5DJDA

Fc heterodimer design 5.1 t366v + y407f
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdA01
3TN0D 4LCCA 4U3XA 4HG4K 4FFWC 1N0XL 3D6GA 1MF2L 2GTWB 3N1PC 4CN4A 1P5VA 5JW3L 2NY0C 3KS0J 3UMTA 1G6RL 3JV0A 1CK0L 4WHYG 3PHQA 2O93L 3MOBH 4YHZH 3KYOB 1KUMA 5DWUL 3CK0L 4MNQA 1X7QA 3SDCA 4ZUVB 5JIKA 1AKJB 5F8QC 3ECBA 5IBUB 3DGCR 4FQHB 3NN8B 3O81A 2BC4A 1DN2A 1YY8B 2XZCL 3FFCA 3REWB 3O3DA 4HJJH 2DTSA 3C08H 2IH1A 1DBJL 2OX5A 1T5XA 4MD5B 5C6WH 2AJYH 4LRNH 4WHCA 4R2GC 4HUXA 4Y4KC 4YXLH 3G6JF 2AI0H 3QIWC 2IBZX 4JY6A 4Q6YA 4WEUD 8CGTA 2OJZH 3FMGL 4Y16C 3QJHA 2H2PC 4PRPA 4WDIB 5HGHA 1JWSA 3GJFA 1JYVA 4ZTPH 4I0PB 5DURD 2BVEA 1TVHB 1UZ8A 5K9KA 5T1KA 4FXKA 3I50H 2RBLA 2WINA 4EOWH 3RRQA 5AD0A 2Z91A 1BQLL 1RHHA 5CZXC 5HHME 4OD2A 1DVFD 3DUSB 1JGEA 4MNQE 5E8EA 4V2BA 4WV1A 1A1MB 1ZLSH 5KAQF 5HYSA 5I73C 3OAYH 4KI5F 2IQ9L 3EDEA 2GKIA 5J89A 1B0RB 2HKFL 3FFCE 4LVHC 4PV9A 5DTFB 4ZUWB 4YAQA 2H26B 3G5YA 5C6PB 2R1XA 5IV2B 2LU7A 3GHBL 3EIFA 5FGCE 1BBDL 3U9UB 4JJ5B 3WDHA 4HF5L 2JK5A 4HWEL 2FHFA 3SGDI 1S5IH 3BT2L 2NY0B 3EYVB 1N5AA 1XF3A 5L9DH 1WUNT 2O5XL 3MRFA 4PRPE 3QIBD 3KYNA 3S35X 5MI0C 4QYOB 4AIZB 3QRGL 1HCFX 1JNNH 3VXOA 1NGWB 1BFOA 2RIKA 3PV7A 3L3IA 4EI5D 3VFVB 2AK1L 4RGMC 3IKCB 3LVEA 4C56D 2OL3L 4YBQC 2X4PA 1QFOA 2DYPD 4JFQA 2JIXD 3HRPA 4M1CC 2QSCL 4RZCB 4HS6B 1T7VA 1OAQL 1MIEL 2YSSA 2DICA 4HKBB 3SQOL 1Q1JH 4XNUH 1X3DA 1ETZB 4ZUSB 4G7VH 4ODHL 2J8HA 1BGXH 4R2GB 5D1QC 4JFHD 5EORH 4FFVC 2RJMA 4TUOA 4Y16B 5ID0B 4Y2DC 5IF0B 43C9B 2AABL 3OKDA 1K5NB 1A9EB 3W2DL 2QADD 1D9KC 5F7NC 3HRZB 5B3JE 1QSEA 5DC4B 5E2WH 2PR4H 5TH2B 4WI7A 2DMCA 5A2IH 4I0CC 2Q6WB 1OVZA 3PWUA 4YHOL 4OCYH 5L8KB 4APQB 3U48A 1MREL 4Z6AT 5IW6A 5D93C 3V7AE 4JRXA 3MLTA 2B39A 1YEDB 3FQNB 1XGQA 3GK8L 4N8CL 3KJ6L 5IM7B 3RX7A 1K2DA 3MREA 5K93A 5I1HH 1Q94A 5EIVA 5ICZB 4LCYA 2B2XL 1QBBA 5I73B 1RZIB 4PRAB 3VXSD 2XTJC 2UZIL 2HVJB 4QHNB 3S96A 1MHHA 3KGRA 1EEUA 3OZ9L 1G9EA 5HHNA 1A6VH 4I18C 2VC2L 3E6FA 1XGUA 5JW4Q 1DR9A 2VAJA 4O51A 4HFWB 2MSPA 3WNPA 1HIML 3ROOA 4NHUA 5KSBF 1ZKAA 4LSQH 4JN1H 1RUAH 1WITA 1WBYB 3BSZH 5E70A 4PRIB 1A0QH 2CSPA 4LLMB 4ZS6D 4JFPA 1JPST 3UJTL 3ARPA 2R56L 4W6WB 3JWOH 3ZT6A 4OJFH 5E0QA 1QSEE 4PG2A 2DMBA 1V3MA 4ZFZA 1FCGA 4RGMB 4FQ2H 2Q8BH 1U36A 4X6DB 2FIKB 4JRXE 4WO4B 4GOSA 4JPVL 1HI6A 1DQLH 2ATPA 1QRKA 4LCWA 1QQDB 1F90L 3PJSB 5GGVY 3HCVB 4GAYB 5ABDE 1NC2B 1JF5A 1XF2B 3D18B 4L4TA 4U1SB 4LPUA 3CLEH 2CRYA 3RZWA 4ZYKA 3PV6B 1F02I 1MI5D 1X5HA 1DANU 2I07B 4Y2DB 5JLZB 3HFML 4ERSL 4IRSD 5HXMA 1PKOA 1IQDB 1FLRH 2IBBA 4Q9BA 4EI6B 2OXHA 2VKXA 4XP9L 2EH7L 2P8MB 3CZJA 4WFFE 4RFOH 2X4NB 5I8KL 2VWEE 4G8FB 2QV2A 1FZMA 2YZ8A 1EEYB 2ZUSA 1RZKH 3QEUA 4PJIB 2B1AH 5AAWA 1HE7A 4HUVA 5FK9A 2BVYA 4CGTA 4XAWL 5BVPL 3MJ7B 3U4EA 5IB4B 2X70A 3N1GC 4FQXA 4GRWB 1Q8MA 3KPTA 5F9JA 1JNLH 3B2UD 5E24E 4NM8L 4I18B 4LCWE 4XPHH 3AAZB 1PG7H 1YC7A 1UENA 5T1LB 3LEVL 4PGDA 3IXTB 4L4TE 2BVTA 1IM3B 3QFDB 1YEFH 1T1YB 4JFED 5C9KA 4NBZB 3LCYA 5E9DB 1U95A 4JG0H 4OD3L 4LOUC 4D0CB 1HSBB 3DX7B 1YZZA 2QQNL 1S8DA 3QUZC 4OZ4B 1BF2A 4BSJA 2X9YA 1XZ0A 1NBYB 5LAXB 2G5RA 4Y4FC 4NQVA 2VZSA 5ISZB 2ZG1A 4HGKC 5I1GH 1T66C 4PD4K 1GGYA 1IILE 2DIJA 2H1PH 1RUMH 5I17B 1K6QL 2A0LC 3ZL4H 5J6HA 4POZC 1H0DA 4KRLB 3S9DB 2IFFH 1A7OL 1MJ8L 1A2YB 1T1ZA 1VFAB 2OL3A 3FQWB 1INDL 2FIRT 3EYFB 4YJZL 5DR5H 1CR9L 3BN9D 1A64A 4KJQC 1SMAA 4RAVB 4UV4H 3NGBC 4D3CL 4D0DA 4RSVA 2DDQL 3L9RA 1NGQH 1QSFA 2H3NA 1XGPB 1BMGA 1I7UB 1IKNC 4IOFD 4WW1B 3U82B 3G04A 2VH5H 5C0JB 3VRIA 1GVIA 4MJID 4XP4L 2CUIA 5FKAB 2DLTA 3MRNA 4P48A 3RWFA 4LSDA 2VDQH 4NQSB 4NQXB 5EDXA 3U4BL 4P57B 3Q6FA 4NSKA 1B0WA 2FJFA 2QR0B 1IGIL 1OW0A 1T2QH 4HLZH 2AEQH 2HWZL 3VFUB 1CFTA 3CDCA 3UZQA 4NOBA 4M00A 4R4FL 3L3GB 1HKLH 3OKOA 1J0ZA 7FABL 2X4RA 2CJUH 2P8PB 2YUVA 5JXAL 5GRXG 4HAFA 5EU4A 1WFOA 1EEZB 5E00B 1XGRA 1M7IB 3L5JA 2GIYA 1A3RH 1KEML 4XXCC 8FABA 1FZOB 3BGFB 2YPLA 5JPNA 5A2KH 1MCJA 4UZGA 1RZJL 1EFXB 1TTGA 2BVPB 1QSFE 3RGHA 2CKNA 1PZ5B 5JDSA 1Q9OA 4LP5A 4GXVH 1LD9A 4JFXB 3QIUA 4XPFH 3G6DH 2Y25A 4BUGA 3PWPD 4XNXH 5D2NB 4Y4FB 1NUDA 5SWSA 3GSWB 3RPIA 1AXIB 3P77A 1AO7A 4GXUM 4G7YH 1MH5A 5E94A 5ESVA 3TN0C 1JHLL 2BX5A 1BECA 4QNPF 4OZHA 4PJDA 1ZVSB 1D6VH 2DQFA 1D5MB 1H3GA 3G5XA 3KDMB 1MCSA 1Y18A 1MHPH 1RIHL 5FCUL 1WC7B 5J0BA 2BY1A 4AEIL 4JDVA 1J0HA 1YUHA 4C4KT 4G6ML 3ZYIA 1KULA 1VADB 1A6TA 4XZUB 1KC5L 5DJDA 3NH7H 2QHLA 4FP8L 1RK1B 1CD8A 3ZKMD 3QUYA 1Z2KA 5GS1A 3W11C 3Q3GA 3FHQA 3LV3A 2J88L 1AD9A 3BGMA 1B0GA 1DQTA 4MWFB 2YPLE 4YZFF 2EIZB 1XR8B 1PG7W 4LLWB 5IB1B 3O8XC 3MRPA 4UB0L 5GSVB 2W0FB 5FGRA 1G7HB 1A6ZA 4NWTH 1SEQL 4LSTH 2V6HA 4M9PA 1MCWW 3PWVA 5DXWA 5D2LB 5BW7A 4YDIH 3OJDB 4NKMA 4NCC1 5SWSE 1KCLA 3BW9A 4DUVA 2DLEA 3P3YA 1JN6B 1LDPL 3ESUF 2YPKB 2I25N 1AO7E 2F5BH 3DUUA 3CFCL 4P5TB 1A9BB 2DLGA 4W6XB 1N0LA 4NRZA 3QP3A 4OZHE 4HFUH 4PJDE 5ELIA 5EWIL 3AC0A 1Y6MR 4G8GD 2G9HA 2ENYA 5CCKH 4NUGL 5DUBA 5IW1A 1G7PB 1KLFA 3A6CL 4LLQB 2E9JA 4X9IA 1DVFC 3X17A 3OKLA 3IFLL 3IRPX 4XNMB 2F8XC 1WWAX 4Z7VF 2UYLB 4X9BA 1I3RA 1YYML 1L7IH 4WW2A 4F57H 4GXUN 3D87B 