5DJCA

Fc heterodimer design 8.1 l368v/y407a + t366v/k409f
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCVVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 37
structure length 207
sequence length 207
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djcA01
1EVUA 4FQIH 2HTKC 2VLJB 4HH8A 1A6ZB 5H2BA 3LVEA 5ICZA 5GS2H 2VXSH 3GMRA 1FC1A 5EC2A 4JG0H 5DD5L 4D9LH 5DWUL 4KZEL 4JLRB 3KPQB 1NKOA 4UU9A 1DUYA 4H26A 1CXHA 2OTWB 2VE6B 1D5BA 3WUWG 3W9DB 4HFUL 4LCWD 4PTTB 4X5WA 4UQ3A 3HZMA 4JFZH 5JQ6L 5IT2L 1K2DB 3RBGA 4LP5A 4PLKD 2W65A 4G6FB 1I9JH 3W11C 3UDWC 1M7IA 5CCKL 5F9JB 4QGYA 1DLFL 4NWUL 3KYKH 3U79A 1D9KC 3HFML 2EICA 1YQ2A 1KJVA 1MHCB 1FZMA 3MV7B 3T77B 1MCPH 1FH5H 3IDYB 1DN0A 2NY4B 4UDTA 3MV8D 4F15B 4NKOB 5EBGA 4NPYB 3MXVH 4LCUA 5BS0D 4ELMF 4MJ2A 3QJFB 1LE5B 4L8BA 3ARSA 2MHAA 4JDZB 3C60B 5F9DC 1UB5B 4MLSA 3MLRL 1CD1B 4JO4H 4XCNA 2LAGB 1QBAA 5CP7A 1AGFA 4QRPA 4IOFC 5FA4B 2VWEC 3HNTH 2FJFB 3FHAA 2DQJL 5F89A 4ODXA 3SO5A 1R3LA 1YUHB 5F9OL 5SV4A 4XP1L 2AJUL 5HHMB 4F3FA 4TUOA 3O6FB 4Q74A 1T5XB 2GTZB 3UBXI 1BM3H 2J4WL 5HGBB 2WANA 2X09A 5E70A 1AP2A 2EDYA 3EFDL 5JHDE 3WN5A 3BUTA 1FC2D 3TBSA 4L4TA 3DROB 2ZPKH 4ZUWA 5CLWA 1XIWA 4PJBE 4M1DH 1NSNL 5IUSA 5E8OB 1J1XL 2VZUA 1OP9A 1OSPH 2APBA 3MLUH 3KYOB 3VRLF 4LNRB 3TNNB 1IGIL 3MACH 2IAMB 5IVXE 1WCQA 2EDWA 2R4SH 5A40E 4YUEL 2VDRL 1JK8B 2E6QA 1PKQB 1UCBH 3L5XL 1BOYA 2ITDB 4XI5D 1WBZB 3LD8B 3NZ8A 4Y5YC 1AE6L 2BHYA 1FL3A 3H9HB 2YKLH 1RIHH 4M43H 4APQA 5IB3A 2BNUB 2HJFA 3L5WA 4G43A 5KVFL 1T7ZA 1YNLH 5EC1B 4WHTB 4HXBH 3O2DH 5HGGS 5L2KE 4XI5C 1BZ9B 1FZJA 3SDYH 4LPUA 4GRWB 5T3ZE 4LLWA 1S7TB 4XBEH 4F80A 2HWZL 1S3KH 2LU4A 4IS6A 1YYLL 1MI5E 1KXVC 1WK0A 3DVFA 3QB7C 4HKXB 5KS9A 4KROC 1S7QB 3EW3B 2NXYD 4P5MB 2X4RB 1FO0B 3MRDA 1JGVH 3DX9B 4F7TB 2GYSA 4TOYH 1K5NB 3HG1A 1P7HL 1JHLH 3ARGA 4KUZH 5EU7E 3ELAT 5JPNA 4M1GH 4HIIB 1OGAD 1MQ8A 4FFVC 2DLTA 1F58H 1Q9OA 3QIBB 4JPKL 2DQGH 5HYJD 35C8H 5F1IA 2Q86A 2AK4A 4BSVA 2WBJC 4MQ7A 4MB5A 1AO7B 3O41A 4J1UB 3WNKA 4LPXA 1A9BA 2OK0L 2FH8A 2ZUYA 1UFUA 3IGAA 3WNMA 2HN7B 1Q9WB 3EOAB 5CINL 4EIZC 3EYFA 2D7QA 4YC2B 3V8OA 4WUUA 3OKKA 4LCIL 1RHFA 2HJLB 3NCJL 4ERSL 5KJRH 1HN1A 3WO4B 4D3CH 3GSOB 4D94A 4S1SH 2A1WL 4PJ9C 4XBPA 5L7XH 2MQCA 5GHWH 3I6KA 1WVZA 4UT6L 3ISWA 1KXTB 5SWZE 1GPOL 4HUUA 3GK8L 3ZDYE 1OAYL 4PJCF 2EDHA 4QHKJ 5INDB 2QKIB 3MSPA 4NCC2 3A6OA 4XBEL 5DJZB 1EHXA 4Y16B 2X1PA 3G5XA 4L9LC 5I2IB 3NIDE 4Z7UE 2B5IC 2DI8A 4HKZB 4AEHH 1BPVA 5HPMB 3TIEB 1YEHL 2VH5L 4OIIL 4X6DA 1WFUA 1BGXL 4XXCA 3SO3C 3QUMB 5HHOB 3C6SA 5F3HA 5KZCB 5MERB 4LSQH 4JLRA 2OYPA 2F54A 4KVCL 2DM2A 2GTWB 3AB0C 1R0AH 4H26B 2CDFA 1G84A 1KCSL 2HRLA 2IQ9L 4Y8AA 2JJVA 4HK3J 1FCCA 3C5ZB 2P1YA 4Y2DB 2BVYA 2VQTA 4XWGH 5IHUH 5EFIA 1ETZA 3OKMB 4WV1A 1QFHA 5T1KA 3PQYD 4JKMA 3T8XB 1RAMA 3SGKC 3VFRA 4D9QD 3SDAB 1DE4A 5D2LE 1D6VL 3V0WH 2EXWD 1DVFD 4LSPL 1JF1A 5IQ9A 3MJ8B 1HEZB 4RFOH 5SWSD 4YDVB 2EYRA 1PG7L 4IJ3B 4OSUL 3HKFA 4PGBB 3OF6A 5F9OH 2EKJA 4ZS7H 3FFDA 1LK2A 5JW4Q 4G5ZH 5IB2A 5HHMD 2BVQB 2PR4H 2F74B 3GEWB 3D18A 4OF7A 5C0RH 1XGPB 1CD1A 4S11A 5DD3H 4KKBD 4XWOD 1C5BH 3DVIA 3KXFA 3QPQC 1B2WL 3BEVA 4NHUA 3NZHH 1DUZA 2D7PA 2RAMA 3MRPA 1T5WB 4OCYL 4Z7NF 4MD4A 3E6FA 4ODXB 1MPAH 4M8QB 1A7QL 5DMIL 3UTSB 4ONOA 5GGQL 1N5AB 1TLKA 4OUOA 4KJYA 1R5VB 1RZJL 3WBDA 4LCWE 4EI5A 4Y4FC 1MCPL 1WZKA 3QWOA 4X83A 2D0GA 1CDYA 2YD3A 1VCAA 1NFKA 3KGRA 4L4TB 3S36X 4GMSH 4MJIA 5IR1A 5CJOH 4L3CA 1HOCA 2F19H 2GSGA 5FYLD 4H5SA 1DDHA 3B3IA 3BKML 3FT2A 1HHIB 5DFVC 1XMWA 3P73A 5TE4H 3MTRA 1A1NA 3AAZB 1AD9A 4NYLA 1F8TH 4GKSB 2QSCL 3IS1X 5C0BE 2QLVB 4Q97A 5DWUH 5C0AE 2FR4B 5FGCE 1R24A 3RA7H 4KTEH 3D39B 5TDNB 1A9EA 1HHHB 3H0TA 5K33A 3QIUA 1IM9A 1NFIB 3CX2A 4QXTA 1QEWA 5CJBA 1PYWA 1FPTL 3JTSA 3PGFH 3P11H 4BFIB 1V7ML 2HVKA 2X4PA 4PRNB 1LNUA 2ARWA 4DW2L 1S9XA 4LLYB 2ENSA 2E7MA 2Z4QA 1JPFA 3ZKXB 3V5HA 4Y4FD 2WUCH 5JW4R 4NFDA 5EBMA 1ES0A 1G0YR 4RQQB 4PJBB 2JELH 2GCYA 1H3PL 1JPST 4HWUA 1BQHG 5IQ7L 2PR4L 3WFHA 4LCWA 3MLWH 5EUOB 5BVPL 4ELKA 1KEMH 4ZS7L 1YEFH 5L9DH 4KJPD 2JIXB 4Q9CA 4JO1L 1N7MH 4ODHL 5ISZA 1A6WH 5E9DD 5ID1B 5AZEH 1KULA 4NZTL 3T0DA 2A74A 3QIBC 5C9KA 2O26U 4HIJA 3UTTD 5I1IH 4MXVF 2FO4B 4QOKB 1DL7L 2JB5L 2LTQB 4KFZC 3D9AH 5DRZA 3ULUL 4GRWH 1EUUA 3ZKMC 5HHPA 1D5ZA 1CGYA 1JTPA 2CGRL 4PJ8A 3WLWC 3TPUB 3BO8B 4Y2DC 5EPMB 3CAFA 1CI5A 4L4VA 3BIKA 5DI8B 2VLLB 3P3YA 1KPUB 5EU6D 3GSUA 4JEGB 1RULH 4LQFH 3RI5F 1R0AL 3UJIH 4KVCH 5JIIA 4NN7B 3SE3A 3ZT6A 4LSQL 4EI6B 5C9JB 2LU3A 2GQHA 1XZ0B 4MAYA 1JHTB 3NIDF 4Z7UF 4KI5D 2W07A 5F93C 1YEHH 4OKVB 2FGZA 1CT8B 4RDQG 4ZG1A 4NWTL 3BJLA 3IFOA 3D3VB 4UV7L 5E8DL 3MOQA 4V1DA 2P46B 1JF6A 3KS0J 1JTTA 3VXPB 3QCUL 2YN3A 2F54B 2HJKA 2XRAH 5IBUG 3W39A 1UXSB 4WFHD 1KCRH 2DQUH 3S7GA 3EO0A 3OJMB 3V6OA 2VXUH 5ENWA 5FHAL 5T1KD 1GOGA 2NY5L 4S1SL 2ZUSA 5FGBA 1Y6MR 1OP5H 1JYVA 5J1AB 3B9KB 2OJEB 1NCDL 3NCJH 1IVLA 4PJDB 2B7DT 3LN9A 3QYCA 4LSRH 4WW2C 1ADQH 5F6IB 1DE4B 3V8CA 3QFJE 4IDJH 3ARTA 3ZTNL 1I1YB 1A0QH 1D3CA 4RZCB 5DURB 1JF1B 3KYNA 4Y4KB 1F4XL 4M61A 2VL4A 5JOPD 1IGYB 1OAQH 2H2PD 1NGZA 5F7LB 