5DJCA

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCVVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
total genus 37
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA01
1PY4A 3B43A 3ULVD 5I1IH 1O0VA 1KJ2B 3TZVD 4PB9H 1MI5B 5MEOA 2X9XA 4ZUSA 1NH6A 4P2CG 4CMHC 5D7KD 1NEZG 4F2MB 5E6IB 2X1XR 5EOQH 3VRJB 5JHDE 3C5SB 2ICCA 5MERB 3W82A 1G6VK 4XWGL 3TZVC 4KZEL 5FM4A 5KG9B 2P46B 4M5ZH 5HDQH 5CJ8A 1BFVL 2JCCF 5EUOA 1KCVH 4WCYL 3UEZA 3JBG7 1G7QA 5C0JB 1A3RL 1VFAB 3VXOB 4YWGL 5DVMA 1CBVH 4EI6A 2G5BB 2X4SB 3MCLL 1KXQE 3CSYA 2P7TB 1NCUA 1RUQH 3ARBB 5DUML 3VH8B 1CD1B 2FZ3A 4EI5A 3AVEA 3O6ML 1F4AA 3CU7A 1YEEH 4L8SA 1LK2B 4MNQE 1RUML 3I6KB 3BP7B 1MHHB 3BESR 2VDQL 3DX6B 4G6JH 3UP1A 3RZCB 2D4FA 4ODTL 4XC1L 3OKYA 25C8L 3V5KB 3QUMB 1NGPL 1FO0A 1G7PB 4NPYA 4RDQF 5EZOH 4DAGH 1EPFA 5DZOA 5IROC 3K0WA 2P47B 2W0LA 5K9JL 3EOAB 1EAJA 3CK0L 3VXMD 4D9QE 2Y23A 3RWDB 4JQXC 2BJMH 3UZEA 4UDUB 1AGBB 1BIHA 1UM5L 2OXGA 2Z91A 3GRWA 1OSZB 1A0QH 5EOTB 2Y7QA 4OF8A 4JM2C 1ZLUK 2VLJA 3OR7A 1NFDB 4QHUB 4WFED 1GIGL 2VOTA 1TZIA 2D03L 2JJUA 4PJEB 4X9FA 4Y2DD 4HUUB 5E8NB 4JRXE 5TE7H 4F7EB 5I18L 3VFMB 4JFFE 3IDYC 4XBPA 2DLGA 2VRAA 5DO2D 5HD8C 1KPUA 2AEPH 2GAZA 3MRLB 5EN2A 4S1QL 3DURA 3KPNB 4HHAA 2V5RA 1WLHA 4LGPB 5DJ0A 4M48H 3OKNB 2FSEA 5D1XC 4OJFL 1YEJH 3CSGA 4A6YA 3GHBL 4EDWH 5F7DA 2NY2B 4B5EA 4L8CB 5FO7B 3UTSB 1R3KA 2BC4B 4X4XA 5BZWB 1A7NL 1YMMD 2WIMA 2A6KB 3MUY1 1EV2E 3V9FA 4YLQT 3H9SE 4R0LA 1INEH 1FC1A 4Q0XL 3SDXE 5LGHL 4WO4C 2AJSH 2PW1B 2BDNH 2OL3A 2VH5L 4M3JA 4OZGE 5EBLB 2CLZA 3SKOA 3X12B 1JTPA 5TQ2H 1SMAA 3WLWD 1FNEA 5JMRA 4M7LT 1INDL 2L7UA 3VMOA 3ARGB 3HC4L 4OZGB 1KLUA 5I1AA 2GSGB 4P3CL 2EH7H 3CJJA 3TESA 2NW2A 1KENL 4YDLB 2H2PC 2B4CH 4IOIA 4XP5H 2HFGL 3CFJB 1SJVA 5DJYB 1QLRB 2F8VA 3PP4L 3P11H 1RU9L 4U1JB 5J13C 4GT7A 1UXWB 4PY7B 2BNQE 2NLJA 4GW1B 3B5HA 3S35L 4KPHH 2GJ6D 2YD9A 4UINL 5IOPB 5C0IB 5F9JB 3QR2A 5DK3A 3C60A 2YUXA 3FCTA 1BECA 3QZWB 3BIBX 2R9HC 4EKXA 2X2YA 1CLZL 2E3VA 1VHPA 3FO1B 3E6HA 1ZANH 3RUGB 5B39A 1ZSDB 4EVNA 3VXNB 3ZYIA 2ZUWA 5HHMB 1ZS8B 3QPXH 1DQLH 5A2JH 2P24A 3LVEA 4JGJA 4L5FL 1J1OH 2J8UF 1A4JA 4M5YL 4PJBE 4PUBL 5GGSB 4UDTA 3PABB 1T6VN 4QYOB 3KPLB 1KCKA 1OP5K 5TDPA 3OL2A 1QSZA 1T83A 1J8HB 5FHAL 1NLDL 1GJIA 4MJ6B 4ZOEA 1F45A 1OARH 4LSVH 4HC1L 5J13B 3CFBB 5FKPA 4GUPB 4Z5RA 3PXJA 1RFDL 1F6AA 2UZXB 3SDAD 4POUB 4NC2B 1Q9KB 1FFOA 3RUGF 1A1MA 3BEVB 4P5TC 5JW5B 4X6BA 1A6TB 4L4VE 3RTQC 4NP4H 2DJ4A 5KVMC 4ZO7A 2P8LB 2R1WB 2PO6D 3V0VB 4O58L 1I8LA 4NQCE 4JRYB 1A9EA 5J1TC 3GEWB 3NFPB 4QRTA 4XH2B 1I9IH 4N0CD 3RTQB 3ARBD 2B1AL 4S1SL 1KFAH 5FO9B 4OLYL 1M7IA 4LHUG 2R29L 4RMTA 2ITCA 1TQBB 4WI3A 3U6RA 4CKVX 5BS0B 5CZXD 1QSFE 1KCVL 5C0CE 1G7IB 4G80A 4XGZB 5SWQB 3WNOA 2D2OA 2DQGH 3MV11 4NKMB 4Z76B 4IMLB 2VLKB 1P1ZA 5K9KA 3KNBA 4K8RH 2I9LA 1I9EA 4PREA 1EMTH 3W0WD 2GJZA 2HRPH 4HS3B 2OSLB 3VI4E 1H3VA 1OB1B 1QBLH 3CLEL 4NO5B 4WW2A 1C16B 1MLBA 3V6OC 5HVHB 1N6UA 2GTWB 1FH5L 1QD0A 4G7VL 4P2QE 3JTSA 4LCIH 4GBXC 1M6OA 2O5XL 4JR9H 4YHPB 2EDWA 3K1KC 3NH7H 4LCWD 4IRZH 2HFTA 2AK4E 5F9WB 1MRCL 4HCRL 1QFOA 4PY8I 1O7SA 2PO6A 2QEJA 2MNUA 4KKAC 1AY1L 2VISB 2JF1A 2XA8H 5D93B 2E6JA 4LRIA 1Q72H 1B2WL 4N90E 5IBTL 5CJBA 1MJ8H 4XVJH 2Z92A 3QIWB 3MLWH 4E9LA 4X5WB 1MCWW 5EU7C 1YPZE 3PL6A 5KZCD 5FGRA 4HAGA 1AHWA 2BOCB 3NCJH 3FL7A 1KENH 4HWZA 2F54E 1E4KC 3T8XB 5J9PA 1QNZL 3DIFB 4P3CH 3VWJB 4NJ9H 4V1DA 2VDKH 1JGEB 4NKDB 3TIDB 4P2OC 5FOBB 4JN1H 1FNSL 2X4QA 4WU7A 2NXYD 3T77B 3QO1B 3U9PH 3LQMA 2A6JA 1MAMH 1NGYA 5TQ2L 5IB1A 4E42A 3PWPD 4WTXA 1G9MH 5FHBL 32C2A 3WFHB 4HKJA 5GHWL 1JGLL 4XXDA 2XQBL 4DW2L 1DN2A 4Y5VA 2CR3A 3VXUE 3LEXB 3HI5H 4Y5XA 1W72B 4KK8C 4QOKB 3F7PC 3BGMA 4RMRA 1RZ7H 1LNUA 1RV6X 3HG1A 4XPAH 1SJXA 4PJ8B 5LQBH 5FA4B 4URTB 4RFEB 5AZ2L 3ILQD 4W4OC 2CPCA 3MNVA 4NNXA 4HKZB 3KYNB 4S0SD 4PJ5B 2GJ6B 2BSSB 4XHJD 3HFML 3F5WB 1BPVA 4RZCA 3O3BB 5FYLH 4PJFB 4JHZA 2YKLL 3AS2A 3MLRL 3B2UD 5GJSH 1I1AA 3ZKXB 1JGDB 1DR9A 1Q9LB 5HHXL 2QQNH 2BNRE 1GIGH 1LO5B 3HZVA 1NKRA 3RY6A 1PG7W 4JB9H 4BQ9A 1RK0B 3QSKB 3QDJB 1IGFH 2PXYD 5IHZA 5HHMD 2RCSL 3ULVL 2A38A 1DLHB 4NQDB 5IVNA 4MQ7B 5C9JB 4NKQB 3V4VL 1A2YB 3UCRA 2VXTL 1II4E 1MFEH 2ZCLL 1AGFA 4C83B 5CUSH 4LLDB 3GK8H 1ES0A 4O58H 1WCQA 2D0HA 3FB8B 4G8GE 2IG2H 2YPKA 4Y5XC 2NY0B 4I0PB 1GC1L 1XGYL 2ZCKH 3O41B 5CEZE 1XGUB 3K8KA 4XPGH 1F4YL 1T7ZA 2HKFH 4WI9A 5AAWA 2AKRB 5D2LA 1IAOB 1RUKL 4E41A 4NC1E 3L9RB 3OBAA 4KH2A 3UJTH 4HF5L 3NAAH 4LFHD 4O2EA 2J88H 3L9RA 1P84J 2VLJD 5IR1A 4ZNEE 1IAOA 4NYLB 3VD5A 1C7SA 12E8H 3IDMA 2GSIA 3MBEA 4M5ZL 4KTEL 4X9GA 5HDQL 1KYOK 1UWEL 2X40A 5AYUH 4IOFD 5ILTL 3QCVH 3O2VL 3PWJB 4G9DA 5DD5L 3EYQC 2CKBH 3BKCL 4KJPD 5E4EC 3FONB 1ZANL 3HE7B 1DUYA 1HQ4B 3KPQA 3MRCA 1IQWH 1S7XB 3O6FB 1CE6B 4O4YH 1TITA 3KPMB 4PTUB 4JFXA 3W5MA 1ONQB 1I7TB 5JW3H 1AGFB 3QHTC 1IC5H 3O81A 5DR5L 3DXAD 1W0WA 3QFJA 4FFYH 4UNTA 1EHLH 5EORH 1ZHNB 3DVNA 1NCWH 1W0VA 3SDXB 4J4PA 4LFHG 3PP3K 1RK0A 4M7ZB 2XZZA 4HIIB 3ZSSA 3NZ8A 2CO7B 3FT3A 5IMKA 2V17H 1UH2A 4GOSA 1Q9LA 3GJEA 1S7WB 1AE6L 1I1AB 2MPAH 5GS0D 3CXDH 5TFSH 