5A40E 5I30L 3C8DA 4J8RB 4U6XA 4DKFH 5HGAA 1UB6B 5L2KB 3LKNA 1RIUH 4ZUTB 4JVWA 4GT7A 1VFUA 2AKRB 3DGGA 3GSQA 4ZS7H 2JCCA 3T0EB 3TN0B 5DUPL 5KVEL 3ALXA 4ODXB 1NKRA 1VSCA 4JPIA 5H2BB 3SJVB 5KOVC 3ARUA 2DMKA 3BDYL 4K55A 1M71B 4KY1L 4U0QB 1M7DA 2NNAB 3QIBC 5AUMA 3S3PA 4EDXA 1T1WA 3T3ME 4Z5RB 5BVJB 4AJ0A 3LEXB 2H6PA 5EULV 5GS0D 1IT9L 1Z9SA 3JVGA 1Q9KA 4EI5C 1F45A 3RZCA 1F97A 3X3GL 4JDTH 4PLNC 1BX2B 3V6ZA 3O8XB 1KPRA 1MF2H 5JW3H 2DI9A 3RBSA 5HYJA 3FCTB 1F6LL 2Z31A 4GAGL 2XWBB 4G8EB 2E27L 4OKVA 4M7JL 2XN9B 1HQRB 4M8QB 4X6FB 5DWUH 3WHXA 4LAJH 1JV5B 2Z93A 3LB6C 4U0RB 4OUUA 5FECB 3CFDB 1QHPA 5CEZD 2ARJB 2EDYA 2O5YL 3D39B 3PGDA 3ARDC 3F7YA 3UTPD 5JIIA 2XZCH 2QADC 4OLUL 2OR8A 4BQ6A 2ZSVB 2JCCE 3WUZA 1A47A 3BESR 2AJZA 3P4NA 5BRZD 3ROLA 4NKIL 3RWDA 4QHLB 1DBJH 4M3KB 4PJHB 3TVMD 2JKXA 1TZIA 2W0KA 4XNZC 2R4SH 1G84A 3MUHL 3B3IB 1HINH 5I74C 1I4FB 2FECI 3KR3H 1J11A 4Q6IC 5J56B 2F53D 4NFBA 3UDWC 3RDTA 4XAKD 1RY7B 4AM0A 3DIFB 2VISB 3DXAD 4WFED 4NQEB 5DZOA 5E8PA 1FC2D 2AEPH 4YWGL 1OGAB 3ZKXC 4D9QD 3RKPA 3N1FC 1REIA 4I3SH 5HYJE 5EOTA 1KJ3L 1I7TA 5DJYA 1FO0L 2EYSA 3ARQA 1BQLH 5IMOA 2JB6B 5DS8B 3JWOC 4XPBL 5DYOA 3BUTA 4NT6B 1X5XA 5FUZL 2DM4A 3GGWA 3HNSL 1A6WL 1MCFA 2VUOA 2IF7A 3V7MA 1BIIB 1KJVA 1SJHB 4C57C 4ZS6C 3QIBB 2NX5B 3OR7A 3DVIA 4LK4A 2VLRA 2Y7QA 4OZIF 4X4YB 4C59B 4R90H 25C8H 1YEKL 4GQPH 4EI5B 4JG1H 4E0RB 2IMMA 1QYGH 3T0DA 4P4RA 1BBDH 4HF5H 1JGDA 2DYPB 3K46A 1E6OH 1FYTA 3BT2H 5F88A 5F96L 5DC0A 1WCBA 1FL3B 2O5XH 2P5WA 1DSFL 5JHDA 1UYWH 3QRGH 3L5HA 5DHXB 1X5IA 3KPOA 5I8CB 3QXAA 4F58L 2E7BA 3ULUL 2AK1H 3ARDB 3FT2A 5H94A 1VEOA 4RFEA 5DVKA 3ULUF 1BVLB 3EYSL 3WIIL 4FMFA 3SQOH 3AS2A 4XNZB 1LEGA 2ZUTA 3VD7A 3MXVH 5I74B 4Q6IB 5CBEB 2AV7A 1LP9B 3O45A 3W2DH 2DJSA 3N85L 3MRKB 3S4SB 1OPGH 3IFPB 1KYOK 2BOBB 5KVFL 2A6JA 5CIPA 4OCRL 3DVGA 1R3HB 2J8OA 2DAVA 2WIIB 4JRYD 5JIHA 5I2IB 3HC3L 1FYTE 4GW5B 1LMKA 3VFTB 2XTLA 3B2UC 5D7JD 5CHNA 2C4FU 1XCQB 4PBVC 2P5WE 5JHDE 3AM8C 3KJ6H 1TDQA 3WHE1 3O9WB 4NO5B 2D2OA 3VDAA 1XCTA 5DEGA 5DI8B 1MWAL 5D1ZB 5I66A 4PJAA 1Z9LA 2B2XH 4NZJA 3N1QC 5EUOF 2P5EA 2DD8L 1PSKL 1W0WA 5ALCL 1I9IH 4PRHD 1VHPA 3UPRA 1FSKC 4BFIA 3OKKB 3U46A 5D70L 3BPNC 2HJLB 4GG8A 3ZE0F 1AQKH 3CUPB 3GMPB 5T5FL 2VC2H 2WV3A 5GGSY 3V0AC 4QEGA 1AP2A 1A3LH 3L6FB 1HWHB 5HI4D 3QNZB 2R56H 2KQNA 4LSUH 4X6BB 5MHSE 3FONA 5KG9B 2YBRA 1QBAA 2NXZB 3BN9C 4BZYA 4TUKL 2XG4A 2AXFB 3HZVA 3BD3A 4PJXA 5KSUB 1IC5L 4ODTH 1MFNA 1B4RA 3C60A 4OZGF 1ND0B 3VMOA 2D31B 3QXTA 3SQBA 5ETUB 4PJAE 5JUEL 1F90H 2A6IB 1VGKB 4DK3A 3ZYZA 4JANA 1X4YA 2PN5A 4KHXL 3Q6GL 2P5EE 1OWRM 3A67L 5IBTL 4MCZA 3WYRA 2BHUA 2YA1A 4HGWB 4OB5L 1WBXB 5DD3L 1I8MB 3HFMH 2VZUA 1OQXA 4U1MB 5GRUL 4ERSH 5AYQA 1QR4A 4X8XA 1F8TH 3KVQA 4LU5L 2B4CL 1PX4A 2AJSL 2ZOLA 1NSNH 4XP9H 5EU5A 4GG6A 3CXHJ 4HIIA 2EH7H 2E6QA 3T4AB 1EJOH 4LEXH 4S0SD 5I8KH 5IJKC 4HV8B 2WANA 4BK5A 1NMBL 4O4YH 1J8KA 4R4BB 4ZFOB 3SE9L 5EFIB 2VDPL 4I9WD 5IMMB 3C8HA 1HILA 4M62H 4XAWH 5BVPH 4FQCL 3QDJA 1KN2L 1A5FL 2LU3A 4PJXE 1FSKB 3I3BA 4UQ2A 4JO4L 1FO0A 1EBPA 2HG5B 3BPNB 1MCRA 4M48L 5CP3A 1IGYA 2ITCA 3IDMA 1KBGH 1FDLL 4NM8H 2KH2B 5IOPB 3N1MC 1ERNA 1CI5A 3BKML 3HA0A 4M7ZC 4IMKC 1X5YA 4H0GA 4LCCB 1SVCP 4KZDL 1LWRA 1SEBB 5ESQA 4ZUUA 3R1GH 4NHCL 4F7MB 2CDFA 2BY2A 4NRXA 1HHJA 1RMFL 3RQ3A 3PHQB 1UM5L 2ZJSL 2GK0A 4QWWD 4NQCD 3RWGA 2EXWC 2QQNH 2VIRA 4CMHC 3S5LG 5E08H 1TJGL 5EU7C 4GG6E 5LKNA 2EDDA 3QG6A 3ECBB 1GRWA 5C86A 2EYTA 3FB6A 3O6FA 1T7WA 1T20B 5CWSA 4ZFGH 5EOCJ 1FFOA 1NCTA 4FG6D 1J1OL 4XC1L 4HLJA 1K6QH 2A77L 2R1WB 1NCWH 4TULL 1ZLVK 2IH1B 1I75A 4RX4A 3T8XB 1GGBL 1MJ8H 3QDJE 1DQML 3DETD 1VPOL 1INDH 5TGBB 5FGCB 2ZUYA 3GNML 5DZLA 3T2OA 1CR9H 4CU7A 1T04A 3DHJA 4D3CH 1MCCA 1QFWM 3BKJH 4RBPK 1RULL 5GJTL 1D5BA 2VR4A 3QJHB 4LIQH 2IAND 2VXTH 4HWNA 4H20L 4OF6A 4XRCA 4Z7QE 1N26A 4LGRB 2VXVL 5D7LD 1RQ5A 1UZ8B 4HZLA 4XNQB 5K9KB 2HLAB 5T1KB 3OR6B 4GRLD 4FXKB 5IVXB 3S34H 3U83A 2WINB 4NKDA 3BDXA 3U4BH 4YHYB 5AD0B 3IXAA 5FUCC 2Z91B 3MTRA 1RHHB 2PXYD 4OBSA 5SWZA 4OD2B 3RVVD 1ZLUK 1IGIH 1JGEB 4OQ1A 3SBWA 1UKQA 2CLRA 2BHYA 3AU1A 3OG4B 3FL7A 4Z7WA 4WV1B 4FTVA 5HYSB 3BP4B 2R0ZL 2IBZY 3QNXA 5EC1A 4R4FH 2QL1A 3Q5TA 4RBPH 4RAHA 3VWKD 1MWAA 4LSSL 4UU9A 5JXAH 4PV9B 2WUBL 5LGKA 4X7EC 2LVEA 5E8DH 1P4IL 1F2QA 4R3SA 3G5YB 4YAQB 3ARFA 1G9NH 2YXFA 3DO7A 1KEMH 1RD6A 4P46A 4U2ZA 5IKCA 1HK6A 1XGYH 5D9SA 2OR7A 1N5AB 1XF3B 2A9ML 1RU9L 4I48A 5M94B 4G8IA 3KYNB 4JFYB 3ZT7A 4FFZH 4JM2A 2BHZA 3VXOB 4M7LT 1UQSB 1BFOB 3WSQH 3WFCH 5FYLH 4E5XA 4BQ9A 3V9FA 5HPMA 2Q7NA 3ZDXF 1VERA 3X14B 5C08A 3IB4A 5F1IB 4JFQB 5GS0C 4J3WA 4DAGL 5SWZE 1B90A 2PUQT 1DUYA 1JHLH 2YSSB 5K59E 4Z7WE 2M1KA 4FTVE 4PTUA 3K4ZA 2V5TA 4KI1A 4HG4J 5E2UL 1JYWA 1FVEA 1QEWA 4PPTA 2NY3C 3OKMB 4TUOB 4Y5XA 2HFGL 3PWJB 2DLFH 2B1HL 4PJ7A 4FP8H 5HGDA 1EXUA 5F9OH 4PGZA 2APTA 2ADFL 2GTZB 2HTLC 2WM0A 1EAPA 2AJVL 1QSEB 2J88H 3OB0K 3P4MA 3IFOB 4FQJL 3TNNA 4LHUD 3P9MB 5IHLB 3PWUB 2PETA 3MMEA 1NEUA 4MB5A 4DCQA 5IW6B 1WV7T 4KHTH 3W82A 5C0GB 2HJKA 4JRXB 1GIGL 3MLTB 4IBLT 1SEQH 1A6UH 4K94C 4WFHE 5C2BH 1GZPA 