1U91A 4W4OC 5DDHB 4DGIL 3WXWL 1YEKL 2YA0A 3QWRA 5DD0H 4WFEE 1JRHI 4OZFB 3QP3A 1F58L 1Q94A 3CH1B 3BOVA 4K71C 2F74A 3BD4A 1XGQB 4GG8B 1A6VL 1K85A 1QO3B 1GGYA 4QRUB 5JMRA 4IIQA 1WEJH 4YFEA 2I07B 1BREA 4MLIA 1R3IL 1TENA 5FYKU 1DTUA 3EAKA 1MCFA 4U1IB 2BNQA 5ANMA 5F21B 4BYHA 4I3RL 4OD1L 1RZJC 2PW2A 1Y18B 4GS7B 4QXWA 1F4HA 4WCYL 3C5ZD 5FAAA 1JPSL 1IILE 5D7LD 3V0AC 1AIFA 5DUBA 2AEQH 1AE6H 3TJHD 5C0DB 4NC1C 3MR9A 1D5MB 3D0LA 3J8F7 2G2RB 3M8OH 1QTYT 3C5ZC 2OM5A 3DX7A 4E0RA 4LPYA 1IC1A 1PJ9A 1M6OB 1PZ5A 2AQ3A 2R4SL 4KUCF 4YAQB 3LKPA 5MI0B 3FQTB 1VFBB 2BHUA 1F4YH 3P73B 4OV5B 2ARJQ 1NBVL 3QIWA 1NGYB 4F7PB 5I73C 1IBGH 2B1AL 4YZFE 3BZFB 4PGEB 4AQOA 4RGNB 5E2TH 5TGBA 1TTGA 4FFZH 2AXGA 1QSEE 4OZGF 1DQJA 4RIRA 4NC1E 4O2CA 1F6FB 2W0PA 3QFJD 4JKKA 1CICC 3HMXL 3PWNB 2W59A 3ZE0E 1MJJA 4HUWB 4LCCC 4X4YA 2A77L 3VFPA 1JGUH 1FNEA 4XNZB 2A9MH 1J86A 2XQYG 3JWNC 1OGAA 1LDPL 4PRBA 2X70B 1FLRH 2P5WA 1S9YB 3RP1A 4NO5B 3PWPA 3LEXB 1RZIB 5E9DB 5GGVH 4MD0B 3S37L 4LSTL 2AK1H 2E27L 1XR8B 1EGJL 2R39A 4L3EB 1CLZL 2FJGA 1OTUD 4L4TE 4JRYD 3MRBB 1L4IA 4N1EA 3TN0C 4Y5VC 5E6IC 1B3JA 3VXTA 2BCKB 4LCWB 4FP8H 5D8JH 1KN4H 4PREB 4PJ8D 2V5SA 1FNGB 4X6FA 4M93C 1C5CL 4AH2B 3D2UB 2X44D 4NT6B 4KRPC 3VCLB 3BZ4A 5C07B 5MHSD 1OF2B 2RJMA 3TESA 1TNNA 4P23A 2MOVA 3U7AA 3OB8A 2YA2A 3DJ9A 1UJ3C 3TPUA 3MX0A 4ZO6A 2ADGB 4JFFE 3D85A 3VFVA 3QXDB 3L9RB 5IB5A 3OKDA 3MLXL 3G9VA 1CF8H 4RWYH 5EN2B 3WYRA 3SKJH 3V79C 5B39G 4YDLB 3LEYH 1FAIH 4QTIL 3IXAA 2G75B 3DHMA 4Z7VB 3MC0A 3CFKB 3E6HA 2LU7A 3GJFK 3WIHA 4I18A 4ELMA 1B0RB 1XCQB 4UINL 2CDGA 3K1KC 4OV6F 3T1FA 3WJLC 3BESR 1NDGB 4ODSH 4GBXC 4RMTA 4HKBA 2DWDA 2YZ8A 1IAOB 4ZYKA 5GSRA 4KC3B 4WI9A 3VRIA 4ZODA 1M71A 1NC4A 4J6RH 2HTKD 1QVOB 4A2MA 5CP3H 4PV8A 5F8RC 5HYQB 1MELA 3TYFB 3BYYA 2ATPA 1FBIL 5F7FA 2WZPD 1BJ8A 1MWAA 1EJ6A 5LXGH 1QG3A 1XCTA 1X4YA 4PV9B 2M1KA 5H2BB 1T20A 3WJLA 4JFYA 5E7BA 1P7KB 2VDPL 3GMRB 2HA1A 1I85A 5I1HL 3QG7L 1EZVY 2XT1B 4Y4KA 3LHPH 2P7TA 2DQIL 3CVHH 3R0MA 4MA1B 5CKGA 1DUYB 3PHSA 4BZ1H 3X11B 2V5YA 3V52H 5E8NA 2AERT 4PJCE 3ZDYF 3FB7A 3UTTA 1EIBA 4X5WB 4D0BA 1PZUB 3GHEH 3ARGC 4JKWA 3KPNB 1BBJB 3X13B 5EA0H 5GGTL 4OJFH 1L6ZA 2OTPA 4N5ED 1L0YA 3GIVB 1DANT 1OM3H 2IGFL 1XR9B 2HT4C 2AJVH 4ZNCD 1EERB 1J1OH 3P9LA 4YHKL 5I8EB 1WTGT 3VXQA 2RR3A 3HZVA 5DT1H 3KNBA 1OW0C 3WLWD 2YOCA 4PIRF 2XXCB 4FQ2H 5SX5K 2NLJB 4X98B 2EH8H 3G5ZB 2FEEI 3TA3D 4GKNA 2DQHL 2IALA 4G6FD 5KSBF 1F4AA 4DUXA 3QI9A 5C09D 4CVXA 4XP6L 4DVRH 4X6EB 4YHPB 3TIDB 4M6NL 2J8UB 5F71A 2VXTH 1FL6B 2HFEB 2JE8A 1RJYB 5DQJA 1NBZB 2Z8SA 3JV6B 1J0KA 4BZYA 5J11C 5AYUH 4JANA 4GS7C 1FVEB 4X8JB 3LN5A 1EZVX 3WEXA 3GSWB 3L3KB 4YAQA 1KNOA 5FM4A 3OAUH 1PVHA 2DQCH 1MAKA 1X5GA 4IIQC 1P4IL 3C6LA 3QIWB 5GJSH 3FT3A 3RWIB 3UO1H 2PYEE 2VR5A 5DMKA 4LPWA 2AXGB 2WINB 2NW3B 5CEXB 4XCYA 3ULVH 2R4RH 3O2VL 5IW3A 4JM2A 3KR3H 5GRZA 4NRYA 3WNNA 3AREC 1JHKL 1G6RB 4FTVB 4LRIA 1WAAE 4LSUL 4PRBB 1NJ9A 1PGRB 3FONB 4CVZA 1RZKH 3EZ8A 4EI5D 4N1CA 2VDPH 3OSKA 2FDBP 1IFHL 4U7KA 2QQNL 2UY7A 2XQBH 1JL8A 5DSCA 4WFFE 1DBBL 1KB5H 5F6IC 4MMZC 2EDJA 3Q3GB 3UJJH 1R3KB 4CNIA 5EIQA 5IBLD 3FZUC 2VXQH 4WI2A 5TFSH 1V3KA 3BJ91 2HJFB 3L5WB 3MV9D 4JZJB 3WIHL 4JHBA 4PB0H 2I60H 4K3HA 3CUPB 3ROOB 5D70H 4JRYE 1E4KC 2QHRH 5CGYC 3F7VA 1X7QB 1BMGA 5FKAA 1WV7T 3GMPB 4OZ4A 2D03H 5IEKA 1AR2A 4MX7B 3AU1A 4OLYL 2EH7L 1KLUB 1X4ZA 1BF2A 1FO0A 3DSNA 4Y1AE 1U8KA 5DJAA 1RJCA 5FOBA 3RHWF 3RWEB 3LMJL 5CAYB 1AXSB 5SWSA 1UZ8B 4KRNA 3DVNB 4BA8A 4HV8B 3RKDD 1BOGA 3QZWG 4LF3A 2DQFA 2IAMC 3GSVA 4UT7H 5I1CH 3VG9B 1YNTB 1LO0L 2RCSL 2VNCA 5J3HC 5B3JF 1ZLWH 5L2KB 1GZPA 1AO7A 3FT4B 2E8ZA 3B2UD 1W0YT 5D96B 1IQWL 1BLNA 4XMLH 2HFGH 2DTML 4UUJB 4F58L 4X4ZA 3FB6B 1DQDL 4PJ8C 3F58L 3W5NA 2ED9A 1NDGA 1K4CB 2H26B 5KW9H 2AS5M 1IAIL 4AQ1B 4GQ9L 2ERJB 3Q5TA 4ONGL 3CD4A 3T4AA 3ZT7A 1QVOA 1ZTXL 3LPFA 4PV8B 4XP9H 4JO2H 3ARFA 3TBVB 2DBLH 3LH2H 3MBEC 3MO1B 4QYOB 3CVHB 5IM7A 5E1AB 4FP8L 3OKYA 1MI5D 5JZ7D 1A4JB 1FJ1B 4JHAH 5MHSE 4ZTOL 2HLFD 1ZWIB 3FRPG 3PE9A 3G5XB 5HHQA 5I2IA 3VW3L 4I0CC 4FFVD 3DO7A 2XNAA 5ACMA 5FGRA 3I02B 4JZNB 1JIBA 1FLRL 4S0SD 3O4LB 1T04A 3ILPB 2VTFA 2G60H 2V17L 1Z9LA 4GXVL 5J9PB 3T1WA 2B0SH 4QCIA 3QJHB 2HFGL 2X4QA 4Y2DA 4FFZL 5KOVC 2IWGA 4GLRH 4Y1AD 4UIMB 2W91A 15C8L 4LRNL 4NZJA 1N5YL 2P8MB 4LOUC 3GRWA 5J12C 4Q9RH 1CFSB 4YNYB 4HC1H 4L8CA 5CEYA 2Y5EA 3IVKB 3QCTL 4XRCA 2LABA 4PY8J 4JFQA 4ZPTB 4DZBA 4U7MA 5E2VH 2C4FU 2VYRE 4TVPD 3MYJA 3MV9E 4XX1E 3M8OL 3U82B 5IFJB 3T2PA 1CE6A 2X4OA 4KK5D 2EDKA 1ZLSL 1B6DA 5CSBA 3EGSB 1JGLL 4C83A 4OLYH 5I8CA 1K8IA 2HLAA 5ICYA 1QNZL 1NBZA 1MCNA 2HP4A 4FXKA 3QUZC 1IGJA 5TPWL 1REIA 2IANA 4M62L 4JPVH 5EULV 5KVDH 4F7MA 4YX2L 2WBJB 1A3LL 2E9WA 5H94B 3B5GA 5FYKL 4CN4A 4BZ2L 1U92A 2J5LB 1BBDL 4P3DA 2XQBL 2F8VA 3UXFA 1R5VA 4A6YH 3U9PH 7FABL 3I6GA 4NQXB 2P5WE 3WKML 4IEFB 3I2CL 1ZLWK 5DD0L 3KPRD 1JVKA 3Q48A 5HVFB 4NQCA 1KTLB 2ITCB 2W0FB 2DLFH 5TDOA 4HF5H 5IR1B 1QA9B 3K2UH 4X5LA 1EO8H 4WI6A 1CDGA 1CK0L 3HNSH 2V2XA 2EDEA 4IMKA 1UENA 4RAUA 1FQ9C 4AMKH 5KS9E 4O02L 1FVCA 4XVJH 3BWAB 1P6AB 2OQJA 5T33L 3MGAA 4H20H 