5DJDB

Fc heterodimer design 5.1 t366v + y407f
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLFSKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 34
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djdB01
5FYJU 1SVCP 4TUKL 4JRYA 2H8PA 5L2KE 1XF5B 4LNVA 2OZ4A 3C2SA 1IM9D 4ELMB 5D5MB 3VFWB 3T0EC 3VJ6A 1LD9B 3HE7D 3EOAB 3MGOA 1K8DB 3GMQA 1H5BC 2NY4D 5L2JA 3DGGA 4HKXB 3GHBL 1X44A 1CYGA 4LQFH 3JWOH 3AY4C 5DWUL 4F33B 4X9FA 3L7FB 5E9DD 4R4BA 3QR2A 1NPUA 5I2IB 3R1GH 2BK8A 1NANI 5BMFL 1KBGL 2Z0BA 3C6LB 4MJ2A 4CW1B 4WUUA 4Z95H 1K8IA 5AG8A 1LK3H 5D7IB 4FFWD 3NA9H 4GKOA 4J6RH 3C6LD 4EI5C 3K3QA 4QXWA 4IOFC 3GK8L 5CBAB 1GOFA 1J8KA 1T22A 3EYOB 3D2UB 2Y5TA 5DTFA 3GMRB 1A6VH 2NPLX 1A64A 4NC1C 5MI0B 4KKAC 3QNXB 3SEPA 3X17A 1JYWA 3QQ9D 4P5TD 4Z7OE 4D94A 3KS0J 5T3XL 1CR9H 3RJDA 3S37H 1UKTA 3AXLA 4N0UB 3CFBA 5HYFA 3S7GA 3TCLA 2R56L 1VADB 3EDDA 1XR8B 4OLVH 3CFEA 3RVWD 1KC5L 2XTLA 3RQ3A 3D48R 2WW8A 5D1ZA 5EFIA 4NKOB 4XBGB 5T1LA 4TNVK 1D5XA 2UZXB 3BO8B 1HN1A 3JZ7A 3NAAL 3OXSB 4OI8A 3VXOB 1U8KA 3G9AB 3QUZD 4OD1L 3FO9A 5GPRA 4HLZG 1F8TH 2VIRB 5EC1A 1NSNH 2JK5B 1IEBB 4F15C 4GLRH 3KPRE 2V7HB 2Q86A 4MVBC 4EI5B 4OCWL 1RUKL 1Z0MA 5ERWB 4QHMA 1QRNA 3TNNB 5BJTB 4KQ4L 2HTLD 1IGFL 4U49A 3IFOB 1KCUH 4O2FB 2WWMC 1T1ZA 4EI6A 3MMEB 4JDVB 1NGZA 4R96A 1BOGB 5FGRA 1FIGL 5ID0B 4L9LA 2DQGH 5IB4A 2IANB 1MY5A 3RBSA 1P7KB 4OT1H 3OKNB 4NQEB 5E2WH 2Y36H 4U1GC 5ELIA 3HC0A 4FFZH 1TZHB 5TDPB 1NFIB 4NC0B 4UTBH 2W91A 1F4AA 4U1KA 1JHKL 3BI9X 4PJGA 5HDBE 1GJIA 5BV7B 2ZG1A 5IW6A 2ARWA 5C3LD 1HHHA 4GT7A 2GITA 4X7TA 2DQJH 5B3JE 4X80H 2PO6A 3OX8B 1D9KB 4WI7A 1P6AB 4YE4L 2DLHA 1I8IA 4OQTL 3DPBA 1BIIA 1LE9A 1LE5B 5IFJA 4KRMB 3BUTA 5GGTH 3S36H 3IU3A 4UT9L 3U7YH 3HI1B 4UILH 1N26A 3VDCA 3UTTB 1I7RA 1RUQH 4XTRC 5I18H 1KPUB 3QQ9C 1W72A 4EN3B 1EHLH 2GJ6A 3TNMA 3JV0A 4OZFG 1JWMA 5DJ0B 2FBJL 2P5EA 3MYJA 4MNQA 3Q6FA 5CWSA 4XNZC 1UWXK 2LTQB 1HNFA 3HZVB 4PP1C 3L5IA 3MX0A 5T3XH 2UZIH 3PF2A 4R2GC 4TRPH 2VQ1A 1QTYT 4PGDB 5MEQA 5I1LB 2DDQH 1OQXA 4NNPH 4GRLA 1DBMH 1QSEE 3QIWB 4O2EB 2PO6C 1X5JA 3DJ9A 3ARGD 1OARL 1V05A 3SY0B 3DTXB 3MLWH 3FTGA 5SWZD 2GJJA 4I3SL 4LVNB 2JE8A 4NQSA 3LKNB 2LE9A 3ARFD 5ABDE 4PJAB 4MWFB 4R4FL 3S4SG 1EH9A 4WO4B 4BQ6A 5F7WC 1S9KC 2BMKA 2OJEA 4PGCA 1P7HL 1PG7W 5DHVA 1NUFA 1A7NH 1JNLH 2WWMD 1Z9MA 3LMJL 3FO0L 5GRUH 2BVOB 2Z93A 3AVEA 4PJDA 1JWSB 2EXYC 2AEPL 5HDOA 1YDPA 4G43A 5T5FH 2EIDA 2CJUL 1MQKH 5C09A 3NGBC 3MR9B 1A1MB 4ZOBA 3TVMD 1CWVA 3UTPD 5C0GB 5C3TA 5E7FA 4DUVA 4D3CH 2XZAH 3IJSB 2X5PA 1Q9KA 4S1RL 1NMAH 1IGIL 4FTVD 3DUSA 3GMMA 1GZPB 1EXUA 1JYXA 4KUZL 5HI4C 2X4OB 3U4BL 1VEMA 3U4EB 3PDOA 3FOLA 2AJXH 5JA8B 1LEGA 3ARGA 4L8BA 1J8HE 4LLUA 5TH2B 4Z7VA 2Y06H 5DK2B 1F5WA 3T0BA 3DMMA 4ZFGH 4ZUWB 5FXCH 3HE6A 4HQQH 3QIWD 2GJ6B 4HH9B 3WIHA 3GRWH 2NCMA 3DO7B 4RRPG 4LOUD 5F21B 2HYMA 4YIQB 2ZUQC 4O4YL 3RVUD 4OCXH 4PTTA 5T1MB 4F9LA 4JKKA 5DA0B 2PYEA 1FRGH 4EUPA 2NY2B 3WLWC 4O2CB 4PP1D 1CDUA 1D9KA 1UEYA 3SE4A 2AK1L 2WM0A 2FJFA 2CMRH 3BP5A 3VXMA 3MGTA 3CDGB 5FKAB 1EA9C 1HYRC 5ITBL 5FHAL 2V9RA 3GIZL 1YJDC 3LKPB 4HJGA 3QUYC 1I1AC 1IC7L 1BLNA 3MNWB 4MMZC 2E7LA 4AEIH 1PG7L 1F90H 4NRZB 4QHKI 5GS1C 1N6QL 1J0IA 1W0VB 3PQYA 3S37X 5DR5L 1M7IB 5JXED 4WTWA 4Y19D 3N1QC 3BPOB 2YKLL 4LF3A 3O4OB 4MJ4A 2EDNA 2V17L 3QO0A 4WENB 1RV6X 1T0PB 2FL5A 4LDOB 1CFSB 1RK1B 5IT2H 5I73C 2WK2A 3QFDA 5K33A 3DSFL 4G9FE 5CJXA 3EDJA 4HIIB 5C0AD 5D7IF 5IFJB 3K1DA 3C5ZD 5CIPB 3QUXD 4NQED 5HYJE 2D7TL 3GHEL 1BOYA 4ZYKA 3K81A 4QHMB 3V4PH 3OWEA 4FQJH 1OWRM 4DW2H 4HIHA 1JPGB 4O51A 4GW5A 1X3DA 1RIVH 3MRHA 3HLAA 3QG6A 4DVBA 1J0JA 4Y16A 1FZOB 1EEZB 5JHDE 2NR6D 3VXOA 3V6BR 2CXGA 3OXSA 1TFHA 3PUCA 3MA7A 2DQGL 3PL6D 2ZUUA 3D85B 5C0CE 2Z31D 3QUKB 4CMHB 2FLBT 4X98A 1UT9A 1CZ8L 4GAGH 3KWWB 4U6XB 1YEKL 2J8UB 1N6QH 2DQEL 4PFEA 4K7FB 4QXGH 1JI2A 3SGDI 3EO0A 1TDQA 3GGWA 5HGHA 43CAA 3MMEA 4JDVA 3RVUC 4QKXB 3D2UA 1UKQA 3LKQB 1T1ZB 3VFRA 4D0DB 4LCWA 5FO9A 4X6FA 3WLWD 5FOJA 4HGWA 1MIEH 2Y23A 4OD1H 12E8L 4HV8A 5GS2H 3C6SB 5BS0B 5DD0L 4FXKB 5F3HB 4P3CL 5FK9B 3HC4H 4Q74A 4W81A 3SE9H 5LVEA 1CD9B 1R3LB 1YY8A 2FO1A 5IVNA 4K7PL 2QHRL 2E6PA 2VH5H 1OW0A 1SEBA 1F2QA 1I1AD 4WW2A 2I26N 4DKFL 1IGCH 2EDYA 2VUOA 3GBNL 1X5LA 3U30C 4TNWF 2BY0A 1CXKA 3BGAA 5I75B 3MRNB 1FZJA 1I3GL 3LDBB 1AQDA 1CE6A 3CVIL 3SJVA 5D7KD 2YD3A 1HWHB 5CD3B 2BNQD 3C9NB 1GHFH 1EO5A 1A3LL 1FG2A 1PGRB 4ORZC 4U6VL 4OZHB 4X7EC 3EJYD 3WXVL 2J4WL 4FXLA 1WBYB 4XPBH 2JJSA 3BXNA 4IMLA 2J3SA 4KUZH 5I1HH 5KOVC 1JFQL 1MPAL 5KJRL 4XMLH 4ZFOL 2D9QB 2WAHA 1Q9WA 5EU6D 5F1NA 4G80A 3PP4L 3GMLB 4RFEB 1GL4B 4KI5E 4ZTPL 5C7XL 5D7LA 2W60A 3DVNA 2NXYB 3HUJB 4D8PA 2VE6A 2OMNA 1JK8A 3SGKC 2R1WB 2QQKH 3NCYP 1LO3L 4UDTB 2VTFA 1C16B 1DSFL 3U30B 1G7LA 1C16A 5I75C 4MS8D 1YY8B 3DIFA 5ESVA 2Q8BH 5L6YL 2EKSB 2EKSA 2DQEH 2D03H 3ME0A 2F5BH 2QLVB 4JGMA 4YFEA 3AM8C 4G3YL 4JG0L 2CQVA 4UMGA 1GHFL 4ELKA 1N0XL 1K3IA 2EYSA 1JMXA 1AO7D 3WFEL 3ZMRA 5CUSH 1RJZA 2Q6WA 2X4SA 1ZMYA 1TIUA 4DKFH 4N90E 4PJXE 5GGSY 3R0MA 5GRJH 4V1DB 4S1QH 1OF2A 4NO3A 4N8VG 4ZQKA 4AMKL 1U95A 3X14A 4Q9RH 