3TVMC 4WWKA 1I8KA 3MREB 1Q9WA 4G8GB 1OP9A 4NNYA 4AENB 5EN2B 4DZBA 3GSVB 4JHAH 5TJWK 1U58B 1LDPH 1F4WL 3S96B 1RV6X 1MHHB 5FYJL 5C08E 1BBJA 4N5ED 2H8PA 4LCIL 4J3TA 5HHNB 1TQBC 1DTUA 4YX2L 4L4VD 1FFRA 1EEQA 2LVCA 3VW3L 3E6FB 3PQYA 4L29B 2XG5A 5EWIH 1MCWM 1BJ1J 1XGUB 3F6LA 4JO1H 2R1YA 1DANT 4F7PB 1IAKA 4O51B 2FX8L 2HTKC 1DBML 4Y2OA 1JCKA 3ROOB 2CDGB 5CIPH 4NHUB 4NUGH 1NC4A 2IAMA 4R96B 1KCRL 3VXRB 3V6OA 5D96C 4PJ7E 4P5KA 3RWCA 3TBTA 4I4WB 5I30H 1J9CT 4MQXC 4EBQH 3EKCA 1CGUA 3L5IA 2C3VA 4X6CF 4ZFZB 4QTHA 3GM0A 1MAJA 4YHKH 3QUKB 3MA9L 2HT4D 1HI6B 3QXDA 2XYCA 2ATPB 1DUZA 2VXQH 5KVEH 2NY1C 4XMKL 4UUJA 2J12B 3LKRA 5C0AD 4ZXBD 4KY1H 3IF1A 4L4TB 3ARRA 2F8OA 2NY3B 1CDYA 4XC3L 3W0WD 3EDKA 4KAQH 1SBSH 3LEYH 3AS0A 3BD5A 4R97C 1TZGH 4DOHE 3UTZA 3VU2A 3PQYE 1IT9H 3QEGH 1KXQE 3NMEA 4OFPA 2Z92A 4D8PB 3X3GH 4JHZA 3GI8H 3MOAH 1FL5B 3LQMA 5L6YH 1WFUA 4KTYA 5IQ9A 3NZ8B 4PRBB 3V6OE 2Z35A 3OPZH 1FZMB 2E27H 1RZ8A 4TYUA 3ILQD 4P23D 2EKSA 3VA6A 4HHAA 5MEPB 4HUVB 5FK9B 3UYPA 3WFHA 2WWMD 3MZGB 4QHUA 4JZNB 2FRGP 3RNQA 3VH8A 3FHAA 1EH9A 2O5YH 3U4EB 1EA9C 4ZQKA 4XI5C 3QQ3A 1NUGA 4OLUH 3A6BL 3T0AA 4FQXB 2YUZA 3TWCL 5JIPA 1R6VA 1TQBB 4JKPL 3WNMA 3NACH 2XPGA 3I9GL 3MRMA 4PGDB 2HA1A 4TVPD 1ACYL 4UNVA 4YLQT 5D5MA 3FQUA 5HYEA 1SM3H 5D96B 1CXFA 3PHOA 2EDEA 2P8LA 1IM9B 4E41D 5LGHH 4KQ3H 1U95B 4KRPD 4F37F 5BS0A 2E7LC 3SKOA 4ISVA 2YRLA 4PLJC 5GRVK 4ONFL 5DRNA 1XZ0B 4YWGH 3LN9A 5FYKD 2VABA 1BAFL 1SJEB 3HZYB 5LCVH 1IBGH 4JN2A 1UZ6E 1WZKA 3IGAB 3MRRA 3IS1X 4NC1E 5HY9A 2NY1B 2BMKA 1RZ7L 2DQUL 1JZ8A 3BPCA 2GJ6B 4H8WL 3HNSH 1A6WH 5B8CA 3D25A 2ZCLL 5HI4C 3U0TB 4PS4L 4QXWA 3IRZA 1JGVL 4D0DB 4R97B 5DK2A 1N4XL 1QLRB 4YE4L 5DEZA 4YHNB 1NANH 5MENB 5EZLA 1MLCB 3DV4A 1YEKH 3G04B 2A73B 2GT9B 4Y5VC 4M5ZL 3KXFB 3VFNA 3VRIB 5CSBA 1GC1L 2BSRB 4J1UA 1SYSA 5D5ME 3RWFB 1JL8A 5A2LH 3SCMD 2DOCA 5F96H 2FZ3A 1DSFH 1NMAL 2Y07H 2ICWB 4PP1D 3Q6FB 2PYED 5CGMA 2VKWA 3SE8L 1CDBA 1YC8A 5BS0E 3DMMA 3MPCA 2FJFB 2NY4D 3IDNA 1JPTL 3ARED 1CXEA 3CDFA 2BNUA 3D3VA 1JYNA 4OFKA 4HPYH 3EYSH 2IH3B 3OKOB 5J9PA 5HDBE 2X4RB 3JTSA 4KH2A 4O2CA 2HFEA 4XBPB 4L3ED 4NCC2 2W9EL 3HC4H 4B53A 1E28B 3LPWA 4BH8A 1R0AL 5FOBB 1IVLA 3X12A 1TETL 1QRNA 2YPLB 4U1JA 4LL9A 3RWEA 5JPNB 1BD2B 5F7WC 1NCDH 2PW1B 4F7EB 1YNKL 3L3JA 5JDSB 1UFUA 3NIDF 5I18L 2RAMA 2EDBA 1Z9OA 1LD9B 2X4OA 3QCUL 4OCRH 4JFFA 2C5DC 3DOSA 3HC3H 4XP1L 3RPIB 3O3EA 4EIGB 1JPGB 4WVRA 3GIZL 1AO7B 3HHRB 3V5HB 4ENED 1MWAH 1ZHKA 4JKLA 5E94B 5ESVB 1OF2A 35C8L 4CKVX 5GJSL 5DJXB 2R4RL 1E4JA 4PJDB 2DQFB 3G5XB 3ZDZE 3NBNA 5ALCH 1BWWA 3D3VE 1RUPL 1XFPA 1YUHB 1MCBA 4WTWA 3QQ9C 1JRHI 1A6TB 1KCSL 4ELKA 2GY7B 3IDXH 5T5FH 5CZKA 1Z5LA 2FR4A 1MFCL 1Z6JT 3BUYB 4Y5VB 1P7QB 4YDLC 5AZ2H 3Q3GB 4JQXA 4MXWL 4IDJL 1L7TL 1S9XA 2AK4D 1JZ4A 1AD9B 2ED8A 4Z7OE 5FYJE 1QRNE 3HG1D 2HFFB 3VWJC 2V2XB 3MRPB 4P2YA 4QXUL 1MCPL 3GRWH 3SDDA 1T03L 1A6ZB 2GSIB 5DRZA 4PG9A 4OFYD 4LEOB 3RUGB 4YDJA 1YN7B 1YQVL 3DETC 3PWVB 3LSOB 3UBXB 4JFFE 1OD9A 1Z3GH 4DWHA 4EXKA 1EHLH 3DWTA 5HHXL 1F5WA 1R24B 1C5BL 5EU6B 1YECL 2DQHH 3HR5A 3SGKA 3DUUB 3PIQB 1OTSD 5FM8A 4NRZB 3VFWA 3VI4F 1ZT1A 3HI6L 4GRLC 4IRJD 5C0CB 5KJRL 3Q6GH 4LARL 1MFBL 3MYJA 4HWUA 4POYA 4MMZC 1QVOA 1HYSD 4M1GL 5E6IA 2G9HB 4K71B 4PJBF 1JPFB 5IW1B 1IARB 5DD3H 2PXYC 3QQ4A 5GRUH 5K9QG 4Q2ZA 1CL7I 5DJAA 1JTTA 1G9NC 4WW2B 3C8KB 4LU5H 3WL9A 2AJSH 4YHIA 1J5OL 3GMQA 4G6AC 5HGAB 5HHMD 1INQA 5KZCB 5L8LB 3P11L 3UYRL 4MNQD 1IEAB 3HAEH 5EIIA 2NTFA 3SDCD 4E9LA 2PO6A 5D1XA 5F1SA 4RMUA 3DGGB 3F7QA 5D6DC 2JCCB 2VDPH 5MEQA 1T83C 2VDLH 4HUKB 4F9LA 4Q97A 3H7BA 1A4KB 5I1DB 4WU5A 4JPIB 4NGHL 5I6XC 4FQCH 1EGJL 3AMLA 1BP3B 3GB7B 3CX5K 1M7DB 1S3KL 4MLSA 4M48H 1G7MA 4NQCB 4QTIL 1TVDA 2VN4A 5AUMB 1FDLH 2XZAH 3LDBB 4HIJA 4YDLB 4D9RE 4ELMA 3QDMA 3UC0L 5F71A 1JJUA 4PRPD 3VWJB 4GKNA 3EGSA 3V6ZB 1CU4H 4KZDH 1KPRB 2VO5A 3L5XL 3QNYA 4NHCH 1S7QA 3UJJH 4CADA 5HYJB 4TPRL 2DWDB 1T7ZA 2XRAL 2Z31B 4K9EL 4LFHD 4XMPL 4WI8A 4QT5A 5I8OH 3WHXB 5ERWA 4LHUG 1FVCA 1UH2A 4OUUB 3LQAC 1IC1A 4TQEL 3MO1A 3PP4L 1FE8H 1WQVT 5DHYA 3F7YB 1B2WL 1OY3B 1DEEA 3CC5A 1AGBA 3QCTL 3E2HB 1J1OH 1E4XH 1JK8B 4XC1H 3SEPA 1VA9A 3IAPA 4P49A 4U6TA 4WGVB 5GRJL 2NZ9D 1I9JH 1KT2B 3P4NB 3ROLB 1QR1B 4DGYL 5TQ0L 3OKYA 1YY9D 2IG2L 1VPOH 1CLZL 2DJ4A 3GNMH 1ZHBB 4PY8J 1VKXA 1DQDH 1AY1L 2X4TA 5IEKB 3H9ZA 1O7VA 3L95B 4L8SC 3LN5A 5SWQA 3LRGA 5L88H 4R7DA 3RDTB 4ELME 2X9WA 3QDME 4YPJA 4PY8I 4AM0B 1XIWC 2X1PA 1TZHB 2DTML 1MJ7L 3QISA 5E8PB 4YC2C 4N5EC 1S7TA 1JNHB 4PLKD 3QFJD 3TA3D 3IDGA 5EOTB 2ZCKL 2D7QA 5DJYB 4EEEA 3PUCA 5KOMC 3H9SA 5DQ9A 5I6XB 1YNTA 2FGWL 4P2RD 3V8OA 2A6KA 2YEZB 3CSPA 1HH6A 4JY5H 4EJ1C 1DP0A 4PJFA 1KJVB 3EYOA 5F3HA 3ULVL 1C08A 1AE6L 3OR7B 4MX7B 5B38G 2VLRB 2Y7QB 1MHEB 2X10A 4LSSH 4RFNC 3SY0B 5I1AB 4TTGA 2WUBH 5F7MC 3UTSD 1YYLH 1P4IH 3F7RA 3SPVA 3BYTA 1FPTH 2PCPA 5HHOA 2FSEB 4Y1AA 4J4PA 4KMLB 2VN7A 1RPQA 5DK0A 2Q87A 1U8PB 2HT4C 4LNVA 1FYTB 4LLDB 2A9MH 4X4ZA 1INEL 3JTTB 2EDOA 1UADC 1UT9A 3IDYC 1RU9H 5JHDB 3O6LH 3VCLA 2HT2D 2PW2A 2Q1EA 4N0UB 3ES6A 3KPOB 3QXAB 5JTWA 4BA8A 2IMNA 