2EH8L 2FD6L 4ALAL 2BP3A 2ARJQ 1CICD 4P46A 5D7JB 4B50A 2KKQA 4OD3L 1FIEA 4RWHA 4TUOA 5TF1H 3HAEG 5MEPA 5I17B 4C55A 2H1PH 4PJIE 1J10A 3VGHA 5EBGA 3OKEB 2R0KH 4FQLH 3ZL4L 2FX9H 1PJ9A 4PJ8A 2VERN 1IE5A 1IGIL 5LGJB 1DE4B 1LNUB 1FNSH 4PGBB 4ZS7H 4UQ2A 4Y8DC 1OQXA 2QR0B 5CIPB 4HS8L 4D3CL 3JVGA 3LEXA 5IVZA 4X5XA 4CL7A 4XBEL 4LOUC 3HR5B 4HKBB 3DUHA 4Y4HC 2H2SD 4JM2F 1N7ML 3QQNA 2DL2A 2ATPB 2Q7YA 4NKIL 3LRSB 1I8IB 4RA3A 3BZEB 2JCCB 1Y18B 3DRQB 3CVHL 5IW6A 1XCTB 3GSWB 3WMSA 3L3JA 1KUMA 5DRWA 4KQ4L 1JRHL 2X4QB 2W38A 1QLEL 4H25B 1UWGL 4Q7DA 2FL5B 4V1DB 1I8KB 5TH2B 5JIHA 4LARH 3KXFE 4PJ7B 5KSAD 4DGIL 5J1AA 3D69B 4MZ3A 3VMNA 1T21A 1KIQB 2YSSB 4Q74A 1YQ2A 2X1QA 4HSQA 3QIWA 2ED9A 4G8FB 5FYJU 3QDME 4UT7H 4G9FE 5EZIL 3RFZC 4ZS7L 3VFWB 4X6EA 2J6EA 5JA9A 1BLNB 5JO5B 2JIXA 2B20A 3CLEH 4K71C 2BY3A 1MJJA 1J5OL 5A3IC 4MYWB 2EIDA 3NCYP 1DBML 3OWEA 3NIGF 5K93A 5TF1L 5I1LA 1TPXB 3G04A 4OI9A 4U2ZA 1RURH 2ARJA 4LCCA 4WV1C 3LZFL 3H9HA 4MJIA 1KNOA 1WWWX 3ELAT 4CRPA 1WWAX 1JNLH 3E1F1 1T4KA 1IKNA 2GFBB 4AH2B 3UJTL 5CGTA 5TDNA 1NGXB 4PRAA 1Y6KR 4HS3A 1RJYB 2C4FT 2WW8A 4JKWA 4J3WA 3I2CL 2F5BH 1BQHA 5JUEH 4LEOB 3QEQA 1N26A 2OMNA 2IFFL 1E28B 5F93C 3ARYA 1CG9A 3DHMA 3T65A 1RHFA 2NY0D 3BMWA 2NNAB 3QEQB 4HUXA 1Y0LA 3LPFA 3BPOB 1BQHB 2VLRB 5F9DC 4XXCC 4R0LC 5CCKH 5EUOF 5I75B 3U6RB 4W6YB 4HWEH 3GMMA 4NCDA 2NY5C 4JM4H 1XIWA 3QXDB 5DEGA 4D94A 3QIWC 1MWAL 4BQCA 5E4EB 3CC5B 4NWUL 5E9DB 2XWJB 3MNZB 3I84A 3HMWH 3QEHA 5EU6E 2J8UA 3WHXB 3L5JA 4ZSOA 1S78C 1A5FH 4XZUA 2ZUVA 4LHJB 4YO0B 5B3JF 3OXSA 1BLNA 5JO5A 4M8QA 1X5AA 3MRMB 5GJSL 3C9NA 4L3CB 3V4UL 3WIFA 3CFBA 1NBZB 1A9BB 1NCDL 2AK1L 5F7KC 1DBKH 2FH8A 4OZIA 2HJKB 5F70A 5IESL 2DIBA 3QDHA 3LKOB 4O2CB 1T22A 1I8KA 5TH2A 3QEGH 1A4JB 1DQQA 4NO2A 2D03H 1MCOH 1QG3A 4G8IA 3BSZL 3VG0H 2YD8A 2IG2L 3I50L 4LHUD 5GGQH 4GRMA 1TNNA 1R3HB 1WFOA 3QJHB 1I8IA 3BZEA 4XC3L 1MJ7L 3RKDD 5JHDB 3CCHA 3MMEB 2VXTH 2FECI 1V7NH 4X6CF 3TVMA 4HKBA 1EAPB 2H26B 4CVZB 1SVCP 4NQVB 2R4SH 2DMKA 4CW1B 2LTQB 2P43B 3AU1B 1BX2A 4LPVA 2EDOA 2J4WL 5FDYA 3S36H 4AG4L 5T1DH 3FFCB 5BJTB 2C7UB 2EDBA 5DURB 3TJEH 3RVTC 4PB0H 4CU6A 1IAKB 4HIXH 5CZVL 2FBJL 2EC9T 3UTPE 1SMOA 1T5WB 2W0FB 5T3XE 3KAAA 3CFJA 2FH6A 1FQ9C 5HYJE 3F8UB 4OTXL 1XR8B 4UQ3A 5D7JA 2QADB 3MRJB 4XTRD 4OIIL 1CK0L 3O8XB 1HZHL 3MOAL 1LO4H 2I24N 1D5BB 1YPZB 2V2XA 4HPOL 4M02A 4JZOA 1DVFD 3VFPA 3ARGA 3QYCA 1MHEB 5IQ7L 1WICA 5EU5A 5FV1L 5B38G 5LJYH 1HHIA 4GG6E 3RWFB 1TLKA 2KDGA 4LEXH 3UJJH 1I8MA 2OL3B 1UZ8B 1RZ7L 2ID5A 1KTLB 3RIFF 3OKMB 5AWNL 5GZND 5CWSB 5I1EH 4DWHA 3K2MC 5TE7L 5GHWH 3TO4A 1BBJA 3VE0A 4LCYA 3O4LA 4TPRH 4L8CA 5JXAH 2DI8A 4HMCA 1SEQL 3DGCR 4MNHB 4HCRA 2CLVB 4PLJC 4ZAKC 1CWVA 3EDJA 4I3SH 5SX5H 4WWKB 5J7CC 1GXEA 1JUFA 4XBPB 4LLMB 4WW2C 4X7CC 4YXKH 3B8SA 1JGUL 4GQ9L 5E5UB 3NGBC 5SX5K 1E6JH 1B6UA 5ACZA 2MKWA 3O6FC 1DL7L 4KAQL 4F33A 5I2IB 5EOTA 2HMID 1GH7A 1OSZA 3CZFA 1WEJL 2CGRH 3P73B 4OUUB 3ROOB 3OMZA 3GI8L 5EUKA 4XPFH 3PNWA 3ZTNL 1F6FB 3MLYL 3PWUB 1YEEL 1JWUB 1DQDH 4PTTA 4W81A 4HJ0D 4XB7A 5HYSG 5F71A 1FO0B 1TCRB 4NPYB 5D1QC 3A6BL 5HYFA 5F7UA 5B21A 3OHXB 2WNGA 4HBQA 3MCG1 1DBKL 3B83A 3P3YA 3SPVA 3PDOA 1AXTL 3BP7A 1FFNA 1MFDH 4PLJD 4U1GB 3P4NA 3CMGA 3HNTL 4NQDA 2PXYA 5E70A 2DS4A 2BFVH 1XFPA 3DGGA 3PGDB 3F65A 1TNMA 3W9DA 4EUPG 5BS0D 2EDXA 3RY5A 2G5BA 1DQJB 3PGFH 8FABB 5KSBE 5J6GA 3VXOA 1E4XL 1F5WA 4PG2C 1VADA 3GMOA 1IAII 2X5PA 4PJBB 1MCJA 2HJFB 3U4EB 5IFHL 5LXGH 5DD5H 4LLVA 5D72H 5HHOA 1LO5A 2R4SL 5KG9A 2K1MA 2F5AH 4G6KH 4DTGL 3STLB 5ETUB 5M94B 1K3IA 3VRJA 4YHNB 3FAWA 4NT6B 1QVOA 1NAKL 3VXTB 4PJ5A 4Y1AD 1N0XH 4HKZA 3DMMA 1DVFC 2CSPA 4Z77B 1UJ3C 1FLRH 2VLRE 2XN9E 1GGCL 3MJ9L 4YHMH 1L9NA 1S8DA 4ODSL 4Z7VE 1HDMA 5F21B 3X3GL 4KK6D 4XTRC 1NC2D 1QQDB 1VACA 3BPLB 2D7QA 3SBWC 3AM8C 1BJ8A 3CU1A 3VW3L 5DQJB 4P23A 1WZ1H 1W72A 3PWPA 1NDGB 2FO4B 5EFIA 1IEAB 3QWQB 4Y5VB 3PHOA 1MY5A 5D4QA 5C6TL 5GS0L 5JHDD 3OF6A 4LSTH 5I71C 2NXZB 1K2DB 2R1XA 1R5VB 1LP9B 4KMQA 4ZUTB 2QQKL 3SDDD 4AJ0A 4DGVL 1U8KA 4OD2A 5HGDA 4OQTA 4H0HB 5DHYA 1F4HA 3BT2H 4HZLA 1EX0A 1JGEA 3RKDC 2ZG2A 1UCBL 1IAIH 3MACH 5F3HB 4M7ZC 5SWSD 4NWUH 1CDIA 3TP4A 5IBUB 1UVQA 2E27L 1LO2H 4JHAH 4ODUA 3DARA 1AHWB 2BOCA 2VWEE 1FVCB 3ZE1E 2RIKA 1TFHA 3SKUD 4X5WA 2H8PB 1OOAA 4KROB 3RJDA 1I9JH 3WD5L 1BWWA 2APFA 5C0EB 5LGKA 3MRFB 1HHHB 4TUKH 5JW4Q 2N1KA 3IXTA 1AFVH 3NZHL 3LEYH 4BH8B 1YN7B 3QH3B 5JW4R 2XTJD 1NEUA 5IV2A 2XY2A 1J8KA 4P57B 4N5EC 1K5NA 2XWBB 1D5IH 2HFGH 1U8PB 4FMFA 1OSPL 1S9YB 4YHPA 1S78D 1OL0A 1OGAB 5MI0B 4AEEA 3LB6D 1I85C 4WEBH 3MQIA 3AM8A 4ZOAA 3ULVH 1C16A 2E7LA 4WFHE 1RUAL 1ZHBB 2PYED 3UROR 1S9XB 3TN0D 4Z7VB 3C5JB 3Q6GL 1T2XA 2ESVA 3GIVA 3FB7B 2W0KA 4M6NL 1CE1H 2E6PA 4HS8H 5FYJD 3BKJL 3KNBB 5HPMA 1CT8B 2KL6A 5DJ6A 4NKMA 2XI9A 5D1ZA 4B53A 5EIVA 1RQ5A 4M1CC 4JFEE 5ICXB 5H2BA 1G7IA 1RIVH 3WSQL 2R2EB 2NY0C 1MCPH 3VXME 4D9QD 3IVKA 5ESVB 1NFKA 2EIZA 4LHQB 2QHLA 1E6JL 4YC2C 5FECA 4K94H 3TBYA 2CMRH 1VKXA 4JQVC 4J4PC 4KRNA 2QKIB 5C7XL 4QHMB 1J1XH 4LQFH 3TT3H 3FMGH 4WU5A 4MNQB 4Q2ZB 5D9SA 2DWEA 4G8GD 3MLSL 4MCZB 2YPLB 