1RJLA 1J0ZA 4Q7DA 1A1NB 3O4LD 3PG2A 1EJOL 1WC7A 3ILQD 5CD5D 1JP5A 3REWA 4XPTH 3PP4H 3TBTA 3OAUL 2ESVB 4I77L 3RVWD 5JXEA 4WWKD 1JPTH 5I19H 3MLTA 4GAJH 4G6JH 1RUMH 4JZJA 2HFTA 4Q2ZA 5A2JH 4G8GA 2XRAL 3CUPA 2A6IB 4I0PD 4FNLL 2W9DH 1NLBH 2KPNA 1R5WB 3VFGH 3VXRA 3RQ3A 1R3JB 4CVWA 3PP3H 3GMNB 4JFFA 1A2YA 5IEKB 2VITB 1FVDB 5DMJB 4K3EL 1U93A 2GITB 1D5XB 1WBXA 2DQHH 4NKDB 4WFED 1RIUL 3O6MH 1I3RA 1QD0A 3UPRB 4L5FL 4M7LT 1CDCA 5AWNH 12E8L 4G9DA 1UZ8A 4GRLA 1MLCA 5I0DA 4HV8A 1LEKB 3EJZD 3FN3A 1GAFL 4IRJB 4ZS6C 2AV1B 4I0PA 3UYOD 1QRKA 3S88H 3MRHB 5C0BD 1JNJA 3QEQA 2UUDH 2P24A 1KEGL 3CFCL 1J1OL 3ARQA 3VXSD 4X0KA 2UWEB 1A7RH 1GZPB 1A22B 2AK4D 1I1RA 3TA3C 4JG1L 4RGNE 1E4JA 4NUGH 1DQLL 2RQ8A 4MA8L 4HIJB 1ZKAA 2BMKA 1SEBA 5D4QA 5IVXF 2ZUQB 1YEIL 3O0RL 2OL3H 5EU3B 3DX8B 1GHFL 5C07E 1QBLL 3LKNA 4TVSa 3MGTA 2KZ1B 3CXDH 1QBBA 3QEGL 4C4KO 1A6WL 3OG6B 4KV5F 4KPHH 1MFEL 2FLRT 2VLLA 2XA3A 5IB1B 3QQ3A 1GZQA 1T0NA 3CDYA 5IM7B 4U33A 1XH3B 5IQ7H 5D7JB 4LVOB 3EBAA 1JRHL 2E5EA 4P99A 4KPHL 5E9DE 1Q0YL 2ZSWA 3MGOA 3L95B 1JYNA 1ZV5A 5LQBH 4U1JA 5C6TL 4YBQD 3A6CL 3VFSB 2FX8L 4WGWB 4WHYG 1AR1C 1X6LA 3OAZH 2VDOL 3O45B 1N4XL 2HJKB 5AD0B 1WWBX 4JZOB 4QRRB 2R2BB 2QEJA 5IBLC 4EOWL 5IMLB 1DQLH 4MA8H 5DS8B 4YE4L 1KB9J 3WJJA 3O3BB 1U3HD 1SHMA 1CFTB 4UOW1 5BRZA 4GBXA 1A7RL 4XXDB 3MA9H 2AQ1A 4GRLD 3UROR 3PHQA 4PJDA 4XCCH 4DN4H 1IEHA 1CFSA 4U49A 5C08D 1EBPA 2QSTA 3SKJL 3IDUA 4ZDHB 5LKNA 1KIPB 4DFIA 1QSEA 3I50L 1MFNA 2IG2L 5KOMC 1BJMA 4GW4B 5GS1A 4DZBB 4K3JL 3BPLC 1G6RL 4FFWD 2E7BA 1YEDA 4LSVH 4LHUD 3WIFA 4JGMA 4QXUH 2N7BA 3STZA 1WAAF 3D6GA 3PWUA 2NY4D 3HAEA 2DMBA 3FO2A 3EGSA 4KI5F 4RGOL 3FFCE 4POYA 2C1OB 2YRPA 2NY5C 5C0CD 4ZTPL 1K8IB 1T22B 2F53E 2PF6A 2XTJE 1FYHB 1NGXA 1PSKL 1INQB 3O6FD 5F9WC 3JWDL 2BNRB 4NZRH 3HLAB 4MD5A 1YJDL 5H8DA 3PP4L 3ILQC 3QEUA 3BQUA 4OM0L 2FIKA 1G7MB 3DGGA 4TRPL 3U9UB 4NFCA 5KN5A 3PHOB 3NCYP 3V6BR 1HCFX 1M7XA 5DD3L 4HG4K 4W6WB 1OAZL 1RK1B 5T33H 1UEMA 4GRLC 3D25B 5FEBA 1EFXA 4R96A 1K9TA 2VLKA 2H6PB 3LKRB 1C16A 1LDPH 4CL7A 4PY7B 3VA6A 1FZOA 4XNQA 3LSOA 4U3HA 5HBBA 4OCSL 3S97C 2F53D 3MR9B 1Y6NR 5DXWA 4ODWA 1AD0B 3BPNC 5T1DL 4OF3A 2MCPH 4L29A 1KCVH 3INUH 2CH8A 4RFOL 3ZDXF 1JWMB 1E4WL 4EUPG 2H8PA 3U0TA 3U9PL 1L9MA 4XCFH 2VERN 3H2WA 3WXVH 4HUXB 2HT4D 1BIIA 4G6ML 2O5ZL 3VFWB 2CKBL 1W0VA 4KVNL 1J11A 3RDTA 3L6FA 4GMTL 2D7OA 2PKDA 2ESVA 1ZLUH 3S8WA 3Q6FB 4Q2ZB 3BSZL 3P77A 1NEUA 4X9GA 5E5MA 4TSBL 4H88H 3V5DB 4R7DB 4H8WH 2V5MA 2BSRB 3SGDI 1HI6B 1KF9B 4NO5A 5J1SC 2J8UF 3DBXA 1TCRA 4MD0A 3QA3B 2HT2D 5E2UL 5IV2B 3MRLB 1F90H 3FB8B 4MGXA 4NQCD 3IT8D 1U3JA 3G9AB 1J9CT 2XTJB 1LP9A 4LHUB 4G8IA 4QY8A 5EUOE 5I1GL 3TH2T 3GSNB 1G7HB 2PO6B 5JOPE 4U1MB 1OD9A 1QRNB 4H0GA 2DL2A 1C7SA 5AG8A 4G6MH 4Z76A 3GHBH 1A6VH 2A1WH 1LO2L 3QXWA 5D7KD 3MJ6A 3O6KL 1WWAX 3GGWA 2JCCE 5LBSL 3AVEA 1KJ3L 2IFGA 3ZMRA 3NACH 4ERSH 4OGYL 2B1HH 5FHBH 1X6NA 3E0GA 2ICES 1OTTC 4DKFL 3HRZA 1UG9A 5K93A 2WWMD 1G7IB 4DTGL 3NBNA 2AGJL 2FCBA 4X80H 2CRMA 2F5AH 3QUZD 2OK0H 2WBJD 3JV0A 3VFVB 1MCWM 4HWEL 5BJTA 3RTQD 2VL5B 3IDYC 1NFDF 3BYTA 1F02I 4KGLA 2YBRB 4CKVX 2NTSP 2HFFA 2PXYB 4NQED 4XPGH 2VLJD 1MNUH 3X3GH 3U7WL 4Z7VA 4LRIC 4WEMB 4KI5E 5EORH 4JM2C 3KAAA 4XX1G 1JGVL 1XCQA 3U4BL 1TVBA 3NA9H 2JB6A 1B90A 2XFXB 2GT9A 3BKJL 4KRPD 5EU7C 4Z8FH 5C09B 3QEQD 2G5BB 3T0AA 4HKBB 2DLEA 5C86A 1DQQB 1E28B 1HIML 3GKZA 1MCBA 5TE6L 2C4XA 4TNWK 1MH5A 4RGOH 4ENED 1AO7D 1XT5A 5HI3D 5SV3A 1DEEB 4PJHA 2VDLH 2R69H 4POUB 1YNLL 3ARYA 4QXUL 3WFDH 2X1XR 3GBLA 2D0HA 3JSSA 4OIBA 2MQ0A 5GGUA 1T1XB 2ESVE 1BHGA 1R3HA 2RCSH 4ZFOL 3ECBA 1PX4A 5I1LB 1KJ2B 4TVPL 4PRDB 5I71B 1T0MA 5KG9A 1XEDA 2JCCB 5E95B 5HYSB 1CICD 2PCPA 3L3GA 1BX2A 4HWBL 5FUCC 4YHYB 3IDIB 3HAEB 4JGUA 1KB5A 2NY1B 2Y23A 4D0BB 4JM4H 1VFMA 1ZGLP 2M2DA 2C1OA 1YA5A 5FKPB 5E6IB 5HGDA 1Z9OA 5JIKA 4Z95H 3UEZA 1MFBH 4H1LA 3HC3L 1RK0A 1S9WB 4UQ2B 3F7YB 1A3QA 3FZUD 2E7HA 2VLKD 1FYTD 1PX3A 5GIRB 4Z77B 2DQJH 2BP3A 2HRPH 1WF5A 1ED3B 1YPZA 5CGTA 1D9KB 5CBAB 4RA3A 2JELL 4YQXH 3CLFL 3VH8G 4HIXL 4LVEA 1A1OA 3PIQA 3UTZA 3RL1B 4Y4KC 5F7YC 1OWRM 3QI9B 4D9RE 1MFCL 1RU9L 1H5BA 1ORQB 3SDAD 3EHBC 4U05A 4G7VH 3TIDA 4HBCL 1UM5H 3RVUC 1NAKH 5DK0B 3O2VH 4TUKL 1EA9C 4KKLD 5AZ2L 4LBEB 3DPBA 4OCLC 4L29B 1FH5L 4NRXB 3UTSE 1FNSH 1ZT1B 3B4NA 3RWHA 3IAQA 2EKSA 5C2BL 5DRWB 3MFGB 1DBJH 1P4IH 3UCRA 3IF1A 1IEBB 5CCKH 1S7VB 3FT3B 3RWIA 5A3IC 4PRHE 5I8OL 1E6OL 1GAFH 3IDNA 3DUUA 1NUNB 1BWMA 2PO6D 4LDLB 5DR5L 12E8H 4Y4FB 2A83B 3FFCB 4JB9L 3TEUA 3VXSB 1FE8H 3IDXL 2CMRL 1A4KA 2ADFH 3VXMB 4K3DL 1I9RH 1H15B 1FFOA 5JHDA 4BH8A 2A6KA 1NBYA 3VFOB 5I1JL 4A6YB 4NM4L 4LGSB 3V95A 5A2IH 5C0FB 3FHQA 4JG0L 2BNRE 1EPFA 3KJ4C 4MNQB 1AC6A 1E4XI 2NYYC 3FB8A 1LP9E 3HE7C 4RMVA 1MEXH 4FQIL 2P42B 3VFNB 4HXAH 2R2EB 4JDZA 2OJZH 4ODVH 4KKCD 1UJ3B 3MRNA 1QSVA 1UACL 2LAAA 3FQRB 4ZXBD 1BFOB 1PY9A 5GGSB 4JPIB 1RI8A 1AGFB 2MWCA 4KK6D 4Z7OF 3QDJA 1UM6L 1HXMA 1S5HA 4WW1B 3V6FB 3DO3A 4WIQA 3FQXB 1IL1A 1KTDB 1IGTB 5CSGA 5DJCA 1MREL 4H20L 1D6EB 5FF6B 5GGTH 1R3LB 2WP3T 3MJ7B 1I7UA 3LKOB 4O51A 3GMMA 1CICB 3OGOE 3BPCA 4WI5A 