5DJDB

Fc heterodimer design 5.1 t366v + y407f
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLFSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 34
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdB01
1A02N 2Y36L 3KXFA 4TYUA 1N0XH 3IJHB 5D93C 4K3DH 3QO0A 4Z7WB 5DSCA 4AQOA 1R3JB 1DANT 3ZTJG 1UM5L 1SY6L 3PWPD 4UT9H 3TV3L 1X4ZA 3IYLW 3WE6A 2E6QA 1QPPA 1YJDH 4GSDL 1X6NA 2X4TA 3NABL 2Z92A 1T03L 3NVQA 2BNRE 1CVRA 3W2DH 4N90D 1XF5B 1UKSA 3DX6B 1GZPB 1RMFL 3IAQA 1I8KB 1EJOH 2ATKB 4HC1A 3KPNB 1A47A 4LSRH 4Z7UB 5LCVH 5IP4A 2DYPA 3FT4A 3ULVH 1H3UA 5FECB 4U1HB 4FQJH 2PO6A 3A6BH 2QL1A 4IJ3B 4L5FL 4X4XB 5MEQB 1W0WB 5FFLA 4P2OA 1AXTH 4DKFH 1RZ7L 1CZ8H 1NBVL 3HPLA 4M7KH 2LTQB 4W4OC 3EYQD 4QHLB 3NACL 1DVFA 5M94B 1I8MA 2PYFB 3VRLE 3JWDL 3P0YH 2ZUQB 1MRFH 3F7PC 3TZVC 2DQCH 2WIIB 2P8LA 3RVWD 4EDWL 4MD5B 5F3BB 4OUUB 1JMZA 3ZZ1A 3GMQB 1KIPB 4ZDHB 3NGBC 5BS0E 4N0CD 4G80B 5FHBL 4S1RH 1IEBB 1TZIA 1EFXB 2DKMA 1NCTA 4OUOA 4U6XB 4Z6AT 2CRYA 1J88A 2CR3A 1BHGA 4QKXB 5ITBL 1ZLWH 1NGXB 2FECI 2RJMA 4QXUH 2CGRL 2D31B 3QDGA 4UTBH 4D9RD 1FFNA 1JMXA 1U8LB 5JPMA 2XIDA 2HFGL 3Q3GA 4JKWA 1TCMA 2IEPA 3EYUL 3CZFA 4DVRL 1XMWA 2JK5B 1JGDB 4OGYL 1YNLL 5D7SH 1BOGB 4NSKA 4JZJA 4OZHA 5LGJB 3PV6B 3WFDH 3WFHA 3ULUH 2BMKA 3MLTA 3GBMH 4MD0B 2AV1B 3TWCL 4S1SH 5D1XB 5IFHL 2EYTB 1NMCC 3QDJD 2DLGA 3BPOB 3HI1B 1FL3A 1JN6B 2PNDA 4UTAL 3TA3B 1CGTA 4YR6A 1OGAB 5IB3A 4WNQA 4NQUA 4XVSL 1T22B 1MFCH 1JWSA 1UWGH 3QUKA 1XFPA 3T0AA 1YY8A 3QQ3B 3IDXH 5GSVB 3MR9B 1RHHB 4Z76A 4KVNH 4R4BA 4LKXA 1UQSA 1P5UA 3WIFA 2OLDA 1X5FA 1R5IB 1CIDA 1N7ML 3QCTL 2VE6B 4WCYL 4TOYH 4MJ6B 4MCYA 5T33L 3CCHB 5GGVL 5IG7A 1T1YB 3QNZB 1I8KA 2ATKA 2QKIA 4O2FB 4UUJA 1BJ1H 1HWGB 3BO8B 1DSFL 1CFSA 5GGTL 3WHXB 3BKYL 3L3KB 1DLFL 1NAML 2P48B 1RZKH 4XWOC 4NWTH 1MCWM 1HE7A 2M2DA 2AKRB 1YQ2A 2X7LA 5JOFB 4Y4HD 3LQZA 5ISZD 5IGXL 3UJTL 1D3CA 4GW5A 2VLME 5I75B 4N5EC 1E6JL 5TGBA 5CEYB 2IGFL 3IKCA 4N0RA 4NCDA 2CUMA 3QPQC 1P1ZA 1QSED 5BRZA 3BIKA 3S8WA 2P45B 1MHHA 2PUQT 5D4QA 3VJ6B 4M8QA 1XIWD 1EAJA 2IH3A 3U7YH 5H37H 5TDOB 3BN9D 4HQQL 1BOYA 3NCEB 4R2GB 1KLUA 5EUOF 4W81A 1R3HB 3AMKA 4PREB 5I1HL 5F3HB 3W82A 4PJDA 4HS6A 5CIPA 4JFDD 5DZNA 3RX7A 4P4KD 4YAQB 1YN6B 2EDTA 4YGAB 4QHKJ 1MJJA 3ZE1F 5HYQA 3OAYK 3P11L 3KYMA 4I2XA 4R3SB 5IKCA 3EJYC 2ATPA 3MRQA 1YYLL 5D7LB 5SWZE 1PEWA 4AIXA 4G6MH 2JCCB 1JNLL 2AK1H 2NXYC 3RVTD 5BQ7B 2JIXA 4AMKH 1OAQH 2NY3C 1BD2E 3MBXL 4FXKA 4YHYB 1JIBA 3IFOA 4HIHB 4JFFE 2APBA 2LV4A 3L3DB 5I6XB 2K9UA 1I7UB 1DLHB 4X9HA 3TPUA 3VFSA 4JLRA 3AB0B 4C83B 3EYSH 1R3IL 4GAGH 5T5FH 1A6UH 4M7LT 4P2QE 4D9QE 2YWYA 5D6DA 5I9QC 1Y18A 3V4UH 1Q9LB 3G6DL 4LCYA 3TYGL 1OAXH 4IDJL 4X7SL 2BHZA 3SQOL 2D7OA 3BKML 1DN2A 4Y4HC 3VRIA 4R4BB 1CDHA 4PB0L 4TTGA 2Y1VA 2X89A 3L3GB 4XMPH 4UNVA 5DD6B 2VWEE 4WEMB 2NY0D 1N4XL 5C09D 4X5WA 4Y2DC 2VAJA 3CFKB 3AM8A 5IB2B 2XNAA 5IG7B 1T1YA 1VFUA 2V5TA 5J3HC 5BS0D 4BKLA 3S36L 1SVCP 3FOMA 5DHVB 1SQ2N 2B1AH 2N4IA 4GQ9L 5TE7H 5ADPH 5BV7H 4KDTC 4M7ZC 2JJSA 3FHQA 5JIHA 4TUOB 4NQDA 3EFDL 2LABA 2X7LB 2DM4A 3W0WA 4HX1A 4LASL 5E7BA 1XF4A 3ARED 1WBYA 3OV6A 4LL9A 4Q0XL 4OV6F 2NNAB 3JWOC 3ECBA 4HULB 3DHMA 4YHMH 2IFFL 4HT1H 4XCNA 3MV11 2VR4A 4MXWH 4ONGH 2R69H 1DQLH 4L8SB 2Q7YB 2G75A 1YPZE 5JMRA 4PJBB 4M6OL 3CFBB 3W0WE 1FZOB 4RAVA 3DROB 1P7QD 4WRLA 1ZSDB 5BO1H 4XAWH 3I6GB 5EORL 3BW9A 3LDBB 4JG1H 1PDKA 1P84K 1HHJA 4JQXA 5HVWA 3HLAB 4X7CC 3Q6GL 2EECA 1SYSA 1CGVA 3DUHA 3QXUA 1INDH 3IJHA 2VOTA 4PV9B 4PJBF 3RGHA 2NY2C 3G5ZA 3SBWC 4NKDA 1CGWA 4PTUB 3PQYE 4LSVH 4UINH 3HUJA 3ZSSA 5KVDH 1DEEB 5L2KE 4HDIB 1IT9L 2V17H 1P7HL 1AO7E 5BQ7A 3LKPA 1QTYT 4ZSOB 2KQNA 1YUHA 1Y6MR 4OCNC 3CH8A 4YX2L 2GI7A 4X8JB 3IFOB 3H9SB 3GMQA 4UT6H 1N26A 4G5ZH 3TJEH 3H42H 1L0YA 2WUBH 4Y4FA 3DBXB 5KJRH 4U1HA 3MSPA 4EIZC 1NL0L 1VADA 5LG1A 1OT2A 5JMOC 2QQNH 1E4KC 2ZNXA 2V5YA 4IHOA 4J3TA 3W39B 4BSWB 4Z77B 4OFYD 4X6DF 4N1HB 5F7NC 4QRPB 1D6VH 4HIIB 5JR1L 1A6ZA 2AQ2A 1MH5B 2A0LC 4JFXA 3QAZC 3OKYA 3UYRH 4HUVA 2NY4D 5KVFH 1G0XA 4PJ8C 1MRDL 4K2UL 5HXMA 4XP1L 3LN5B 5DA0B 4X5WB 3RVXD 5CP3A 1Q38A 5ETUB 1G9MC 1FYTA 1INQA 4V2BA 1GSMA 1MFEL 2CIKB 2HFFA 1U0QA 3ARGB 4RIRB 5DYOA 5F21B 1U41A 1KT2A 3WN5B 5JHDB 2APTA 3REVB 1PZ5B 2EKSA 4LSPH 2V2TB 1MHEA 4JRXB 4TUOA 1NDMB 5GHWL 3RVUD 5IB3B 4H1LG 4O2CB 1OTTC 5MHSD 3S5LG 2R2HA 2BOBB 5E6IA 1HHIB 2NX5D 2P4AB 3S37X 5LAXA 3V2AR 1A7PL 1OOAA 3R4DA 5DEZA 5E8DL 2EXYD 4PJFB 4OIBA 1IAKA 4NKOB 3BH8B 2C3VA 3O2VH 5JORB 4NQED 4GG6E 3HPJB 2XFXA 15C8H 5IW6B 4NSKB 2EZ0C 2ENSA 5IUSA 3DJ9A 2X4OA 1EV2E 4PUBH 3MRLB 1JV5A 4X7EC 3T1WA 1KPUB 3LKRB 4HWEH 4X7DC 5DJAB 3B6SB 3HI1A 1FE8H 2BY3A 1WIPA 3HAEG 3ABZA 2XZCL 3H3KA 3TZVD 1QBAA 1BJ8A 4HXBH 1OGTA 1CXHA 2XI9A 3DX8A 4PJEF 3I3DA 4KMQA 3LQZB 1DN0A 3F58H 5C0ND 5J1TC 4PLOB 3TO4C 3SKJL 4J3UA 4JM2A 2UUDK 3QB7C 4PRIB 5DEFA 5JIPA 1T4KB 1I1FA 1WAAE 4PR5B 3VI3F 1V3KA 2F8XC 2XN9B 2WUCH 2YPLB 3TVMD 5SWSE 2VLRA 3AUVA 5ESQA 1JHKH 3SGKA 5H94B 4KH2A 1T5WB 2EDBA 4L8DB 1DDHB 1SY6H 1XT5A 2DMKA 5IW1A 5D72H 3OJVC 5C0BE 4JFPB 5D2NB 1I1RA 4QT5A 3IDMA 4M7LL 4TULL 3BP4A 3U83A 