5I1JL 4UUJA 2VABB 5CSZB 4M43L 5I8KL 3L5HA 1JZ7A 5EU3A 2X42A 3ZT6A 3GMPB 3R06A 1UM5H 4FFYL 1AO7A 3QUXB 2CIKB 1TETL 1CR9L 4XPHH 4TYUA 3OXRB 4WW1A 3UTTE 1JHTB 2MQ3A 1N5AA 3FQXB 1TVHB 1J8HA 1A6UH 4NO0D 2AV1A 4H1LG 4Z7QF 4PRNB 5FYKU 4NCC2 2OBGA 4EXKA 5D1XA 3D9AL 4QRRE 3QT2A 1LGVA 3D1MC 1CXLA 4R90L 3TEUA 4Y4HA 2GY7B 1DP0A 4LLAA 4RGNB 1OAQH 5L8JB 5FXCH 4BFIB 1MRDH 1JFQL 3RDTB 5CEYB 2IPKA 3K7UA 2DQGL 3L3OA 3IDJB 3BRGC 2V2WB 2C3GA 4ZPTA 1HHKA 4X7SH 4LKXA 3RNKB 3QZWA 1AKJA 1RULL 1BM3H 2P48B 5C0IA 3DSNA 2BCKB 4U1LA 4YXLL 5F96L 5TGBB 4ONHA 2P4AB 1RHHA 4DKFH 1PDKA 1PFCA 4TTDC 3RIFK 1C5CL 5HHNB 1R5IB 3MRKA 4I9WD 3VFSA 1FV1B 1QLRA 2HVKA 4RGOH 1PEWA 3O3DA 1SJHA 1K4CA 4YHOL 4O51A 4MXVE 2Y72A 3HKFA 3RI5K 4HUNB 4BFEA 2XZQL 3QFDA 4M62H 1CFTB 2C1PA 5I6XB 1JI1A 2F9BT 1TJIL 3JV0A 1MRFL 3O9WD 2JJVA 4WHYH 3N85L 4KTYA 2VDMH 2IPUK 4X6DE 5L88L 3UYRH 3MBXH 1YEDA 2Q76B 3SKOB 2UWEF 1HNGA 2BOBB 4LDOB 3LKNA 3KHOA 4LSPL 4NNPH 3TBVB 4RWYL 4YHLL 3OAZH 1B0GB 3KYMA 5SWSB 3MRBB 2BVPB 4LRIC 2A6KA 3C08H 4CDGC 4S2SB 3JTTA 2UWEE 1T1WB 1ZVSB 4NNPL 5B38B 1J1PH 3DNKA 4HHAB 4R97C 4NN5B 5L88H 3IDGA 3FB5A 4PIRF 3TLRA 1VGKB 4X4ZA 3GHEH 1CFSB 1IKFL 5DC4B 3QNYA 3D87B 2ADFL 1TJIH 2F58H 1LO0L 4Q9BA 3ULUE 1A7PL 5FHAH 1U3JA 2B0SH 1QYGH 1JPSH 5ERWB 3UAJD 1NFDA 1U93A 1D6EB 4PJDA 3MYJB 5E6IC 1OWRM 1TPXC 5F7YC 1IBGL 4MA7L 1P6FA 5C0FB 3O3EB 4X7TB 2O26U 1Q1JL 5EDXA 1BQUA 3T4YA 4DFIA 4JY6A 4BH7A 5JW4M 2QHRH 1I3RA 4LAQL 3O4OB 1X6LA 1Q0YH 3T0EC 2ZUUA 3LKPB 3HNVH 4O2FA 4FQIL 1D5XB 1EBPA 1KN2H 1L0YA 4X7EC 5GRUH 2EC9U 3P9WB 2EO1A 3EYVB 1EFXD 1RZIA 4GG8B 2GK0B 4K2UL 2NY3C 3QUMA 5BRZE 5MP6L 2HTKD 2FNBA 5DMKA 1OAZH 5DUBB 4JQIL 2XKUA 2WBJA 4IRSA 2Z8SA 4J3SA 4NHUB 4RNRB 3HFMH 4Y4FD 1DTUA 2NMSA 3P0VH 3H3PH 4LCUA 4LPTA 3SCMC 1UEYA 4XP5L 3BUTA 5E9DE 4R90H 3TPKA 5I1EL 3Q0HA 2I9TA 1KTDA 5EU7E 4Y16D 2IQ9L 4HH9B 3WD5H 1VFAA 3EKCA 2YPLD 3QNXB 4BUGA 4CMMA 4F7TA 2IH1B 1KC5L 2VITA 3GJFK 4L4TE 4U0QB 4LSRH 5FCUL 1YEGL 4JY5L 3NIFE 4UT7L 1ZLSH 1D5ZB 4M1DH 1VPOL 2VDPH 4JFEB 1DBJH 2PYFB 3EO0B 4KQ4H 3C09B 4HIJA 4TOYL 3H3PL 1H3TA 4KXZH 1HK6A 2B1HH 2R23A 5E6IA 1HKLH 4Y2DB 5FO8A 1URLA 2BJML 3IFNH 4HXBL 1A3LL 3CK0H 4U3HA 3GO1L 3LSOA 4HMEA 3AREB 5D6CA 5DI8A 1EZVX 5IW1B 1ZA3A 3DTXA 4LP4A 1ZTXH 1YNTA 4EN3B 5ADOH 3GRWH 5J57B 4G42B 1MFAH 2LTQC 2VO5A 1PSKL 2X89A 3UTSD 2IH1A 3BIKA 4I5BA 1LILA 3SN6N 3ECBA 4PLOB 3EJYC 5L2KD 4JJ5B 2QTEA 3V5HA 1LO3H 5I30H 4LLYB 4Z95L 5F7MC 2Y6SD 4TNWK 1UADC 1AE6H 3QG7L 1J9CT 3ZYOA 3WFZA 5IEKA 1CE1L 1HXMB 3DSFH 1YEFL 3ZKXC 2AGJL 5C0BB 3I75B 3LQAC 4IRSB 3BD3A 1GOHA 5D70L 5EOCJ 5C0DA 1KIUA 4OI7A 1SJEA 1N0LA 1L9MA 2B2XH 3PGFL 4MQTB 3LKPA 3DSFL 1JK8A 2MWCA 5JIIA 1A1OB 5TFSL 1A5FL 2APWA 5K9OB 5DURD 4YNYB 4DOHE 2FB4H 4LU5H 4ISVB 4FQXB 2P49B 3V6FA 1A1NB 4KKAD 4N0UB 3T3MF 1D6EA 2R4RH 1ZLVH 3ZMRA 2DLFL 1F00I 1YNLH 4YPGA 5E8PA 5I1GH 2YOCA 3UTPD 3V7AG 1YNKH 3WUWB 5DD6A 5EORL 4F15C 4HX1A 4GBXD 5IEHA 3W2DH 1J0IA 1A4KB 5IF0B 3NAAL 2UZIL 4X4ME 3FB5B 5C0ND 4XCNB 4KZEH 1LE5A 3KDMA 4P5KB 3ZDXE 4KTEH 2AJ3B 4H0IA 2OL3H 3RVXC 3DVGA 4ELMF 2W9EL 4OZGF 2XTJE 4NQEE 5LKNA 2BSED 4PJIB 4Y19D 4AM0A 3NFNB 3QNZB 4N8CH 2ICWB 1XCQB 1FNHA 3L7FB 1B0GA 3BQUA 4UIMB 4YDLC 5I66A 4NKOB 5ILTH 3HMXL 4WHTB 3UC0L 5D2NA 3BT2L 3AS0A 3D2UB 2X44D 4NWTL 1PGRB 1FZMB 3HA0A 3I3DA 5L2KA 4GS7B 3ME0A 1MEXL 1NDMA 5TPWH 4DCQA 1EGJA 3PJSA 5HGAB 3JWOC 3L3HA 4WHYG 5FKAB 5HBBA 1SVZA 2FX7L 4PJIF 5FB8A 1ZEAH 3O3DB 5E2VL 3RTQD 1ZT4B 3K4ZA 3TA3C 2XQYG 3TIEA 4X83A 3HI1B 4E0RA 1BD2A 4K7PY 5HHNA 1VENA 2BVQB 4Q6YA 4XPBL 2A9ML 4OJFH 4HBCH 4HPYL 3FZUD 4U4BA 1L7TH 5FYLL 1E4XH 3X17A 4YZFF 3AMKA 3F7RA 2BCKA 2PN5A 4U1LB 3QWRD 5ALBH 1NBYB 1MIEH 4ZAKA 1LO4L 1RY7B 3HNTH 3CUPA 4JM2A 3C6LD 3OQ3B 2VLKD 1MFDL 1GAFL 3BHBB 1MCSA 1WAAE 3L3OB 2IPKB 1C12B 5D8JH 4BFIA 4KI5D 3VFGH 5DLMH 5C7XH 2CMRL 3BISA 4ZFOB 2BVEA 3BKYH 1I7UA 4AMKH 2EXWD 1OTTD 3F12A 3L3GB 1IAMA 1RZFH 1MHPH 4RMWA 4AL8L 2BK8A 3VRLE 2NX5A 2R9HD 2M2DA 4QRUA 4NRXB 4MA8H 3FQXA 2LE9A 2G9HA 1FN4B 1P7KB 3NMEA 5DVNA 5L6YL 4WW1B 5FUCE 4BJLA 2HLFD 4ZYKB 4L29A 2H32H 3T4AA 4LDEB 4OF3A 3HI1A 4TNVK 3MLZH 1FVDA 3NPSB 1CL7L 4J6RL 5J3HD 5ADPL 3GMPA 4MHHG 2AGJH 1DEDA 4U7SA 1W0YT 5FFLA 4GAGL 4NC0B 2EH8H 2FD6H 4ALAH 5EIIA 5JDSB 3CDYA 3DV4B 1MHCA 5T3ZD 3MX0A 3C6SA 3CVHB 4MCZA 3IJSB 3MFFB 1OW0C 4PJCA 4PR5B 5E2WH 5L2KB 4HMDA 1UZ6F 4LBEB 3VWJD 3TH3T 4YWGH 4QHMA 3L5IA 4OGYL 1VB9A 5DQDL 4Y19A 1XGQB 4MA3A 4YDKH 3T0WA 5GGTH 3MZTA 1N6QL 4FNLH 4XP9H 4ZODA 3VGFA 4CN4A 1XCQA 2RHEA 2CUIA 1FBIL 3DO3A 1JPST 1X5XA 4TUKL 1OPGH 5ICXA 5C0AE 4FA8A 5ANME 3CDCA 2BNRB 3RI5F 4JFZH 4RGMB 4FZ8H 5K9QI 3ARFA 3SE9H 3UTZB 4HGKC 4UTBH 2AJVH 2NXZD 1FYTD 1MRFH 4XMLH 3DO7B 2R2CA 1AGCB 4W70A 2XT1B 4HK0A 2VE6B 5DSCB 1S7UB 4JFDA 3STZA 3U2SA 2EZ0C 3BGAA 4M4PA 3O6LL 2DQDH 4P2RB 3P2TA 1A1NA 3CFCL 1U92B 4KK5D 4Z7WF 4JO3H 4ORZC 1FL6A 5DHVB 4XP6H 5GIRB 3HMXH 1KJVA 5BW7C 1MIMH 4P57A 3BKML 3BWUC 5DD1L 3QH3A 1T0MB 5HGBA 3QQ9C 1OHQA 1G9NC 2V9QA 2W59A 4DKAA 4OFPA 1VSCA 1MY7A 2KH2B 4R2GD 1JK8B 4XCEA 4I4WA 3TYFA 4EBQL 1I9IL 1MJ7H 4OZ4A 