5T3ZL 1JNLL 3QHZL 4NJAL 1F4WH 2R23A 3HRZB 4PJEB 1MCEA 4HF5L 1CXKA 1RY7B 3OKOA 2BVEA 1HH6A 4G8EA 1OL0A 1OTSD 4UBDC 3KS0H 4P2RD 1MUJB 3TBSB 5JW5B 3QDHA 4N0CD 2FBJH 5AEAA 2CRIA 4HK3N 2KQNA 4W4NA 4DJMA 1OWWA 3FOLB 3GBNH 4ZFGH 4N9GA 2WWKO 3TNNA 1MCKA 3TO4B 4LMQI 2NX5A 4RRPA 1UWGL 4CJ0A 2FHCA 3HPLB 3LRSB 3QDMB 5KVDL 3FB6A 3RDTC 4QHLB 1BZQK 4P9MH 5F6HI 4QRRD 5GZNC 5J11B 1DBKH 2YK1H 4ZSOB 4NBYB 2FO1A 2B1HL 3RPKA 3L3IB 2XY2A 1FFQA 1KJ3H 3O6KH 1BZ9A 2P8PA 2YEZB 4U3XA 2EDLA 4PJHB 3G6AB 4BUHA 4G8GE 4I9WE 3FN9A 3TBVA 5K9OA 4E41D 4OLXH 1KIQA 1WIPA 4ETQA 3CVHA 4IS6B 4U1NB 1SJEA 2GIYA 5F97E 4MWFB 2OZ4A 4QTIH 1FAIL 3RIAK 4L8DA 4YBLC 3ARGD 4PRPA 4RWYL 2VDQH 1MVUA 4OLXL 3ECBB 5E2UH 5I1LA 3FQUB 2I5YH 3UC0H 2BY1A 4IOSD 3UTPD 3I02A 4JZNA 5C0IA 2XZAH 1T0MB 1BFVH 2F54E 1FSKB 5E94B 5A2FA 2ICWA 4NQDE 4HH9A 5HYSA 4N0UA 2AAVA 2NY0D 4BUGA 4CADB 4X6DE 4Y4KD 5F7EH 3WMSA 4KKBC 2NYYD 4XAWL 2DIJA 4UAOB 3OPZH 4JN2B 1B9ZA 3QJHA 4P46C 4R97B 4G3YH 4YXHL 3DLQR 1YEEH 1GIGH 1G1YA 3QHFL 1T1ZA 3FMGH 1VGEL 1C5CH 4EIGB 3EJYC 1LO4H 1WFNA 1U3HC 2VAAB 5JTWA 2APTA 1RK0B 4UQ2A 4PJ7A 3C60C 4G7YH 4L8CB 1W72A 3GRWL 3U7YL 5DMGD 4LKXA 2X4SA 4YH6A 3ZHLA 4Z77A 1F11B 1YN7B 2YXMA 4RGMC 3SKOA 1UYWL 4YEEA 5DEZA 1JHLL 1NCWL 5F7UA 4Z0XA 3MYJB 3WUWA 5IFJA 2UY6A 5BRZD 4XXCC 2X4OB 3DGCR 1IAIM 4OCSH 2VZTA 3QCVH 3DYPA 5DJZA 4Z9KB 3P2TA 1NAMH 5L8JB 4UZGA 4IBLT 5KW9L 1UB6B 4I1NB 4TN9A 3PJSB 5HPMA 4JFDA 1IGJB 4FXKB 4P46A 5DRXA 4NKQB 3MRMB 4NQEE 4JGJA 2CO7B 1RZ8A 3RL2B 4UI2A 1T0PB 2OX5A 5MERA 2VSCA 4WWKB 4PJ5B 3RWDA 4HMEA 1KG0A 5B39A 1UACH 1VACB 4MS8D 1QSZA 1YYML 1KTKE 3WD5H 1IAII 1A6TB 1MEXL 4LAJH 5FUZL 3HC4L 4UOW0 3PWPE 3NAAH 1FYTA 4WV1B 1CFVL 3VXUE 3OGCB 1ZANH 1OQOA 4NM4H 1UVQA 1OSPL 3LMJH 4OGAD 5EU6A 3CPLA 1NEZG 1I8MB 3LV3A 4ZFZA 3VFOA 1Z3GL 4P9HL 3T0ED 2IG2H 1UA6H 2B2XL 1CLOL 4PGBA 5D70L 2Q6WB 2R8SL 1DSFH 5GJTL 1WC7B 3HPJA 5H35A 4RMUA 4ZO9A 3ARPA 3AXLA 4HMCA 1PQZA 4P23C 3EOBB 4GXUM 1BF8A 1A1MB 4JFPB 1FFRA 2D7NA 3NFSL 4XT1C 4EOWH 3KJ6L 1Z5LB 4XPHH 5LGKA 4KDTA 3ES6B 3BEVB 4NHUB 1IFHH 4HX1A 4NO0D 3VWKD 1KTDA 2AXJA 4YR6B 5DEGB 3H3KA 3P30L 1DLHB 3U48A 5KANG 5ALCL 3MOBH 1FVDA 5CILL 5FB8B 3QZWB 4PRHA 1A5FH 4J8RA 4DGIH 2FB4L 5I74C 2PTTB 3KR3L 4P4RA 4MA3B 3KPTA 4OTXH 2P5EA 1BQUA 2IANE 4HIXH 1EEUA 4CMHB 4OLZL 4DGVL 4R4BA 5HGAB 4Y2OA 1ACYL 4NWUH 2CLZB 3CDCA 3FO0L 4MJ5A 2ZCHH 1DDHB 4I0KA 1W2KT 4AL8H 4JZJC 1J18A 1KACB 4OZIB 2ICEB 4WO4B 1MJ8L 5D5MB 2BY3A 3VE0A 2F58H 3LB6C 4GAFB 3S35H 1A14L 1X5FA 4LARL 3S96A 4IRJD 2FR4A 3QUYB 3D0VA 1KGCE 5AAWA 4KZEH 3RGHA 3T0EA 4AG4H 1TVHA 1JWUB 3NPSB 3DIFB 1XGTA 1PBYA 4TVPH 4ZQKA 3S88L 4PJ5D 1HILB 1S9XB 4LLYA 3DXAD 2FGWL 4FQXD 2I26N 5J7CC 3AREA 3VD9A 3TVMD 1A7BA 3VD7A 4P2QD 5EBMB 1I7ZB 4WU7B 5E4IA 4KROD 4LVNB 1XF2B 3MQIA 3FQUA 3L95A 1VEMA 1IRAY 3VD3A 4AG4L 1OSZB 5C0CB 5DHVA 2Y1VA 1S7SA 4Y5XB 2DDQH 1XF3B 3GHEL 1C7TA 4EUPB 2VDNH 4LGRB 1NQBA 3KLSA 2F58L 5GGRB 5IMLA 3L7FA 5IKCA 3WSQL 1MJ8H 4LLQB 1RUML 3FB5B 1VERA 2XZZA 1JPTL 1CL7L 4MXVE 2EZ0D 4XXDA 3OHXB 1UM4H 3IFNL 3U6RA 3U7WH 1ONQA 4Y1AA 5TQ2L 5L9DL 1DBML 4OLWH 1KEML 1YN6A 3RKDC 5J6HB 3QDME 1ND0B 5HDBF 1QSEB 4LASL 4PJGF 1H3PH 1EXUB 3OJ2C 2DAVA 1DBAL 1T89C 2QADC 1EO8L 2WUCL 2NY4C 2GK2A 3VWKA 3ULUE 4P23D 1J0IA 4B50A 4J6RL 2ZWLT 3MOBL 3I2CH 2Y7QB 4POZD 1FGVL 5FHBL 1S7UA 1T21A 2V7NB 5CFHA 3HA0A 4XAKE 3NACL 4QRQB 5GSVB 5J4MA 1EV2E 4P46B 4R97C 4KDWA 1U0QA 5ETUA 5C0BB 1BBDH 2I9TA 3MREA 4NKMA 3V4UL 3FRUA 5CHNB 5HDLA 1S7WA 1MAJA 4PJ5A 2MKWA 3D39E 4LNVA 1EHAA 2VC2H 43CAA 5C0GB 2I25N 5SWZA 4ZUUA 2Q20A 3CFEA 4NNPH 4WENB 3SGDH 3VG0L 2GSIA 4JPWH 1QFWL 3ZKMD 5HYEA 4JRYA 5TE4L 2X1WL 1CF8L 3SDXF 4MJID 4LEOB 1WZ1H 3IDGB 1Z0NA 2FEDC 5I9QC 1A6ZA 2H6PA 3FJTA 4P9HH 2UZYB 3TWCH 3VGAC 3VGBA 1I1AC 1JGLH 1KPVA 3QDGE 4TSBH 5EOTB 3ZE1F 2B20A 2GJ6B 2R1WA 5FA4A 5T3XH 3MLYL 4KHXL 3LV3B 4TSAH 1AQDB 1FNHA 1KLGA 1U42A 5JOEA 4P5KA 2H8PB 1YJDC 5I66B 3WFEH 3KPOB 2VABA 4L1HA 4J3SA 5T1LA 2PYEB 4DEPC 4FS0A 5H35B 2O5YH 1YYMH 2Y36H 4GW1B 4YO0B 3RDTB 2FWOA 4XVUC 1A1MA 1GGUA 3Q6FA 1DR9A 1E4WH 2P5ED 3WL9A 1MJ7H 1KOAA 1EEZA 4IIQB 4DZ8B 1KJVB 2DM3A 4YR6A 1MHCA 1K8DB 3ZE1E 5IJVB 3KPRB 4PP2B 1BEYL 2IAMA 1MCCA 2I9LB 3IDJB 5ANMB 1NCAL 1T83A 5IV2A 3SJVA 1N64H 4YC2C 3HMXA 1CLCA 1JNHA 3QO1A 4M7LH 3QXUA 4UB0L 1A7OL 1MQKL 1FDLL 1NCWH 2P47B 3C60A 2R0ZL 4OFIA 2YC1A 1YJDH 3GRWH 1IBGL 4K94C 1MCWW 4WHTA 5F7KC 2GJJA 1HK6A 5BOPA 4Z5RB 2EYTB 2CIIB 1G7QB 4YHMH 1IC4L 3TA3A 2UZIH 1YUHA 1GIGL 3BQUD 1QFWM 1PEZA 2AEIT 4F7PA 3DX6B 4FZEH 3DXAA 5BQ7A 4I0PC 4PGEA 1X5XA 4LPVA 3VGAB 1UKTA 4X99B 3L3HA 5JPNB 3ZYZA 1JPSH 4HUKB 4YWGH 2XZAL 4ZD3H 5LGJA 4K94L 3VFPB 4JAMB 3UTTE 4I3RH 1MOEA 4OD1H 4WTZA 4LNRA 3BHBA 1MCQA 4WU5A 2X4TA 3VG0H 2R2HB 5GRUH 3PWPB 3PV6B 3H9YA 4XH2B 2XY1A 5GZND 1T7VA 2IPUK 2VZOA 3PNWA 1T1YB 1TJIH 1GSMA 4LAQH 5FO7B 2MMXA 1I8IB 5F96H 1XF2A 5BCAA 2EXYC 3WN5C 2YPLB 2BCKA 4FXLA 5DA0B 2LE9A 2EH7H 3O4OC 4G43B 3PABB 4OCWL 2EC8A 4CBPA 4CU8A 5F7HA 3NTCH 3RZCC 4MDJB 1YEKH 5JHLL 3BXNA 1CXEA 3D85D 4P9ML 3QH3B 3WIHH 4R0LC 4O2EB 4QOKD 5FUOL 2F8OA 4M00A 3S3JA 