5DJTA

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
b'SLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djtA00
4I3AA 3MQQA 2W0NA 2L0WA 2QKPA 5AVFA 4EXOA 1F9IA 4M4XA 4R38A 4PKYG 1XJ4A 3LUQA 2PDRA 5AVEA 1G28A 3IBRA 1S4RA 1DP9A 2VEAA 3BY8A 2BASA 2KDKA 2INWA 3LIEA 4L9EA 4GS9B 4HJ3A 3SW1A 2V0UA 3K3DA 2QWSA 4KQDA 1JNUA 3UB6A 5J7EA 3LIFA 3H9WA 1GSVA 4LRXC 2Z6CA 4EEPA 4NXFA 4JGPA 1XJ2A 3NOUC 1WA9A 4JGOA 3PYPA 5IS1A 1S67L 5G4ZA 4R6LA 3FC7A 1T1AA 5IU1A 2PD7A 3E4PA 3NHQA 3UMEA 3LIDA 3NJAA 4JGQA 2V0WA 2PYPA 2L4RA 2QJ7A 1OTEA 4EERA 3FG8A 1OJ5A 4HNBA 4GHIB 3MFXA 1N9LA 2VLGA 4MN5A 3P7NA 3UE6A 3T50A 1T1BA 4GHIA 2OWJA 4I39A 2VV7A 4EEUA 3E4QA 2PR5A 3UB9A 2VV8A 3K3CA 1BYWA 2YKHA 1OTAA 3CWFA 3LI8A 2H28A 1S1ZA 1V9ZA 3F1PB 2A24B 1D06A 1S1YA 5DKKA 1KOUA 1TS0A 1UWNX 4MN6A 2OWHA 4HHDA 3F1PA 3ICYA 2Z6DA 3UMDA 3MQOA 2A24A 5HD5A 5DJTA 1LL8A 3UB8A 3IS2B 2I9VA 2CMNA 5F6AA 3GECA 1TS8A 2B02A 4GS9A 1EW0A 4L9GA 3RH8B 2WKRA 3IS2A 2PD8A 5HD3A 3PHYA 4I38A 5A8BA 3LIBA 3E4OA 3LYXA 3BY9A 2WKPA 4I5SA 4JGRA 2D02A 2W27A 2J80A 2PHYA 5DJUA 3VE4A 4RQ9A 1N9OA 4HY8A 4HP4A 1TS7A 1XFNA 4L9FA 1X0OA 3CAXA 1OTBA 1LSWA 3F1NB 3GDIA 4NXGA 2QHKA 2KX6A 2V9AA 4NXEA 1VB6A 5HWWA 5HWTA 2V1BA 4HP9A 4I3IA 3F1NA 4HH3A 1TS6A 1LSVA 1OT6A 4WF0A 2D01A 2YKFA 3RTYA 2GJ3A 3EEHA 4EW7A 5J3WA 4EETB 4BBTA 3UB7A 3A0RA 1MZUA 5I5LA 1LSXA 3G6OA 4BBUA 1XJ3A 1T18A 1F98A 4EQ1A 5F5YA 4XT2B 2PR6A 5KIZA 2HV1A 4GCZA 5HDSA 4LLOB 4HQAA 4LRZE 1D7EA 5HSQA 1S4SA 4WLAA 2JHEA 5HWVA 4E04A 4WUJA 5TBMB 3A0SA 2EA9A 1P97A 3ZQ5A 2ZOHA 2K7SA 3C8CA 4HJ6A 4F3LB 1N9NA 3B33A 3NOTC 5TBMA 1V9YA 1DP8A 3VOLA 3LICA 5G4YA 4NXBA 4EESA 2ZBBA 3LIAA 3MJQA 1DRMA 5EFWA 2OOLA 1GSXA 1DP6A 1OT9A 4F3LA 4PKYA 3OLOA 1LT0A 1OTIA 3C2WA 4WN5A 3D72A 4KUOA 5F69A 3ULFA 3H82B 1ODVA 3LI9A 4YWZA 1UGUA 4R70A 2L1MA 3NOPC 3VE3A 4LPZA 2QJ5A 4H6JB 4WL9A 2R78A 1GSWA 3H82A 3CLOA 3MR0A 1P0ZA 4HH2A 5HDCA 1OTDA 3KX0X 4BBVA 4H6JA 1NWZA 2JN7A 2PYRA 5HDDA 3H7WB 4R3AA 5F68A 4B9OA 4DJ2A 5J4EA 1OJGA 5DKLA 3H7WA 4GW9A 3MXQA 3F1OB 4DJ3A 3HJKA 1UWPX 1XFQA 3BWLA 4LRYC 4K08A 1XJ6A 2M1CA 4HI4A 4HJ4A 1T19A 3EWKA 4HIAA 4HOIA 2VV6A 3A0VA 2ZOIA 1T1CA 2V1AA 3F1OA 5HZHA 4KUKA 2WKQA 2P7JA 4I3JA 1Y28A 1S66L 3HJIA 4XT2A
chains in the Genus database with same CATH superfamily
2L0WA 3NIAA 4JF6A 3QHYA 1IEMA 2ZM2A 4OP8A 4LFUA 3N8LA 1G28A 4E6XA 3VOYA 4E3OA 1E25A 4Q0HA 5U47A 2EFUA 3HUMA 3K3DA 1XGIA 3T1RA 5F82A 3NDEA 3GTCA 3A3JA 4G3KA 4HBTA 4GDNA 3MBZA 4RYEA 1YKDA 3NOUC 3W4PA 5FAQA 4JGOA 3FKVA 5L8MA 2VGKA 4Z9QA 5IS1A 1S67L 3V39A 1KE4A 2W1TB 3CUEA 3DTIA 5DF8A 1KDWA 1T1AA 3R4KA 3LY3A 3NHQA 3UMEA 1LL5A 1C3BA 3LIDA 4U0TA 4UA7A 2PYPA 4MCWA 1K6RA 5AJGA 1OJ5A 2HZ5A 1OMEA 2XA7M 4MN7A 3G32A 3WS0A 3QNBA 3ZHHA 3UDFA 1N9LA 3PAGA 1WYBA 5M18A 3W4OA 4P6ZS 3ZG0A 3LY4A 2R9XA 1MWUA 4FH4A 3LGOA 1RP5A 3MZEA 3W8KA 2P08A 3CJMA 3PAEA 3K3CA 4UQIS 1BYWA 1TDLA 4YNRA 4X55A 1KGGA 4OQIA 2H28A 3ZVWA 2EFXA 4EUZA 4P85A 3F1PB 2J3WA 3QP1A 3GQZA 5CGSA 4WZ5A 3KSGA 1KOUA 5HL6A 1UWNX 2GZAA 3UY6A 4FSFA 3IT9A 3LEQA 5L09A 3ICYA 2Z6DA 3UMDA 3MQOA 4DMZA 1ESUA 4EBPA 4FTXA 5EUAA 5GHYA 3IS2B 4KZ3A 2CMNA 3DWKA 3KYQA 3UE0A 4OVDA 3M2JA 5HAQA 1EW0A 3O88A 4Y15A 4PM5A 4LV0A 1IOUA 4I38A 4M3KA 4GNUA 2WZXA 5A8BA 4K0XA 3G35A 4GDBA 3BY9A 1KGEA 4KENB 4S2NC 2WKPA 5FDHA 1K54A 4I5SA 2XH9A 2W27A 1K6SA 4LCLA 3BFFA 5CXWA 3B47A 1VETA 3VE4A 2EXAA 4RQ9A 2XD5A 2PRFA 2K2NA 1QMEA 1W8QA 3BFCA 4E3IA 2W1TA 3UO9A 4EBLA 1X0OA 5IT5A 3F1NB 2H5SA 3C7VA 4YOFA 5CEDA 4R1GA 3B42A 4NXEA 1MY8A 4Y5FA 1H8MA 2V1BA 2PT7A 2DNSA 3Q7VB 4WMCA 4X53A 1XPBA 4KZ7A 1OT6A 5KSHA 3RTYA 4EUVA 4QWOA 2GJ3A 2JKTI 2OLUA 5J3WA 3VP0A 4RX2A 1NYYA 4WELA 3MKFA 4ZAMA 5JYOA 2EX8A 3HUOA 2IWCA 4BLMA 4ZTKA 2JBFA 4NKPA 5FI7A 3IXHA 4XT2B 4II7A 5C5KA 4GCZA 2PBYA 1YLTA 4HQAA 2EX6A 1D7EA 2DMWA 5HSQA 2V20A 3OPHA 1MC0A 4WLAA 2WGIA 5FAPA 4DDYA 5HWVA 3BLSA 3O5YA 1MPLA 3VMAA 3C38A 3LCEA 3CITA 4E3KA 1LHYA 5FL3A 1P97A 4HBUA 1KVMA 1STZA 1YT4A 2LB9A 4HJ6A 1KE3A 2OLVA 5TBMA 3VP1A 1VHMA 3VOLA 5G4YA 4N9LA 4NXBA 2I72A 5FA7A 2ZBBA 3LIAA 2OOLA 1GSXA 1DP6A 3WS5A 3WRTA 1OT9A 2FFYA 3OLOA 4OOYA 1OTIA 2XSSA 3C2WA 3Q81A 5TR7A 1L3LA 2JKFA 1GHPA 5FAOA 4WMCD 1DJCA 4ARZB 3ULFA 2WGWB 3JYIA 1F5MA 2FH5A 4R70A 3BRMA 4QY6A 2R9WA 2H0YA 4E3JA 3D3OA 3ZVTA 3E2LA 3JPUA 5HDCA 2EX2A 5EM0A 4S2IA 4H6JA 2JN7A 2XF3A 2PYRA 4MDZA 4S2KA 5F68A 3TSGA 1Q2PA 2ZQ9A 2VJWA 4IBRA 4EBNA 2K31A 4IUHA 3FKWA 3S7PA 1E3UA 3Q7VA 3KSHA 4KQRA 5KZHA 5HFOA 3BEBA 3GMWA 3ZNYA 4GW9A 3PXPA 5FEFA 5FI6A 3F1OB 4ZRRA 2CC1A 4DJ3A 3BWLA 1NRJA 1GA9A 1YPRA 3OC2A 4HIAA 1T19A 2VV6A 4JXWA 1NYMA 2ZOIA 2QPNA 1MWRA 4KQQA 3IHBA 3IWQA 1I2SA 1FOFA 1ONGA 5CEBA 2ZD8A 4LV2A 2Y2NA 1PNEA 1Y28A 4XT2A 3IF6C 4P6ZM 4OONA 3NDGA 5DF9A 5DFXA 3BYDA 3AGEA 1PWCA 3KYZA 4PKYG 1XJ4A 3LUQA 3PBQA 2ZJ9A 3HVFA 3IBRA 4CLCA 2W1RA 2VEAA 3VP2A 3BY8A 2Z2LB 4PM7A 2BASA 4UQIM 4L9EA 4GS9B 1IFQA 4GD6A 4HJ3A 5FQIA 2Q9MA 1YM1A 3Q82A 1JNUA 3IXGA 2LB5A 3V3RA 2ZMFA 2HPBA 5GHZA 5DVAA 2O0YA 3RXWA 1EI5A 1OPXA 5E2HA 3SS4A 4LRXC 2KOIA 1FCNA 2Z6CA 1FSWA 2Y2MA 4DF6A 