2FIKB 4MNGE 3KYOB 4PJFF 4PRPB 4JM2A 4N8CL 4QTHA 1X4XA 2MHAA 4F57L 3O4LD 3FQNB 2BXYA 3CLFH 1AD9A 3SKJH 4DKEL 1CI5A 4C83B 3MOQA 5DJDA 1FSKC 3U0TA 3SDDA 1FORL 5FCUL 1WIPA 4QGTA 2YPLA 2HH0L 5TDNA 1CE6B 3SJVB 3W39B 1J87A 5KSAD 1U2CA 3VXMD 1KJ2H 4IOIB 5IEKB 1TITA 3KJ4C 2PO6D 4EDWH 4PJGE 5JQ6L 4FRWA 1MFCL 4NSKA 4I77H 3DUUA 1MFEH 4HULB 4R0LA 1AQKH 4XXDB 4H88H 4M93C 1MCDA 4HGWB 1S3KH 5E6YA 5F89B 5CIPA 2NY5L 3C6SA 4X6FB 2N1KA 4PJ5A 4R4ND 5DDHA 1B0WA 4CMMA 4XWOD 3HMWH 4U3HA 4G7VH 1U92B 5HHQA 2ZJSH 5C0RL 3WNNA 3BKJH 5LG1A 2IBBA 2W38A 1R3JB 2ICWB 1CFSA 1RK1A 5CFHA 1A7BA 3QRGH 4MX7A 1A4JB 3N9GH 2EDTA 1ZE3C 5C0AA 3BDYL 3EYFB 4TOYH 4OSUL 3KPMB 2CLRA 4HGMA 3LN4A 3NCBB 1FNSH 5LQBL 2XY1A 3KXFD 5IOPB 2A6KA 1FAKT 1JTTA 4CN6A 2OYPA 1KULA 2R8SL 4HIEB 3S96A 4UV4H 4G8IB 2YPLD 2HH0H 3SCMD 4MS8C 3BN9D 4EN3D 3QEGL 5IT2L 2R15A 1NLDH 4XNMA 4F7TA 4NQXB 4L4TD 1LMKA 5FUZL 2UUDH 3ARBA 1FNLA 4G8EB 3TPUB 3PL6A 1G0YR 1JGLH 1LNUB 1JPGA 1LO4L 4PJDE 4KDVA 1MHCB 4UT6H 1W0WB 1QR1B 1HKLL 1DQJA 1CU4L 4PLJC 3IF1A 5JHLH 2I9LB 4QRUB 3N50A 4JFEA 1VERA 5D4QA 3DETC 4P4RA 3FN3A 1JHLH 2C3HA 4KC3B 1N3NB 3DROA 5MEPA 2RBLA 5B22A 2VOTA 4QT5A 1MJJA 1MI5E 1T2JA 1ZANH 4KUCF 1LGVA 5DRXB 3IRZA 3QFJD 3IFLL 3P4MA 1MREH 4TVPH 5I9QC 5INCA 1AKJB 4M1DH 3O45B 4TULH 1PYWB 3QUXB 2X4TA 2VZSA 2BCKA 1M7DA 1R5WB 1XGRB 3TA3D 1P84K 4NKQB 5HHXL 3J7HA 1JZ4A 2IAND 3EOTH 5J89A 4B5EA 1OAQL 2QSCL 4YUEH 1EX0A 4FQIH 2ARJQ 4JM2C 4U2ZA 4JRYD 4IJ3B 2XNAB 2XFXB 2I60L 2VAAB 4OBSA 5CJ8A 4Y2DB 3BP5B 3TBVB 4MAUH 3FQUB 4EJ1C 2MCG1 1V7NH 4X5XA 1DQML 1C5BL 1QFWL 1QO3A 3RVVC 1JRHI 3IDNA 4X9GA 2FATL 5CEZL 2B1AL 4OUOA 1UH3A 2E7BA 2MMXA 3MLZH 5T1DH 3FO1A 1U8HA 1DQDH 1RZ8A 5BVJB 4I9WD 2W9EL 4JQIL 3RWEB 1RQ5A 3DO3A 4APQA 1SYSB 1D9KD 3EIFA 5I16A 1SBSL 1XCQB 2NTFA 1KB5A 3F7YB 4NPYB 4JZOB 2Y1VA 3EAKA 1IGCL 3BMVA 3QWOB 4I13B 3SDXE 2IH1B 1EAPB 2H41A 4KHXL 5DURB 1MREL 2UVFA 4TVPL 2AV7A 4HLJA 5E24E 1F3DH 5I30H 3MRFB 4LKXA 3SOBH 1T2QL 5DVNA 4X5LA 1P5VA 3QI9D 2GSGB 1DE4B 1DE4A 1AGBB 1FFNA 5F8RC 3BN9C 2FX7L 5E70A 4EN3C 3G6AB 4KV5F 1R24B 4GG8A 4J2XA 5TF0A 1BP3B 3QEQB 1VGEH 5CEZH 1FBIH 2F74B 4F9LC 1KTDB 1HHKA 4U1JB 3PDGA 4OI9A 4R3SA 4D2NA 2RB8A 3EDEA 4G42B 3V5DB 3C5SB 2FSEA 5I1GH 2IBGA 2R23A 3BKML 5DMYA 1I85C 2YUVA 1RZ8B 1OSPL 2NY4B 2X70B 3HN3A 1JUFB 1J1PL 3FZUD 3CDYA 4PJ9A 1YEGH 1RURL 4J3SA 4AM0B 2C3WA 4AIOA 1KIQA 4X5XB 1E6OH 5T5NF 2JJWA 2BNUA 3ARWA 1WCBA 2MOVA 3DTXA 1JN6B 3NCFB 3V95A 1AR2A 3LZFH 3ALWA 3OKLB 2ICES 3BT2H 2XFXA 3QUYB 4GAGL 1KPRA 4PRID 3Q5YA 1KEMH 1RHHA 1GAFH 4P59L 1R6VA 1CGXA 3MLUL 5E6IB 1VFOA 5MEND 1XF2A 3JV4A 4X6BB 5C08E 4IRJA 3DV4B 3ARGC 3CDFA 2EEBA 1FN4A 1MY7A 2DM3A 4HWBL 4V2CB 4X4XB 2YR3A 2EDXA 5MEQB 5FM8A 1QKZH 2AABL 3PIQA 2W07A 2G5RA 5AUMB 3CXDL 3ULVF 4HPOL 3P4MB 4M7LT 5IQ9B 1IKFH 1I1RA 4MB3A 4PJCE 4BH7A 3VFTA 1UXWB 5F44A 4TN9A 3O6FB 1HINL 1DLFH 1J1XH 2H26A 5A2KH 1KEGH 5CEYB 1CLZH 1UA6L 3MRMB 5IB1B 2XTJE 3ZKXC 4OM1L 1L7IH 3QEUB 2B8OT 5DJYA 3U83A 2EYTA 3LS5H 4QRQB 4WFFE 1UZ6E 5JORB 4OCNC 1QR1A 1BIIB 5DUPL 1TZIB 1WWAX 2AI0L 4F7EA 3BISA 4ZAKB 3WIHH 1MFDL 1AJ7L 5F7LB 3FO9B 4LASL 2AK1H 4U1KB 4PJ7E 2NY6C 3TIDA 1J0ZA 3SJVD 4QOKD 5IFAH 2VUYA 3MA9L 4QHKJ 1RZFH 1A2YA 3IJYA 4K55A 4W70A 5C0RH 4A2LA 4CJ1A 3LN4B 1CBVH 2FJHA 2A6KB 5CS7A 4JFZL 1MAML 1YMHB 1JWUA 2VLRE 5GS0L 4JO4L 4U3CA 3MXWL 4G9DB 4XVTL 1HHJB 5EO9A 4Y4FC 4N68A 4FQ1H 2ADJA 4QHUA 3PHQA 4RMTA 4EI6B 1S9YA 1WTLA 3TO2B 4P57B 5BXFA 3U2SA 4CMMB 4TSBH 1QQDA 1KTLB 1QSEA 2VN7A 4U2YA 1NCBH 4W6WB 3EYUH 4XI5C 2PTVA 4ODUB 4LKCB 4H8WC 3UYRL 5KAQF 5CKGA 5EBLB 1T6VN 3L3DA 3SPVA 2MNUA 5GS0D 1DQQA 2EE2A 4XHQA 3K1KC 2Q86B 4EI5A 5D70H 3KPSE 4DJMA 1FHGA 2JK5A 3ORJA 4MXWH 4YHKH 35C8H 4Z8FH 5JW4M 1GC1H 1X5HA 5DD6A 4GKSB 4LLQA 2YPKA 3ILQC 3ZDZE 5IR1A 5FO7A 1D5BB 4UNTA 5EOQH 4MD0A 3HB3D 1XZ0B 2YBRB 1ZGLB 1GRWA 1OAUH 1B6DA 1CBVL 3X3GL 1CS6A 2M1KA 4U6TA 5JHDD 4RMWA 1CLOH 5C0JB 5KS9B 4ZQKB 1VADA 1NCUA 3U9PL 5C0FA 1YNLH 2X1OA 1G6VK 5CINH 4PRPA 4JO2H 5DT1L 4ZO8A 3QZWB 5BO1H 3DV6A 3CMOH 3A6BH 2XWTA 4M3JA 4RFNC 5BOZG 3MLWL 1UB6A 4OKVA 8FABB 4ZSOA 4F9PC 5D96C 4PY8J 3RL1A 3LN5B 5E9DE 5B38A 3SHSA 1L7IL 1A6WH 2ICWI 1TVBA 4L8SC 3OXRA 4FQXC 2CDFB 4LLYB 3BPLB 4R4FH 1G7IB 4LPCA 3MOBL 1C8PA 5ESVB 1IAKA 1K4DA 1XAUA 5EZIH 2X7LB 4QRRA 1HHIB 1SY6H 4HXAL 4XXCA 5H37G 1HXYA 5IEHB 2HFTA 3JVGC 3EOAA 2H9GA 5EO1B 1G7QA 4NWTH 3U7AA 3UTSD 2YD1A 3NFPA 2X05A 5GRVK 2VABB 3S4SB 4GG6A 3TH4T 5F1NB 1NDGA 1GAFL 3MREA 4P59H 3NCMA 5F6HI 2OXHA 4P23B 3T65A 4PJ7F 5A16B 2D7NA 5ITBH 5A16A 4HMCA 1CGWA 1DFBH 4AJ0A 1JYNA 2GY5A 2YD2A 3ALPA 3FQTA 3HNSH 3MRKA 4ZS7H 5EU5B 4LSDA 4DUWA 3QO1A 2APBA 5D7KE 4N1CA 3QRGL 4QEGA 3TFKD 4XBPA 1WC7A 3V0AC 3CDCA 3T2NH 1AC6A 3BP4B 2HMID 4JQXA 3RVTC 3K8LA 5GZOD 1D6EB 1WWCA 2WLYA 3H3PL 4NQVB 3RY6C 4LP5A 2BHZA 3OJDB 1XIWB 5DI8B 1OSPH 2AJVL 4Y4KA 3R1GL 3QIBD 1X5FA 4BK4A 4NQVA 4LSRL 1MSPA 4Q2ZA 2LU7A 3FHAA 4WWID 1BQHA 4HQQL 4PRDB 3IFNH 4O9HL 1MUJA 1G7IA 2J88L 5D1XC 5L6YH 4NQCD 3TN0B 4Y4HD 4QRRD 4P2QD 3UAJC 1IFHH 2VITA 3L3OB 5D72H 2ENSA 5I0ZA 2DLIA 3D0VA 2X4UA 3NPSC 4JDTL 