5DJTA

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
b'SLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-2
molecule tags Signaling protein
source organism Avena sativa
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djtA00
1V9ZA 1N9OA 1OTEA 4EETB 4F3LB 5HD5A 1X0OA 1S4SA 4RQ9A 2VEAA 3KX0X 2V0UA 1TS8A 3IS2A 3ULFA 2QJ5A 3K3DA 5DJTA 2QWSA 2YKHA 3F1PA 1T1AA 4PKYG 4HY8A 2PD7A 1Y28A 5KIZA 5F68A 3G6OA 3FG8A 5HSQA 1ODVA 1XFQA 3E4PA 3F1PB 5J4EA 3D72A 3A0RA 3MQOA 3HJKA 4HP4A 2H28A 4LRZE 3MXQA 3LIEA 4LPZA 2V1BA 2P7JA 1DRMA 4GCZA 4R3AA 4XT2A 1GSVA 2KX6A 3MQQA 5AVEA 3RH8B 1TS0A 3UMEA 1UGUA 4I3IA 2OWHA 4HIAA 3C8CA 3SW1A 4BBUA 1OJ5A 4WN5A 4EXOA 1T18A 1N9NA 3H7WA 4L9FA 5HWTA 2WKQA 3NOPC 5G4ZA 5G4YA 4KUOA 3E4OA 1WA9A 2V0WA 1LT0A 5F69A 4JGQA 3EWKA 2PD8A 2ZOIA 4EW7A 3LI8A 2ZBBA 3GECA 3F1OA 2QKPA 3UB9A 3LIFA 4K08A 1T1CA 3F1NA 4EQ1A 4XT2B 2L1MA 4HHDA 1LL8A 5HDDA 5HD3A 3BWLA 1F98A 2Z6CA 1LSXA 4GW9A 5DJUA 5TBMB 2PYRA 3P7NA 2PDRA 2D01A 2CMNA 2GJ3A 1TS7A 4I38A 1UWNX 3LI9A 4I39A 1BYWA 1S4RA 2OWJA 2PYPA 4LRYC 3MJQA 3NJAA 4JGPA 4R70A 5DKKA 5F6AA 4EEPA 1D7EA 1S1YA 4NXBA 5TBMA 2J80A 2EA9A 5DKLA 3GDIA 2A24A 4EEUA 3LUQA 4M4XA 4WL9A 3ZQ5A 1OTBA 2ZOHA 2V1AA 1KOUA 3K3CA 3IBRA 2W0NA 2PR5A 1XJ3A 1OJGA 1LSVA 2BASA 2L0WA 3NHQA 4WF0A 3FC7A 2B02A 4NXEA 5HDSA 1UWPX 3H7WB 4MN5A 1XJ6A 4I3AA 5IS1A 3UB6A 3H82A 1S1ZA 2WKPA 2HV1A 3MFXA 4BBVA 3A0VA 4EERA 2R78A 3LIDA 3F1OB 3LYXA 1DP6A 4R38A 1XJ2A 2KDKA 2L4RA 1OTAA 3LIBA 4R6LA 5AVFA 4B9OA 4EESA 3VOLA 1NWZA 2YKFA 1EW0A 1VB6A 2PR6A 1XJ4A 2V9AA 1OTDA 1P97A 3PHYA 2W27A 3UB8A 2I9VA 4GS9B 3B33A 3OLOA 4DJ2A 4HQAA 4HJ4A 3CLOA 4WUJA 3HJIA 4E04A 1TS6A 3H82B 3LIAA 3NOUC 3EEHA 1V9YA 4NXFA 4PKYA 4I5SA 4WLAA 4HI4A 1OT6A 3UMDA 3C2WA 3IS2B 1P0ZA 1DP9A 1D06A 2VV6A 4LLOB 2A24B 1GSXA 3UE6A 1T1BA 3CAXA 3ICYA 4HNBA 3UB7A 4KQDA 5HZHA 4H6JB 5HWVA 2Z6DA 4JGRA 5F5YA 4KUKA 1JNUA 2OOLA 3VE3A 1OTIA 1S66L 4JGOA 3CWFA 2VV8A 5IU1A 2K7SA 4GS9A 5HWWA 4HH3A 2VLGA 2M1CA 3PYPA 4HP9A 4H6JA 4L9EA 5EFWA 3NOTC 2JHEA 1DP8A 5J7EA 1T19A 4F3LA 5A8BA 3H9WA 4HJ6A 4YWZA 3A0SA 3T50A 1G28A 2INWA 4HJ3A 2D02A 2WKRA 4HH2A 1S67L 4HOIA 5J3WA 3VE4A 2JN7A 1N9LA 3F1NB 4LRXC 4MN6A 4DJ3A 3E4QA 1OT9A 1GSWA 4GHIB 1LSWA 2QJ7A 4L9GA 2QHKA 1F9IA 3BY9A 3LICA 3BY8A 1MZUA 3MR0A 4I3JA 5HDCA 5I5LA 2VV7A 3RTYA 1XFNA 2PHYA 4NXGA 4BBTA 4GHIA
chains in the Genus database with same CATH superfamily
1N9OA 2WKHA 2XRNA 3OPPA 3LR3A 3FKVA 4WZ5C 1L0EA 2XGNA 3G35A 1K57A 2H5SA 3NDEA 3PBSA 2XD5A 1LL9A 4JXWA 3D72A 4BJPA 4CLCD 3MQQA 3UMEA 3SW1A 1ES2A 1OJ5A 3CHWP 3S7NA 1WA9A 5GLAA 2AVXA 1IKGA 4EQ1A 5HD3A 3QNBA 5HDDA 5TBMB 3MKEA 5HD5A 1QMFA 4LV0A 1ACFA 2EXAA 4R70A 4DE3A 3LUQA 3ZG7B 2ZOHA 4P6ZS 3KYQA 3D4FA 2IWBA 1CK3A 3LYXA 4Z9QA 3M6HA 2P9VA 4BL3A 2I9VA 3B33A 4HJ4A 1FCOA 4NXFA 4X69A 1VQQA 4EQIA 4JGRA 4MBHA 2H0TA 2Y2NA 3MXSA 1H8MA 2WADA 4WEKA 1MKMA 4MNRA 4Y2FA 4S2PA 3IX3A 1MWSA 1RCJA 4HOIA 5FASA 1PIOA 1PNEA 1ES3A 2EFUA 2WUQA 1F9IA 2ZJ9A 5DTKA 3KSHA 3VP3A 5TR7A 5I5LA 3VSKA 2M7UA 3U4LP 1S4SA 2IWDA 5FDSA 2VEAA 4OQ0A 2VX8A 5C5KA 1L2SA 4ETZA 2QWSA 3HVFA 3FKWA 1NJ4A 1T1AA 5LBRA 2Q0OA 1IYPA 3T12B 3MXQA 5CEDA 4RA7A 4DMZA 3LR5A 5GHYA 2Y2GA 3DTEA 3G31A 3HBRA 3LY4A 2O9BA 3QNCA 3ZG5A 4RX2A 1IKIA 1LT0A 5CTNA 3EWKA 1XPBA 2E8JA 1XXMA 4R0QA 2MJ6A 1T1CA 4M3KA 3HL9A 3C4OA 5DJUA 2XD1A 3P7NA 2ZLYA 4JKTA 5HSQA 4WYYA 5F6AA 2OLVA 3B3XA 3KYZA 1FSWA 4E3IA 1GCEA 4NXEA 1E3UA 3H7WB 2ZQ9A 3SH9A 4ZAMA 1MWUA 3K2NA 1HVBA 5TGFA 1DJCA 3QHYA 3VV4A 2XK1A 1ES4A 3HJIA 4S2NA 2KLIA 2VV6A 2XFTA 3UB7A 3C7VA 4KQDA 1XA7A 3A3JA 2VLGA 2J9OA 4OQHA 4IEDA 4ZRRA 2EWVA 4PM5A 3F1NB 1MWTA 3C30A 3PBRA 4N1HA 4BENA 2WGWA 5HAIA 4CLCA 1N9BA 4Y0TA 1SKFA 4C6YA 3NBLA 4OLGA 4O01A 2VK3A 4JXSA 2QJ5A 3T1SA 2LB9A 1SDEA 3IF6B 1K55A 4B4XA 2W3GA 4DE0A 2V2FF 3LY3A 3LR4A 1GSVA 3WRTA 1K54A 1STZA 1UGUA 3P98A 3C8CA 1K0KA 3GRJA 1N9NA 4O7DA 3OPRA 5G4ZA 3UE1A 3PAGA 3CITA 5EPHA 1IOUA 2W3EA 4EU0A 3HCYA 3T4TA 2PYRA 3JVVA 2PDRA 2D01A 3L9KA 2OWJA 4MLLA 