2NR6C 4WVRA 5DEGB 3LKOA 3IAPA 4F9PA 2NW2B 5E99L 4HK3N 5JUEL 4XCYA 1MCSA 2KKQA 4GBXA 4OCSL 4TSCH 2B1HH 4JO3H 5ID0B 5EPMA 3A6BL 1OTUD 4L5FH 4WWKD 5L2JA 4LPYA 1AXTL 4PYHA 4FABH 5EU7E 4DKFL 2W60A 3BPCB 3GBNH 3QDAA 6FABH 3NACH 1SJHB 3CDCA 1K8IA 1WBXA 1QG3A 1I7UA 2VZ1A 3GUTA 1WV7T 5B8CB 1NDMA 3PL6B 1R0AL 5CBAA 4LHUD 1LEGB 2DJSA 4DJMA 2Q8BH 5ID1A 2P5WE 5GRXG 2IAMD 1DVFB 2XYCA 4D2NA 2N56A 4U1KB 3E6FB 4UV7L 1KJMA 3DSFH 1TQCB 2BSED 2MHAB 2JCCA 1G84A 1NC4A 2C4FT 5DMKB 1D6EA 2F54B 5DFWH 3EIFA 4L3EB 3NCBB 4CRPA 4WI7A 1RIVL 4BKLB 2VISA 4UTBL 2JELL 1RZIB 4OCWH 4YHOH 2HFGH 4WI5A 1ZANH 5HPMA 1XR8A 4DVRH 3L1OH 4DEPB 1T21B 3EHBD 3ETBF 3BGMB 4NNPL 4X6CB 1RJYB 5JA9A 4QWWD 3WFDL 2AXHA 1AY1H 4PJEE 4ZFOB 3E6HA 3ULSB 2Q8AH 3C5ZC 5C7XH 5DRXB 4PRNA 4C56D 3PIQB 5BV7C 3GSQB 2WZPD 1A7RL 3QIBC 4B53A 2XA3A 1IQWL 2QR0A 1PEZA 3HN3A 5IEHB 1F58L 3LV3B 3V4VH 2VJXA 3EJZD 4L8SA 1B2WL 3V6ZB 2JK5A 4NCC1 4HIEA 3MRPB 5GS1C 1WAAF 4W4NA 4ZFGL 2QHLA 5IJKC 1MFCL 4FQIL 3WLBA 4OD2A 1X4YA 4EN3A 1N8ZA 5CLWA 3LQAH 3QDHA 3BW9B 3T04D 1LO5A 5I1AB 1WZMA 2F74A 2EIBA 1DJSA 1NEUA 2CXGA 4U1IB 1F2QA 3I75B 4X80L 3GSNB 5ISZA 1M7IB 3H3BC 3MV7E 1WWWX 1NGWA 2NY3D 2XN9E 3ARSA 4PP2A 5H2BB 1U3HD 2IAMC 2YA2A 1RHHA 4Z76B 4G8EA 1U9KA 3NCMA 4OLZL 4BQCA 4K9EH 5D71H 2Y23A 5E9DB 5GGTH 3BKYH 1UWXH 2P8PB 4Y5VB 1ZE3C 3U30C 1IGYA 5CWSA 3HE6A 3TBWB 1MVFA 3EOTH 4OZHF 4PGBB 1ZHBB 3BWUC 3PP4H 4PRDB 4XPTL 3RY6A 2ARJB 5SX4I 4NUGH 3UJTH 4L8BA 1MHCA 4U49A 3MJ7B 1H3GA 1TJIL 1OW0C 2HKHH 5EC1B 4MJ5A 2GSIA 1KJ2B 2IGFH 3IDNB 5CJXC 3B2VH 1IMHC 3DYOA 4UBDD 4IHOB 4Z77A 4NN7B 1CDJA 2MPAH 5JOFA 4N0UE 4OZ4B 3I6LD 3FO0H 3IAGC 4KKNA 3FO1A 3QDJE 5GS1A 5JA8B 3NFNB 4GMTH 3MCKA 4I3RL 4MQ7B 1O7VA 1CICC 3BIKB 1JCKA 2WWKT 5CJQH 3FAWA 2DWEA 2GFBA 4YDKH 4N0CC 5I76A 1T83A 5FUZL 2X9YA 1J1PH 2R0KL 4ZUSA 3P11H 5K9KB 3RKDC 4MSWA 5B38G 4KXZH 3ROLA 3W39A 1WTGT 4YHIA 4LQ1A 5F3HA 3MROB 2OTWA 4PIRF 4AMKL 4M43H 4HG4J 2OK0L 3MRFB 2CK0H 5CUSH 2BVOB 1P2CB 3WKML 3BKCL 2A6IA 3C2AH 3DUUB 3V0VB 5HHMB 5DJYA 4JY4A 1IM9A 2EC8A 1KC5L 3N1FC 3GSNL 5GS2D 3LPWA 4BZYA 4N8VA 4YBLC 2UYLB 3WCYA 4G6FD 4L1HA 1AE6H 4HMCA 3RTQC 3G6DH 3TYGH 4CGTA 1HKLL 1N8ZB 3ARGA 5E6ZA 2YXFA 4PB0H 2W38A 4G7VL 3SDAA 4CU8A 1S7WA 1DE4A 4EI6B 2OM5A 4LARH 1ZKAA 1FFPA 3UTTA 3VGBA 1N4XH 1KGCD 3OB0K 4E41E 4K94C 3O45B 2ZUWA 1J0KA 4NQVB 4ZFZA 1PSKL 2APXA 3SN6N 5L6YL 4ZS7H 1F97A 4C54A 1U95B 3WO3B 4GQ9H 4Y19A 1E27A 1RZKC 4HWNA 3SY0B 1ZT7B 3HE6B 3HS0B 4XPFL 2ARJA 1NBYB 4L4TD 2CKBH 4C55A 1MFDH 4F57H 3IDIB 4PG2C 5DJAA 5HBBA 1I4FA 4HT1L 1CGSH 4QRUA 4HMEA 1BVKB 4NO2B 4AEHL 3IT8D 4I0PB 3C6LD 1T6WA 3IDMB 4QOKA 3W0WB 1ES0B 1AHWA 1W72A 4GLRH 4YDVA 5IVXE 3GM0A 5BO1L 3OZ9H 5EO0A 2PYFA 1HIMH 4D8PA 1UZ8A 3NZ8B 4XZUA 3LKQB 3HFML 5HGHB 3ARFA 1VPOH 4MAYB 1X5ZA 1FCGA 1OF2B 5HYSA 1DTUA 2ZKHH 1JVKA 3VXUB 4POUB 4GRMA 1KCRL 3ESUF 4NM4L 4ZD3L 1K8IB 1WBXB 3I6GA 3I2CH 5J57B 1MFAH 1ZXQA 4JB9H 3GUTB 3LD8C 2GJ6B 1QSFE 4RGNC 3FN9A 3FCTB 2NY2B 3FQWA 3X13A 1QFOA 1XF1A 3VXMB 5IFJB 3TJEL 2BSTA 5C2UB 2WUBL 3OKKA 5KJRL 3LZFH 4HUWB 3CDYA 5EZJB 3UZQA 4WTZA 4KUCD 1J10A 1MVUB 5D2LA 1A0QL 1T7VA 4DFHA 4L3EA 4G42B 2UWEB 3WS6C 2P5WD 4L3ED 1KCSL 4LLWB 4PJ9B 1ZHLB 3BUYB 4YFLF 4XMKH 4LIQL 5HHVH 1OCWL 3WUWG 2EKJA 5J6HA 1XH3A 4H0HB 4UIMA 2O61B 3EO9H 5FO9A 2R2BB 1EX0A 3F7YB 4JVWA 3FB7A 4ZXBB 5KVFL 2UWEE 1MRDH 4K2UH 1EZVY 4XP1H 3O45A 2JJUA 5KG9A 1RJYA 4E41A 1LP9F 4NDMB 3DMMA 1R6VA 1LGVA 1A6ZB 4ZODA 3PWPE 2VSCA 1BX2B 5EFIA 5D7LE 2ZG1A 2FBOJ 4R96A 4LSPL 4TUJA 5DJXA 1N5AA 4ZO6A 4KK8C 1MRCH 3V6ZA 2F19H 4QGYA 1A4KB 3SDDD 1RV6X 4HPOL 1RZGA 4ZOAA 4QTHB 4I4WA 4DKDC 2D7MA 2A9NL 1FH5H 1IVLA 2R8SH 5CD5C 4UUJB 4QRRA 3G6JB 1FP5A 1IZKA 2GJ6E 1A7PH 5ACMA 4P48A 1PZ5A 3KS0H 4F7TA 8CGTA 32C2A 3IDYB 4XBPA 2CLZA 5BV7B 2AKRA 3MGAA 4RMRA 5ISZB 3FQTA 5C0CE 5DGRA 2WP3O 3Q1SH 4PUBL 5FYLD 4Q58C 2OSLB 4RGND 1UGNA 4Z95H 4CN6A 5MEOB 3OG6B 1FZJB 1ZLSH 5J11B 1AKJB 3L95B 1IGTA 5DS8B 3H9YA 4EBQL 2EEDA 3B3IB 2DN7A 1NEZG 4CMMB 1DBAH 1QBML 2XZCH 4X83A 4OGAD 1V3LA 3BFOA 5AD0B 4PFEA 2AJXL 1AFVL 2NCMA 3INUL 5JDJA 4KK5D 1J0JA 3P0VH 1N0LA 1GZPA 2G9HB 1G7JB 3ILQD 3D3VA 1UKQA 3FT4B 4U1IA 3UJIL 1RUML 1MF2L 4RFNB 2MJWA 3WFBH 1XCQA 1DVFC 1ONQB 2E8YA 4FQHB 5LGHL 5CP7A 3K4AA 1A8JH 4JHAL 4KJWD 3P30H 3PP3K 4P2YA 1RIUL 4DN3H 1QFWH 2Y06L 1BF2A 3O3DA 5FYLH 4LMQE 3NN8B 5I1CH 4WWKA 3LQMA 3PWPA 3MACL 3AROA 5KSAA 2X4SA 5BZWA 4MQ7A 1KLFA 2ARWA 4H5SA 4PY8I 2VDRH 3O2WL 4MD5A 4YWGL 2YPLA 2UV3A 2XT1B 1EO8L 3GJFH 4M7LH 4TULH 3WHE0 4HIHA 2UWEA 2JJVA 1C8PA 4YK4C 4WY7L 5DFVC 4JLRB 2IC2A 2OMNA 1Z5LA 3V7MA 2P46B 5JUEH 1YMMD 1AD0A 4OCSH 1XZ0B 5INCB 4Z78B 2AJYH 4XTRD 3RBGA 2VLKA 1INEH 2W0KA 4WI4A 4XXCC 3SO5A 4DVBA 2CDGB 1YEIL 3B5TA 4WFFE 4NO5B 3RIFK 4NRXA 5KSBA 3HE6C 5ILTL 1FVDA 4HS3A 3B83A 4FQXD 5DJXB 4WHYH 1AGFA 5F7FA 4P2CG 5HD8D 1R0AH 4JHWL 4RSVA 4P23B 1LD9B 2YA1A 3VD3A 1I7RB 1UCBH 2XACC 2RIKA 1BGXL 2AEQL 4F7TB 4YGVB 2JJTC 2XV6B 4NQDB 4OLEA 2NMSA 1M71B 4JRYD 4J3WA 4I3GA 3RKPA 2BNUA 5CBEB 3SHSA 1MCOL 3DVNB 4QYOA 2EIEA 2D7QA 2VN4A 3BUTA 4R7NA 3RY6C 1L9NA 3ECBB 1YY8B 