A 3T62A 4CBOA 1EP5A 2H5CA 4K8YA 1C1VH 1OSSA 1QA7A 3QDZB 4INKA 1J16A 3RM0H 1MQ6A 1FY1A 5B6OA 5E0GA 1V2VT 2DE8A 1YM0A 1AE5A 1EAXA 3A83A 3D62A 1O5CB 2ZGJA 3FP6E 2ZHQH 2G4UA 4AG1A 2UUKB 3RXSA 3U1JB 3KNXA 1O3NA 1BQYA 1FLEE 4MLFB 1EJMA 1V2OT 1C1PA 4IN2A 4NA9H 5DG6A 2BQ7B 2IN2A 4TYDA 3OY5U 2A1DB 4ABIA 3NKKA 2AFQB 4X2YA 1P03A 4WH6A 2F9NA 7ESTE 2ANMH 2OBOA 3Q3KA 4NIYA 5T3HA 3FANA 5E0HA 2FI3E 1MZAA 5GWZA 3G01A 1BTPA 1CA0B 1C2LA 1GBIA 1O2TA 5ABWA 2HLCA 3I29A 3SV6A 4Y8ZA 3M36A 1K1NA 1IOEA 3BG4C 3EA8A 5PTPA 1C5ZB 4GAWA 2THFB 1ANBA 1ORFA 2BYAX 1ZRBA 3FVFB 1GBAA 2PTCE 1DSUA 1QB6A 1O5EH 4JYUH 3B23B 1O2JA 1IQEA 3DHKH 1MMJN 4ZUHA 2BB4A 1MD8A 3BV9B 3ATKA 2K1QA 2ZEBA 2ZF0H 3P17H 1P8VC 1EOLA 2OC0A 5E2OA 3AASA 1LHGH 1XUFA 1E34B 1EKBB 1HXEH 2QXHA 2XBYA 3QLPH 3S9BA 1A0HB 5DP8A 2ZGCA 1DWDH 3UTUH 3MH6A 5HYOA 3MFJA 3LPRA 1O2YA 2NWNA 5BPEA 5CHAC 4FUHA 1EPTB 4JZDH 2ZFPH 2ZTYA 2FOHA 4ZROA 4E7RG 5FPYA 1WSSH 3A86A 3URDA 1LPKB 3PMHB 1C2DA 2ZU5A 2NU0E 3ATWA 1KTSB 1GBJA 1HLTH 4IN1A 1C4V2 4B2BA 4X1QU 3D49H 1A3BH 1GL1A 2CGAA 1TYNA 4ISHH 1SOTA 4DT7B 1PQAA 5GCHG 2D8WA 4CRGA 1C2FA 1QURH 1S6HA 1SPJA 2FI5E 1O3KA 2P94A 4IC6A 1HAVA 1GHBG 2XC5A 4E06H 4IMQA 1O2VA 4BAKB 5C5OA 1AKSA 1GVZA 2PKAA 3V0XA 1P2MA 1SLVB 2AEIH 3QZRA 1GBEA 1D9IA 2Y7ZA 3H5CB 3P6ZB 4R0IA 1O3IA 4U30A 3RXGA 2HRVA 3ZV8A 1CT4E 3JZ1B 2ASUB 3HK6B 4FVDA 4NZLA 1FAXA 4BTUB 1ZGIA 5EXNA 3PTBA 2HPPH 7GCHF 3W94A 1NFYA 2SGFE 3TK5A 3STIA 1HJ8A 1JIRA 1MBQA 3RXFA 1BRCE 3BIVH 4JYTA 3RMMH 4X6PA 3SV7A 2UWOA 1QA0A 5DP4A 4BAOB 2WUBA 4UFFH 2J95A 2ESTE 1BIOA 1C2JA 2FESH 3C27B 4ASHA 2C93B 1SSXA 1NTPA 1HCGA 1O30A 1ELBA 2CF9H 2D1JA 3GCHC 4XE4A 3TU7H 1DWBH 3ZVEA 1ELFA 4Y8YA 4D76A 