3T4SA 3NJAA 4XUZA 4PM7A 5L2FA 4NK3A 1BSGA 2JKTI 2WKEA 3IX4A 5HPFA 1KVMA 4I3AA 3ITAA 1S0WA 4R3BA 2FZ0A 3OLOA 5L09A 4GDNA 1HZOA 2ZC6B 3KSFA 1GA9A 3Q82A 5CEBA 1D06A 4OQIA 1SZVA 3OOVA 3ZGAB 1NXYA 5F5YA 3IXGA 4PHTA 5DFXA 5HAPA 2FFFB 3T1QB 2JHEA 3O3VA 5HAQA 3W4PA 1G28A 3FWLA 5HX9A 2ZMAA 1HLUP 2OV5A 1YMSA 4KZ4A 4CQHA 2HJEA 3PBTA 1ALQA 2IWCA 2VV7A 4NXGA 4GHIA 4DE1A 4EV4A 4YINA 1F2KA 1D1JA 3T1XA 1H0MA 1Z09A 5J8XA 2YKHA 1MBLA 2XLNA 5KIZA 1JWVA 5HARA 4D60A 3IQAA 1DRMA 3LFVA 4IUHA 5E2EA 4E3MA 3LR0A 2WKQA 3L7HA 2PD8A 2XQZA 3OCNA 3Q7VB 1PW8A 4N92A 3UDFA 2Y2HA 3C7UA 3UB9A 1NYMA 2XH9A 5HL1A 3BWLA 4DKIA 1WYCA 1NYYA 4JGPA 4C3QA 4DXCA 1EI5A 1D7EA 2X71A 2ZL1B 3G4PA 2ZQAA 1G6AA 4FTXA 2V1AA 3IBRA 3N8LA 2HDUA 2W3HA 4YOFA 3PTEA 5KSHA 4OOYA 2V1ZA 4EERA 4EESA 3MSHA 3IWQA 1NWZA 3UPNA 2JBFA 4QU3A 3LEQA 2WAEA 3S7OA 4LLOB 2PAVP 5I94A 4RX3A 1RP5A 4ZJ2A 2J8YA 1BLPA 2Y2MA 3NCKA 5A8BA 1BLSA 2K2NA 4X56A 1SDNA 3WRZA 2D02A 3VE4A 2XR0A 4GHIB 4I3JA 3EEAA 1I2WA 4BLMA 2LB5A 1X0OA 3E98A 3KX0X 3MKFA 2V0UA 3IS2A 3UY6A 3EGDC 4ZBEA 1WYBA 5EUAA 2HDRA 3U2AA 3BLMA 3MQ0A 2O9AA 4HY8A 4WM9A 2WGWB 2XF3A 3F1PB 3KYEA 3VP2A 3S7PA 5AVEA 3OC2A 2KX6A 3QP8A 3IXBA 1TF1A 2GX5A 3CZDA 4BBUA 5EECA 4EXOA 4GOGA 4L9FA 5HWTA 4YFMA 2OAQ1 4KUOA 5CECA 4K08A 2B18A 5AJGA 1F98A 2G7UA 2Q9NA 5HFOA 1KE0A 4QPRA 3UNWA 2ZM0A 1BYWA 2HF6A 3E0YA 2QYBA 2B95A 4IBXA 2WZZA 4KG2A 4WL9A 1KOUA 4QY6A 4OH0A 1XGJA 4NG2A 5HPIA 3RXXA 2M7VA 3S7QA 5E43A 4EWFA 4YNRA 4UQIM 2Y2JA 4PM9A 3ISGA 3OZHA 1XJ4A 2VGKA 1P97A 3V67A 4FH2A 3UB8A 4FOFA 1K6RA 1KDWA 2ZC5B 5JYOA 1OT6A 4Y15A 1T1BA 3ICYA 3UDIA 3E2LA 1C3BA 4HP9A 4H6JA 5CRFA 1XP4A 3UE0A 3BJNA 3CUEA 3A0SA 4DRTA 1S6RA 1SHVA 2ACGA 1OT9A 3OBFA 5EOOA 3V5MA 2J9PA 4FD8A 1PZOA 4EUZA 3IXHA 3ULFA 1FQGA 3JPUA 3V3RA 1YAXA 3E4PA 3A0RA 2H28A 5GHXA 2Z2LB 2B5RA 1H8ZA 2OWHA 4LENA 3OPHA 4KZAA 4DDYA 3LIFA 4HHDA 4ZJ1A 3BQ8A 4KENB 1FCNA 5CHUA 3T4KA 1VETA 1FOFA 2EA9A 2J80A 4EEUA 1ESUA 2EFXA 2DCFA 1KE3A 5MC7A 2HGVA 2W0NA 3NULA 3LCEA 3NHQA 3R7WA 2J7VA 5HDSA 4MN5A 1XJ6A 4Q0JA 5EVIC 3BLSA 2R78A 5AQ7A 3IX8A 3W4OA 2PR6A 2W27A 4B88A 3OPLA 3FPWA 3H82B 1K4EA 3C38A 3LIAA 4E6WA 3C2WA 5FQJA 3WS4A 5GHZA 5FEFA 1L0DA 3UPOA 1G5UA 2Y2OA 4H6JB 4GN2A 2OOLA 1S66L 1IEMA 5E2GA 5F83A 3SS3A 1DP8A 5L07A 4AFIA 3IXDA 1P9WA 2IA2A 5HDCA 4F94A 1TEMA 4UEYA 2VJWA 1JTGA 4RQ9A 4G3WA 3NY4A 3TRCA 1LI9A 2PD7A 3G6OA 5J4EA 1YSQA 2ZM8A 1CEFA 4WBGA 3T1RA 4GD8A 4OONA 3ZG0A 1MY8A 2G2UA 3E4OA 5F69A 5FAQA 2Y2QA 4OP8A 5KSCA 1ZKJA 1W5DA 4FCFA 3DAVA 3W4QA 1VEUB 2K31A 3ZG8B 3BM6A 4GW9A 1H5XA 2JKRM 1ESIA 4WZ5A 2CMNA 1TS7A 4U0TA 1K55C 1XKZA 4E3NA 3IH8A 1LSVA 1A0KA 3D9YA 4JXGA 2B02A 3IWOA 2W1TB 1NZOA 1W8QA 1LHYA 2WKPA 3MFXA 4G3KA 4P87A 4WN5A 2P08A 3A3EA 1XJ2A 3NC8A 1CI9A 2PRFA 5DF8A 1YMXA 3CLOA 2DMWA 4UQIS 4H8RA 4X55A 1BTLA 5CXWA 5L10A 4LGWA 2C5WB 1NZUA 2M1CA 1JWPA 1MWRA 1PWGA 5J7EA 1T19A 3H9WA 3O87A 3DTMA 1P9RA 2C6WB 2P9VB 1MZUA 4X53A 3TSGA 5CGXA 4Y17A 2WGIA 1BZAA 3GSGA 2HPBA 5FEGA 3F1PA 4NKPA 4OOLA 5FQKA 1YLPA 1Y54A 2KOIA 2EX2A 3LIEA 2Y2KA 3MZFA 2P7JA 2A3UA 3Q1FA 4KQQA 3BFGA 1KGFA 1IYOA 2V0WA 4BL2A 2P74A 2HZ5A 4OPQA 1IFQA 1LL8A 5D3OA 2GDNA 2WZXA 2Z6CA 4ME4A 5EVLA 3SH7A 1ONHA 1VEUA 4I39A 2GJ3A 2PU4A 1Q2QA 2Y2PA 4EEPA 3FYZA 4NXBA 4DN0A 3G2YA 3A3IA 3IHAA 1PW1A 2Q9MA 1G68A 2HP9A 3G34A 4UA6A 2JE5A 4S2IA 4Q8IA 1XX2A 1DP6A 4R6LA 5AQBA 1JWZA 1KGEA 3GMWA 4X25A 3DWKA 2X01A 4WEJA 1O07A 4Y7PA 4HQAA 5JYPA 1TS6A 5FI6A 3G30A 2Y79A 5FQIA 3UE6A 2ZL1A 3ZVWA 1RGYA 5CGWA 4S2JA 4C75A 5CX7A 3WS2A 4DXBA 3ZHHA 2Y59A 5A92A 1KVLA 2XDMA 4N1XA 5L8MA 4X1MA 2Y2LA 1WE4A 2PT7A 3BEBA 1YLJA 4LFUA 4KZBA 1E25A 5KZHA 1E4DA 1MPLA 1XA1A 3FG8A 4QHCA 3MQOA 1LI0A 1ES5A 1TS0A 1I5QA 3UN7A 3MXRA 4ETXA 4GLQA 3SOIA 4JGQA 2VGLS 4IHQA 4UA9A 4JF5A 1G6OA 2JKFA 5FATA 4JF6A 1VETB 2WGVA 4LCLA 3VOZA 1QMEA 2VA0A 2J3WA 4CJNA 1S1YA 3G2ZA 5A90A 3JVUA 1K38A 1Q2PA 5FQQA 3K3CA 4DE2A 3UO9A 2BASA 2L0WA 1NY0A 2FFYA 4RYEA 2EX8A 3VP0A 2DNSA 3O5YA 3UB6A 2V20A 2J3TD 3ZYTA 1HTZA 5FI2A 3LIDA 2H10A 