2A3UA 4JGPA 1XJ2A 2JKRM 4R4RA 1E3UD 4C3QA 4E6WA 4Q0JA 1WA9A 3U2AA 2WGWA 3WS2A 2G7UA 4DRTA 4BMWA 3FC7A 4D60A 3OPRA 2PD7A 1IYPA 4MNRA 3E4PA 1CK3A 4OQ0A 3NJAA 3N7WA 1N4OA 3C30A 3GR2A 2V0WA 4S2JA 2Y2KA 3G2YA 4OP5A 5E2EA 1OTEA 3FG8A 3FV7A 4CLCE 3SZTA 3E0YA 2Q0OA 4LGWA 3UE6A 5FEGA 1F2KA 3P98A 4X56A 4BD1A 2Y2GA 2P04A 4I39A 5DF7A 2XLNA 4EEUA 3UB9A 1HD8A 4DE3A 3T12B 4LCMA 4CLCD 2Y4AA 3P01A 3VP3A 1PFLA 4ESPA 4B4XA 2A49A 1TEMA 4NETA 1OTAA 1I2WA 1YLYA 4KZ9A 1ONHA 1KDSA 4R3JA 3FPWA 1V9ZA 1SHVA 5EOOA 1L2SA 4F94A 4MBFA 1K57A 1CF0A 1S1YA 1TS0A 1ES3A 3PBSA 4LV3A 4C75A 2OWHA 4EU0A 1IKGA 2A24A 1LL8A 5HW3A 1Q2QA 4N9KA 1FIKA 1Y4OA 4OKPA 4O7DA 3N8SA 1K4FA 4GS9A 1BLSA 3NC8A 4L9GA 3RH8B 2Y8HA 5HD3A 2PAVP 1JWZA 2O9BA 4H8RA 4LV1A 5EPHA 1PRQA 2G2UA 3OBFA 5CGWA 1VETB 3E2KA 1YMXA 3ZG9B 1NLZA 5L10A 4QHCA 2H10A 4JGRA 1BSGA 2OAP1 4KZ8A 3ZYTA 4DE0A 4MBHA 1YQSA 4ETZA 5TJJA 2J80A 2PHYA 3TG9A 2A2LA 2ZQ7A 4HY8A 4HP4A 2W3FA 3KSIA 5F1GA 1NZUA 2M7UA 3IBJA 3HLCA 5CTNA 3V5MA 3SH9A 2KX6A 4CQHA 3M2KA 1VB6A 4N1XA 3ZG7B 5HWTA 3BM6A 4S2MA 4JKTA 4S2OA 2E8IA 4HH3A 1TS6A 1FR1A 1EROA 1ERQA 4WF0A 3S1YA 2D01A 2VKSA 3LR4A 4IVIA 2XR0A 4QPRA 3OPLA 3C4PA 3EEHA 1NZOA 1W79A 5AQBA 2XDMA 3VOZA 3A0RA 3PBOA 4O8GA 3PBTA 1J9MA 4PM6A 1KVLA 1CI9A 4BBUA 2IA2A 3C7UA 4DDSA 4Y0UA 4X6TA 2V1ZA 1GHIA 1RGZA 5KIZA 2J8YA 2HV1A 3UE1A 3HL9A 5DTSA 1HZOA 2HJ9C 4LRZE 4DXCA 1S4SA 3VV4A 3IF6A 4RX3A 3UPOA 3M6HA 4R3BA 5D3OA 3HLFA 5TBMB 3IX3A 4FUWA 2HP9A 2ZQCA 3A0SA 4QU3A 3CPTA 4UHUA 2ZOHA 2K7SA 1N9NA 3B33A 3NI9A 3NOTC 2ZM0A 3HLDA 5HARA 3LICA 3T4LA 4EESA 4WEJA 2PBDP 3VP4A 2VGLS 3MJQA 1DRMA 1BT5A 1H8ZA 2UWXA 3QP6A 4F3LA 4BD0A 5GLDA 4OPRA 1O07A 4C6YA 2ZQ8A 3BFEA 4R23A 4PPRA 5FI2A 5TGFA 3BQAA 1Z09A 4IVKA 4K91A 4Z1WA 3LFVA 5FSRA 3MFDA 4MLLA 3MS6A 4PM9A 4EV4A 3S4XA 3EGXC 4LPZA 1VEUB 4XUXA 4H6JB 4PHTA 3BECA 1GSWA 2JKRI 3R7WA 2FFFB 1M40A 2BLSA 4HH2A 2QZ6A 1RCJA 4R0QA 4E3MA 1OTDA 1L0FA 4WYYA 1NWZA 3KO6A 4UAAA 5HDDA 4B4ZA 1CQAA 1BULA 1VM1A 1S6RA 1NY0A 3UE3A 3HUNA 1PWDA 1OJGA 4FH2A 1ZHHB 3H7WA 3N8RA 2ZMAA 2XD1A 3MXQA 4LRYC 1UWPX 4KZ4A 4K08A 1DJBA 1WE4A 2P9VB 4HOIA 3EWKA 3A0VA 5EVIC 4PAUA 4N1HA 3N6IA 3DWZA 1K38A 4QB8A 2HGVA 1LI0A 1L0EA 5J8XA 1D1JA 1S66L 1MWTA 4Y0TA 4UEYA 3MZFA 3CI6A 4I3AA 3MQQA 4CLCB 2W0NA 2QKPA 4D2OA 5AVFA 2X01A 4EXOA 5GL9A 1F9IA 2PDRA 3IXBA 1DP9A 1EWZA 3IWOA 2OAQ1 3CHWP 2J3TC 4S2LA 3JVVA 4O01A 2KDKA 2INWA 3LIEA 2HP5A 3SW1A 2V0UA 2WKIA 3G2ZA 4EQIA 2V8FA 3HCYA 3RXXA 4KQDA 3B3XA 1BUEA 3SS3A 3CZDA 5FQJA 4CJNA 3H9WA 1XA7A 1GSVA 4JBFA 3UDIA 5CERA 4KG6A 3G34A 4EEPA 4IBXA 3HREA 3L7HA 3A3IA 2Y79A 4X68A 5FQ9A 3T4TA 5G4ZA 4R6LA 2XFTA 3IX4A 2G2WA 3CUEC 1GA0A 2ZQAA 1LL9A 2Y2PA 3T4QA 1VEUA 2JCHA 2OSUA 2Y2OA 4U0XA 2L4RA 3NBLA 2M7VA 4JLFA 1TF1A 3RJUA 4EERA 3HLEA 3O86A 3QP8A 2NUTC 2Q9NA 4HNBA 3T4SA 3MFXA 1SKOA 4EWFA 5EOEA 4FD8A 2VLGA 4MN5A 3P7NA 4DE2A 1LLBA 1DJAA 4AFIA 5HX9A 2ZQDA 1T1BA 4GHIA 1W63M 1ZTUA 4X1LA 5FQQA 2VV7A 2Y59A 2PR5A 4ZJ1A 2P9VA 3CWFA 1K4EA 4B93A 3LI8A 3O87A 1G6AA 3FWLA 1BLCA 3MXSA 1KE0A 2A24B 4Y13A 1VQQA 5CTMA 1W63Q 5DKKA 4WZ5C 3DW0A 1ES5A 5EVLA 1YLPA 4HHDA 1FCMA 3ISGA 3W2ZA 5HD5A 1MXOA 4ETXA 5EE8A 5M19A 3T1XA 4ZDXA 1YSQA 3QP5A 4KG5A 5HAIA 4Y0OA 2WUQA 3BQ8A 1MKIA 3SH7A 5F6AA 3E98A 5EECA 1HLUP 1L0DA 5KSCA 4HESA 2XQZA 2WKRA 1G68A 2J7VA 4DN0A 3FYZA 4WM9A 4S2NA 3UN7A 1RGYA 3TW8A 1K54C 3MQ0A 1AWIA 4DE1A 3TOIA 4ZJ2A 2PU4A 1IKIA 2VZWA 1H0MA 4HEFA 5DJUA 1ES2A 2HDSA 4IJGA 3MZDA 2WZZA 1TS7A 2C5WB 1XFNA 2VGLM 1BLPA 4L9FA 4U3TA 3PBNA 1SDNA 3CAXA 4Y2FA 3GDIA 4JF4A 2QHKA 1NLYA 1ZG6A 2DRWA 1BTLA 5HWWA 3MMHA 3GV9A 4HP9A 4I3IA 2ZC5B 5DTKA 4NK3A 4BJPA 1IYOA 1LSVA 1MWSA 2Y2LA 1ES4A 4BBTA 5CX7A 4XXRA 3WS1A 4X1MA 4N92A 1MZUA 1ZC2A 5I5LA 1NJ4A 4FOFA 1LSXA 2XFSA 5BOHA 3G6OA 3UPNA 4NEED 1QMFA 1XJ3A 4JXGA 5EVIA 1T18A 5FASA 1F98A 3IF6B 4GOGA 1K55C 1SDEA 4FCFA 2QYBA 1FR6A 2PR6A 3RFBA 1XP4A 4GLQA 5FQMA 4BL3A 2P74A 4LLOB 4Q0IA 2J9PA 5FQKA 3CPTB 2KLIA 4Q8IA 1NRFA 2JHEA 4E04A 4KQOA 3LR3A 1YLWA 3G4PA 2MJ6A 2XEPA 3VFHA 3IX8A 3C8CA 3EEAA 5E2GA 4F3LB 4Y3IA 5A90A 5HL1A 1V9YA 2O99A 3GRJA 1DP8A 2VK3A 4BENA 5EFWA 2WK0A 1PZPA 2JKGA 4PKYA 3S7OA 1FILA 2Y91A 5HPFA 1SCWA 5TFQA 5KMWA 4WEKA 4WBGA 3LO7A 3WWXA 4OQHA 2ZC6B 3ITAA 4KUOA 5DTTA 4IUKA 5F69A 2FZ0A 1H5XA 1HTZA 1K56A 3LI9A 3R7WB 4G3VA 4MBKA 2E8JA 3K2NA 4YWZA 4KZ5A 1UGUA 3NOPC 3VE3A 1ZKJA 2QJ5A 5M1AA 4WL9A 3NCKA 3HLBA 3ZFZA 3H82A 1AXBA 3MR0A 3DTMA 2XROA 1PZOA 5GHXA 3KX0X 4BBVA 5F1FA 2QMIA 4IEDA 5EVID 3NULA 1IYQA 3H7WB 4GN2A 4YFMA 4B9OA 4PMAA 1SKFA 4NG2A 2DCFA 3BLMA 2HJEA 3VSKA 4OOMA 1U60A 2IWDA 1KGFA 5G18A 2M1CA 4HI4A 4HJ4A 3TE8A 3IQAA 5A91A 3Q7ZA 5CRFA 2J3TD 3ZG8B 1GCEA 3DBAA 3TJZC 4KUKA 2J9OA 3T4JA 4I3JA 4OOLA 1PI4A 4KZBA 2GNXA 4IHQA 5E2FA 2UV0E 1O7EA 5HAPA 1CI8A 3CMZA 4GZBA 4M4XA 3ZCZA 4R38A 3FPVA 2ZL1A 4KZ6A 3T4KA 5AVEA 1S4RA 5EVEA 2B95A 1K56D 4CLCC 4JXVA 2H0TA 1MKMA 2XRNA 2HDQA 1N9BA 1XX2A 1XA1A 2C6WB 2WYXA 4OH0A 2QWSA 4OPQA 3EGDC 3UB6A 4ME4A 2HDRA 4GKUA 2Y2IA 1A0KA 2EWWA 5J7EA 3LIFA 2JE5A 4QJGA 3IXDA 2NUPC 4X25A 4E3NA 2B5RA 2EX9A 5JYPA 