5D2LA 2VDPL 3LAFA 2IJ0C 5I8EA 5T3ZD 3RL1B 3CLEH 2EICA 3OGCA 2A6IB 1FO0L 1A5FH 3ARRA 4KI5C 3UTQA 4NFCA 3PNWB 3V8OA 3HAEA 1CF8H 4X6CB 3MLXL 5HHOD 5I76B 3T0EE 5MEOB 4Q9QL 4N9OB 3SE8H 3FCTA 3V7MA 3WS3A 4QRPD 3IDXL 1CDIA 1G6RL 1DBAL 3MXVL 1AO7E 1JWUB 3QT2A 5EBGA 5EO9B 4YHPB 1BQLL 3T3ME 4GMSL 4P2QB 3TA3A 2OS7A 1XF3A 3ARXA 1QLFA 1IGTA 3LKSB 4NKDB 3TJHC 5JO5A 5JIPA 4JJ5B 3SQBA 2IGFH 4QRTA 5DD1L 2UWEE 2FJGB 4CU6A 4ODTH 3BHBB 3GBNH 1EZVY 1CGSH 4S11A 3SDDC 3A67L 5CCKH 4R0LC 4PTUA 3GNMH 3QCTH 1P1ZA 5EZLA 4QOKA 5B39G 4MJ5B 2GY7B 5IMOA 4MHHG 5TE7H 4H26A 4DGVL 4Y1AD 3U0WL 4H25B 1VB9A 4PIRF 4TSAL 2IAMC 1X7QA 1I8KB 3NGBB 2H2SC 3MBEA 1YC7A 1K5NB 3QULA 1YYMH 1ADQH 3CAFA 1ZGLA 3L3GB 5DRZA 3O6FA 3QIUC 3R0NA 4XXCC 5SV3A 4XP6H 1H5BB 2MKWA 2Z91B 4KHTH 4MQ7B 3VFMA 5IKCB 1T7YA 5J0BA 2XXMB 1I9IH 5F96H 1Y6NR 2OJZL 4N0CC 1V3LA 1N5AB 1UXSB 3QNYB 3H9SB 4BFEA 2BSSB 4ZNCD 1MF2L 3GO1H 4Z0XB 1KUMA 5HHME 5AD0B 1UG9A 3AREC 3HZKB 4QF1A 5IBUB 3D0LB 2A74B 5LKNA 1YN7A 4GW1B 4MNQD 5DWUH 3DVGA 3M8OH 4R97B 1XEDA 1WBXA 3F8UB 1ZLVH 4PTTB 4P3CH 1EFXB 2BOCA 3NZHH 5DMIH 2ZUWA 3LD8C 1YUHB 1Y6MR 4UT7H 1CFTB 4L1DA 3O41A 1CXEA 2BNRD 4PLNC 1JNJA 3UDWA 5KN5B 2EH7L 1YEDB 4OIIL 3VFUA 5TF1H 4DEPB 5C08D 5L8LB 2R69H 3E2HC 1JGDA 2IPTL 5TH2A 4DK6A 4L8BB 4QRSB 4P46D 1HHGB 2XA3A 3K4DA 4WGVB 5HY9A 4QHLB 3LH2L 3EDKA 3RNQA 4PS4L 4ZAKA 5MENA 1KGCE 4NWTL 1JTPA 3JV4B 5IJKC 5BQ7A 3QUZC 3VWJA 3PWJA 1JGVL 3PWLA 1XF2B 1SJEA 3PWLB 2QQNH 1I3RB 4KTDH 4HEPG 5IVZB 4EUPG 5KSUA 1ZXQA 1EGJL 1FV1A 1S7VA 2MWCA 3RA7H 1A9EA 1IC5H 3SDDD 1S7XA 1S7SB 3TIEB 3AGVA 1JF6A 1GOHA 3D39D 3C08H 1A7QL 4JFFA 3VD7A 2VLRA 2NTFB 4ZPVA 2A38A 1MWAB 3WJLA 1OM3H 3SDCC 4JGUA 2APFA 5C09B 1DVFA 2F5BL 1OL0A 4OGYH 1ZLUH 2UWEF 2IAMD 1R0AL 1K6QH 1CXLA 3RI5F 4KK6D 1UH4A 3DHMA 3HE6C 4PJ7A 3G08B 1EFXD 3G08A 1T83C 1KJ2L 4WI8A 1TJHL 4QO1A 2BMKB 2VDLH 3CVHB 3DSFH 5HGAB 4XI5D 1QO3B 4PGCB 3SJVE 4P9HH 1DUZA 4JR9L 3SDYL 5KZCB 4WO4A 5C07A 4PLOB 3S37L 1B0RA 1EEYA 2FEDD 2NY2C 1J0HA 2IPTH 4ZO6A 5AD0A 5HHPB 4KVCH 1A9EB 1MCNA 5JLZB 2XZCH 2MTPA 5JDJA 3HPJB 5IESL 4GRLB 5GRJL 2A1WL 3T4AB 2R0LH 3MODL 1ZLUK 5I71C 1KT2B 3BE1H 2AAVA 4O2EA 5I1LA 1ZKAA 2HTLC 4I8DA 2N7AA 5FYKU 5JDSB 5LGHH 3K80A 2W0LA 4PGDA 5GGTL 1I8LA 1DANT 4HKBB 5FGCE 5TGBB 4U1IB 3O45A 4M6OL 2W9DL 4E0RB 2KPNA 2Z91A 3D39A 1JZ3A 1MRFH 1XF4A 1T3FB 4NPYA 4EN3A 5SX5H 4HS3A 1YMMA 3KPSD 1JWMB 4ZNEE 3AS1A 1IARB 3OAUH 1W72B 5LGKA 4XAKE 1HYSD 1NCCL 1RUML 4N0FB 4GRWB 4JM4H 2XKUA 4Z7NE 3GRWL 3U0PA 2VAJA 3QXWA 1I1FB 3WS6C 4J4PC 3MLVL 3IDIB 3LS4H 4WFGD 3MRJB 2F8VA 3MJ9H 3OX8A 1BFVL 4HWEH 1P4IL 4IRSC 5EU3B 4XP6L 4Z0XA 3ARZA 5DMJB 1YEFH 4PRAA 1NEUA 1XIWD 4BFGA 4I3SH 4OJFL 4RDQF 3WIFA 3HG1E 1FIGH 5SWSA 1GIGL 3PHOB 3QFJA 4XPBL 2J4WH 4MAYB 3DX8A 3TF7C 5JO5B 3ARBD 4LEOB 3VFUB 4FS0A 2AV1B 1OY3B 4FN0A 5F72S 3O3UN 2EDOA 2HLFC 3PP3H 5JHDB 1B2WH 1T03L 3QUXA 4NQEA 4HX1A 2FECL 2IANA 1QOKA 4G9FA 3GNML 4E41E 2AJ3B 1TZGL 2R0WL 1O7VA 4UBDD 4RAUA 2DL9A 3S3SA 3MRBB 5JPMA 1BM3L 3BQUD 2VDQH 3B83A 1QFWM 4JKPL 4X4MA 3GHBH 1Q8MA 5HHQB 3HI6L 3I2CL 3EZJB 3MBEB 3LEYH 2I9LA 4QRUA 5I18L 1P2CB 1CLZL 1WFOA 4JRXB 4G8FB 3FB5B 3BJ91 4OFYA 1MRDL 5DJ2B 4CNIA 2WBJC 4TVPE 5J1AB 3RWIA 2V7HA 3S98A 4BSWB 3LIZH 3GMPA 4PLKC 4L4JA 2XN9E 1T1XA 1TETH 4POYA 4OLVL 2D3VA 3IJHA 1WAAA 2ERJC 4NN7B 3GSXB 3VI3E 2NY3B 2W1NA 3QQ3B 2DB8A 1IZKA 1SJHB 2E9IA 1PY4A 1F6FB 1HCFX 4IHOA 1WTGT 2NY1C 2HWZH 1GSMA 1J0YA 3RFZC 1EJ6A 3I6GA 4NQDE 3VW3L 4HG4J 2NYYC 2B39A 4KKNA 2AEPH 3NA9L 5I6XB 2FEEI 4M8QB 4M7JH 5F9DC 5D2NE 3SO3C 1OF2B 2R0KH 4YK4B 3QWQB 4KK8D 1A1OB 1C7TA 4U1HA 3RDTC 3KYOA 5HDQL 2RQ8A 5C70A 3L3HA 4OF3A 4RGOH 1AGFB 5AZ2H 4PV8A 4XPHL 1QFUL 3HS0B 3GB7A 4GKNA 5GS2D 1A7QH 1KIRB 3DMMD 3R8QA 3K2MC 3F7QA 1NCAL 1KOAA 1PKOA 1ZA6B 2X1XR 3LQMA 4NQXA 2VDRL 5T33L 1AHWB 2JB5H 5F1IB 3F12B 5K9QI 5IMKB 4F37F 3LEYL 4JRXE 2EYSB 1U0QA 5LWYL 5FO8B 4UOW0 4Z7WF 1ACZA 3B3IA 5DS8B 3QA3A 1IGTB 3O0RH 3QPQC 3DGGB 3X13B 1LP9F 5DF0A 1V7MH 4PBWD 3KLHC 1KSRA 4LRNH 2GK0A 5FA4B 3MNVA 4HKZB 15C8L 5J8OA 1L6ZA 2XTJB 3OHXA 4NZTH 5IW1A 3CH1B 4P5KB 4U1GB 4X6DB 2QJDA 2FDBP 1UB6B 3B2VL 4RFEA 2A6IA 4HS8L 5JIIA 3GMNA 1CFVH 5IVXA 3G6JE 3BXNB 4IMLB 3KDMB 5EUKA 4XXDA 3O6FC 3D69A 3AFLA 1QD0A 1WF5A 1SM3H 4RDQG 1Q9OB 3X12B 2DF3A 2J5LB 4WJ5B 1DQLL 5C0BA 3C9NA 1J1OH 4XB8A 3JWDL 1S78D 1C5CL 2PXYA 4PLKD 4YFLI 1JZ7A 5HHVL 4HJJH 5GGVY 5IEHA 4ELKB 5DHYB 4WHYG 1D5BA 2ORBL 1INDH 1MRDH 2JB5L 4WEUD 4CMHC 1T0MA 3CFJA 4Z18A 2DLGA 5TDNB 2YUZA 5KSBB 1HIMH 3RWGA 3C5ZA 4WNQB 5DMGC 1QR4A 3ROOB 3MXWH 3FQTB 4MA7H 5EU5A 5FK9A 4JPIB 1MJ8L 3HB3C 5F71A 3VG9B 3VXQA 1ZVSA 1T5WA 1BF2A 4G5ZH 3SO3B 3AS0A 4PV8B 2A83A 3EO9L 3O6KL 1IAIL 1KC5H 5F6HJ 1DBML 5EU4B 4KK8C 2J8UA 3AM8A 1G7MB 4PJ8B 3RUGF 4Q6IB 4LP4A 5IG7A 4PRHE 4JFFE 1HHJA 4HWBA 3T0EB 5B21A 4XP9H 1TNNA 3WJJC 4I4WB 5DS8A 2Z8SA 4Y4KC 4HIXH 2BHYA 3T1WA 3SGJA 1F3DJ 3EYVA 4HUMB 2H32A 2PCPB 3VFVA 3PL6C 3D18B 5A3ID 3TBWB 2VL4A 2NW2B 4DN3L 5CP3A 3RHWK 3HI6H 5C08B 4B41A 1KCLA 4KVNH 1JMZA 4MA1B 2BNRE 1OP5H 5F97E 4ZUTB 3KDMA 4ORGA 5EUKB 4JFPA 5DHVH 1ADQA 