5DJCA

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCVVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA01
1KB5A 1UQSA 4LHUA 3PWUA 4GW1B 2OK0H 3O0RH 5LCVL 1S9WA 4LSQL 3TYFA 3LKOB 2Z93B 1AR1C 2FHBA 4ESKA 3F7PC 1Q8MA 3QFDB 5I8EA 3QZWA 5ISZE 1ES0B 3PV6A 4U1KA 3UJTL 1UM5L 5A2FA 1EEYA 3W5MA 2J8UA 5CZKA 3N06B 1DQML 1G7IA 4LCIL 4YNYB 1GOHA 1UC6A 3U6RB 3MBXL 4BQ8A 1PEWA 5EBLA 1UG9A 3WLBA 4Y8DC 3I2CL 1R3JA 3K4ZA 3HI1B 4YLQT 4HG4K 4G42A 1HHHA 2YSSB 1Z2KA 1OSPL 3QEGL 3H42H 2Q3ZA 4ZPTB 4MXQC 4J8RA 4UU9A 3QIWA 3ZYIA 2ID5A 5D8JH 7CGTA 2IH1B 4RAVA 2DI8A 2OR9H 1CL7I 3B3IA 3FB8B 4NQVA 2AABL 4ZS7H 2ENYA 2CGRL 4MDIA 3MREA 1EAJA 1WAAE 3V0VB 3QB7C 2BVPA 4Z7WB 4OFYA 2XY2A 3RGVA 3U0PA 4S2SB 5E5RB 3CUPA 2VDKH 2MPAH 5CFHA 3WS6A 3GJFA 3LN4B 3QAZB 4GKNA 1D5IH 1JV5A 4W6XB 4XCFH 4L8CA 1ND0B 5L8KB 4QOKE 2V5RA 4ZNEA 5MP6L 1WBYA 3T3MF 4KV5F 3HTLX 1PLGH 3LKNA 1GPOH 1ZT4B 3KPQA 2EIZB 1UCBH 1B90A 4QHNA 4BH7B 3W81A 1UVQA 1H9VA 1TNNA 3QCTL 4HGWB 1A6PA 1KCLA 5TF1H 4RGND 1OLLA 1RIUH 3TBYB 4JZJB 4LCWE 1S8DA 3RWCB 4O5LH 1Q9OA 2X7LA 4HC1L 1EBPA 5GRXG 1KIQB 3T77A 1NLBL 2CDGA 5CUSL 5E1HB 1DBBH 5F9OL 5TE7H 3ARXA 5EORH 1UCTA 1RZIA 5K59E 1L7IH 1X9QA 4QY8B 2VR4A 5A16A 2DQTL 3NA4A 1C08A 3SO3B 1BD2B 4JPIB 1KXVC 1J5OH 1G0DA 3BE1L 3VRIA 4M61B 5IVXE 4PYGA 4HWEL 5DQJB 4KZDH 1BFVL 4NQDA 3QR2A 1VEMA 1NAML 4OAWB 4BZ1L 2HVKA 3EYOA 1M05A 4I48B 4WI4A 2O93L 5B4MC 4Y5VB 1XF4B 2DKUA 3TJEL 4XNZB 4YHKH 4Z95H 3TZVA 4E41B 2X1PA 1QFOA 4DK6A 3GIZH 3BKML 3MNVA 2GJ6A 5F96H 3O2DH 3ULVE 4L4VD 5HDOA 5JQHC 4HV8B 4KKAC 1I4FA 2BY3A 3BP7B 2H3NB 1UWXH 2E6QA 1DN0A 2YRPA 1Z9SA 4NKIH 1IVLA 1ZT7B 5JORA 4U1IB 2R2EB 2BSSA 1E4XL 1J11A 4LOUC 1ZEAH 5TDOA 5DSCB 5HJ3B 2DLFL 1HKLH 1FNAA 1OF2B 3E8UL 3GHEH 6CGTA 2ESVA 4I3RL 2BRRL 5FXCH 3O45B 5AG8A 5IGXL 1OD9A 1T0NB 2PYEB 4ELKA 2ATKB 3DV6B 3IDYB 5E99H 4OCRL 4ONFH 1A9BA 5T1LD 4HWNA 3PP3K 4PLNC 3UTZA 1KB5L 3DXAB 3E3QE 3QULA 1F13A 4Y8AA 5GRYA 3U0WH 1BBJA 5BV7B 3ROLA 1UZ6E 2VZ3A 4QNPF 4BYHA 4YHMH 4HWZB 3QXAB 1NDGB 5BZDA 4PJ7B 1NMCB 2VAAA 3G04B 4JLRB 4UB0H 4HZLA 4YUEL 3EYFB 3V6FB 3RZCA 5FM5M 4P5TD 1X5FA 3VFVA 2WUBL 2LE9A 4YBLB 4I2XB 1UH3A 4JRWA 1U95B 4OZGE 1P7HL 4HPOL 2FJFB 3EJZC 1NGWA 5CLWA 3O3DB 1MPAH 5FAAA 5J12C 4JM2D 3MV8A 4URTB 1YMMD 4L29A 3DUSB 1JF5A 1I3UA 2G5BA 4LIQL 1CD1A 2QKIA 2B7DT 3O41A 3IVKB 4TULH 4YHPA 1HIML 4LVNC 5HYSB 1N2RB 3RWEB 4CU6A 5FA3B 2W0FA 2CR6A 4LF3A 4NO0D 4DGVH 2FGWH 1XIWD 2HH0H 1AO7B 1T3FA 4I13B 5JW5A 5FB8A 4HX1A 4U31A 4YBHA 1VSCA 3I85A 4FZ8H 4M7ZC 4OGAC 1WFUA 2JIXD 4F37F 3RDTB 1Q9KB 3D48R 4I9WD 1IZJA 4PG9A 1ZHKB 3OKLA 4KTEH 1G6RA 2A6KB 5CBAB 3HAEA 3IF1A 3SQOL 1G7MA 1AGCA 3HR6A 5BW7A 2VN7A 1RK1A 5CJXC 4N9OB 5TF0A 1R5IA 3RJDA 1ZHLA 2W60B 4R0LC 1ZSDB 3GK8L 1LE5B 3ALXA 3JTTB 3VXRE 1U8KB 5DK0A 4BUHA 1I7RB 1AD0B 3PABA 2P8PB 2X1WL 5CINH 5BJTA 4CVXB 2FZ3A 1N5YL 3CVHA 1A7QL 3MJ8A 2IPTL 1A6WH 5FOBB 4UT6H 3R8BB 4JKWA 5BS0E 2I07B 4KDWA 3BRDA 4FQXA 4MNQB 5C0AD 3VXPB 3FZUC 4XVTH 1G9NC 2NY6D 5GS1A 2Z92A 1AGDB 2AXHA 2RB8A 4MCYA 1TJGL 1KTKE 3JV4B 1MHCB 2AI0L 3V6BR 1UXWA 3ZE2F 3PWVB 3UROR 1FJ1B 1MCCA 5JXED 4P2RB 3FFDB 1FL5A 2YRLA 2B0SL 1B9ZA 5CEYA 5FM4A 1FFOA 3HPLB 1NCCH 3VD7A 1JFQL 3BPOB 2YA2A 4GRWF 4JFFD 3NFPA 3GBNL 4G6JL 3N1FC 4JE4B 4NHUB 3I02B 4L9LA 3G5ZB 3DROB 1T80A 4U6VL 4XBPB 3QUYD 1WEJL 1UFUA 3N85L 1F3JB 1BVLB 2DIAA 4PRPB 2FH6A 4J4PC 4P9ML 1JNHB 2ZG2A 3RZWA 3U30C 2CLRA 4OGYL 1OW0C 3ARFC 5FUOL 4F7PA 3IAPA 1U42A 1SYVA 4GSDL 3S97C 5EU5A 2HFTA 4HCRH 2DDQH 4Q9CA 5A40E 1AI1H 3GBLA 5A1AA 1CLCA 2E9JA 3MGOB 3VWJD 4DGYL 4JAMA 1RJLA 4HKXA 3D85D 1F8TL 2VH5H 1CFVH 4YXKH 5K9JH 3OKMA 3VXOA 4PLOB 1YEGL 3NPZB 5CGTA 1A7RL 3JWOL 3Q6GH 4PRIB 4YQXH 3QIBB 3TT3L 3ZO0A 4KY1H 1QSEE 3ZYZA 3C5ZB 3G9AB 1SJHA 4W6YB 5GGSY 3GSUB 1QBBA 3CSGA 1A5FL 2ADJA 4PP1D 2F8XC 4QRTA 3IU4H 2NY4B 4NT6B 3HC0A 5AAWA 1AGBB 2ICES 1TZHB 3D3VB 4ZS6D 1K4CA 3BDYH 3L3HB 5BRZE 2R2HA 1MH5A 4UIMB 2H8PB 3O2WH 4P23A 1GXEA 2NY1D 4MLSA 1JF1B 2LAAA 4RDQF 4NBYB 5E4EC 1G7LA 1PX3A 1P2CB 3DMMA 3EFFB 1BZ9A 4LBEB 2W38A 4KMTH 4RQQB 5HYIA 1KYOK 3LZFL 3OZ9L 5D1XB 1HXYB 4KGJA 2FO1A 3PJSA 2W9DL 1K3ZA 1DJSA 1FNEB 1R3HA 4QRPA 2HT3D 3QUKB 4X7EC 3NTCL 5IOPA 1CLYH 5H35B 4KKBC 1E27B 2QLVB 2F19L 4MJ5B 2XG4A 4N0UE 3VXMB 2GI7A 2JJWA 2I9LB 1MIML 1RK0A 5C92A 3H7BB 3HMXA 3HR5B 4PGDA 3CSYB 5A3ID 5F3BB 2RBLA 5AZEL 3OTTA 4KROD 3BMVA 1G6RL 4AG4L 1A4JB 3OKYA 3BWAA 4R7DA 5MERB 3FO1B 1J0HA 1GAFH 4P5TA 1D6VL 3ULVC 4QRQA 1S7VB 4FQCL 4GAGH 3RVVC 2BY0A 2G9HB 2FIKA 4NQCB 4EOWL 3HG1E 3QWOB 1V3MA 4GJTB 1DBJL 5EOCJ 1YMMA 4IJ3B 1CFSB 4L8SC 5E6ID 3KS0H 3O9WC 5L2KE 1EO5A 1N7ML 3T0ED 4IRJB 1RUAL 3CVHL 4WY7L 3QHZH 3NIDE 3JUYA 5LWYH 1Z3GL 4XMKL 4XGZB 1I7UA 1TVDA 4WGVB 4NO0A 4N1EA 3HA0A 1XIWA 3GI8L 5TPWL 4OFPA 4MS8D 2ZSVB 1P4BL 4UDUB 5ALCL 4OLZL 2JIXA 5T1KD 3RGHA 1T0MB 4X6BB 4HUWB 2VDML 1ZAGA 4KJWD 4G8EA 1ZTXH 4RRPG 2EDDA 1I9IH 5IMKA 4WTZA 3QCUL 4LASH 3KJ6L 1NEZA 5CSZB 3VD9A 1S7SA 4ZUSA 1NMAH 1DTUA 1HHJA 5KSAD 2A1WH 5I8CA 5DRXB 3UTTE 3IKCA 4PJIE 4MVBD 4HWBA 4YDIL 3IDGA 4YK4B 3WEXA 1VB9A 2EDOA 