1I85C 3DUUA 4LHQB 3QDGD 1KB5L 1CFNA 4XCNB 4YHOL 1IM9B 4ERSL 3E6FA 3T77A 1ZANL 5L2KD 5D1XC 4PRHD 1RY7B 1PD6A 3QO1B 4LVEA 4NNPH 4Z7QF 3VFNB 5BXFA 1KXQE 3U36B 2Y07H 3CFEB 3OJMB 1AY1L 4GKZA 1NCAH 4L3CA 3BRDA 5KVEH 2DQIH 1XCTA 4ZPTB 1NDGA 1A7RH 5DFVD 4L3AA 4JHZA 2HG5B 1TNMA 1B2WH 1EFQA 4MGXA 3GGWB 1FYHB 5I18L 3PDOA 3FN3A 3H8NA 1VEOA 4MA1C 1UZ6F 2HN7A 3CVHA 2OS7A 2UZXB 1HEZA 1W72L 4KQ4H 1D9KA 4M48L 4QRTB 5JW5A 1OAUH 4WW1A 5E9DE 4U6YB 5EU6D 5F1OB 3CX5J 4PY7A 4BM7A 2EE6A 3HE6D 4Q9QH 4JKPH 3FTGB 5T1KD 5IQ9B 5EB9A 1BEYH 2KPNA 3MRPA 1K4DB 2OX5A 5HD8C 5C09A 1M7XA 5BZDA 1KELL 3RVTC 1QZ1A 5I1KL 1CR9L 1QFPA 1NSNH 1QLFA 3MA7A 3RHWK 3GSNA 3SPVB 2BVYA 3DRTA 3DTXB 1BF8A 3NTCH 3MCG1 5HJ3A 5MI0C 1XIWC 3EOTL 3SEPA 3PP4L 3IU4L 2XRAH 4GW1A 4D0DA 3GIVA 4NZRH 4JM4L 5C2BH 3VXMA 3RZWA 5F1IA 4PP2B 3TFKD 2VR9A 4HS3B 1FVDB 4ZOBA 4I2XB 3IFLL 1OVZA 3RA7L 5IKCB 1TJIH 4WU7A 2RCSL 3I9GH 3QEQB 3U4EB 3VXUD 1YNKL 3RAJH 1GXEA 3B2VL 1V7NL 5BMFH 3K74B 2EH7H 1H3TA 3M17A 4PRAA 4OLWL 1ZHBA 3I85A 3QG7L 5EN2B 5F7DA 4B7IA 4G42A 1CLYH 4OF7A 4OLUL 1A6WH 1KT2B 1DLHA 3TPUB 4NRYB 4WDIB 3VFSB 4NNXB 2ORBH 3ARDA 1SEBA 2H32H 4YXLH 3OAUH 3PJSA 4MLIA 2R2EB 4FP8H 1J0HA 2UVFA 1AGCB 1CFVL 3B9DA 4DGIH 4H20H 4I9WE 1KEGH 3UTZB 5FK9A 1KCVL 1ZA3B 1QO3B 2AV7A 5LAXB 4KRPB 4X6BB 2PW2A 2R0KH 5E1HB 5IOPA 3IFNH 1J0IA 2OI9C 4IOFD 5ANMA 4ISVA 1JF1A 1MVUA 5D2LB 1U92A 4PG9B 3U36A 1IKFL 1RZGB 2FHBA 1HCFX 2H1PL 1VEMA 5CKAA 3VI4E 3WKMH 3S34L 3BKCH 2X1WL 3QI9B 3SDAD 3C2AL 4ZQKA 4POYA 4QRSA 4PJGF 4MA8L 3UTTD 4I0PD 1IC1A 4DUVA 3RWFA 5AAMA 5DLMH 2CDEB 3GSNH 3RNKA 5B4MC 5JHLL 4X9BA 4EN3C 3KVQA 1OSZA 4IOIB 2DLTA 1UB6B 1EEQA 3T2NH 4LBEB 1CD0A 3MGTA 1HKLH 1I3GH 5EFIB 4XP9H 1BFSA 4U6YA 1QSEB 3F7QA 3NFPA 2Q76B 5KVGH 1BFOA 1JGDA 2K1MA 3L3HB 3QXTA 4LARL 4LGRB 1EDQA 4HZLB 4KK6D 1BOGA 1F11A 3VXQA 4M3KB 1C7SA 3UTQB 3DRQA 2F58H 1A4JA 2YPVL 4R0LA 1TMCB 3RRQA 5BZDB 1IFHL 2AV1A 1QLEL 4PD4J 1PSKH 5JXAL 5D2NE 2W91A 4P2RE 5L6YH 4ZS7L 1BIIA 4JFOA 4KDVA 4HKJB 3QWRA 4LPVA 1UVQB 3WFEH 4WU5A 4R97C 5CD3B 1VFMA 2B4CH 2D9CA 3Q2CA 1A7QL 3VFUA 2ZUXA 5CSGA 3VW3L 2MQCA 5SWSB 4XCFH 5BJTA 2BY2A 3S35L 2JKXA 4NKDB 2CKBL 1FZJA 3VXPA 2J6EA 3WIHH 1S9XB 4OF8A 1DR9A 4EUPG 3LEXA 3GSOA 1J86A 3T0EA 1G9NL 4AEHH 1Z3GH 2YK1L 1F4WH 4IEFB 5E5MB 3CCHA 1NBYA 4LLVB 1BREA 2QKIB 3ALPA 3CVHL 3IVKB 1IKNC 1HIML 2FX8L 1TJHH 4XH2B 2E9WA 2BNRD 4LAJH 1TZHB 1X5GA 4ODWA 3T4AB 4KI1A 3D25A 4GKOA 1ACZA 2DQFA 5C92A 3OGCB 1J9CT 4JFZH 3MTRA 2F5AL 1GOGA 4K8RD 3VXME 5T3ZH 5CP7B 4Y5YA 3ZYIA 4HV8A 1Q9OA 1KCRH 1XGTB 1ZVYA 4NM4H 4ZD3H 1NBZB 4GG6B 4AEFA 4LNRB 4LK4A 1MFAL 4JB9L 5EU7C 3GHBH 2BERA 2AJUL 2O5ZL 4MAYA 5TDPA 1FHGA 3QDGE 3FO9B 5CCKH 1UT9A 4P23C 1C12B 2HKFL 3OXSB 3RWEB 4ONHA 5ICZA 3SO3C 3BP6B 4NQXA 2VLRD 3WIIH 2VXQL 4L8CA 1QBLL 2H2SD 1KLUB 4H8WH 5JHDE 5BOZG 4U7MA 1XF2B 4S10A 1U8JB 3TJHD 5ICXA 5CBEA 2PCPA 1J05B 2X5PA 3VRJB 4X98A 1TETL 4AY0A 3QIBA 4U05A 1JNJA 4CBPA 5I16B 1BZQK 1JI1A 3MRQB 5GS0D 1HH9A 2XG5A 4BQ9A 2Q6WA 3QJFB 2JE8A 1EEZA 1U42A 1V5JA 4YK4B 3VXNA 3N06B 3L3IA 2Z4QA 5F9AC 1RFDL 1KPUA 3DV6A 3LKRA 3V0AC 4EVNB 1QA9A 3LN4A 2XWJA 4LCWE 1KBGL 4UDUA 3PHSA 2SEBB 1J11A 1NFKA 3KPPB 2AI0H 4K3JL 4XGZA 2EDDA 4WUUE 2F19L 3FB7B 1WIOA 3KLAA 3IRPX 4HPOH 1Q72H 2YXMA 5KG9B 5A2JH 2UY7A 3REWA 4ZSOE 2R8SL 4CNIB 1PZUB 4O5LH 4CMHC 2FX7H 4Y2DA 3TT1H 2Z31B 4P5MA 4PJ8B 5L2KB 4R96B 4LCWB 2P47B 2YA0A 1I1FB 2FYYA 1GGBL 4J4PA 4MB3A 1A4KA 5HYFA 4LLVA 1BD2A 3DV4B 3UC0H 3GMLB 3OKLB 4WUUB 3CSGA 2V5RA 4PV8B 1WEJL 1S9WA 3RPKA 2HG5A 2F9BT 4RMTA 1KJ2A 3D25B 3IDNA 4JFPA 3OL2A 4JY6A 1QBMH 3C60C 3N85H 4GXVL 3MRJB 2EDNA 5HHME 3MV9D 3TO4A 2ZSVA 2AXGA 3BZ4B 1JZ2A 4QHLA 2AJXH 1AFVH 5JW4M 3RFZC 4LVOC 1FLRH 5EU3B 1WFOA 4S11A 5GGRY 4YDIL 2IF7A 4QHUA 5MEOA 1BQHB 5J4MA 3RWHB 3S3PA 5F1IB 1PX3A 3BMVA 1A1OB 3CLEH 4X6EA 4CAGA 3RZCA 2BVPB 1A14H 2EDWA 3WFBL 1Q9KA 2BDNH 1KB5B 2W65B 4S1DC 4MB5A 5HDBE 1N0XL 2FSEA 4UAOB 5GRUL 4L8CB 5KTEH 5C3LD 2G9HA 4DN3L 4Y5XC 4YHLH 1H8OA 1XF3B 2HA1A 1UM5H 1HHJB 1Z9OA 2VLJA 5DMYA 1SHMA 1QFHA 2ZOLB 2ERJC 2FIRT 3MACH 3QDJB 3RGVA 4W6YB 3KPSA 4X99B 4U1MA 1J05A 1RUQL 2ICWB 1EO8H 1G7QA 1X7QB 4MDJA 3EZ8A 4PTUA 1FNGA 4GW4A 4XAKE 4QNPF 5KSVA 2X4UB 1FBIL 5GRVK 1RMFH 1EJOL 1NUNB 1ZA6A 3MUJA 5HVGB 3ULVL 2ED8A 1PBYA 2AJYL 4A6YB 1K2DA 3OQ3B 3MLXH 5DI8B 5CSZA 5JDSB 1INEL 3T08A 1RZ7H 5KSAD 2OZ4A 1YEIH 3H9SA 1ORQA 4KKAC 4I9WD 4KMTL 3ZO0A 1DBKH 4RMQA 4U4BA 2I9LA 4V2CB 4J1UA 5ILTH 3P0YL 4I1NB 4HK3J 4M3JA 4WFGE 4GAFB 1KIUA 4ODSH 3I50H 4U3XA 3UTZA 5IEKA 1KEML 1ZHKA 4X6DB 2FIKA 1UCBL 1MAMH 5IROA 2ZZUT 1MH5A 5FHBH 4WW2B 4S1RL 2Q76A 1T1WA 1WGOA 1K85A 3SDDC 4LKCB 3FONA 1QOKA 4PLJD 5CD5D 4R0LB 2H32A 2P5EE 4K7FB 3X3FL 1QHOA 2NPLX 4QRSB 4Q9BA 3DIFA 3BIAX 5I9QB 1KB5H 4HXAH 5IHZB 1LK3H 2ITCB 4U1SB 3KAAA 4X7TA 2DD8H 1TVBA 1B88A 3CFJB 3HE7C 2MWCA 3PNWA 3ULUL 2R29H 2E9BA 1NCAL 2VB5A 2DQIL 4S1SL 3NFPB 3IFPB 1WT5C 5IFHH 2F8OA 4OZGF 5MENA 3L9RA 3X17A 4Z7QE 2XPGB 3EYOB 3B5GA 1A4JB 2A6DB 2BNQA 4L3EE 3DI2B 5E5MA 2A1WH 5D2LE 5CILH 4KQ4L 5KSAC 3KHOA 2ICES 1CWVA 1R3HA 2B20A 3TH4T 4KVNL 