4NXFA 1CEGA 2XGNA 3AGDA 3PYPA 2VA0A 1GHMA 2WADA 4UA9A 1ERMA 1P9RA 1TDGA 5IU1A 4JPMA 1ACFA 4OPZA 1SKOB 4JGQA 3ZDJA 3A3DA 2QJ7A 3Q1FA 3DAVA 4DKIA 1K25A 4GHIB 3UB5P 4GB7A 3D4FA 4OLGA 4Y17A 1M6KA 4R4SA 3T1SA 2WAEA 2AVXA 3VSLA 5FATA 2GDNA 3T50A 1FSYA 2OWJA 3IH8A 5GLBA 1G5UA 5CHMA 2O9CA 5IHVA 2Y2HA 1P9WA 1Z6FA 2V2FF 3E4QA 4KZAA 5CHJA 2VV8A 3BFDA 3QP2A 2HDUA 3PR6A 4GJ4A 3NECA 3EOIA 3KYEA 4G3WA 2RCXA 5F83A 2YKHA 1JTDA 1BLHA 1CJFA 1MBLA 5GLCA 1S1ZA 3IH9A 3M6BA 2X02A 1K55A 2WAFA 1PW8A 2IWBA 4MEZA 3V3SA 3MXRA 1JVJA 5HPIA 4XUZA 1D06A 2HF6A 3I7JA 1K57C 3V50A 3NY4A 3SOIA 5E43A 1E4DA 4S2PA 4MN6A 3D9YA 1L0GA 2EWVA 3F1PA 3P09A 3TRCA 2ZM8A 4X69A 1W8YA 3LEZA 5DJTA 3UB8A 4E3LA 1XGJA 4YINA 1YSPA 2GX5A 2I9VA 3S22A 3GECA 1TS8A 3EQUA 3EQVA 2B02A 3ITBA 4QD4A 3IS2A 3FZCA 4BQMA 2PD8A 4JXSA 3PHYA 2WGVA 3PTEA 2XA7S 3LIBA 1FQGA 4DXBA 4QY5A 3E4OA 1DY6A 3LYXA 4UA6A 1JWVA 3ZGAB 5I94A 1IYSA 3OCLA 5GLAA 2D02A 4LENA 1ALQA 3G31A 1YMSA 4L0LA 3A3FA 3GVBA 5CGXA 3OCNA 2HP6A 4K0WA 3C4OA 3GSGA 1N9OA 4WZ4A 3Q07A 1XKZA 3MF0A 5L07A 3T4OA 4MMNA 4P87A 5AQ7A 1OTBA 1LSWA 4GD8A 4NXGA 3UPPA 2V9AA 5EV0A 1IELA 3OZHA 2VX8A 3BJNA 3IF5A 3VFFA 3IWIA 1PYYA 2JC7A 4OPYA 3SS5A 1CEFA 1I5QA 3KSFA 3F1NA 2OV5A 5CECA 4P6BA 2YKFA 1JWPA 2W3HA 4RVAA 4EW7A 4EETB 1FCOA 5EVIB 2VGJA 3UB7A 3V67A 2WKEA 1XXMA 5FDSA 5CHUA 1W7FA 1Y54A 3LR0A 4EQ1A 5F5YA 5AQAA 3CG5A 2BG1A 2W3GA 3SH8A 1LI9A 2ZC4B 5HDSA 2WKHA 2ZC3B 2ZLYA 2B18A 3DTEA 1PWGA 1PI5A 2ACGA 5EM1A 2EXBA 4P0MA 4ZJ3A 4WUJA 4OQGA 3JVUA 1J3WA 1TD5A 2EA9A 4PM8A 3S7NA 3ZQ5A 4B88A 3O3VA 3N4IA 1S0WA 1PW1A 2X71A 3WRZA 3DTKA 3OPPA 1YAXA 4CPKA 3OOVA 2RL3A 2W3DA 3QNCA 4OLDA 3ZNTA 4ID4A 1LT0A 2V8CA 4RA7A 1SZVA 1W5DA 4WN5A 3UNWA 3D72A 5A92A 1H3QA 1ESIA 3MKEA 2Y2QA 5L2FA 3H82B 1ODVA 1YLZA 3ZG5A 5A93A 2L1MA 3PBRA 4BL2A 2XK1A 5MC7A 4ARZA 2R78A 4JF5A 1TVFA 3L9KA 1G6OA 1HVBA 3CLOA 4KG2A 1NXYA 5DFYA 1P0ZA 3S7QA 2Y55A 3U4LP 1ZG4A 5LBRA 3HLWA 3BW6A 4R3AA 1BZAA 2O9AA 3HLGA 3IHAA 2JKTM 4DJ2A 1WYCA 4Y7PA 5J4EA 2BTFP 3MSHA 5AQ9A 3HBRA 4BWIA 5DKLA 3WS4A 2ZMVA 2W3EA 2PU2A 3C5AA 1K0KA 1JTGA 4A5RA 2Y2JA 3G30A 2Z2MB 3HJKA 1XFQA 1XJ6A 5K5BA 3AGFA 4O0PA 1T1CA 2V1AA 3QP4A 4ZBEA 3F1OA 5HZHA 3UDXA 3BFGA 3LR5A 2WKQA 2P7JA 1H8YA 3W4QA 3HJIA 3A3EA 2ZL1B 2ZC7A 1YLJA 3T1QB 1PIOA
chains in the Genus database with same CATH topology
3CI6A 4I3AA 3MQQA 4CLCB 5DF9A 2W0NA 2L0WA 5DFXA 2QKPA 5AVFA 4EXOA 1F9IA 4M4XA 4R38A 3FPVA 3KYZA 4PKYG 1XJ4A 3LUQA 2PDRA 3PBQA 3T4KA 5AVEA 1G28A 3IBRA 4CLCA 1S4RA 1DP9A 2W1RA 4CLCC 2OAQ1 2VEAA 3BY8A 2J3TC 2BASA 1MKMA 3JVVA 4O01A 4UQIM 2XRNA 2KDKA 2INWA 3LIEA 4L9EA 4GS9B 1IFQA 4HJ3A 3SW1A 4Q0HA 2V0UA 3K3DA 3HCYA 2QWSA 4KQDA 3EGDC 1JNUA 3UB6A 4ME4A 2LB5A 2ZMFA 2EWWA 5J7EA 3LIFA 4G3KA 2O0YA 1OPXA 3H9WA 1GSVA 2NUPC 4LRXC 2KOIA 2Z6CA 1YKDA 4EEPA 4NXFA 4JGPA 1XJ2A 2JKRM 3NOUC 4Q0JA 1WA9A 4JGOA 3U2AA 2Y79A 3PYPA 2VA0A 5L8MA 3T4TA 5IS1A 1S67L 2G7UA 5G4ZA 1P9RA 2W1TB 3CUEA 4R6LA 4BMWA 3FC7A 1T1AA 5IU1A 3CUEC 2PD7A 3R4KA 3E4PA 3NHQA 3T4QA 3UMEA 3LIDA 3NJAA 4JGQA 3C30A 2V0WA 2PYPA 2L4RA 4MCWA 2QJ7A 5AJGA 2M7VA 1OTEA 1TF1A 4EERA 3FG8A 1OJ5A 2NUTC 4GHIB 2XA7M 4HNBA 4MN7A 3T4SA 4CLCE 3MFXA 1N9LA 2VLGA 3E0YA 3P7NA 4MN5A 4P6ZS 3UE6A 4AFIA 3T50A 1T1BA 4GHIA 2OWJA 1W63M 2P04A 4I39A 2O9CA 1ZTUA 2VV7A 1P9WA 2P08A 4EEUA 3E4QA 2PR5A 3UB9A 2VV8A 3K3CA 4CLCD 3PR6A 3P01A 4GJ4A 3EOIA 4UQIS 1BYWA 4G3WA 4YNRA 2YKHA 1OTAA 3CWFA 4B93A 3LI8A 2H28A 1S1ZA 3FPWA 1V9ZA 3F1PB 2J3WA 5HPIA 2A24B 1D06A 3KSGA 2HF6A 1S1YA 1W63Q 5DKKA 1KOUA 1TS0A 5HL6A 1UWNX 3PBSA 4MN6A 2GZAA 2OWHA 2EWVA 4HHDA 3F1PA 4FSFA 3TRCA 4EU0A 3ICYA 2Z6DA 3UMDA 3MQOA 2A24A 3W2ZA 4DMZA 5HD5A 5DJTA 4ETXA 1LL8A 1YSQA 3UB8A 3IS2B 1YSPA 2GX5A 2I9VA 2CMNA 3BQ8A 5F6AA 3E98A 3KYQA 3GECA 1TS8A 3EQUA 3EQVA 2B02A 4GS9A 1EW0A 4L9GA 3RH8B 2WKRA 3IS2A 2PD8A 4DN0A 2Y8HA 5HD3A 1IOUA 3PHYA 4I38A 2O9BA 5A8BA 2XA7S 3LIBA 3OBFA 3E4OA 3LYXA 3BY9A 2WKPA 3TW8A 4I5SA 1NLZA 4JGRA 3OCLA 3MQ0A 2OAP1 2D02A 2W27A 3ZYTA 4ETZA 5TJJA 2J80A 2PHYA 4L0LA 2VZWA 3B47A 5DJUA 3VE4A 3OCNA 4RQ9A 4IJGA 2A2LA 1N9OA 4HY8A 2K2NA 4HP4A 1TS7A 1XFNA 2VGLM 2W3FA 3KSIA 3MF0A 2W1TA 3T4OA 4L9FA 1X0OA 4MMNA 5IT5A 3PBNA 3CAXA 2M7UA 3IBJA 1OTBA 1LSWA 3F1NB 4Y2FA 3GDIA 4YOFA 4NXGA 3B42A 2QHKA 1NLYA 2KX6A 2V9AA 4NXEA 4CQHA 1VB6A 4Y5FA 2VX8A 5HWWA 3BJNA 1H8MA 5HWTA 3MMHA 2V1BA 2PT7A 4HP9A 4I3IA 3KSFA 3F1NA 4HH3A 4BJPA 1TS6A 1LSVA 1OT6A 4WF0A 5KSHA 2D01A 2YKFA 2VKSA 3LR4A 3RTYA 4EUVA 2GJ3A 4QPRA 2W3HA 3EEHA 2JKTI 4EW7A 5J3WA 4EETB 4BBTA 5CX7A 3UB7A 3A0RA 3V67A 3PBOA 4O8GA 1MZUA 3PBTA 4WELA 5I5LA 4FOFA 1LSXA 3G6OA 4BBUA 4NEED 1XJ3A 2IA2A 3LR0A 1T18A 1F98A 4NKPA 4EQ1A 5F5YA 4XT2B 4II7A 2QYBA 2PR6A 3RFBA 2W3GA 5KIZA 5C5KA 2HV1A 4GLQA 4GCZA 5HDSA 4LLOB 4HQAA 4Q0IA 2B18A 2HJ9C 4LRZE 1D7EA 2DMWA 5HSQA 2KLIA 1S4SA 3VV4A 1MC0A 4WLAA 2JHEA 5HWVA 4E04A 4KQOA 3O5YA 4WUJA 3JVUA 5TBMB 3LR3A 3C38A 3CITA 5FL3A 1TD5A 2MJ6A 2EA9A 3A0SA 1P97A 3S7NA 3ZQ5A 1STZA 2ZOHA 2K7SA 2LB9A 3C8CA 3EEAA 4HJ6A 4F3LB 1N9NA 3B33A 4Y3IA 3NOTC 5TBMA 1V9YA 1VHMA 2O99A 