4EBLA 1BLHA 4KQOA 2YKFA 1BULA 3PHYA 2CC1A 4GS9B 1YT4A 1LLBA 3BFFA 3FV7A 3NOUC 4K91A 3MF0A 5GLCA 2W3FA 3T4QA 4Y3IA 1HD8A 4O8GA 4IJGA 2VV8A 1ERQA 1F5MA 5EFWA 4E3OA 1GHIA 3ZNYA 2HDSA 3S4XA 3HLEA 3ZCZA 3MZEA 2FH5A 4HJ3A 2WKRA 3VMAA 2JN7A 3P01A 2EWWA 4N9KA 3LICA 5IT5A 3RTYA 4HBTA 1FIKA 1GHMA 3RJUA 3ZG9B 1OTEA 4X68A 5E2FA 4EETB 1JVJA 1IYSA 3VFFA 4S2LA 4BWIA 4MCWA 5F1GA 4WMCA 3IF6A 4KZ6A 3AGFA 2EX9A 1ODVA 1XFQA 4HP4A 4LRZE 4LPZA 1RGZA 4CPKA 1W63Q 4QY5A 4DDSA 3H7WA 2BG1A 5FQMA 3TE8A 4KG5A 2ZOIA 4EW7A 2ZBBA 5EVIA 5FSRA 3F1OA 2QKPA 4XT2B 2VGJA 2NUTC 1K6SA 3JYIA 2A24A 3QP4A 4MBFA 3V39A 2Y91A 1O7EA 2GNXA 1TD5A 1DY6A 3H82A 3F1OB 2L4RA 1EW0A 3HUOA 3TG9A 4PM8A 2HP6A 4E04A 3Q81A 3EEHA 1YQSA 2GZAA 3IS2B 1PYYA 2I72A 4NETA 5CERA 1NRJA 3CWFA 2K7SA 4OKPA 2ZQCA 4F3LA 1ZG6A 5FAPA 3DBAA 4G3VA 3DTKA 4JLFA 1Y4OA 2QJ7A 2PBDP 5FI7A 3A3DA 3NDGA 2XEPA 2PHYA 3LGOA 3CI6A 3T4JA 4F3LB 1K56D 1IYQA 3N8RA 5DF9A 1ZC2A 3ZNTA 1ZG4A 3FPVA 1Y28A 5AQAA 5DTTA 5DFYA 5EVEA 3AGDA 3IHBA 4IVKA 1EWZA 5EV0A 3PXPA 4QB8A 3RFBA 1YLZA 1MKIA 3LI8A 5K5BA 2Y55A 5EVID 1YPRA 1YLWA 2ZMVA 1TDGA 5IU1A 3DTIA 1UWNX 5A91A 3VP4A 4U3TA 3HUMA 4KQRA 1OPXA 3M6BA 4FUWA 2WKIA 1OJGA 5IHVA 3FC7A 4BQMA 3SS4A 1L3LA 3NIAA 2PBYA 2RL3A 3IH9A 2OLUA 3IF6C 3CPTB 5EOEA 3BECA 5KMWA 4K0XA 1VHMA 2UV0E 4B4ZA 5G18A 4CLCE 1BLCA 3ZVTA 4HESA 4BD1A 4PM6A 4K0WA 5HWWA 4S2OA 3PBQA 3GV9A 4ARZA 3HREA 2ZQDA 5FL3A 4L9GA 4Y5FA 1FR1A 3MR0A 4ESPA 3VP1A 5EM0A 2XA7M 5AQ9A 5U47A 3GVBA 3R4KA 4S2KA 3BYDA 4GJ4A 4II7A 1CJFA 4L0LA 3NECA 4WMCD 3OCLA 3DW0A 5EVIB 1TDLA 3S1YA 3HLDA 4S2MA 3CUEC 3O86A 4X1LA 4R3AA 3RH8B 2HJ9C 2ZD8A 4I3IA 4HIAA 1VM1A 3R7WB 1FSYA 4E3LA 1U60A 3LO7A 2L1MA 2XROA 1PWDA 4P6BA 3WWXA 5M1AA 1W79A 5DKLA 3ITBA 3ZQ5A 1YLYA 1KE4A 2XFSA 2ZQ8A 4LCMA 3PBNA 3IT9A 3BW6A 3QP2A 3N7WA 2DRWA 4HEFA 1H3QA 4BBVA 5GL9A 3UE3A 3EQVA 2A2LA 5AVFA 2A49A 1K56A 2V9AA 4UHUA 3QP6A 1PI5A 4WUJA 5GLDA 4EUVA 2Z2MB 1Z6FA 4O0PA 4BBTA 4I5SA 4OP5A 1IELA 4HI4A 3V50A 1CQAA 5HL6A 4N9LA 4R4RA 4JF4A 4E3KA 3EQUA 2WK0A 4KZ8A 4Q0HA 3I7JA 4YWZA 3B47A 3WS5A 1S67L 4GD6A 1J3WA 1N9LA 4DJ3A 5F1FA 2HP5A 2V8FA 1GA0A 1FCMA 2VKSA 4E6XA 1I2SA 5EM1A 4UAAA 3K3DA 3MFDA 3HLGA 5F68A 2XSSA 4IUKA 4KZ5A 2P04A 2X02A 4MN7A 1W63M 4BD0A 2VZWA 3NOPC 4R23A 5GLBA 3O88A 2WYXA 3GECA 2BTFP 2ZC7A 5CTMA 1NLYA 3VFHA 4KG6A 3E2KA 1S4RA 5HW3A 3WS0A 4JPMA 4M4XA 2QMIA 3IBJA 4HBUA 4LV3A 4OPYA 2PR5A 1XJ3A 3TOIA 2ZMFA 1W8YA 2ZM2A 1UWPX 3D3OA 1YM1A 2BLSA 1PI4A 3RXWA 1JTDA 3A0VA 3LEZA 4LV2A 4EBPA 3W8KA 4D2OA 4DJ2A 1K54C 3PAEA 4UA7A 1V9YA 4KZ9A 1DJBA 2NUPC 3C5AA 4P85A 5TFQA 1LL5A 3T4OA 1CI8A 5HWVA 3TW8A 3GR2A 4GS9A 3TJZC 3PYPA 1NRFA 2RCXA 2UWXA 1AWIA 2QZ6A 4QJGA 3BQAA 4PAUA 5M19A 1OMEA 3UPPA 4LRXC 4MN6A 3CG5A 4OQGA 1K25A 3BRMA 5M18A 2EX6A 3HLBA 3KSGA 2QPNA 1ZTUA 1TS8A 2JKGA 1KDSA 3W2ZA 3BFDA 2OSUA 4P0MA 1CF0A 3HJKA 1E3UD 3MS6A 4IBRA 3Q7ZA 4OLDA 4MEZA 2JCHA 1YSPA 2O9CA 3ZDJA 4FH4A 1EROA 4U0XA 3G32A 3QP1A 4GNUA 4RVAA 3F1NA 2H0YA 1ERMA 4FSFA 1TVFA 2Y4AA 3BFCA 5F82A 5FA7A 3SZTA 1L0FA 1XGIA 5DKKA 5TBMA 3GDIA 1AXBA 3C4PA 2V8CA 3HLCA 4R3JA 3N8SA 5IS1A 3CPTA 1K57C 3Q7VA 3A3FA 4R38A 2KDKA 3LIBA 3VOLA 2PU2A 1K4FA 1VB6A 4JXVA 2ZC4B 3HLWA 5FQ9A 3SH8A 1GSXA 2E8IA 3WS1A 1J9MA 5HZHA 1DJAA 1BUEA 1JNUA 3VE3A 2XA7S 1OTIA 4JGOA 4HH3A 4JBFA 3KSIA 3NOTC 3VSLA 2Y8HA 3M2JA 4HH2A 2JC7A 4MBKA 2W1RA 4Q0IA 3E4QA 1LSWA 3BY9A 2W1TA 2JKRI 2O0YA 1SKOB 1V9ZA 4B93A 1M40A 4BMWA 5BOHA 5CHMA 4KZ7A 4PKYG 3KO6A 3EOIA 2VGLM 1SKOA 4Y13A 1N4OA 3Q07A 4PMAA 4GCZA 4NEED 3DWZA 2R9XA 3S22A 4ARZB 3MZDA 4LV1A 1KGGA 5CHJA 4E3JA 3VOYA 5CGSA 4EBNA 4MDZA 3HLFA 1LSXA 4P6ZM 3MJQA 2OAP1 4PPRA 1BT5A 4R1GA 4GZBA 4WF0A 1ONGA 1YKDA 3AGEA 1MC0A 4GKUA 1OTAA 4B9OA 3HUNA 1GHPA 4S2NC 4QD4A 3IF5A 1OTDA 2ZQ7A 3N4IA 3T4LA 4WLAA 2G2WA 1SCWA 3PBOA 4HNBA 2ZC3B 1CEGA 2Z6DA 4IVIA 5E2HA 3CMZA 3CJMA 4L9EA 2W3DA 1PZPA 4OPZA 4OPRA 3ZFZA 1PRQA 2INWA 4GDBA 3PR6A 4CLCB 1GSWA 1H8YA 3BY8A 3MMHA 1XFNA 1PWCA 5FDHA 2EXBA 4XXRA 5TJJA 4Y0UA 4WELA 5DJTA 5A93A 1YLTA 3M2KA 5DTSA 4ZJ3A 4Z1WA 2V1BA 4XT2A 3IWIA 1ZHHB 1T18A 1W7FA 1L0GA 4GB7A 5G4YA 1PFLA 4XUXA 4X6TA 1FILA 4A5RA 2J3TC 4ID4A 3FZCA 3GQZA 3P09A 4DF6A 3NI9A 5EE8A 4I38A 3LI9A 2PYPA 3MBZA 4LRYC 4OVDA 4Y0OA 5FAOA 3N6IA 5DVAA 3B42A 1OTBA 3EGXC 1FR6A 1S1ZA 1MXOA 2HV1A 2O99A 4OOMA 3SS5A 3UB5P 3BFEA 3GTCA 4R4SA 2Y2IA 4QWOA 4CLCC 2JKTM 3V3SA 4KZ3A 4PKYA 2R9WA 1P0ZA 1DP9A 4ZTKA 2A24B 3CAXA 4KUKA 1M6KA 5DF7A 3UDXA 4MMNA 3QP5A 2HDQA 2WAFA 4ZDXA 4HJ6A 3T50A 1NLZA 4WZ4A 5J3WA 3UMDA 2QHKA