5KSVA 4U6HB 2EE6A 3ZMRA 1NFDF 3TCXA 4G3YL 3STBA 1WFTA 4L3EE 2X05A 2A74A 3LMJL 4O4YL 2F54E 3F7RA 2EYSB 1NFDA 2UYLA 1T0PB 4X7TA 5E9DB 2Z8WC 1TCRB 4L4TE 3KXFE 4CMMB 4KKLD 5FKPA 3ULUE 4OIIH 5ENWB 4Y2OA 5D7LB 5C0BB 2VXTL 3O11A 2XWBB 2AXFA 4M1CD 4NN6B 4F7EA 25C8L 5JXEA 4HJ0D 3IDIA 3ROOB 1NFKA 2EO1A 2DQIH 4ODUB 4B0MM 4JHAH 5I17B 1U8QB 3UO1L 1H5BA 4JFFA 1FC1A 2B4CC 4PR5A 1FPTH 4TSCL 3FN0H 4RMTA 1F6FB 3CC5A 1VFOA 3A67H 1QFUH 3BP6B 3QUYA 4IOSD 4Y4KD 1MCDA 3GMQB 3GRWA 1W0WB 1RULH 3PQYB 4G6FB 5DO2D 3ZKXC 4PRDB 5FO7B 3C8KB 3SY0A 2EXYD 1A4KB 5DJAA 3IDUA 1HCVA 4YH6A 3QDGE 3V8CA 1AIFB 1QG3A 3R06B 5KVDH 2VAJA 4ZUTB 5H8DA 2RFXA 3WIIL 2HLFC 3VWJA 3KWWA 3CMGA 2Y1VA 1HXMA 4JB9H 3WUWA 5I19L 3FHAA 3O6LH 3RIAF 1MJ8L 3KNBA 3DLQR 3L3DB 3RP1A 2W9EH 1BJ1J 5GZND 3HMXL 4R96A 5E2JA 4LSUL 2OL3H 3HZVA 5MHSD 4S1DD 2NY0B 4LU5L 2KZWA 2IAMA 2MMXA 4TUKL 1A14H 1RPQA 4JFXB 4DFHA 2CPCA 3HNSH 3OGCA 3VFSA 3OV6A 3MYJA 1Y18A 1XR8A 3STZA 2QTEA 2VDRL 3WNOA 2X4NB 3JUZA 3MLVH 4G7YL 3BFOA 5DURB 4HF5L 3CZFA 1T7XA 3W2DL 5JIPA 5GGQH 4IIQB 3P30L 4P48A 1NAMB 5SWSA 5CIPB 1DSFH 2YR3A 1IFHL 1FE8H 4UTAH 2XV6B 1EUUA 3S5LA 2ORBH 4XP9H 3OB0K 3QUZD 1JNNH 2YXMA 4G7VH 1F3RB 3P4OA 1OVZA 2VABA 3MRPA 2CKBA 1ULVA 2BK8A 3OMZA 3JTSB 1P4LB 3D6GA 1NANI 2B8OT 4UV4L 4BSWA 2EDWA 2AJUH 1LVEA 1V7NH 3O2VH 3TVMA 3LSOA 1G0XA 1IAMA 4XBEH 1J05B 1KJ2A 1FGNH 3BKYH 4OV5B 4DAGH 1MY5A 1FNFA 4P2QE 3I6KB 4HWBL 3QFJE 4QRSA 1WZ1L 4XWOD 3O4LD 4BFIA 3LKSA 4O2CB 3MLZH 1BQHG 5JDSA 3L9RB 3BWUC 5E5MB 5GRVK 1NBVL 1UH4A 4JR9L 1RIHL 4KJYA 2HFEA 5H94A 1B0WA 4Q7DA 2PCPB 2UY6A 2FO4B 4X80H 2DQHH 1KB5B 1CICC 1PZ5A 1UQSB 4LHUB 3RUGE 1BF8A 5T1DH 2F5AL 2XKSA 5E00A 4W81A 5AUMB 5IROC 5ILTH 3CPLA 3VRJA 1U8PA 3TYFB 4HIHB 4D0BB 5IT2H 5FYLH 3PV6B 4ZUWB 1AD9B 3O8XC 4U1KB 1J1OL 1T5WA 1L6ZA 1EEYB 2C1OA 3MRJA 3QSKB 3W39A 2J8UB 3Q48A 1G7IB 5I15L 1NLDL 5C2BL 1MFAL 3BP4A 2DLHA 3TA3C 4LHQB 3I50H 4OCWH 4QWWD 2WWKT 4DN4L 4RFOH 3WLBB 1JHLL 1UXSA 5ESVB 1R3JB 1WWCA 5KSAA 3I6LD 3TO4B 2BVTA 5FDWB 2BMKB 1NBYA 1FO0A 1WIUA 3I75A 3RNQB 4H25A 4J8RB 3QIWB 1MI5B 3VGEA 4XVSL 4UT7H 4RAVB 4NZUH 3B3IB 1X5JA 1G1CA 5FO8B 4JQIL 1TVBB 4X6CE 1INEL 4OLEA 3G6DH 2ZCKH 4MDIB 3MREB 4C56B 1QYGL 4KK5C 5IJVA 4AIZA 5DFTA 1RZKL 4GW4A 2BVPB 4QF1A 3RGVB 3HE7C 1M6OB 3WFHA 4JJ5A 2CKNA 4YHZL 1MCIA 3GJFB 5SWZE 4HQQL 4GKNB 5B3JE 1JV5B 4L8CB 5GJTH 1FFPA 3LVEA 1Y6KR 4DKEH 4D94A 4N5EC 1DUYB 4MSWA 5ICZB 1WBYB 1Z9OA 1QFWL 4JFOA 1RZ7L 4MJ4A 5D7JD 5C08E 3KPQB 1IILE 4MJIB 5IBTH 1BEYL 5TE6H 1OP3H 1ZLWK 1UVQB 1FSKB 3AB0C 2LVCA 1KPRA 1I3GL 1ZLWH 1I9RH 1YEJH 1S8DB 1Q9OB 2X7LB 3NCEB 4PJ5D 3T77B 4F9PA 2W92A 4YWGL 2CDGB 5E1AB 2UZXB 1G7JA 2FBJL 3V0AC 3P4NA 3WJJA 5CD5C 4G8GA 5HYJD 1KTRL 4LSPL 5AZ2L 3MRQA 4E0RA 5F7FA 3ZHDA 3FO9B 5CJ5A 4Y4KA 1I1RA 1RZIB 4QHLB 5ERWA 5JUEL 3IS0X 2W0PA 5A16B 3QEUA 3ARGC 5KS9F 1C08B 3VGBA 2MQCA 4FQJL 5C0GA 2EYRA 2HJLA 1P69B 1K8IB 4WEUD 5GZOD 3HUJA 3O6FB 3VRIB 5GGTA 5KS9A 3FQNA 1KCRL 2LV4A 3D0LB 2P5WD 3ZDZE 3LRSA 1BJ8A 2YOCA 5FYJL 4F58L 2XZAH 3P11L 4NQDB 4HH8A 1EV2E 2HVKB 3EYOB 1M05B 4OLXH 5D5MF 1I7ZA 4J12A 2Y6SC 2V2TA 4ODSL 4AK1A 3UTQA 3TZVB 2VXUH 5D5MA 3ULUC 3MNVB 1JTTA 2ZG3A 3N9GH 4PG2A 2CKBL 3MOBH 1BPVA 3K8KA 3LQMA 1JZ4A 1SHMA 1T1WA 5AYQA 1N6QH 4FS0A 1DCLA 4LCCA 1MFDL 3OXRA 2FIRT 3WFEH 1JGLH 1MHHA 2VXQH 5CJBA 5JORB 4BQ9A 4OZ4A 2V5SA 1ZE3C 4NJAH 5TDOB 2HRLA 4Z7OE 1KJ2L 3UTSD 2D3VA 1BVKB 1FG2A 1MAMH 2ESVB 3VW3L 5CEXB 5D72H 4PJ8D 5CD3B 1D5MA 4U3CA 1L7TL 2IBBA 1DFBL 1HHGA 2J6EH 3WN5C 3DRQB 4H88L 2AEQL 5GGRY 1N6UA 1IQWH 3WIHL 4ZSOE 2ZOKA 5HD8D 3T2OA 2EDRA 2A77H 1A9BB 1FZKA 3QJFA 4LQ1A 3CK0H 5C1MB 3UTZB 4FFZL 1SY6H 2NQCA 3SDCB 2AJVH 4S1SL 5IVXF 3QULB 2GSIA 1IM9D 2APVA 3QUZA 3TNMA 3OAYK 1BBJB 4UAOC 4KHXH 3VG0H 1ZOXA 3ROLB 3VG9C 5C8JB 2FATH 5I73B 5JHDA 3OAYH 3F7VA 3RVXC 5BZDB 1MY7A 5HGHA 3EYSL 1UJTA 2VAAB 4PLKC 3QT2A 4M1DL 2XN9E 1KBGL 4Y7MA 1TCMA 3VFVB 4RMQA 4K9EL 3ZYJA 1I9EA 1VKXB 4HJJH 1DL7H 5D7IB 1NUDA 1RMFH 5C0FA 3S34H 1DANU 1NGWB 5DUPH 4HHAA 2HJKA 3IFNL 4U6YA 3MV8B 5I1GH 1HSBA 4L29B 1FO0L 3BT2H 3TN0D 3O4LA 1CD1B 2QKIB 2UWEB 4HJGB 3O41B 4D8PB 5CLTA 3OF6D 5MENE 2XT1B 2EE9A 3NACH 3K2UL 3CFEA 3MLSL 3MV9E 4YHPB 1FRGL 1IEAA 1QNZL 1K8DB 4ONOA 2W0FB 2ZUQC 4LF3B 5KVEH 1YEKH 3MLXH 4N9GB 1T3FB 2NXZC 3IJYA 5DVKA 3S98A 2AJSH 4DJMA 4NFDA 3ARRA 2HA1A 5HI4D 4HIEB 4U1HB 4RGOH 5GRJL 4XMPH 5EA0L 1G7MB 3PE9A 4K3DL 2EIBA 1RK1B 1N0XL 4GRLC 1R5IB 2A6JB 1NCWH 3ARBD 1F4YH 3F65A 1JF6A 2ICWI 1OGTA 1JGDA 1PKQE 3BKJL 1BGXH 3PABB 2NCMA 3S35H 5BJTB 4OZGF 3WL9A 2FZ3B 3T1WA 3CVHB 3MJ8B 1MCNA 2BFVL 4AEHL 2W91A 4NSKB 4Q6IA 1CGVA 3QRGL 4UINL 3EJYC 5GS1B 4LRNH 2YUWA 5IHZA 1F6LL 4YXLH 4MCYB 4MXVE 2DYPD 2CLVA 5D6CA 2X70A 1UXWB 4CNIA 1JK8A 3K4AA 1FL5B 4HSQA 2OP4H 3ES6B 1CDCA 4H1LA 5DJ2A 3D69B 4ZUUA 3H8NA 1FFOB 1IKFL 5CEYB 1YEEH 3RNKB 1EIBA 2C7UA 5DHVA 4PRHD 3NFPB 4Q2ZA 4J3WA 1NGQL 3RA7L 1RZFL 3MJ9A 5CKGA 4L9LB 2V5MA 3VFUA 1AKJD 4K3JL 4RGNB 3GMLA 1G7PA 4U3XA 2E7CA 4NKMA 2A6DA 1PYWA 4PJ5A 5F70A 4LNVA 5I75C 3TYGL 5K9OA 4KRMB 4MQXD 5TDNB 4ZO8A 2UZIL 2X4TA 