1DP8A 3VOLA 3T4LA 3LICA 5G4YA 4NXBA 4EESA 4WEJA 2ZBBA 1YAXA 2VGLS 1DRMA 3LIAA 3MJQA 5EFWA 2OOLA 1GSXA 3OOVA 1DP6A 1OT9A 4F3LA 2W3DA 4PKYA 3OLOA 3S7OA 1LT0A 5HPFA 1OTIA 2XSSA 3C2WA 4WN5A 4WEKA 3D72A 1H3QA 3BQAA 4KUOA 4IUKA 5F69A 4ARZB 4Z1WA 2FZ0A 3LFVA 3ULFA 3H82B 1ODVA 1F5MA 2FH5A 3LI9A 3R7WB 4G3VA 4YWZA 3K2NA 1UGUA 4R70A 2L1MA 3NOPC 3PBRA 3EGXC 3VE3A 4LPZA 5MC7A 2QJ5A 4ARZA 4H6JB 4WL9A 4PHTA 2R78A 1GSWA 2JKRI 3H82A 3D3OA 1G6OA 3R7WA 3CLOA 3MR0A 2XROA 5DFYA 1P0ZA 4HH2A 3S7QA 5HDCA 1OTDA 3KX0X 4BBVA 4H6JA 1NWZA 2JN7A 3KO6A 2PYRA 4MDZA 5HDDA 5LBRA 3BW6A 3H7WB 4R3AA 5F68A 2O9AA 3UE3A 2JKTM 4B9OA 4DJ2A 2VJWA 5J4EA 2K31A 4IUHA 3S7PA 1OJGA 3KSHA 4BWIA 5DKLA 1ZHHB 3H7WA 4GW9A 2HJEA 3PXPA 2ZMVA 2W3EA 3MXQA 4OOMA 3F1OB 4ZRRA 4DJ3A 3HJKA 1UWPX 1XFQA 3BWLA 4LRYC 4K08A 1XJ6A 2M1CA 1NRJA 5K5BA 3OC2A 4HI4A 4HJ4A 1T19A 3EWKA 4HIAA 4HOIA 2VV6A 3TE8A 3A0VA 2ZOIA 4O0PA 1T1CA 4PAUA 2V1AA 3F1OA 5HZHA 2J3TD 3DBAA 3TJZC 3LR5A 2HGVA 4KUKA 2WKQA 2P7JA 3T4JA 4I3JA 4OOLA 1Y28A 1S66L 2GNXA 4UEYA 4IHQA 3HJIA 4XT2A 4P6ZM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3A A;  3MQQ A;  2W0N A;  2L0W A;  2QKP A;  5AVF A;  4EXO A;  1F9I A;  4M4X A;  4R38 A;  4PKY G;  1XJ4 A;  3LUQ A;  2PDR A;  5AVE A;  1G28 A;  3IBR A;  1S4R A;  1DP9 A;  2VEA A;  3BY8 A;  2BAS A;  2KDK A;  2INW A;  3LIE A;  4L9E A;  4GS9 B;  4HJ3 A;  3SW1 A;  2V0U A;  3K3D A;  2QWS A;  4KQD A;  1JNU A;  3UB6 A;  5J7E A;  3LIF A;  3H9W A;  1GSV A;  4LRX C;  2Z6C A;  4EEP A;  4NXF A;  4JGP A;  1XJ2 A;  3NOU C;  1WA9 A;  4JGO A;  3PYP A;  5IS1 A;  1S67 L;  5G4Z A;  4R6L A;  3FC7 A;  1T1A A;  5IU1 A;  2PD7 A;  3E4P A;  3NHQ A;  3UME A;  3LID A;  3NJA A;  4JGQ A;  2V0W A;  2PYP A;  2L4R A;  2QJ7 A;  1OTE A;  4EER A;  3FG8 A;  1OJ5 A;  4HNB A;  4GHI B;  3MFX A;  1N9L A;  2VLG A;  4MN5 A;  3P7N A;  3UE6 A;  3T50 A;  1T1B A;  4GHI A;  2OWJ A;  4I39 A;  2VV7 A;  4EEU A;  3E4Q A;  2PR5 A;  3UB9 A;  2VV8 A;  3K3C A;  1BYW A;  2YKH A;  1OTA A;  3CWF A;  3LI8 A;  2H28 A;  1S1Z A;  1V9Z A;  3F1P B;  2A24 B;  1D06 A;  1S1Y A;  5DKK A;  1KOU A;  1TS0 A;  1UWN X;  4MN6 A;  2OWH A;  4HHD A;  3F1P A;  3ICY A;  2Z6D A;  3UMD A;  3MQO A;  2A24 A;  5HD5 A;  5DJT A;  1LL8 A;  3UB8 A;  3IS2 B;  2I9V A;  2CMN A;  5F6A A;  3GEC A;  1TS8 A;  2B02 A;  4GS9 A;  1EW0 A;  4L9G A;  3RH8 B;  2WKR A;  3IS2 A;  2PD8 A;  5HD3 A;  3PHY A;  4I38 A;  5A8B A;  3LIB A;  3E4O A;  3LYX A;  3BY9 A;  2WKP A;  4I5S A;  4JGR A;  2D02 A;  2W27 A;  2J80 A;  2PHY A;  5DJU A;  3VE4 A;  4RQ9 A;  1N9O A;  4HY8 A;  4HP4 A;  1TS7 A;  1XFN A;  4L9F A;  1X0O A;  3CAX A;  1OTB A;  1LSW A;  3F1N B;  3GDI A;  4NXG A;  2QHK A;  2KX6 A;  2V9A A;  4NXE A;  1VB6 A;  5HWW A;  5HWT A;  2V1B A;  4HP9 A;  4I3I A;  3F1N A;  4HH3 A;  1TS6 A;  1LSV A;  1OT6 A;  4WF0 A;  2D01 A;  2YKF A;  3RTY A;  2GJ3 A;  3EEH A;  4EW7 A;  5J3W A;  4EET B;  4BBT A;  3UB7 A;  3A0R A;  1MZU A;  5I5L A;  1LSX A;  3G6O A;  4BBU A;  1XJ3 A;  1T18 A;  1F98 A;  4EQ1 A;  5F5Y A;  4XT2 B;  2PR6 A;  5KIZ A;  2HV1 A;  4GCZ A;  5HDS A;  4LLO B;  4HQA A;  4LRZ E;  1D7E A;  5HSQ A;  1S4S A;  4WLA A;  2JHE A;  5HWV A;  4E04 A;  4WUJ A;  5TBM B;  3A0S A;  2EA9 A;  1P97 A;  3ZQ5 A;  2ZOH A;  2K7S A;  3C8C A;  4HJ6 A;  4F3L B;  1N9N A;  3B33 A;  3NOT C;  5TBM A;  1V9Y A;  1DP8 A;  3VOL A;  3LIC A;  5G4Y A;  4NXB A;  4EES A;  2ZBB A;  3LIA A;  3MJQ A;  1DRM A;  5EFW A;  2OOL A;  1GSX A;  1DP6 A;  1OT9 A;  4F3L A;  4PKY A;  3OLO A;  1LT0 A;  1OTI A;  3C2W A;  4WN5 A;  3D72 A;  4KUO A;  5F69 A;  3ULF A;  3H82 B;  1ODV A;  3LI9 A;  4YWZ A;  1UGU A;  4R70 A;  2L1M A;  3NOP C;  3VE3 A;  4LPZ A;  2QJ5 A;  4H6J B;  4WL9 A;  2R78 A;  1GSW A;  3H82 A;  3CLO A;  3MR0 A;  1P0Z A;  4HH2 A;  5HDC A;  1OTD A;  3KX0 X;  4BBV A;  4H6J A;  1NWZ A;  2JN7 A;  2PYR A;  5HDD A;  3H7W B;  4R3A A;  5F68 A;  4B9O A;  4DJ2 A;  5J4E A;  1OJG A;  5DKL A;  3H7W A;  4GW9 A;  3MXQ A;  3F1O B;  4DJ3 A;  3HJK A;  1UWP X;  1XFQ A;  3BWL A;  4LRY C;  4K08 A;  1XJ6 A;  2M1C A;  4HI4 A;  4HJ4 A;  1T19 A;  3EWK A;  4HIA A;  4HOI A;  2VV6 A;  3A0V A;  2ZOI A;  1T1C A;  2V1A A;  3F1O A;  5HZH A;  4KUK A;  2WKQ A;  2P7J A;  4I3J A;  1Y28 A;  1S66 L;  3HJI A;  4XT2 A; 
#chains in the Genus database with same CATH topology