1AZ8A 1O3LA 1ETRH 1EZUC 4D7GA 1A4WH 3L33A 2XTTB 5JPMH 2XXLA 1P2OA 2HPQH 3A7XA 1AD8H 1V2UT 2XBVA 4BAQB 2P59A 4X8TH 2VGCB 4X1NU 1QJ7B 5AFYH 4AORA 1BTWA 4A1XA 4B73A 3HK3B 1LPGB 3P70B 3GCTF 3ZV9A 1SGDE 4ZXYH 1C1OA 4UD9H 1P2NA 3GY2A 4BTIB 2HNTE 3IITA 2FZZA 1O38A 3K2UA 4NSYA 2Q6DA 1C9TA 1IHTH 3BSQA 4X6NA 1AFEH 1TNJA 1QB1A 1K1MA 1EPTC 4TY7A 2ZU4A 1ID5H 1QBNA 1IQIA 4Y7AA 1LVOA 5DO4H 4AB9A 4I8JA 1FIWA 1GBLA 1QBVH 2DE9A 1ANCA 1KXBA 3VB3A 2R3YA 2ZHFH 1D3TB 1H1BA 1Y3VA 5EPYA 1Q31A 3SQEE 1O33A 1YPGH 1WOFA 4YESB 2BXTH 2Z3CA 2BD2A 2WINI 2ZI2H 3LGVA 3RXPA 5LPFA 1OP2A 2C8WB 2B8OH 3ATIA 1K9OE 3RXTA 2ZHWH 2BOHB 3E1XB 1XKBC 4GSOA 1UTNA 1L1JA 5K7RA 3KIDU 3M61U 2F83A 3E3TA 1HUTH 1O2XA 2H5DA 3A82A 3TH3H 5AFZH 3RUOA 3KQEA 2J38A 1O5DH 4FXGH 3RLWH 3SJ9A 2YNBA 2C8XB 4GLYA 1JBUH 2Y5HA 1B5GH 1N6XA 1THPB 1Z8GA 3SNDA 3M35A 1RRKA 1MZDA 1KYNA 3RC5A 1LVBA 4CBNA 1GVLA 1QHRB 4IGDA 1KLTA 4O97A 3FFGA 5JBTA 1C5YB 5EXLA 1P10A 3HGPA 1T8NA 4AZ2B 2PGBB 2ZO3H 3CP7A 2O8UA 2GT8A 1EP6A 2ZDLA 5EODA 3P95A 3RXEA 1QL8A 2GZ7A 3SU2A 4Y0ZE 4BAHB 1FUJA 4OS1A 2QY0B 5IYTA 2FS9A 3O8RA 1O35A 1EQ9A 1VCWA 1ZPBA 2GP9B 3BTEE 3KCGH 4NFFA 1QGFA 3GY6A 1GGDC 1K1JA 1PPFE 3ZZ5A 1C1WH 4NA7A 1XUIA 5SGAE 1P9SA 1SL3A 2BHGA 2VU8E 1CHGA 4NSVA 1YPHC 4AFZA 2WPLS 1P2IA 1HAVB 2VGCC 4LK4A 3UIRA 1JRSA 4GPGA 2PKAB 1BMLA 1PJPA 3LC3A 1GHAG 1ANEA 5L30H 1ZTKA 1W0YH 1G37A 2PLXA 1NU9A 1QRZA 1SFIA 2VVVA 2P93A 1F5LA 1UK4A 1OS8A 2PV9B 3KHVA 1A1RA 2Y80A 4MPUA 1SG8B 3SUGA 1CT0E 4OS7A 2QAAA 1J9CH 3EA9A 3RXCA 4ABBA 3BTQE 4INLA 4OS6A 1QRXA 1S0RA 2A5AA 3ODFA 4THNH 9LPRA 3F68H 3S7KB 2QCYA 1EZXC 1D3QB 1B7XB 1P3CA 2FWWA 1LKAA 1ZYOA 3QWCH 1P57B 1EB1H 1HAGE 1HAOH 5FBEA 3RU4E 