4U7SA 2EDFA 3LKPA 4I3RL 5L7XH 3FT2B 3QEQB 4L3AA 5H94B 2A9NL 2XIDA 4RFEB 3VXQA 1ZSDA 1FFPB 1AI1L 5C0IB 1Q0YL 5IB2B 4AMKH 3H9SE 4DAGH 3BZEB 4TRPL 2K7QA 3EYQC 4U6YB 2R2BA 5A16B 3C6LD 4PJFE 1HWGB 3MNWA 4MD0B 4HULB 3ILQC 2VZVA 4P23C 5E5UB 2HFGH 3EO1A 3K8LA 4L8SB 2AV7B 3VG9B 5BQ7A 3UCRA 3I3DA 1IGCL 2B1HH 2DQEH 2EH8H 1PLGH 4WFFD 2WWMC 1FNAA 2ADFH 1XIWB 1UWGL 3LHPL 1II4E 5E4EC 2AJVH 1CDCA 5C09B 5CIPB 5HHOE 2XWJA 3DVGB 4WTXA 4Y1AE 3WHE0 2X4QB 4JFDB 4QHMA 4CW1B 3WKML 2ZP0T 3LQZA 3QWQB 3RVTC 4Z7NF 1LK3H 1GIGH 3EOTH 1GZQA 4RQQA 1IEBA 2CGRH 5GGTL 5F97E 1XCTB 3LS5L 5DEGB 3BO8A 5I9QC 2B7DT 1U3ZA 3B5HA 4XBEL 4ORZC 4HH8A 3HPJB 3VXUA 1K8IB 2LAGB 2E6PA 5FOJA 2P5EB 1DQJB 1W0WB 5INCA 1A1OB 4LCWD 3UPRB 5GZOC 4BFIB 1F4WH 5FYJH 3U46B 4ZAKD 4OCLC 4KRPC 5I15L 1UM6L 1I85A 4GG8B 5EOQL 5JXEA 1I3GL 5IBLD 5KSVA 3VW3H 5JR1H 4PTTA 4WY7H 1TQCB 1DBMH 3WJJC 1I1YB 4B5EA 5DD5H 5J1AB 1KCRH 3BPLC 3IDYB 1A6AB 2AJ3A 4RIRA 4P4KA 4L9LC 1OTUD 4GQ9L 1R5WB 2JE8A 4RWYL 1P69B 4GBXD 1W72L 3D48R 2IEPA 1FZJA 1EUTA 3HS0A 2VDOL 3KPRD 3ALWA 1BPVA 3FONB 3P9WB 5BZDA 3UAJD 3HZVB 5KN5B 4S2SB 2Y6SC 5IHBA 1ITCA 2C3WA 1DBKL 2P47B 3C60B 1B6DA 2P7TA 2Z0BA 4Y7MA 1ZT4A 4G6KL 1JZ5A 3A0OA 2V5YA 1CDGA 3DX9A 5GS2H 1WFNA 3MLXH 4JANB 3VXUE 1F6FB 4ODSL 2V7NA 4N90D 1PVHA 4KI5D 4XC3H 1C16B 3KLSA 4MCZB 3SO5A 3C5SA 3LY6A 4GMSH 2NY4C 3AREC 5HHPA 3EOBB 4U1NA 1EJ6A 3BE1L 3S6CA 2NMSA 5EU5B 2ZOLB 4JREB 4GG6B 3T3PE 5C0ND 3O3UN 1BQSA 1JUFB 4YDVA 2EIDA 2BNQB 4W81A 3TBYB 1KIRA 4YQXL 1HILB 3KS0H 3LKOB 4F33B 1PKQB 3JV4A 3QUXD 1G7QA 4X6EA 2ESVA 1W0VA 1KPUB 5CUSL 1D5IL 3A6BH 1P84K 4FQ1L 2ITCB 3FAWA 3IDMB 4Z7UB 3HTLX 3MA7A 4KUZH 3LKQB 4JKMA 1K9TA 3FQTA 1QO3B 4AG4L 2CLZB 1J1PL 4F9PC 5IHUL 5I1EL 3HE7A 2GJZA 1QSFD 2BJMH 5I76A 1X44A 1LE5A 1FFNA 1M7XA 3V52L 4OCSL 3BPLB 2OSLA 4KV5F 3MGOB 1T1XA 4ZUUB 2CDFB 3RIFF 4X5XA 3SDXA 2H41A 3RFZC 2AEWA 3QHZL 3VGFA 1ZS8A 1HXYA 4GFTB 3QG6B 4MA8H 1G1YA 2L7JA 4Q7DA 2ADIA 2EYTB 3RY6C 4JE4B 1XF1A 4MDJB 5CWSB 2YMXL 4M6NH 1FFOB 5FA3B 1H9VA 4N9GB 4WJ5B 1WIPA 1RZ7H 3QA3A 4UT6L 4H88H 4UDTA 2ESVE 2R23A 1IL1A 5KVGL 5C92A 1S7XA 5B39G 4XBGA 1AGEA 1T5WA 2ZCLH 1T04B 4PS4H 4PGEA 4ESKA 1BFVL 1UEMA 2XY1A 1JGVH 3DSNA 2IPUK 1N4XH 2VITA 4DN3L 5F6IC 3UTTA 1NUNB 5IESL 3RWJA 1JHKL 5DJ8A 3GMLB 4XRCB 4M5ZH 4N8VA 3C5ZC 2UWEA 1KTDA 5AWNH 3NOIA 3ULVE 4UNUA 4FQQB 4LVOC 3SGDH 1LGVA 1MPAL 1AJ7L 3S88L 2ARJQ 1NMAH 4KPHH 3FQXA 3SDXE 4X8JB 4IRJC 1FNEA 3OAZH 5ID1A 5SWZB 1IKFH 5CLTA 1JPTH 1HYSC 4Z7WB 1NQBA 3KYOA 4FTVB 5LBSL 1MCQA 5FYKU 2YUXA 4KKCD 3E8UL 1MAML 3GZKA 4X6DF 5I16A 3D1MC 4IS6B 1GPOH 1UC6A 2EDQA 3BWUC 4WRLA 2Q3ZA 4P5MA 1DFBL 4K3JL 3HI5L 1IAII 3ARFB 4L3CA 1WLHA 2AGJL 3U0WL 4P46B 2GCYA 2FLBT 3QUYD 5H35A 4MVBD 3TPUA 2VDRH 12E8L 1FGVL 3CU1A 3P30L 3UTTE 1H3PL 4XP6L 1F3DJ 2VLKA 5I18H 4JM2B 1VGEL 2UWEE 4WDIA 1JZ3A 2NY6B 1CBVH 5C07B 4I0PA 4XP1H 4NC2B 1TVHA 3CJJA 2Q3AA 4RGND 1KPVB 4N0CC 4PJIF 3FKUS 1W72A 4MXVF 4NP4H 3V6FA 2Z8WC 5C08B 3O3BA 2GFBB 4WFGD 1QFUH 2HYMA 35C8H 1OB1A 1DUYB 1QLFB 3AUVA 1Z0NA 1NCBL 3H2WA 3DUSA 4R0LA 3HE6D 5IVZA 2JF1A 1RUPH 2IGFL 3ARTA 4GRWF 1A1MA 1I1AA 1FVEB 5F6IB 1KCSH 1EMTL 5F1NB 4ETYA 4PJ7B 4UILH 1EXUB 4PP2A 4G9FB 3RBGA 3GI9L 1B0RA 2R8SL 2VXUL 3C5ZB 4MXWH 5DTFA 1L7TH 1EAPB 2EEDA 2H26A 1UCTA 2FB4L 3ORJA 3L3KB 1MQ8A 1MCOH 2EE9A 1OP5K 4HKJB 4QXUH 3O4LB 3MMEB 1MCPH 5C0EB 2NZ9C 3MRHA 4H0IA 1FORL 4DCQB 2HJKB 2CIIB 2VLKE 1YY9C 1U3JA 3EYVA 2V9TA 4WWKB 3T2PA 5MEOA 3OAUL 1I8KB 1ULVA 5JNYB 1PY9A 4NNYB 4DZBB 2R0LL 4QYOA 4AIZA 4YHLH 2OK0H 3DECA 3WD5L 3HAEB 1NGWA 2QQLL 1G9MH 4O2EA 2I9TA 3NZHH 5HGGS 1C5BH 5J57B 3ARXA 1BBJB 3IKCA 2BFVL 1KNOA 5CJOL 3HI6H 4EXPX 3PQYB 5KJRH 1ZA3B 4OFDA 2R1YB 4PJGF 5JQHC 4PLKC 2ED7A 4OSUL 3TA3C 4HKBA 4MDIA 3T1FB 4M1GH 1IGJB 1U3HD 4D2NA 4DKEL 1NC4B 2IAMB 4Y4KA 3ZTJH 3RZCD 2X1WL 3QIWA 5C1MB 2CR3A 4IRZL 4I13B 3RWCB 4Y16A 4XVUD 5ID0A 2EE3A 4JM4L 5IF0A 1CFBA 1K5NA 4HIHB 5K9QI 2D7TH 4URTB 1J5OH 5DD6B 2VB5A 3P11H 3BVNA 5TH2A 3C9NA 4NC0B 3QXDB 5F1OB 1J12A 4YBLB 5T1DL 1CQYA 3FQNA 1YEDA 1V7MH 5LJYH 5IM7A 3LKRB 1MRFL 2EC9T 1WK0A 4V1DA 5JOFB 4NZRL 1S3KH 1T22A 4BH7B 1OTTC 1RZIA 4PRAA 4KROC 2HVJA 2ZSWB 5GGRB 1ZHNA 1RFDL 3UTZB 2WQRA 4M8VA 3O2WH 1I1FB 3QO0A 2Z92B 2Y4SA 4FQLH 3QG7L 2VLMD 4ZO8A 3L5XH 2X4SA 4GO6B 2OP4H 1OM3L 5HDQL 1PBYA 4TPRH 5T33H 3PP3H 1FQ9C 2Z35B 3MV8A 1GCFA 2HT3C 3Q1SH 5CBAA 2QLVB 2XRAH 4XMPH 4XVSL 2P1YA 4PRIA 4LLMA 3CLFL 3C6LC 3INUH 3MLYL 3WFHB 2C1PA 4ZDHA 3RNQB 3VH8B 5EIQA 4TQEH 4KJPD 4QCIA 3PP4H 2WZPD 5FM4A 4KXZI 4OLWL 4ZQKB 1B2WH 5IB3B 3QQ3B 3QCTH 2BSSA 5F7HA 4U33A 1HHHA 1XF5B 4IIQC 2EDRA 1AC0A 4HC1L 4OI7A 2XPGB 2IG2H 3EO0B 3MRMB 1NCCL 4V1DE 4BK4A 3HCVA 4GAYA 1NC2A 4NZTL 5D1QA 4KC3B 3CFEA 1KCUL 1MJUL 3QCVL 3HI1A 5DT1L 3RVXD 2P8LB 3H6JA 1FHGA 3OTTA 4N0YH 4NM4H 2I07A 4Y2DA 3IFNL 5IFAL 5BS0B 1D9KA 2P5WD 1MJ7H 3SKOB 4XT1C 5DRNB 2YD2A 2PNDA 3MRCA 4EI6A 4ZAKC 1CFNA 1BEYL 2DQGL 3AVEA 2V2TB 3MV8E 5IBLC 2X4NA 4X5WB 1BLNA 3V4VL 5HY9B 3AS3A 4PRIE 2BMKB 3BISA 2YS4A 3FOMB 1JVKA 1SJVA 2FGWH 3BPCB 1KCVL 2ZUQC 1N6VA 2C26A 4XCNB 3SKNA 