 2L0W A;  3NIA A;  4JF6 A;  3QHY A;  1IEM A;  2ZM2 A;  4OP8 A;  4LFU A;  3N8L A;  1G28 A;  4E6X A;  3VOY A;  4E3O A;  1E25 A;  4Q0H A;  5U47 A;  2EFU A;  3HUM A;  3K3D A;  1XGI A;  3T1R A;  5F82 A;  3NDE A;  3GTC A;  3A3J A;  4G3K A;  4HBT A;  4GDN A;  3MBZ A;  4RYE A;  1YKD A;  3NOU C;  3W4P A;  5FAQ A;  4JGO A;  3FKV A;  5L8M A;  2VGK A;  4Z9Q A;  5IS1 A;  1S67 L;  3V39 A;  1KE4 A;  2W1T B;  3CUE A;  3DTI A;  5DF8 A;  1KDW A;  1T1A A;  3R4K A;  3LY3 A;  3NHQ A;  3UME A;  1LL5 A;  1C3B A;  3LID A;  4U0T A;  4UA7 A;  2PYP A;  4MCW A;  1K6R A;  5AJG A;  1OJ5 A;  2HZ5 A;  1OME A;  2XA7 M;  4MN7 A;  3G32 A;  3WS0 A;  3QNB A;  3ZHH A;  3UDF A;  1N9L A;  3PAG A;  1WYB A;  5M18 A;  3W4O A;  4P6Z S;  3ZG0 A;  3LY4 A;  2R9X A;  1MWU A;  4FH4 A;  3LGO A;  1RP5 A;  3MZE A;  3W8K A;  2P08 A;  3CJM A;  3PAE A;  3K3C A;  4UQI S;  1BYW A;  1TDL A;  4YNR A;  4X55 A;  1KGG A;  4OQI A;  2H28 A;  3ZVW A;  2EFX A;  4EUZ A;  4P85 A;  3F1P B;  2J3W A;  3QP1 A;  3GQZ A;  5CGS A;  4WZ5 A;  3KSG A;  1KOU A;  5HL6 A;  1UWN X;  2GZA A;  3UY6 A;  4FSF A;  3IT9 A;  3LEQ A;  5L09 A;  3ICY A;  2Z6D A;  3UMD A;  3MQO A;  4DMZ A;  1ESU A;  4EBP A;  4FTX A;  5EUA A;  5GHY A;  3IS2 B;  4KZ3 A;  2CMN A;  3DWK A;  3KYQ A;  3UE0 A;  4OVD A;  3M2J A;  5HAQ A;  1EW0 A;  3O88 A;  4Y15 A;  4PM5 A;  4LV0 A;  1IOU A;  4I38 A;  4M3K A;  4GNU A;  2WZX A;  5A8B A;  4K0X A;  3G35 A;  4GDB A;  3BY9 A;  1KGE A;  4KEN B;  4S2N C;  2WKP A;  5FDH A;  1K54 A;  4I5S A;  2XH9 A;  2W27 A;  1K6S A;  4LCL A;  3BFF A;  5CXW A;  3B47 A;  1VET A;  3VE4 A;  2EXA A;  4RQ9 A;  2XD5 A;  2PRF A;  2K2N A;  1QME A;  1W8Q A;  3BFC A;  4E3I A;  2W1T A;  3UO9 A;  4EBL A;  1X0O A;  5IT5 A;  3F1N B;  2H5S A;  3C7V A;  4YOF A;  5CED A;  4R1G A;  3B42 A;  4NXE A;  1MY8 A;  4Y5F A;  1H8M A;  2V1B A;  2PT7 A;  2DNS A;  3Q7V B;  4WMC A;  4X53 A;  1XPB A;  4KZ7 A;  1OT6 A;  5KSH A;  3RTY A;  4EUV A;  4QWO A;  2GJ3 A;  2JKT I;  2OLU A;  5J3W A;  3VP0 A;  4RX2 A;  1NYY A;  4WEL A;  3MKF A;  4ZAM A;  5JYO A;  2EX8 A;  3HUO A;  2IWC A;  4BLM A;  4ZTK A;  2JBF A;  4NKP A;  5FI7 A;  3IXH A;  4XT2 B;  4II7 A;  5C5K A;  4GCZ A;  2PBY A;  1YLT A;  4HQA A;  2EX6 A;  1D7E A;  2DMW A;  5HSQ A;  2V20 A;  3OPH A;  1MC0 A;  4WLA A;  2WGI A;  5FAP A;  4DDY A;  5HWV A;  3BLS A;  3O5Y A;  1MPL A;  3VMA A;  3C38 A;  3LCE A;  3CIT A;  4E3K A;  1LHY A;  5FL3 A;  1P97 A;  4HBU A;  1KVM A;  1STZ A;  1YT4 A;  2LB9 A;  4HJ6 A;  1KE3 A;  2OLV A;  5TBM A;  3VP1 A;  1VHM A;  3VOL A;  5G4Y A;  4N9L A;  4NXB A;  2I72 A;  5FA7 A;  2ZBB A;  3LIA A;  2OOL A;  1GSX A;  1DP6 A;  3WS5 A;  3WRT A;  1OT9 A;  2FFY A;  3OLO A;  4OOY A;  1OTI A;  2XSS A;  3C2W A;  3Q81 A;  5TR7 A;  1L3L A;  2JKF A;  1GHP A;  5FAO A;  4WMC D;  1DJC A;  4ARZ B;  3ULF A;  2WGW B;  3JYI A;  1F5M A;  2FH5 A;  4R70 A;  3BRM A;  4QY6 A;  2R9W A;  2H0Y A;  4E3J A;  3D3O A;  3ZVT A;  3E2L A;  3JPU A;  5HDC A;  2EX2 A;  5EM0 A;  4S2I A;  4H6J A;  2JN7 A;  2XF3 A;  2PYR A;  4MDZ A;  4S2K A;  5F68 A;  3TSG A;  1Q2P A;  2ZQ9 A;  2VJW A;  4IBR A;  4EBN A;  2K31 A;  4IUH A;  3FKW A;  3S7P A;  1E3U A;  3Q7V A;  3KSH A;  4KQR A;  5KZH A;  5HFO A;  3BEB A;  3GMW A;  3ZNY A;  4GW9 A;  3PXP A;  5FEF A;  5FI6 A;  3F1O B;  4ZRR A;  2CC1 A;  4DJ3 A;  3BWL A;  1NRJ A;  1GA9 A;  1YPR A;  3OC2 A;  4HIA A;  1T19 A;  2VV6 A;  4JXW A;  1NYM A;  2ZOI A;  2QPN A;  1MWR A;  4KQQ A;  3IHB A;  3IWQ A;  1I2S A;  1FOF A;  1ONG A;  5CEB A;  2ZD8 A;  4LV2 A;  2Y2N A;  1PNE A;  1Y28 A;  4XT2 A;  3IF6 C;  4P6Z M;  4OON A;  3NDG A;  5DF9 A;  5DFX A;  3BYD A;  3AGE A;  1PWC A;  3KYZ A;  4PKY G;  1XJ4 A;  3LUQ A;  3PBQ A;  2ZJ9 A;  3HVF A;  3IBR A;  4CLC A;  2W1R A;  2VEA A;  3VP2 A;  3BY8 A;  2Z2L B;  4PM7 A;  2BAS A;  4UQI M;  4L9E A;  4GS9 B;  1IFQ A;  4GD6 A;  4HJ3 A;  5FQI A;  2Q9M A;  1YM1 A;  3Q82 A;  1JNU A;  3IXG A;  2LB5 A;  3V3R A;  2ZMF A;  2HPB A;  5GHZ A;  5DVA A;  2O0Y A;  3RXW A;  1EI5 A;  1OPX A;  5E2H A;  3SS4 A;  4LRX C;  2KOI A;  1FCN A;  2Z6C A;  1FSW A;  2Y2M A;  4DF6 A;  2A3U A;  4JGP A;  1XJ2 A;  2JKR M;  4R4R A;  1E3U D;  4C3Q A;  4E6W A;  4Q0J A;  1WA9 A;  3U2A A;  2WGW A;  3WS2 A;  2G7U A;  4DRT A;  4BMW A;  3FC7 A;  4D60 A;  3OPR A;  2PD7 A;  1IYP A;  4MNR A;  3E4P A;  1CK3 A;  4OQ0 A;  3NJA A;  3N7W A;  1N4O A;  3C30 A;  3GR2 A;  2V0W A;  4S2J A;  2Y2K A;  3G2Y A;  4OP5 A;  5E2E A;  1OTE A;  3FG8 A;  3FV7 A;  4CLC E;  3SZT A;  3E0Y A;  2Q0O A;  4LGW A;  3UE6 A;  5FEG A;  1F2K A;  3P98 A;  4X56 A;  4BD1 A;  2Y2G A;  2P04 A;  4I39 A;  5DF7 A;  2XLN A;  4EEU A;  3UB9 A;  1HD8 A;  4DE3 A;  3T12 B;  4LCM A;  4CLC D;  2Y4A A;  3P01 A;  3VP3 A;  1PFL A;  4ESP A;  4B4X A;  2A49 A;  1TEM A;  4NET A;  1OTA A;  1I2W A;  1YLY A;  4KZ9 A;  1ONH A;  1KDS A;  4R3J A;  3FPW A;  1V9Z A;  1SHV A;  5EOO A;  1L2S A;  4F94 A;  4MBF A;  1K57 A;  1CF0 A;  1S1Y A;  1TS0 A;  1ES3 A;  3PBS A;  4LV3 A;  4C75 A;  2OWH A;  4EU0 A;  1IKG A;  2A24 A;  1LL8 A;  5HW3 A;  1Q2Q A;  4N9K A;  1FIK A;  1Y4O A;  4OKP A;  4O7D A;  3N8S A;  1K4F A;  4GS9 A;  1BLS A;  3NC8 A;  4L9G A;  3RH8 B;  2Y8H A;  5HD3 A;  2PAV P;  1JWZ A;  2O9B A;  4H8R A;  4LV1 A;  5EPH A;  1PRQ A;  2G2U A;  3OBF A;  5CGW A;  1VET B;  3E2K A;  1YMX A;  3ZG9 B;  1NLZ A;  5L10 A;  4QHC A;  2H10 A;  4JGR A;  1BSG A;  2OAP 1;  4KZ8 A;  3ZYT A;  4DE0 A;  4MBH A;  1YQS A;  4ETZ A;  5TJJ A;  2J80 A;  2PHY A;  3TG9 A;  2A2L A;  2ZQ7 A;  4HY8 A;  4HP4 A;  2W3F A;  3KSI A;  5F1G A;  1NZU A;  2M7U A;  3IBJ A;  3HLC A;  5CTN A;  3V5M A;  3SH9 A;  2KX6 A;  4CQH A;  3M2K A;  1VB6 A;  4N1X A;  3ZG7 B;  5HWT A;  3BM6 A;  4S2M A;  4JKT A;  4S2O A;  2E8I A;  