chains in the Genus database with same CATH topology
3EEAA 1N9OA 2PT7A 2VKSA 2LB5A 1X0OA 3E98A 2XRNA 3KX0X 2V0UA 3IS2A 3LR3A 3EGDC 3K3DA 3U2AA 3MQ0A 2O9AA 4HY8A 5F68A 2XSSA 3FG8A 3PBSA 4IUKA 3F1PB 3D72A 3MQOA 4BJPA 4CLCD 3S7PA 5AVEA 3OC2A 2KX6A 3MQQA 3UMEA 1TS0A 2P04A 1TF1A 2GX5A 3SW1A 4BBUA 1OJ5A 4ETXA 4EXOA 4MN7A 1W63M 4GLQA 4L9FA 5HWTA 2VZWA 3NOPC 3S7NA 2OAQ1 4KUOA 1WA9A 4JGQA 2VGLS 3GECA 4K08A 2B18A 4IHQA 4EQ1A 1G6OA 5AJGA 5HD3A 5HDDA 1F98A 1NLYA 2G7UA 5TBMB 4QPRA 5HD5A 2VA0A 1BYWA 1S4RA 2J3WA 4R70A 2HF6A 3E0YA 1S1YA 2QYBA 3LUQA 4M4XA 3JVUA 3IBJA 4WL9A 2ZOHA 3K3CA 1KOUA 4P6ZS 2PR5A 1XJ3A 2BASA 2L0WA 2ZMFA 3KYQA 1UWPX 3D3OA 3O5YA 3UB6A 5HPIA 3S7QA 2M7VA 2J3TD 3ZYTA 3A0VA 3LIDA 3LYXA 4YNRA 4UQIM 4KQOA 2YKFA 1XJ4A 1P97A 3PHYA 3V67A 3UB8A 2I9VA 4FOFA 3B33A 4GS9B 4DJ2A 4HJ4A 4NXFA 3NOUC 1V9YA 3MF0A 1OT6A 2W3FA 3T4QA 4Y3IA 2NUPC 1T1BA 3ICYA 3T4OA 5HWVA 3TW8A 4JGRA 4O8GA 4IJGA 2VV8A 1H8MA 4GS9A 4WEKA 3TJZC 4HP9A 3PYPA 4H6JA 1F5MA 1MKMA 5EFWA 4Y2FA 3BJNA 3CUEA 3A0SA 3BQAA 2FH5A 4HJ3A 4PAUA 2WKRA 4HOIA 2JN7A 2EWWA 3P01A 4LRXC 4MN6A 1OT9A 3LICA 1F9IA 3OBFA 3KSHA 5I5LA 5IT5A 3RTYA 2M7UA 1OTEA 4EETB 1S4SA 3KSGA 2VEAA 1ZTUA 2VX8A 1TS8A 4BWIA 5C5KA 3ULFA 4MCWA 4ETZA 2QWSA 3W2ZA 1T1AA 5LBRA 1ODVA 1XFQA 1YAXA 3E4PA 3A0RA 3HJKA 4HP4A 2H28A 4LRZE 3MXQA 4LPZA 4DMZA 1W63Q 3LR5A 1YSPA 2OWHA 2O9CA 3H7WA 2O9BA 3TE8A 1LT0A 3EWKA 2ZOIA 4EW7A 2ZBBA 3F1OA 2QKPA 2MJ6A 3LIFA 1T1CA 3F1NA 4XT2B 4HHDA 4FSFA 3BQ8A 5DJUA 3P7NA 2NUTC 5HSQA 5F6AA 5DKKA 3T4KA 5TBMA 2EA9A 2J80A 4EEUA 3GDIA 2A24A 3KYZA 5MC7A 2HGVA 2W0NA 3NHQA 3R7WA 4NXEA 5HDSA 3H7WB 4MN5A 1XJ6A 4Q0JA 2GNXA 5IS1A 1TD5A 3H82A 3K2NA 2R78A 3F1OB 4R38A 2KDKA 2L4RA 3LIBA 3VOLA 3VV4A 1EW0A 1VB6A 2PR6A 2W27A 3FPWA 3HJIA 4E04A 3H82B 3LIAA 3C38A 3EEHA 2GZAA 3C2WA 3IS2B 2KLIA 2VV6A 1GSXA 3UB7A 4KQDA 5HZHA 4H6JB 1JNUA 2OOLA 2XA7S 1OTIA 1S66L 4JGOA 1NRJA 3CWFA 3VE3A 2K7SA 4HH3A 2VLGA 3KSIA 3NOTC 4ZRRA 2EWVA 1DP8A 4F3LA 3DBAA 2Y8HA 4G3VA 4HH2A 4AFIA 3F1NB 2W1RA 4Q0IA 3E4QA 1P9WA 1LSWA 2QJ7A 2IA2A 3C30A 3PBRA 3BY9A 2W1TA 5HDCA 4CLCA 2O0YA 2PHYA 2JKRI 2VJWA 4UEYA 3CI6A 1V9ZA 3T4JA 4F3LB 4B93A 4RQ9A 4G3WA 4O01A 2QJ5A 4BMWA 3TRCA 4PKYG 5DF9A 3KO6A 3FPVA 2PD7A 2LB9A 1Y28A 3EOIA 2VGLM 3G6OA 5J4EA 5DFYA 1YSQA 2W3GA 3LR4A 4GCZA 1GSVA 4NEED 1STZA 1UGUA 3C8CA 1N9NA 3PXPA 5G4ZA 3E4OA 3RFBA 4ARZB 5F69A 3CITA 3LI8A 5K5BA 1IOUA 2K31A 4MDZA 2W3EA 4EU0A 2ZMVA 3HCYA 1LSXA 4GW9A 3T4TA 2JKRM 2PYRA 3JVVA 2PDRA 2D01A 2CMNA 1TS7A 5IU1A 1UWNX 2OWJA 4P6ZM 3T4SA 3MJQA 3NJAA 2OAP1 1OPXA 2JKTI 1OJGA 1LSVA 5HPFA 4WF0A 3FC7A 2B02A 4I3AA 2W1TB 1YKDA 2WKPA 3MFXA 4G3KA 4WN5A 2P08A 1XJ2A 1MC0A 1OTAA 2FZ0A 4B9OA 1OTDA 3OLOA 3T4LA 3CLOA 4UQIS 2DMWA 3KSFA 4WLAA 1VHMA 1D06A 3PBOA 3OOVA 4HNBA 4CLCE 2Z6DA 5F5YA 4PHTA 5DFXA 5HWWA 2M1CA 4L9EA 3PBQA 2W3DA 2JHEA 4ARZA 5J7EA 1T19A 3H9WA 1G28A 2INWA 5FL3A 3PR6A 1P9RA 4CLCB 1GSWA 4L9GA 4CQHA 4Y5FA 3MR0A 2HJEA 3BY8A 1MZUA 3PBTA 3MMHA 2VV7A 1XFNA 4NXGA 2XA7M 4GHIA 5TJJA 3R4KA 4WELA 5DJTA 2YKHA 4GJ4A 4II7A 3F1PA 4NKPA 4L0LA 4OOLA 5KIZA 3OCLA 4Z1WA 2KOIA 3LIEA 3CUEC 2V1BA 2P7JA 1DRMA 3LFVA 4IUHA 4R3AA 4XT2A 3RH8B 2HJ9C 4I3IA 4HIAA 1ZHHB 3R7WB 3LR0A 1T18A 2WKQA 5G4YA 2V0WA 2PD8A 3OCNA 3UB9A 1IFQA 2L1MA 1LL8A 2J3TC 3BWLA 2XROA 2Z6CA 4ME4A 4I39A 2GJ3A 4I38A 3LI9A 2PYPA 4LRYC 4JGPA 4EEPA 1D7EA 4NXBA 5DKLA 4DN0A 3ZQ5A 3PBNA 3B42A 1OTBA 3EGXC 2V1AA 3IBRA 2W3HA 4YOFA 3BW6A 5KSHA 1S1ZA 1H3QA 2HV1A 2O99A 4OOMA 4BBVA 3UE3A 