3U7WL 3F58L 4B53A 7FABL 3KPNB 4XT1C 4AZ8A 4G8FA 1NFDB 3MRIB 3L7EB 1PLGH 3MJGX 3TO4D 5K59F 3WKMH 1WBYA 3VFSB 2RR3A 4ELME 3EJYC 4LCWB 3ARPA 3VD4A 4MXVF 3MC0A 1FG2B 1JP5A 5KBNC 1UYWL 1XZ0A 2YBRA 2VDKH 3SCMA 5CJOH 5DSCB 4NRYB 4IHOB 4I48B 1AO7B 2E5EA 1RUAH 5DFWH 4LGPB 4CDGC 1LP9E 4LVOC 3MRRB 2CD0A 1U91A 1ZHBA 3W9DB 1Y18A 2HMIC 3WD5L 3I84A 3F6IA 3QUKA 2I07A 4PRBB 4QWWC 2X4RB 4X4YB 2DBLL 4IRJB 1WAAF 3TIDB 1NKOA 5IB5B 3QI9C 2BVTA 3MROA 4MZ2A 4PRAB 3SPVB 1Q9LA 4HCRH 4UT9H 1W72H 3ELAT 2FJFB 4PRHB 2YZ8A 1T80A 2BFVH 2DQDL 5JQ6H 3CDGA 3EKCA 4XP5H 1UWGL 4K23H 2IAMA 4P57A 2PYEB 4EZMA 4K3DL 3VWKA 4U6HB 5DC4B 2DM4A 1KELL 1IGYB 1WBZA 1ZK9A 4ETQA 4KQ3L 4AEFA 5IV2B 4YZFE 4LSVL 2OK0H 3UBXA 3GIVA 1KCSL 4YHMH 3RI5K 1YMMB 2E7CA 5GGVH 5HDLA 3RGVB 1XF4B 3RIAK 3FZUC 4HMDA 2VXVH 3BAEL 2XZCL 1UM4L 2XY2A 1N8ZB 3ARGB 1DFBL 3QEQA 5EULV 3UYOD 3DX7A 4G7YL 4LEXL 3MRLA 1AY1H 1PG7X 4HC1L 3KLDA 4RNRB 2GTWA 3BIKA 1Q94B 3KG5A 4FG6D 5E6IA 5F7MC 1A6WL 4LCCC 1I1FA 1A6ZA 1LO0L 4ZYKB 4FP8H 4NYLA 2AVGA 4KDTC 2Q7NA 1RZ7H 2FATH 2EECA 2BNUB 3NZHL 5D8JL 1FQ9C 1SYVB 4PJDF 4NGHH 2HLAB 4JLRA 3TGXA 4RAUB 5EBWA 4HS3B 4QCIB 4P5TC 5HGAA 2AJSH 2FR4B 1SJVA 1A6TB 4PJIF 2Y07L 4CVWA 3BW9B 3U46B 3H0TB 5DVOA 3OKMB 3UYRH 1OP9A 3WNPA 3QCVH 5AYUL 1HH6B 2BVOA 4GG6E 5I73B 2YN5A 3T2QA 4RAHA 1L4IA 8CGTA 3IGAB 3UP1A 2WQ8A 3FQXB 3B9VA 1SY6A 3DURB 3VXRB 4Z7OF 1N4XL 2B5IC 1U8NB 5GJTL 1W0VA 3PQYB 4K3JL 4M7KL 3T4AA 2F74A 4DCQA 3LQAL 5FYKE 5KVEL 2LU4A 1E27A 1NUGA 4F58H 3BGFB 3JV6A 2XWJB 3DOSA 3QIWA 5E1AA 1A6ZB 4QWWD 1T1WB 3ZYJA 5HYJB 1EXUB 3SCMC 3NABH 4CU7A 1X5AA 3VXNB 3MRFA 3RTQB 4JPVH 3SBWC 1JE6A 3CVHA 4V1DD 4QHLA 1N2RA 1A7OH 3VCLB 1GZQA 4MDJA 4PBXA 1NKRA 1EAPA 4HPYH 5CWSB 4AENA 3OKMA 4TVSa 1JZ5A 4TSBL 2G2RA 2NYYD 1PKQA 3LQZB 4JHZA 3QDHA 4BH8B 1QFWH 3TN0C 3RGVA 4FQ2L 1ODAA 4L3AA 1KPUA 4WI2A 3M8OL 3W5NA 2Z8RA 5E2TH 1PKQB 4PYHA 1OD9A 5DO2C 4APQB 5FYLH 5FKPB 5D70L 1XGQA 4ZOEA 1L7TH 2AJYH 2ZCLH 2VZ1A 1U8HB 4HUVB 1YNKH 5HHNA 3CLEL 3TIEA 4UV4L 2Y5EA 5F7HA 3NFNA 3HFML 4LVNC 3RX7A 5DEFB 1SJEB 4CAGA 4GW1A 1KB5L 3HPJA 3A6CL 3NOIA 4HIJB 1N5YL 3LKNA 1TMCB 2XWJA 3CX2A 2PO6B 3GUTB 1VHPA 3GDBA 32C2B 3W9EB 4KHTL 2VC2H 2QBWA 4DZBA 4QRSA 5EH1A 1KN2L 1W8OA 1IQWL 3I3EA 3KLHD 4LSQH 1BGXH 5CGMA 3WO4C 4PLJD 5F93C 1S5IH 4NO2B 1WV7T 2DMBA 4KTDL 1IZJA 1K85A 1F00I 3HUJE 2A1WH 3OKNA 4JZJC 5IESH 2NXYC 3ARFC 3IGAA 4I48A 4D9QD 3JVGA 3BW9A 3U46A 5KTEL 3HNSL 4RIRA 4ZS7L 1BD2A 1QZ1A 3SQOL 4F7PB 5F6IC 1NGQH 1IKFL 3WBDA 1N3NA 3DROB 4RISH 3QULB 1DQTA 2L4OA 5F9AC 4PRHA 3L7EA 2NXZC 3O6FD 2NY5C 4BZ2H 1KJ3H 3KPNA 4H8WH 3QUMH 2CPCA 3BEVA 3PHSA 5ERWA 3W2DH 4JANB 5FDWA 2GTWB 3BIKB 5EZOL 4TQEH 3CFKB 4CADB 4G8EA 3QH3A 4Z78B 4ZD3H 1DQMH 3RIFF 2HVKA 5IKCA 3QQNA 4Y89A 4KGLA 1G9MC 3BP6A 3KYMB 5IMMB 3AY4A 2VLKD 3MTRA 3AMKA 5CBEB 2IG2L 5ETUB 5DJ0A 2Y6SD 2OR8A 2VJXA 1TQCC 2B4CH 3B4NA 4D9RD 3CU1A 1G7PB 2V2WA 1ZEAL 1P4LB 2OSLA 3L3IB 5JR1L 5DZOA 4UQ3A 1I8KA 3ZDZF 1JPFB 4PJAE 4HEME 3B5GA 5CSBA 3O11A 4H25A 1IGYA 4NJ9H 3C2AL 5KW9L 1VCAA 4JFPB 1FGNL 4U6HA 1S7TB 2C1PB 1A0QH 3H42L 1BAFL 1OTTD 4JZJB 4PJHE 3Q6GL 2P5WA 2IPKB 3QXDA 1N59A 2B7DT 2VLME 3TN0A 1I1AB 2VMFA 4CKVX 1Z3GL 2J8HA 2P5EE 1NL0H 2IEPA 3C5ZB 4X4YA 1ZHBB 4PRDA 3W9DA 5EC1B 3CVHH 4XC1H 1LD9A 4IOIA 3GEWB 1U91B 4NZDA 2B4CC 4DQOH 5CINL 4JFFD 3UTTE 3PABB 5DJDB 4PD4J 3STLB 2UVEA 1D5ZB 4Y19B 4RWYL 2ZCKH 2ATKA 4NO0B 3IFLH 1U41A 4O2FA 1HILB 3IFOA 3AS2A 1EAJA 3GMNB 5DVMA 1EZVX 2ICEB 4FQ1L 3S36X 3HZMB 1X5GA 1LO3H 1P1ZB 5EZLB 2QQKL 1P53A 3WN5C 3RAJL 1FGVL 1VFUA 1IT9H 3E6HA 4J4PA 3QUYD 5BZDA 1GGIL 1JGEB 1YYML 2KUTA 4XCEA 5FA4A 4LLAA 5CZVH 5L88L 5DEGA 4NQCE 3TBWA 1WQVT 1RUMH 3ZKXB 2F58L 3QXAB 4OCYL 5DUBB 5I2IA 1SEBB 2Q8AL 1RHFA 5DGQA 2FD6L 5FB8A 4F33A 4M61B 1JPSH 4K3GA 5EPMB 1YY9C 1TJIL 3WLBB 4UDTA 4BUHA 1NLDL 4WW1B 5MP6L 1TVBB 1UZ6F 4JRXD 3V5HB 5HHOE 2LABA 4MB5A 3TO4A 3TESA 3FCTB 4QRPE 4QTIL 3IRPX 3DVFA 4DTGL 1EFQA 3HHRB 1Q0YL 3WEXA 4EQ2A 3B5TA 3SKJL 4DKEH 1U58A 4HUWB 4P4KA 4O02L 3BT2L 1A6AB 2I5YL 3LQAH 1A02N 3L5HA 5GJSH 5IFHL 2N4IA 3QHFH 1YEJH 2GI7A 9CGTA 3CMGA 3REWA 4I18C 4Y2DC 4M61A 1MFDH 2X89D 2XWBB 3TBYA 5IJVB 2Z31B 3F7VA 3X13A 4NQCA 4O00A 5EDXA 2D7TH 4WNQA 4B50A 4JQVC 1BVKA 5L2JB 5DZNA 5EZJB 4X99A 1RSFA 4XZUA 3V4UH 5FV2A 4MLSA 1AQKL 1AHWA 5JXAH 4X8JB 5C0BB 4K3DH 2XZZA 3KYKL 8FABA 2PXYB 1N5YH 1RI8A 1NBQA 1MCHA 1OB1A 2H8PB 4HCRA 4LSPH 3BGMB 3EYQC 5FEBA 4O51B 3TC9A 4RSVA 5SWSE 1L9MA 4NWUL 2Q8AH 4WCYH 4TNWK 3N9GL 2ATKB 4P9HC 2P8LB 1MCFA 4NHUB 4ODSH 1KN4L 1NBYB 1MAMH 1KTLA 4LNRA 4PJIE 5D93B 3H6JA 1BZ7A 3NZ8A 4FFZL 1DLHB 1UVQA 3VWJC 1YPZA 2Y36L 4NKMA 5ICXA 2CKNA 5I30L 3MNVB 4X6EA 5C92A 4X7DC 5EA0H 4AMKH 2FL5B 4Q9RL 5DK3A 1ITBB 4KKLD 1DDHB 5I17A 5GJSL 4ZOCA 1M6OB 3HNVL 2ZKHL 3O2DL 3FFCA 4XVUC 4D9LL 4WWKA 2J12B 1Z0NA 4LLYA 3IJYB 2XPGA 2BRQA 3MA7B 1MRCH 2W92A 5K9OB 4BZ2L 1X4YA 3RGHA 4Z76A 4Z77B 1T04B 3MNWA 5D7JA 4I18B 5EN2B 2P5WB 5IMKA 3V7AE 1QRKA 2C1PA 1ZT1A 5TQ2H 5KZCD 2DWEB 1CDCA 3T3PE 1ZLSL 3VXMB 1QQDB 1AR1D 4XRCB 3MRBA 4WO4C 1LEIA 4PJ9C 1NL0L 2C26A 3LPFA 3KYKH 1Q1JH 