3VRJA 5IW6B 3BZ4B 3AS2A 2C3HA 4HW6A 3X12B 2X4RA 2E8YA 4P23B 3O3AA 1TJHH 2PTVA 1ORSB 1EEYA 1AHWA 4HS8H 2YRLA 4F7CA 4K7FB 5CJQH 4HKZA 4ZFGL 2HT3C 3NCFB 4AK1A 4OLEA 3JWOL 1KGCD 1RZKL 3GIZL 2Y6SC 5EIIB 4KMTL 5IB5B 5HI4D 4FQPA 3KPLB 3X14B 3VDCA 4OD2B 4K9EC 4P49A 1K4DA 1EXUA 2PCPB 3F6IA 3L3GB 5EN2A 2Q86B 2DBJA 1OP3K 3TBYA 4NKIL 2GTWA 4JKLA 2EEBA 4QRTB 3WS3B 4DKEH 5DHYA 4LU5L 5MEQA 1JGDA 1PLGH 1F4WL 3CNKA 4PJDF 5D1XB 3QUXA 2OL3L 4ZSOE 3N1FC 2VDNL 4DGYL 5KSAC 3I84A 2F15A 2DDQL 2KZWA 4M9PA 2F53B 3F65A 2K7PA 1L7TL 1KJ2H 1MREH 2P44B 4NQUA 5T1KB 1F3JB 1JGEB 3G6JE 1NDMB 5AUMB 3O2DL 4HXBL 3QULA 3FQWA 2I9TB 3ULVD 1KEGH 3GSOA 3IJHA 3CC5A 1S7WB 3MBEB 4TQEH 3T2NH 4PR5A 3T3PF 5FDWA 4GKZA 3LQAL 4B7IA 2WIIA 3ZKSD 4EUPH 3I6KB 2AQ2A 4X5XA 3CFJB 1A1OB 3PIQB 4Z0BH 3EYOB 1QUNA 2A6DA 1NPUA 4PFEA 4LEOA 3MNVB 4IRSB 2P49B 1OP3H 1XCTB 1ORQA 5KSUA 1ZHKA 4K3EH 4JFYB 3RTQC 5CD3A 2XA8H 1XGPA 1I9RL 1QQDB 2DLIA 4R4ND 4X6DB 1T6WA 3MV8A 2OL3B 5D7SL 5ID0B 4JB9H 1QLRB 2YUVA 1VKXA 1NCUA 3RZCB 1T5WA 2NY1C 2PNDA 3O2WL 1HH9A 1ZLUK 2GY7B 5DFTA 3X11A 1CLYH 3RJQB 1JTOA 5T1LB 4XPTL 5BW7A 1U8JB 5J12B 4UNUA 4LSDA 4DQOL 1IT9H 1JUFA 4HCRA 4XTRC 1X5ZA 3IAGC 3OB0H 3KG5A 4BH7A 3LZFL 4YHZL 2X1QA 3SDAA 2NY3C 1NANH 4NO0A 3GO1L 5AZ2H 1TJGH 4DUWA 1QSFB 2GSGB 4FG6C 2AEPL 4FG6D 4V1DD 5I1KH 5IJVA 5M7QA 4G7VL 4QHMB 3ZE0F 4Z7WB 5C0FA 4LGPB 3MXVL 1CD8A 1HSAB 2FD6H 2DKMA 4L4TD 4AT6A 3MA7A 1IQDB 4BK5A 2WM0A 4OQTH 3OQ3B 2D0FA 3DRQA 4MCZB 2J8UA 5GS0D 1UH4A 4BSWA 1RJYA 1U95A 1VENA 2BRRL 3AGVA 1GGIH 3SY0B 3QDJB 5H37H 1FORH 4I2XA 5F72S 3D5OF 1DUZB 3HC3H 1IGTA 1INEL 1OVZA 1QEWB 2Q8BL 4R90L 4DOHB 5TPWH 2V2TA 4RBPH 5IT2H 1MF2H 3ALXA 4U2ZA 5DVNA 3ARDB 1JPFB 4RWHA 3NCCB 1Z3GH 3QNXB 2F19L 5JIHA 3RIAF 1CQKA 3MRIB 4WW2B 5D6CB 3S5LG 5DMKB 3EYSL 2EIDA 2NXYC 3K4ZA 4UTBH 1D7FA 4PJFA 5JW3L 4N0UE 2ZZUT 5DD5H 4D9LL 1S7RB 5BVJB 3FOLA 1OGTA 4L3CB 4KJWC 2R1XB 4I3SL 1TZIA 5J06A 3THMH 1G6RA 2P48B 5B3JE 3MLXH 1NJ9B 5IBTL 4CVZB 4I13B 1HZHL 3TO4A 4AY0A 3Q1SL 4PBWD 5L6YH 3NZHL 4NHCL 3HPLA 3QDMA 1B2WH 4QOKA 1WZMA 5FO7A 3C8KA 1CQYA 4JY4A 3QUMH 1LE9B 4P59L 5C0RL 4PJ8B 3KLAA 2G60L 4ONHA 2F54D 2ATKB 5TE6H 4NUJB 2UUDK 4CAGA 2EC9T 4L4VB 1SBSH 1IM9B 2JJSC 4P2RA 3S5LB 2IQAA 3PWLA 3NA9L 1BWWA 4OSUH 1KIQB 5IFHL 2CO6B 4KZDH 2VDMH 1PG7H 2Z35B 4NGHH 1E27B 4GO6B 4QHNA 3VG9C 1KLUA 5CMAA 4MZ3A 3SE4C 1AO7E 1EEYB 5C8JB 3NIFE 1YY9D 1D6VH 4K7PY 3V0WL 4N8VA 2X41A 3EYVA 3BZEA 3C2SA 5GS0H 4YBHA 4DKAA 2E27H 4JO2L 4MDIB 3PP3K 4X4MA 2W0LA 3BEWA 4X7EC 5D2LF 4TPRH 5EUOA 2UYLA 4ONGH 4PTUB 4ELKB 3X14A 4MAYD 4OD2A 5EBWA 4GQ9H 5IOPA 5E99H 5EO0B 1IAIH 3WS3A 1DFBL 3HS0B 4HHAA 4P46D 1A7PL 3FT4A 2NY2B 3PWPD 4OGYH 4HPOH 2EYSB 3EJYD 1CFBA 4NP4H 5SWZD 4QNPE 1J1PL 5E2TL 1CWVA 3B9KA 4I9WD 1ODAA 1ZT4A 2QR0A 2JTDA 1NDMA 2Q3AA 4PJ7B 1P7QD 1UADC 1HKLH 1P5UA 1RV6X 1ERNA 2ICWI 2VDQL 5EPMA 1AKJB 2AJZA 3IKKA 1F11A 1YN7A 1IGFH 4N5EC 3KYNB 3I3BA 3F5WA 2WIIB 1OAYH 3TO2A 4M61B 5FYJD 1V3LA 1I1CA 3ROLA 2ICWJ 3BQUC 2EC9U 2A6DB 2C3VB 2A73A 5L7XL 4M5YL 5BXFA 4MAYB 1ZLVH 1HCVA 5HVWA 3D87B 4K7PX 4LLMA 5FM5O 1FSKC 4YDKL 3T4YA 4U1GB 2X4NA 1T03H 1GC1L 2YK1L 4LIQH 4X7FC 1NANI 3DSFH 3RL2A 1J87A 4HT1H 2VXVH 3OAYK 4OKDA 2MCG1 5T3XE 2Z31B 1CE1L 2GFBA 3QNYA 4Y2DD 5MI0C 4MXWL 5FV1L 2CRZA 3BKYH 3G6JB 4HJJH 4XCFL 1Y18A 4Z78A 3TF7C 2DICA 3N1MC 4WGVB 4EDXB 1YNKL 2IADB 4HJJL 1MCJA 4ZOAA 2ADIB 3UTOA 4JFEB 3QI9C 1I8MA 4K7PL 4X9HA 4KJQD 1RFDH 1P4BH 4RZCA 1QSFA 4X6CA 2H32H 5DO2D 3TNMB 2RHEA 1DP0A 1IGYA 1Z6JT 3FQTA 3KXFE 4NN6B 4MMXC 2HG5B 2V7HB 3BPNB 1T03L 4RFEA 1IQDA 3O6FA 4OM0H 5KVFH 1NCDH 2L7JA 4I3GA 3B2VH 2YKLL 4M43L 5D2NC 4WO4D 1XGQA 3T0EE 1KCLA 4H25A 4P57B 1HYSD 1CZ8L 3WN5B 4PJFE 5FHAH 4DVBA 3L7EA 3JBG7 1KYOJ 4HK0B 2VB5A 5TH2B 5IMKB 4R8WH 1JZ6A 5DEGA 3N1QC 5IFAL 5FYJH 3TYGH 2FSEB 3ZKQD 1IGFL 3GMLA 2BSSA 3QRGL 4R0LB 5FB8A 3BP5A 5I1JH 4NQXA 4B0MM 1M7DB 5DQ9A 4KJWD 5E08L 4K3JH 3KVQA 4X4XB 2VLKE 4R4BB 1D5MA 3D0LB 5HGAA 5TDOB 3U83A 1KXQE 5GGTA 2NPLX 1VFUA 3PXJA 1FZJB 3WDJA 1CGTA 5SX4H 1MHPH 4LLWB 2IBZY 4OZGB 2AXHA 2KH2B 2A6JB 4TPRL 1OM3L 1RJLB 4F37F 3HNTL 1NUGA 5EA0L 5B8CB 2XKUA 4YHNB 1GRWA 5GS0L 3TT3H 3CSYB 1FV1A 3TBTB 4F9PC 5C0ND 3WE6B 1QFOA 2ATKA 1CXLA 2VISB 4HBCH 4PG2C 3U1SL 1G9NC 4WFGE 1G9MH 1U8LB 3OR6B 2O61B 2A6IA 4AIXA 3DYOA 3S5LA 1O7VA 4YEFA 2HTLD 43C9A 5BZWB 4WDIA 3F7QA 2X70A 3AB0B 3H9SE 3AM8C 5JXAH 4ELME 2AVGA 4NQDA 3VI3E 5E8PA 1X5LA 4PJHF 2Y9RT 4P59H 3IGAB 1NUDA 2VQUA 1AGCA 5CD5C 3EOAA 3T1FB 2R56H 1IKNC 3BUYA 4YK4C 1G7LB 3JV4B 1G7JB 1I9JL 4LP4A 1Z9SA 1MFBL 4R26L 3N1PC 5CKAA 2UYLB 3QPXH 4S1DD 1FN4B 5HTSA 5IBTH 4AENB 3DYMA 1XF1A 4EUPA 3MRHA 1XIWD 4MA1C 1T66D 4ZOCA 3I9GH 3L7FB 1WCBB 4Q6IC 5FK9A 2QKIA 2VLJE 2Z31C 5ERWB 4PRHD 1P5VA 2HVJB 2NY1D 3OHXA 1ZLVK 5HD8D 1YDPB 2H3NB 4KTDL 3MGTB 2VKXA 3I9GL 5KAQG 4NQSA 1ZA3B 4OCNC 4FMFA 4S2SB 2NY2C 3GFUA 3M1BB 3MBXH 4U1SA 2ADJB 2Q8BH 3SDCD 3UP1A 2CKBA 4NZUH 1GZQB 1T0NB 1S9KC 4PLOB 2GK0A 2R56L 2JJTC 2AK4E 2A73B 3ARWA 4F9LA 4Z7UA 3UTTB 4YHYC 4N0YH 1GGCH 5MP6L 4D9RD 1JYWA 3OR7A 1CFNB 4QF1A 3RWCB 1ETZB 1B0RA 1EHNA 2F5BL 