4HH3 A;  1TS6 A;  1FR1 A;  1ERO A;  1ERQ A;  4WF0 A;  3S1Y A;  2D01 A;  2VKS A;  3LR4 A;  4IVI A;  2XR0 A;  4QPR A;  3OPL A;  3C4P A;  3EEH A;  1NZO A;  1W79 A;  5AQB A;  2XDM A;  3VOZ A;  3A0R A;  3PBO A;  4O8G A;  3PBT A;  1J9M A;  4PM6 A;  1KVL A;  1CI9 A;  4BBU A;  2IA2 A;  3C7U A;  4DDS A;  4Y0U A;  4X6T A;  2V1Z A;  1GHI A;  1RGZ A;  5KIZ A;  2J8Y A;  2HV1 A;  3UE1 A;  3HL9 A;  5DTS A;  1HZO A;  2HJ9 C;  4LRZ E;  4DXC A;  1S4S A;  3VV4 A;  3IF6 A;  4RX3 A;  3UPO A;  3M6H A;  4R3B A;  5D3O A;  3HLF A;  5TBM B;  3IX3 A;  4FUW A;  2HP9 A;  2ZQC A;  3A0S A;  4QU3 A;  3CPT A;  4UHU A;  2ZOH A;  2K7S A;  1N9N A;  3B33 A;  3NI9 A;  3NOT C;  2ZM0 A;  3HLD A;  5HAR A;  3LIC A;  3T4L A;  4EES A;  4WEJ A;  2PBD P;  3VP4 A;  2VGL S;  3MJQ A;  1DRM A;  1BT5 A;  1H8Z A;  2UWX A;  3QP6 A;  4F3L A;  4BD0 A;  5GLD A;  4OPR A;  1O07 A;  4C6Y A;  2ZQ8 A;  3BFE A;  4R23 A;  4PPR A;  5FI2 A;  5TGF A;  3BQA A;  1Z09 A;  4IVK A;  4K91 A;  4Z1W A;  3LFV A;  5FSR A;  3MFD A;  4MLL A;  3MS6 A;  4PM9 A;  4EV4 A;  3S4X A;  3EGX C;  4LPZ A;  1VEU B;  4XUX A;  4H6J B;  4PHT A;  3BEC A;  1GSW A;  2JKR I;  3R7W A;  2FFF B;  1M40 A;  2BLS A;  4HH2 A;  2QZ6 A;  1RCJ A;  4R0Q A;  4E3M A;  1OTD A;  1L0F A;  4WYY A;  1NWZ A;  3KO6 A;  4UAA A;  5HDD A;  4B4Z A;  1CQA A;  1BUL A;  1VM1 A;  1S6R A;  1NY0 A;  3UE3 A;  3HUN A;  1PWD A;  1OJG A;  4FH2 A;  1ZHH B;  3H7W A;  3N8R A;  2ZMA A;  2XD1 A;  3MXQ A;  4LRY C;  1UWP X;  4KZ4 A;  4K08 A;  1DJB A;  1WE4 A;  2P9V B;  4HOI A;  3EWK A;  3A0V A;  5EVI C;  4PAU A;  4N1H A;  3N6I A;  3DWZ A;  1K38 A;  4QB8 A;  2HGV A;  1LI0 A;  1L0E A;  5J8X A;  1D1J A;  1S66 L;  1MWT A;  4Y0T A;  4UEY A;  3MZF A;  3CI6 A;  4I3A A;  3MQQ A;  4CLC B;  2W0N A;  2QKP A;  4D2O A;  5AVF A;  2X01 A;  4EXO A;  5GL9 A;  1F9I A;  2PDR A;  3IXB A;  1DP9 A;  1EWZ A;  3IWO A;  2OAQ 1;  3CHW P;  2J3T C;  4S2L A;  3JVV A;  4O01 A;  2KDK A;  2INW A;  3LIE A;  2HP5 A;  3SW1 A;  2V0U A;  2WKI A;  3G2Z A;  4EQI A;  2V8F A;  3HCY A;  3RXX A;  4KQD A;  3B3X A;  1BUE A;  3SS3 A;  3CZD A;  5FQJ A;  4CJN A;  3H9W A;  1XA7 A;  1GSV A;  4JBF A;  3UDI A;  5CER A;  4KG6 A;  3G34 A;  4EEP A;  4IBX A;  3HRE A;  3L7H A;  3A3I A;  2Y79 A;  4X68 A;  5FQ9 A;  3T4T A;  5G4Z A;  4R6L A;  2XFT A;  3IX4 A;  2G2W A;  3CUE C;  1GA0 A;  2ZQA A;  1LL9 A;  2Y2P A;  3T4Q A;  1VEU A;  2JCH A;  2OSU A;  2Y2O A;  4U0X A;  2L4R A;  3NBL A;  2M7V A;  4JLF A;  1TF1 A;  3RJU A;  4EER A;  3HLE A;  3O86 A;  3QP8 A;  2NUT C;  2Q9N A;  4HNB A;  3T4S A;  3MFX A;  1SKO A;  4EWF A;  5EOE A;  4FD8 A;  2VLG A;  4MN5 A;  3P7N A;  4DE2 A;  1LLB A;  1DJA A;  4AFI A;  5HX9 A;  2ZQD A;  1T1B A;  4GHI A;  1W63 M;  1ZTU A;  4X1L A;  5FQQ A;  2VV7 A;  2Y59 A;  2PR5 A;  4ZJ1 A;  2P9V A;  3CWF A;  1K4E A;  4B93 A;  3LI8 A;  3O87 A;  1G6A A;  3FWL A;  1BLC A;  3MXS A;  1KE0 A;  2A24 B;  4Y13 A;  1VQQ A;  5CTM A;  1W63 Q;  5DKK A;  4WZ5 C;  3DW0 A;  1ES5 A;  5EVL A;  1YLP A;  4HHD A;  1FCM A;  3ISG A;  3W2Z A;  5HD5 A;  1MXO A;  4ETX A;  5EE8 A;  5M19 A;  3T1X A;  4ZDX A;  1YSQ A;  3QP5 A;  4KG5 A;  5HAI A;  4Y0O A;  2WUQ A;  3BQ8 A;  1MKI A;  3SH7 A;  5F6A A;  3E98 A;  5EEC A;  1HLU P;  1L0D A;  5KSC A;  4HES A;  2XQZ A;  2WKR A;  1G68 A;  2J7V A;  4DN0 A;  3FYZ A;  4WM9 A;  4S2N A;  3UN7 A;  1RGY A;  3TW8 A;  1K54 C;  3MQ0 A;  1AWI A;  4DE1 A;  3TOI A;  4ZJ2 A;  2PU4 A;  1IKI A;  2VZW A;  1H0M A;  4HEF A;  5DJU A;  1ES2 A;  2HDS A;  4IJG A;  3MZD A;  2WZZ A;  1TS7 A;  2C5W B;  1XFN A;  2VGL M;  1BLP A;  4L9F A;  4U3T A;  3PBN A;  1SDN A;  3CAX A;  4Y2F A;  3GDI A;  4JF4 A;  2QHK A;  1NLY A;  1ZG6 A;  2DRW A;  1BTL A;  5HWW A;  3MMH A;  3GV9 A;  4HP9 A;  4I3I A;  2ZC5 B;  5DTK A;  4NK3 A;  4BJP A;  1IYO A;  1LSV A;  1MWS A;  2Y2L A;  1ES4 A;  4BBT A;  5CX7 A;  4XXR A;  3WS1 A;  4X1M A;  4N92 A;  1MZU A;  1ZC2 A;  5I5L A;  1NJ4 A;  4FOF A;  1LSX A;  2XFS A;  5BOH A;  3G6O A;  3UPN A;  4NEE D;  1QMF A;  1XJ3 A;  4JXG A;  5EVI A;  1T18 A;  5FAS A;  1F98 A;  3IF6 B;  4GOG A;  1K55 C;  1SDE A;  4FCF A;  2QYB A;  1FR6 A;  2PR6 A;  3RFB A;  1XP4 A;  4GLQ A;  5FQM A;  4BL3 A;  2P74 A;  4LLO B;  4Q0I A;  2J9P A;  5FQK A;  3CPT B;  2KLI A;  4Q8I A;  1NRF A;  2JHE A;  4E04 A;  4KQO A;  3LR3 A;  1YLW A;  3G4P A;  2MJ6 A;  2XEP A;  3VFH A;  3IX8 A;  3C8C A;  3EEA A;  5E2G A;  4F3L B;  4Y3I A;  5A90 A;  5HL1 A;  1V9Y A;  2O99 A;  3GRJ A;  1DP8 A;  2VK3 A;  4BEN A;  5EFW A;  2WK0 A;  1PZP A;  2JKG A;  4PKY A;  3S7O A;  1FIL A;  2Y91 A;  5HPF A;  1SCW A;  5TFQ A;  5KMW A;  4WEK A;  4WBG A;  3LO7 A;  3WWX A;  4OQH A;  2ZC6 B;  3ITA A;  4KUO A;  5DTT A;  4IUK A;  5F69 A;  2FZ0 A;  1H5X A;  1HTZ A;  1K56 A;  3LI9 A;  3R7W B;  4G3V A;  4MBK A;  2E8J A;  3K2N A;  4YWZ A;  4KZ5 A;  1UGU A;  3NOP C;  3VE3 A;  1ZKJ A;  2QJ5 A;  5M1A A;  4WL9 A;  3NCK A;  3HLB A;  3ZFZ A;  3H82 A;  1AXB A;  3MR0 A;  3DTM A;  2XRO A;  1PZO A;  5GHX A;  3KX0 X;  4BBV A;  5F1F A;  2QMI A;  