2BVQB 4GW4B 5I66B 2YD5A 3BKCH 4U1HB 1T0NA 4H1LG 3ZE1F 1WFUA 4LCUB 2FZ3B 3GSQA 3BP7B 4HH9A 4X98B 1IC7H 4W6YB 4KK5C 1AI1L 1H3XA 1GYAA 3QPXL 4KKBD 5CBEA 1FPTH 4JN1H 3ZHKA 3C8KA 5GGRY 5DD3H 2VDKL 3I50H 3RVTD 1S7RA 3VU2A 4WFHD 1QHPA 2L7UA 3P40A 5E7BA 1T1XB 2J2ZA 4RAVB 5SX5K 5FDWB 2JIXB 4JFZH 4MXVE 4AQOA 3DUSB 3GMPB 4WUKL 2E9BA 3BH8B 3HE7B 1ZHNB 1A7NL 5T1KD 1FVEA 3T04D 2AQ2A 5D1XD 2UYLA 1DQDL 4P0DA 2VDOL 3VWKC 1P7QD 2M8XA 1DUZB 1DTUA 1HIML 1ED3A 3PHQB 1DR9A 3UPRB 4JFOA 5F7DB 4DW2L 4GG6F 2DD8L 1GCFA 1Q0XH 4YXLH 5FYJD 5TQ2L 2FD6H 4G6AC 1AHWC 4G6KH 5HHVH 1BD2B 3IDGA 4ESKA 1JYVA 5IHZA 1EBAA 1LDPL 4DGYH 1OGAB 2FH8A 4BSVB 4PJ5E 2ADGB 4Y1AB 3FN0L 4GBXC 4WFEE 5JDSA 3VWJD 4GAFB 5EUOF 5M94B 1J88A 4OLUH 3O2VL 4S1RH 3L3KA 1U3JA 3H3BC 2H2PC 4XAWL 3FB6B 1CFVL 32C2A 4OZFH 5E4EB 1TXKA 5SWSB 4ZG1A 5LCVH 4HJGB 2JJSC 4HK3J 4JFHE 4XCFL 1ULVA 3BAEH 3EOBB 3U4EA 5E2UL 5I0DA 5GS0H 4XPTL 2DQCH 5CD5D 2NY7L 4N1HB 3GMMB 4G7VL 2NY6D 3NCYS 1GGTA 5KVMC 4N0FA 1DCLA 1WICA 2EYTB 4RA0C 2VDMH 1QA9A 1BF8A 2F19H 1XGQB 4YX2L 4PJ9D 5CZXC 3R4DA 1CTNA 3TT1H 2NX5B 3NPZB 4Y19E 2WINA 5D8JH 2QSTA 1GGBH 4YXKH 1P4BH 1HHKB 1E6OL 1ORQA 4U1IA 3RWEA 2X40A 3MLTA 2Z9TA 2NY0B 3NIFE 4KK5D 2R4RL 4BQCA 2P49B 1RZGB 3LPWA 2IMNA 1ZS8A 5EIQA 5FAAA 4NO0D 4OB5L 2C7UB 2EO1A 4YHIB 3P0GB 1M71A 1MCCA 2E7LC 1J5OH 4M6AA 1QP1A 3ZTJG 4PJGF 4G6MH 2JCCA 3FO2A 5HTSA 5D6DC 4OLEA 1JZ8A 2ARJA 1T20A 1H3PH 4KU1A 3FRPA 2HFFA 3TYGL 4BELD 4G6FB 3SKOA 3OR6A 1MFAL 3KPQA 4FQJL 4DCQB 1WJ3A 3VXRA 2HT2D 1B0RB 3WNOA 3MOAL 3DXAD 1K2DA 1OW0C 2ADGA 3NH7L 2GT9B 3NABL 1YEEH 3IDYC 5FYKD 5FYKL 3VRLF 3DURA 3KPOA 2Z93B 1TTUA 4BSVA 4BK5A 1V7ML 5DRXA 5DRZB 3FT2B 2X4PB 2WINB 3GKZA 1IM9A 5INDA 5EBWB 5FM5M 2IH3B 4NNXA 1ZLSH 3CGTA 5FUZH 1VA9A 2XG5A 1FC2D 3B2UC 4E9LA 5DMKB 4O4YH 2F54A 2WBKA 4NDMB 3W0WA 4JQIH 1MHCA 1I8IB 4JB9H 5FYLL 1PJ9A 4MA1C 4NCC1 1GVIA 1N6UA 4OAWB 2HRPL 3ZZ1A 1YYLL 4LARH 4PTUB 3RNQB 3ARBB 3F5WB 3D85D 4NQDD 2YA1A 1V3JA 1GH7A 4UTAL 2VL5A 3HZVA 4ODHL 3GSWA 3VXTA 5I1KL 1YY9D 4LL9A 3LV3A 2C1OA 4LSSH 1W2KT 1RZKC 3Q6FB 4RWYH 4JHAL 3ULUH 1IGMH 3CZJA 3REVA 3V4VL 1SYSA 1NFIA 5EUOE 4YWGH 4NUGL 4PBVC 3MUGB 4MD5A 1W0YT 5CJQH 4JFXB 5EU6E 3MFGB 4P5TA 3MJ9A 4LSQL 5CLTA 4OF6A 2QKIB 1N64L 3WFCL 3T0DA 4H88L 5IB4B 2E6JA 2YD4A 2BOCB 1KFAH 1DL7H 2X4QB 4XNQB 2DQIL 1N4XH 3QDJA 4PJCB 4P46C 1MCWW 1MLBA 4U6VH 5HI5C 3HC4L 3CFDA 4I18A 4YHKL 4EDWL 5F9JB 1INEH 2DWEA 5TFSH 4NM8H 4L5FH 5F89A 1IAOA 2YK1L 3UPAA 2Y07H 3ZL4L 1UCBL 2EDRA 1XGTB 5GGQH 3STZB 2B1AH 2BSSA 2JELL 2HFEB 3LPGA 2NY6B 2X4RA 4NGHL 3P0YH 4J1UB 4XNXL 4NFBA 5TDPA 2JIXD 4L3EE 5I17B 2ADFH 1AP2A 3VFMB 2A6DB 3UEZA 3EO9H 3O6KH 4Y4HC 5C6PB 1D6EA 4ELMA 5ID0A 4M9PA 1FFQA 1D3CA 4FQQB 2EO9A 1KXTB 4HWZA 1HQ4A 1XGPB 5E94A 4OZ4A 4OLWH 4Q9CA 1DANU 3H42H 4CVZA 4G7YH 4HKJA 3WMSA 3AXLB 4LNRB 1MAKA 2EC9U 5EIIA 2FIKA 3MPCA 3MUZ1 4XMKH 4NHUA 2HRPH 2QTEA 2VITB 4V1DA 1M1SA 3GM8A 1H8OA 2I27N 2PTTB 1LEIB 5EUOA 3S4SA 3O8XC 5J3HC 3V6ZA 3O0RL 3LQAC 1GXEA 4M48H 2FECI 3G5VA 2VIRA 2DKUA 5DYOA 1K8IB 3BRDA 3EYVB 1KJ3L 2VDRH 2R4SH 3D18A 1MJ7H 3F58H 5IOPA 3U7WH 4IMKC 4D0BA 1UWGH 1ND0A 1RIVL 3TA3B 3V6FA 5B8CB 3VXME 3OKOB 3PWPE 2AQ1A 3RY5A 4WWKB 5D96B 5L0QC 1UQSB 2V2XA 3PWVB 4RBPH 2VISB 3C8DA 4LPYA 4G6JL 1VEPA 3KPTA 1JNHB 4XGZA 1A14L 3B9DA 2CK0L 1NCNA 1AR1C 1U95B 3WN5B 3X14B 4NCDA 3WJLC 1R3JA 2HLFD 2R0LL 3MODH 1FH5L 1WT5C 2V5RA 4Z9KB 1A1NA 5E8NB 1B4RA 4HFWA 5ACMA 1H3PL 5ANME 2H2SD 1DZBA 3OGCB 4NNPL 3QZWA 1IQWH 4HJ0D 3FOMA 2X4UB 5D2LB 2A73B 1D5MA 3RVWC 3B5HA 4M1GH 5C0FB 3TJEH 4NT6B 4MXQC 2HTKC 3QP3A 5HI5D 2ZUTA 2MJWA 4WW1A 3UTTD 2AQ3A 4GRLD 1MJUH 4S1SL 1KLFA 4J8RA 4ZXBA 3BGMA 2MQCA 5CD3A 3HNTL 3ZDYE 4P3DB 2Q76B 1FZJB 2KL6A 4YK4C 5FO7B 4LRIC 5T33H 1J1PH 3BQUA 1L0QA 1IL1A 4OZIE 1IL1B 1XGUB 2ERJB 3RZCD 2JJVA 3KXFE 1LWRA 1XGYL 2IFFL 5DHYA 4WJ5A 5F1OB 4QTIH 3QG7L 4XCEB 3MJ8A 2ILLA 1NSNL 1D5IL 4JRYB 4LVEA 4Z7WE 2DQUL 5C09E 5K93A 3T0WA 5D71H 3OQ3B 3RU8L 3BWUC 2OR9L 3Q48A 3QB7C 3CK0L 3ZLQC 1MWAL 5GGTA 2YSSA 5C6TL 5HVWA 3ARFB 4KMTL 5CILH 4MA3A 5DFTA 3O8XD 2WBJD 5GS0C 3RVXD 4R7DA 4U6YB 3VFGL 3UC0L 3SOBL 3OL2A 2GKIA 4YC2C 4O5LL 1WIOA 2YMXL 4C56B 3DRQB 1LO5B 5J3HD 2VLLA 1KLGB 2BJMH 1CXIA 3DIFB 2OI9C 2WUBH 3OKOA 2AJXL 5IFHH 1NCTA 1UJTA 1RU9H 4FQLH 4D0BB 3ZKMC 3S35L 4GXUM 1NUDA 1OT2A 1R5VB 4D0CB 2NY1D 5MERA 1INQB 4JM4L 1H8SA 2F15A 3B3IB 3EYSL 1EEZA 1KTRL 3MCLH 3CCHB 4MQSB 4TSAH 3HUJA 5D1XA 5DRWA 4YEEA 3QPQD 2ITDB 5TE7L 5GHWH 1E4WH 1MHPL 5BZDB 1XH3B 5F9JA 3RP1A 4KY1L 1NCDH 5CGTA 4OKVB 4RISL 3U36B 4LVOB 5A2IH 5F9WB 5CEZD 1UCBH 5J12B 1BBDH 3GB7B 4GKNB 1A1OA 5J13C 1OQOA 4KVNL 2GJZA 4NN5B 3SE9L 4NM8L 5JMOC 2WIIA 3RPKA 5LGHL 1OAZH 2XQBL 1R0AH 5F96L 4MD5B 4NCC2 2FJHB 1F90L 1UXWA 3GI9H 1M4KA 3BH9A 4YHZH 3FL7A 1S9WB 1R3KB 5E99L 4XMLL 4Q58C 2EDDA 1ZA3B 4GRLC 1PW3A 5SX4H 5FYLE 4Z78A 4N8VA 1VPOL 1IGML 4GW5B 5EWIH 4YPJA 3I85A 3QDAA 2HKHH 5JR1H 3L9RA 3QH3B 1EJOH 3L1OH 4JANA 1XGTA 3MLRL 1KPRB 4HF5H 2B4CL 4OAWA 4HV8B 3OG4B 4QRQA 1FAIL 4UV7L 5BZWB 4LKCA 3K8KA 5DJ2A 5GRUL 5B4MD 2ZSVA 3DSNA 4JDZB 2B5IB 2VLKB 4GBXA 