2Z4QA 1M71B 4QRPE 1KGCE 2PYEE 4FZ8L 1NCAH 2AP2A 2H8PA 4NP4L 1MIML 3ZKNC 1B0RA 4M7JH 1U95B 1UVQB 3OAYK 1ZE3C 5CLWA 2BHZA 3B9DA 4XCFH 4JO2L 4XVUD 3VFRB 4HZLB 2VDOH 3IFLL 4L3AA 4OD2B 5HGDB 4LLYA 2PETA 2X89D 4NCC1 2GT9A 4MMZC 3HN3A 1T1XA 3VG9C 1FAIH 5IW3A 5IESH 2R1XB 3O3AB 5HYQA 4OCSH 2V2TA 1FE8L 1EHNA 3DX8B 4CGTA 5JORB 2GHWB 1NCDH 1CFBA 4QY8A 4OT1H 2HT3D 3SDCB 5I75C 1KTRL 1Q9OB 1TVDA 1IEAA 3LH2H 1JV5B 3S7GA 2EYRB 1NDGA 3FO0L 3PWPB 4TTGA 4P23B 4TRPH 1ZA3B 4LARL 2W91A 5DGQA 5GRYA 2VIRA 3GHEL 5TJWK 1MWAH 1YDPA 4RGNE 1S9WB 5E4IA 5FGCB 3SGJA 1XF4A 3R1GL 1INQB 4G6AC 5FEBA 1XIWD 3TT3L 3LY6A 3PDDA 3ZLQC 2DQFA 4J8RB 1S7RB 4MVBC 4MNGB 1MHPL 1G0XA 2VLKE 3BMVA 3FQUB 3CFEB 4U6VL 3H8NA 3OX8A 1R3LB 4UINH 3WFDH 3H9ZA 1AGDB 1EA9C 2VKWA 4JO2H 3FFDA 4AMKL 1XGPB 2PUQT 3QUKB 4PJ5D 4Y1AA 1B9ZA 4WY7L 2PYFA 3KPPA 4OFDA 4GSDL 3KLHC 3H42H 5HHOB 2X7LB 3P4MA 4GAYB 3TJHD 1UCTA 4JO4H 5MENA 1IGYA 1WEJH 3QNXA 4CMMB 3QIUC 3QUXD 2VB5A 5KW9L 3CZJA 4GXUM 1WITA 3W9DB 3GJFA 3PGDA 2Z35B 2PXYB 3BP5B 4MCYA 3F7VB 1BAFH 4K23L 3OB0K 3QB7C 4LCUB 2WANA 3I2CH 3QJFA 3H3KA 1H8SA 3EYOB 1KB5H 2EDYA 4NGHH 1GL4B 3GBML 4JG0L 3PQYE 3ARQA 1HSAB 5JZ7C 3NN8B 5DYOB 4PS4L 4EI5D 4ZO6A 3RDTD 4QXUL 4GG8A 1MLCA 1RZIB 1U8NB 3FT4A 3IS0X 1FNGB 4DKFL 5EO0A 2JELL 1ZK9A 1CF8H 4PJGE 5E1HB 3MBEC 3DUUB 2XPGB 4I3GA 3S36X 4EOWH 1I3RB 4OUOA 1YC8A 2J8HA 5D7SH 2YEZB 3PNWB 3BN3B 4UNVA 1F3DH 1HYRC 2D4DA 5JHLL 4NN7B 3T4YB 3QDGD 3QHFH 3ARDB 4KJWC 1UENA 2RB8A 1OAUH 4W6XB 2AEQH 3OKDA 5J6HA 2BNUA 3DVFA 5ERWA 1FGVL 4D2NA 4F58L 4BUHA 3VW3H 2YMXH 2JELH 1HHGA 2BY2A 3RNQB 2YR3A 4B0MM 5CP3H 1KXTB 3EFFB 4Z7WE 1HXYA 1L6ZA 3MV7A 1IM9D 1GGIL 3TH4T 4BZ2L 1MCRA 3ESVF 3I85A 3ET9F 3CSBA 1H0DB 1FFQA 2YRZA 5F7FA 3O4LB 1RUKH 4QTHA 4LCYB 3TFKD 1BQHG 4F7CB 2H45A 3ARUA 3MRDB 3HRPA 4S2SA 3TO4B 3LOWA 4L8BB 2BVPA 2ENSA 4AG4H 4E5XA 1WIOA 3BQUD 1ZT7A 5SWSA 4PYGA 2OJEB 1CZ8L 4AEFA 2F53E 1UWGH 2ZOLB 4X6CE 3K4DA 4I77L 4ODWB 5HHPA 3O8XC 1F11A 3QWOB 4P48A 1G7JA 4WI2A 2GI7A 4ZUVA 1I8MB 5AD0A 1YEDB 2Q76A 2YUZA 1G9NH 5CUSL 3E8UH 5GGQL 3KXFD 1X5IA 3VG0L 1LP9E 1AJ7H 2V2XB 1Z2KA 1AD9A 2MQ0A 4Y5YB 1XR8A 1BREA 4JLRA 5TQ0L 3QP3A 4PJHE 1YNKL 3R1GH 4L3EA 2V5SA 3BVNA 4JRXB 2VDRH 2XQYK 5CBEB 5EC1A 3AREC 4W6WB 1AJ7L 1QBMH 3UTQA 3FFCA 1IC5L 1DQDL 3X13B 1O5DT 3VRLF 1RSFA 1BIIA 3RZCC 1I7ZA 1HSBB 2CLRB 1T7WA 5A43C 1MAKA 5KANG 2FHCA 5CSGA 2I60L 5JW4N 4JFYB 5I1IL 3BX7C 5JHDA 5FYJE 4M1GL 1YMHB 3O2VH 4XNZC 2K7QA 5SX4I 3CVIH 3QJHA 3ARVA 4JKKA 2E7LC 4JRWA 4D0CB 4N0YL 1N64H 4KXZI 4I0PC 3TO4C 2VMFA 3PV7A 1HINH 4G8IB 3NA4A 5F7LB 3RWCB 5BOPA 3EDFA 4KRLB 3SE3C 5ICYB 5DK2B 4O2CA 4U0RB 3VD4A 2NY4D 1BFTA 2DOCA 4I3SL 1QFUH 3P4OB 4DUVA 5DD0H 4EIGB 2HFFB 4K8RC 4OLUH 4P4KC 4LPWA 5HVGB 1RU9H 3N06B 4L3CA 2YN5A 1HNFA 1FL3A 4N9GB 3S4SA 3R06B 5JMOC 1NJ9A 5DK0A 5J4MA 5EU3B 4NQCD 3REVA 1XF2A 1UQSA 1S7TA 3V8OA 2DYPA 1NCBL 3VCLA 4HV8A 1QOKA 4KDVA 3SBWA 5C0BE 4ZO9A 1CXHA 2EEBA 4P99A 5IROA 1P53A 5FYJH 4H26A 1Z5LB 3CC5A 3MLWL 5F7NC 1HYSD 4FTVA 3ALPA 1EUUA 3FQTA 3GMQB 3LKQB 3B3IB 2QKIA 5ID0B 5GRVL 4MNGE 3IDIA 1ZGLA 2OK0H 3VI4F 2X4RA 1GGTA 4KQ3L 4C58B 5F7EL 2QSQA 4HWNA 2R2EA 1FNFA 2VLJE 2NNAA 3LIZL 2LABA 5IFHH 3HTLX 5EU6D 1F02I 4JFFA 3DOSA 1YEJL 3MRPB 1MCWM 2D7PA 1EERB 1KC5H 4ODHH 2FGWL 4K7PX 3VWKC 3FFCD 3ROLA 5D7LA 3AY4C 3ZT7A 3SE3A 3GIVB 2AQ2A 1NGXA 4LSSH 5TDNB 4L9DA 5DD3L 3RWIA 3QEQD 2W65A 3M8OL 2VWEC 1A6WL 2YPVH 5I0DA 1F8TH 4FQ1L 4XAKE 4G5ZH 5EWIH 2QADD 1V7NL 5HI3D 3RVWD 1F2QA 4Q6IA 4APQC 4X99A 3AAZA 3G04B 5I1LB 3MREA 4BK4A 5D5MA 4DEPB 4OCRH 3RWGB 3QI9A 1V5JA 5EPMA 2DRUA 1CGVA 2KZWA 1MSPA 1ZVHA 4JPKL 3QQ4B 1YEIL 4PGDB 1AD0A 3D25A 2UVEA 3E2HB 5CEXA 2JIXB 5CEZL 1GVIA 3S37X 5FUOH 5C0EA 3B9KA 2H9GA 4OGAC 3QUMH 4NO3A 4OCYL 2Y5TA 4GAJL 3U79A 3WS6A 5GISL 1I1YA 4PRHD 1KIQA 2YSSA 2FR4A 5IFJB 1JNNH 3QCUH 3TO4D 4N8VA 4ODUB 2EDKA 3SE8H 3BPNC 3CPLA 3F7YA 2MPAL 3H42L 3MRIA 4LIQH 4YH6A 3GJFH 5DRWB 4HS6B 1FDLL 2JCCA 1J05A 3MJGX 1DUZB 5DDHA 1CBVL 5A16B 3IKCA 5FGBA 3NCCB 2O5ZH 2VZUA 1XF3B 1GPOL 3HR5A 2YWZA 5CS7A 3QDMD 3C60C 4R3SA 2NY1B 4HIHA 1Z0MA 3JSSA 5I76A 4EUPA 2NZ9D 3U30B 2FO4A 5HJ3A 2CIIB 3O2DH 5DRXA 5IB2B 4M9PA 1X5YA 1CFVL 3UYRL 2VXUL 2ZSVB 2E7HA 1NSNL 5KVFH 3OKEA 4TSBH 1P5UA 4S1DD 4X9BA 4JRXD 5BS0E 3BZFA 5MEPB 3QI9C 5DZLA 4EBQH 4R96B 3RGVD 2FX7H 1CLYL 1QSEB 3VXTA 1UGNA 4TPRL 1MPAH 4AIXA 4GQPH 5DMIH 5AUMB 3VFNA 5ITFB 4PBXA 1Q0XL 5DTFA 3OTTA 1B3JA 1S7WA 1JNLL 2IFGA 3D85B 3O8XD 1SEBA 2AABL 1MCCA 3FT3B 1BVZA 4LRNL 1DVFB 5F89A 3BQUC 5CEZD 1VADB 3DVNB 5CJQH 2X4NA 5HY9B 3SKMA 8FABA 4ODVL 1FORL 2CD0A 5IJKC 1P2CA 3K74B 3T0EA 1DBBL 3G6AA 4U7KA 1MH5B 2NY4B 2LV4A 3QXTA 3GNMH 3WDIA 3MJ8A 1NSNH 3MA9H 3V4PL 3CFDB 4JFXB 4U1MB 2R29H 3GSNL 3QRGH 3MV8A 4OLYH 1S7XA 3O6FA 3T08A 3OHXA 1ZV5A 1X7QA 2CRMA 3OJDB 1BFOB 2BDNL 4MJ4A 5C0CA 5LBSH 2C4XA 4MJ5A 3E6FA 1UM6L 4UMGA 4XP1L 1S5HB 5F1NA 3EYSH 3NFSH 2EDNA 4LSUH 5I1JH 5D72L 3DV6B 3C2AH 5FA3A 5HHVH 3A6OA 1NC2B 2AS5M 2FLBT 3G5VA 4IS6A 4Y4KC 4ETQB 4KHTL 1A6UL 3IDNB 3N1MC 4MHHI 5BW7A 1TTUA 1KN4L 4LSQL 5E08H 3V4UH 1PX4A 3DV6A 