4CMHC 4X7TA 2X4UA 2CSPA 1F13A 3T8XA 2X4NB 1RZJH 3VFUA 5E2WH 4HLZG 5A16A 1Q1JL 5BO1L 2BY0A 1X9QA 3BP6B 5EORL 4DFHA 5ADPH 2BJMH 4U6HA 2AEPH 4NOBA 4ZUUB 2XI9A 5A43C 2N1KA 4YGVB 3PF2A 2LV4A 4XPGL 1NEZB 4HFWA 3TT3L 4YHZH 4LSTH 4XVJL 2BSED 4HWEH 4X6EA 2FZ3A 1DVFB 2VLRE 3QDJD 4OF0A 4XMKH 1IT9L 4XNYL 1TIUA 1CK0H 2HH0L 3JVGC 2X89A 2WW8A 3JV6A 3LDBC 2L4OA 3LS4H 2AJYL 3L3DB 5C0NC 1BD2D 3MRPB 5F1OB 2GAZB 3BW9B 3P4MA 3E6FB 1HHGB 2DTSA 3P9WB 3STZB 5IP4A 5DJ2B 1N5AA 1RSFA 1L7IL 3FB7B 2CUMA 1IJ9A 1YMMA 1W0WA 4MZ2A 1IEAB 3GUTB 1WWWX 3H9SD 1H3XA 4TTDD 5E7FA 2OR9L 3GIVA 5CP3A 4WY7H 4WJ5A 2BC4B 4BZ2H 3IETB 4F2MB 5IIEA 5CJXC 3AFLA 4U6XA 4X6BB 4P3CH 4AIOA 3L7EB 2EDXA 3N50A 4LCYA 1HOCB 4K9EH 3GJEB 2D7TH 3HZVB 3QIWD 1FL5A 5FO9B 4MNQE 3IJYB 1U2CA 3BQUB 4WNQB 4OGAC 3B3IB 3FT2B 1IZKA 3BP5B 4WEBH 1J12A 1ZHLB 2VH5H 3RIFK 4WUKH 1RK1A 4D0DB 1RIVL 5D5MF 2PYFA 4LVHC 4NQVA 4MSWB 5KSVA 3VFTA 3RVVD 4I5BB 4G8FB 4R4FH 3OXSA 4YPGA 4X4XA 5D7LA 1AD0A 4GMTH 4S1QL 5E24E 3VWKC 2BOBA 4Z7NE 3O3EB 1SEQL 3MJ9L 4JFXA 4OF6A 2HVKB 5JHDD 4PRNA 3UYRH 4D3CL 1OP5K 5B38A 3R1GL 4MX7A 2AJSH 3RVXC 3C5JB 2XWJB 1NAMB 4L4VD 2YPVH 3QG6B 3N85L 3CSYA 5DJ6A 3BE1L 2LTQC 1I1AA 2MJWA 4FQHA 4HS8L 4Q9BA 3CFIC 4QTHB 2X1OA 4HAFA 5D6DA 2J88L 5IG7B 3CZFB 3M17B 3TM6A 4B41A 5ITFA 4NC0B 4GG6F 1CE1H 3CFBB 5FO8A 4NO3A 1IKFH 1I4FA 2NR6C 1C1EH 3P77B 2VXVL 3X17A 5LGJB 4LL9A 4ZAKB 1NGWB 5TJWK 4FTVA 43C9B 4LIQL 1GC1H 2AI0L 4LSRL 2R2HA 1C8PA 1EAPA 3L3OA 4PJAF 3FL7A 2A74B 3QUZB 4JR9H 3EO1B 2NY5H 4UUJA 2FO4A 1QBML 1OT1A 1OAXH 5DRZB 1AGEA 5EO9A 1U3HB 4ZNEA 4Y4HD 2JF1A 5GRJH 1IAKA 5HYJE 1TMCB 3QCUH 3OX8B 4NNYA 5DYOB 4KHTH 1OGAE 3ROOA 5DI8A 3QO0A 4K94H 4J3WA 4LHUG 3CDGB 5F7NC 3F58H 4KH2A 3QH3A 1KPUA 3QDJE 2DTMH 2Q7NA 2IF7A 3IFLL 5EZJB 4F58H 4XVTL 3O9WC 2ESVD 4QHKI 1G6RH 5CBEB 2W60A 4KK8D 1RHHA 5DJAB 1ORSA 2PXYD 4NQEB 1ZA6A 4F7CB 4FOMA 4K7FA 1NKRA 3UBXA 4PJIA 4Y19D 5CEZL 3DO7B 2R15A 4NQSB 1EHLL 2EIBA 4KHTL 2Z93B 4EQ2A 2GUOA 2VDRH 2I27N 5L8KB 4XNXL 1VPOH 2QTEA 3MA9L 2ADJA 5DK2A 3TBWB 3VXPA 4X6DF 2YBRA 5DVOA 2CGRH 2FX9H 1JGDB 1TZHB 1WWCA 3MZTA 3UPAA 3PGDA 4OFYD 2G9HA 4QF1B 2VDOH 2E6PA 5J1AA 4UIMA 2JB6B 3OJDB 4K71B 4WHDA 4P4KB 2J6EH 4CW1A 4M7LL 4UB0H 1NC2A 4PB9H 2AJUH 1K4CA 3KPPA 2I60L 1FZKB 1Q0YH 4JO1H 1INDL 3C9NA 5TFSL 3X3FH 5J13C 4TSCL 5FECB 1RZ7H 2CK0L 2PN5A 2P43B 3BE1H 4F15C 4Y19B 3SGEH 3RBSA 2QQNH 2KL6A 2EE6A 2Y07L 4X9IA 2BOCA 4LPTA 3P0VL 5C1MB 2KUTA 1H3VA 4JDVB 5SX5H 1HDMA 4U1HB 3UYRL 2R9HD 4R2GC 3CFDB 3PDOA 4K3GA 3VXSE 5L88H 1G1CA 3MJ9H 4HULB 3B9KC 3FO1A 1HZHH 4CMMB 2O5YL 4WTXA 3L3JB 1CYGA 4S1QH 1N3NA 1QO3A 3MOAH 5GGRY 3THML 4WI3A 2ZG1A 5ESQA 2WIMA 3EO9H 3HZYB 4F7MB 1GL4B 3MRFB 3OKLB 2FEDD 4KTEL 3RA7L 3NGBB 4Y4HB 3LEVL 5J9PA 3EOTH 4HEPG 3O4LE 3RUGA 1U8JA 3UAJC 1KB5B 1RUAH 1W0WB 3SGJC 3ZHKA 4OF5A 4WJ5B 1O7SA 5F8QC 5GQBA 5JQ6H 2XTJC 1E6JH 1GGBL 1JBJA 1CDUA 4NQCB 5EOCH 1INEH 2VIRB 4GRWE 4NO0B 4R90H 3KPRE 1OARH 4JFQB 4P9HC 5E0QA 3CSBA 4HLZH 4QT5A 4YHIB 2XZCH 4LFHG 4FMKA 4RAUB 1T7YA 2P45B 1FVCB 1PZ5B 4N0CC 1OY3B 3V4UH 4WNQA 5D7IA 1VFBA 2QSQA 4OV5A 1KPRB 1I7RB 2EH8L 3IDMA 3WNOA 5KVEL 3GI9H 3G6DH 3DRQB 4PJXB 5DT1L 4JY5L 3DRTA 1MPAL 5DMIH 4OCYH 4I77H 1F2XK 2ZUTA 1ZT1A 3QUXD 1T7XA 1LHZA 2XICA 1VADB 4HAGA 3IF1B 2KBGA 1RZIA 4O02H 4XBGB 2W0KA 1NMCC 4K23L 1KIRB 4ODUA 3V52L 3I6GB 4JN1H 4ENEC 3TP4A 1F42A 5CWSB 1X5IA 1I3VA 1CTNA 5I1HH 5FO8B 2QSVA 4F9PA 4IRJA 3EYQC 3LN4B 2R1XA 2NXZC 3QXVA 3WJJC 2V2XB 1ZHBB 4J2XA 3OF6D 2XA8L 3BWAA 5C0CE 2XN9A 3OKNB 1GJIA 4NT6A 2PO6C 2R1YB 2XZCL 1OF2A 2BMKB 1HKFA 5GRXG 3RNQB 5GISH 3TVMC 3LKNB 4JPVL 3EDKA 1J7VR 5EOCL 1EFXD 1BVKA 3BGMB 3KYAA 2NY2D 1UZ6F 1QNZH 4J3XA 4YIQB 4WW1A 3W82A 4KTDH 5KAQF 3KDMA 5FF6A 3RZWA 4RMWA 4Q6YA 4GRMA 3IXAB 5HHOE 4K8RL 3TCLA 3IKCA 1MRCL 1HXYB 2BVTA 5D7JA 3UTQA 3D69B 4JVWA 5E2VL 1D5XA 1WBXB 2XWBA 4PLJD 4ZAKC 9CGTA 4MNGA 4CN6A 4ELMB 1A6AA 4NQEA 1G0XA 3K3QA 3PWJB 4JCMA 1BFSA 5JQHC 3BZEB 4U0RB 1WZLA 1MUJA 5GHWL 5GSRB 3SDDA 1XF5B 1U8QA 3RNKA 5TE7L 2PETA 2AXFB 3GDBA 1NC4B 3QIWC 5BV7L 5I73B 4M1CC 5IOPB 4M1CD 2XXMB 4FQXB 2CDEB 2EIZA 1ZE3C 1KCUL 3TYFA 2EDOA 3PGCB 1U8MA 3AY4A 5CINH 2IMNA 5I1AA 4PTTA 3X3FL 4NIKB 5DFWH 4U3CA 4ZNEE 4D8PA 2YD6A 5EUOF 3TN0A 1LGVA 2FB4H 3VXOA 4GUPA 3BN3B 5HHVH 4WRLA 1YMHB 2XKNB 2BX5A 2XPGA 4PJEF 1YY8A 4PRIE 1NCNA 4BQBA 1JMZA 1BVZA 4JFED 3SOBL 3T77A 2GJ6E 1RJZB 3VMNA 2DBLL 3LH2L 4TOYL 5L2JB 2BOCB 1JN6A 5IBUB 3MUY1 4LCUB 5HPOA 3NFNA 3SEPA 4QEGA 2AJ3A 4WV1C 3QQ4A 1MHPL 1SM3L 2ZKHH 2MHAB 4CMMA 4P2YA 3BI9X 1IARB 4XP5H 4FZ8L 3W5MA 3JWDC 1MFDH 3QNZA 5FCSH 4TTGA 3SDYL 1KENL 1CLOH 2ICWB 5FCUL 3VD4A 2L0DA 2UWEE 4YWGL 4KQ3L 1TETH 2GFBB 2FJFA 2R2BA 5I75C 4JRXE 4W4OA 5F6HJ 2B1AH 4U6YB 2VDKH 4AEFA 3H42L 1CN4A 3SO3B 1IC5L 2Y5TA 4JN2A 3VGFA 5E4EB 5HDQH 4G6AD 2DM4A 3G6JA 1B4RA 4ORGA 2X05A 1DCLA 3JXAA 4L4JA 1NL0L 3CSPA 4EVNA 3TYGL 4LLUA 1XGUB 2HFEA 1U8OA 3C5SA 1DQMH 4XB8A 4AEEA 3BGAA 3RAJL 2QQLH 1CZ8H 3IS0X 4OZHE 1JWMA 1MRFL 2UVEA 3L3KA 5KANI 1KNOB 3CVIL 1RMFL 2YSSB 3SDDC 4F37K 2VO5A 1A7OH 1MQKH 4C56B 5IESH 3C6LB 5FM8A 1PKQA 4GAGL 