3HB3D 2XXMB 3WJLA 3P77A 4TPRH 2CLRB 2DM4A 1R3KB 1NAKH 5IVOA 4F7PB 4YXHH 4R4BA 3LN5B 4RFNB 5EU5B 3UBXA 2B1AH 3CFKA 5EC2A 3X12B 1PG7X 1QLFB 4M62L 3GSOA 1IGMH 2AK4E 1A1OB 2FB4L 1RJLB 3MLRH 4HXBH 2Z0BA 4HKXB 4PJCE 4KJQC 1A9EB 3BP5A 1CE6B 2ILLA 2P5WA 1KJVA 5D7KE 1T5XA 3OKMB 3VXOB 5F1KC 2OSLB 2OZ4H 4V1DD 5GGUA 1N64H 3LEXA 3VH8A 1CDHA 1QRKA 4WEBL 3WE6A 4L4VB 4FRWA 1NGPL 1SJHB 3LS5H 3CCHA 3OSKA 1JWMA 2WP3O 4K8RL 4JM4L 5FECB 4QRTB 3U4BL 4C4KT 1RZGB 3DGGB 2N7BA 3HC0B 5DFWH 2Q8BL 1UM6L 1BVZA 3KVQA 2DM2A 1K4CB 2R2HB 5D2NE 5CGYD 3L5WA 2FSEA 5AAMA 4FFWC 3V52H 1QLEH 1WBXB 4MZ2A 3NZ8A 4WHCA 3QDME 4U7MA 3MLWH 3UTSA 2VDNL 1G7LB 1OWWA 4P9HC 3LD8B 1NCUA 1BZ9B 1MQKH 4PJ8A 2WUCH 2X1OA 2FJGA 4JQVC 1FAIH 1IGJA 5DF0A 5D70L 3EUUA 4ORZC 1R3HB 1D5BB 4UUJA 2VMFA 5F7EH 5T1LB 2QHRL 3RVTC 5ITBH 5L7XH 3C6LC 5DK3A 3KLAA 1RK0B 5A43C 2YK1L 2BVYA 4OJFL 4X5LA 1T1YB 2MNUA 3JWNC 2OQJA 4PGDB 5D71H 5GHWH 3UDWA 3MRKA 5TH2A 3BUYA 4M7LT 4RAUA 5KW9H 1CXLA 4XTRD 1OTUC 2BXZA 2VIRA 1K5NA 3QUXC 3BWAB 4NKQB 4P5TB 3C09C 3QXDA 3PGDA 1PG7L 4QRQB 3TJHD 3ALWA 3BI9X 2FIKB 3SJVD 4HMCA 3MUGA 4UNUA 1EGJA 5KN5A 1ONQA 1KXQE 4WO4C 4JG1H 3CLFH 3PP4L 1R5VA 2OJZL 3G9VA 4JM2B 3V4PL 5GIRB 1YMMB 3SKUD 4Z7WE 3TN0A 3QQ4A 3FONA 3OF6A 5ITFA 5DFVD 1H3UA 3CX5J 1OAXL 4ZAKC 1I1FA 4XVUD 1CDJA 2WAHA 4I0PC 4NO0B 4W4OC 5H2BA 1CXFA 1WQVT 4KVNL 4HPYL 1XIWB 1ZLVK 1NC2D 5C2UB 2P1YA 4P46D 5DQ9A 3BZDA 2JJSC 3AY4A 4TNWK 4CKVX 4DEPC 1JYWA 3SDAA 2JIXB 4J3SA 4MXWH 3V6OC 1LHZA 4NO5A 2MSPA 5DC0A 2EXWD 5EWIH 1Y6MR 4MNHA 1NEZB 1S7SB 4ZUSB 5I1AA 3FQUA 1FP5A 3MODH 1CU4L 1HHJB 4LEOB 3K1DA 5I8CB 4XNUH 4QXWA 3TWCL 1Z5LA 2VJXA 1F3DH 3MJ9L 5D1ZA 3NA9H 3IDGB 3BSZL 3O81A 3ARBA 3CD4A 3WEXB 2VE6B 5GISH 1MRFH 2AXGB 1OAKH 3MBEC 4WUUD 5ANMA 1HH9A 2IPUK 4P9HH 1BD2E 2O5XH 2C4FU 4AMKL 1XZ0A 2A74B 4GG8B 5I9QC 5DD0L 5DMGC 2IG2L 4M7JH 1NFDB 2UYLB 3B9AA 1EBAA 1FV1A 4RGMC 5B39A 5E6YA 5C6PB 2A9ML 2PXYC 4X7TB 4A6YH 5ESAA 1U93A 1QBMH 1YNLL 4X4YA 3L7FA 5IFHL 2YD5A 3BGFB 5C0AB 3OKNA 3K2MC 4PS4L 2VDQL 5EG6C 4KZEL 1JZ6A 2NY6B 2X2YA 4WI8A 4JKMA 4OF8A 1GGBH 5FV2A 1H15B 4X6DF 3O11B 4AIOA 4WTWA 4NRZA 2R9HD 2DYPA 4ELMF 2CD0A 4YIQA 3H7LA 5L2KA 1FH5H 1FORL 4BJLA 4LRIA 4EIZC 3ARDD 4X6DA 4F7EB 1IMHC 3S8WA 2M8XA 4Y1AD 1T83A 4YDKL 5CZVH 4ELMA 4YGAB 1YEIH 4NO3A 1E4XI 5KSBE 4PJEF 3QI9D 5HGAA 1D9KD 1EUTA 1LWRA 1YJDL 4WUKL 1H5BB 4JFFB 4J3XA 4PRHA 4U6TA 2HP4A 4PJEA 5CSBA 3BEWA 1GRWA 1ZANL 4PR5B 5C0JA 1KB9K 4ALAL 3CLEH 1AKJA 1QBLH 3FOMB 1OQXA 2DL9A 3QUYB 4LVOC 1EO8H 5ICXB 2ZKHL 4O58H 2VZTA 3OKKA 3QO0A 8FABA 2BVQA 4PJIF 1EHLH 3NGBB 5DJAB 1BIIA 4PFEA 4Q97A 1CQKA 1NL0L 2HTLD 3BHBA 1LO0H 4KQ4L 4LMQI 3PF2A 3JVGC 1F45A 3OR6B 5I1LB 3DXAE 1OAUH 2RFXB 1MUJA 3VWJB 3IJSA 2B2XH 1QHOA 5HHOD 1X6NA 3D85B 1J1PH 3QPQC 1HQ4B 4QRRD 4CMHB 2O61A 1HXMB 1KN4H 2LTQC 3WUWB 5J6HB 1KG0A 1X6LA 3KNBB 5DC4B 3UX9B 4B41A 4KI5D 4PB0L 5IBLC 5KOMC 4NWTH 4R96B 4XAWH 3HZVB 4R90L 1OP5H 4XXCC 1K6QL 2X09A 4FHBD 4EUPA 4Y5YA 3T4AB 2ZCHL 1LEKA 3RY6C 3BN3B 4P2OC 4UBDC 1A7PH 3OGCB 1X5HA 4IRSA 2DTSA 3QQ9C 3VFSB 4XPBL 4L1DA 1L4IA 1BFTA 4LARL 2NNAA 4JHBA 3L3KA 3SDYL 1CI5A 2BSED 2NY1B 5FHBH 3NAAL 1YNKH 3DSNA 1AO7E 2AJYH 3FO2B 3BZ4B 3CZFB 3OAUH 5EFIA 5TDPB 4JY4A 4U4BA 5BQ7A 5GGSA 1BP3B 5J3HC 4M6OL 1CGWA 1OPGH 5IBUB 3S5LB 5IWLA 5J57B 5IB1A 3ARED 5EIQA 4PTTA 3P4OB 2VABB 3MRPB 2CKBB 3LIZH 4IOFD 2APBA 2XWTA 1OP9A 4ORGB 5GGVH 2C4XA 3VD4A 2IH3A 1NH6A 1B0GA 2XY1A 4JO1L 3O4OC 4BSWB 4K23L 3MLPA 1SMOA 3BH8B 2X6MA 4N8VA 4KROB 4WGWB 2IWGA 1JGUH 3TNNB 3TVMB 1CXEA 3LSOB 1WVZA 5AYUH 1KJ2B 4KUZH 3C2AL 2AS5M 4AENB 4O9HL 4QRSB 4YHLL 3DI2B 4MA8H 3WFCL 4TYUA 1CLOH 4BFIB 4LEXL 3LKSB 3G6AA 2IPUG 1BZ7A 1U3HC 5FO9A 4KKAD 5L6YL 5E6IB 4JDTL 1J0KA 5IJKA 4KJYB 2E9IA 1HHIA 3RU8L 5H94B 4NQXB 3T0EB 1K4DA 1FDLH 4X5WB 2VZSA 5D2NC 3RL2A 1CLZL 3ESUF 4XWGH 1PZ5B 4BZ2L 4LVHC 2P5ED 2WBJD 4KMQA 3ZKNC 5E00B 3WKMH 3U46A 2R0ZH 5TFSH 3CPLB 2Q7YB 1U8PB 4JFZL 1NC2A 1MAKA 4P46A 2ZJSH 1IGFL 4PD4K 3NIFE 1T5WB 1X5YA 4WFFD 5T1KB 4YE4L 2C1OB 3MRJB 4LPXA 5IB4A 2NTSP 5IEKA 3MV7A 5FDYA 2Z31D 1QRND 3KLDA 1IAOA 5DJZA 1NMBH 2JTDA 3C60D 3PUCA 1BWMA 5EPMA 2NW3A 4J3OC 4PRPE 5KSAB 2CJUL 4K2UH 2VYRE 2UVFA 4Y2DC 5DD1H 4WCYL 1NBYB 3MXWL 3S4SG 3ARVA 3O6ML 1FO0B 4JFHD 4KRLB 5HBBA 4H25B 3O3EA 1OQOA 4XC3H 3GKZA 1GC1C 2VC2L 2WQRA 1JNLH 3U36B 2D7NA 4WUUA 1M1SA 4JFPA 1ACYL 5C70A 1IM3B 1QHPA 3VXSA 4JO4L 1QR4A 2VLKD 2DOCA 1CG9A 3TH4T 1KELL 4AIZB 4GW4B 3UYRH 4QF1B 3KLSA 3UYPA 3WFHB 2D2OA 4JJ5B 2H6PA 1YN6B 2XYCA 1EEUA 1BM3L 5L8LB 1A21A 2AJXH 4PRIE 5EUKA 2FX7L 5DLMH 2V2WA 2NZIA 1FL3A 1I1YA 3QAZC 4ODHH 1RVFH 4NGHH 2AGJH 2HKFL 4JFOB 3ZYOA 4M7LL 3QISA 4XPFL 5HHQA 3CMOL 2P8MA 2RCSH 3I84A 3ARDA 3JV6B 4OIAA 4DKDC 1SVCP 1QP1A 4CJ1A 3GHBH 3QI9A 1KPRB 3SE9H 1D9KA 4ZOEA 4ODVL 4EDWH 5IR1A 3DUUA 1XMWA 3D3VE 4X0KA 4AL8H 4JZJC 1PSKL 1D5ZB 2FX8H 1G7JB 4JG0L 3O3AB 4TRPL 3ZDXF 3GSWA 1RURL 3FTGA 3MRQB 3OBAA 4E0RB 4KHTL 3TESA 1AY1H 1VPOH 1AR2A 1NCAH 3KGRA 4Y4KB 5DJ6A 3UJIH 5ERWB 5EU6D 2BCKA 3H3KA 4WI2A 5C0GB 2EYRB 2HJLB 3HNVH 3HUJB 1JUFB 1KT2B 1DEDA 