2AKRA 1GZPB 3CDGB 1V3MA 5GPRA 5ADPH 5JZ7D 2VXVL 3O41A 1KCLA 4PJAA 4PG9B 1N8ZA 2O61A 4GLRH 2ENYA 2OZ4L 4NN6C 4K3HA 2IBBA 2A6DB 3FB8A 2HG5B 1C7TA 3WKML 2R2HA 4O9HL 1YEIH 3MJ8B 1RJZB 4RQQA 3LEVH 1TZGH 3RL2A 1U6AH 3TYGL 3QG7H 5IB3A 4MQ7A 1DLHA 1ZGLM 3T0EB 1XH3B 2Q7NA 5BRZD 5BQ7B 1KTLA 1DQLL 3SKMB 1A14H 2YHGA 2F54A 3KLHD 1CFNA 4F7PA 1F2XK 3O9WA 3MRQA 4V1DE 5F89B 1DL7H 3PE9A 4KAQH 5E94A 1VFOA 4F9LA 2XTJB 1C1EL 4N9OB 5EU5B 4ZDHA 1E4XI 2R69L 2WUBL 2IALB 4YXLH 4YHZH 1FZOA 1BMGA 1G7MA 2A9MH 2Z0BA 4PJFA 2ZUTA 5DR5H 3SGKA 43CAA 4WHDA 7CGTA 4DGYH 3B6SA 3ABZA 3KYNA 4ZFOL 5ISZE 3K3QA 3VD3A 1C1EH 1T5WA 1WISA 1NCWL 1H3WM 4LVHB 3VXMB 5JQ6L 5KSAA 2ZSVA 3PGCA 1IAKA 4TOYH 3HG1E 3V8CA 3U0TB 4RBPK 3SY0A 2WWMD 1MCBA 1MEXH 4QOKA 4Y8AA 1BX2B 4EUPB 4MS8D 5HGHB 2DTML 4HIHB 4R3SB 4R2GB 2CKBA 3MXWL 3TPUB 3C2SA 2OR7A 5CILL 1A7NH 3TVMB 1W72L 2Z8VC 4LHUA 2CKNA 4YBQC 5EO1A 3CAFA 2N4IA 1NGYB 3DROA 1AQKH 1R3HA 5I73B 4M48L 4MD4A 3TGXA 3TIDA 3ZKND 3PHSA 4BSVA 2AJSL 4HEPG 3KLAB 1DQQB 4NO2B 4ERSH 2FHBA 5JXEC 5A40E 5EBWA 3CPLB 5GRVK 4YFDB 1V7ML 2HRPL 3C8KA 2HJKA 1BJMA 3HC3L 4D0BB 3VGGA 4QKXB 4HXAL 1UH4A 3QZWG 4G7YL 1ZWIA 4OCXL 4FXKA 1NBZA 3K8MA 4U6TA 3L5WA 3VU2A 2Z92B 4GKSB 3MRMA 1ORSB 1Q0YL 3BWAB 3SDCD 3GBLA 4JDZA 4OLXL 1EEYA 5DEZA 1LK3L 4A6YL 4GRWH 1IM3B 1KCSH 3CVIL 3JWDC 2C1OA 4PP2B 4PLNC 1NUFA 5GS1A 4HUVA 2WQRA 2J8UB 3WHXA 3RWGA 2AXFB 3D3VA 3V0WH 3L5XH 5D1QB 3WCYA 1UACH 1IBGH 5D5MB 1T7VA 2KQMA 1V05A 4DZ8A 1M6OB 2X6MA 2GTWA 1QYGL 4QF1B 1XIWB 2SEBB 1NLBL 3KVQA 3QXDA 2BSTB 3QXWA 3DMMD 1MLBB 1FLRL 4YHML 1U3HA 3SE4C 2CQVA 2AJXH 3RWIB 4D3CH 2Y9RT 1WWCA 2V9RA 1BF2A 1UJ3A 2GJZB 1WC7B 4NN5C 4PJ9D 4HUXB 5D70H 5K9KB 3VXUD 4N0YH 2MFNA 5IT2H 4Z76A 4ODVH 1JWMB 1RK1B 1EVUA 3FAXA 4XP6L 3JZ7A 4JGUA 1UJ3B 2X4RB 3LH2L 1S7QA 3WL9B 3NZHH 2ZKHL 3IDIB 1KCRL 1OP3K 1U3HB 2DQUH 3X3FL 3LKQA 3TBWA 2VZ1A 5I15H 3H9HB 5J11B 4FTVB 3DHJA 3D39D 1S3KH 2HJLB 1YECL 1Z5LA 4H26B 4JKPL 5FK9A 3TC9A 5IT2L 1WTLA 3RVVD 4XP1H 3DJ9A 3MGAA 2BNQD 5JDJA 1G84A 2AXFA 5EUOE 4KC3B 1ADQH 4X6BB 3S97C 1IC4H 3WFBL 1QHPA 1BBDL 1EIBA 4M7JL 5IP4A 1CFVH 3HRZB 5IGXH 3JWNC 1W8OA 1KIRB 4X6EB 4JVWA 4F37K 3V6ZA 3UPAA 1SBSH 4OV6F 2D7TL 1QFPA 3RWEB 2NPLX 4OZHF 3L5WB 4FABH 2Q8AH 4RRPA 1ZWIB 4MJ6A 1T21B 2A0LC 3WFEL 1NGWA 3SOBH 3WNPA 5J1AB 3DXAE 4KI5C 4IM8A 4BM7A 5ICYA 3Q6FB 5BRZB 5C08A 2DQJH 1ZTXL 1R0AH 1IC4L 1JPGA 3FOLB 3OGCB 1JTTA 3RAJL 1J11A 3IAPA 1INDH 3SO3B 4WJ5B 3OG4B 1NMBL 3RA7H 2ATPA 1QPPA 4WW2F 2HKHL 1N0XL 3QHZL 4M6OH 3FZUC 3TPUA 4K9EC 4BFGA 5HGHA 1I9RL 3B5GA 3HB3C 1HSBA 2CLRA 4XBGA 1BIIB 5IVZB 2NYYD 5DJ2A 2QV2A 2QR0A 3G08A 1QSFD 4UQ2B 2MKLC 1FGNH 2VKXA 5C0GA 2GTZA 2UWEB 4KGJA 1Z0NA 1T5XB 1TTGA 3B2VH 4JRXA 4R4FH 2YA0A 5TDOA 1JI2A 3MV9A 4QTIH 3QCTH 3QXUA 4JLRB 2FX8H 1BWMA 4ODBD 2CH8A 4BZYA 4JEGB 3S36L 2A9NL 4A2MA 4L3ED 1CQKA 3GBNL 3QDJD 5ALCL 2CK0H 2HP4A 5MP6H 3IB4A 4XVTL 3EZ8A 4K9EH 4XB8A 5H94B 4JGMA 4HIIA 1IL1A 3CH1A 4HBCL 4HPYH 3SDXA 2KQNA 3QWOA 2F54B 1CLOH 1P69B 3S35X 2VYRE 4FZEL 4UBDD 5K9JH 5GRUL 1KCSL 1W0WB 1UA6H 1QUNA 3EOTL 3LQAH 4FQHB 5BZWA 3HI5L 1RJZA 2XQBH 4DW2H 3LRGA 3MA7B 4A6YB 2DMBA 4D8PA 1I7RB 1H3PL 3LS5L 2FSEB 3BRDA 4HUKB 1XF5B 5HSFA 2GCYA 2A6DA 4POZD 1JZ3A 1HH6A 3MRCB 4JVUA 4JO4L 5EN2B 3F7QA 1MAML 4C54A 3BKYL 1KPUB 3BO8B 3QEQE 4HJGB 4PJAB 1H3GA 2IEPA 1IM9A 1MWAA 3LN9A 4PJEA 4L5FH 1XGRA 3O6MH 1QO3A 2GSIB 2JJTA 2DJUA 2OR9H 2VLJB 4L4JA 2NTFA 1RZKC 1WTGT 5BVPL 3IDNA 3N85H 2D7OA 2EKSB 1U8OA 4GFTB 4QHKI 3OV6A 4UDUA 4MSWA 4HUMB 2EXYC 4WUKL 2MJWA 3PWLB 3SQBA 4PJ8C 3ALWA 4NHCL 4YHLH 4OLVH 4OBRA 4TVPL 3CD4A 1XGTA 1S5HA 3MBXL 2J5LB 1B6DA 1XEDA 4I0PA 2ZNWA 4LLQB 1P4BH 1MLCB 5EU6A 2J8UE 4PPTA 4RFNC 2DJSA 5JQ6H 4LEXL 4ZSOE 3UJJL 4JPVH 1CQYA 3SHSA 5MHSE 3WXVL 3NTCH 2Y6SC 5F9OH 3IFOB 1MFBH 2EEAA 1MHHA 1A2YA 4OCLC 4YFLI 3QJFB 1LK2A 5C9JA 4OLVL 3BYTA 1NMAL 4LPUA 3Q1SH 2Y4SA 1FPTH 3PHQA 3D39B 4H8WC 2ERJB 3PP4H 2DF3A 5GS0H 1IC7H 3HCVB 1F90L 4HT1L 4H88H 3TF7C 2B4CL 1FIGH 4WGWB 5FUCC 2ZWLT 3HZVB 1A64A 4NQCA 3HUJB 1LEIB 4PJ9A 4N1HB 4OLZH 2EIBA 1D9KB 3U36A 5I6XC 4F8QA 4UIKL 1M7XA 3FQUA 3N9GH 4RZCB 3VFNB 2A2QT 1SHMA 4K94C 1DEEB 2GJ6A 1MRDL 5IJVB 4MJID 3FO2B 2E7CA 3MNVB 1BGXL 2CDGA 4ELKB 1A7RH 2BZDA 1DBMH 1QSFA 3W2DL 2AI0H 4FNLL 2YK1L 1HINL 3BP4B 1FFPA 2B8OT 2VIRB 5IMLB 5IB2A 4IIQA 1AI1L 3MGOA 3BGMB 4NBXB 2R4RL 5C6PB 2CIIA 4JHBA 1FYHB 2AQ3A 4UB0L 1JV5A 2I27N 2I5YH 4Y16C 5E5RB 3UZQA 4PJXF 1PAMA 5I76B 5T3ZH 1FSKC 4OM0L 1Z9SA 2BHUA 4XI5D 5JR1L 1XF3A 3DX8A 4HKJB 3RQ3A 2V2TB 3SCMD 1D5MA 1RFDH 2BRRH 5A16A 4EN3D 3AROA 2J8OA 4KKBD 2A6JB 3U7WL 7FABL 3T77A 4ZUUB 4KVCH 2APTA 1MCPL 43C9B 3IJYA 3MRIB 1FBIH 3O2DL 4JKLA 2AK4D 3RJQB 2NY3D 1QR1B 4GKZA 3RRQA 1T66D 2Y07L 1F4XL 1VDGA 1U95A 2IANB 2F53B 3BKJH 3O2WH 1EBAA 2RGSA 3LV3B 4NO3B 4ORGA 1M71A 1PY9A 2Z4QB 3NCBB 2DBJA 4XCEB 3WSQH 2NY1D 3ZDYF 1Z9LA 2Y36H 4QNPF 4MAYD 4A2LA 2ADGA 1ZLUH 3D25B 5J12B 4KKCD 2FX9L 2H1PL 2C3VA 5T3ZE 3HE7C 4HK3N 1U92A 5DXWA 3GFUA 4X99B 2F54D 3FRPA 3QULB 5J12C 4OCYH 3X11B 4AQOA 2ZOKB 4D0DB 4QXUH 3J8F7 3T09A 4OZFH 4WW2B 5TE4H 