3IXAB 4O9HH 3UAJD 1U8IA 2P1YA 4J3TA 2IADB 4OZHE 5D2NB 4RIRB 1TQBC 2CSPA 4K8RL 3WFZA 4BH7B 5B3NA 5FYJL 5T1MA 2FX8L 5K9JL 3PIQB 3RWFB 3FKUS 3QDME 4U6XA 4P5TB 3C5SA 2ORBH 3BD4A 3OF6A 3MV9D 4PJXB 2D0GA 1JZ2A 1NBZA 3HG1A 4HJJL 4PUBH 3B8YA 1KELH 2ZOLA 4LCYA 4LPUA 4TSCL 5E08L 3V2AR 3UTSB 1T7XA 2D4FA 2VLJB 2R0WH 1Y6KR 3C60B 3T77A 3I02B 5DK2A 4IIQB 1UENA 1BJMA 4YBQD 3LEXB 1RULH 3BDYH 2ARJB 4Z7UB 4PJ8C 2DKMA 2E27H 2HJLA 1RK0A 1T03H 3ZKMD 3FONB 1HSAA 4P2OB 4WW2C 4XCCH 4WIQA 1FIEA 3IDIA 1ZVYA 4NWUH 3TYGH 3Q2CA 5LAXA 1VKXB 2FB4H 2ZJSL 1GIGH 3U0PB 4HUVA 4RFOL 1LQSR 2CKBL 2H32H 2I25N 1BGXL 4Y16C 5IBLD 3ARDC 3QWOA 5AZEH 3GJFA 2OTPA 3V5DA 1IM9B 4PJCF 4OQTH 3LIZL 2AJVH 4AENB 3V9FA 4JGJA 3VCLA 1CQYA 5D7SL 3VMPA 5J12C 1ZHKA 1RVFL 1ZWIB 3HTLX 2XYCA 3G6AA 3PDOB 5FYJH 2NXZD 3HAEG 2BSTA 4K8RH 2OJEB 4OZHF 3OF6D 5KSAC 3HRPA 1TJGH 3RTQA 1E28A 3QCTL 5HJ3B 3SGKA 2I5YH 3DV4A 3OKLA 3U4AA 4OLXH 5CCKL 3FFDA 4XPHH 4TRPL 2JJTA 5ICZB 4EXKA 2ID5A 2CRMA 1EEYB 4QYOA 1H3WM 4D9QE 1JHTB 4M7JL 4HPYL 2DLEA 1KB5B 3F7YA 4JPKL 3ETBF 3FB7A 4O58H 1RUQL 4XCFH 3B43A 4I0KA 1ZWIA 2V5YA 3E2HB 5DJ8B 5DMIL 4OD3L 5D7IE 5FUCC 2X70A 4XP9L 2B0SL 3BWAA 1ONQB 1EEQA 1NCWL 4R8WH 4NQUA 4R3SB 4BSJA 4XPAL 1T4KB 2QEJA 3H0TA 4G3YH 4JG0H 5HYEA 2PUQT 1F4XL 3FQWA 5DVKA 2FR4A 4UUJB 2ZWLT 1YZZA 4A6YB 3QUXC 1CGSL 4PGJA 3CIQA 2HP4A 1X5KA 3WDJA 5C0IB 3IF1B 4KMQA 4HMEA 1HK6A 4KRPC 5LAXB 1VKXA 1JZ6A 4Z95L 5EG6C 3PWJB 4GG8B 2GSGA 1RMFH 1MH5B 4LLWB 5D93C 1G9NC 4YNYA 1BQHG 3VXSA 4Y5YB 5E8OB 3QWRD 4CL7A 3VWJB 4JO3L 1Q38A 1WCQA 2EXWC 1BD2D 5FUCE 4OZGA 3RPIB 4D9RE 4PJGB 1XCTA 3H3PH 3UTSA 5IB2B 3EFDH 3LB6D 2I9TA 2BOBB 2XICA 4HT1L 3F65A 1NBZB 4X7SL 2DQFB 2CO7B 5KN5A 4X9BA 1FJ1B 1FPTL 5F8QC 3VWKB 3WDIA 4CDHA 4Y5VC 2BDNL 2YPLE 3B9KD 2GTZB 2KKQA 4JFOB 5F7DA 4APQD 5ADPH 5CAYB 4P9HL 4JFQB 3EJJX 4NQSB 4MXQD 4JVPA 2DI9A 4K7PH 5FFLA 2OZ4H 5GHWL 3NVQA 4POZC 3Q1SL 4AEHH 4Z0BL 4M5YL 4XWGH 3TP4A 3TVMA 3QEHA 4DWHA 5C0EA 4PB0L 4W6XB 5SX4I 3DUUB 1OT1A 4QHNA 1XGRA 5K9OA 4K3HA 5GGSA 1D5IH 3IS1X 5JOEA 2XPGB 3QRFM 1BQLH 1F6AB 4ZTOL 3O2WH 4XCYA 1J9CT 1FNFA 1QKZL 2AABH 1H0DB 3P11H 4M62L 2WP3O 4PJHA 2R0KL 4YAQB 3WIIL 1AKJA 3MLXH 5JW3L 3L6FB 1FC1A 2W59A 4I3RH 3MA9H 3P4OA 2APXA 5CZKA 2J6EH 4U1NA 3ZDYF 1KG0A 2EC8A 3CMOL 5DUML 4KI5F 4HUXA 1YPZB 1AGCA 1UVQB 5I1KH 1YN6B 3RZCB 4UTBL 2P5WD 3WKNA 4P4RB 3JV5A 3GBMH 3HZYB 5FGCB 5HVFB 1DP0A 1EO8H 3W5MA 3KXFA 2Q87A 3ZKSD 2VN4A 2E3VA 2HVJB 3N85H 2VLJE 3MLSH 2VNCA 4HFUH 2GITB 5CSZA 1KN4H 1L9NA 4BFBD 4M93B 5KSBF 4RMSA 5J11B 1UM6H 1JPTL 4PR5B 3H9SE 3LD8B 5IEKA 4WI5A 4PJBE 5DRWB 3G6DH 4FQXB 2WZPD 5BVPH 2VKXA 4HIEA 3S96B 1MCOL 2QR0A 1R5VA 5MERB 3LRHA 4M3KB 1QLFB 3B9EA 4KTEH 4R97C 5DQDH 4PREB 3SGEH 3U0WH 3TM6A 4U05A 3MV8E 4YDKH 5EFIB 25C8L 3UJIL 2F5AH 1RZKH 4IIQC 5JXAL 4HC1A 3DUHA 1XR8A 4MD4B 5DT1H 3GMQB 3UMTA 3T2OA 1FE8L 4GRMA 3EYQD 1PEWA 1MF2H 1A4JA 2CUMA 2XIDA 3EDFA 3QEQE 2NNAA 5I1JH 2W60B 3DVNB 3S34L 5BRZE 5TE4H 3FQRA 2YKLH 4MX7B 3VRLE 1I1YA 1U92A 4IRZL 5JOPE 5L8KB 4AG4L 3LZFL 3TBSB 1I9IL 3VA6A 4JPIA 3UTQB 3D0VB 4FQCH 1VDGA 1FVDA 3WD5H 1KB5H 4PJEA 3TO4B 2NXZB 2E27L 4LLVB 3MOBH 4YHYC 1CR9L 3C5JA 4OZHA 4L3CA 4GSDL 2IBZY 2DJ4A 1OB1B 1B90A 1C1EH 3BZFA 3H7LA 4YDJA 3WLBA 2A6JB 1CIDA 1L7TL 2AJYL 2ZCLL 3MRNA 3VE0A 1JPST 2YC1A 1II4E 3MGOB 4W68A 2AXFB 3NTCH 5DD5L 1IGFH 3F6LA 2MCPL 4I4WA 2PETA 1AD9B 5KG9A 3QUMB 2Z31A 3F7VB 2MHAB 3CFBB 5JW5A 2F58H 1WC7B 4FXKA 1J05B 2C4FU 4YDVB 1QBML 4P2RE 1M05A 4P2OD 3VXPB 1MNUL 1OTSC 1RJYA 2XI9A 3CUPB 1MFNA 1CXHA 4QRPB 2WNGA 4NQDA 2EIEA 2P44B 4JREC 1U8OA 3STLA 2V9TA 4S2SA 4HUKB 3RWDA 4KHXH 3EO0B 3GGWB 4GMSH 1DEDA 4ZOAA 5D7IA 3CXDH 5EWIL 2BVPB 3UO1L 1ACYL 2X7LA 4QRRB 1DUYB 4Z8FL 2X9WA 4MD4A 2GFBB 5FF6A 2KZWA 4M1GL 3M1BB 3P4LA 5EU6B 1W8NA 2MPAL 1JHLL 3SE4C 3RWGB 3ULUL 1F45A 5EIVA 5ADOL 1JL8A 2FWOA 2YZ1A 3CFJB 4M4RA 5EU6A 4YZFF 3KR3L 4K07A 5BS0A 4Y16B 1I1AA 4ZXBC 5D71L 5DYOB 4UOJA 4RGMB 4YXLL 3MRHB 2DD8H 3GMLA 1K6QL 3ARTA 4K7PX 5I8KH 3LN5A 1A9BA 2OI9B 1RJLA 1KFAL 3L3HB 2A9ML 3WL9A 3D69B 3KXFB 3HS0A 3QG7H 4KRNA 4X83A 4MCZB 2R4RH 4ERSH 2WUCH 3SKMA 3MQIA 4PRPD 1URLA 3P77A 1XGPA 5E94B 5DD1H 3VGGA 3CFIC 1UKSA 1KCVH 3MLUH 4FQQA 4EVNB 3RHWF 2PW1B 3ZTJH 5KVGL 1V8HA 4XPGL 4U3XA 4EDXB 2G9HA 5BW7A 3SBWA 3S6CA 4K9EC 4M03A 2H2PD 4QXTB 2FGWH 5FECB 1RUPL 1SJHA 4PD4K 4KUCD 4O5LH 1LEKB 3ILQD 5D5ME 2DJSA 2EDHA 1ETZA 3D39E 4HIHB 4OIIH 1EHNA 1U3HC 3AU1A 4QHNB 3STBA 4NP4L 4OZFA 1MCQA 1UA6H 2Y9RT 2D0HA 4GRWF 3TVMB 4HIIA 2CDEA 1FVDB 2WWKT 4N1EA 1BVLA 3D3VA 4U1SA 3BPLC 5FO9B 43CAB 4HCRL 4Z7NF 4XNQA 2BNRB 4OCRL 2M26A 4S0TD 4K7FA 3QHZL 2AK4A 1OTSD 1RZKL 2CRIA 1RJCA 2EXYD 4Z0BH 4G9DA 2DICA 2E9JA 5GGQL 2QKIA 3N1MC 3MLZL 5T1DL 3AAZB 1QRND 5GRYA 2NZ9D 2NZIA 3IKKA 2FHBA 4XP4H 2CDGB 3O2DA 3O6MH 1IILE 1KJMA 3TWCH 2P24B 1PAMA 4BZ1H 1V7NL 4RBPK 1FZMA 4KV5E 1Z5LA 3KYMA 2R29H 1BLNB 4IBLT 2BXZA 5AZ2L 2LQRA 1AIFA 1YEJL 1AD0A 1KCVL 4GXVL 2DQHL 3PXJA 1QNZL 3F5WA 2LU3A 2MFNA 4WEMB 3RKPA 1Q0YH 3RWCA 1H3UA 2W0FA 4ZFZB 3DI3B 4LHJB 5L2KD 1FNEA 5I1GL 5K59E 2YXMA 4ELMF 4I77L 2HKFH 