3HZMB 3LQZA 3GJFH 4OQ1A 5ILTL 1QRND 1R3IH 2P8LA 2BVOA 2WMPA 5EU5B 1UB6A 1T22A 2Z9TA 1JZ7A 3G5VB 3C60D 3HRPA 3BT2H 3RUGF 4F8QA 5IMKA 4RSVA 4NRYB 1YECH 3S4SB 2PYED 5HHNB 1VACA 3GMLB 3E2HC 1SY6L 1M05B 4AIZB 3ULVC 4U0QB 1Q8MA 2C9AA 3NN8B 5JORB 2VLRB 4KRMB 3PHOA 4NKOA 3U7YH 3J7HA 4P5TB 3D48R 1AGBB 4P0DA 4MXWH 5E5UB 1FYTB 4PRAA 1WSST 4YFDB 3DX9A 4F7TA 1FZOB 4XNQB 3GKWH 3O6FC 4UV4H 2DWEB 1CDHA 4KU1A 4WEUD 3G6JF 3SCMB 2BXYA 1WT5A 1P84K 5F7EL 1KCUH 3SHSA 2OTUB 4J23A 1U3YA 1LO3H 4AM0A 4Z76B 5CLTA 3F7PC 2WQRA 2XIDA 4WEBL 1X7QA 5FKAB 3H7LA 5IMMB 4HJ0C 5I30L 1CU4H 3IAPA 3OWEA 5B8CA 4HSQA 4CU7A 2JCCF 1WZ1L 3ZDZF 3H7BB 1KCRL 2DQUL 2GTZA 5KSBB 3FO9B 5I71C 4KWUA 5JUEH 3WIIH 4FQQA 2VXTL 3ZO0A 5J0BA 2W9EL 1MRCH 5CZXD 3GSVB 5BJTB 3MUHL 4XP6H 4DVRL 1HKLL 3SDXB 1F97A 5IMOB 4OCXL 2O5XL 5L2KA 4R6UA 2VXSL 1NFDB 4Q0XL 4PRHB 4JHWL 2X2YA 2YMXH 1R5IB 5LGHH 1P7QB 2XWBB 4MB4A 5T5NF 4MNGB 1AGCB 3CK0H 5INCB 2HKHH 2VWEE 3SJVE 2G5BA 3BPOB 5BZDB 3HI5L 1UQSB 4APQB 3B9VA 2J5LC 4XNYH 2K1MA 3HZKB 2AXFA 1H8NA 4OBSA 3T3PE 5EOCJ 1BFTA 1BJ1J 2A0LC 3GBNL 1DBMH 3PL6B 3BKCH 1XF4B 5EWIH 5IGXH 3VJ6A 2DJSA 2CLRB 1T1XA 2VDML 2ZG2A 1I8LC 1ZWIA 5HHQB 4H0HB 4RRPG 5K9KB 1ZA3A 1RZKC 5FYLL 3KJ4B 2XKNA 1AGDB 5CEZE 3QAZB 5T3XD 2ZCLH 1YY8B 2R0LH 1JWUA 4HKJA 1A64A 3BH9B 4D0CB 3ILPA 4TUJA 2CKBB 4QXGL 2W38A 4HDIA 4DEPB 4NO2B 3GSNL 2EYRB 1U6AH 4UIKL 1MCOH 4PJGA 4KKCC 1W8OA 2MSPA 5T5NG 5C09E 3UDWA 1CFNA 2AJ3B 2VLRD 3RWCA 2KQMA 1V7MH 3I85A 4X7TB 4WU7A 3RX7A 4Q0XH 5K9JL 3R06B 2PW1A 3QNZB 3T65B 5DJYA 3N1GC 3OKKB 4RAVA 4M7ZC 3F7YA 3SE4A 5A16B 5D1XC 3S3PA 2ZCKH 4XVSH 2WV3A 4ZPTA 2QJDA 2Z8RA 2A38A 2FIRT 4U6HB 4XB7A 5ISZD 1SJVA 3HE6C 1O5DT 3EYSH 2OR8A 2J6EA 4K3DH 3WDIA 4OFYA 3HR5B 1BAFL 4PP1D 5KS9F 1A02N 3N9GH 5JUEL 4LLQA 3S35L 5DR5H 1I8KB 2D7MA 2QADD 5GGUB 2FNBA 2W1NA 5K9QG 2FJHB 2C3WA 4KJYB 1MF2L 4U0RC 5I8CB 5HVHB 4KK8C 3O3DB 4LLUB 4PJAA 5CSZA 2ZOKB 3NCYS 4IRSC 2V2WB 3SGKA 5IJKC 1VESA 4PRDA 3BX7C 2IANB 4GSDH 1GGIL 3ZL4H 4GRWF 5KG9B 1WTLA 4HIHA 1LO5A 3EOTL 4XZUA 4MJIB 1RVFL 1U8NA 3TO4C 3MCG1 4OZIF 1BX2B 1KSRA 4P5TD 4ALAH 4P3DB 4DOHE 1I1FA 1KJMB 4HLJA 4NYLB 4YK4B 5EFIB 5ANME 1P1ZB 2YPKA 3STLA 5L88L 2BVOB 5D8JL 1BVLB 5EU5A 4EBQH 1HWGB 1KTLA 3P30H 5ETUB 5C0BA 1N6QL 3O9WA 1UWXH 1C5BL 2YZ1A 2OZ4L 3VXMA 2Y07H 5TDNA 1NGPH 4FFYL 4MQTB 5JR1L 4MVBD 3LZFH 3TFKC 1FFOB 4LHJB 3RWJA 4Z7QF 3BP4A 3QIUB 1P9MA 5JNYA 3IJYA 4TSCH 4RX4D 5ALBL 1JNNH 5FOJA 1EMTH 2DF3A 3NFPB 3REWB 3VD5A 2J7LA 1ZEAH 3JTTB 5KSVB 1F6AA 1ES0B 2R2EA 1VFAA 1IGML 2YWZA 2GCYB 3MRNB 4YDIL 4OT1H 1MRFH 3C6LC 1EUTA 2NY6D 4UNTA 2QQLL 3TZVB 2FX9L 2BOBB 1KLGB 3O3EA 4C56E 1JI1A 1NBVH 5DRWA 1LQSR 2ZUXA 3C09C 3CCHA 4H1LH 3TT1L 5M94B 1R3JA 1QLFB 4C57C 4JFFB 3KPOA 5B38B 2FECI 3BPCB 5FYJL 1S8DB 5IFAH 3NAAL 1S7VA 1Y0LB 4HJGB 4XPFL 2IQ9H 3SDAC 1TXKA 2JLLA 4GW1A 4EI5B 5EO1B 3UPRA 4ZFFA 3LQAH 1QHOA 3IYLW 5DUPL 4N0FB 3SBWC 3CZFA 1F2QA 5ITFB 5CZVL 1G9NL 4P4KD 4P4KC 1LEKA 3VXSA 1TETL 2FATL 4XVTH 3B2VL 3WFDL 5DHXB 1U58B 4DZ8A 2P5EE 1NGWA 3WLBA 5FCUH 3QEQB 2NW2A 4AEHL 1NBYB 5DJDA 2APFA 1I3UA 4EDWL 1JMXA 4X0KB 3KPSB 3DMMA 2I9LA 3IDJA 2OS7A 4KDTC 3S9DB 1CDBA 3MODL 4OFVA 3OXRB 1GOFA 5BOZG 4MQSB 3OZ9H 1PLGL 4EI6A 3MNZB 5C9JA 3G5YB 4QHLA 4XHJC 4NKIH 1MFAL 5IROA 3K1DA 4OKVA 1R24B 4JR9L 1QYGL 4JPIA 3SKMA 1UXWB 2D3VA 3D39A 3HI1B 5JPMA 1HXMB 1S5HB 4O9HH 1DEDA 1XGRA 1J05B 1PAMA 2D31B 1TJHL 2HAZA 2X4PB 3C6LD 4R4NC 3VJ6B 3OBAA 3CMOL 8FABB 1VGEH 3BVNA 2V9TA 1F4XH 4PJAE 2UZXB 5DLMH 2W60B 5ENWB 1JZ5A 3LAFA 2J88H 4ZOBA 5BQ7B 5F88B 5KVMC 1E0OB 4PRPB 2HMIC 3DSFL 4PJIB 1UZ6E 3N85H 1IM3B 4BELD 1AJ7H 3Q6GH 1AGDA 5EC2B 2EXYD 4HC1A 3BH9A 3HUJE 1BFVL 3FRPA 3QFJB 3DMMC 5ISZB 3BISA 1QRNE 2Q7YA 2FH6A 3DURB 2OTWA 2VE6A 3MJGX 1CFTA 3TZVD 3BD5A 4R4FL 2HWZH 4P4KA 2RIKA 1K2DA 4ZO7A 5TDPA 1U8IB 3T65A 1F90L 4NWTH 2RGSA 3FAXA 2L7UA 5F9JA 5D96C 4PY8I 1KIPA 1S5IL 4QRUA 4WO4C 3MCKB 3IXTB 4TULH 3KPSE 3V4PH 2P8PB 2YEZA 2YHGA 3MZGB 4UOJA 5DJ0A 2NY6C 2JIXD 3TH4T 3WO4C 4LCCA 5FYKD 3FO2B 4K07A 3B83A 3H8NA 3X12A 4H8WC 4P2OB 3QJFA 1LE5A 4HEME 1FFNA 3TT1H 4YHML 4JRXD 2CKBH 1J1XH 4WTWA 3PJSA 4CJ1A 2M26A 3DI3B 5T1LD 4FHBD 5IB4B 3MRMA 3WXVL 1MCIA 5C0DA 5ESQB 1TTUA 3UTPE 2DB8A 4HIHB 4XZUB 2VN4A 2XWTB 4N0UB 1U8NB 3O8XA 2EDRA 4HWZB 1QR4A 1K6QL 2MCPL 2NXZB 3DGGB 3NH7L 3UAJD 5IFHH 4KZDL 3C87A 2DOCA 5BMFH 5DJ8A 3QUXB 5B4MC 2YD4A 4KGJA 3E8UH 1JNNL 1P4LB 4MAUH 3QHZH 4NJAH 4KJPC 4JY6B 4G8GD 2VLKB 2NTFA 3ZDZE 2FECL 4PG9A 1Q9LB 1YEGL 3O3UN 5GRYA 1OAZH 5JR1H 4BQ6A 4LEXL 2X4SB 3H3BC 2GY5A 1OCWH 1CD0A 1I1YA 2HTLC 4KRLB 3MLRH 3WUZA 4ZFZB 4UT9L 3RRQA 3U0TB 5DTFB 3R4DA 4HXAL 3EYOA 1FPTH 1LD9B 1MLBA 3G6DL 3B9KD 3NFPA 2OR7A 3QUYC 3WFEL 4Y5XC 3MRGA 2H2SD 2FJGB 4PJXA 5GPRA 3TH3T 3K46A 4N0YL 1OLZA 3H9HA 4NM8L 4UTBL 3U2SA 1X44A 5JO5A 3ES6A 4OZHF 3T0XA 1DJSA 2BNQE 3RWDB 1KG0B 1FNGA 1TCMA 3KPSD 5B39B 5D7LE 3PV7A 1HH9B 1HI6A 1DN0B 5ESVB 4JFHE 3QA3A 4RCAA 2X6MA 4HJGA 2BNRD 3VXNB 5J6GB 1ZAGA 4P5MA 1NUFA 6CGTA 3ABZA 3OGCA 2BRRH 4E42B 1UB5A 3HG1B 5EU6B 3MRKB 2PO6A 4U1MA 2BVUA 3ZLQC 5E8EA 2CLZA 3WLBB 4E0RB 