1I7TA 5KS9B 4IHOB 3SO3C 3FQNB 5D93B 5AD0A 3I9GH 2P46B 4X6CF 3LRSB 2Y72A 3VXME 4XPHL 1ODAA 3QG7H 4PRBA 4JN2B 3TF7C 3RPIA 5HHOA 1I7ZB 1K9TA 4QRRA 3UTQB 1A7OL 4OLYL 4GKZA 3NPSB 3LEVH 1SBSH 5B3JF 4XNZC 1I1AC 1TJHL 1T1WB 4FQ1H 4LCCB 4FOMA 5DD3H 3CU7A 1FZMA 5BVJA 3OXRB 2BHZA 3BIAX 4L5FL 4NQCE 1NCNA 4OD3H 2X44D 5EZOH 4RWYL 5ALBL 4OZ4B 4YPJA 4AY0A 4D3CH 2A38A 3SKJL 3Q5YA 3THML 3FN9A 5GJSH 1WBZB 2CO6B 2V7HA 1KFAL 3MFGB 5KVFL 1O7VA 1DBKL 3CDCA 4QXGH 4L3AA 1RZJH 3KPLA 3O0RL 3QQNA 1D5MB 3INUH 5EN2B 5ISZD 1IT9H 2ZOKB 2VUYA 2VOTA 5MEPA 2EH8L 4TNVF 4M5ZH 1FZKB 3QJFB 4F8QA 4E5XB 3IDYC 3QIUA 1T04B 2GSIB 1AFVH 3AAZB 3QUZB 5GRWA 3TNMB 3AREA 1CR9H 5FKAA 1DQJA 1GHFH 4JQXC 2WNGA 4HEME 3F7VB 4HIJA 3H42L 4EDXB 4Y5XA 5HGHB 4YO0B 1CYGA 2JK5B 1NMCC 2ARJA 1MCQA 2OR9L 3FRPG 4ZS7L 1FIGH 4YBLC 5C0FB 5JMOC 1PGRB 3EYVA 4HHAB 2VLME 4PGCA 1L0XA 2ENSA 1IKNA 3BVNA 4U6YB 4TTDC 1JHTA 1VHPA 4LLUA 1HSBB 5E9DE 3O4LB 2VDKL 2MPAL 4NUJB 4P49A 4XHJD 4QOKD 4XCFL 1T20B 3CFEB 4N0YL 2VDOH 4GH7B 5D7LE 1IEAB 3V2AR 4LSTH 2WWMC 1PLGL 4XAKE 1GPOL 3IJYB 4PJDF 4ZXBD 1JE6A 2ADGA 4HS3B 4YFDB 3G6JF 5EOTA 2WBJA 1XF3B 4RISH 3VD5A 3DVNB 3QA3A 4JRXA 1BFOA 1JZ5A 4PJDA 5TF1L 5C6WH 1RIUL 1MCWM 1QTYT 3G6JA 3MMEB 3LB6C 4O5LL 3DVIA 5EU4B 4C58B 1ZLUK 1CIUA 2E3VA 1T7YA 3HC4H 1N8ZA 1DBBL 4GS7B 2CH8A 2YN5A 3G5VA 2YD2A 2XA3A 5TE7L 2EH7H 5EORL 3B5TA 2VDPH 1DP0A 1QRNA 2Z31A 4XB8A 3C60A 1JWUA 4PY7A 3PQYE 3GSNH 1OGTB 3C2SA 4U7KA 1JGDB 5F88A 3IXAA 3UYOD 2ZUUA 4CJ0A 4X7SH 1OL0A 3U1SH 1ZKAA 4KZDL 3WL9B 1SQ2N 4G9FD 5FGSA 3KDMA 43C9A 1FAKT 3DVGB 2C1PB 4GLRH 1RU9H 1ZA6A 2NLJA 3BZEB 4Q6IB 1X4XA 4EQ3A 1RQ5A 1C5CH 4YHKL 4Z95L 5C9KA 2D7OA 4G6AC 1AQDA 3GIZL 3REWA 5F96L 3QDAA 5IHZB 4KK8C 2CLVB 5D6CB 2VKXA 2X70B 4GQPH 3DGCR 3BPLB 1DUZA 4CNIB 2EKSA 4PJHB 3LV3A 1JK8B 3HE6D 3O9WD 5F21B 5M94B 4ZUUB 1V8HA 2C7UB 2YBRA 5DHVB 1ZEAL 4Q2ZB 4XBGA 5D6DC 4GXUN 1C12B 3BPOC 4HLZG 4RMVA 3DBXA 1HKLL 1WCBB 3KPRD 4FNLH 1A7NH 3VFUB 4Z7UB 4F3FB 3GHEL 4HCRA 4IDLA 3GMLB 1G7PB 1LP9A 2A6DB 4PJ5B 5DRZA 5K9OB 4XI5D 2CUIA 1SEBB 3BUTA 5HYQA 3OAZK 1FGVH 3QG6A 4LLYA 2J88H 5GS2H 2X4TB 3OAZH 3PIQA 4F7CA 3P77B 5E99L 5EZLA 4ONFL 1C5BH 1CQYA 1FYHB 4XPGH 1RUPH 4PYHA 2N1KA 2O5YH 5EU6A 3UBXB 4OZFH 3CFKB 3TBVA 5E08H 3U0WL 3GSOB 3GKWH 1F4AA 2ICEA 1MJJA 4YHML 4X98B 3BP5B 1GGYA 2P5WB 3SKOA 2EDHA 3VFRA 5EZJA 3DTXA 1KJVB 2ZOLB 1T5XB 4X9GA 5SWQB 2X9YA 2Z4QA 4GLRI 5LVEA 4UB0L 2A6IA 2GJZA 4NFCA 1J18A 3NZHL 5I76A 3LEXB 4MXVF 3VH8B 3WNMA 2ZUVA 2V2XB 4ONHB 1J1XH 5L9DH 1MPAL 3WE6B 5GGVY 1T6VN 3OKEA 3CCHB 1JWMB 4JVWA 4KK6C 1JRHI 2NR6C 5C9JB 3WNPA 2IGFH 1S9VB 3LCYA 1KCUH 1RY7B 1MNUH 4LCYA 5IW6B 4DGVL 2ZNXA 1HZHH 2FGWL 2HH0L 3L5WB 2FSEB 4GMSH 3NZ8B 3UTSB 3P9MB 4MMXC 4OCXH 1MWAH 3PXHA 4FZ8L 4PJ8B 5T5FH 4LP5A 4TQEH 3EDEA 3QEHA 4K3HA 2FJGB 1P7KA 1JTOA 3ZT7A 4LKCA 4F15B 1IGJB 5EIVA 4P59H 2X4QA 3VWKD 1J8HA 4KTEL 5D1XC 4NNYB 2F53A 3OX8A 5J8OA 4OFIA 1OT1A 4OSUL 2J8UE 4XNYH 3KLAB 5D96B 1IM9B 3EOTH 4PJCF 4HEPG 1FYTD 2OQJB 3ZKQD 5DJ8A 3MRKB 5TH2B 3BUYB 1SVZA 5HI3D 3EYUH 4RAUB 5D9SA 2E6JA 3SCMC 6FABH 2R69H 3MRNA 2VIRB 2BXYA 4NRXA 3ECBB 5CINL 4WFGE 4LIQE 3QXDB 4UT6L 1X5KA 5INDA 1KEMH 1OTSC 4HULB 5KN5B 3IDJB 4Y4HA 1ONQB 4FQQA 1J88A 4XVTL 4WI7A 1R5VB 4R2GD 3WSQH 5A2KH 5JOPE 5FYLD 3EO9H 1PX4A 4MQTB 3TN0B 1NKOA 3QQ4B 1OAQH 4D9QD 4QXUH 3FONB 5ITFB 2ZWLT 5JA8B 1QFWI 4G6KH 2P7TA 1I1FB 4IRJC 4DZ8B 1KXTB 2WBWB 4M4PA 5TQ2H 35C8L 4NPYA 1HHKA 1CGSH 4ZNEE 3BISA 4KPHH 1NCCL 3IYLW 1RZ8A 1YUHA 4ZXBA 2C3HA 5DQ9B 1CDIA 4JFEA 1F4XH 2GITA 1LQSR 3N1PC 2JLLA 2FD6H 4KV5E 3T3ME 4QKXB 2A2QT 3GM8A 4H8WC 4MNHB 1IEBA 3OJ2C 2Z93A 4X8XA 2DLTA 3LQAC 1HEZA 5I1AB 1PQZB 3FQUB 1EO7A 3B8YA 3T0BA 2IQ9H 3WS3A 5EOCH 1A1MA 1Z5LB 2XZQH 3IDNA 5D1ZB 3ARBB 1OLZA 3TM6A 2K1MA 4KRNA 5DTFA 3U6RA 5HHME 3Q6FB 5F7HA 1IBGH 4HCRL 1JZ3A 2DDQL 4YK4C 3TT1L 5ANMB 3PHQA 1HSAB 5DHYB 1XZ0B 3W0WA 2KKQA 2WP3T 4NYLB 2JCCA 3QEQD 4BSVA 4X9HA 5E8PA 1FV1B 1CFVL 4ZPTA 4YXKL 4G9FA 5HYSG 5K9JL 5ESAB 3NABH 5D1QD 4NQDE 4X4YB 4OZHA 3Q6GL 3FB8A 5JMRA 2ZG1A 3OKNB 4KY1L 2CQVA 3IFOA 4Z7WF 2Y06L 4RAHA 4MAUH 4MD0A 3TIEA 4NIKB 1OSZA 3V0VA 4U1NA 4NRYB 2F5BH 4NRZB 2DYPB 4GBXD 1TLKA 2QQLH 4S2SA 4YIQB 2YPLD 3B9EA 3HI6H 4X6DB 3LN4A 3IU4L 4FA8A 1ND0A 3BPCA 3HE6A 3LPGA 4NN6C 4P57A 1E4KA 3BDYL 3EGSB 2ZUWA 4PRHB 3ZHLA 3IFLH 2BP3A 1CICD 4I0KA 3BEWB 5IIEA 5I1CH 1G6VK 4LGSB 1N5AB 3KPRA 3DRTA 4GQ9H 1AKJB 4WFEE 3S7GA 4MA1C 3TBYA 4NKOB 3HNTH 1QLRA 3ARWA 2ESVE 4KMTL 4PB9H 2OI9C 2J7LA 3QO0B 3OKKB 2H9GA 1KIQA 2BVQB 1E6OH 1JCKA 4APQC 2APXA 1I75A 1CLYL 3BHBB 3AGVA 3P9WB 3RRQA 3EOBB 1DN2A 2W65B 3GZKA 1MUJB 1UKTA 2BNQD 2OL3A 5E8DH 4JPIA 3P73B 3IJSB 2CMRH 2F9BT 4MNGA 5E8NA 2YRZA 1FL6A 3PGCA 5LXGH 3BMWA 2GUOA 3PWNA 4H8WH 2O61B 3BQUC 3LQAH 4ENEC 1GAFL 1KG0B 4V1DB 2VR5A 4Y5VA 3WNLA 3SBWC 3QXVA 2DKSA 4E41A 1VESA 4LLDA 5D7IE 2OR7A 4Y5YB 5J56B 2HMIC 2JELH 2NY0C 3MV8E 1LEKB 3QDJD 4JRYA 4N5ED 2H3NA 3BAEL 4K7PH 3QHZL 2UWEE 4N90D 5LWYL 4CDGC 1ZT7A 2NNAB 3L3KB 2IBGA 1OGAD 2R2EA 3AMLA 4KU1A 5ID0A 3VDBA 1C16A 4R9HA 5HJ3A 4JCMA 5ID1A 5EFIB 