3TYFB 5C6TL 3H9YA 1OTUC 3ULVH 1AE6H 4KROB 3MJ7A 4GBXC 3RAJL 5IB4A 2ARWA 3QHTC 2DRUA 3MR9B 3S35L 3FO0L 3HMWH 4G6JL 1HHGA 4MSWA 4I18A 4YUEL 3V4UL 3VFNB 3AAZA 4K23H 4RMVA 4HS8H 2X2YA 5K9JL 4J1UB 1SYSB 3B5GA 2Z4QA 4MS8C 1INEH 3VE0A 5MHSD 1Y0LA 4PGCA 3QFDA 2FZ3B 5HHVH 1T3FA 4U6VH 4NN5B 3MRJA 1T1YA 1T0MA 4QRPD 3DMMB 1DN0A 4LDOB 5E9DA 4KI5C 3CFIC 4I3RH 3GSNH 3MOBL 2VLJA 4YHZL 2BNRD 3P0VL 3DX7A 3MODL 4OZ4A 1CTOA 2A9NH 1WTLA 5E99L 2F8VA 2E9WA 2YD4A 2DKUA 4M6OH 4QOKB 1WAAA 5ISZA 5J9PB 3MLPA 3QQNA 3JTSB 4IIQB 1H3WM 2HFEB 4P99A 4UIMB 3MUZ1 3KHQA 4J3OC 5JQ6H 1A2YA 3BYYA 2XTJE 3DSFH 1MELA 4CNIB 3EYFA 1Q9LB 2L7UA 4YXLL 2WUCL 4NO3B 4RAVA 2AI0L 2VE6B 3MNVB 3GM8A 3LHPH 3QUXC 2NXYB 2QSQA 1XGPA 4OQTH 1FV1A 3KG5A 4JFFB 4KMTL 1E27B 4HXAL 3WKMH 1U8LB 4ZTPL 5FKAA 2JJUA 3O3EB 3V6BR 3I50L 4NQXA 3KWWB 1JBJA 1IZKA 2VZOA 2F5AL 3LS5H 1ZHKB 1OF2B 4EOWL 3G6JB 4QGYA 4Y4HD 4EKXA 1K8DA 5E9DE 1CGSL 2VLJE 3N9GL 2QR0A 4XPTL 4JPKL 5IMLA 3QPQD 3VFUA 3FFDA 3SDYH 1WAAE 3H9HA 3CDYA 3RX5A 5ISZE 1UM6H 1P2CB 2VYRE 4ELKB 1I3GH 1UB5A 1Z5LB 2D7PA 4ONGH 5F7FA 4C83B 4Z0XA 5IVOA 1EEZA 3G9AB 1UXSA 4POUB 3EOAA 5E00A 4U1KB 1ED3A 1M7IA 4ZNEA 4MMXC 3QXVA 5DVOA 5J12B 4GQ9H 3SDDB 4H1LH 4RWYH 1W72H 2BVPA 3SE4C 1S5IL 2AAVA 5L9DL 4YDJB 3CIQA 5EA0L 5F44A 1PZ5A 4J6RL 1N3NA 3PNWB 3QUZA 3ZDYE 5I1CH 4WUKH 3DRQA 1KACB 4K7PX 3VGHA 4KFZC 4HXBL 3ZKQD 3FAXA 4Y4FA 4KGLA 1CXKA 3QDJD 3IS0X 4G6KH 4M7LH 1KIPB 5L2JA 3WFEH 4Z78B 2IQAA 1U91B 3VFWB 3SO3C 1ZT1B 3T0BA 4KVCL 3SGJC 3STZA 3MYJB 3MJ9H 1PQZA 1B4JH 1QVOB 5E6IB 1UGNA 4LVNB 1WC7A 3QQ4B 5K33A 4YPGA 5C70A 3MV11 2JJSC 4HC1A 4KK6D 1VADA 4FS0A 2O61B 1EPFA 5ADPH 1IKNA 1EZVY 4KKCC 4HUUA 2AXGB 1HOCB 3GMQB 4ZNEE 2ATKB 1INQB 5DDHA 1QFWL 2HMIC 1KXVC 3FRUB 3KYKL 4MWFA 5E2WL 5EIIB 3RY4A 2EIZA 2NTFB 4KZEL 4LLWA 2WBJD 5IB1A 2PO6B 2VXSH 5D1XB 5GSVA 2W0FA 3O6FD 3P73B 5I0DA 1G7HA 4P9HH 4PRDB 4X7TB 5MEQB 2DQCH 3TIDA 4WHYH 4WU5B 1WF5A 4MVBC 3FO1A 5D2LA 3WV0A 4O9HL 3OJDA 2AJUH 2NY2D 5CUSH 1D5IH 3ULUD 4RX4D 1HSAB 1G7MB 2CKBB 2IWGA 2VOTA 4LLVB 4MA3B 4AK1A 1ZE3C 1QFHA 4HIJB 4AG4H 3QDMB 5IHUH 5I1EH 4YR6A 3P9LB 3BQUD 1TCMA 3KPLA 4RGNC 2DI8A 5JORB 4UTBH 3JUYA 5D6CB 3RTQD 3V52H 4GKNB 4XXCA 3MLUL 3QNYB 1X5AA 3DVNB 4CADB 1CGWA 4XCYA 4LLQA 4P2QD 4X4MA 3IJSA 3BSZL 4WI6A 4QT5B 1K3ZA 3HE6C 4XNMA 2BY0A 3VD5A 4HKZA 5I75C 2YHGA 3A6OA 1FVCB 3O6ML 3BKCL 1NLDH 3JWOL 4K3DH 4JVUA 4J8RA 1M05B 2DLHA 3CC5B 5C7XH 4FQ2L 2Q8BL 1NAMH 2FEDC 4ZUTA 3TH4T 2AKRA 3EFDH 4EN3D 4ZOBA 1DQLL 5KVGH 3GSUA 3TN0A 4Z76A 3GHEH 5D2LE 3MBXH 1G9MC 2X4TB 4S10A 3WNOA 1WZMA 2MKWA 1KJ2L 4M6AA 5SWQB 1YEHL 5IESH 3TESA 3VXNB 4Z5RA 3LEXA 3BIKB 1GL4B 4W6YB 4LLUB 1MPAH 2OTWB 4CMMB 4HIEB 5I1LA 3HUJF 2EO9A 1BX2A 3IDGB 3O8XA 2UZXB 5IGXH 4X80L 4X4ME 3H9SB 3FCTA 4TNVF 2XWBA 1YNTB 1RZKL 3VFRA 1HQRA 1U3HC 2IALB 3P0YH 4M8QA 3E6HB 4X6FA 2B1AL 5TPWL 1JV5A 2OTUA 4WIQA 4K8RD 4PJFB 3QZWG 5FECA 3THML 1C08B 1VEMA 2J8UA 3D39A 4XVUC 1NJ9B 4MLIA 4K3JH 2C1OA 4OGAD 3UPCA 2BCKB 2GJJA 3MV9B 2ZSVA 5ESAB 5B4MD 2W92A 1JGUL 2OMBA 1HYRC 1RURH 4PGBA 4Y1AB 3UTQA 1L0QA 4QHLA 4PJHA 5DK0B 5CEYB 4KQ4H 3RVUC 1KGCE 5DVLA 1N59A 3QR2A 2P48B 12E8H 1I8IB 1UWXH 1FGVH 1HKFA 2BVQA 3P30H 4BQBA 1H3PH 4XP6H 2H45A 4LDEB 3VCLB 1YEFL 1DVFA 3B6SB 5H37G 1I4FA 1VGEH 5I75B 1OQOA 4WUUB 4J23A 4NYLA 4JGMA 2E3VA 1NGPH 5ICYA 3FT3B 3DIFA 2VISA 3CX5J 5IG7B 2Q76A 2C3HA 2WAHA 1TJIH 1ZSDB 1UWEL 5IT2L 5HD8D 3HN3A 2UVEA 1NGXA 5I1GL 4R4ND 2JB6A 2H1PL 3H42L 5DS8A 4G9DA 3E3QC 2IGFH 3MNWB 5CD5D 4OF0A 2J8UE 4LSVL 4Z9KB 4HGMA 4W4OC 3D39E 4OCWH 1BIIA 5AZEH 1SJHA 1EMTH 5BQ7B 4MNGB 2YD1A 3QIBA 2NX5A 3GI9H 1BZ7A 2XICA 4UV4L 2G60L 1NGQL 4KJPC 4XH2A 2FB4H 4LHJB 4PJHE 4EI5A 4E0RA 2VH5L 4XTRD 2FJGB 4KKAD 3U0PA 2DYPA 5C9JB 2JIXA 1GZQB 3N06B 5DSCA 4RQQB 2IPKB 2FD6L 3BP5A 3OAUH 4D0BA 1P9MC 1D3CA 4AH2B 4WHTA 1A8JH 4NWUL 2CIKB 5DFWH 5I8CA 5EG6C 3RVXC 4V2CB 1T2QL 3HC0A 5CGYD 3HB3D 3CXHK 3ARDA 5AG8A 1S9YB 1EIBA 1BVLA 3B9KD 3OJVC 3EJYC 1HKLL 2SEBA 3SDAC 2CJUL 1T0NA 2CUMA 4QGTA 4DKEH 4NNXB 3VRLE 4ODWA 4RIRB 4P4KB 4KDWA 1JMZA 1RVFL 3IYLW 2NX5E 4DEPB 4YNYA 4Q6IA 3RVWD 1G7JB 3UDWA 1FZJB 1LP9A 2DQTH 3HS0B 4Y5YC 4Q74A 5IHZA 1Q38A 3MRKA 1H3XA 3VXSA 4BZ2H 2BOBA 1R3HA 3G6DL 2WIIA 3AGVA 4XNXL 4GW1A 5F7EL 3OKNB 3VFTA 1LEKB 5T1DH 5JZ7D 4N5UA 3DJ9A 4NO5A 4G7YL 1MRFH 1MRCH 5E1HB 5DI8A 4JFHE 4B50A 2D3VA 2K1MA 4NUJA 4NZRH 4ORGA 1J8HD 2V7NB 3OHXB 1D6VL 1UJTA 3C5SB 4PBXA 3OKKA 3KLAA 1RFDH 1P6AB 4MJ6B 5SX5H 1HNGA 2XNAB 5HHPB 5B3JF 4XMLL 3CUPA 1BHGA 3GMPA 3W81A 2LFGA 5HDQH 1OM3H 1FYHB 1M4KA 2VZ3A 1KJ2A 3F12B 4DFIA 3L6FA 4CDGC 4I77L 2V2WA 4XVSH 2WQ8A 1LP9E 4OLEA 1NCNA 3MLYH 2FO4B 1KIRB 1U6AL 3VXSE 3JV4B 2ESVB 2R15A 4PB0H 2AV1A 5KG9A 1W0VB 2NYYD 4HS3B 3IU3A 1MI5A 4OLWH 3ZTNL 3K3QA 1N5YL 5KSUA 1K4CA 1OAZH 2D31A 4HC1H 3SDAB 1P1ZB 3WFDL 5EOCH 4QRTA 2X7LB 5ETUA 1MJJB 4R9HA 3VG0H 2GJZB 5I76B 1VGKA 1LE5B 3H3PL 1FFNB 4HFUL 2A74A 4NZTH 2OSLB 4U1LA 3ARYA 1KCUH 1MJUH 3QCVH 4X5XB 1JTOA 2NCMA 1E6JL 4GLRI 4OI9A 4Y4HC 5BZWA 2AS5M 3IFNH 2Y9RT 1I8MA 5IFAH 4U1MA 4Y5YB 4NQDD 4M43L 4BSVA 