3ZTJH 1Q0XL 1OD9A 5DJCA 1KIRA 2V2WB 2AJZA 4MVBC 4EZMA 4L9DA 8FABB 4Q9QL 2X1QA 1YMHA 2V9QA 5A16A 4P2OB 4IOFC 3U6RB 1BEYL 3PDOB 3R0NA 4JG0H 2ICWA 4IIQC 4WCYH 5FOBB 2HN7B 4TOYL 2R1WA 4P57A 4YXKL 4YBQD 3DSNA 4LLQB 1A22B 1J18A 4PJAE 1CFBA 4PY7B 1DSFH 1K2DB 3HZMA 4KKBD 1DLFH 4NHCL 3BGFB 3Q48A 1YA5A 1SJEA 4PJ9D 3F7RA 1OGAE 4N8PA 3O41A 4NZRL 4PRPE 3FQNB 4JM4H 4RGMB 5E4IA 4AM0B 5C2BL 5BVPL 2DQTH 4J1UB 2CRMA 4J3OC 3RL2B 3TH2T 4JZOA 1LO0H 1X5XA 2Z8RA 5TPWL 2RCSH 5IB5B 4OBRA 1YNKH 3NFSL 1U8KB 2Y7QB 3C9NA 1U58A 4WTZG 3QISA 2EXYC 4KK9C 2BFVH 1QR4A 3L7FA 3QEQE 2DQDL 3V0VA 2OP4H 4ZAKA 3LN9A 4HQQH 4I2XE 3CZFB 3OAUL 2EEBA 1F02I 2FO1A 3D0VB 5DJ2A 3ARRA 3VXNB 4DGIL 3ISWA 2C3HA 1KEGL 3MLWL 5EN2A 5FGSA 2R0WL 4Z7UF 1LO4L 3UP1A 5LJYH 2FECL 4XNZC 3EZJB 3HAEB 4P5TA 4F58L 1BQLL 4QEGA 3IFNL 2PKDA 3BPOC 4NUJA 3I02B 1AP2A 4JPVH 4FG6D 1Q94B 2FHFA 1JNLH 2AK1L 2MOVA 1AGCA 1GAFL 1JWUB 1A64A 1JWSB 1OAQL 3O9WD 2EDHA 3MBXH 3QQ3A 3P77B 4K3HA 3MO1A 4JO2L 4EIGB 1HWHB 1S7TA 5DC0A 1C7TA 1LWRA 2DWDB 4PP1C 5IOPB 4IRSA 3IETA 3L9RB 5F72S 4UIKH 1RZJH 1R3IH 3EYOA 5DRZA 4U1LA 1ZVSB 3ULVD 1A6UL 2A6DA 1NKOA 1IBGL 4PGDA 3FB6B 5IMMA 3T2NL 1J0ZA 3T0EC 2FR4A 4X7SH 1I3GL 3QZWA 3UTSA 4PGJA 4MXVF 4FTVA 4OSUH 4XNQA 5DJCB 5KAQF 1OWWA 2GJZB 4PLNC 4AENB 1DANU 4I18C 4JY6B 1A1NB 4NZDA 2FDBP 4XMPL 1CU4L 4WV1B 2VNCA 3B9KB 5LBSH 4OGXH 2YPVH 5CINL 5D6CA 5HHOD 4QHUB 5EIIA 3S36H 5IV2B 5IW3A 4WWKC 4XVUD 2QR0B 1QSEA 2OZ4H 4PJCA 5CEYA 1TVDA 3ARBC 2FYYB 5L9DL 2B0SL 5B8CC 3MRCA 1M7DB 2B4CL 1WJ3A 1A7QH 2OMBA 3ESVF 5EU5A 4U2ZA 4XCFL 3BD5A 3ALXA 3CMOL 3WXVH 4LASH 4L4VD 3TA3C 1TJGH 3N1MC 1Z5LB 4NRZA 4QRRD 4YHML 1LK2B 4MXWL 3VD5A 2R69L 4JFDA 3KXFB 1S7SB 1IAII 4HLZG 4P9HH 1Z3GL 2YK1H 3DX9B 4WGVB 5D8JL 1UG9A 5GS3A 1VGKB 1HXYA 5HHMD 4D0CA 5IFJA 5HGDB 3V4PL 1BFVH 2HJFB 4EOWL 3CVHH 2HWZL 4R3SA 3RWDA 3CLFH 4LSQL 5E00A 4G8GD 1B90A 4LDEB 2H26A 5D7LD 3Q6GH 1KB5A 2F5AH 2EIDA 1INDL 2FSEB 1X6LA 1QKZL 3O3EA 4PJ7E 1ULVA 3SO3B 4E42A 4KK8D 3WN5A 5JHDA 1FFOA 1OD7A 1KJVB 3GEWB 4LLMA 4X9GA 5HYJE 3C8HA 1TVHB 3VXTA 3T0XA 1FIEA 3GHBL 4PRPB 1IT9H 2V17L 5E2JA 4X99A 2NZIA 1JWUA 3HC0A 4FXGA 2HKFH 3EYFA 3OAZK 3RZCC 5CEZD 1LE9A 4UT6L 3WIIL 4ELMF 5C8JA 3O2DA 2VXQH 3S4SB 1QBLH 4G5ZL 1OB1B 3AVEA 4TUJB 1T1WB 1L6XA 4OIIL 3C5JA 1JE6A 3QO1A 5DURB 2BVQA 1NL0H 4L29B 4R4ND 5C0EB 1T7WA 3GSWA 1NQBA 2H32B 5DJ6A 1KYOJ 2Q3ZA 1QSFA 3VDAA 1TETH 4N1CA 4DFIA 3MV01 4U6XA 2DYPD 4CVXA 3K2MC 3IDGA 3FRPA 3ULUE 1NCDH 2FL5B 4G9DA 1WWAX 2OR9H 2FWOA 1X44A 5TE4H 3CXDH 5JZ7D 5F88B 3M1BA 1BJ1J 5IV2A 3CFDB 1BAFL 3QIBB 5EIVA 4GKNA 4JM2B 1B6UA 1MFEH 3MZGB 3LMJL 3SE4C 1HH6B 3JTTB 5ECJE 2G2RB 1XGQA 5EBMA 4BFBD 3O4LB 4KJYA 3OKNA 1AGEB 1YPZF 2N7BA 1SM3L 3ZKXC 3BEWA 3V5HA 1U91B 4XWGL 3U0PA 4C4KT 1YDPA 2WQRA 5E8DH 4M5ZL 3B43A 4JEGB 3G6JE 4JZNB 1GGBH 3KWWB 3CSYB 3WHE1 2OTPA 3TM6A 1E4WL 3QUKB 2NW2A 1SEQL 2P1YA 2RR3A 1AQKH 1KPRB 3H9HB 1BQUA 2P24A 3N50A 3RDTA 1CG9A 5T3XD 1FL5A 2HRLA 4MNQE 4J2XA 1FE8L 4APQA 5CGYC 1YYML 4KJWC 3FFCA 4F3FB 5HHOE 4Y4FD 1H5BA 3L3OA 2DL2A 3QH3B 4J4PD 3PE9A 4JKMA 3UTTE 1JHTB 5I19H 5D70L 2MKLC 3SKJH 1AD0B 4JZOB 8FABA 5DR5H 4AIOA 3VD9A 5BW7C 5D7JA 5A2LH 2XKNA 1O7SA 4XNXH 1FNEA 4M5YH 5ID1B 1K5NA 4BSWA 2FJFA 1YEHH 3QQ4B 4PRID 2DS4A 4U7KA 4RCAA 5KTEL 1JHKL 4D8PB 5TDNA 5E7FA 4ONOA 5D9SA 1Z9MA 3VE0B 4JFXB 4LPTA 5D72L 2NLJA 3IKCB 1ZGLM 1NCNA 5T1KA 3FB5B 4S1QL 3LDBC 1ZT4B 4NN6B 1F3DH 43CAA 1KN2L 4GRMB 3D2UB 2DF3A 1UM4L 4XVTL 3S97C 4LCCC 1A6AB 3E2HB 5CZXD 4NBXB 4R90L 4FS0A 4MQXC 2OJEA 5D1QD 3SDYH 4P46D 2B1HL 5ALCH 4JO3L 4P46A 2ICCA 3FJTA 3MLXL 2VLJD 2BNUB 1U58B 3FCTA 4NT6B 4C4KO 1J1XH 4RFNC 1RJLA 3GBNL 4KMTH 4JAMA 1DBKL 4PTTA 5EZOH 1TNNA 2HLAB 1B0RB 2PTTB 4KWUA 2C1PA 3EW3B 4Z9KB 4O9HH 3MNZB 4LFHD 1ZVSA 5DI8A 4ODSL 1CLOL 2C4XA 1FNAA 2Q8BL 3L7EB 3BX7C 2I9TB 3PV7A 2LVEA 3PL6D 3KLHC 4XXDB 1ZWIA 2I9LB 4QTIH 1MCFA 1AP2B 2EYSB 3LQAC 2YD1A 3RJQB 4ZXBA 3W5NA 1R5WA 3VH8A 2WWKO 12E8L 2A74A 4LRIC 4MNGA 4Q9RH 5E9DD 1RIVH 5EIIB 5BCAA 1T7XA 2F54D 3WNOA 4OCWL 3W9EA 2DQUH 3C5ZD 2KZ1B 4F15C 4HXAL 5F1SA 1LK3L 1MCWW 4APQB 2ICWI 1OP3K 3TBWA 4PJ7B 2DD8L 2XN9A 2OTUA 4AH2B 4OD1H 3UBXA 2GTZA 5KZCD 1FN4B 4LLUA 3DNKA 4ZUTB 3ARBB 2R29L 2E9JA 4S0TD 1RJZA 2AP2A 2DB8A 4HGWB 4L8DA 3LEVL 4X7FC 5GJTH 1NCBL 4JPKL 1IQWH 1G7IA 3FZUD 4LVHB 4UT7H 1F58H 4K55A 3DX9A 2PETA 1E0OB 3ZKND 1VHPA 1CT8A 4IDLA 4FQXB 4NYLA 2A1WL 3BGAA 5CILL 4FQIH 3T0DA 4M7ZB 3LQAL 1KTKE 1MSPA 3KJ4B 3JXAA 1Q0XH 5IBLD 5GGRB 1V3MA 3MRCB 4JR9H 3E1F1 2Q20A 4PJBA 3DVFA 1GCFA 5MERB 3QUXB 4ZS6D 5ICZB 3D2UA 3VD4A 4J7RA 1IAIM 3NIFF 4XPAH 5GIRA 3SDXF 1EXUA 5D1ZA 3PL6C 3KLHD 5F96L 3X11B 4OLZH 5EBLA 1RZ8A 1U8JA 1OAZL 2PO6D 5A16B 2D7NA 3PQYA 1JYXA 4U3CA 4N0UB 4FQHA 3HA0A 4G8GA 1AJ7L 4M00A 3T2PA 4NO3A 3KDMA 4NKMB 3ARFD 3U2SA 2H41A 2HT4C 5F93C 2OYPA 4OKVA 1HH9B 4RBPK 3VXMD 5JOPE 4H25A 1S7RA 3MNZA 5DMKA 4ISVB 5J0BA 3LKPB 1O5DT 5DRWB 5DK0B 1GL4B 3NFSH 2DTMH 4M61A 3SBWA 4YHYC 3QJHB 4HH9A 2R0ZL 4OFPA 1LEIB 2BFVL 2VXUH 3FO0L 3FQNA 4XC1L 4AM0A 3SQBA 4HUXA 3UTPE 2DQDH 3RL2A 4N90E 4GMTL 4I3RH 4GMSL 3MODL 4Z78A 