5BQ7B 2D03H 1ZTXL 1I9IL 4P5KA 4JY5H 4LASL 3F12A 3O45A 2MCPH 3VWKA 1BJ1H 3I3DA 2PYEA 3DETC 3IJHA 5I6XB 5IB1B 4PTTB 2A1WL 4LCIH 1QQDA 3ARGD 4G5ZH 4X83A 3ZSTA 1YPZB 2EYTA 5J4MA 1QSVA 4HS8H 1FYTA 1A1NB 1ZVSB 3UPRA 4OV6F 3ELAT 3JV5A 4N8VB 4PJ7F 2DQEH 1A64A 4KQ3H 5F71A 5IF0B 4PJXB 1T2JA 1NDGA 1S78C 4PJ7A 1T89C 4Z7VB 3T4YA 4L4TD 3KXFD 2Y6SD 3VE0A 3SJVB 4I2XA 2VDLH 1U95A 5A2LH 3G6AB 1I8KA 4OIIL 1BZ7B 5I1EL 1WITA 3UC0H 2X4SA 5FO9B 2UVEA 3DX6B 3ZKMC 9CGTA 4F33A 1I9JH 2DIBA 2YWYA 5DVLA 4LSRH 3RL2B 2HTKD 5B8CC 4GT7A 2DQIL 4PJAB 4Y19D 3WD5H 1CFNA 4JHAL 4WU5A 3U46B 3V4VH 1N2RA 3RWEA 4I18A 3ZE2E 1NC2B 4B5EA 4KUCD 4P46B 3BN9C 1SBBA 1FPTL 3K8MA 4HLJA 4XB7A 3FN0L 4UQ2B 4F2MA 3A67L 1QFUL 1KJ3L 2IPKA 1U2HA 4GRWE 3RDTA 5KVMC 4RGNE 1IE5A 3GI9L 5DJZB 1RULL 5EPMB 5E8EB 2NW3B 5CJ8A 2CO7B 2A6KA 1S5IH 3QDGD 4OCSH 4V2CB 5CBAA 4HGMA 1JVKA 1D7FA 5T3ZH 1QKZH 5KVDL 1IAIH 5JZ7C 1PBYA 4EJ1C 3IS1X 5JNYB 2W60A 1IJ9A 4JPKH 4WUUB 4NZRH 4H20H 1LO5A 4P4KD 3QIWC 5F6HI 5IQ9A 3JTTA 5HVHB 4U0QB 1R0AH 1JGVH 3ISWA 3QEQA 5C0EA 1AD0A 3KYNA 4CVXA 3K8LA 1NAMH 4FQLH 4JB9L 5J11B 1IQDA 5IV2A 5D1QA 2NTFA 3O6LL 1P53A 2H6PB 4L8BB 2IMMA 1BF2A 2I07A 3RGVC 3QPXH 1MCSA 5EUKB 2W9EL 4MNQA 2V2WB 2NY3C 1I1YB 2OL3L 3WS6C 4CVZB 1MCKA 2R29H 4P5MA 4GBXA 2YPLA 1A14L 5LGKA 2P8MB 3HCVB 3ARDB 1PJ9A 3CZJA 3KPPA 2PW2A 3BKCH 3PWVA 3HNSL 2V7NA 1S7RB 3MRFA 2YUZA 2D9QB 1LO4H 3QI9B 4P2RA 1D9KB 2HFFA 3NIFF 1FSKC 3CAFA 4FXGA 5IR1B 1NUFA 4CAGA 3DUUB 3CFBB 4X0KB 2GSGA 5J0BA 5F8QC 1I85A 3MLVL 4NHUA 3GSWB 3FTGB 1YYMH 1EZVX 4XBPA 5GGQL 5DJ6B 3HRZB 1DSFL 1YZZA 3D87B 1FE8L 2BCKB 1MEXH 1AH1A 2ORBL 3Q2CA 4O02H 4ZPVA 4WV1A 4X4MA 5IB3B 4OCRH 4XP9L 1JNNL 3FT2A 3W9DA 4GRLD 4G7VL 1I7TB 3TBWA 4QRPE 4MHHG 4M6MH 3MOQA 3O6FC 3D9AH 5AD0B 3SGDI 3MSPA 5HXMA 1T22A 4QHKI 4PRBB 4MJ6B 3T2NH 2BNQA 1MJ7H 4R97C 4I3GA 5HHOB 3FOLA 3IDXH 4Z6AT 3B2UC 4QRRB 3S9DB 4JO2L 4X7FC 2AJUL 1V7NL 3O2VL 5F72S 4YUEH 1FGNL 3TZVC 5SV4A 3QFJD 4OCNC 5FGCB 4DAGL 3RBSA 2Y5EA 1F2XK 2L7JA 1U8OA 3N1QC 3WUZA 3FB6B 5CZXC 3QIBA 3TC9A 1FZMB 5BVJB 5EZIH 3MLZL 2J6EA 4PREA 3EJJX 4HIXH 3C5ZA 4Y16D 1HILB 4NOBA 2ZPKL 5FFLA 1XEDA 2W9LA 4YDVA 4FTVD 1YMME 3RY5A 3T2PA 2V7HB 2WINA 5GRVL 1BLNB 1SYSA 3EDDA 4NT6A 2DQHL 4G6MH 4QHMA 2CSPA 1AGBA 1OGAA 2ATPA 3KPLB 3GEWB 2P8LA 3RX5A 1WIOA 1XCTA 2H32H 2H8PA 1GIGH 5IT2L 2CIKA 2R4RL 4TUJA 5LGHL 2ICWA 5FYLL 3GJFK 4NUGH 5MEPB 4ZFGH 1TMCB 4N1HB 1OARH 1P2CA 3KPSD 3EFFA 5DDHA 1KGCD 1DR9A 2DWDA 4WVRA 3I50L 3EYQC 1U58A 5C09D 3JWOC 4RFOL 3G5YA 2FEDC 3AREB 4IRZH 1DQJB 1FNEA 5L2JA 4OM0H 3B5HA 1JN6B 4BQCA 4XP4H 1KJMA 4HIJB 4Y5XB 4X6FB 3GDBA 3MV11 2FGZA 2ZP0T 4M7KH 3H7BA 1Z9LA 2GTZA 3JZ7A 4GG6B 5CEZL 4UT7L 2ARJB 4NZUL 3GIVA 3WFZA 3VXTA 3SQBA 4PV9A 4MAYD 3RZCC 2COQA 1YA5A 3G6DL 2ZCKL 1K2DA 3EYVB 1N5YH 3L1OH 4OI8A 4PGCB 2EEBA 3EHBC 4TSBL 1NFDE 2VB5A 3BVNB 3VFOB 1HKFA 2XXCB 4LLUB 1GJIA 2DQUH 3E0GA 4XP6H 2VZOA 5JOFB 1E4JA 3QQ3A 2EIEA 5C0AE 5GJTL 3MACL 2IADB 4DKEL 1SM3H 4YR6B 1A6VH 1H8OA 5BVPH 5IESH 1TJGH 4EVNB 3EBAA 3KHQA 2HLAA 4MA3A 2ADGB 3MRHA 5FA4A 5TE6L 5EOTB 4U6XA 1F00I 2P5EB 2WBJB 4Z5RB 4Y19A 5HY9A 2GK0A 1BFOB 4PJDB 1FVCB 2IALA 1I9RL 1YEJL 3G6JB 1SJXA 2DWEA 3GBNH 4UOJA 4WW1A 3SDDD 4JFFE 4NC1E 1NBQA 4JGUA 5LKNA 1MQ8A 2L0DA 1QA9A 4UDUA 4AEIL 4OT1H 2RHEA 3KPMA 3G5VB 1HCFX 4X6BA 1JGEB 4YPGA 1QPPA 1TDQA 2Z31B 1QRNB 5DZNA 3C60B 1JWUB 3I3EA 5BW7C 2R1WA 1FFNA 4PY7B 2BZDA 1WWBX 5IVZB 2PTUA 5GSVB 3HFMH 5F88B 4ZNCD 3I6GA 3IXAB 2WIMA 2AKRB 3QHFH 1LD9A 4G9DA 2X42A 2XZAL 1ZA3A 4P4KA 3KDMB 1X44A 3U2SB 3SDXF 1OTUD 4OLXL 2VLKB 3V7MA 1H3GA 3W11C 1RUMH 1ZA6B 2QADD 5LQBH 2NLJB 1IGIL 3SDXA 4LHUG 2VXUL 1AQDB 4FQXC 1YEGH 3REWB 3N9GL 3CSPA 3LAFA 3MOBL 4XCYA 1FQ9C 1ROWA 2JB6A 1N6QL 5GS1C 2WMPA 3BESR 3QZWG 4CMMA 5I18H 1DUZB 1CT8A 2EKSB 3KG5A 3D18B 3WFEL 1JGLL 2VXQL 5C0BA 3UJJH 4KC3B 1SEQL 4ZAKD 4XBGB 4NJAL 5GS0H 1U8LB 4Q58C 4TSAH 3ROOA 1P84J 4C83A 7FABL 4OD1H 4L9LC 4NWUH 1MAML 1LP9B 1CFQB 5D72L 4RGNC 1J0YA 1T03H 5DRZB 2J6EL 3RWDA 4M7ZB 5HYQB 3QG6B 1IQWL 5FEBA 2UZYB 3ZTNH 2E8ZA 2W0LA 3PIQB 4F7CB 2A77L 5EZLB 1PVHA 2BX5A 1TZIA 3GGWB 3LZFH 3BP6A 5FYJE 2R0WH 1KV3A 5SWSE 3S35X 5EU6B 4XH2B 5HDBF 3EO0B 1AHWA 3TBVB 4PRDA 5FO7A 3C8KA 4RFNC 4KHXL 3VG0L 2FATL 1MJJB 2R8SH 3V4UH 3VFRB 4TVPH 4TOYH 5EZJB 3RBGA 1TJIH 3DTXB 4BH8A 4F37K 3P0YH 2Z4QB 1ITBB 2OR8A 5EOQH 5LAXA 4KFZC 1AGEA 4LLQA 2A6IB 2GJZB 1A6AA 5DMGD 4R4ND 5I76B 1C5DB 1AGFB 1G6RH 4HJJL 3HAEH 1E4WH 5CS7A 5JPMA 2PXYD 1DL7L 1HN1A 1RMFL 3S34L 5DUPL 2DQFA 1MOEA 4IOIB 3OKEB 5I1GL 3BT2L 4WWKD 3HC3H 4DW2H 3MV9D 3NACL 4Y16A 4YHOL 1XFPA 1KN2H 4LCYB 5F7LB 4O2FB 4FTVA 1S7UB 5KVEL 1YEKL 3MLXL 4JFXA 1YMHB 3DURA 4CW1A 2VO5A 3CVIH 2AJSL 4P23C 4ZTPH 2NY2D 3QEHB 5ISZB 3LD8C 3TCLB 3GSVA 4EZMA 4O2EA 3DMMC 3D5OF 2VL4A 4XMPL 3EDJA 4H0HB 3KPSA 3OX8B 4RMWA 4EQ2A 4U1GB 3QCUH 1U8MA 4ZTOH 4IIQA 3RKDC 3BW9B 3KJ6H 1JBJA 1NCWL 1F4YL 3U30B 1EERB 4J3UA 1EHNA 5C09A 3MUY1 1CZ8H 4LFHG 4LLMA 3J8F7 5DJ8B 1AQKH 5IM7B 1BGXL 4QO1A 4NZDA 4GRWH 3MRNB 2HG5A 3DYPA 4NRXB 4ISVA 1O7SA 3S35L 3JTSA 1DEEA 1P4LA 4L1HA 