5I1HL 2X9WA 1N4XH 1TQCC 2W65B 3BAEL 1S7UA 2VE6A 3VD9A 1BZ9B 4K3DH 4JPKH 5FDWB 3QA3B 3NIDE 1KT2B 1OSPH 4M93B 4TVPD 5D7LB 5DVOA 2LU3A 3VXUA 5T3XL 3SKNB 3UTZA 5KS9B 4IMLA 4JFFB 2XWTB 3O45B 5EWIL 4F37F 1FYTA 2ITDB 1GAFH 2R56H 5IFAL 2EH7L 1FL5A 3QG6A 3BXNB 5IMOA 3G5ZA 4XAKD 1S9VA 5ISZB 1EGJH 4HCRH 3WO3B 1TQCB 3BUYB 4Y19B 1LP9F 1HOCA 2EECA 2P5EA 2FIKB 3O9WC 1MQKH 1FVEB 4XH2A 3IKKA 3O2WL 4OAWB 1A9EB 3SQOL 5E8EB 5BOZG 1DDHB 1T89C 2FBOJ 3QIBB 4ZUWB 4PGJA 2RFXB 3QCVL 2P8LA 3O11A 4IOSD 4CN6A 4HV8B 2DYPB 1S7TB 5KJRL 1SY6A 1PEZA 1UQSB 2YC1B 2ADJA 2H41A 2VZTA 4HK3J 1DQMH 3ARGC 2CJUH 2OJZL 4GXUN 1T2JA 5HHOE 2UZIH 1VESA 3HPJB 4WUUA 5HI4D 5JTWA 8CGTA 2HFFA 1P7KA 1KOAA 3VA2C 1CGXA 1KPVA 3FRUB 4NWTH 5L8KB 4ZXBB 1A7QL 4OF7A 1UC6A 3TV3L 3VG9B 5CKAA 4Z7NE 4ZFOA 1GGCH 2AJXL 1QZ1A 1ZS8A 3PP3H 4P3WA 1BQLH 1DN0B 4RISH 3VXNA 5C0CD 4ZOBA 1VEOA 1JHKH 4PRIB 3ZKMC 3E6HB 2B5IB 4YHOH 2A1WH 5D2LE 2CK0L 2LFGA 1BJ1H 4GW4B 4I3RH 2QL1A 3MYZA 2A77L 3WS3A 5BMFL 1CXIA 3U0PA 5FYKH 5IG7B 3V4VH 2WUCH 5DJAB 1IGML 3MCLH 4KHXL 2DLEA 3BVNB 1QP1A 25C8H 1ED3A 4FZEH 4I0KA 3TT1H 1RULH 3ILPA 1ZT4A 4IOIB 5E2TL 3ARDC 1LEKB 3BH8B 4J3TA 3O6LH 4Y5YA 5B8CC 5E9DD 2NW2B 3KPRB 1IGFL 1YMME 5I1CL 3WN5B 5KJRH 4HLZH 2NTSP 4RWYH 4ZNCD 3OB8A 4YR6A 1JYXA 1JGVH 2VAAA 4DKEH 1EHAA 4AIOA 2DICA 2IAMC 3GSUA 4KDTA 5EG6C 3SCMB 5IB5B 1FNEB 4KJYB 1YJDH 3QFJE 1MF2L 2VTFA 1QKZL 1FZMA 4NZUH 4HUWA 5GGUA 1T0NB 1G7JB 5DT1H 4MGXA 2XKNB 2OLDA 3BGFB 1F11B 5I66B 1F3RB 4ZTOH 2AK4B 4R0LB 1KLFA 2ICWA 3QNZA 4IMKA 4R4FL 4F57L 4E5XB 4EDXA 1CI5A 5GZOC 2CGRL 4UV4L 1WUNT 2IAND 4P2QB 2ADIA 1R3KB 2BC4A 5JOEA 4WUKH 5GS2H 3EFDL 1XAUA 3EDEA 4WTZG 4X6DF 1C5BH 1H0DA 1WJ3A 5DRNA 5ICZA 4F80A 4P23D 2ESVE 5BV7C 1JGLH 4XCNA 4XVSL 1WVZA 4MDIB 3MV7B 3Q5OA 4NM8L 3EFFA 2HKHH 4K3DL 4U1NA 1ZLSL 3ULUD 3BE1H 5T1LD 4R4BB 4X0KA 3N50A 4F7EA 2B5IC 4J23A 1DBAH 3K2UH 3LZFH 1TZIB 4X9IA 1KELH 5J6HB 4N5ED 1MF2H 4G6ML 4KKCC 1J0JA 4MAUL 1RIHH 4HLJA 4ONOA 4RCAA 4P5MA 4DN4L 4PRBA 3V6FB 4WI6A 2R8SL 3ARDA 4R7DB 4F3FA 3B9KD 1INEL 4GRLA 1JWSB 2IH3A 3IF1B 1NAMH 1IT9L 1VGEL 4XX1G 2XPGA 3DUUA 4OTXH 4JJHA 1KBGH 3DYMA 2BSRA 1CLOL 1QBML 2R2BA 4CNIA 5B39G 1OPGL 1RZGA 3ARZA 3V5KA 2B39A 5ESQB 3WIIL 3OPZL 4YE4H 1HWHB 5KBNC 1CVRA 3RZCA 1S7SB 1QBLL 5FCSH 5FF6A 1CCZA 1M1SA 2YPLE 5JLZA 1S3KL 2YPVL 3MLRH 2NW3B 4M7KH 3RBSA 1KSRA 3QPQC 1KEMH 1T2QL 4H1LA 4B7LA 3BP5A 3AMLA 3GSXA 4EI5B 4XI5C 4N0RA 2YK1H 2X4SA 4JJ5A 4C59B 1RIUH 4RISL 4YX2L 4JZNA 4TQEH 2QQQA 3U0WH 4XNQB 3KJ4B 1EMTL 4LVNC 3Q2CA 4PBWD 4Y0GA 1MFCL 5AAMA 1KB5L 4OZFB 1JE6A 1H15B 1FLTX 2HWZH 2NR6D 5GSVB 4Y1AB 1XGPA 4OLXH 3LSOB 1AGDA 4QRQA 4ZG1A 5BZDA 2FCBA 1T0PB 4RFNB 1FNAA 3MROB 4ZUSB 3BSZH 1Q1JH 1A7QH 4ZXBD 1EEQA 3GSVB 1S9WA 2R23B 4QRQB 3UZVB 4HIJB 3EUUA 3DETC 4QRRD 4NSKB 5ENWA 4LKCB 1OP9A 4RFOH 1WBZB 2YD6A 1D5ZA 4XAWL 3UDWC 4CMHB 2D9QB 4OZFA 5CMAA 1Q9OA 5IK3B 3V52H 4XNQA 2IGFL 1P9MC 1EJOH 3WE6B 3FB6A 4H20L 3WEXA 4Q9QL 2MOVA 3ARFC 3GSXB 3HLAA 3GSQA 3IYLW 5DJXB 1A7OL 1EJ6A 1Q0XH 4KROC 5F9OL 1U8QA 3ULUF 3NACH 3L7EA 4J1UB 4CBPA 2X9YA 4JQVA 1ODAA 4I18A 4PJ7E 4NQXA 1IQWL 4DTGH 1H8NA 4G6FD 3RU8H 1YC7A 5DS8A 1QFWM 4NJAL 1I1FB 3JV5A 4RSVA 1YY9D 2M1KA 4JFHE 3DBXB 4GRWF 2Z93B 5D7KE 3GIZH 3HR6A 1EFXA 1JWSA 2IH3B 1H3UA 1M7DB 1CDBA 1TJGH 1SQ2N 4O02H 1SY6H 1NGZA 2ARWA 3O3EA 4Z7UF 3V2AR 4F9LC 4P2RA 3S35H 2M26A 2V7NA 3MYJA 4Q0XH 1JNHA 1NFDE 4F7MB 4PJDE 5LWYL 4FQQA 5EH1A 5KS9E 2NXYB 1MCLA 4D9LL 1OAXH 2GEEA 2E9WA 2VL4A 3BKMH 1VGKA 2AV7B 4GXVL 2O5YH 4U6VH 4JDTH 2OZ4A 1JN6B 4L9LB 5ACLA 5E7FA 2ILLA 4X7SL 2YUWA 2DQDL 5DRNB 5GZNC 1SM3H 5ICZB 4UBDC 1ZVSA 5C08D 2IBGA 2CRZA 2VXQL 4MWFB 1RUPL 5CGYC 4QOKD 3RVUC 5CEZH 2HVJA 2HH0H 2AXGB 2J1KA 4WGVB 4NUJA 1YEKH 1ZVYA 4PJXA 3GSRA 5KANI 5I1DA 2Q3ZA 1V3LA 4I18C 2IADA 3G6JF 5GGUB 1RIUL 4R6UA 5ITBL 3JUZA 1FAKT 5CIPH 3LEVL 4DVRH 1Q94B 4N68A 1CGTA 5GSRB 3SCMA 3IJSA 4WHCA 4O9HH 4GG6A 4J3OC 3TA3B 3T1FA 1QLEH 4ZFZB 4P4RA 3FO9A 1CFTA 2ATKB 2G75B 5HYIA 1KJMB 2NY5L 4PD4J 5KN5B 4O5LL 4XCFL 2YMXL 5D96C 3BH8A 1NQBA 1UKQA 1WK0A 1LEKA 3RVTD 3SDYL 2C4FU 2VDPL 4M6NH 3VFSB 4NO0B 5I18H 3OAYH 1R5WB 4XCYB 4RX4A 2NYYC 3LN4A 5DJ8A 4QRSA 4ZTPH 4LSRL 4UOJA 3O4LE 1AC0A 4U6XB 4NRXA 5TE6H 5TGBA 3VFOB 1NEZA 3WS3B 4XPFL 1A6ZB 5DUMH 1QRNE 1I7UB 2CRIA 5C2UB 4GW4A 5E2UL 4ZS6D 4FN0A 1FIGL 3TCXA 1AKJB 4RAUA 3OJ2C 4JE4B 1TTFA 5EO9B 5EA0L 3F62A 3QUYD 3KLDA 1IGIH 3IU4H 4YGAB 3DRTB 4OM1H 3ZO0A 3RDTA 1DN0A 5EO9A 5M7QA 3CUPB 1JP5A 4JM2B 3GSOB 4L4TB 5I8OL 3GSNH 3QRGL 1A3QA 4WIQA 4M6MH 1HN1A 5DT1L 3HNSL 2HT2C 4ZD3H 4QRSB 3NABL 4NO0A 4WFHD 3TIEB 1J0YA 1A7OH 1K4DB 1Y6NR 2HN7B 1F90H 3HAEA 3RVVC 2A74B 2YC1A 2DI7A 1C5BL 3WFBH 2VABA 5CSZA 5MEQB 2NY6D 1OT2A 4JREB 3PJSB 5HGAA 4P4RB 5HI5D 4IRZL 2IGFH 3O11B 4PJEF 1QBAA 5KVDH 1OT1A 1NAMA 1QSVA 1PZ5B 4DQOH 5GSRA 3K80A 4Z0BH 4U1SB 3U30C 2D3VA 4LCCC 3PUCA 4XPGL 1FVEA 2FIKA 5D96B 5D2NB 4UIMA 3X3GH 5HYSA 3L7FA 3M07A 2VXVH 4C56E 3NFNA 1FL5B 2XRAL 3QG6B 3SE8L 5IMOB 3IVKB 3W9EB 5LAXA 4HW6A 4XMPH 2XZAH 4PJ9C 1MNUH 3P77B 4FQJL 5I1CH 3KPOB 5JA8B 4Q9QH 2XWTA 4UTAL 