1F6AB 4XI5C 2R9HC 1HQRB 3EJYD 5CJQL 4I18A 1TTGA 4YDKL 5C8JB 1JUFB 2YD2A 5FA4B 4EUPB 1JBJA 4P5MB 1LO4H 3KR3L 3PIQA 4WI3A 1J1PL 2Z93A 1BQLH 4QY8A 5DURD 3HB3C 3V0WL 4OFIA 2CLRA 5E2TH 2VE6A 1S7XB 1IM3B 3RPIA 1NMCB 4JPVL 5AAWA 5E2VH 1HINH 5I30L 1GAFH 5DUML 3PF2A 4O02H 3ARBA 3MLVH 4HFUL 3MV8D 5DYOB 4JO2H 4ZUWB 1LO5B 3WO4B 5I1AA 4P3WA 2EKSB 5CEXA 4DQOL 4FQQB 1D5MB 1WLHA 3D85A 4XC3L 5K93A 3ZKXB 1RZJL 5CD3A 1IQDA 3RBSA 4PJEB 3DGCR 2YUXA 1IBGH 2PO6C 35C8H 1BQHA 3T0WA 1U8OB 1YEGH 3EBAA 2E5EA 2HJLA 5K9JL 4RMSA 4OSUL 1QSEE 3KYKL 3PGFL 2HH0L 2UY6A 2OR7A 2WP3T 3JTTA 3P9MA 4G9FD 3VFVB 5SWQB 4ODXB 4Y5VA 3GSOB 5DRZB 1T20A 3VMNA 4GO6B 1CU4H 3MRRA 2I27N 5LBSL 4OGXL 3K7UA 5CINH 3KPNA 4QF1B 3QUZA 2UVEA 4G8IA 4A2LA 4PGZA 2OZ4L 1SMOA 5L9DH 1EZVX 2B0SH 5FYJD 5GGTA 5I66A 1T80A 3KPRA 4Y4KC 1NANI 3AM8C 2HFTA 3JVGA 4XI5D 9CGTA 4NBYB 4W68A 1TTUA 4XPFH 3CMOH 3WXVL 2F54E 4OQTA 5B3JE 3FHAA 5JW5B 3BZEB 1CDUA 4GOSA 4PPTA 3QAZB 1KF9B 1N5YL 2FX9H 2BOCB 3HB3D 3SGEH 2B39A 5L0QC 4NFBA 2P5WB 3FFCE 3SDDB 1LEIA 3RWEA 2EDXA 3P0GB 5FXCH 5GRZA 3V4PH 1BFVL 4C59B 4EOWH 3OZ9L 1HKFA 2HWZH 1NEZB 4D94A 4LSQH 1MWAH 5FO9B 5ABDE 5C0CD 3OKEA 1Y18B 3CGTA 1BFTA 4P46B 3WBDA 1L6ZA 2FJFB 1NGQL 1HQRA 1J8KA 2YKLL 4LSSL 4WEBL 3C8DA 5CGTA 1QKZH 1JUFA 1FFNB 3OTTA 4F37F 4WJ5A 4QRPD 3LB6D 1N5AB 1B0RA 3MRIB 1RULL 3EOBB 3RIAK 5J11C 3FONB 2Q6WB 3TBYB 4LMQI 4JZJB 1UWEH 43CAB 3QUMH 4NQSA 3P9LA 5F7DB 2YOCA 5DHVA 3SKUD 2NW3A 1QBBA 4ZNEE 4K9EC 2OJEB 3LZFL 4OIIH 4PRPA 4WHDA 1WFNA 3FQTB 2HMIC 4LU5L 4PRBA 4PB9L 2Q86B 5L8LB 5GS0L 4MDIA 4Y0GA 3QYCA 5B38A 3C2SA 4OI7A 1KCSH 4PRIE 5L8KB 2YD3A 1JPGB 4LIQH 1KCKA 4L4TA 4OCXH 4GG8B 4YC2B 5B4MD 1Q9WB 3RVVD 2EIZB 3MRNA 2OR9L 3MBEA 3CXDL 2J12B 4PV8A 1BAFH 4ZQKB 2PXYB 1KIRB 2V2WA 1XGUB 2XQYK 3RWFB 2V7HA 3EFFA 4JVUA 4K7PH 3G04B 5T1MB 4D9RE 2QV2A 2LAAA 2A9NH 3BDXA 1SM3H 4TPRH 4DGVL 2IAMA 5EO9A 1YY9D 3MXVL 5TGBB 4RMUA 2EZ0D 3ZKMD 5K9OB 1B4RA 5T3ZD 1HH6A 5C07A 4AH2A 1B0GA 3QDMD 2AK4D 3MRGA 5HPOA 4R7DA 4OI8A 3GRWA 4XPHH 3Q1SL 5HGAB 1E4WH 1G1CA 5CHNB 2VLLA 3ROOB 4Z95L 2FATL 4LVNC 3PG2A 1ZLSL 4PGCB 1YDPB 3MREB 4B7LA 3WS3A 5EBLB 3Q5TA 4YFDB 4QRPE 1YYMH 2ZWLT 5DSCB 4HBCH 2BSRB 4JCMA 5EUOA 5SV3A 4OFDA 3P0VL 2IG2H 4Y16B 5I19L 4YHNA 1EERB 4XNMB 1DBBL 5DR5L 4ZOEA 5MEND 1UXSA 3VGAC 1RUMH 5EZJA 1DQTA 1MF2H 1RUKH 3JBG7 4ZXBC 1CDYA 4M5YL 1LD9A 5GJSL 2E7LA 5GRWA 1EO7A 5LGHH 3AY4C 4JHAH 4P2QA 4P2QD 1CICB 4P2OD 1QFWL 1X5IA 1ETZB 5FYLL 5I1CL 4UIMB 2O61A 4F9PC 3H9SE 5I2IA 2X42A 2X05A 4JFFD 4U6VH 3T2OA 3OX8A 4LCYB 1AD9A 2ZG2A 4YWGH 1LO2H 1S7QB 1KN2H 3U9UB 5JNYA 4PJ5A 1UM4H 4XVTH 1U8QA 5T1DL 1F5WA 4R90H 4Y7MA 1OQOA 5K9QG 2WIIA 3TO2B 2APWA 5T1KB 4IIQB 3ULVE 4YPJA 2QTEA 3TJHC 2AW2A 3TYFB 3BOVA 4ZPTA 2VQ1A 5EZOL 1RD6A 3QXDB 1L0QA 4URTB 4O9HL 4JHWH 4NZUH 1CLOH 1ZS8A 5EU4A 4CDHA 2V9TA 2D31A 3VRJA 5DVLA 4MHHG 5I0DA 2NNAA 5ESVB 2QSCH 4KRLB 4IRJA 1U2CA 1IM3A 3RPIB 2R39A 5C0IB 1B0GB 5E03A 4KTYA 4BH8B 2P7TA 3CFBA 4KXZI 3MLTB 2D7PA 1FL6B 3CH1B 1MCOH 12E8H 5ISZE 1ZSDA 4Q9RL 2H45A 1JWMA 2HFEA 1ZWIB 2X09A 2Y6SC 4LP5A 2BHUA 5HYEA 1JZ5A 3MLYH 3OJ2C 4E9LA 1D5MA 3D85B 1NMBL 1LDPH 3DRTB 5EZIH 4JN2B 3BWAB 1IQDB 2HTLC 2AJVL 5HJ3B 1T22A 2H8PA 2DL9A 1OP5K 3O9WA 3CVIL 3QA3B 5D7KE 5F9JB 3GJEB 4P57B 1W8NA 2DAVA 4G43B 4XNUL 2YHGA 5JQ6L 2K3TA 4PRHB 3WSQL 5GJTL 4NPYB 1CN4A 1NCBH 4JPKH 3PWPB 1M4KA 2EDFA 5FDWA 2XY2A 4ZSOA 1U3YA 3U4AA 5C71A 5I18H 1PX4A 2DBLH 4CJ0A 4EKXA 1BD2B 2R1YB 1Z0NA 2OQJA 2HT2C 3IDIA 4WUUA 1OWRM 2PYEE 4H0GA 4MNQB 3N9GH 1WCQA 2ZG3A 5IMLB 2A6KB 5FYJH 1OAUL 3PQYD 1WUNT 3C6SB 5DO2C 1U8KA 3B2UD 1LDSA 2AV7B 2BRRH 3U9UA 4YDVB 4FQXA 1J8HE 4Y5VC 4ZYKB 2JCCE 2DM2A 1GRWA 4PJXA 4XPAL 1KELH 5F96H 1RUAL 3T65B 4NOBA 5I1KH 1UEMA 4GBXD 4Y2OA 3RZCB 1NSNL 5DJ2B 1OAZH 2VDNH 2ZP0T 1V8HA 5M95B 3EYVB 1QSFB 2IH3B 3IU4H 1UB5A 2XRAL 2X2YA 3D2UD 1B3JA 4P5KA 4X0KA 4CN4A 1N6UA 4MMXC 3NPSC 3GI9L 2Y25A 3EGSA 3X14A 4OT1L 4W70A 3O2DH 3EDFA 3RAJL 3KPLB 1V7NH 4QYOB 2EH7L 1YEJH 3X13B 1K9TA 3GSQA 5KS9F 2VH5L 1MFBH 2VXUL 5B38B 5J13B 3KDMB 4NKMA 4OLUH 3U2SB 1A6WL 4CU7A 3MRIA 2AERT 2IFGA 2ORBL 3LH2H 2C3VB 4YXLL 2WNGA 1WZLA 3TBYA 1L7TL 4HF5L 3PWVA 5AG9A 4RFOL 3D39D 5DD1L 4XT1C 5GS2H 4LP4A 2HVKB 4H20L 3KPMA 1KV3A 2GK2A 3V5HB 1KCVH 5T5NG 4XX1E 3S3SA 2NY4C 4YUEL 1AR1D 1JRHH 5E2TL 1M7IA 3CU1A 5EBWA 3AU1B 4ZTOH 1MJ8L 4MDIB 1HINL 5DO2D 5I30H 1QFWI 3DUSB 1ZGLP 5FV1L 1D5ZA 2FZ3B 5A40E 2RFXB 3F62A 2HAZA 4BUGA 4NN5B 2H1PH 4RWYH 1BX2A 1NC2B 5F7UA 2Z31C 4NGHH 4MA8H 3NZHL 1X9QA 1T04A 2P8MB 5F6HJ 3KS0J 3OJDB 1JZ3A 4JVPA 5E24E 5I74C 1TCRA 4TQEL 3BJLA 2R1YA 2D0HA 3FMGH 3BEVB 5H94A 3HMWL 1C5DA 1KG0A 3T4AA 1IEAA 1DDHA 3ARBD 4XP9L 1GZQA 3KYKH 3PGFH 2FH8A 5D2NA 4PJGB 4U1SA 1F6FB 5KVGL 1TVBB 1WT5A 4BQ6A 2VZSA 3BPNC 2DMBA 4WFFD 3CFJA 4IBLT 3FO1B 5DC9B 4MX7B 1GGTA 3IXAA 3QP3A 4HKXA 4JDVA 5BVJA 1IFHH 2VLJE 2YS4A 3QFJA 1VACA 2AK4A 1QLEH 3RWDB 4P3DB 2VXSH 1G1YA 4L9LC 2XPGA 3WFEL 4Z7WF 5B39B 4ZDHA 2DKUA 2W9DH 3RJDA 1G0YR 3DROA 3S35H 1UB5B 2EDKA 4O4YL 1SY6A 3MV9A 4PGCA 4NC2B 4FQ1L 1P4IH 1QD0A 1C1EH 2W9EH 1N5YH 3VFGL 3BYTA 