4G3YH 1TITA 3QPQD 4OM1H 4EI6A 4MAYA 1JTPA 5INDB 5KANG 5F8RC 4P5TC 2P49B 4FQQB 4GRMA 1NFIB 2MTPA 5DZLA 1JI2A 2X4OA 5E2UH 3ZT6A 4LRNL 1U3JA 2C5DC 4YXLL 5IBLD 4UNTA 3I6KA 4NNXB 2D31B 4ZO9A 4QTIH 2DMCA 1H3WM 4QOKB 4O2CA 4X99A 3IGAA 2P7TB 2OP4L 3L9RA 3FL7A 1HHKB 2ZSWA 2CXKA 1QUNA 4LSSH 4P2OD 4UBDD 4POYA 2XFXA 1YEEL 4FXKA 2IMNA 4ZXBB 4PY8J 1XIWC 4DZBB 4BQ6A 2MCG1 5TE4H 2Q6WB 5T3XL 3B9VA 5AUMA 4P0DA 5E4EB 3SDDA 1IEBB 4HFUH 4HIHA 4JDVB 4D0BA 3BIKA 1HEZB 2J8UF 3ZE0F 1T1XA 2Q3AA 4ZUWA 1AD9A 4G8GE 3WS3B 1A1MB 4OD2A 3MA9H 1JPFA 1IGTB 4TPRL 4A6YA 3IDNB 1NQBA 4NCC1 4NQED 2JJVA 4YHIB 1T2QH 2D4DA 3CX5K 4YXHL 3O6KH 5DTFB 3QBTB 5CBEB 2AEPH 2B1AL 4JFDD 3PHQB 5ESVA 1IGML 3HUJE 3MLRL 4HXBL 2LU7A 3TO4A 3W0WB 4ZOAA 2WANA 2JCCB 2BMKA 4BSVB 5FDWA 5KS9E 3V5KA 2MKWA 5E8PB 4HUVB 3RNQA 3IXTA 4G9FB 1MI5A 1TTUA 1ORQA 5J1TC 2OZ4L 4OZHB 5FO8A 1TVBA 1MLBB 3VGHA 1N64L 3IFOB 3BGFC 3GSQB 3L7EA 4MD0B 5ADOH 4C56A 3TIEB 4NHCH 1OSZB 4EIGB 4U1NB 5D5ME 1KLGA 3VDAA 3JBG7 2NY6C 3AVEA 1QEWA 2PTTB 3LS5L 1M6OA 1HNFA 1U8HB 4O51B 1TIUA 5A2JH 3RHWF 2KZ1B 3HAEG 3BPCB 3HE6B 3O9WB 3DJ9A 4PP2A 5JXEC 5CCKH 5MHSE 1DUYA 4JZOA 4P57B 5ICZA 5IMMB 5CHNB 1MFEH 2X1XR 4LLAA 1CE1H 5I74C 5IIEB 3V52L 1H5BC 1QLEL 4MJIA 1WZMA 3KPRB 4NC1C 4ODBD 3DRTB 3MLWL 5F9WC 1EK3A 4QYOB 1QACA 4HW6A 1MQKL 1QLRB 4XMLH 5JW3H 2WUCL 3LHPL 4QTHA 3QUYC 1WFNA 2H9GB 1FAIL 1KUMA 4DOHB 5E1AA 1QBAA 3QHTC 5F7EL 2VLRD 3T0AA 3KYMB 3NGBC 4O00A 3FO9A 3V5DA 4DVBA 4DK3A 5ITBL 1RZKC 3HZKB 3PNWB 1P1ZA 5DYOA 5L7XL 4QHLA 1MAJA 3MLUH 4Y2DD 1GVIA 2GY5A 3WLWD 2KBGA 2OL3B 1K8IA 5GHWL 5D71L 3O6FA 4MNGB 1AE6H 1FNSL 5E8NB 1LDSA 1FL6B 3VWJC 5KW9L 1P7QD 4X4ZA 3PGCB 5JHDE 2GUOB 3PWNB 3D0LA 2Z9TA 1RFDH 1BIHA 5FHAH 1GH7A 1KCVH 4CMHC 2XRAH 5IW3A 3FT3A 2BDNH 3VGGA 2N56A 4JG1L 4LLDB 2Y36H 2OCFD 3H2WA 3S88H 1A2YA 4HWBH 2R2BA 4NN5B 4WWKA 2IAMC 1GZQA 4JRYB 3LOWA 4PP1C 3O4LE 1WV7T 1V3JA 3DX7A 4KTYA 4PIRF 4IMKA 1TETH 3ULSA 5DJYA 4ZFFA 3O3UN 1H8SA 5ID0B 1P6AB 1S7XA 3F58H 4ZS6C 2KL6A 1C16B 1MFCH 1MLCA 1HK6A 3S37H 4F9LA 4LAQH 1UADC 3SE4A 1MCLA 2NY1C 2F5AH 2I25N 5ID1B 1BVKA 4YEFA 5J9PA 2BVOB 4FQ2H 3HZYA 5CEXA 5CD3A 4P5KB 1ZXQA 5EWIL 3DUHA 3BXNA 3F12B 3DRQA 2A73A 5DJDA 3VWKB 5EH1A 1J1OH 2CLZA 3DV4A 3C08H 3MODL 4WNQB 3IJHB 1F90H 4PJGA 5I15H 1QQDB 2HT3C 5IB2B 2GCYB 2EYTB 2DQGH 5GISL 3SDCA 5F7DA 4JKKA 1FYTB 1MRFL 2FEEL 3BPNC 3PP3H 3UPRB 1OAKL 3GNMH 1VADB 2IFGA 4P9HL 2O5XL 1WJ3A 1WF5A 3I6LE 5A3IC 5C8JA 1B0RA 3NVQA 3V6ZA 5J1AA 3RWGB 5LJYH 5IHBA 4KROC 4M7JL 4XVSH 4JPWH 4GUPA 3T4YB 4AEFA 3TVMC 4A6YL 2HYMA 3GRWH 4HD9A 5D7IF 3VE0B 1DQLH 1QBML 3RY4A 1VKXA 1ZLSH 1ORSA 4PPTA 1I1AD 1I8KB 5D7IA 3RVUD 5F44A 4R2GB 2X4SB 3N1GC 1GGBL 4RDQG 2UWEF 4FFVD 4XZUB 2DAVA 4H0IA 2YEZB 4F33B 1FH5L 2UWEA 4HJGA 4D8PA 5J1SC 4N0RA 5CZVL 1YEIL 1CFNB 4WU5B 4PBVC 4I18B 1K8DA 1DQQB 4N9GA 3MXVH 4MS8C 4F2MB 4MWFA 3CLEL 4I0CC 1H3XA 3RIAK 2IPKB 1HYSC 1QBLL 3BX7C 4J3VA 1EO8L 4HIEA 4KJWC 4O58L 1JPTH 4U1HA 4OBRA 4PJ5E 3MRIB 2OJEA 4C4KO 4K9EC 1Q9LB 1EHLL 4RMRA 1MCPH 1UYWH 3TLRA 3F5WB 4NQEA 5KSAC 5K9QG 1LO0L 2A6JA 1HYRC 1VFMA 4MVBC 4DGIH 1YY9D 4JFDA 5JR1H 1OAUL 3ZSSA 1LO5B 3FQRA 5IQ9B 5GSRA 5C3TA 2JB5H 3P40A 1EHAA 4D9RD 1MFBH 2B2XL 1YQVH 4PBWD 5C0DA 3QEQB 5C0EB 1J1PL 2V5TA 3KYNB 5HPOA 5FYJH 5I1IL 1EHXA 3P11H 2P5WE 3GMNA 1B4JH 1KN4L 1IQDB 5IV2B 1REIA 4IS6B 5D1QB 2DBJA 2NTFB 1QD0A 4CDHA 4LQFH 3SGJA 3QNXA 4Q9BA 1GOGA 2VRAA 3BYYA 1INQB 4NSKA 4AYFA 4NWTL 4XAWL 2WW8A 1CXHA 3ILPA 4P5MB 4GBXB 4KJPD 5GS2D 2YPLB 4MD4A 4WTZG 1IAIM 1NEZG 3KPPB 2PW2B 1A7PL 4JN1H 2V7NB 4M1CC 4XC1H 1KC5H 3MRFB 4BFGA 3DOSA 4HJ0C 4MQ7B 2HFFB 1ITCA 3ES6A 3D39D 4FXGB 3D69A 2X4UA 3RNKA 2GSGB 1CICB 4MMZC 1EFXD 1M7XA 5MEOA 5FHBL 3WO4C 3B2VH 4PTUA 1YNKL 4U2YA 2PO6D 2UUDK 2AJYL 5JO5B 4F9PC 5I0DA 3UTSE 1P4IH 3LB6D 3WJJC 1TENA 3RKPA 2BNRD 1IAKA 1OPGL 4K7FB 4F7TA 4Y4KC 3QXUA 4KDTA 5TDNA 4ZPVB 4WV1B 3W9DB 3FT2B 4ZD3H 2VLRA 4C57C 4JJHA 3TBWB 3LIZL 4U1MB 3FFCD 1BOGB 5B38A 1R3KA 5DRNA 5GGVL 1T22B 3LN5A 3B43A 5D93C 1FVDA 3BOVA 2BNQB 3X12A 3RI5F 1QLFA 4R26H 3W82A 3FOLB 1A1OA 5IUSA 4LPYA 2FRGP 2R4SH 1JGUL 1A9EA 1CE6A 1MCBA 1U8JA 4C55A 1TTGA 5AYUL 4L3CB 3SPVA 5EUOA 2E7LA 1DVFD 4S1QH 3NPSC 2OSLA 5DT1H 4PG2C 3AU1A 1U8OB 4MA8L 4G6AD 1CLOL 5C71A 3VMNA 4LCCC 4PREB 3DNKA 4KK8D 5GZNC 2X9WA 1WWWX 2Q7NA 4L4VA 2BOCA 1FO0H 4S1DC 2G2RB 3QDJB 4YDVB 3TFKD 4OLWH 5K93A 2HT2D 5FECA 3WNKA 1FDLL 2WINB 1AJ7H 1Q38A 1SYSB 4GXVH 4XWGL 1RZGA 3DGGA 4QHMB 4EI5D 1FRGH 3BD4A 1OGAB 2ATPB 1IGCH 2P8LB 2R0ZL 5TFSL 3LRHA 4PJBF 1XCTB 1CXIA 1FZOA 4QHUA 2CIKB 2ZJSL 4TUJB 2Q76A 2ICWB 1VFUA 1WBXA 4PJBA 5HTSA 3TV3L 4MD5A 4NJ9H 2UY7A 2G75A 1G9NH 4JHWH 5DI8A 5DDHB 1L0QA 2O5ZH 1UA6H 2DLEA 2DWDB 4CVUA 2DF3A 1YEDA 4M1GH 3WUWG 1U58B 4NQSA 3G5YB 5J6GB 3TPUA 1B4RA 3BIBX 1OAZH 4M93C 5L2JB 4K2UL 1D5BA 3QUZC 5DD1L 3GMOB 3ARGB 5T1LA 1KJMB 3T0XA 5DMJB 2G5RA 5B22A 4WU7A 3PHOA 4XC3L 4Q9RH 2GTZB 5F6IB 4K8RC 1T1YA 3GIVB 3VXTB 4KXZH 4PV9B 5ANME 3BZFA 1W8OA 1K2DB 3UCRA 1S9KC 4L4TB 3UYRL 1OY3B 2B5IB 1WLHA 3PWPD 1H3PH 3H9HB 1S3KH 5IVNA 5DMIH 1TTFA 