3MR9A 2DLFL 3KJ6H 2NXYD 1ZANL 3K4AA 4URTB 1RIUL 4A6YA 3V6OE 3C87A 3V8CA 3T1FB 3ILPA 2KZ1B 1AGCB 2X4PA 2H26B 3HE6B 1A22B 4U1NB 4DAGL 3TFKC 4HKBA 4U0RC 4BA8A 4WFGE 4WGWB 3LQZA 4FNLL 4M1CC 1BD2E 5DHVB 1MJ7L 2HFGL 3B2UD 2XQBH 1GC1C 3FB7B 2R2BA 5JXEA 1K2DB 5GSRA 2R9HD 1J10A 2GJ6E 1M7IA 1OGAD 5E2UH 1KT2A 4X6BA 4ZUVA 3UTSE 5EO0A 2M2DA 4OV5A 3UJJL 2D2OA 3MGTB 4G5ZL 3JV6B 5FKAA 3T8XA 2CIIA 3D5OF 5E8DL 3GUTA 3MV8B 3LKPA 3EO1B 4YR6B 4JE4B 2W9DH 2AEWA 4E42B 4Q9QH 4HIJA 2CUIA 3I3DA 4PJ9B 4AT6A 5C8JB 3ZHLA 3ESVF 1KIQB 4X6DE 2BSTB 2XKSA 4WWKD 1B6UA 5I19H 1VENA 2PYFB 4FQLL 3CSGA 2EYRB 2ZUXA 5HPMB 1FFOA 2D03L 1CU4H 3I75B 4NZUL 4PRNA 4UIMA 1HH6A 3JXAA 3OKDB 5I1IH 1TJIH 2O93L 5ICYB 3R06A 2XQYK 3ZTNH 1KTDA 1WWWX 5DUPH 5DC0A 4MLIA 5EU7C 2ICCA 2IFGA 3C5ZC 4JY5H 4KKLC 3BDBA 3E3QC 1Z3GH 2NQCA 5GSVA 4G8GD 4ZUWA 2JELH 2NZ9C 3DVIA 3N1PC 4NKIL 5KSUB 2A9NL 5C6TH 2HN7B 1NCCH 4DAGH 5B3JF 2BSED 1IVLA 5IVZA 5C2BH 1Q94A 3SDXA 5IHLB 5DK0B 4ZO9A 5E1AB 4OSUH 2DLFH 4LLMB 1A1MA 4U1MB 3UJTH 4CGTA 4ZODA 4R8WL 3L3KB 1CQKA 1G6RB 4UAOC 2B0SH 4MNHB 5IWLA 3HMXA 3SGEI 2GCYB 3O9WA 3RA7L 3FQXA 2X09A 3HC0B 3FQWB 4C55A 1BZQK 1A3RL 3WSQL 1D7FA 1G1YA 1J18A 4JPKH 4ONOA 2F54E 5FM5O 2DIBA 3IU3B 1S3KL 1D6VH 3I75A 5FA3A 5E5MA 5TQ0H 1ZT7B 4WDIB 1U8IB 3WIHL 2EE3A 4OFIA 2A74A 4OCMC 5BVPL 4I5BB 4ZNEA 4GBXB 2IAMB 3DVGB 2VLRB 1AFVL 1JHTA 3FTGB 4GBXD 4NNYA 2HJFB 3D0LA 3KNBA 1MFBL 4XVSL 1CT8B 3BKMH 3MV8A 1WWBX 2VDLL 1NQBA 4HS6B 3ZDXE 1BVZA 4L3ED 2IQ9H 3DNKA 4HBCH 3WE6A 1NAMA 3UTZA 3V7AG 1FG9C 1I9RL 4E41B 2BCKB 4LFHD 3H9HA 5CD5C 1H5BA 4P4KC 3OPZH 5FHBL 1ZHKB 2P5EB 1NFKA 5IF0B 3O3EA 1NANH 5DR5H 3IDXH 2QSCH 4NOBA 5D6CB 2OX5A 1SQ2N 1I3VA 4RCAA 4NKOA 2IG2H 2FZ3A 1QNZH 1OHQA 3MRDB 1BJ1H 3G04A 5KANI 1NC4D 3RZWA 4H26B 3NFSL 4NZUH 3WHE1 3QNXA 1EFXA 3TLRA 1QSZA 1NFDA 5E8PB 5DO2D 4NJAH 4O02H 3IU4H 1LE5A 2W0KA 1OAKL 3VMOA 1I7ZB 1A3QA 5HHMD 2VXSL 1RZJC 1I9EA 1GGUA 1WGOA 3TPUA 5C0CA 5FV1L 2ITDA 5ISZA 1HHHB 4PUBL 5D1XB 1MFBH 3LEXA 4Z7UA 4Z77A 4YPGA 3T77B 1QSFA 2C4XA 5KVDH 3IKCB 3GSOB 1N5AA 1UXSA 4P2RA 4OLYH 3RZCC 1G9MH 1TZHA 1T5XB 2UY7A 1H3VA 5D2NC 2JLLA 2CLZA 1B2WL 1CN4A 5TQ0L 1WT5A 5CZXD 3C60C 2XTJC 2EE9A 5ANMB 3EYFA 4J3XA 3MYZA 3LB6C 3RWFA 5ESQA 3THMH 3OTTA 5T1LD 5EU4A 4UI2A 2UUDK 3WS3B 2D9CA 2AW2A 4F8QA 3HAEB 3DECA 5TDOB 3NIGE 3MJ9L 1XR9A 3VXRD 4QXGL 4PV9B 3MRIA 1CDGA 1X7QB 1IKNC 3LS4L 4LVHB 5BJTA 3VXQB 2GUOB 1ERNA 2OLDA 2YOCA 3GSUB 1NMCB 1F3JB 3OR7B 1J8HD 3SDAC 4NSKB 5D7JC 5GRWA 2CGRL 1QFOA 4F7MB 2AKRB 2VB5A 1MUJB 3SE8L 4Y4KB 4JFDB 1MCWM 4EIZC 3F62A 4OLUL 2E6QA 5C09D 5SWZB 1BVKB 2X4NB 4W4NA 2H3NB 5HVHB 3ZSTA 4NFDA 3V0VA 5AAMA 2ZPKH 4YHOH 1AJ7H 4KTEL 4PRPE 1HQRA 5I15L 3QO1B 3SDDB 1G9ML 2E9WA 1Q0XL 2OTUB 3FT4A 4CN4A 1H15B 3BEWA 4N0RA 3FQNA 3ZDXF 3IDUA 4Z7VF 3E0GA 3U4BH 1U8PA 3SGDH 3GMRA 1IGJB 3KPRD 1IC1A 5I76A 2NY3C 4S1SH 1IC4H 4XHJD 1IGIH 4JFYB 3TH3T 1PVHA 3WYRA 2WBJB 5DJ6A 4GSDH 2QSQA 3WN5A 1XH3A 1G7QB 3QEQD 4R90L 4AL8H 3UJJH 3TBTA 5BRZD 4ZFOA 3NFSH 5ESAB 2G60H 3A0OA 2QHRH 4OFPA 4ZS6C 1KYOK 2P8PA 3EW3B 3JWDC 2GK0B 4ODXA 3RL2A 1EDQA 1EVUA 2GYSA 3CU7A 5E00B 5E6ID 2ZUYA 3G5XB 4DVRL 4JN1L 3KLAB 3QWRA 5DUBA 3MBXH 3BYYA 5J7CC 3U7YL 1JK8B 1ZHLA 3QQ4B 2AK4E 1KLGA 3N1FC 5IBTL 4JFED 1OM3L 4YXHL 2B2XH 3DX6B 5DQ9A 4C56A 2AJSL 3CK0H 1EO7A 3D3VD 3IDJB 1AH1A 4WU5A 4LCCA 2OTWA 3X12A 1F42A 5B4MC 4BFIA 4YDKL 1KIRA 4HXAH 3KGRA 3IAPA 4GUPB 1CDJA 1BEYL 1U8OB 2EDBA 2DQUH 4KZDL 3VFOA 3AB0C 5K9KA 5IP4A 5E4EC 1U8PB 3HI5H 2A9NH 4G6AD 3UX9B 2X9XA 4CVZB 4Y19A 3RX5A 2NTSP 5FCUH 3GSRB 4GG6B 4HWZB 4HAGA 4IDJH 3MLSL 4ZFFB 4ZUUA 3BD3A 4LBEB 4WI4A 1U8QB 1EUTA 3MRGB 1ZHLB 3LN9A 1JRHL 2P8MB 4JQVA 1YPZE 3KR3H 1UM5H 2KDGA 2VQUA 3Q5OA 4YBQC 2Q76A 4JKWA 1CFNA 1WZLA 4RGNE 4UILL 3BZFB 3WUZA 4WW2F 4PGEB 4HWNA 5DZLA 3WKML 4F7CB 5FO8A 3ARED 1B4JL 3C5JB 2AXJA 4DFIA 1PY9A 4PY7B 1QACA 5B38B 5J57B 4XNXH 5HPOA 5A2LH 4OCWH 4WV1A 4Y8AA 4Y16D 2DQDH 3RDTD 1VACA 5HGHB 1BX2B 4XMPL 1A21A 3PGDB 1YNTB 5B8CC 1QHOA 2AGJH 3HFMH 4HFWB 5L7XL 1OVZA 1A1NB 3MCG1 5E8NA 3SDCB 2YWZA 1PQZB 5HI3D 4FQHB 12E8H 4FTVA 5L88H 4C58B 1CD8A 2NY3D 4M8QA 5FIEA 1ZT4A 1H15A 1CD1B 3CX5K 3KYNB 4KXZH 1WIUA 3REVB 1HQRB 3RIAF 4H5SA 2HT4C 2HTKD 1NCWH 3INUL 3L5WB 4Y5XA 3V0VB 2K7PA 1ND0B 3QJFB 4RMRA 4JAMA 3V6FB 4Y2DD 1NCBL 4JVWA 1FZOA 3ZE2E 4J3OC 4GRWH 1OPGH 3U6RA 4DZ8A 4Z7UF 4GKSA 4NIKB 3NTCL 5KS9E 3BFOA 5CKAA 4NQTA 2E7HA 3Q3GB 4XPGH 2VDOH 2ZCKL 4JHAH 2WMPA 3MRQA 2J6EL 3PP3K 4FFYH 1QSFD 4XVTH 2O26U 4HT1H 5HGDA 5HYSB 1QBLH 4CVUA 3FHQA 5F7FA 4ZUSB 4DGVH 1CGTA 4OCXL 5DJZB 2WP3T 5ISZE 3VXUA 1XMWA 1UFUA 2GUOA 4PJXF 1ZTXL 2YPVH 5DJYB 2JJUA 3C09C 4OLZH 1RUKH 4FTVE 1FDLL 3RY6A 1UGNA 3A67H 2EZ0D 4HD9A 2X41A 1UM4H 4HKJB 3DGCR 5CEYA 1JF5A 3L3JB 4PRIB 4HUXB 1C12B 4TPRH 2YRPA 3MACH 1T7ZA 2PR4H 4PP2A 3QO0B 5J6HB 1BFTA 2A6DA 4JRWA 1L6XA 1MCEA 1I4FA 3VFPB 3G6JF 4X4XA 5IVOA 1KCKA 3UJIH 3PP4H 2BDNH 2ATPB 2A0LD 3EJZC 1X9QA 2DQJL 3VH8A 1NAMB 4HK0A 2N7BA 3W9EA 2R2EB 1KIPA 4W4OA 3UO1H 2CXKA 2CIKA 2YWYA 1UCTA 1JHKH 2LVEA 3FRUB 3FFCE 3ULSA 1B88A 2FX9L 2VDNH 1MLBB 1CG9A 