2GJ6D 1TZGH 4JFYB 1IGJB 3EHBC 4FFVD 1CQYA 5B3JF 3EYFB 3BT2L 3BVNB 2FEDC 2X9XA 4X6BA 2D0FA 3S4SA 4YHNB 5I71B 3GKZA 1KJMB 2FX8H 4N5UA 3D18A 5CJ8A 43C9A 2HLFD 1MWAL 5E08L 2NR6D 3QNYB 4TVSa 3PV6A 4IMKC 4U0QB 1EEUA 5LVEA 2YKLH 2XG4A 4LSSH 4WEBH 1HCVA 3BQUA 3LN4B 1RZIA 4UDTA 5F7KC 4M9PA 1N59B 5E95B 4Q6YA 1XGYL 3HG1E 4XGZB 3KPOA 1PY9A 1VADB 3WKNA 4P3CH 2NYYD 3AU1A 4PJIF 2O5ZH 2R9HD 1VSCA 4H1LB 4G9DB 1UWEL 1S7QA 2YC1B 3C9NB 2VZ3A 3QUML 1QRNB 4F8QA 4LBEA 4U2YA 4NO5A 3IDJB 2DIJA 4F7PA 1I1AD 4LCWD 3QZWG 3T1FA 3DVIA 4Z7OE 2R4SH 2CRZA 4J3XA 3H9SD 4XXCA 2GTZB 1F11B 4LU5H 3GSUA 4PB9H 4ZMAT 3GMLA 5GS0H 1HOCB 5F7LB 3O4LD 4OFKA 2VQ1B 1KNOB 5IF0A 1FO0A 3DXAD 3V6FB 4N8VG 4HKJA 2X1XR 4NUJB 1YMMA 5IMKB 3W0WD 2AXGB 3BZ4A 3V6OA 4JZNA 1XR9B 2HJKA 3GZKA 4TNVF 2YUWA 4OZFH 2BOBA 4HJ0C 5E6IB 5CJXA 1KCLA 4N0FA 5EO0B 5DQ9A 3C60A 5D7JC 1RFDH 1BZ7A 1KPRA 2B7DT 2C26A 3TN0D 3T0ED 2Z35B 2P24B 2D4FA 1KBGH 1RUPL 2B8OT 5IW6A 4K7PL 1ITCA 4WFHE 1MHHB 5E4EC 4JFEE 1ED3B 2YD8A 4X6CE 1Q72L 4HKBB 2KH2B 4NM8L 4OF3A 4FQCL 4Y1AD 3MXVH 1EXUB 4O5LL 4GXUN 2HTKD 2FX7L 3LSOB 4PJAB 4F15B 4YDLC 4LPWA 1YC7A 2XKNB 3VFOB 3G04A 5FHAL 4YAQA 4H0IA 4XP4L 3E0GA 5T1MA 1BVZA 4G43A 4L4TE 3UC0L 5E8PB 4OKVB 1Z9SA 1OP3H 4HUWA 1UXWB 4LOUC 5HVHC 1T4KA 1TDQA 1YEDB 4GXVH 2R2CA 4M61B 2RAMA 4ONHB 4HBCL 3ZHLA 1FLRL 4HIXH 2XKSA 1T5WA 1MQKH 5HHQB 5J6HB 1JZ7A 5F1KC 4P5KB 5E8OB 1NGZB 1I3UA 1DBBH 3C6SA 3O9WC 1NBQA 3MA7B 4JFFA 1HSAA 2I25N 3CLEL 4GT7A 5TQ2L 3BP5A 3MCLH 1JF5A 1A14L 3EDDA 1ZHKB 3DMMB 2PCPB 2BDNL 5C0CB 1G7PA 2IWGA 1P2CA 1S7UA 5FO8A 5L0QB 3OR6A 5EUOB 5FYJU 5GRUH 1B4JL 4U0RC 3QEGL 4Y16A 4YHLL 2PTTA 4DZ8B 4BFIB 4KROB 4LCCB 1PG7H 3QJFA 4WFEE 3ZDZE 2YPKB 1VB9A 5LKNA 5C0DB 4R2GC 4I4WB 1K3IA 3BE1H 5MI0B 4CVZB 4M8VA 4U6VL 1EHLL 2VLKE 1RUQH 2WV3A 4PYGA 3KYNA 3O3EB 1VKXA 2V6HA 1YJDC 1KNOA 2NY1B 3C09B 1MCRA 5SX5K 2WBJB 5C0BB 1FO0B 2EXWC 4KI5E 1FBIH 4NQCB 4QXGH 1H3VA 4MJ2A 3K3QA 1JN6A 3KPPA 5M7QA 4HH8A 4WNQB 2IQ9L 2X10A 3F65A 4X6DE 4KDWA 3PGDA 2YPLE 4N0FB 3FQRA 4JDTL 2GEEA 1AD9B 1NFIB 4RBPH 2RFXA 3S98A 3WV0A 3ZE0F 5B3NA 2IPTH 1NUGA 2VLMD 1O0VA 3QIWA 3ALWA 2IH1B 2G75B 1BD2D 3OJDA 2BVQB 5DRNA 1NCWL 1FZOA 3JSSA 2LU3A 3MRRB 4J3SA 2YRLA 4NZUL 5SWZD 3I50L 2D03H 4NKQB 4ZUTA 2VISB 2LAGB 1KEMH 4YO0A 1EGJH 4G8IB 1IAMA 5I74B 1MAML 4BK5A 5I71C 5FF6B 4PJGA 4FFZL 1JPTL 2O5YL 5ADOL 1I8IA 1ZGLB 5A3ID 4KJQC 1MQ8A 5E56A 1XAUA 4C56A 3QFDB 5FB8B 5KSBF 1P84J 4RMVA 2DICA 1LE5B 1AGDA 3AGVA 4HDIA 3NN8A 3X3FH 3FZUC 2Z8SA 3MLYL 5A1AA 1PJ9A 1LDPL 1S5HB 5D96C 1YEDA 2NY0C 1TCRB 3QQNA 2NY4B 4Z5RA 1KTLB 3VXUE 1T7YA 2XN9D 3QUXD 4JPIA 3NCJH 4OD2B 5IM7B 2X44D 1ZT1B 3CVIH 5TDOA 5HHQA 2BVTA 2NY7H 4LLYB 3WSQH 4JFOB 1A6VH 3NA9H 1RZ8B 3NCYS 4P0DA 1Z0MA 3I84A 3KNBA 2JB5H 1OP5H 1KACB 2DBLL 1NGWB 1HI6B 3ZYOA 5L8JB 4P9MH 3GJEA 1ND0B 2E6PA 2IBZX 3N9GL 4GRLC 5FYJL 1EJ6A 1IGYB 4MJID 1G6RB 5CZVL 2X1OA 3G6AB 4KKBC 3T8XB 4DAGH 4JG0L 1ORQB 2E27H 4FA8A 1T2XA 1K4CB 3V5DA 2EDJA 3RI5K 3AB0C 5J1AB 4YXKH 1MHEB 4JRXA 4OJFH 4KPHL 5KVMC 4O2EA 1FSKB 1RUAH 5EC2B 5E94B 3DO3A 1I75A 3S9DB 5E8NB 3RY4A 3TZVB 2NY1C 2VDNL 5FIEA 4JFYA 5FO7A 4W6WB 4NHCH 3MRBB 2FGWL 4TSBH 2PR4L 4KGLA 2K7QA 3MV7A 4PJFA 4CVUA 3MCKB 2NTFB 5BVPH 2DQTL 3MJ6A 4AL8H 3QNYA 1LO0L 3RU8L 4NFCA 3LVEA 3GI9H 5DRNB 3ARWA 2EE3A 4LKCA 5TPWH 3FB5A 1U93B 4PGDB 3O2DL 4QTHA 2GFBB 4FFWD 2FR4B 4U6TA 3STLB 2VWEC 3LRGA 2VH5H 1WTLA 3L6FB 3O6FA 4KTEH 4BSJA 3IF1A 2OP4L 5EOQL 3JWNC 2G60H 4M1DH 4XBPB 1TPXB 3QWQB 1XF2A 1L7TH 4HF5H 2J8UE 4RFOH 2OTWB 2C9AA 1HEZB 2BVOA 3UXFA 3D69A 4X5LA 3C60B 4YNYB 5DJ0A 3MLWH 4LSUL 2R0WH 3UZEA 1H0DB 5I16A 5J89A 4F58H 5KANI 2BNQD 1JRHL 4PJCF 1K4DA 1DBMH 4J4PC 1U8HA 1CLZH 4HFWA 3IRZA 4HKBA 2OBGA 4H26B 3DV6B 1OTSD 1EVUA 1JNHB 3QUZB 3JV4A 1TQCC 1EEYB 3NPZB 4LRIA 3HLAA 4MYWB 4NGHL 1S7WB 5DMJB 3Q6FB 1S7SA 3QSKB 2GT9B 4UIKL 2ADIB 1EH9A 4TQEH 1OY3B 5DEGA 3BN9C 1HI6A 3L3JB 3FMGL 2A74B 1UKTA 4EQ3A 1DEDA 1NMAL 4Y19E 4WU7B 3WNPA 1G7HA 2R1XB 1JHLL 3JUZA 4FQXC 4MNGE 2OTUB 5LGKA 4GS7C 2APFA 3F6IA 4P2QB 4HUUA 5KOMC 3ZKNC 1HHHB 2ICEB 5B8CA 2J8HA 3QI9C 5E8NA 2VXSL 5AZEL 4JFFB 3VFOA 4NZTL 3VFRA 2Y7QA 3HCVB 4XAKD 2W9DL 3W11D 1KLGB 4U1KA 4NRXB 3TESA 1M6OB 4NWUL 1TJGL 2JLLA 2NZ9D 4XP5L 2GJJA 3TVMB 5AUMA 1P4IL 4JO1H 3EOBA 3HNVH 4MCZA 1G0DA 2QSVA 2W9EL 4JRYE 1IKNA 1Q9KB 3VFGH 1S78D 4MA3A 1NAKL 4P23A 4P9HL 5D8JH 1XGRA 25C8L 5IB4B 3STLA 2BVUA 3BT2H 3KYNB 4PLKC 2KQMA 1VKXB 3GI8L 3QQ9C 4YDJA 1X5KA 3ARYA 1A6TB 5IMOB 5J6GB 3CLFL 4KKLD 3QCUH 4H8WC 1SJVA 5SX4H 4RAHA 4JFEA 5TF1H 3KPSB 1NFDA 3N1PC 5C0CA 3OPZL 3BN3B 5FO8B 4MDJB 4G8GB 5F8RC 1WBZB 4MAYC 3BP7B 5KSVB 5C0AA 1XGYH 5FCSH 4OCRL 3MRDB 1FYTD 4K71B 3WLWD 1CD8A 1E4XI 2IH1A 4P3CL 1T1XB 2J8OA 4BH8A 3EUUA 1XIWB 3OKMA 2VTFA 4HHAA 2YR3A 3MRNB 2EIZA 3CZJA 2NY5C 1E28B 3OHXB 4K7PX 4GKZB 5F9OH 1CGUA 3U1SL 5F44A 4YFEA 3I75A 3E2HC 4GRWF 2R4SL 2PTUA 5HHOA 2YD7A 4RISL 1W0YT 5D2NC 5IBLC 4R97B 3H9HA 4J8RB 3FL7A 1GC1H 5F9DC 2LE9A 3B8SA 2Z93B 4QY8B 1YN7A 3TFKC 3QT2A 1S7XA 3NIFE 1T5XA 3K4ZA 5FCUH 2KBGA 1GHFL 5DJ8A 1FYTE 2C3XA 1NCDL 5C09B 1S78C 