3AS0A 4MB3A 1T4KA 4JM2F 2AJXL 3QQ3B 2P42B 3OPZL 5DLML 4DUVA 1JL8A 5GGTH 4ODHL 1GGCH 1RVFL 2NR6D 3KJ4B 4NGHL 2AGJL 4JM2A 5GIRA 1A0QH 4S1RH 1BREA 2HLAB 2RCSL 4MA3B 5IBUG 3MRHB 3BJLA 3S5LG 5FA4B 4X6DE 4U6XB 4XVJH 4Y19B 5HY9B 3GHBL 2GK0B 4ELME 4I1NB 2IALB 2ICWJ 3T1FB 1CD8A 3FT4A 4EDWL 2DWEB 4X8JA 5SX4H 4WW1B 4AL8L 4YHYC 1IC7H 4PRHE 1KNOB 2R0KH 2FX8L 1QA9B 2ZUSA 3D25B 4PJEE 5E2WH 1J12A 5DK2A 3KPMB 4YPGB 3GMMB 4GS7C 1AY1L 1VPOL 1NCAL 3SE3A 2P43B 1TZGH 5IKCA 3UJIL 2R1WB 3ZDYF 1FFNB 3X3FH 1UZ8B 4FP8H 3E3QC 3QDGB 1YDPB 1PFCA 3I6GB 4LEOA 2EICA 4ONGH 2VITB 3WO3B 1QO3B 2YMXH 4BA8A 3I9GL 1LD9B 1KCSL 1M7IA 4G9DB 4GAJH 4KXZI 5F1NB 4TTGA 2VE6A 1P9MA 3QG7L 1ZA3B 3AROA 1GGTA 2EDTA 4P4KB 5F7KC 2AXGA 4OF3A 3SCMD 5IFJA 4HUNB 4MB5A 3ALPA 4GG8A 4BK4A 3SDXB 3QUMH 1MHPH 4Q6IC 3LEVL 1SBSL 5GQBA 2BNUA 1OTSD 4XCYB 4POUB 4X9IA 4GW5A 2JB6B 1CXKA 4FQ1L 4JY6A 3EZJB 3BDBA 3NCYS 2XA8H 2ED8A 5EBMA 4MCZA 5DD3L 2W59A 5C0AA 1CT8B 2VXVH 4WEBH 1F11A 4OD3L 5EZOL 1HDMA 5F7NC 1RIVH 4D3CL 1H15A 2F74A 3U83A 4KRPD 4LPWA 4K8RH 3TO2A 2CUHA 2OM5A 5GJSL 1X7QA 1ZS8B 5I1DB 3VXUD 4QXGL 5INCB 5SX4I 3UXFA 4C83B 3PXJA 4XNMA 3TBTA 1RZJL 2X1QA 3D39A 4OZFA 4XPTL 1CDBA 2YZ8A 3INUL 1J0ZA 1EA9C 1EFXA 4I4WB 1U8NB 3VMOA 1IT9L 3RWDB 3ULVH 2PO6A 32C2A 4EXKA 3WXWH 3OKDA 1NUGA 4D9LH 1XAUA 2FJHA 4PRNA 2ICCA 3FOMA 1TZIB 2DQCH 2EZ0D 1OAYH 5KAQG 3WJLC 5ICXA 1RUKL 1AHWB 2E9WA 3VFMB 5KVGH 1AFVL 5I8OH 4GRLB 4XP5H 1CR9L 5GZOC 5KJRH 1GHFL 4Z7QE 1UB5A 5F89A 3FFCA 1ZHBA 2BSRB 4BH8B 4OJFH 5LAXB 1AGEB 15C8H 2R56H 4LLQB 3OR6A 5I1LA 1CFBA 1A6AB 5I1KH 1R3IH 1D5XA 3OR7A 2XICA 3DSFH 5JPMB 3D85A 1FIGL 1HQ4A 1N0LA 2DQFB 3BH9B 3QFJB 1DVFA 1NSNH 5L88L 1MFNA 5J6HA 2VLJD 3EOAA 1YN7A 2X10A 3OXSA 4OTXH 5DQDH 4Y16B 4K3EH 3V4PH 3L3GB 1DBAH 5GRUH 2VDOL 5C0CD 4XAKD 4FTVB 4LSTL 3K0WA 5JLZB 4ZMAT 3T4AA 5A2IH 5D2LA 3DURB 4CW1B 4AT6B 1Z9MA 4OGZA 4EI5A 4RISL 1MCEA 4PJAE 3GSVB 4NNPH 4M03A 3OG4B 4O2EB 5E95B 1NGYA 4PJ8C 2R15A 3DYMA 2DBLH 1MF2H 1CD0A 1VGKA 2NY5C 3AS3A 2X4PB 3HC4L 3MRRA 3UPAA 5CSGA 4DUWA 5I75B 2WIIA 3KPSB 3FO2A 3BZ4A 5TDPA 5HD8C 3HZMA 2EC9U 1B2WL 4JFQA 1U8MB 2EH7L 1XH3A 1EFQA 2VDPL 2I60H 4H1LH 3MV7E 4XCCH 5C09B 4APQD 5EO0A 1IC4H 4LLMB 3GSNL 1UT9A 5D96C 5HHXL 2AV1A 4X7SL 1DE4B 1RV6X 3BSZH 3OB0H 3UDWC 3U1SL 4CBPA 2HG5B 4ISVB 4ORGA 2APWA 3RTQD 1DEEB 2B4CH 5IB5A 4EI6B 4QT5A 4WUUE 1LO2H 4MAYB 3BH8A 3EDFA 3VXSE 3BQUD 1RU9L 4GRMB 3TNNA 3VXNA 1C5CL 4NO2A 2IFFH 3GO1H 4OFDA 5F7UA 1J86A 2X4OB 3PWPA 3LDBB 4AENA 1UWEH 1DDHB 4H26A 4XPAL 4KZEH 2J3SA 3TN0C 4X99B 3IGAB 4JHZA 3MCKA 2PYFB 1JRHL 3WIHA 2ZSWB 3MRGB 2XFXB 4FZEH 5E6IA 4FXKB 2F15A 2J2ZA 4NQXA 3T0EA 3LKQA 4X5WA 3CDGB 5T3ZD 4FNLL 3AY4C 1A7NL 5I16B 2ZNWA 4I3SH 3SDAC 2Q7YA 3MCG1 3SDDB 1G84A 5HI4C 1MVUB 3BIKB 4M48H 1FGVL 5TGBB 4CN1A 5BMFH 1T1XB 5DURD 1M7DA 4BELD 5T1KA 2QQQA 2F58H 3BO8B 4OD2B 1JPFB 3QWQB 4A6YB 4XPGL 3IDMB 2O5YL 3ZDXE 3WDJA 3K7UA 3DWTA 5D1ZC 4L8DA 1X3DA 3ARBC 1ETZB 5E08L 3IETA 4Q9QH 3GKWL 4QCIA 5F7WC 3S3JA 1U3YA 2XTJD 5FUZH 4YC2B 4DCQA 4ODXA 3V5KB 3MLTB 3IXTB 1X4ZA 5H37G 2AQ3A 4K71C 2NY5H 3U36A 1UEYA 1ORQB 5KAQF 3GMRA 3HMWH 1IM3A 1U2CA 2QADB 4UIKH 5CILH 4TUOA 5HHOE 1OD7A 4U1JA 1QSFD 3C09B 2LAGB 3L7EB 1URLA 4QRRE 1J1XL 1KLGB 5L9DL 2LFGA 4RX4D 1QEWB 3NCCB 1D6EA 1DQDH 3K74B 4POZD 5FGCE 3MJ7B 5LBSH 1Z6JT 1YN6A 3JXAA 1TQCC 4KI5E 2DMBA 4LRIC 1KCUL 1DLFH 1A3LH 4PP2B 4OZIF 1T83C 4CADB 1MNUL 3CNKA 1F3DJ 4JZOB 2ZZUT 1GCFA 4ZAKB 4AZ8A 4BM7A 1HZHL 4OZIA 3VXUA 1UWGH 1FZJA 3JV6A 1MCOH 4GMSL 4OFKA 2ED9A 1XR9B 1KEGH 4OCXL 1MWAL 1EGJH 1Q1JH 2B1HH 2AEWA 5T5FL 4TQEL 4DEPB 4QTHB 4ZSOB 3ARUA 3NAAH 4OUUA 1BQLH 4U49A 3DHMA 4P59L 5F9JA 1D5ZA 5IHUH 2R39A 5I8KH 4IMLA 1VACA 3O3AA 3PV7A 4MQXC 1J87A 4QEGA 1WZKA 4OQTA 1VERA 3HB3C 3V5DB 4DVBB 2YZ1A 5J7CC 5DYOB 1P1ZB 1OTTD 4XNYL 3HUJF 1SMAA 3VRLF 1RUQH 2OTUB 3EOTL 3OGOE 1C7SA 1JUFA 1KT2A 2NX5D 3EYUL 5HHVH 4IHOA 6FABL 2R69L 4OCLC 4H1LG 4WFHD 4K55A 2EC9T 2VR9A 5DVOA 5GXBB 4P99A 4JN2A 4M4RA 1S9XA 1IRAY 1BOYA 4GXUM 3VA2C 3FT3B 1KEML 2PXYB 5CP3A 3P4LA 1I8LA 1OM3H 1TFHA 4HUUA 4O9HH 1A2YB 3WSQL 2FR4B 4YHLH 2HT4D 3EO9L 2R2BB 2FWOA 2VLJA 3MGTB 4WWKB 3QXTA 3U7YH 2NY3D 1LK3H 1GZQB 3A0OA 1OAQL 4LEXH 1BQUA 4Y5YC 1N4XH 4QXUL 3MV9B 4A2MA 1CFTA 3T04D 1N59B 3DX7B 1EAPB 4G6KL 5L6YH 1LEGB 3ULSB 1XGTB 5C0CA 3BD5A 5TQ2L 4IRSC 3UAJD 5DJYB 1CGSL 5HHNA 4ZFFB 3U4AA 1S7XB 3RWJB 1WBZA 3UBXG 1MLCB 4JPVL 1UKSA 3M17A 4XNXH 1HH6A 3U9PH 1F4XL 3VFPB 5HGBA 2CRYA 2IBZY 4PUBH 5J9PB 2FD6L 2P5EE 1Y0LA 2NY2B 1FHGA 3HZYB 1ZK9A 4JRXE 4WRLA 4PJDE 2W07A 3BXNB 5EN2A 4LPVA 3G6JE 2A73B 5DJDB 3MRLA 4JANB 2CLZB 3DV4B 1TVHA 2J8HA 1S7TA 1QFHA 4WFFE 4PJGB 5DWUH 5IWLC 2IQ9L 2MFNA 3HPJA 5EOCL 2XZQL 4RMUA 4W4NA 3VH8G 5HHMD 4E5XA 4MDJB 3M45A 4XXDA 4DQOH 1QRNE 1T04A 5F7DB 4DN3H 2GAZB 4CU7A 1IBGL 3AAZA 5E2VH 2AEIT 3CXHJ 4K07A 1FLTX 3ZE1F 1B0RB 3R8QA 3ABZA 3N1MC 3V6ZB 5J1AB 4EDXA 2AERT 1IEHA 4JFHE 3RTQA 4LHJB 3WXVH 4GUPB 5C07D 4YO0A 3EKCA 2JK5A 3NABL 1F5WA 1ORSB 3PWJA 4K7PX 2LTQB 2JF1A 2Z35B 5HYEA 4I77H 2PR4H 4MAUL 2GJ6D 3RX8A 5E94A 5CZXD 2F5BL 