1RULL 3QIUB 2X4QA 4IOFD 4FXGB 5IMLA 4RGMC 3RX8A 5KSVB 5HVHC 3GBML 1FJ1A 4UU9A 4L8DB 4IDLA 1HWGB 3TZVB 1ZGLM 3T0XA 3A6CH 4U1JA 1BBJB 2F53E 1BJ8A 3G6DL 4PJBB 3TJHD 4YXKL 1ORSB 5I1CH 2R1XA 4J3VA 1JF1A 3S3JA 3PWNB 2Z92A 2ITCA 2VLKE 1FNHA 2AV7B 1Q9KB 2DJUA 1ZAGA 2EDEA 4LKXB 1KB9J 1CD0A 1NGYA 4XP1H 4Z6AT 4X0KB 5F88B 2D4DA 4L29A 1KLUA 3RDTB 5IB3A 5KTEH 1HHGA 5C2UB 5E6ZA 3FN9A 4HGKC 5H94B 5KSAA 1OGAE 2F9BT 1U8NA 3SKNA 5EU7E 4CUCA 4KRPB 5J9PB 1LK2A 1ZT7A 4GRWE 4WDIA 4YGAB 5BVJA 4G43B 2Y7QA 3DBXB 5J4MA 2RCSH 3WO4B 1NH6A 4I3RL 3HC3H 5ID1B 5ID1A 3O41B 3VGFA 1MCRA 3OKEB 5J11C 4F9PA 3BZ4B 4M6ML 3IAQA 2QQQA 3PXHA 3V79C 1B9ZA 2VLMD 4FHBD 4GFTB 2VYRE 2R4SL 3U48A 1MWAA 4I0PD 4ZPVB 1HNGA 4ODVH 1MCOH 2VAAA 1GGYA 4WRLA 4U1MA 4HSQA 4U7MA 2Y4SA 2A0LC 3G9VA 4PG9A 1T20B 2R2EA 2XNAA 5FOBB 3SY0A 3TA3C 3K74B 1F58H 1FFNB 2AJUL 5ICZA 5ECJE 1QFUH 4QY8B 2A9MH 3S5LA 3QNYA 3HRZB 3MV9A 1MLCB 5MENB 5T3XD 1FNSL 2Q3ZA 3AMLA 1RMFL 5KJRH 3M07A 3IETB 4G6FD 1HOCB 3FAWA 1EEUA 3U79A 2ZG3A 1C7SA 3MCKA 4YHNA 4JPVL 1ORQB 3H7BA 1HDMA 1BBJA 1TCRB 3QNZB 4M8VA 1AXSA 3CNKA 3HCVA 5MEPB 4WY7L 2VDML 4ZTPH 5C7XH 4LSUL 5I71B 3EFDL 3UC0H 1YUHA 2P7TB 1LE9B 1IQDB 2XV6B 3VI4F 5IGXH 1LNUA 1FLRL 2HRLA 3H9SD 4Q0XH 5IK3B 3UZEA 5LCVL 4HUUA 4QGYA 4B0MM 2YK1H 3ALXA 3QIUA 3GSNA 5HGBB 3ZT7A 1EHXA 3CXHJ 4Y2DA 3EOBA 5AWNH 2AP2A 3CVIH 5FCSH 3GKWH 4OTXL 1B0GA 4TPRL 4XWGL 5TJWK 5E56A 5J56B 3P4NA 5IQ7L 1X5IA 5HBBA 1JGUL 1HSBB 4JAMB 4I9WE 3CX5J 3O3DA 2R2BB 4MCYB 3OZ9L 1MRFL 1I4FB 5E2TL 1O7SA 5F9OL 4H0IA 2MCPH 4PJBF 2CLRB 5HXMA 1TNMA 4PJXA 1SMOA 1OGAA 2R39A 1OARH 4M43L 2L7JA 2JB6B 4LHUA 1NJ9B 1S8DA 5C0AB 3G5YB 4F2MB 1W72L 4MAUL 1A7PH 5AG9A 4FFYL 3MV01 3L3GA 2BRRH 3T1FA 3RWJB 3Q6GH 2DDQL 1BOGA 1BHGA 1U93B 2ZCHL 3VFSA 1OAYH 1IAIM 1X5ZA 4KJWC 1I7TB 2UYLB 3RVXC 1FO0B 4ZUSA 5BZWA 1FNAA 3K2UH 3D3VE 4RQQB 1DBBH 1AXIB 3PL6B 1G0XA 3GSNH 1OP3K 5F3BA 4ISVB 1MQKL 3EHBC 1S9XB 3HE7C 4X8JA 4NZTL 4CBPA 1RZIA 4AH2B 1U8KB 4RWHA 1FYTB 4DZ8B 5C9JB 1AIFB 5D72L 1S7RB 4C56D 2PCPA 2IALA 3IFPA 1XIWA 3C8KB 1FE8H 3W39A 4FMKA 1QG3A 4Z5RA 1HH9A 2W9LA 3L5WA 3X3FL 2V5MA 2XXCB 1FNGB 3IDMA 4QLRA 2PXYC 2YPLB 1S7WB 3ZYOA 3SN6N 4OCRH 3BP4A 5CEXA 3T0EA 4XPAH 2B2XL 2HG5A 3IT8D 4FFWC 5CGYD 4H1LH 2ZNXA 4NO3B 3BJLA 1AGEB 4KH2A 1EGJH 3PGDA 2AK4B 4O58L 5JQHC 3W2DL 2X4SB 4Y1AE 3SDCA 1BX2A 3QUML 4H8WL 3DHJA 1JRHH 1K4CA 3HNTH 5GS1A 1U3YA 3NFPB 3QXVA 4XRCA 1LILA 1G1CA 4DK3A 1MHHB 3DX9A 3L3OA 5J1SC 1P9MA 3MRCB 4V1DE 3DRTB 2ZCHH 3VFNB 4U1LA 4L8CB 5EPMA 4LPTA 3ZE2F 1XIWC 3BMWA 1SEQH 2JCCE 3RWHB 4LPXA 4LAQH 1ZOXA 3LRSB 4IMKA 2HJKB 2CDFA 4GQ9L 5FF6B 2VLLB 3QDMB 4HDIA 4WUUD 5L0QB 4GXUN 5D9SA 2R2HA 3S9DB 2FX8H 5DHXB 1KNOA 1PSKH 5CMAA 5K9JH 1MVFA 1P4IH 2FYYA 4N0YL 2UZYB 2WBJA 4L3EA 3ZYIA 4WFFD 3RIFK 4RGNC 4Y88A 1IM3B 3CXHK 4ZFFA 4HHAA 5F7EL 4OQTA 1NBYA 4IRJD 2HT3C 1INEL 2IMMA 4XPFL 3VFOB 2BSRB 2P8LA 4UBDC 4K94C 3S88H 2J8UF 1NDGB 3MREB 3VXPA 2Z4QA 5JW4Q 5C0JA 5KS9A 3ES6A 2EIBA 1YEKH 2VABA 5EOTB 1CICC 3OMZA 3HPLA 3LKOA 5HVGB 2OJZH 4X6DA 4TUKH 1QSFE 3WFCH 2DBLH 4KJWD 2MPAH 1AQDB 5KANG 5E8EB 3U9UB 3CPLA 4MGXA 4F57H 4ODWB 3D9AL 4JKMA 3IDJA 4YLQT 1U8LB 2FHCA 5C0ND 4Z7QE 4NUGH 3WHXB 2YPKB 4WW2B 2DYPD 1K4DB 4YHLH 3MFFA 5E9DB 3IVKA 1BWMA 4I3GA 2EDFA 3ARUA 1G7LB 3GK8H 3WO3B 4ZPTB 2O5ZH 3BIBX 3KPPB 2P8PB 3H8NA 2GFBA 5JTWA 2WUBL 1PX4A 2CK0H 1F4HA 5C0BD 1U3HA 5FYJE 3TH2T 1IRAY 3D25B 1MCBA 4MQXC 3OG6B 5GS1B 2IANE 1K4CB 5H2BB 3MLYL 3TYFB 3QIBA 4NQEE 2CLVB 1CDYA 5CP7A 3GI8L 2BY1A 1JGUH 4LFHG 1VFMA 4I1NB 4MJID 1JPFA 1M7XA 2FNBA 3BGFC 1HEZB 3H9YA 2V2WB 1NC4A 3GKWL 4OTXH 2JJTC 1BPVA 1BEYH 1T89A 3KWWA 4BKLA 3I50L 5LXGL 1AE6H 3SDAA 1CL7I 1ITCA 3E8UH 1SM3L 4FNLH 4Z5RB 5HHOB 4JCMA 1DN0A 4DOHE 1A2YB 3VGEA 4PJ5D 3QPXH 4WHTB 4XNYH 5C0CD 2VWEC 3CSYB 4K8RC 4OUUA 5IGXL 4HLZH 4JO4H 2WIMA 3KYAA 4R7NB 4FQXA 4ZMAT 5LBSH 2YC1B 1GGCL 4OLWL 4I2XB 2PNDA 3PJSA 3ECBB 4LSUH 1WZ1H 3CFKA 4FZ8L 4J3UA 1NAKL 4CADA 1N7MH 4JFDA 2W0PA 1H8NA 1FO0H 4OKDA 1LO0H 2AXGB 5EUOB 3W11C 3V0WL 5JORA 3P9MB 1I7TA 3DWTA 1WEJH 4U4BA 1VSCA 2OR9H 3QEUA 4ZD3L 3PG2A 5I74B 4IRJC 5I1DB 3OZ9H 4KY1H 3QFDB 4KDTA 5TDOA 5I1CL 2P5ED 3PABA 4JB9L 3G5YA 5DQDL 2OQJA 3BPNB 5B38G 4M7LH 4I0PC 2YRLA 4F2MA 4TOYL 1NBVH 4ODBD 3L95B 1WUNT 2NY2D 4P2RB 4YHOL 4OM0L 3NIDF 5GGSB 4BQBA 4ENED 7CGTA 1CL7L 3MO1A 4X9HA 1B0GB 1G7HB 3S8WA 5HI4D 3W82A 3WHE0 3FT3A 2DS4A 2EXWD 5HGBA 5CJQL 3HLAB 3QDGE 4NZRH 2RCSL 1FFPA 1WEJL 4MSWB 2P42B 2DRUA 1UACL 3I9GH 4XNZB 2CKBA 1TJHH 4OCSH 4OGAD 3EBAA 3K2UL 4FZ8H 4PRIE 1MFCH 3G04B 2K3TA 2OR7A 1DN2A 3UZQA 3DO7A 3H7BB 1OAXH 3QNZA 1C08B 1RUAL 4JN2A 1PDKA 3E6FA 3VD3A 5GGUB 3P9LB 5KVFL 4WTXA 2ZOKB 4OZGE 3PWUB 5IVXF 1RD6A 2FBOJ 1N2RB 4POZD 3MACL 1QLRB 4XVJH 5FGBA 3UTZB 2W65B 3HRZA 1GZPA 3MV9B 1NGPH 2VXQL 3WUWB 4QY8A 5IWLC 1IE5A 3X11B 3S3PA 2BVYA 2NY0D 4KTYA 1WCBB 4XMKL 5C0IA 3B6SB 1F8TL 2Q7YA 3I3BA 2GAZA 1IC4L 5JXEC 4I5BA 3C8HA 4JJHA 1H9VA 5ACZB 4YEFA 1MFAH 1U6AL 3TO4C 3W11D 3DYPA 2NX5D 2VDNL 4NJAL 1YDPB 1WFNA 3FMGL 1UZ8B 2XA8L 4C4KO 5C9KA 3PDDA 2R23B 4JO1H 1AI1H 3QI9A 4G42A 3N06B 4HBQA