1PGRB 5T3ZD 1ZS8B 3QPQC 4K07A 4F57L 2YWZA 1BQHG 4JO2H 4LQ1A 3WO4C 2DQGH 2W07A 2DIBA 3NCJL 2R39A 4DKFL 2E5EA 1A4JB 5TQ2L 4ZSOB 1XAUA 2DBJA 4YO0B 4M5YL 3AM8A 3D3VD 4HV8A 3RL1A 3QA3B 5D8JL 2AQ1A 3GSNB 4RMTA 5EFIA 4UDTB 2G75A 5D7IA 4J3SA 4ZS7L 2R23B 3RI5F 4YXHH 5C71A 5IMMA 1S7XB 3UJIH 4HQQL 5C6TH 1MI5E 4XBGB 1AGEB 1T5WB 3I6GB 1LK2B 3WUWB 4QRPB 3QAZC 1J0KA 3RAJH 3TT1H 4N9OB 2VITB 2HG5A 5FYJD 1QRND 3S35H 1I7ZB 3DX6B 1JMXA 5DJ8B 1H15B 5KSAD 4F2MA 5IOPA 2UWEB 4QRRB 5K9JH 1FNFA 1U8MA 3ARBD 1TITA 4KJWC 4JDTL 3ABZA 4PJCA 5E8NA 4Z0BH 2YC1B 3FQXB 1SEBA 3H0TB 4F7MA 2YN3A 1FNEB 4G43B 3MLRL 5ID1B 1BREA 2KPNA 4IDLA 5GS0L 3P0VH 5IWLC 2KKQA 5L0QC 3MODH 5I16B 5E99H 4BFEA 5EO9B 1YMHA 4KK6C 1AXTH 4UT9H 3MUGA 4P5MB 5IMKA 1T20A 2YPVH 4P9HC 4MQTB 4YIQB 3T0VA 4JRWA 4NN6C 3WIHL 2I60L 5D4QA 4JO3L 3BPOB 5D7IE 4MJIA 4L3CB 2R1WA 4WNQB 1NUFA 2GCYB 3T8XA 4Z18A 2WBJC 5H35B 4WI2A 3TPUB 3C6SA 4K3HA 5TGBA 3BKYL 5GZNC 5DQDL 2CO7B 2R4SL 2WUCH 2PTTB 1WFTA 2VLKB 1HINL 2ZNXA 3KR3L 3PDDA 2CRZA 4P3CL 5C2UB 4K94L 1KEGL 1C12B 4KMTH 4HXAH 5FKPB 3ULUC 3WO4B 4XNQA 1P84J 2HLAA 4EQ3A 4H1LB 4PJCE 3OR6A 1W72B 2AEPL 3V6FB 3VFOA 5IVXA 3O3BB 5IJKA 2F5AH 4I3SL 3BWAB 1MSPA 3CNKA 3BQUC 1OB1B 3RTQC 1CGSH 1HNFA 3N9GH 4R0LB 4XPTH 3QDHA 4JPKH 5IVZB 2R2HA 3GBML 3VMNA 1CTNA 5ECJE 2X9XA 3LH2H 4JAMA 4CVZA 1I1AB 3HMXL 4O02H 3BP4A 4S1DC 2R69L 1CGYA 3LS4L 4F37K 3GUTB 4PP2B 2V7HA 4MJIE 3PWPA 3OXRA 3QEHA 1L0YA 25C8L 4R90L 4YBHA 3OJMB 4IMKA 4JG1L 3FOLA 4Y19D 3LZFH 1QYGL 1BJ1H 4JZJC 2KZ1B 3MRHB 4JPWH 1E6OL 3I02A 4EN3C 1CLYH 1T7XA 4O2FA 2FHBA 2H9GB 5DD0L 5I71C 5MEOB 5EA0H 1MRDH 4J6RH 4JFYA 1UYWL 5FM5O 3V0WL 5L0QB 4XPAL 2EE6A 3ARWA 3TZVD 4HXBH 1IGFL 1UQSA 5I1JH 4O2EB 1CICC 2I9TB 1CFSB 4HT1H 4XWGL 5IVXE 2BRRH 2CMRL 4RRPA 1KNOB 3EJJX 4NN6B 5CS7A 3X14A 1FN4B 5GS3A 5F1IA 3EYUH 1CZ8L 4KVCH 1EFQA 4LPVA 4YEEA 1KLUA 4MDIB 1JP5A 4UIKL 4FQIL 4OGYL 1AGFB 3MLWH 4OIAA 3H7LA 4Y4KB 3BIAX 3QIWB 4GKSB 3U79A 5D72L 3TFKD 3OKMA 3MXVL 3PWJA 3PWPE 4JCMA 4K8RC 4BQCA 2GTZA 1NH6A 2ADGB 1OPGL 3T2QA 1WJ3A 3BH8A 1QFWH 1ZVHA 3IJYB 5DEFB 4N68A 3BVNB 3KYKH 3IFOA 3P9MA 4KZEH 3C9NB 3CDGB 5B4MC 3ZSSA 5C0GA 4HK3J 5E95B 5EU7E 3ZKNC 2J4WH 4O9HH 4M4RA 4G8GA 4V1DB 3H3BC 1ZA6B 5EN2A 4AENA 1T22B 3GSVA 4N0FB 3ZSTA 1DJSA 4P2QB 3UZVB 3G08B 1I9IL 1NAMB 1U58A 4NO0B 1ZHNB 4JR9L 4OF8A 2XQYG 4LVHB 4PUBH 3UO1H 4HEPG 2B4CC 2EEAA 4NN7C 5C0FA 3QO0B 4X7DC 1A7QH 3QRFM 3TBVB 1EBAA 1AQKL 3PF2A 5B22A 4L29A 4U7KA 4BJLA 2NTSP 1G1CA 4AIOA 4F7PA 3MLUH 2X4SB 1NEZG 1KV3A 1A3LL 2CDGA 2F54D 3MV8B 1NBVH 5CBAB 1O7SA 4R96A 4MD4B 4M3JA 3VXRA 2WWKT 1QKZL 5MI0B 3VDCA 3BN3B 1SJXA 2C1PB 3NVQA 3O6MH 3BKCH 4ZDHB 2APXA 5CD5C 2XACC 4M1DH 4GH7B 4LSUL 4I4WA 1YMMB 4QCIB 1CICB 1YEEL 4JY4B 4Y88A 3B9VA 4Q0XH 5DJZA 2BSSB 3BEWB 5EBWB 3K1KC 1F4YH 4ODTL 2QSTA 5JA9A 4WHDA 1MY7A 1HHHB 4OZHF 3QUKA 4PJDF 5FUCE 4JDZA 4PJ9D 1CFQA 1SY6L 3W9EB 2HLFD 4MCYB 4XTRC 4LGPB 4G8GE 4PBWD 3KLHD 1ZTXL 4KKAC 3GBNH 5IR1B 3UZEA 5D1QB 1MEXH 3CFEB 3VXTB 3HI1B 5HHOD 1KJ2H 4XWOD 4J4PD 3WIHA 1YEHH 4OV5A 5FV1L 4S1RL 3NIGE 5GIRA 1S5HB 1D9KB 4OZGB 1GHFH 3RKDD 3HB3C 1F8TL 1ORSA 2K7PA 3MRCB 1U8OA 4D8PA 1CFNB 3I2CL 1NSNL 1NDGB 1A7PL 1FL5A 3LOWA 3B9KC 4X80H 3L3OB 1BLNB 1EJOL 4LEXL 2NR6D 3NZ8A 5T5NF 3VXRE 4PRBA 5D93B 4TOYH 5JW4M 1P53A 5KVDL 3TVMA 4OGXL 4O4YL 1F3JA 3MV01 4OZFG 5TPWH 2EC8A 2YWYA 5MEPA 4UV7H 1BFSA 3VFMB 3BP6A 3SKNB 4JZNA 3M8OL 1PAMA 2QBWA 4M62L 1YEJL 1JWUB 3THMH 3L5WA 2XTJB 3PL6C 4HJGB 4HPOL 3T3MF 3DYPA 4P2OC 5DF0A 5ACMA 4FFYL 4PJ5B 4NN7B 1KBGL 1JGUH 1HHGB 4MSWB 4KKLD 2ZUUA 4G6FB 4IOSD 3HMXA 2Y5EA 3BMVA 3B2VL 1NDMB 2ZOKA 3IVKA 2Z4QB 3VE0B 3IDIB 1Y0LB 5EBGA 4PGCB 5JZ7C 1ACZA 1T3FB 3F7VB 4WW2F 4DZ8A 3MRJB 3R1GL 1T0MB 1UEYA 4OF3A 3GMRB 1IM9A 5JW5B 1DN0B 2J6EA 3C09C 1S7UB 3S36X 4DTGL 2BDNL 3KPSD 2VLJB 1AR1C 3UTPE 3O2DL 5E08L 1UWEH 4U1IA 4H0HB 4X9HA 2MFNA 5IT2H 1HQ4A 4GS7C 2JCCF 3HZYA 1SJEA 3CSYB 3DURB 1RJYA 3IGAA 5JMRA 4ZFGL 1J10A 3QO1B 4MHHG 1CDJA 1WGOA 3VXMD 4FA8A 3ETBF 1AFVH 3H42H 2DQJH 1NCWL 3AXLA 3GSRB 1H3VA 4PJ8D 2GJ6A 4LSVH 3ZKSD 4ETQA 2XXMB 2GUOA 3D2UD 4XAKE 3U0TA 4LP4A 4ACPA 3BKJL 2G60H 1QLRA 4LIQL 2FJHA 4YHNA 5MENA 1FV1B 1MLCA 2VXTL 4JVPA 5JW4N 2A73A 2GT9A 4D9QE 4A6YH 3KXFA 2MQCA 4PRNA 3PE9A 4HDIB 4GSDL 1FVDA 2VUYA 2BSRA 4JHBA 5GHWH 3S34L 2FD6H 3GMNB 1NGYB 1ZMYA 2ICWA 2VJXA 1K8DB 4J3UA 4F15C 4X4XA 1JGLH 1QTYT 4NWUH 3RL2A 3FB8B 5IMLB 3PL6B 2YD8A 3FFDB 3D85D 4P2OB 3H9HB 5C0BB 4KKNA 3D0VB 1UB5B 4OGZA 3MCKB 2IH3A 2ITDA 1FNGB 4YDKH 3CD4A 4LAQL 4UOW0 4Z0XB 1G0DA 4LRIC 4XBPA 5E8DL 3WFZA 1UXSB 2W9DL 3EOAB 2GJ6E 1G9NL 1ED3B 2ZCHL 2OTPA 4CN1A 2CPCA 1E28A 3MRGB 5FOBA 1RVFH 4MNHB 3ZE2E 1BD2A 2GQHA 5TF1H 1XGYL 5DK3A 2AJXH 2PW1A 4F7EA 5BXFA 5MENE 1L4IA 1N3NB 2C4XA 4FFZL 1RUKH 4PRHA 2WWKO 2E7LA 3QUZB 3KXFE 5CEXA 3ILPB 1FZKA 3DRQB 1QPXA 1HH9B 3WSQL 3WFCL 5FYLL 5F7EH 3QPXL 5I1IL 1ZVYA 5KSAC 3MLSL 1JPGA 5L2JB 3KPNA 2IQAB 5BCAA 2NQCA 1CDIA 3MBED 5DVNA 3V5HA 2DBLL 3ARBC 3STZB 4KMQA 4F80A 1PQZB 5DJXA 2LAAA 3OJ2C 3F7PC 3HE7D 4JFZH 4YPGB 3NGBB 3ZT5A 1SY6A 2O5ZH 2EXYD 