3IVKA 5TE4L 5IM7A 1NCCH 1GGIL 1F3JA 3RL1B 3T3PF 2BY0A 1HHHA 4WENB 4ZXBD 4Y16C 3F8UB 1LK2A 4EDXB 3LMJH 4KUCF 2RGSA 5F9WB 1FNEB 1RUPH 3SPVA 1IC7H 1QHPA 4KKLC 4OZ4A 3QNXB 1IGFL 5HHNB 1I8MB 1LVEA 4UU9A 4F7MA 5T3XE 1QR1A 4NM8H 1Z9LA 4K71C 4TNWK 4V1DB 5DQ9B 2AXFA 1A7OH 3QHZH 1LP9B 2NX5A 3C8KA 5D5MB 3TVMA 2NY6D 4XWGH 1I85A 1L0XA 3PWNA 4M5ZH 2J6EH 3LIZL 5DMGC 3TBTB 2B2XL 1A6AA 1MCQA 4UMGA 1E4XL 1G7JA 1GJIA 3MV8E 1SEQH 4NNXA 1A9EB 1I7TA 1AQKL 3ROLB 1HILA 5E94A 1LO3H 3KNBB 1KJ2H 3KPRB 5IVOA 3TIEA 4RDQG 5FO7B 5FOBA 4TVPE 2GYSA 1EUTA 4ONFH 4DZBA 4AIZB 3O3DB 4LLQA 3MJ9H 1MQKL 2NTFA 5D70H 2DDQL 5GGUA 3EO0B 1T1XA 3TO2A 2BOCA 3BDYL 3WFHB 3OKMB 3IXTA 3GMPB 5I8KL 3T8XA 3MCLL 2P5WA 4XNXL 2A73B 3DX7A 4K94H 1YEHL 4I48B 1YPZA 1A5FL 3R06B 1B4JH 1BBDH 5KOVC 4M4RA 5HYJA 2JF1A 4Z7UE 4ESKA 4WTWA 1PG7L 1R5WB 2H2PC 3IDGB 3PHQA 3FT2A 5D1QC 4GS7B 3DUSA 3T4YA 3BE1L 3TLRA 5IESL 4S1QH 1JGUL 3VU2A 4FFYL 5GGSB 1C16B 5IIEA 4IS6A 1F4HA 4NQDE 3HUJF 2YD5A 3WIFB 3P40A 4QXGL 3WEXB 3FO2B 4M1GL 2G2RA 1HHGB 3D0VA 3SDYL 1WCBA 4WHCA 4QNPE 5JO5B 5ALCL 4HSQA 1FL6A 2AEIT 1P4LB 3CH1A 3IJSB 4X4MA 4HWZB 1J1XL 1RJZB 4TNVK 4WV1C 4H26A 3WNKA 2R0LH 1ZLVH 4YGVA 2PF6A 4MJ4A 2IPTL 3MRJA 1OAKL 3I02A 2ED9A 4MJIE 3U0WH 1DBJL 3DXAB 3K8KA 1NCWH 3LPGA 1JZ4A 5JXED 4XCCH 2D7TH 2H8PB 4G6JL 3IXAB 5BVJB 4YNYA 3P77A 3TN0C 2QLVB 4A6YH 3MNVA 1EGJL 1GIGH 1CFQB 3VDCA 5IVNA 4PJCE 1RZFH 5HGHA 3LEXB 2YZ8A 3ZDYE 3KYOA 4QTIL 5BRZB 1OF2A 2BVPA 5HYSB 5ADOH 2EDYA 1MAKA 5B39A 5DUPL 3SCMD 1Q9WA 4F7EA 2XQYG 4XMLL 1H5BB 3VMOA 4F9LA 1AI1H 5L88H 3D48R 2I07B 1AO7B 3QZWB 3UTSB 3ME0A 1LNUA 1OTUC 1RZJC 3SDXA 5HSFA 3PDDA 2GSIB 2J2ZA 4WI9A 2DLEA 2DQUL 3I6LE 2O26U 3GMRB 2PYED 2RBLA 3PQYB 4JCLA 3MYZA 4HC1L 2EYRA 3O6LL 1Q9OB 4HV8B 1D9KD 5H8DA 4LHUB 4OD1L 4ORGB 4YHKL 1S9YB 2BSTB 4NO3B 1EK3A 4NHUA 3MOQA 3H2WA 3OKKB 4PJXE 1MCCA 1E4KA 4XB7A 3VXSB 3HNSL 3LEVH 2AJ3B 3NA9L 2FEEI 3FQXB 4UT7L 5TDPB 3BZFA 1NAMA 4BZ1H 1B0WA 5DVMA 2ZJSH 2R23A 4NRZB 4P9ML 4P4RA 2PTVA 1VFOA 3QFJE 1F6AA 2VUYA 5F8QC 4PJFF 5GXBB 3P73B 5I75C 2VDLL 3JV0A 1A21A 3BKJH 1W0VA 3CSPA 4JR9L 5CZVH 4MS8D 4PD4K 1WC7A 4DAGL 1RAMA 1PW3A 2FBJH 1I3VA 5C0RH 3HR6A 3LEYL 2E27L 1DQMH 3TIDB 5HGDA 3T1FB 4PBXA 4PTTB 4KRMB 2ZPKH 2CLRB 3ORJA 3MFFB 3QEQA 1FFRA 3O6MH 4LQFH 2F53E 3DLQR 1SJXA 4QXTB 4OZHB 5LGJA 1XIWA 3ZT7A 3G6AA 4GUPA 3IJSA 2PR4H 2IBBA 1H3WM 5IHUH 1AJ7H 4NRYA 4WDIA 1FFOB 1NGYA 4JDZA 1U8NB 4KMLB 4FQQA 2FB4L 4G8FB 1JJUA 1I8LC 3TBVB 5EC2A 4U0RB 1N2RB 4JN1L 1DZBA 3LAFA 4WFED 3D5OF 5I2IB 2E9IA 3IJYA 1LMKA 4OGZA 3UYOD 1JGVL 2DTML 1IGTB 5DS8A 4NQVA 4ZFZB 1D9KC 2R0ZH 4Y5YC 1F4XL 2Z31A 2DRUA 4XC1H 1EHNA 1CTOA 2XTJE 2G60L 5GRVL 2AVGA 3ZE1E 3W5MA 4GMSH 5LXGL 3MODH 4WO4C 2O93L 3SJVE 3UBXB 2QADC 3HI6L 1BQSA 5C0EA 5KZCB 4S1DD 3K80A 4L9LA 3D3VB 2J7LA 1NPUA 1F3JB 3C5SA 2FRGP 5SWZB 5ITFB 4LSUH 4ENEC 3KR3H 3IF1B 2GAZA 4RGMC 4HJGA 3NIGF 3V52H 3V0WH 5IB1B 3O8XC 4Y5XA 4CN1A 1DBML 2KDGA 4IRSC 3GJFA 5E2VL 4PP1D 1IJ9A 5CJOH 5DUMH 1AXSB 1T89A 4O02L 1DUZA 1KOAA 2DMCA 3N1QC 3O11B 3MLVL 4HFUH 4MX7A 4J8RA 4HAGA 3VA2C 5I1LB 1IRAY 5DJDB 3STBA 1A9BB 3TBSA 1BFOB 4QHMA 4DQOH 4E0RB 1MCBA 2GKIA 4X8XA 3MBED 1RK0A 3MLZH 4HZLA 4XC3H 5T1LB 5BS0A 4X8JA 3QUXC 2FHCA 1FZMA 3ZDXF 4P2OC 1W2KT 1NCUA 1QQDA 5D1ZD 35C8L 2YD9A 3BPLB 1NMAH 2HFEB 1YEGL 3VGHA 5K9JH 2HH0H 3S5LA 2XTJC 4NQDD 4DVBB 2VDQL 1HSBA 5IVXB 3WLWC 2Y9RT 4PS4L 3TIEB 1KB9J 3GRWL 3VXOA 1IGJA 1QR1B 2IPKB 2XKUA 1FNGB 1DQJA 4DUXA 1PKQA 3A6CH 1U8MA 4YIQA 1BM3L 1CXLA 2BCKB 3PHOA 5BOPA 3LN5A 4OAWB 5AZEH 1CXEA 4NZTH 1S8DA 3HE7B 3H7BA 3WDIA 1KXVC 3HAEA 4P5TB 1ZHLA 2VDKL 3BUYA 4IRZL 3MRMA 1ORSA 5AZ2H 2A38A 5F6IC 3G5YB 3JTSA 4XB8A 3AS3A 1UC6A 2R56H 2Q86A 2FX9L 3VGDA 1NAKH 1YEEL 4E41B 4NIKB 1FDLL 4PBVC 3VRIB 2I24N 3L5WB 5I1EL 1C16A 1CDBA 3NCFB 4WW2C 4Y89A 3HPJA 3NGBB 3OGOE 1FIGL 5KS9E 3B9VA 2NLJB 1J12A 3QCUL 1RJCA 4WFHD 3VFNA 5BXFB 5TF1L 1MAJA 3ZE2F 3CFKA 1NGQH 2W0PA 4L3CB 4A2MA 4Q2ZA 2CUIA 1I7ZB 3C09C 4PGEA 3ZYZA 1KPVB 3CX5K 4LDOB 1T1ZB 5D7KD 5CEXB 5IHBA 5IHZA 3UZVB 2CLZB 4X7TB 2DQGH 1RULH 4YPGA 5DHVH 2AQ1A 4LHUG 4ORZC 5MHSE 5CLTA 2J5LB 3EDEA 1X3DA 5F9OL 4RX4A 1QUNA 1CD9B 3HR5B 3FTGA 1X5HA 4E0RA 3HC4L 4R4NC 3KYOB 1HHGA 5IJVB 3VWKC 1CS6A 5BS0B 3FAXA 4OBSA 3Q5OA 5GGQH 2VLRB 5EBGA 4RISH 1BWMA 1P4LA 1HXMB 4K8RC 4RAUA 1A6PA 2VLLB 3ROOA 3ILPA 5F89A 1WVZA 1MLBA 4R26L 5I1IH 1A2YA 3GMNB 1GC1L 3UTSD 4YQXH 4PLJC 1WIUA 4FRWA 2VN7A 1KFAL 5E6YA 5JZ7C 3DXAA 4PJ5E 4JE4B 3AS1A 5FCUL 1GHFH 4OCXL 1DQDH 3BJ91 2ICWJ 1BQHG 2QSQA 4LHJB 5FM5O 1WISA 1NCCL 4OZGB 4GBXC 3FB8B 3RDTC 3SE8H 3ZLQC 2M26A 4I77L 5IROC 4M93C 1ZLVK 5ALBH 4G7YH 1F45A 4H5SB 3CU7A 3CMGA 4YDLB 3HZKA 3BZFB 1IGFH 1MREL 2BNRB 3F12A 1AO7D 3EYQC 1AO7A 3U0TB 4Y4FB 1CICA 3MRMB 2R23B 3SDXB 3QHZL 3QI9D 4TPRL 4DGVH 1G7IB 5I6XC 1PQZB 5J12C 5IB5A 4DKAA 3HC0B 1W0VB 3QNXA 3GMOB 1JRHI 4HIIA 3MV7B 4QRPA 1PG7X 3QG6B 4KJPC 4XPHL 3OR6B 1E4XH 3ZT6A 1D5BA 2EE9A 3QRFM 2FATH 2AK4B 3VFWB 1SYVB 3C5JB 4UZGA 3STZA 2BP3A 5HDBF 1JYNA 4ZTPL 2QEJA 3FOLA 1U8PB 5IWLA 4XNYL 4CVZA 5C0FA 2ADJB 2DM3A 3R1GL 5E8EB 3JWOH 