4EERA 1DP6A 3EQVA 2A2LA 4R6LA 5AVFA 4EESA 1NWZA 2V9AA 4WEJA 4CLCC 2JKTM 4HQAA 4WUJA 1TS6A 4EUVA 4O0PA 4BBTA 4PKYA 4I5SA 4HI4A 3S7OA 1P0ZA 1DP9A 4LLOB 2Y79A 2A24B 5HL6A 3UE6A 3CAXA 4KUKA 3EQUA 5CX7A 4MMNA 4Q0HA 5A8BA 4HJ6A 4YWZA 3T50A 1NLZA 2K2NA 3B47A 5J3WA 2D02A 1S67L 3VE4A 1N9LA 4DJ3A 4GHIB 3UMDA 2QHKA 4I3JA 5L8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9Z A;  1N9O A;  1OTE A;  4EET B;  4F3L B;  5HD5 A;  1X0O A;  1S4S A;  4RQ9 A;  2VEA A;  3KX0 X;  2V0U A;  1TS8 A;  3IS2 A;  3ULF A;  2QJ5 A;  3K3D A;  5DJT A;  2QWS A;  2YKH A;  3F1P A;  1T1A A;  4PKY G;  4HY8 A;  2PD7 A;  1Y28 A;  5KIZ A;  5F68 A;  3G6O A;  3FG8 A;  5HSQ A;  1ODV A;  1XFQ A;  3E4P A;  3F1P B;  5J4E A;  3D72 A;  3A0R A;  3MQO A;  3HJK A;  4HP4 A;  2H28 A;  4LRZ E;  3MXQ A;  3LIE A;  4LPZ A;  2V1B A;  2P7J A;  1DRM A;  4GCZ A;  4R3A A;  4XT2 A;  1GSV A;  2KX6 A;  3MQQ A;  5AVE A;  3RH8 B;  1TS0 A;  3UME A;  1UGU A;  4I3I A;  2OWH A;  4HIA A;  3C8C A;  3SW1 A;  4BBU A;  1OJ5 A;  4WN5 A;  4EXO A;  1T18 A;  1N9N A;  3H7W A;  4L9F A;  5HWT A;  2WKQ A;  3NOP C;  5G4Z A;  5G4Y A;  4KUO A;  3E4O A;  1WA9 A;  2V0W A;  1LT0 A;  5F69 A;  4JGQ A;  3EWK A;  2PD8 A;  2ZOI A;  4EW7 A;  3LI8 A;  2ZBB A;  3GEC A;  3F1O A;  2QKP A;  3UB9 A;  3LIF A;  4K08 A;  1T1C A;  3F1N A;  4EQ1 A;  4XT2 B;  2L1M A;  4HHD A;  1LL8 A;  5HDD A;  5HD3 A;  3BWL A;  1F98 A;  2Z6C A;  1LSX A;  4GW9 A;  5DJU A;  5TBM B;  2PYR A;  3P7N A;  2PDR A;  2D01 A;  2CMN A;  2GJ3 A;  1TS7 A;  4I38 A;  1UWN X;  3LI9 A;  4I39 A;  1BYW A;  1S4R A;  2OWJ A;  2PYP A;  4LRY C;  3MJQ A;  3NJA A;  4JGP A;  4R70 A;  5DKK A;  5F6A A;  4EEP A;  1D7E A;  1S1Y A;  4NXB A;  5TBM A;  2J80 A;  2EA9 A;  5DKL A;  3GDI A;  2A24 A;  4EEU A;  3LUQ A;  4M4X A;  4WL9 A;  3ZQ5 A;  1OTB A;  2ZOH A;  2V1A A;  1KOU A;  3K3C A;  3IBR A;  2W0N A;  2PR5 A;  1XJ3 A;  1OJG A;  1LSV A;  2BAS A;  2L0W A;  3NHQ A;  4WF0 A;  3FC7 A;  2B02 A;  4NXE A;  5HDS A;  1UWP X;  3H7W B;  4MN5 A;  1XJ6 A;  4I3A A;  5IS1 A;  3UB6 A;  3H82 A;  1S1Z A;  2WKP A;  2HV1 A;  3MFX A;  4BBV A;  3A0V A;  4EER A;  2R78 A;  3LID A;  3F1O B;  3LYX A;  1DP6 A;  4R38 A;  1XJ2 A;  2KDK A;  2L4R A;  1OTA A;  3LIB A;  4R6L A;  5AVF A;  4B9O A;  4EES A;  3VOL A;  1NWZ A;  2YKF A;  1EW0 A;  1VB6 A;  2PR6 A;  1XJ4 A;  2V9A A;  1OTD A;  1P97 A;  3PHY A;  2W27 A;  3UB8 A;  2I9V A;  4GS9 B;  3B33 A;  3OLO A;  4DJ2 A;  4HQA A;  4HJ4 A;  3CLO A;  4WUJ A;  3HJI A;  4E04 A;  1TS6 A;  3H82 B;  3LIA A;  3NOU C;  3EEH A;  1V9Y A;  4NXF A;  4PKY A;  4I5S A;  4WLA A;  4HI4 A;  1OT6 A;  3UMD A;  3C2W A;  3IS2 B;  1P0Z A;  1DP9 A;  1D06 A;  2VV6 A;  4LLO B;  2A24 B;  1GSX A;  3UE6 A;  1T1B A;  3CAX A;  3ICY A;  4HNB A;  3UB7 A;  4KQD A;  5HZH A;  4H6J B;  5HWV A;  2Z6D A;  4JGR A;  5F5Y A;  4KUK A;  1JNU A;  2OOL A;  3VE3 A;  1OTI A;  1S66 L;  4JGO A;  3CWF A;  2VV8 A;  5IU1 A;  2K7S A;  4GS9 A;  5HWW A;  4HH3 A;  2VLG A;  2M1C A;  3PYP A;  4HP9 A;  4H6J A;  4L9E A;  5EFW A;  3NOT C;  2JHE A;  1DP8 A;  5J7E A;  1T19 A;  4F3L A;  5A8B A;  3H9W A;  4HJ6 A;  4YWZ A;  3A0S A;  3T50 A;  1G28 A;  2INW A;  4HJ3 A;  2D02 A;  2WKR A;  4HH2 A;  1S67 L;  4HOI A;  5J3W A;  3VE4 A;  2JN7 A;  1N9L A;  3F1N B;  4LRX C;  4MN6 A;  4DJ3 A;  3E4Q A;  1OT9 A;  1GSW A;  4GHI B;  1LSW A;  2QJ7 A;  4L9G A;  2QHK A;  1F9I A;  3BY9 A;  3LIC A;  3BY8 A;  1MZU A;  3MR0 A;  4I3J A;  5HDC A;  5I5L A;  2VV7 A;  3RTY A;  1XFN A;  2PHY A;  4NXG A;  4BBT A;  4GHI A; 
#chains in the Genus database with same CATH topology