1YJDH 1YPZA 4HMEA 3WE6A 5GQBA 4XMLH 2DLFL 4OF5A 5F9OL 3GKWL 5CINH 3JWDH 4HUUB 3BUYA 4Y5VA 1P7QA 4K7PY 1ZANL 4C58B 2ICEB 5DDHB 2APWA 3FO2A 3MV7D 4GKZB 4K2UH 2HFFA 2Z9TA 4U3HA 1U9KA 3QYCA 2R2CA 1BD2E 4I77H 3B4NA 5CKAA 2V2XA 3LQAL 4LBEB 5CLWA 4KHTL 2GSIA 3WEXA 3S97C 1ES0B 5C2BL 3TIDB 1A6UL 5DFTA 1U6AH 4LEOA 4PRHE 3RUGA 1YN7A 3FO1B 3LSOA 3UBXA 5EU3A 4DVRL 5DUMH 3ZTNH 1N5YH 4JHAL 2G5BB 4MAYD 3TYGL 2VERN 2X89D 2MQ3A 1R24A 5JA8B 1ZWIA 5EU6A 3U9PL 3WFDH 2A1WH 4OUOA 2FWOB 4YR6B 3PIQA 2NY7H 3TV3L 3UTTD 4OM0L 3H3PH 3X3FH 3KPLB 5C0CA 4JO1L 1A1NA 1S7VA 1WZ1L 5F9WC 1QNZH 1E6JH 1JPFA 4XCYB 1YPZE 3RGVD 5TDNB 3IJSB 2QTEA 4W4NA 3WKNA 4M43H 4HKZB 4JEGB 3DPBA 4ZFFA 1JTPA 4G5ZH 5F7UA 5JOEA 3C8KA 1X4XA 4YEFA 4HWBL 4PIRF 3TCLA 1A7RL 2YD7A 3NCJH 4KRNA 4R8WL 1JFQL 4EBQL 4MA1C 4HWZB 5TQ2H 5IW3A 5DMYA 1CE1L 5FUOH 3OXSA 1IEAA 4PJAF 4ZO6A 4M5YH 1AKJD 4KK8D 4YHKL 1GGIL 2GK2A 5D8JH 5I8EB 3ALPA 3RUGE 3GSUB 3O2DA 4LPCA 1P4BL 2VXQL 4Z76B 3QBTB 5CD3B 4HQQH 2ILLA 1QUNA 1A4KA 5I1DA 1F00I 3KYMA 3GB7A 5C0DB 4G3YH 5EU6E 3JSSA 4NQCA 5EUKA 5EPMA 4X6CB 2DQIL 1HHIA 4KAQL 1SBSL 5T1MA 3LEYL 3TZVC 5IQ7L 1TZGL 1G0YR 5C0CE 5FDWB 3QEGL 4PLOB 3LIZL 1FBIL 5GISH 3P4OB 5I1LB 1N7MH 3GI8L 3VWJA 3FB5B 1ZLWK 3IDJB 1CT8B 3MOAL 1S9VA 5D7SH 5J13C 1DLFL 5L6YL 4I0PD 4XCCH 5E03A 3MLRH 1TVBA 2DWDA 2ZUWA 3OPZL 4FN0A 1URLA 5HI5D 1S78D 5GS0H 4PJXF 3VFRB 1OD7A 1AGDA 2OTUB 2R29L 2YRPA 3QWRA 1NANI 3TFKC 2ICES 5EC2A 3OQ3B 3O41B 2J8UB 2C1OB 2FX9L 3WIHH 2I60H 1JK8A 4JO3H 1P7KB 5DURB 1KT2A 2FCBA 1QR1A 4GRLA 4PGBB 3NACL 1BFTA 3UTQB 4TTDD 5CEZH 2HH0L 1N59B 3BKYH 1ZHBA 5DQDH 2CLVA 1ZLWH 2BVQB 4KUCF 3SKMA 5FYJU 1UH3A 2PXYA 4NQCE 1DVFB 1SM3L 5IEKA 5KW9L 4Y0GA 3D0LA 1OAYL 3L95A 4GG6F 4QRSB 4P3CH 2HRLA 4FFWD 4K94H 1KEGH 4NYLB 4FNLH 5LGHL 5ICYB 4KQ3L 2NY0D 5ACZA 1DEDA 1TZHA 2Q76B 3PWLB 1DDHB 4MA1B 4KK9D 1JNHA 4LIQE 5LCVL 1NGXB 4LLYB 1IBGL 3U6RB 4BKLA 5D6DA 1UVQB 1MHCB 1T83A 2CO6B 4NO2A 3GSXB 1PEZA 4G9DB 3GBMH 4XP5H 3RIFK 5EBLB 3B43A 1AH1A 2YEZA 3HMXH 3VD4A 2R69H 3QUMB 1U8JA 3LS4H 1ZGLP 4EVNA 5J4MA 1BZ7B 4MX7A 4Z7QF 5I1AA 3MACL 1MHEA 3I3EA 3SY0A 4R2GD 1T89C 4QF1A 4C4KO 5C3LD 4XH2B 3CVHL 2J6EH 4Y16D 2H2PD 4L4JA 4C56B 2FSEA 5J13B 1U8PA 3TBSA 3KNBB 3U0PB 2JIXB 2B0SH 4LLDA 5DSCB 4PJ9C 3JTTA 4JQVC 5DRWB 4FXLA 5DD0H 2HLFC 3L1OL 2L0DA 2Y07L 3BP5B 4D0BB 3RA7L 3RWIA 3V0WH 5E2VH 1AIFA 4UMGA 4WHTB 4XPAH 3W39B 4APQD 5HYFA 4N0UA 1IGFH 4R6UA 4XWOC 4XWGH 3HC0B 1E4KC 2FATH 5FO9A 3RU8L 3QEQA 2CMRH 1V05A 2QADB 4IRSC 1FFPA 1U41A 4HPYL 1CDUA 5C0IA 3MCLH 3S37H 5IB2A 2SEBB 3RKDC 1CZ8H 1UCBH 3BZEA 4OCXH 2L4OA 5DRXA 1T0NB 4LHUA 5CP7A 5HJ3A 3FJTA 3EDFA 4U6YA 4EUPG 5FYLE 4MB4A 4UIKH 4FQIH 5A16A 1DBBH 4OGYH 3ARVA 2NR6C 4ODWB 3HC4L 3G5VB 5IFJA 4MD0A 5D72H 2HRPH 2WNGA 2VLRE 4YNYB 4L8SA 2QQQA 1NCDL 1OT2A 4KDTC 5IHZB 1XIWA 3VXSB 4PRID 5C09A 3U2SA 3LKSA 1Z9MA 4X83A 1BVKB 2X4QA 4JFDA 1EO8L 3ZKXB 4EIZC 4CW1A 4GW1B 3ZTJG 3B83A 4RCAA 2M26A 4KKLC 5K59F 4Z7WF 4HX1A 3EHBD 2IPTH 1BF8A 4HWBA 5E6YA 4N0UE 4WO4D 3CSBA 4NUJB 4ORGB 3GDBA 5E2TL 1QD0A 3HPJA 1K8IA 1DQJA 1OCWH 4L8CB 3QEQE 4TN9A 1A1OA 2OI9C 1DQQA 3KLAB 4JR9H 2RFXB 1PW3A 4NRYA 3X11B 1NC2D 4FFVD 3IDXL 4K7FA 2RR3A 1GH7A 4Y2DD 4B41A 5AZ2L 4EZMA 5JOPD 6FABH 1HZHH 2COQA 1SQ2N 1JI2A 1I1YA 1KJ2B 3G6AB 1SBBA 3JWNC 1IFHH 5B38A 2V2WB 4JM2F 5J1AA 3MJGX 4WTZA 1A6AA 1CQKA 3GRWL 1QKZH 5TE7H 1R5WA 4NJ9H 3Q2CA 4PJ8C 4F7TA 3GBLA 4NIKB 2CRMA 2BRQA 5C09E 2AV1B 1YEEH 1AHWC 3W0WA 3IU3B 1Z3GL 1MI5B 4JFDE 5KN5A 4S2SA 1EHLL 4IRSB 1K4CB 4IOFC 1A14L 3P2TA 2DQHL 1SY6H 3WNNA 4QRTB 3AB0C 1AC6A 3TEUA 1ONQA 1ZTXH 4OFVA 3OX8B 2A74B 1CXIA 4U1LB 4PJ7F 4HMCA 3S3SA 1NCUA 3QDGD 4K9EC 1C16A 3QHFH 4P23A 4QRQB 4S1RH 5T1LD 5BZWB 2FEEL 1X5LA 5K9OB 4QRUB 4BSVB 2IBGA 3EOBA 2FO1A 3S37X 4Q9RL 1E4WH 3TJEL 3I2CH 6CGTA 4LSRH 3DYMA 1A7PH 4UINL 5E9DD 4RMQA 4I8DA 5CZVL 3OG6B 3M17A 4MA7L 2VAAB 1JUFA 4X5LA 5KVDH 1IGML 3RL1B 4OGXH 4PJBB 2FGZA 1YN6A 1KTLA 3WLWD 1U8QB 2BNQA 2BSTB 2G75B 3NA9L 5D7IB 3WN5C 5ISZD 4JFOB 3TBYA 2VDLL 3K2UH 3M8OH 1U93B 2MKLC 1YEJH 3LKOA 3W0WE 4TSAH 3RPKA 1PKQA 4F33A 3NCFB 4JLRB 4JFEB 4HPOH 3NFPA 4CJ1A 5FO7B 5HSFA 3D9AL 5CILL 1KPUA 3GMMB 1NPUA 4FFYH 1DCLA 3KPSB 4Z7UA 3TCXA 1IGTA 2XZAL 3LKQA 4F2MB 1QO3A 3F58L 1HEZB 2CLZA 2AERT 3B2VH 1U8MB 1MCDA 3V4PL 4UI2A 1K4DA 3WJJA 1FH5L 2PTVA 5E8NB 4PJCB 3VJ6A 2HN7B 1TPXC 1CU4L 5FB8A 3MGOA 3HR6A 3NCYS 4L9LA 1YJDC 2YKLH 3MBEC 3UJJL 1ZHLA 5IROC 3CVHA 5HI3D 4DTGH 5DD1L 3G5ZA 3JWDC 2BDNH 2FHCA 4A6YB 3PG2A 1F3DH 3MRQA 3BH9A 5I8OL 3O2DH 4LPTA 1YMHB 3GEWB 1LHZA 4O5LH 3MUGB 4OLYH 5IMKB 1JPSL 4MDJA 1FE8L 3VI3E 1SYVB 1L9MA 5FA3A 3ZKMC 3AB0B 1EV2E 1E4XL 2BNQE 4N9GA 4MJIB 4WJ5A 1QHOA 3X13B 1I9JL 2OLDA 1IZJA 1XT5A 4L8DB 4MHHI 1PKQE 4J3XA 3C6SB 1GSMA 3DUHA 5IB5A 3K1DA 2PYEA 4PV8A 1DQDL 4Z7UE 1C5CL 3AREA 2J5LC 5AYUH 5L88L 1K3IA 5FYKE 1EFXD 1JYXA 3GMLA 1CFVH 4MAYC 2W1NA 4N8VG 1UZ6F 4GSDH 4LMQE 1VFBA 4PGJA 1T0PB 4FQQA 1R3KA 4HIXH 3VFOB 1IRAY 3JV6B 2MWCA 4UQ3B 5J1SC 4L3EA 4X8JA 4XHJD 2N1KA 4Y4FD 2YD5A 2H2SD 2R2HB 1ZLVH 1QP1A 5FGBC 4CVZB 4JAMB 2A0LD 