4LAQH 4M9OA 4ETQB 2JCCF 4LCUA 3MJ9L 4Y4HA 2V2TA 2FEDD 2IG2L 2DDQH 1X5AA 2IBZY 3LRSA 1HILB 1ZS8B 1RUKL 1OTTD 4J3VA 3QIBD 3M1BB 2L7JA 4K94L 5FGCE 5GJSH 4PJIE 1T2JA 4GKNB 3MO1B 1R24B 2X4UA 1A5FH 3ZYJA 5HHXL 3HR5A 3T77B 2XZQH 1BBDL 2CPCA 4D9LL 2I60L 1CYGA 4HIEB 5JORA 4IMLB 1BZ9A 4G6AD 4BELD 3OXRB 4Z7OF 1JGUH 1LO2L 5FM5M 3LPFA 2FO4B 4FMFA 5FOJA 5ITFA 3WIHA 4LLAA 3R06A 4F9LC 4NC1C 2V7HB 5T1DH 3TBVA 3KPOB 3CSYA 3GGWA 3EKCA 4AYFA 3TCLB 4KRPD 1AC0A 1U3HC 3KG5A 3T4YB 1F3DJ 3EAKA 5GGSA 4NJAH 1S9XA 4WUKL 2JIXD 3CIQA 4E41D 2C3GA 3QUYB 2ZCHL 5A3IC 1OAKH 4KJQD 3DHJA 1LILA 2VRAA 3U0WL 1L9MA 3VFMB 1D5XA 3MOAL 5EG6C 3C87A 4XCCL 2D7TL 1FZMB 3TVMC 1HOCA 1MHCB 4G6JH 3U0TA 1QQDB 3C5SB 1GIGL 2ICEA 4IRJC 2VL5A 4ODHH 2DQFB 2QSCL 2ADFL 5DJZA 1W8OA 3DTXA 3RUGB 1QSVA 3GJFB 2BSRA 1U8OA 5IR1A 4XHQA 1A7NH 3S96A 3U9PH 4GBXB 3RZCD 1HNFA 1U8MB 5ERWB 5ID0A 3U4EA 5KSUB 1RK0B 1NMBH 4Q6IC 5E5UB 5EZIL 3FOLB 3WFCH 3SDCA 4KK6C 1MWAA 3O6LH 2E7HA 3ELAT 1FCCA 2AJVH 3HE7D 3HI5L 1IC5H 3SCMA 3ARDB 1JTPA 3MV8A 1MI5D 4XNUH 5JQ6H 4ODUB 3LSOA 4Q7DA 1KN4H 3GDBA 3HNSH 5CGMA 1T89C 3EGSB 3VH8G 1LQSR 3U6RA 1WWBX 2MKWA 2WAHA 2CH8A 3KPLA 3VMPA 3KYAA 1RK1A 1ZA3A 1QO3A 2VAAB 3CC5B 3QFJD 3MLPA 3B2UC 3QUZC 4JY4B 4X6FB 5ANME 1BMGA 2CRIA 2ZJSL 1A3QA 3PABA 2ZUQC 1RHFA 1JL8A 2BCKA 3PHOB 3VXSA 2VKXA 4MD4B 5HI5D 3ZTNL 3PWVB 1EO5A 3HZMB 3SE3A 2Y5TB 4LSTL 2E8ZA 4LFHG 1U92B 1UH2A 4PG9A 1JK8A 1ZHNB 1JYVA 1VCAA 1YC8A 2QQKH 2BRRL 1DQML 1I7ZA 4WI2A 1CCZA 4YBQC 4PJFE 5DUBA 4FZEH 4DUWA 2CDEA 4QHKI 4P4KA 4LQFL 5DXWA 3BGMA 4YPGB 4HKZA 4JANA 3K1DA 5B39G 4EXKA 3PWLA 3O0RL 3T2QA 1WZKA 1NJ9A 2EEAA 4ZFOA 1VEPA 5J13C 3GSXA 3W9EB 1P4BH 5IHUL 5ESVA 4JRXE 4ZAKB 2X4PA 2K7PA 3RWGB 1VFAA 1RU9L 4GRWE 3L3HA 5GGSY 2QBWA 3P4OA 4QRRE 4JN1H 1U8HB 3QXWA 4FZ8H 1JFQH 1OAYH 4ZFOL 3QNZA 1T2QL 4O2FA 2H3NB 3BEVA 4OT1H 4P23D 3S4SG 3BEWB 1YEJL 2NW3B 3I3BA 1F4XH 1MFBL 5C9JB 1KTDB 1S9VB 5DJZB 4XRCA 1AR1C 3LH2L 5DVOA 4FHBD 1CT8B 1TQBC 4PJHE 4K23L 4WHTB 4JQIL 3FQRB 5DD1H 2ZUUA 3AC0A 1LHZA 4EI5A 2MMXA 4ELMB 3LKQA 1A1OA 4G8EB 1ZLUK 3W81A 3UCRA 2CIIB 1FGNH 5CKGA 3ARFB 5E9DA 3PP3H 5HI4D 4YUEH 3QIWB 4PG2A 1MLCA 4U1LB 5IT2L 4KUZH 3EDJA 1ZAGA 4G9FB 3MPCA 1PG7W 3MLRH 4E5XB 3ARGD 4ZTOL 1MJ8H 3F12B 5DQDH 1MELA 5CJOL 4L8BB 3SCMB 3ZKQD 1J1OL 4RWYL 4NC0B 4U1GC 5GZND 2A6JA 2PO6B 1Q1JH 3W9DB 1A1NA 4QCIA 1F13A 3G5VA 3NZHH 3QDME 4MQXD 3OR7A 2Y5EA 3MLZL 5DF0A 4ZUUB 1G7QB 1RK1B 4OM1H 4HWBH 2J3SA 1YECL 3QG6A 4OZGA 5FYKU 2VKWA 3RWCB 1M6OA 3HMWH 4TRPL 1S7RB 2BY1A 2EO1A 4GKSB 5I8OH 1WWCA 5F3BA 4KI5F 2BNRA 3GRWH 4Z5RB 4PJBE 1KIPA 1YPZB 3EYVA 5IB4A 5IVZA 4KHTL 4XNZB 5FM4A 2CJUL 2QQLH 1F6LL 2BVEA 4UILH 2R2BA 4TVPD 2GK0B 3S5LB 1Q9LA 4N0YH 2IMNA 3MROA 4GRLD 4JM2F 1NFDB 3LRSB 4Y1AE 1MFNA 3DMMC 1EHAA 2YEZA 2W92A 1RIHL 2D9QB 4N5ED 4XBGB 3K81A 4IS6B 3E3QE 1VGEH 1MCNA 2DIBA 5DJYB 1NUDA 2VDKH 3AAZA 4IRZH 3PXJA 4CUCA 4O4YH 3FO2A 2X4NA 4Q97A 5AZ2L 3STZB 1X5JA 4FQ1H 1WCBB 3ZHKA 1BZ9B 1C1EL 5FGBA 2R56L 3PXHA 2XNAB 4XPBL 2HVKA 1TZGL 2KUTA 3CPLB 4ZUWA 5D1XA 1QA9B 5MEPA 5I1EH 1YZZA 2XWTA 1MCKA 1U3ZA 1S9VA 3LRHA 3P4NA 1WICA 4TN9A 2W1NA 2VZOA 4LCIL 3ARDD 1MI5B 5E08H 1X5YA 5C6WH 4MAUH 4DW2H 3LB6C 3VXRA 4Y16D 5GSVA 4CNIA 3MNVB 3VCLB 1R24A 1JGEB 3L5WA 1FC1A 3B3IA 4CMMA 4LKXB 1FV1B 1CE6A 5E2UL 3LOWA 4WO4D 5I1GH 4U33A 4L29A 1QYGL 4M4PA 2IPUK 3AXLB 1K8DB 2L4OA 3U30B 4Q2ZB 6CGTA 4OCMC 3R0MA 3KPTA 3RL1A 3D3VE 1U8IB 1FRGL 1BVKA 3HG1D 5I66B 1ZEAH 4K3EL 4MZ2A 5JIIA 1R5VB 4NOFA 1RVFL 5GGQL 3BH9A 2ZCLL 5HHNA 3DMMD 2XTJB 3EOAB 1AGBB 3CFDA 1CF8H 4NQEA 1T3FA 4Y4KB 2ESVA 3BZEA 4KDTA 4PJ5D 2ESVD 1UWXK 2X4SB 1UACH 1L4IA 5FYKL 3QIUB 3MBEC 4YQXL 2HT4D 5AWNH 1P1ZB 1KFAH 5MP6H 3IU3A 1D5XB 3TBTA 2E3VA 3K0WA 1DQDL 1HHKB 3FT3A 1QLRB 2VABA 5EOTA 4LVNB 3RIFF 4LEOA 1IARB 2NY1D 3V9FA 4ODUA 3G5XA 3SE8L 3QR2A 1N3NB 2BC4B 2GJ6A 1EVTC 5I1JH 4JN2A 2GT9A 4M6ML 1S3KL 5ALBL 4L4VE 4KC3B 3GNML 5SWSD 1G9MH 3U7WL 1T6VN 4FQCH 3GB7B 4UB0H 4HUVB 3GHEL 5D7LA 4BFIA 1MIML 2VYRE 3HRZB 3VG0L 5SX5H 3VRLF 3WJJA 5C0DA 3OB0H 1AIFB 4Y1AB 4NQSB 3ES6A 5FHAH 1ODAA 4WI8A 1AH1A 1Q8MA 4XP4H 1S7VA 3REVA 3G9VA 1FNSH 1U8NA 1P6AB 2XWTB 1N59A 3SGJA 4MNQA 2V2XB 4PJAF 2NY2D 4GQPH 3MJ8B 2V5SA 1JTTA 4NDMA 4XNYH 4Y88A 5J9PB 5FUOH 3QIUC 1A3LH 1ZLUH 1QRND 5IIEB 3KLDA 4JQVA 4LAQL 1QVOA 4HIXL 5D9SB 4PJXB 2V7NB 5F97E 2P42B 5JOEA 3CD4A 2X4OB 1UA6L 3UBXG 4W4OA 1EUUA 1OTSC 3CFEA 5IB2A 3AXLA 5TQ2H 2JB6A 1F8TL 4YO0B 4L9LB 4YEFA 1J5OL 1H9VA 2DYPB 5KANG 5D1QA 4BSVA 3RWJB 1FO0H 5J8OA 1QFUL 3UTSE 4AENA 5HHXH 1U8IA 4OZIB 3QEGH 2XZQL 4D9LH 5FYKD 3HPLB 4HKZB 4JANB 4JY5L 2DTSA 4C56B 4PJEA 1LE5A 1AXSA 4KZEH 3DYPA 4Y4KD 1RJLB 1EHLH 1AKJA 4Y4KA 3MV9E 4PJCB 2CIIA 1VFAB 5C0AB 2GY5A 5IQ9A 1CBVH 4IMLA 4JHBA 3QEQD 4P46C 5JTWA 2Q7YA 1T20B 3ZL4H 5I73B 2KL6A 1JGLH 5H37G 4R7DB 2IQ9H 4U1JA 3TNMB 3QHFL 5HGGS 5DZLA 3P4MA 3E3QC 1QLRA 5EOTB 5GRYA 4JDTH 4NJAL 3U7AA 5C9JA 1R3KB 3HZVA 3ILQC 2XOTA 3MZTA 3S6CA 2X4QA 2ZCHH 2R15A 3SCMC 5EBWB 4LRNH 3SE3C 5FKPA 1HXYB 1FZKA 2LU4A 3GIVB 2IPKA 4LHUA 2FEEL 5TJWK 2D03L 2NXZD 3ZDYF 1PKQB 3RDTD 1V7ML