4IED A;  5EVI D;  3NUL A;  1IYQ A;  3H7W B;  4GN2 A;  4YFM A;  4B9O A;  4PMA A;  1SKF A;  4NG2 A;  2DCF A;  3BLM A;  2HJE A;  3VSK A;  4OOM A;  1U60 A;  2IWD A;  1KGF A;  5G18 A;  2M1C A;  4HI4 A;  4HJ4 A;  3TE8 A;  3IQA A;  5A91 A;  3Q7Z A;  5CRF A;  2J3T D;  3ZG8 B;  1GCE A;  3DBA A;  3TJZ C;  4KUK A;  2J9O A;  3T4J A;  4I3J A;  4OOL A;  1PI4 A;  4KZB A;  2GNX A;  4IHQ A;  5E2F A;  2UV0 E;  1O7E A;  5HAP A;  1CI8 A;  3CMZ A;  4GZB A;  4M4X A;  3ZCZ A;  4R38 A;  3FPV A;  2ZL1 A;  4KZ6 A;  3T4K A;  5AVE A;  1S4R A;  5EVE A;  2B95 A;  1K56 D;  4CLC C;  4JXV A;  2H0T A;  1MKM A;  2XRN A;  2HDQ A;  1N9B A;  1XX2 A;  1XA1 A;  2C6W B;  2WYX A;  4OH0 A;  2QWS A;  4OPQ A;  3EGD C;  3UB6 A;  4ME4 A;  2HDR A;  4GKU A;  2Y2I A;  1A0K A;  2EWW A;  5J7E A;  3LIF A;  2JE5 A;  4QJG A;  3IXD A;  2NUP C;  4X25 A;  4E3N A;  2B5R A;  2EX9 A;  5JYP A;  4NXF A;  1CEG A;  2XGN A;  3AGD A;  3PYP A;  2VA0 A;  1GHM A;  2WAD A;  4UA9 A;  1ERM A;  1P9R A;  1TDG A;  5IU1 A;  4JPM A;  1ACF A;  4OPZ A;  1SKO B;  4JGQ A;  3ZDJ A;  3A3D A;  2QJ7 A;  3Q1F A;  3DAV A;  4DKI A;  1K25 A;  4GHI B;  3UB5 P;  4GB7 A;  3D4F A;  4OLG A;  4Y17 A;  1M6K A;  4R4S A;  3T1S A;  2WAE A;  2AVX A;  3VSL A;  5FAT A;  2GDN A;  3T50 A;  1FSY A;  2OWJ A;  3IH8 A;  5GLB A;  1G5U A;  5CHM A;  2O9C A;  5IHV A;  2Y2H A;  1P9W A;  1Z6F A;  2V2F F;  3E4Q A;  4KZA A;  5CHJ A;  2VV8 A;  3BFD A;  3QP2 A;  2HDU A;  3PR6 A;  4GJ4 A;  3NEC A;  3EOI A;  3KYE A;  4G3W A;  2RCX A;  5F83 A;  2YKH A;  1JTD A;  1BLH A;  1CJF A;  1MBL A;  5GLC A;  1S1Z A;  3IH9 A;  3M6B A;  2X02 A;  1K55 A;  2WAF A;  1PW8 A;  2IWB A;  4MEZ A;  3V3S A;  3MXR A;  1JVJ A;  5HPI A;  4XUZ A;  1D06 A;  2HF6 A;  3I7J A;  1K57 C;  3V50 A;  3NY4 A;  3SOI A;  5E43 A;  1E4D A;  4S2P A;  4MN6 A;  3D9Y A;  1L0G A;  2EWV A;  3F1P A;  3P09 A;  3TRC A;  2ZM8 A;  4X69 A;  1W8Y A;  3LEZ A;  5DJT A;  3UB8 A;  4E3L A;  1XGJ A;  4YIN A;  1YSP A;  2GX5 A;  2I9V A;  3S22 A;  3GEC A;  1TS8 A;  3EQU A;  3EQV A;  2B02 A;  3ITB A;  4QD4 A;  3IS2 A;  3FZC A;  4BQM A;  2PD8 A;  4JXS A;  3PHY A;  2WGV A;  3PTE A;  2XA7 S;  3LIB A;  1FQG A;  4DXB A;  4QY5 A;  3E4O A;  1DY6 A;  3LYX A;  4UA6 A;  1JWV A;  3ZGA B;  5I94 A;  1IYS A;  3OCL A;  5GLA A;  2D02 A;  4LEN A;  1ALQ A;  3G31 A;  1YMS A;  4L0L A;  3A3F A;  3GVB A;  5CGX A;  3OCN A;  2HP6 A;  4K0W A;  3C4O A;  3GSG A;  1N9O A;  4WZ4 A;  3Q07 A;  1XKZ A;  3MF0 A;  5L07 A;  3T4O A;  4MMN A;  4P87 A;  5AQ7 A;  1OTB A;  1LSW A;  4GD8 A;  4NXG A;  3UPP A;  2V9A A;  5EV0 A;  1IEL A;  3OZH A;  2VX8 A;  3BJN A;  3IF5 A;  3VFF A;  3IWI A;  1PYY A;  2JC7 A;  4OPY A;  3SS5 A;  1CEF A;  1I5Q A;  3KSF A;  3F1N A;  2OV5 A;  5CEC A;  4P6B A;  2YKF A;  1JWP A;  2W3H A;  4RVA A;  4EW7 A;  4EET B;  1FCO A;  5EVI B;  2VGJ A;  3UB7 A;  3V67 A;  2WKE A;  1XXM A;  5FDS A;  5CHU A;  1W7F A;  1Y54 A;  3LR0 A;  4EQ1 A;  5F5Y A;  5AQA A;  3CG5 A;  2BG1 A;  2W3G A;  3SH8 A;  1LI9 A;  2ZC4 B;  5HDS A;  2WKH A;  2ZC3 B;  2ZLY A;  2B18 A;  3DTE A;  1PWG A;  1PI5 A;  2ACG A;  5EM1 A;  2EXB A;  4P0M A;  4ZJ3 A;  4WUJ A;  4OQG A;  3JVU A;  1J3W A;  1TD5 A;  2EA9 A;  4PM8 A;  3S7N A;  3ZQ5 A;  4B88 A;  3O3V A;  3N4I A;  1S0W A;  1PW1 A;  2X71 A;  3WRZ A;  3DTK A;  3OPP A;  1YAX A;  4CPK A;  3OOV A;  2RL3 A;  2W3D A;  3QNC A;  4OLD A;  3ZNT A;  4ID4 A;  1LT0 A;  2V8C A;  4RA7 A;  1SZV A;  1W5D A;  4WN5 A;  3UNW A;  3D72 A;  5A92 A;  1H3Q A;  1ESI A;  3MKE A;  2Y2Q A;  5L2F A;  3H82 B;  1ODV A;  1YLZ A;  3ZG5 A;  5A93 A;  2L1M A;  3PBR A;  4BL2 A;  2XK1 A;  5MC7 A;  4ARZ A;  2R78 A;  4JF5 A;  1TVF A;  3L9K A;  1G6O A;  1HVB A;  3CLO A;  4KG2 A;  1NXY A;  5DFY A;  1P0Z A;  3S7Q A;  2Y55 A;  3U4L P;  1ZG4 A;  5LBR A;  3HLW A;  3BW6 A;  4R3A A;  1BZA A;  2O9A A;  3HLG A;  3IHA A;  2JKT M;  4DJ2 A;  1WYC A;  4Y7P A;  5J4E A;  2BTF P;  3MSH A;  5AQ9 A;  3HBR A;  4BWI A;  5DKL A;  3WS4 A;  2ZMV A;  2W3E A;  2PU2 A;  3C5A A;  1K0K A;  1JTG A;  4A5R A;  2Y2J A;  3G30 A;  2Z2M B;  3HJK A;  1XFQ A;  1XJ6 A;  5K5B A;  3AGF A;  4O0P A;  1T1C A;  2V1A A;  3QP4 A;  4ZBE A;  3F1O A;  5HZH A;  3UDX A;  3BFG A;  3LR5 A;  2WKQ A;  2P7J A;  1H8Y A;  3W4Q A;  3HJI A;  3A3E A;  2ZL1 B;  2ZC7 A;  1YLJ A;  3T1Q B;  1PIO A; 
#chains in the Genus database with same CATH homology