 1N9O A;  2WKH A;  2XRN A;  3OPP A;  3LR3 A;  3FKV A;  4WZ5 C;  1L0E A;  2XGN A;  3G35 A;  1K57 A;  2H5S A;  3NDE A;  3PBS A;  2XD5 A;  1LL9 A;  4JXW A;  3D72 A;  4BJP A;  4CLC D;  3MQQ A;  3UME A;  3SW1 A;  1ES2 A;  1OJ5 A;  3CHW P;  3S7N A;  1WA9 A;  5GLA A;  2AVX A;  1IKG A;  4EQ1 A;  5HD3 A;  3QNB A;  5HDD A;  5TBM B;  3MKE A;  5HD5 A;  1QMF A;  4LV0 A;  1ACF A;  2EXA A;  4R70 A;  4DE3 A;  3LUQ A;  3ZG7 B;  2ZOH A;  4P6Z S;  3KYQ A;  3D4F A;  2IWB A;  1CK3 A;  3LYX A;  4Z9Q A;  3M6H A;  2P9V A;  4BL3 A;  2I9V A;  3B33 A;  4HJ4 A;  1FCO A;  4NXF A;  4X69 A;  1VQQ A;  4EQI A;  4JGR A;  4MBH A;  2H0T A;  2Y2N A;  3MXS A;  1H8M A;  2WAD A;  4WEK A;  1MKM A;  4MNR A;  4Y2F A;  4S2P A;  3IX3 A;  1MWS A;  1RCJ A;  4HOI A;  5FAS A;  1PIO A;  1PNE A;  1ES3 A;  2EFU A;  2WUQ A;  1F9I A;  2ZJ9 A;  5DTK A;  3KSH A;  3VP3 A;  5TR7 A;  5I5L A;  3VSK A;  2M7U A;  3U4L P;  1S4S A;  2IWD A;  5FDS A;  2VEA A;  4OQ0 A;  2VX8 A;  5C5K A;  1L2S A;  4ETZ A;  2QWS A;  3HVF A;  3FKW A;  1NJ4 A;  1T1A A;  5LBR A;  2Q0O A;  1IYP A;  3T12 B;  3MXQ A;  5CED A;  4RA7 A;  4DMZ A;  3LR5 A;  5GHY A;  2Y2G A;  3DTE A;  3G31 A;  3HBR A;  3LY4 A;  2O9B A;  3QNC A;  3ZG5 A;  4RX2 A;  1IKI A;  1LT0 A;  5CTN A;  3EWK A;  1XPB A;  2E8J A;  1XXM A;  4R0Q A;  2MJ6 A;  1T1C A;  4M3K A;  3HL9 A;  3C4O A;  5DJU A;  2XD1 A;  3P7N A;  2ZLY A;  4JKT A;  5HSQ A;  4WYY A;  5F6A A;  2OLV A;  3B3X A;  3KYZ A;  1FSW A;  4E3I A;  1GCE A;  4NXE A;  1E3U A;  3H7W B;  2ZQ9 A;  3SH9 A;  4ZAM A;  1MWU A;  3K2N A;  1HVB A;  5TGF A;  1DJC A;  3QHY A;  3VV4 A;  2XK1 A;  1ES4 A;  3HJI A;  4S2N A;  2KLI A;  2VV6 A;  2XFT A;  3UB7 A;  3C7V A;  4KQD A;  1XA7 A;  3A3J A;  2VLG A;  2J9O A;  4OQH A;  4IED A;  4ZRR A;  2EWV A;  4PM5 A;  3F1N B;  1MWT A;  3C30 A;  3PBR A;  4N1H A;  4BEN A;  2WGW A;  5HAI A;  4CLC A;  1N9B A;  4Y0T A;  1SKF A;  4C6Y A;  3NBL A;  4OLG A;  4O01 A;  2VK3 A;  4JXS A;  2QJ5 A;  3T1S A;  2LB9 A;  1SDE A;  3IF6 B;  1K55 A;  4B4X A;  2W3G A;  4DE0 A;  2V2F F;  3LY3 A;  3LR4 A;  1GSV A;  3WRT A;  1K54 A;  1STZ A;  1UGU A;  3P98 A;  3C8C A;  1K0K A;  3GRJ A;  1N9N A;  4O7D A;  3OPR A;  5G4Z A;  3UE1 A;  3PAG A;  3CIT A;  5EPH A;  1IOU A;  2W3E A;  4EU0 A;  3HCY A;  3T4T A;  2PYR A;  3JVV A;  2PDR A;  2D01 A;  3L9K A;  2OWJ A;  4MLL A;  3T4S A;  3NJA A;  4XUZ A;  4PM7 A;  5L2F A;  4NK3 A;  1BSG A;  2JKT I;  2WKE A;  3IX4 A;  5HPF A;  1KVM A;  4I3A A;  3ITA A;  1S0W A;  4R3B A;  2FZ0 A;  3OLO A;  5L09 A;  4GDN A;  1HZO A;  2ZC6 B;  3KSF A;  1GA9 A;  3Q82 A;  5CEB A;  1D06 A;  4OQI A;  1SZV A;  3OOV A;  3ZGA B;  1NXY A;  5F5Y A;  3IXG A;  4PHT A;  5DFX A;  5HAP A;  2FFF B;  3T1Q B;  2JHE A;  3O3V A;  5HAQ A;  3W4P A;  1G28 A;  3FWL A;  5HX9 A;  2ZMA A;  1HLU P;  2OV5 A;  1YMS A;  4KZ4 A;  4CQH A;  2HJE A;  3PBT A;  1ALQ A;  2IWC A;  2VV7 A;  4NXG A;  4GHI A;  4DE1 A;  4EV4 A;  4YIN A;  1F2K A;  1D1J A;  3T1X A;  1H0M A;  1Z09 A;  5J8X A;  2YKH A;  1MBL A;  2XLN A;  5KIZ A;  1JWV A;  5HAR A;  4D60 A;  3IQA A;  1DRM A;  3LFV A;  4IUH A;  5E2E A;  4E3M A;  3LR0 A;  2WKQ A;  3L7H A;  2PD8 A;  2XQZ A;  3OCN A;  3Q7V B;  1PW8 A;  4N92 A;  3UDF A;  2Y2H A;  3C7U A;  3UB9 A;  1NYM A;  2XH9 A;  5HL1 A;  3BWL A;  4DKI A;  1WYC A;  1NYY A;  4JGP A;  4C3Q A;  4DXC A;  1EI5 A;  1D7E A;  2X71 A;  2ZL1 B;  3G4P A;  2ZQA A;  1G6A A;  4FTX A;  2V1A A;  3IBR A;  3N8L A;  2HDU A;  2W3H A;  4YOF A;  3PTE A;  5KSH A;  4OOY A;  2V1Z A;  4EER A;  4EES A;  3MSH A;  3IWQ A;  1NWZ A;  3UPN A;  2JBF A;  4QU3 A;  3LEQ A;  2WAE A;  3S7O A;  4LLO B;  2PAV P;  5I94 A;  4RX3 A;  1RP5 A;  4ZJ2 A;  2J8Y A;  1BLP A;  2Y2M A;  3NCK A;  5A8B A;  1BLS A;  2K2N A;  4X56 A;  1SDN A;  3WRZ A;  2D02 A;  3VE4 A;  2XR0 A;  4GHI B;  4I3J A;  3EEA A;  1I2W A;  4BLM A;  2LB5 A;  1X0O A;  3E98 A;  3KX0 X;  3MKF A;  2V0U A;  3IS2 A;  3UY6 A;  3EGD C;  4ZBE A;  1WYB A;  5EUA A;  2HDR A;  3U2A A;  3BLM A;  3MQ0 A;  2O9A A;  4HY8 A;  4WM9 A;  2WGW B;  2XF3 A;  3F1P B;  3KYE A;  3VP2 A;  3S7P A;  5AVE A;  3OC2 A;  2KX6 A;  3QP8 A;  3IXB A;  1TF1 A;  2GX5 A;  3CZD A;  4BBU A;  5EEC A;  4EXO A;  4GOG A;  4L9F A;  5HWT A;  4YFM A;  2OAQ 1;  4KUO A;  5CEC A;  4K08 A;  2B18 A;  5AJG A;  1F98 A;  2G7U A;  2Q9N A;  5HFO A;  1KE0 A;  4QPR A;  3UNW A;  2ZM0 A;  1BYW A;  2HF6 