2APWA 4NN7C 1N4XH 3MOAL 3GBML 1FGVH 2FX8H 3A0OA 4XMPH 1UM5L 3QPXL 3SJVD 1HYSC 3I75B 4R26H 5EU4B 4UT9H 4BSJA 1MCOL 4M3KB 4AYFA 3MNZA 2Q8AH 5MENB 3G5YA 4RFNC 3BZFA 3GO1H 4N9OB 4K2UL 4MCZA 2D4DA 4HGWA 4JVUA 5C08B 1AP2B 4LVNC 3UTSD 3D0VB 4JFOA 1UWXK 2DWDB 5TF1L 1AY1H 1I8LA 1IAOA 3BN9C 4ZUWB 4KAQH 4G5ZL 3GI8L 3S36H 4KQ4L 4MAUL 1INDH 1CR9L 4WI8A 3U4EA 5E2JA 1CL7H 2FHFA 4PB9L 3ARDA 5ELIA 3D69A 4YFLF 3QEGH 3AREB 3C2AH 4O2FA 2VMFA 4WW2A 5D6CA 1QBLH 1CVRA 2GI7A 3PWJA 3GSXA 5HVHC 4Y16A 1IM3A 1FL3B 3ALWA 5IHZA 1P7KA 4JJ5B 4W6YB 4P2OC 4A2LA 3QQ9C 5DEFA 4YDJB 1MH5B 1QLEL 1XF3A 3C09B 4JREB 1FG2A 1OTUC 1DEEA 2HKHL 1CS6A 1S7TA 3PGCA 2CDFB 3RVXD 4FQXC 3AROA 4TYUA 3KLDA 2E7CA 5I1AB 4JHWH 1PKOA 2WNGA 1MRDH 4TULL 1U9KA 1KCKA 3OKMA 4PJCB 4FRWA 1K5NA 4BJLA 3T0VA 2ADGA 5K59E 1KYOK 1EDQA 1Q9OB 1QP1A 3ARBD 3QRGH 2DS4A 1NFDE 5I8EA 5EOQL 3P0YH 5D2NE 2ILLA 1HIMH 3QHTC 2AK4B 4BSVB 1GPOH 3Q2CA 2D9CA 4YDVA 4YXKL 4ZXBC 2G75A 3TJEH 3SE8H 1J88A 4QHNB 1CG9A 4JRXA 3HHRB 4I18B 3S37X 2Z8VC 5IW1B 1T3FB 3QXAA 1MNUL 3V2AR 3X3GL 4GG6B 2R0KL 5F1NB 1JZ2A 5CJQL 5B22A 2Y72A 2CLVA 4O58L 3KXFB 4UV4L 1S78C 3O8XB 5EO0A 3LN5B 43CAB 4OZIE 1HHJB 3GSWA 4MD4B 5HYQA 4D9QE 1P4BL 2ERJC 1U2HA 2ATPB 5C3TA 4JRYB 4DTGH 5EBLA 2IPTH 1MWAB 1I9EA 5I1DA 4POZC 5ALCH 4YFLI 4EVNB 4OCWH 1AI1H 3FN0H 3WS6A 3REVA 4FABH 5D1ZA 2M8XA 3VWJC 5FGSA 3QWOB 1Q9LA 2G5RA 4M6MH 1U8OB 4F7EB 1LO2H 4OZFH 4LBEA 3KJ6H 4XPHL 2YR3A 5EOTA 3NFSH 4LAQL 3QUMA 5F3HB 5I18L 4P5KB 25C8L 4G9FE 4YJZL 4ISVA 4YX2H 5I66A 5GRUL 2JJWA 1YYLH 3P9MA 3RPIB 3ROLB 3FONA 4D2NA 4KK5C 4GAGH 4PGDB 1IEBA 1HHKB 2C3VA 1HHIA 1F45A 3AAZA 1RQ5A 2V5TA 3LQZB 4YO0A 3BD3A 4CGTA 4G9FD 1XR9A 4X6CF 1G9NH 4HUNB 5CJ8A 3G5VA 2NY3D 4H88L 5DJXA 5ITBH 3MREB 3FRUB 2QQKL 1DQML 5CHNA 5JO5B 1BQLL 4C54A 1H15A 4NSKA 5I6XC 1UCBL 4QXTB 2EE3A 4P3CL 3WNLA 3EOYG 1PYWB 4YUEH 4OZHB 1QSED 3MACL 4ZOEA 3GMPA 1VA9A 4EXPX 1RZGA 5K9QI 4Z78B 4Q9RL 1U3ZA 4JM2D 4LRNH 5JA8B 2BVQA 1I7TB 4MJ6B 4E42A 2IAMD 3RWEA 1VGKB 2NX5D 1LK3H 2ADIA 3MRKA 2X7LA 1AXTH 4OB5L 3WFHB 1X5JA 3WKNA 1BM3L 2J4WH 5ADOL 5E4EC 3VWJD 1DQTA 1U36A 1AQKH 1SYSB 3B5TA 1MY7A 4XP1H 1SM3H 2ZKHL 4LDEB 5E99L 3U0WL 3DUHA 5JXED 1EMTL 1I7UB 3D3VD 2PYEA 2HG5A 2V7HA 2QL1A 5D6DC 5EH1A 4F57L 5F9WB 1BLNB 4ZTOH 4HGWB 4LMQE 3DOSA 2WBKA 5HYFA 1NMCB 3DHJA 2X9WA 4JFOB 4WFGD 4WI4A 1D5IL 2CJUL 3WL9B 1MHEA 2ZG3A 5JDSA 3R8BB 1U8HB 2NXZD 3B9AA 4J3VA 4JAMA 3KPRA 4PP2A 3BIKB 4XNMB 4Q6IA 2Y06L 4H1LG 3ARFB 1NFDA 2NX5B 1IAMA 3PV6A 2AV7A 3GSUB 3OPZL 2NY0C 1T1YA 3EYUL 1XZ0A 3GSXB 4HPYH 3B2UC 4PD4K 4GSDL 1IQWH 4XMLL 5LCVL 2XYCA 4BQCA 5DK3A 4NZUL 4Y5VB 2VJXA 3RX5A 4I18C 3PABA 2YRZA 5IK3A 1FG2B 5HI4C 2P4AB 1T1WA 1LWRA 3LIZL 1A7NH 4KKNA 4OZGA 1SY6A 5L8LB 3QXTA 1BAFH 3AU1B 2Z4QB 4WUUD 5IW6A 4RA0C 1HINH 3DXAB 4WUUE 1RUKH 4PG2A 4U2YA 4RQQA 3GNMH 3P0GB 4JFDE 2XQYK 5BS0A 1AXSA 5SWSB 3QR2A 1JZ3A 1WLHA 5IF0B 5K9JH 3IVKA 1ITCA 3T3ME 1MIEH 5E6ZA 1C12A 3LKSB 1K4DB 2JIXA 5I75B 4WU5B 3U0PA 4XGZA 4DK3A 4HZLA 5C7XH 4L3EE 4PJHE 5E8PB 3U30B 4OGXL 1T7WA 4HUMB 4YZFF 1WGOA 1JRHH 3ARED 4L8SA 3PXHA 1NGQL 2YPLA 3AS1A 1D5ZB 3FQWB 4JO3L 4RISL 1FN4A 1BQHB 1F6LL 4OI7A 3U1SH 3RY4A 1ZS8B 2WBJA 3ALPA 3QQNA 2NMSA 3WUWB 1TJGL 3HR5A 3MO1A 1JPGA 5HYSG 2KKQA 3VRJB 2N7AA 5HY9B 1M4KA 1KT2B 1HSBB 3PDGA 3O0RH 5ERWA 5ECJE 1QR1A 3D3VE 1P53A 3QAZC 4U1KA 3ARFD 4M9OA 4BQ9A 2YUXA 1YC8A 5J89A 2FBOJ 3CFCH 2LQRA 2W0FA 1J0HA 3ESVF 3RY6A 1LO5B 4IHOB 1ZVHA 3TV3L 2FGWH 4L5FH 5AWNL 4PGDA 5D7SH 4FXGB 2IMMA 4Z7UB 4XP4L 1I1FB 3VGGA 4ZPVB 3O6ML 4HG4J 1RIUH 1KJMA 4L3ED 2E9JA 3SE9L 1NGYA 5D1QD 5D1QC 2OLDA 2X4UB 2H1PH 1BVLA 3MCLH 3UZVB 1JCKA 4NJ9L 3RWGB 4PPTA 3QULB 4MXQD 1UGNA 1NLBL 3VFGL 3CPLB 2J8HA 2DQDH 4MJ4A 3DTXB 5H37G 4PR5B 2V5RA 3QDGB 3PWNA 4PGJA 2PXYC 2DQEH 3T3MF 3SQBA 3TLRA 1JE6A 4Z7WA 1E6OH 1OGAB 3D2UD 4QRSA 1NGZB 3HTLX 5HJ3A 4HJ0D 4MQXC 4M8VA 8CGTA 1ZHKB 4XC3L 2FZ3B 1I3RB 2NXYB 4OLZH 4DGVH 1FNSL 2NZ9D 3MUGA 3O9WD 1QQDA 1UWEL 4GRLB 1MLCB 1Z5LA 2FRGP 4OTXL 3K2UL 4G42B 4LU5H 3NCEB 5EZOH 1JWSB 4IMKC 4M48L 3QG7H 2BNQB 1P2CA 1KBGH 3WFCH 3KHQA 3P0VH 1QHPA 2BZDA 1YMMB 4IOIA 4P4RB 1I75A 1FRGH 1XGYH 5DMYA 3ORJA 1CFQB 2CK0H 1SJHB 1G7PA 2BSTA 2AP2A 1A3LH 1VB9A 5JDSB 2G2RA 2R2CA 5FUOH 4Y8DC 4P2QA 5K59F 1A47A 5DUML 3L9RA 2YPLD 5JHLH 3ESUF 5FM5M 1M6OA 1V7NL 1UKSA 3L1OL 4O4YL 4YDKH 4OZIA 4HCRH 1T2QH 4HS6A 5E6YA 5B21A 4PGCA 5F3BA 1V05A 2ZSVA 5JDJA 3VE0B 4M5YH 4CN1A 3VFTB 1LEIA 3ZYOA 4HWBH 1PW3A 3QUKB 1HQRA 3VWJA 4NRZA 4BSWB 1H5BC 1P6FA 1WQVT 3KPMA 1HINL 1ZANL 5D7LB 5HHOD 1N8ZB 4I2XB 3ME0A 5IK3B 4G8GB 3QEHB 1UKQA 3DIFA 3QCTH 3FOMA 2CD0A 3PWLB 5HI5D 3BMVA 2WQ8A 1II4E 1Q72L 1MCLA 4XWOC 4JQIH 2EDQA 3C8DA 5F7MC 1A2YB 2ZOLA 15C8H 5ESAB 3WNPA 1U93B 3L5HA 3RVUD 5CMAB 5C0AB 1A3RH 1RZFH 3SQOH 2B0SL 1I1AB 3BIAX 4N8VB 3CZJA 3CH8A 4M6OL 3EYUH 2YD2A 4QRPE 3QBTB 3M17A 1MFDL 4OFKA 3ULVF 3K8KA 3NABL 1NAML 1SVZA 2AV1A 4LPCA 2AJXH 3VXUA 1TZIB 5I1EH 2P24B 4XCEB 2P7TB 1QBMH 1YMME 5GGRA 4HHAB 1KN4L 3SOBH 4EKXA 4PYGA 1IM9D 1RUPH 1UYWH 3VXRE 1UEYA 2Q87A 1ZVSA 3DX8A 3DECA 5TDPB 4GXUN 4JE4B 2E7LC 3O2DA</