4I5BB 3RGVC 3SGEI 4JY5L 1L0XA 1VCAA 1CG9B 1MLBB 4IS6A 4OV6F 4XXDA 3FQRA 3MCG1 5LQBL 5IBUG 3TO4D 2V7HB 4LAQH 2WLZA 4KJQD 2MHAB 3MZTA 2N4IA 3PWPB 1YYLL 1CVRA 1F42A 4F9PA 3OXRB 5D5MF 3QEHB 2W9DH 4M7ZB 2ZCHH 1FC1A 3FOLB 1A22B 3DARA 2YN5A 3FRPA 5FHBL 2Y06L 1FPTL 4BQ8A 4KK8C 4LKXA 2PYEE 2GITA 3I02B 2YA2A 4KGJA 5KS9A 3W9DB 3OGOE 4O2FB 1G0XA 3MJ8B 2C9AA 2FH6A 5F6HJ 3O6LL 5E8OB 3Q48A 4CMHB 1ZLUH 4NJAH 1SHMA 3MGTA 5C07A 3RY6A 5HVWA 3QPXH 5HDBF 5F6HI 3GRWA 5LVEA 5L7XL 5I1IH 1KPVA 3MLSH 4E42A 4L3EE 2GFBA 4AMKL 2AK4A 2DBLH 4MJ4A 4OAWA 3S5LB 3MROB 1BZ9A 3HG1A 1QLFA 2FNBA 1KLUB 3HLAA 3QI9D 4P5TD 2D0HA 4CL7A 1I9RH 4BSWB 4OFYA 2LE9A 5LWYH 5F1NA 2J5LB 2ZG2A 2DQEL 2EH8L 1PLGL 4G9FA 3GKWH 3REVB 5DMJB 1ZANH 2VQ1A 3C5ZA 5FXCH 3BH8B 4UTAH 2OJEA 5B39A 3VFPB 4OLXH 1LO3H 2VZTA 1LVEA 1J86A 1C1EH 4LCUA 3L3KA 5I19H 2RCSH 3LQAH 4HKJA 3LMJL 5KS9E 1HDMA 3O4LA 4S1SH 5C0EA 2RHEA 1BM3L 1LK3L 4P9ML 2OZ4L 2VMFA 3EOTL 2CIIA 4IRJA 4Y8AA 2CGRL 3O3AB 4TTDC 3ZDZF 5L2KD 2MQ0A 5FEBA 4KXZH 3WMSA 1WZLA 3KLDA 5JNYA 3I6KA 4DVRH 4AIXA 5C07E 2Y5TB 3TYGH 3T0ED 5F89B 3HAEA 2VTFA 1MFEL 3SJVD 3U9PH 1BOYA 1KGCD 3EO9H 1T80A 2AK4E 2HVKB 3R0NA 3TV3H 4Z7OF 4GAFB 4OM0H 5C0FB 3HG1E 5IEHB 4M7KL 4P2CG 3TP4A 2GW5A 1J0JA 4KK9C 5JR1L 1ZA3A 4WY7L 3OB0H 1WZ1H 3W11D 3T1FA 1IGJA 5DD5L 4ZPTB 1L6XA 3NA4A 3MGAA 2ADJA 4G9FE 5GRWA 43CAA 3O8XD 4JCLA 4HIHA 2VL5B 4HWBH 1A7RH 5DD6A 3ZHLA 4R8WH 1JFQH 2XN9D 5DJZB 1CE1H 3O4LE 3UYOD 3OAYK 3MXWL 1GGIH 4JDZB 3RHWK 5BV7H 5DMIL 3D39D 1CFQB 5IIEB 1MQKH 1P4BH 3BXNA 3SOBH 4P3DA 1GGCH 3MLXL 2OBGA 1OLLA 4RA3A 5JOFA 5DLMH 2FX7H 2DM3A 4BH7A 1TNMA 4OV5B 1CE6A 1U8KA 2DQIH 3BX7C 1LO0L 2ZSWA 5GGRA 4APQC 5GIRB 5IQ7H 4GMSL 4PJEA 1RK0A 5CJQH 1NFDA 1I1FA 1ORSB 1U8OB 3LIZH 4WWID 4TVSa 1FBIH 3PWNB 32C2A 5D7KE 3SKJL 4L5FH 1DLFH 5E6ZA 5BRZB 1GGUA 3ET9F 4NQED 4BZ1L 4XGZB 3TVMB 1OGAD 1F3JB 3MNZB 4AT6A 1XGTB 2XI9A 4H25A 1JI1A 1MOEA 2R29H 4LSPL 2YD9A 3BP6B 3L5WB 2F53B 4I2XB 2P24A 3S3JA 5IB3A 2FX9H 2EC9U 3I6LD 3DXAB 1JHTB 1J05A 5BO1L 4KUZL 1XF5A 1HN1A 3CCHA 5F70A 2NX5D 5DHVA 3EO0A 1QSVA 2HH0H 2ZOKB 5HGBB 3QFJA 3IVKB 3TA3A 2BJML 5D7JC 2NY5H 1MNUH 1G7LB 2ZUVA 3DTXB 3NFSH 1KB9J 3EHBC 3LD8C 1JZ6A 4DZ8B 1M6OA 5KW9H 1OAYH 5JMOC 4DW2L 2F58L 1MCKA 2YK1H 4WO4C 4P2RA 4PJEE 5KVMC 4U1HB 2XXCB 2WW8A 1NFDE 3K8MA 3WLBA 4TVPH 2A6DB 4ZD3H 4MA8L 3PDGA 4U1IB 4DN4H 1HQ4B 5MERA 3ZE1E 1L9NA 3NIFE 4YHMH 1T2JA 3LB6D 3UTSA 1RJYB 2V2TA 3VGEA 1IMHC 5F7LB 4M6NL 4X5WA 1Q0XH 4NNPL 3ARDD 1OARH 2CKBL 3AFLA 3FOMA 4BUHA 1J0YA 3WJLC 3AXLB 4H88L 5FYKH 2MCPH 4ETQB 1OAXL 4XCNA 3TYFA 2GUOB 4QXGH 3C5JA 3F6IA 3KJ4C 4ELMF 2X1XR 4XX1E 3MACH 1OAKH 1YDPA 2FJHB 3LRSB 3MR9A 3CVHH 4HKXB 3EFFA 5TDPB 3GMOB 3QFJE 4PRNB 1PX3A 1KG0A 1FVDB 5AWNL 1CD1A 4W70A 4CUCA 3BAEH 4TUJA 3L1OH 5GSRA 2GEEA 4KPHL 5DC9B 4P2RE 3RA7H 4XVJL 3DRTA 3FN3A 2I27N 3C6LA 5T3XL 4X4XB 1EHAA 3K4DA 2DM2A 1YA5A 1IKFL 3RL2B 1W2KT 3AY4C 2DQDL 3UX9B 3O9WD 1KJMB 1PJ9A 3RU8H 4XNYH 5D1ZD 1NAKL 3UTSE 3SE3C 2OZ4A 3VFSA 4QOKA 1GPOL 4UOJA 4J3VA 2ITDB 1EHNA 4IIQA 3R06A 2X40A 3UEZA 2EO1A 5KTEL 4JRYB 2XZZA 3MOQA 2VRAA 2MNUA 4MJ5B 2X09A 5JO5A 5D7JB 4LGSB 4UIMA 5KANG 1MCIA 3LD8B 4TNVK 2PYFA 4H26B 4CNIA 1G6RA 2VDRL 3WLWC 1Q9LA 3LRHA 4NO3A 5BXFB 2B8OT 2VE6A 1IAMA 4CVWA 2D7NA 3MNVA 1J1XH 3OF6A 4PRHB 4YGAB 3RWHB 5DVMA 5CEXB 3ME0A 1FZKB 2X42A 1CBVL 1E27A 1EO8H 4ZAKA 5J7CC 2XQBH 3CMOL 1U8LA 3EDJA 2CXKA 2NXZD 4NP4L 3KPNB 4RMWA 3KWWA 5GGSB 2EDNA 1QFUL 4PJFF 5M95B 4RGOL 4NQTA 3G6JA 1CGVA 5E2TH 4TNWF 3CH1B 3KJ4B 1N64H 5FF6B 4QY8B 1MFAH 2FBOJ 4GBXA 5A43C 5HI3C 4QOKE 5IFHL 1YPZB 3KPRA 4QWWC 2X4UB 3WE6B 4ZPVB 1FIGH 1P2CA 3VGGA 4HAGA 3FZUD 2Z8SA 4UILL 4AL8L 3V0VB 1MCHA 2A38A 5MP6H 2K9UA 4C83A 2DI7A 3FO2B 3NABH 3WDIA 3FN9A 4U1KA 3MRDA 1FJ1A 1MCOL 4FG6C 2BVUA 2IJ0C 1IC7H 3ARGD 3IJHB 3WEXB 4IHOA 5J06A 2CRIA 3BFOA 2W38A 1FAIL 2W60A 4U6HB 3OSKA 3K2MC 3L7FB 3QDGB 3NCYP 5EU3B 1CIDA 4KTEL 3PNWA 4YHLL 2OK0L 1CN4A 3D5OF 1G9ML 3GO1H 3BGFC 1ZWIB 3NZHL 3O6KH 1KN4H 2YUWA 1A14H 1H5BC 4ZO7A 4BELD 1BOGB 1KIPA 2XZQH 1D6EA 4Z78A 1U91A 1UKTA 2ZKHL 3G6JE 3RIAF 4NKOB 1A1NB 1NBQA 4JZOA 1EAJA 4IMLA 4NPYA 3TH2T 1S7VB 3UXFA 1A21A 2VDNH 5D2NC 4XHJC 3KPRE 3RVVC 2H2SC 1R3JA 1R5VB 3QUXA 4QKXB 2O61A 4X98B 4ZFFB 2HFTA 1UACL 4Q9RH 3TJEH 2D7TL 1WT5C 2AXGA 3TCLB 2YZ1A 4UT7L 4UINH 1HOCA 2CDEB 2ATKA 1SVZA 3TO4C 3DROA 4WEBH 3VWKC 3FRUA 3OXSB 4PJGB 5CZVH 4MA7H 1IGMH 4NBYB 2M8XA 4HJ0D 3D69B 3P73A 5EZJB 3NA9H 4PRDA 4X7TA 1DLHB 1AGCA 4N90E 3UTOA 4KI5E 4FZ8H 1V7ML 1RIVL 1B88A 3KYMB 4RDQF 5GGQL 3GJFK 3FFCD 2XWTA 4P0DA 3D9AH 5CILH 1IQWL 2BOCA 2V17H 5C8JB 4LQFL 1HSAA 5EZIL 4LLVA 2CKBA 4MA3A 5EUKB 5EPMB 1HHIB 3DVFA 5T1MB 1X5GA 2QKIA 3T3PF 1VFMA 3F58H 1G7IA 2QHRL 1UM4H 2CQVA 1FG2B 3P9LA 1T4KB 5FA4B 3O2WL 3V4PH 1O0VA 4WCYL 1TNNA 1FH5H 2EEBA 5IJVB 3WDJA 5JORA 5D6CA 3K80A 4FQLL 5FO8A 1S9VB 1J88A 2W59A 2OP4L 3DVNA 2E7CA 1V8HA 3VRJB 4G42A 1TVBB 5T33L 5T1KD 3Q1SL 3SE4A 5DD1H 3TH3T 2GSGA 1WEJL 5JPMA 1KENL 3QI9C 4P5TC 4IM8A 5CGTA 3INUL 1AGDB 2JJVA 3GJFH 5EC2B 5EZOH 3QJFB 1JF1B 3FN0L 1JPSH 2IANB