2QQLL 2FX7H 1W72H 3HI6L 4NUJA 5EBGA 5IJKC 3LN9A 4Z0BH 1G0YR 5DFVC 1T20A 3FRUB 4P2OB 5DUBB 4XVUC 3OKOA 1QVOA 4PJ9D 1PG7W 2O26U 3IFLL 5F7YC 4GAYA 5I1CL 4UNVA 4WFED 3C8DA 4HS3A 4P46C 4MWFB 4GQ9L 1XF3A 5ELIA 3DVNA 3ULUH 3HNTL 4ZFZA 3MMEA 4PB9L 4BUGA 1LP9E 1T66D 2FCBA 5EU4A 2IAND 4OBSA 2EXWC 5C6TH 4JG0H 2OJEB 4J23A 4EUPH 1E6OL 4YZFF 3H3BC 2FECI 4NQEB 5I66A 3EYQD 1EVTC 4PLJD 3HI5H 3C5JB 1MCJA 5DHXB 2FEDD 2OMBA 4I5BB 2N4IA 4JFDB 5EU6E 1GGIH 3HHRB 3FQRB 4OF0A 5GSRB 5E8DL 2CMRL 1K3IA 5C0DB 1AP2A 5LXGL 3KPOA 2EDXA 3MRDA 4H8WL 5HVHC 1HE7A 3GMNB 4OQTL 5GS0D 3LQAL 2C9AA 3RZCD 4ODWA 5BO1H 3B9DA 4KKCD 5J11C 3QNXB 3WIFA 3DVGA 2C1PA 1QSFA 3EHBD 1CL7H 5F7MC 3F6LA 3TIDA 4OLYH 3BZEA 5DD5H 1TQBC 3H9SD 3U4EA 3S36H 3ILPB 5CJOH 4Z8FH 3LKPB 3NCJH 4UV7H 4MD4B 4PJHF 1ZGLM 2P24A 2R9HC 3MRMB 2YPVH 4LDLB 3U48A 2GIYA 1FNHA 4K7PL 3PHSA 4PJHA 3ARDC 3SKMB 4LPTA 3QJHB 3QI9C 3ZLQC 2X4UB 1D9KC 5D7JA 5MEOB 4Z7UF 4PTUB 1X5LA 4WHYG 1C12A 1KF9B 4TVPD 4HS6B 1WCBA 4GKOA 4Z7UA 4F3FA 2D03L 1XF5A 5HI5C 5HDQL 2QSVA 1IC5H 1IAKB 3CX2A 1VFAB 1LNUA 5B39G 2HJFB 4JY5L 4MB4A 4F7TB 2MCPL 1OT2A 1SEBA 4LVEA 4HMEA 2EH8H 5HYJA 4X6EA 1EJOH 3OJVC 3H9YA 5DEGB 2VLRB 1J8HE 2F53E 3EIFA 2D9CA 5B38B 2OLDA 4G5ZL 1BAFL 2HTLC 4WHTB 5DRNB 4YFEA 5T1MA 4Y2DB 2R23A 1FVDB 4HS8L 1A8JH 2NX5A 4KTDH 2DQEL 4KQ3L 3D2UD 1P7QB 1UB6A 5KZCD 1A6UH 4X98A 4G43B 1U8JB 2ZOLA 5SWQA 3SPVB 4QRUB 5EUOB 1TPXC 3W11D 4WW2F 2XPGA 3T3PF 3AU1B 1A6ZA 5JHLH 2VDLL 2YWZA 4FQXD 4U1SA 2NYYD 4KI5C 4WW2A 2H32A 4BKLA 4ONHA 2V2XA 3E6HB 3UC0L 5HGGS 3U7WL 2NXYD 2BOCB 3ZL4L 3OJMB 4EN3D 5K33A 5C9JA 1I9JL 4LSRL 1LGVA 3RAJH 4N0YH 1S9VA 3LS4H 2VSCA 3SGEH 3WD5L 1NJ9A 2A0LC 3FHQA 3V4VL 3L3IA 2QQKH 5FV1L 5IW6A 1FZOB 1DANT 3AMKA 4QHUB 1KSRA 5J89A 2Q76B 4LNRB 4PJBB 5AWNH 4MD5B 5ACLA 4QXTA 4JFEE 1KENH 2G75B 3P9MA 1QR1A 5DI8B 3IRPX 2DTMH 5C0IA 1YEDB 2I5YH 4NQSB 3QIUC 4WWID 3TPUB 4NP4L 4WI5A 1S5IL 4OCSL 4NNYA 3T8XA 3PGFH 3AREC 1V3KA 3OJDB 4PGEB 4IOFC 5T3ZL 3VI3E 1QKZL 3QWRD 1IAIL 4WU7B 3PHOB 3MNZA 4LGRB 1IM9A 2YD3A 1TNMA 4Y5XC 4CU8A 3REVA 4JPKL 4EUPG 4NZRL 1C7TA 4NM4H 4H20L 1NGZA 3EDKA 2J12B 2SEBA 4LLVA 3BZFB 2AK1H 1JZ2A 1R0AL 1JGVL 3W0WE 4H0GA 2JCCE 5C07A 3MPCA 4ZYKB 3ECBA 4FQLL 1J10A 4G9FE 1YY8A 5JOEA 2E7HA 1IKNC 1PDKA 1LDPH 3DARA 3QPXL 5FCUH 1T4KB 4OZHE 4ZUVB 1I1AB 3WYRA 3IDJA 2NY7H 4U2ZA 4OLUH 5IHLB 1EZVY 2HVJA 1N3NB 4Y4FD 2R29L 1UWXK 2V6HA 4IDJH 4N0CC 1JMXA 2NZ9C 3FJTA 4NM8H 3SGEI 5KSBB 3BKCL 1FLRH 1UACH 1LO4L 1F4HA 4DZ8A 2MQ3A 2WBJC 2XWJA 3GSNB 3FT4B 4X8JB 3H3PH 1A47A 3Q1SH 4PJ9A 4U3HA 3DO7A 4P23D 5K9KA 3D0VA 1PZUB 5HVWA 1XF2A 1ZLVH 3LEYL 1KPVA 5FGRA 5DK2B 3KPRE 3E6FA 4N8VG 1YYML 3DMMD 1MRDH 1F58H 5IKCB 2IANA 4ACPA 5D7SH 4S0SD 3CXDH 1MEXL 2Z31C 3PL6D 1PQZA 3C60C 3L5HA 4O02L 2D7TH 4QRPD 4DOHE 3RKDD 2QHLA 3KPNA 3OG6B 1JMZA 1S9YA 2JJTA 4M6ML 4FG6C 2H2PC 3B9KD 3D9AL 1M7IB 3Q6FA 1E6JH 3T2NL 1MJ7L 3MFFA 1VGEH 1V7ML 1CIDA 1F4WH 3MNWA 1HSAA 3IDXL 5IFJB 5DHYA 4MNGE 4NYLA 4DKFH 3KYKH 4PBXA 1YEHL 4NN7B 4TNVK 2BNUB 1BJMA 1I3VA 3SGKA 4GW5B 3NZHH 3S96A 4JY6B 2D7MA 4FFYH 5EBMB 4MCZB 3L6FA 4U0RB 2BJMH 5EZIL 1F11B 3H9SA 3P9LA 3L5IA 2VZ1A 3V0WL 4HIXL 1HDMB 4E41E 4NRYA 2F74B 3MCLL 4DUXA 5FGBA 3TO2B 2XKNA 1Q9WA 2OTPA 1X7QB 2PW1B 3FB7A 4JRYE 1R5WA 1I8MB 1QFPA 4XNMB 4CN6A 3TBTB 4G6ML 1GOFA 1FBIH 3D39B 4OZFB 4JEGB 1A3RH 3LQZB 1INDH 1EFXB 2ZCLH 3EGSA 3DI3B 4NOFA 4DTGH 2XQBH 1GIGL 4NZTH 2E27L 2PO6B 32C2B 3GSRA 1N5AA 3OKDB 4NUGL 4XNQA 2FJHB 4ZFGL 5JXAH 4PRNB 1OARL 1AR1D 2BNRB 3CFJB 3OHXB 4NKOA 1JNJA 1R24B 3CDYA 1VEOA 3FN3A 3OWEA 3QYCA 2GT9A 3JWDC 3NIGF 4LLWA 4IRZL 2PYEE 4OM0L 3EFDH 1UB5B 4OSUH 3FFCB 5F89B 3L3OA 1ZHBB 3AS2A 2FEEI 4OKVA 4XP4L 4ERSH 1MIEH 1P84K 4JKLA 4NKDA 4M7KL 3EOBA 3QO1B 3IU3B 2W65A 2JKXA 1FYTE 4MX7A 1D5XB 3OR7B 5JQ6H 3P73A 3D2UA 4TVSa 3R1GH 2X89D 4MXQD 2ITDA 5DXWA 4PJFF 3L1OL 4JFYA 4PJ7E 1DVFB 1KOAA 1MWAB 4PJFA 1RJZB 4V1DA 1EMTH 3EOAB 2DQUL 2J4WH 4J6RH 4UMGA 4XP6L 1YN7B 3OXSB 4I2XE 3PWLB 4KAQH 4X5XB 1SM3L 1A6VL 5BVPL 5IESL 4L9DA 5FYJU 5FYLE 4EN3A 4RCAA 2LU3A 5D2LB 3EOYG 4D9QE 4M5YL 3R4DA 1A7BA 3S3SA 4EI5B 35C8H 5MEQB 3FO0H 1NGYB 1L6XA 1VGKB 3UPCA 3MRRB 5SV3A 1I1CA 4Z18A 2WIIB 1LILA 4OT1L 4OFVA 3HZMB 4JFQB 1XH3B 2CDFA 3T65A 5CEZE 4Z7QF 3RWHB 4D0CB 1UJ3A 4U1GC 2AJ3B 4UT9H 5EO0B 3HLAA 4QGTA 2DL2A 1BWWA 3HFML 3WFBH 1XGQB 2AV1B 1YPZF 5EBWB 2XTLA 3QWRA 4XRCA 3QHFL 3RIFF 2X40A 3STLA 2HAZA 1YPZA 1TXKA 3TT1H 4Q0XH 3O3BA 1A1NA 4PJXF 1ZVSA 4HXAH 4QT5B 5IB5B 2HRPH 3C9NB 5BZWB 3BRGC 4UQ3A 3WFDH 5IF0A 2EDLA 4Z7VF 1RUML 5LQBL 1HNGA 1CK0H 4PJXA 1YC7A 3VXNB 3QEQE 4U1LA 4ZODA 4NO2B 4HFWA 4Y4HC 4OLVH 4Z7VA 2XQYK 3PWPB 5B4MD 4WJ5B 2OTWB 2H26A 3JWDH 5FIEA 3SJVA 4H26B 4JDZA 2Y06H 1U36A 5I18L 4YHNA 3GBMH 2X9XA 4MNQE 3MCKB 4XHJC 4Y4FA 3SOBH 1JHKH 2IAMD 2C4FT 3UJJL 3DX6A 4E42A 2A9NH 2YPLE 4XCEA 4PJAF 3LKQB 5GS0L 4M8VA 2VL5A 2R1XA 3I3BA 4TSAL 4ZXBC 3VFGL 1YECH 4PJAA 4LOUD 4OD1L 4P2RE 5GS3A 4NWUL 2AP2A 4YDJA 1T03L 1E28B 2BC4B 1M7DB 1G7HB 4RA0C 4UQ2A 5IK3A 3ZTNL 5I71B 4NDMA 5FYJD 2QQNH 3CIQA 5SWSD 2R0WL 1NGXA 1WTGT 2ADFH