 3CI6 A;  4I3A A;  3MQQ A;  4CLC B;  5DF9 A;  2W0N A;  2L0W A;  5DFX A;  2QKP A;  5AVF A;  4EXO A;  1F9I A;  4M4X A;  4R38 A;  3FPV A;  3KYZ A;  4PKY G;  1XJ4 A;  3LUQ A;  2PDR A;  3PBQ A;  3T4K A;  5AVE A;  1G28 A;  3IBR A;  4CLC A;  1S4R A;  1DP9 A;  2W1R A;  4CLC C;  2OAQ 1;  2VEA A;  3BY8 A;  2J3T C;  2BAS A;  1MKM A;  3JVV A;  4O01 A;  4UQI M;  2XRN A;  2KDK A;  2INW A;  3LIE A;  4L9E A;  4GS9 B;  1IFQ A;  4HJ3 A;  3SW1 A;  4Q0H A;  2V0U A;  3K3D A;  3HCY A;  2QWS A;  4KQD A;  3EGD C;  1JNU A;  3UB6 A;  4ME4 A;  2LB5 A;  2ZMF A;  2EWW A;  5J7E A;  3LIF A;  4G3K A;  2O0Y A;  1OPX A;  3H9W A;  1GSV A;  2NUP C;  4LRX C;  2KOI A;  2Z6C A;  1YKD A;  4EEP A;  4NXF A;  4JGP A;  1XJ2 A;  2JKR M;  3NOU C;  4Q0J A;  1WA9 A;  4JGO A;  3U2A A;  2Y79 A;  3PYP A;  2VA0 A;  5L8M A;  3T4T A;  5IS1 A;  1S67 L;  2G7U A;  5G4Z A;  1P9R A;  2W1T B;  3CUE A;  4R6L A;  4BMW A;  3FC7 A;  1T1A A;  5IU1 A;  3CUE C;  2PD7 A;  3R4K A;  3E4P A;  3NHQ A;  3T4Q A;  3UME A;  3LID A;  3NJA A;  4JGQ A;  3C30 A;  2V0W A;  2PYP A;  2L4R A;  4MCW A;  2QJ7 A;  5AJG A;  2M7V A;  1OTE A;  1TF1 A;  4EER A;  3FG8 A;  1OJ5 A;  2NUT C;  4GHI B;  2XA7 M;  4HNB A;  4MN7 A;  3T4S A;  4CLC E;  3MFX A;  1N9L A;  2VLG A;  3E0Y A;  3P7N A;  4MN5 A;  4P6Z S;  3UE6 A;  4AFI A;  3T50 A;  1T1B A;  4GHI A;  2OWJ A;  1W63 M;  2P04 A;  4I39 A;  2O9C A;  1ZTU A;  2VV7 A;  1P9W A;  2P08 A;  4EEU A;  3E4Q A;  2PR5 A;  3UB9 A;  2VV8 A;  3K3C A;  4CLC D;  3PR6 A;  3P01 A;  4GJ4 A;  3EOI A;  4UQI S;  1BYW A;  4G3W A;  4YNR A;  2YKH A;  1OTA A;  3CWF A;  4B93 A;  3LI8 A;  2H28 A;  1S1Z A;  3FPW A;  1V9Z A;  3F1P B;  2J3W A;  5HPI A;  2A24 B;  1D06 A;  3KSG A;  2HF6 A;  1S1Y A;  1W63 Q;  5DKK A;  1KOU A;  1TS0 A;  5HL6 A;  1UWN X;  3PBS A;  4MN6 A;  2GZA A;  2OWH A;  2EWV A;  4HHD A;  3F1P A;  4FSF A;  3TRC A;  4EU0 A;  3ICY A;  2Z6D A;  3UMD A;  3MQO A;  2A24 A;  3W2Z A;  4DMZ A;  5HD5 A;  5DJT A;  4ETX A;  1LL8 A;  1YSQ A;  3UB8 A;  3IS2 B;  1YSP A;  2GX5 A;  2I9V A;  2CMN A;  3BQ8 A;  5F6A A;  3E98 A;  3KYQ A;  3GEC A;  1TS8 A;  3EQU A;  3EQV A;  2B02 A;  4GS9 A;  1EW0 A;  4L9G A;  3RH8 B;  2WKR A;  3IS2 A;  2PD8 A;  4DN0 A;  2Y8H A;  5HD3 A;  1IOU A;  3PHY A;  4I38 A;  2O9B A;  5A8B A;  2XA7 S;  3LIB A;  3OBF A;  3E4O A;  3LYX A;  3BY9 A;  2WKP A;  3TW8 A;  4I5S A;  1NLZ A;  4JGR A;  3OCL A;  3MQ0 A;  2OAP 1;  2D02 A;  2W27 A;  3ZYT A;  4ETZ A;  5TJJ A;  2J80 A;  2PHY A;  4L0L A;  2VZW A;  3B47 A;  5DJU A;  3VE4 A;  3OCN A;  4RQ9 A;  4IJG A;  2A2L A;  1N9O A;  4HY8 A;  2K2N A;  4HP4 A;  1TS7 A;  1XFN A;  2VGL M;  2W3F A;  3KSI A;  3MF0 A;  2W1T A;  3T4O A;  4L9F A;  1X0O A;  4MMN A;  5IT5 A;  3PBN A;  3CAX A;  2M7U A;  3IBJ A;  1OTB A;  1LSW A;  3F1N B;  4Y2F A;  3GDI A;  4YOF A;  4NXG A;  3B42 A;  2QHK A;  1NLY A;  2KX6 A;  2V9A A;  4NXE A;  4CQH A;  1VB6 A;  4Y5F A;  2VX8 A;  5HWW A;  3BJN A;  1H8M A;  5HWT A;  3MMH A;  2V1B A;  2PT7 A;  4HP9 A;  4I3I A;  3KSF A;  3F1N A;  4HH3 A;  4BJP A;  1TS6 A;  1LSV A;  1OT6 A;  4WF0 A;  5KSH A;  2D01 A;  2YKF A;  2VKS A;  3LR4 A;  3RTY A;  4EUV A;  2GJ3 A;  4QPR A;  2W3H A;  3EEH A;  2JKT I;  4EW7 A;  5J3W A;  4EET B;  4BBT A;  5CX7 A;  3UB7 A;  3A0R A;  3V67 A;  3PBO A;  4O8G A;  1MZU A;  3PBT A;  4WEL A;  5I5L A;  4FOF A;  1LSX A;  3G6O A;  4BBU A;  4NEE D;  1XJ3 A;  2IA2 A;  3LR0 A;  1T18 A;  1F98 A;  4NKP A;  4EQ1 A;  5F5Y A;  4XT2 B;  4II7 A;  2QYB A;  2PR6 A;  3RFB A;  2W3G A;  5KIZ A;  5C5K A;  2HV1 A;  4GLQ A;  4GCZ A;  5HDS A;  4LLO B;  4HQA A;  4Q0I A;  2B18 A;  2HJ9 C;  4LRZ E;  1D7E A;  2DMW A;  5HSQ A;  2KLI A;  1S4S A;  3VV4 A;  1MC0 A;  4WLA A;  2JHE A;  5HWV A;  4E04 A;  4KQO A;  3O5Y A;  4WUJ A;  3JVU A;  5TBM B;  3LR3 A;  3C38 A;  3CIT A;  5FL3 A;  1TD5 A;  2MJ6 A;  2EA9 A;  3A0S A;  1P97 A;  3S7N A;  3ZQ5 A;  1STZ A;  2ZOH A;  2K7S A;  2LB9 A;  3C8C A;  3EEA A;  4HJ6 A;  4F3L B;  1N9N A;  3B33 A;  4Y3I A;  3NOT C;  5TBM A;  1V9Y A;  1VHM A;  2O99 A;  1DP8 A;  3VOL A;  3T4L A;  3LIC A;  5G4Y A;  4NXB A;  4EES A;  4WEJ A;  2ZBB A;  1YAX A;  2VGL S;  1DRM A;  3LIA A;  3MJQ A;  5EFW A;  2OOL A;  1GSX A;  3OOV A;  1DP6 A;  1OT9 A;  4F3L A;  2W3D A;  4PKY A;  3OLO A;  3S7O A;  1LT0 A;  5HPF A;  1OTI A;  2XSS A;  3C2W A;  4WN5 A;  4WEK A;  3D72 A;  1H3Q A;  3BQA A;  4KUO A;  4IUK A;  5F69 A;  4ARZ B;  4Z1W A;  2FZ0 A;  3LFV A;  3ULF A;  3H82 B;  1ODV A;  1F5M A;  2FH5 A;  3LI9 A;  3R7W B;  4G3V A;  4YWZ A;  3K2N A;  1UGU A;  4R70 A;  2L1M A;  3NOP C;  3PBR A;  3EGX C;  3VE3 A;  4LPZ A;  5MC7 A;  2QJ5 A;  4ARZ A;  4H6J B;  4WL9 A;  4PHT A;  2R78 A;  1GSW A;  2JKR I;  3H82 A;  3D3O A;  1G6O A;  3R7W A;  3CLO A;  3MR0 A;  2XRO A;  5DFY A;  1P0Z A;  4HH2 A;  3S7Q A;  5HDC A;  1OTD A;  3KX0 X;  4BBV A;  4H6J A;  1NWZ A;  2JN7 A;  3KO6 A;  2PYR A;  4MDZ A;  5HDD A;  5LBR A;  3BW6 A;  3H7W B;  4R3A A;  5F68 A;  2O9A A;  3UE3 A;  2JKT M;  4B9O A;  4DJ2 A;  2VJW A;  5J4E A;  2K31 A;  4IUH A;  3S7P A;  1OJG A;  3KSH A;  4BWI A;  5DKL A;  1ZHH B;  3H7W A;  4GW9 A;  2HJE A;  3PXP A;  2ZMV A;  2W3E A;  3MXQ A;  4OOM A;  3F1O B;  4ZRR A;  4DJ3 A;  3HJK A;  1UWP X;  1XFQ A;  3BWL A;  4LRY C;  4K08 A;  1XJ6 A;  2M1C A;  1NRJ A;  5K5B A;  3OC2 A;  4HI4 A;  4HJ4 A;  1T19 A;  3EWK A;  4HIA A;  4HOI A;  2VV6 A;  3TE8 A;  3A0V A;  2ZOI A;  4O0P A;  1T1C A;  4PAU A;  2V1A A;  3F1O A;  5HZH A;  2J3T D;  3DBA A;  3TJZ C;  3LR5 A;  2HGV A;  4KUK A;  2WKQ A;  2P7J A;  3T4J A;  4I3J A;  4OOL A;  1Y28 A;  1S66 L;  2GNX A;  4UEY A;  4IHQ A;  3HJI A;  4XT2 A;  4P6Z M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...