A;  3E0Y A;  2QYB A;  2B95 A;  4IBX A;  2WZZ A;  4KG2 A;  4WL9 A;  1KOU A;  4QY6 A;  4OH0 A;  1XGJ A;  4NG2 A;  5HPI A;  3RXX A;  2M7V A;  3S7Q A;  5E43 A;  4EWF A;  4YNR A;  4UQI M;  2Y2J A;  4PM9 A;  3ISG A;  3OZH A;  1XJ4 A;  2VGK A;  1P97 A;  3V67 A;  4FH2 A;  3UB8 A;  4FOF A;  1K6R A;  1KDW A;  2ZC5 B;  5JYO A;  1OT6 A;  4Y15 A;  1T1B A;  3ICY A;  3UDI A;  3E2L A;  1C3B A;  4HP9 A;  4H6J A;  5CRF A;  1XP4 A;  3UE0 A;  3BJN A;  3CUE A;  3A0S A;  4DRT A;  1S6R A;  1SHV A;  2ACG A;  1OT9 A;  3OBF A;  5EOO A;  3V5M A;  2J9P A;  4FD8 A;  1PZO A;  4EUZ A;  3IXH A;  3ULF A;  1FQG A;  3JPU A;  3V3R A;  1YAX A;  3E4P A;  3A0R A;  2H28 A;  5GHX A;  2Z2L B;  2B5R A;  1H8Z A;  2OWH A;  4LEN A;  3OPH A;  4KZA A;  4DDY A;  3LIF A;  4HHD A;  4ZJ1 A;  3BQ8 A;  4KEN B;  1FCN A;  5CHU A;  3T4K A;  1VET A;  1FOF A;  2EA9 A;  2J80 A;  4EEU A;  1ESU A;  2EFX A;  2DCF A;  1KE3 A;  5MC7 A;  2HGV A;  2W0N A;  3NUL A;  3LCE A;  3NHQ A;  3R7W A;  2J7V A;  5HDS A;  4MN5 A;  1XJ6 A;  4Q0J A;  5EVI C;  3BLS A;  2R78 A;  5AQ7 A;  3IX8 A;  3W4O A;  2PR6 A;  2W27 A;  4B88 A;  3OPL A;  3FPW A;  3H82 B;  1K4E A;  3C38 A;  3LIA A;  4E6W A;  3C2W A;  5FQJ A;  3WS4 A;  5GHZ A;  5FEF A;  1L0D A;  3UPO A;  1G5U A;  2Y2O A;  4H6J B;  4GN2 A;  2OOL A;  1S66 L;  1IEM A;  5E2G A;  5F83 A;  3SS3 A;  1DP8 A;  5L07 A;  4AFI A;  3IXD A;  1P9W A;  2IA2 A;  5HDC A;  4F94 A;  1TEM A;  4UEY A;  2VJW A;  1JTG A;  4RQ9 A;  4G3W A;  3NY4 A;  3TRC A;  1LI9 A;  2PD7 A;  3G6O A;  5J4E A;  1YSQ A;  2ZM8 A;  1CEF A;  4WBG A;  3T1R A;  4GD8 A;  4OON A;  3ZG0 A;  1MY8 A;  2G2U A;  3E4O A;  5F69 A;  5FAQ A;  2Y2Q A;  4OP8 A;  5KSC A;  1ZKJ A;  1W5D A;  4FCF A;  3DAV A;  3W4Q A;  1VEU B;  2K31 A;  3ZG8 B;  3BM6 A;  4GW9 A;  1H5X A;  2JKR M;  1ESI A;  4WZ5 A;  2CMN A;  1TS7 A;  4U0T A;  1K55 C;  1XKZ A;  4E3N A;  3IH8 A;  1LSV A;  1A0K A;  3D9Y A;  4JXG A;  2B02 A;  3IWO A;  2W1T B;  1NZO A;  1W8Q A;  1LHY A;  2WKP A;  3MFX A;  4G3K A;  4P87 A;  4WN5 A;  2P08 A;  3A3E A;  1XJ2 A;  3NC8 A;  1CI9 A;  2PRF A;  5DF8 A;  1YMX A;  3CLO A;  2DMW A;  4UQI S;  4H8R A;  4X55 A;  1BTL A;  5CXW A;  5L10 A;  4LGW A;  2C5W B;  1NZU A;  2M1C A;  1JWP A;  1MWR A;  1PWG A;  5J7E A;  1T19 A;  3H9W A;  3O87 A;  3DTM A;  1P9R A;  2C6W B;  2P9V B;  1MZU A;  4X53 A;  3TSG A;  5CGX A;  4Y17 A;  2WGI A;  1BZA A;  3GSG A;  2HPB A;  5FEG A;  3F1P A;  4NKP A;  4OOL A;  5FQK A;  1YLP A;  1Y54 A;  2KOI A;  2EX2 A;  3LIE A;  2Y2K A;  3MZF A;  2P7J A;  2A3U A;  3Q1F A;  4KQQ A;  3BFG A;  1KGF A;  1IYO A;  2V0W A;  4BL2 A;  2P74 A;  2HZ5 A;  4OPQ A;  1IFQ A;  1LL8 A;  5D3O A;  2GDN A;  2WZX A;  2Z6C A;  4ME4 A;  5EVL A;  3SH7 A;  1ONH A;  1VEU A;  4I39 A;  2GJ3 A;  2PU4 A;  1Q2Q A;  2Y2P A;  4EEP A;  3FYZ A;  4NXB A;  4DN0 A;  3G2Y A;  3A3I A;  3IHA A;  1PW1 A;  2Q9M A;  1G68 A;  2HP9 A;  3G34 A;  4UA6 A;  2JE5 A;  4S2I A;  4Q8I A;  1XX2 A;  1DP6 A;  4R6L A;  5AQB A;  1JWZ A;  1KGE A;  3GMW A;  4X25 A;  3DWK A;  2X01 A;  4WEJ A;  1O07 A;  4Y7P A;  4HQA A;  5JYP A;  1TS6 A;  5FI6 A;  3G30 A;  2Y79 A;  5FQI A;  3UE6 A;  2ZL1 A;  3ZVW A;  1RGY A;  5CGW A;  4S2J A;  4C75 A;  5CX7 A;  3WS2 A;  4DXB A;  3ZHH A;  2Y59 A;  5A92 A;  1KVL A;  2XDM A;  4N1X A;  5L8M A;  4X1M A;  2Y2L A;  1WE4 A;  2PT7 A;  3BEB A;  1YLJ A;  4LFU A;  4KZB A;  1E25 A;  5KZH A;  1E4D A;  1MPL A;  1XA1 A;  3FG8 A;  4QHC A;  3MQO A;  1LI0 A;  1ES5 A;  1TS0 A;  1I5Q A;  3UN7 A;  3MXR A;  4ETX A;  4GLQ A;  3SOI A;  4JGQ A;  2VGL S;  4IHQ A;  4UA9 A;  4JF5 A;  1G6O A;  2JKF A;  5FAT A;  4JF6 A;  1VET B;  2WGV A;  4LCL A;  3VOZ A;  1QME A;  2VA0 A;  2J3W A;  4CJN A;  1S1Y A;  3G2Z A;  5A90 A;  3JVU A;  1K38 A;  1Q2P A;  5FQQ A;  3K3C A;  4DE2 A;  3UO9 A;  2BAS A;  2L0W A;  1NY0 A;  2FFY A;  4RYE A;  2EX8 A;  3VP0 A;  2DNS A;  3O5Y A;  3UB6 A;  2V20 A;  2J3T D;  3ZYT A;  1HTZ A;  5FI2 A;  3LID A;  2H10 A;  4EBL A;  1BLH A;  4KQO