2X10A 2VQTA 1H5BB 4XT1C 4LSTL 3CXHK 2EDFA 3VFVA 2A77H 5E0QA 4PJ5E 1KT2A 2KPNA 3OAZK 3FB7A 3G6DL 2AV7A 2ESVB 5CBAA 3CX2A 5EC2A 1X5HA 3INUH 1RZFL 4AL8H 3D6GA 3C5JA 4Z7VA 5DD6B 1CVSC 3WUWA 3E0GA 4YX2H 2XZQH 2W9EH 2ZOKA 2HWZL 1CICA 1WBYA 2WWKT 1OGAA 2V7NB 1FP5A 5D2LF 4N0UA 2CK2A 2V7HA 1U8PA 4FQXA 1B4RA 4ISVA 3L1OH 4PY8J 4YNYA 3SDCC 4JO1L 5CGMA 3INUL 1U3ZA 1K5NB 2AEWA 2XWBA 2YKLH 1G9MC 2XG4A 1C5CH 5HTSA 1RAMA 2W9DH 4U7MA 3GB7A 1EFXB 3EIFA 5F8RC 1PW3A 5F88B 5L2KE 1CU4L 5ALCH 4JB9L 3ZE2E 3KPSA 5KSAC 3C5ZD 2P8PB 4J3UA 4OLEA 3LHPL 4UAOB 5C6WH 1QRKA 3MV9D 2C3WA 4J1UA 2VC2H 1YY8A 3M45A 1U8QB 4PRHB 1OGTB 1JL8A 5IEKB 4JZJC 43C9A 3GI9H 2C26A 4LOUD 3ZDZF 2FECL 3VXRB 3EW3B 3OKOB 1D5MB 1JHLL 1S5IL 4TSAL 4H0GA 3HS0B 4JFFD 4NZRH 5IK3A 1J0ZA 3D0VB 5CCKL 1IGCL 1CR9H 4P4KA 4G6MH 4OZHA 5ID1B 2BHYA 4BFBD 1RJCA 1P84K 4PJDF 4LKCA 5DI8B 5IW1A 1IAIM 3EOYG 4LVOC 5I8KH 1TMCB 4F8TA 1CICC 3FHQA 5E56A 2UYLA 4I2XB 4PRPB 3HNSH 1S8DB 4FOMA 1FCCA 1TXKA 2OTUA 3MROA 4UI2A 5IJVA 5K33A 5E7BA 3LPGA 1AY1H 1QVOB 5I8OH 1FDLH 2YBRA 3SDAB 4YHNA 4HFWA 1Q38A 5C0RH 2VLMD 3BFOA 3FQNA 2ORBH 4H5SB 4KTDL 4PRIE 5B3JE 3AB0C 5AG9A 1NPUA 5JOPE 3IU4L 4JFEA 1HHJB 5C0AB 3QUYB 5F1SA 4M1GH 4FQPA 3RL1B 1WF5A 4AT6A 1Z9OA 2WK2A 3HI6L 1E6OL 1YEHH 4WO4B 3EO1A 1DQJA 2PTVA 3D39A 3PHQB 1KTDB 2B1HL 1T3FB 2PKDA 4ZQKB 4XNZB 2Y36L 4OIIH 1ZA6A 2AJYH 4XNYH 2HTLC 3GI9L 5I15L 1JMZA 3TT1L 3WS6C 1FFNB 2EKJA 4N0FA 4TUJB 3PDOB 5CZVH 4LVNB 4U6HA 4KJPC 3EYQD 1YEGH 1MUJB 3OGOE 4IOFC 4CAGA 1AXSA 4YFEA 5CD3B 3GGWA 4LLQA 2HH0L 4ONGH 2BSRB 1FO0H 4M8VA 2DKMA 1IGMH 2NY6B 1JWUA 4XNMA 4K8RL 4Y4KD 4MD5B 2H32A 2NY7H 2B1AH 4S1SH 1NUGA 2DQUL 1NUDA 3C5ZC 3PWLA 4GRLB 1F4WH 1HCVA 4OGXL 5EUKB 4R7DA 4F3FB 4FFWD 4YFLF 5JR1H 4QRRA 1BGXH 1QLFB 3ULSA 4HWBL 1TJHL 2AW2A 2FJFB 5ACZB 3EAKA 4F15B 1JYVA 3SEPA 1U93B 4TVPE 4OLZL 4GG6F 4BZ1L 5DJZB 3LS4H 2IMNA 3ZL4H 2A83B 3BO8A 3AS1A 2ZCHL 1GYAA 4U1NB 2R0WH 2FLRT 5IHLB 4X8JA 3IDGB 2DQTL 4DVBA 4MQSB 4Z7QE 4U1HA 1KLGB 5HYEA 2ERJC 4D8PB 3WUZA 2VQ1A 2QQKH 3IETB 4U1IA 5CP7A 1T1WA 2P5WB 4FQHA 3ES6B 3N1FC 4M00A 2MTPA 2PYEA 4WEBL 4WDIA 3VI3F 3ZT5A 3X14A 2AXHA 5H8DA 1FORH 5C09D 1AQKL 5B8CA 4LMQI 3SGKC 3TBVA 3K8LA 1D5IL 4HUWB 1PQZA 2JJTC 5KVFL 3RWFA 1CD9B 3GIZL 3GSUB 3P9LA 4GS7C 4TVPH 1TJGL 2BMKA 3QI9D 1EEZA 2VAAB 2X4UB 4X6DA 1JZ5A 3WYRA 3ILQC 3C5ZA 3QFDB 1OLZA 4QT5B 3GMRA 1PLGL 2BXZA 2XXMB 1T6WA 3KPRA 5ABDE 3LN5A 2WV3A 4JPVL 1NANH 4IMKC 3OR6B 2DD8L 3MNWA 5BV7L 2NY6C 3MV9B 3VFTB 4IDJH 3U1SL 1R5IA 4KK8D 1OW0A 4OKVB 2VUYA 1MFBL 4NQEB 5CINL 2NZ9C 3O0RL 3VD7A 3U7AA 2UWEA 4Q9RL 5C0GB 2UY7A 3U9UA 1RHHB 5TE4L 5I1HH 4ONHB 5GQBA 4CVXA 2WP3O 1IILE 5CHNA 5BXFB 4NM4L 2XN9B 2OTWA 3AU1A 1P4BL 5C07E 2QHRL 4XPTL 2HT2D 3S37H 5GGTL 3RNKA 4AEHH 4LKXB 2VH5H 5CP3A 4XHQA 4P2OD 2V2WA 4Y1AE 4WWKD 1JCKA 5DQ9A 3ZE0E 4WJ5A 3DUSA 4XNXH 3FOMB 2Y1VA 4QGTA 1KJ2L 1YUHA 4KI1A 5AZ2H 4GLRI 4MA1C 5A2LH 3Q6FA 4FTVD 1MVFA 2OR9L 1T22B 5D1XB 1AQDA 5IHUL 4PRPD 4YDVB 3RX7A 1CFQA 5DF0A 4ZXBA 1MREL 1TVHA 1ZLWH 1H3PH 3MRRB 1FSKB 4ZS6C 1S7VB 5FYLD 1JZ2A 2C9AA 2XICA 3EYUL 2YD5A 1G6RA 5F72S 4XXCA 1KIRA 1PSKH 4GMTL 3SDYH 4KDWA 2YXFA 2EDRA 3PQYA 4APQD 1QFWH 4YDIL 3RVWC 4ZSOB 1P4LB 4QCIB 5I16B 1F3JB 1DFBL 4KMTL 1FZJB 3MNZA 3G6JE 5FK9B 1MFNA 4KKLC 3ULVF 2PTTA 2LQRA 4XPHL 2HJLA 4WU5B 5D9SB 5E9DA 4KV5E 5DEGB 4AENA 1X44A 3JV6B 3S5LB 2VDOL 1MCHA 1VKXB 5DD3H 3GMMB 5FECB 1Q8MA 4OB5H 4JZJB 1RIHL 1FYTB 1CG9B 3T65B 3VXSE 1U0QA 3RGHA 3DX7B 3LD8C 1E28A 1Q9WA 1X5ZA 4MB4A 3ZKSD 2EDTA 3C6LB 2V5TA 2LVEA 1KN4H 4GBXA 4LSQH 3MV8D 1EH9A 3RVUD 3SKNA 3KR3L 3VXUB 1UB6B 1WC7A 4YC2B 2AXJA 3NH7L 3PF2A 4ODXB 1U91B 4U3CA 5KSVA 2ZPKH 1BZ9A 5F6IC 1EO8H 4GRLD 4HEME 4H88L 4HJJH 2OI9C 1OD7A 2PO6C 4LSUL 2CRYA 3WFEH 4YHIA 3S88L 5D71L 3SJVD 2L7JA 35C8L 3QULA 3IJHB 4DZ8B 3LCYA 5HXMA 2YN3A 5D1QA 3UPRB 4XWGH 3LDBC 4FQCH 4K2UH 4KU1A 3R4DA 4P3DA 2C5DC 3HHRB 1AO7D 4UV7L 4P4KD 4WNQB 3NA9H 1KACB 2VDLL 4JDZB 3QUZD 1AR1C 4B7IA 1HHHA 3MRFA 4O00A 3B8YA 3I6GB 2NY4C 4IBLT 5GGSY 3LV3A 1RUQL 3HC0B 2X70B 1R3IL 1LQSR 1B88A 3E2HC 1YY9C 4XNUL 4ZTOL 5KAQG 1PLGH 4OZFG 3QDJE 5EBWB 4WY7H 5C09B 1UB5A 4L3EE 4ZFFB 4DFHA 2AVGA 4ZUUA 4AIZB 5IW6B 1Y18A 1R3IH 3DRQA 4QHLB 3DROB 3ZHKA 4KROD 1IEBB 5E2JA 5EO1B 5SV3A 3RWJA 1AHWC 1IMHC 2ZKHH 3ARFD 2CKBB 2E27H 4JPIB 4X5XB 3SE9L 4P2OA 4K94L 4S11A 3MGOB 5HDLA 1DE4A 5AEAA 2GKIA 2C3HA 3KHQA 1QQDA 3DYOA 5J0BA 3QDGA 4KJQC 1GHFL 3R0MA 2VC2L 5ANMB 2ZCLH 5KSAB 1HDMB 1CGUA 1BQLL 4EQ3A 1QSFB 4NRYA 4RAVB 1ZLVK 4ELKA 5IB4B 1J1OL 3P9MA 3WIHA 3HPLA 2DWDB 3L5XL 4RBPH 4X4MA 4OFYD 5IVOA 5I8CB 5B4MC 1DEEA 2HLAB 3BDYH 1G7MB 2WUCL 2Y25A 4JDVB 5ETUA 3STLA 1D9KA 2DLIA 2IALA 2ZNXA 4BQBA 2KBGA 3HUJA 1PKOA 3CSPA 4OFIA 4YBHA 5E99L 5IMKB 4MAYA 5C3LD 2HJFA 4UT6H 3U4EA 3BZ4B 3WO4C 4L1HA 3MRQB 4M7LH 2A1WL 3GMOB 1W0VB 1QEWB 5D2NE 1ZHNA 2YA1A 1NFIB 2IFFH 1XH3A 4RMUA 5J06A 2EYTA 4HKXB 4H1LH 5IB3B 2EC8A 5D1XD 2DB8A 1A02N 1MOEA 2QSVA 1CS6A 1L7TL 1L0XA 1J8HD 4XMKL 4FG6C 4FTVE 4R7NA 1BVKA 1I7TA 1ONQA 4YJZL 1QPXA 1LK3H 3IAGC 3QFJD 4PYHA 1VERA 2BY0A 2VN4A 1BOGA 4TQEL 