3A7WA 1AVXA 4ISNA 5L2ZH 3KF2A 3EE0B 1DM4B 1G2MA 4KTCA 5J4SA 1Y3XA 1P2KA 1DSTA 4NIVA 3EDXB 3SUFA 1NRRH 3MHWU 3P8GA 4BOHA 4XFQA 1OWKA 4TWYA 1M9UA 5DK1A 1WU1A 1F92A 3W95A 5EQRA 1C5SA 3VEQB 1A3EH 4A7IB 3MO6A 2FPZA 2Z9KA 4FUJA 3RXLA 3AAUA 1BTYA 2ZWLH 1UTQA 1HNEE 4Q80A 1MCTA 4ZKOU 1H4WA 2WPJS 5A8XA 1DY9A 4WH8A 4ISLA 2XWBI 4Q7XA 2BY7X 3SU3A 3ELAH 3M7UA 5EPNA 1MU8B 2AGGX 4WY3A 2F91A 1C5XB 5EQQA 2KAIA 4MPVA 3PMBB 1HAXB 4YLQH 1ZTLA 5CE1A 1ZSLA 4K5ZA 1D3PB 1LQDB 2WPKS 3ZZ8A 2EC9H 1AVWA 7KMEH 2Q1JA 2B9LA 1BMNH 3GISB 2AS9A 1BJVA 3BF6H 4ABEA 4DGJA 1SLWB 1LCYA 3NK8A 3RP2A 5F6MA 2C90B 1CSOE 2R2MB 4E05H 2XBWA 3M3VA 1YBWA 2FOGA 1O2RA 1XUHA 1GDUA 1YLCA 3GY5A 2WPHS 5A8YA 1GJDB 1C5WB 4ABDA 2C8YB 3SHAH 3B8JA 1CO7E 1GI0A 4X8UH 3VGCB 3K6YA 1C5VA 5C5NA 2P8OC 5FAHA 3ZZDA 1GDNA 1BUIA 4YOJA 2J94A 2BXUH 1DVAH 5GPIB 2BVSH 4AGJA 1L1GA 5GDSH 3BG8A 1H8IH 2ODYB 3NWUA 1ZMLA 2YOLA 4JK5A 1DUEA 1IQLA 5GCHF 1K28D 4UFDH 5DKMA 1SGPE 1JOUB 1ZTJA 3ZZ7A 4DOQA 1RGQA 3LGYA 3M7QA 1O2IA 1GHBF 2Y5FA 4CRFA 1K21H 2DUCA 2Z9GA 4IW4E 4Y6DA 1XX9A 1L1NA 1BRAA 1O2WA 5ESTE 2ZGBH 1O3HA 3V13A 2G52A 3RU4D 5GIBA 1O37A 1LMWB 1SQTA 1BT7A 4X2XA 1MKWK 1O2ZA 4MPXA 3SUDA 2M5TA 1SFQB 3Q77A 4AOQA 4Q7ZA 3UUZA 2I6SA 4X0WU 3AAVA 3SQHE 1UTMA 3EA7A 3LJJA 3MOCA 1QCPA 1TAWA 1GI8B 1RTFB 1HFDA 1GBMA 2R0LA 1ETTH 6CHAC 1YGCH 2BD9A 3ZZCA 1FMGA 1GI5A 3V3MA 1TIOA 1VJAU 3QK1A 3TGIE 1KIGH 2BDCA 1UCYH 1C1NA 1PPGE 5AHGH 2AMDA 3RXUA 2NU1E 1TA2A 3LGUA 1SGYE 1BRBE 4JZIA 3ZZBA 3KGPA 2XWAA 2SGDE 3LU9B 3S0NA 3H7OA 3TLOA 3U9AH 3ITIA 1F5KU 3MU1A 5EQSA 1W8BH 1RXPA 1MTWA 4X8SH 1TOCB 1O3OA 4AG2A 1YPJH 4Z0KA 1DPOA 1KXCA 1T4UH 2P95A 4CR5A 4NIXA 3VB5A 4MVNA 3TH4H 4I8KA 1TNHA