3EJJX 3Q48A 1EGJL 2ICES 4JY4A 4Y2DC 1D9KD 4P9ML 2F74A 3FONA 4M5YH 4PUBH 5D8JL 1GGBH 4IRJD 5DMJB 1BD2E 4JM2D 1DQML 1HEZA 3IDUA 3PWUA 5F7EH 3TZVA 1T1YB 1GZPA 3CDGA 3HE6A 5JOPD 5T3XD 2ICEA 1MQKL 3B9VA 4MSWB 3P0YL 2EE2A 3WIIH 4R8WH 5H37H 3P73A 3AY4A 4HD9A 4ODHL 3MBED 3OG6B 4F33B 5I2IA 3GUTB 5FA3B 4KDTC 2ICEB 5D2LB 1RZJL 2V5YA 1QO3B 1X9QA 5FYKE 2AJZA 1WAAA 1L7IH 1MWAB 3RDTC 2R69H 2WUBH 4XWOC 4C57C 1IM9B 4EI5C 4KY1L 3A67H 4LLMA 5D5ME 4PJHB 3UYPA 3BP6B 1U58B 4YDKL 2F74B 2UZYB 1X7QB 2UUDK 1HH6B 3WXWL 4MNHA 3MV8B 5I8EB 2NX5E 4DN4H 4U1MA 5E2WL 2A73B 4R7NB 5E24E 3VFUB 3UTTB 4YHZL 4MQXC 1FRGH 1P7QD 4P23C 4OQ1A 1A6PA 3QUXC 4UV4H 2CO6B 3G6JB 5CWSA 4LAQH 2VDKL 1TVBB 3G6AB 4P49A 3C8HA 1NFIA 3ETBF 2FGZA 1A8JH 4G9FD 1BD2D 2XTLA 4CVWA 4JPWH 1K6QL 3NCJL 3KXFB 3RU8L 1JIBA 2OZ4H 3BZ4A 5L2JA 4MAYB 5AZEL 3KLSA 4FABL 1RZKL 3D85A 4MVBD 3EJZD 4PJCE 4XC1H 5HVFB 1XIWC 3KPTA 5T1KB 1A14L 1NCCL 2HLAA 3O3BA 5DJCA 1PG7H 2VR9A 4TSCH 4KK9D 3KWWB 2Y5EA 5CJXA 1QSEA 3WHE0 3MRJA 4IJ3B 4UQ3B 4R96A 3EOBA 5FYKD 4DGIH 3SJVA 4YQXL 3N0PB 3BZFB 2MHAA 5T5NF 3DPBA 1JZ8A 1QHOA 4UILL 5FA4A 4X8XA 3QDGB 2DM3A 5ANMA 1T5XA 1WAAF 3ARDD 2HT3C 1M05B 2C7UA 2XA3A 5D7LD 3DLQR 1R3JB 1TZHB 5BJTA 2IAMA 4EEEA 3G08B 1B0WA 3G5YA 4NBYB 5DJ2B 4XBGB 4JPIA 1KB9K 1ND0A 4LL9A 4OT1L 4V2CB 4LSPH 3QBTB 4UOW0 1MCIA 1U8JA 1EAPA 32C2B 3IKCB 4JFDE 3CCHB 1FAIL 3MMEA 3OF6D 4I77H 4FFZL 3N1QC 3RWJB 4HIXL 1J05B 1YYLL 3PWNB 4GRMB 4MD0A 4Z7NF 4HS6A 3ARTA 4WU7B 1NCNA 3FOLA 3OGCA 3KS0H 3ZKMD 3F7YB 3VWJA 5IVXE 3BJ91 2A6IB 5CJQL 5KSBB 4I13B 3P30H 2CUHA 2IMMA 4R2GC 3D18B 4EUPH 1EO7A 1I1YB 3HC0A 3JUYA 3QQ9D 1WQVT 3V5DB 2H9GB 1A7BA 5K59F 3I6GA 2VZOA 4ERSL 1BEYL 1EHXA 4M8QB 2E6QA 3OJMB 3PL6D 1WZLA 1Z3GL 2OJZH 5HI4C 4KK5C 3HRZA 4HJJL 4BELD 5DD1H 2D0FA 3MV8E 4PGDA 3V4PH 1DSFH 4HH8A 2X4PB 2W9LA 4XNXL 1F58L 3KR3H 3QEHB 2EZ0D 4XRCB 1AP2A 5DWUH 4OSUH 4OCXH 4LF3B 3KJ4C 1REIA 2OM5A 4LASL 3TBWB 4LCWA 4XPTH 4KI5F 4YBLC 5EOQL 4R8WL 4U49A 4JAMA 1F42A 2OSLA 3BJLA 4ODXA 5D1ZD 1K85A 1OP5H 4IDLA 4Y16B 3ROLB 1UZ6E 1UB6A 1WGOA 4PREB 3TBTA 3TO2A 3C6LA 5BVPH 4KWUA 3V6OE 4JG0H 5T5NG 5I73C 3NGBB 1JWMA 1YA5A 5GRXG 2EDDA 1E0OB 1CLZH 4XGZA 5SWQA 3TBTB 5E03A 2PCPB 4PV9B 4Y16A 1FRGL 1ZT1A 3QHFL 4M03A 3VWJC 3C8DA 1KULA 1CGSL 2CDFA 4HF5H 1M7IB 1JNNL 3QCUL 4ZFGH 1KNOB 3FQTB 2SEBA 4QF1A 4JRYA 4HG4J 1AP2B 2P44B 4Z6AT 4IHOB 5SWZE 1F3JA 5J3HC 1A6TA 4QCIA 3VCLB 4EXPX 5DFVD 5MENE 1XF2B 1MJUH 3K1DA 3BOVA 3REVB 5C1MB 2HLFC 1N4XL 2W92A 2WBKA 5DK0B 3HE7D 1G6RB 1RIVL 1ORSA 4MA1B 4OBSA 5EOCL 4K3EL 1PYWA 3TNMA 1F6AB 4XVTH 3EHBC 1OTTC 5C3TA 3PABA 2P24B 3KYKL 1UA6L 4CJ1A 1JZ4A 4MD4B 1VFBA 3C6LC 3L3JB 4MD0B 3GSWA 4D0CA 4PJGA 3WJLC 1A3LH 5DQ9B 3V6BR 3LRSA 4AYFA 2Q7YB 1ETZA 3ZE1F 2MSPA 1SEQH 2PW2A 3LKSB 1YYML 3VI3E 4DAGL 1MJ8L 4XVJL 2Q87A 2FX8L 3SGEI 3G5YB 2FGWH 3SDXF 5IOPA 3BPCA 4I2XE 1R3JA 4PRPE 5C2BH 4KVCL 1M05A 4PGBA 5TF0A 3U9UB 4ZFGL 2C3XA 4GW1A 1MCQA 3CVHH 3STBA 4LSSL 4ACPA 2VDQH 4CJ0A 1MRCH 4BQ6A 5I17A 1A7RL 4P2YA 3OR6A 4MLIA 4Z7WA 1EO5A 3MV7E 3V0AC 4EJ1C 2BVUA 4OCSL 3B6SB 2DLTA 3GMRB 2ED8A 43CAB 4QT5A 1KBGL 1KLUB 4Z7OE 4QXGL 4JFOB 2D0GA 2IJ0C 2P45B 1PX3A 1MQ8A 3QAZB 2Y06L 5KSUA 5DHXB 3NA9L 2R0KL 4FQLL 5L2JB 4UV7H 2JIXD 3NZ8B 2X1PA 4WI4A 5E94B 2VL5B 5SWSE 3X12A 2R15A 4PRHE 2ZUYA 4ZUVB 4M6OL 4JREC 3CH8A 3IGAB 3M1BB 1CFNB 3LAFA 4NJ9L 4HGMA 3THMH 4F7PB 1P7QA 1OGAD 2PW1A 3D3VE 1JF1B 2VLLB 3RVXD 1UM4H 1G1CA 5JOFB 2G2RA 1J5OH 2PYEB 3CLFL 1T03H 1CDGA 3RL2B 2P5WA 4RQQB 3MR9B 2LU7A 3VFUA 3E3QC 3IETA 4U1IB 1QA9A 3IAQA 2VQ1B 1YQVL 3OKNA 2R2HB 4OIAA 5DJ0B 5FUZL 4P2QD 1IC7L 1CE6A 5HDOA 1ZMYA 5A2KH 3DURB 3KPNA 2Q8BL 1HXYB 3L3KA 4OD1L 3RNQA 3UBXA 4PJHA 3PWJA 4G9DB 4TSBL 4PG9A 5D7IF 5DJZA 3T0VA 5GS2D 2VXUH 3BGFC 2CXGA 5E8DL 2E7MA 2W60B 3RIAF 2BNUB 3OKDB 3FFCE 5C8JA 3DVIA 5IR1B 4JQXA 4W68A 1CDYA 2X1WL 1JHLH 1S5IH 4ETQA 1E4WL 4QRRB 1QKZH 1HQRB 5I19L 1IVLA 3RWDA 1CDJA 3LMJH 4XAWH 2YEZA 4GAGH 4RA0C 3MUJA 1XGUA 4XNMB 5F1NB 3UO1L 4MJ5B 1U8NA 3FT4B 1BFOA 1G7PA 1YN6A 2IQAB 4C56B 3HMWL 2IPUG 4R97B 1CTOA 5D2NC 5DQDH 1MUJA 2XNAA 4W4NA 1ITBB 1UT9A 4U6HB 5ADOL 3DX6A 3TWCH 1CU4H 3I6KA 1KFAL 4NC1C 5L7XL 4HC1A 1V8HA 2EYSB 4ONFL 3ARBA 3VH8A 1P2CB 3GJFB 2IBZY 3LD8B 3U4BL 3QEUA 4EI6B 2VZVA 4WO4A 4RX4D 4FQ1H 3W5NA 3DXAA 4NQUA 3OAUL 5F7WC 3KPSD 1OF2B 3DI3B 1E4KA 2QSTA 4OFVA 5C08E 5EUOB 1DVFA 1G6RL 1HILA 4GAYA 3CFKB 1MIEL 3QUYA 1SEBB 3SGDH 2F19H 1WSST 2X05A 1MVUA 5MERA 1ERNA 3EZJB 4JDVA 1R3LA 4HFWB 3SDAA 2OX5A 4G7YH 2BSSA 4MNGA 5EZLB 1FJ1B 3TH2T 1ADQA 4WENB 4WFGE 2Z9TA 3ZKQD 2OTUB 3I9GH 3HPLB 2JJSA 1P9MA 4RFEA 3ZE2F 4KRPC 2HFEB 5HHME 1XZ0A 3FJTA 1XR9B 5INDA 3HG1B 2N7BA 2HAZA 2XRAH 1FGVH 1PG7X 3MRGA 5DRXB 1KCUL 1UWEH 2BNRD 2WBWB 4P4KB 2Q20A 4DOHB 5D7LE 3D0VA 4WI8A 4LLUA 3QUZB 4KY1H 2HT4C 5JORA 1PKQE 3QIUA 2COQA 3O3AA 5HYQB 5KOMC 2FRGP 3VXRA 5DDHB 1A6AB 3MJ7A 4ELMA 1IEBA 3GHBH 5IB1B 2AEQL 2GT9B 2O5YL 3BDXA 1U3YA 5EULV 5DUPH 2XIDA 1WZ1L 5FOBA 4ZFFA 4NKDA 3O6KH 4DUXA 3MJ9A 5DRZA 2HTKC 5C09A 1IZKA 5IKCB 1ITCA 5JIKA 3S34L 2IANE 1X4ZA 4X6CB 1B0RB 4N8CL