A;  2YKF A;  1BUL A;  3PHY A;  2CC1 A;  4GS9 B;  1YT4 A;  1LLB A;  3BFF A;  3FV7 A;  3NOU C;  4K91 A;  3MF0 A;  5GLC A;  2W3F A;  3T4Q A;  4Y3I A;  1HD8 A;  4O8G A;  4IJG A;  2VV8 A;  1ERQ A;  1F5M A;  5EFW A;  4E3O A;  1GHI A;  3ZNY A;  2HDS A;  3S4X A;  3HLE A;  3ZCZ A;  3MZE A;  2FH5 A;  4HJ3 A;  2WKR A;  3VMA A;  2JN7 A;  3P01 A;  2EWW A;  4N9K A;  3LIC A;  5IT5 A;  3RTY A;  4HBT A;  1FIK A;  1GHM A;  3RJU A;  3ZG9 B;  1OTE A;  4X68 A;  5E2F A;  4EET B;  1JVJ A;  1IYS A;  3VFF A;  4S2L A;  4BWI A;  4MCW A;  5F1G A;  4WMC A;  3IF6 A;  4KZ6 A;  3AGF A;  2EX9 A;  1ODV A;  1XFQ A;  4HP4 A;  4LRZ E;  4LPZ A;  1RGZ A;  4CPK A;  1W63 Q;  4QY5 A;  4DDS A;  3H7W A;  2BG1 A;  5FQM A;  3TE8 A;  4KG5 A;  2ZOI A;  4EW7 A;  2ZBB A;  5EVI A;  5FSR A;  3F1O A;  2QKP A;  4XT2 B;  2VGJ A;  2NUT C;  1K6S A;  3JYI A;  2A24 A;  3QP4 A;  4MBF A;  3V39 A;  2Y91 A;  1O7E A;  2GNX A;  1TD5 A;  1DY6 A;  3H82 A;  3F1O B;  2L4R A;  1EW0 A;  3HUO A;  3TG9 A;  4PM8 A;  2HP6 A;  4E04 A;  3Q81 A;  3EEH A;  1YQS A;  2GZA A;  3IS2 B;  1PYY A;  2I72 A;  4NET A;  5CER A;  1NRJ A;  3CWF A;  2K7S A;  4OKP A;  2ZQC A;  4F3L A;  1ZG6 A;  5FAP A;  3DBA A;  4G3V A;  3DTK A;  4JLF A;  1Y4O A;  2QJ7 A;  2PBD P;  5FI7 A;  3A3D A;  3NDG A;  2XEP A;  2PHY A;  3LGO A;  3CI6 A;  3T4J A;  4F3L B;  1K56 D;  1IYQ A;  3N8R A;  5DF9 A;  1ZC2 A;  3ZNT A;  1ZG4 A;  3FPV A;  1Y28 A;  5AQA A;  5DTT A;  5DFY A;  5EVE A;  3AGD A;  3IHB A;  4IVK A;  1EWZ A;  5EV0 A;  3PXP A;  4QB8 A;  3RFB A;  1YLZ A;  1MKI A;  3LI8 A;  5K5B A;  2Y55 A;  5EVI D;  1YPR A;  1YLW A;  2ZMV A;  1TDG A;  5IU1 A;  3DTI A;  1UWN X;  5A91 A;  3VP4 A;  4U3T A;  3HUM A;  4KQR A;  1OPX A;  3M6B A;  4FUW A;  2WKI A;  1OJG A;  5IHV A;  3FC7 A;  4BQM A;  3SS4 A;  1L3L A;  3NIA A;  2PBY A;  2RL3 A;  3IH9 A;  2OLU A;  3IF6 C;  3CPT B;  5EOE A;  3BEC A;  5KMW A;  4K0X A;  1VHM A;  2UV0 E;  4B4Z A;  5G18 A;  4CLC E;  1BLC A;  3ZVT A;  4HES A;  4BD1 A;  4PM6 A;  4K0W A;  5HWW A;  4S2O A;  3PBQ A;  3GV9 A;  4ARZ A;  3HRE A;  2ZQD A;  5FL3 A;  4L9G A;  4Y5F A;  1FR1 A;  3MR0 A;  4ESP A;  3VP1 A;  5EM0 A;  2XA7 M;  5AQ9 A;  5U47 A;  3GVB A;  3R4K A;  4S2K A;  3BYD A;  4GJ4 A;  4II7 A;  1CJF A;  4L0L A;  3NEC A;  4WMC D;  3OCL A;  3DW0 A;  5EVI B;  1TDL A;  3S1Y A;  3HLD A;  4S2M A;  3CUE C;  3O86 A;  4X1L A;  4R3A A;  3RH8 B;  2HJ9 C;  2ZD8 A;  4I3I A;  4HIA A;  1VM1 A;  3R7W B;  1FSY A;  4E3L A;  1U60 A;  3LO7 A;  2L1M A;  2XRO A;  1PWD A;  4P6B A;  3WWX A;  5M1A A;  1W79 A;  5DKL A;  3ITB A;  3ZQ5 A;  1YLY A;  1KE4 A;  2XFS A;  2ZQ8 A;  4LCM A;  3PBN A;  3IT9 A;  3BW6 A;  3QP2 A;  3N7W A;  2DRW A;  4HEF A;  1H3Q A;  4BBV A;  5GL9 A;  3UE3 A;  3EQV A;  2A2L A;  5AVF A;  2A49 A;  1K56 A;  2V9A A;  4UHU A;  3QP6 A;  1PI5 A;  4WUJ A;  5GLD A;  4EUV A;  2Z2M B;  1Z6F A;  4O0P A;  4BBT A;  4I5S A;  4OP5 A;  1IEL A;  4HI4 A;  3V50 A;  1CQA A;  5HL6 A;  4N9L A;  4R4R A;  4JF4 A;  4E3K A;  3EQU A;  2WK0 A;  4KZ8 A;  4Q0H A;  3I7J A;  4YWZ A;  3B47 A;  3WS5 A;  1S67 L;  4GD6 A;  1J3W A;  1N9L A;  4DJ3 A;  5F1F A;  2HP5 A;  2V8F A;  1GA0 A;  1FCM A;  2VKS A;  4E6X A;  1I2S A;  5EM1 A;  4UAA A;  3K3D A;  3MFD A;  3HLG A;  5F68 A;  2XSS A;  4IUK A;  4KZ5 A;  2P04 A;  2X02 A;  4MN7 A;  1W63 M;  4BD0 A;  2VZW A;  3NOP C;  4R23 A;  5GLB A;  3O88 A;  2WYX A;  3GEC A;  2BTF P;  2ZC7 A;  5CTM A;  1NLY A;  3VFH A;  4KG6 A;  3E2K A;  1S4R A;  5HW3 A;  3WS0 A;  4JPM A;  4M4X A;  2QMI A;  3IBJ A;  4HBU A;  4LV3 A;  4OPY A;  2PR5 A;  1XJ3 A;  3TOI A;  2ZMF A;  1W8Y A;  2ZM2 A;  1UWP X;  3D3O A;  1YM1 A;  2BLS A;  1PI4 A;  3RXW A;  1JTD A;  3A0V A;  3LEZ A;  4LV2 A;  4EBP A;  3W8K A;  4D2O A;  4DJ2 A;  1K54 C;  3PAE A;  4UA7 A;  1V9Y A;  4KZ9 A;  1DJB A;  2NUP C;  3C5A A;  4P85 A;  5TFQ A;  1LL5 A;  3T4O A;  1CI8 A;  5HWV A;  3TW8 A;  3GR2 A;  4GS9 A;  3TJZ C;  3PYP A;  1NRF A;  2RCX A;  2UWX A;  1AWI A;  2QZ6 A;  4QJG A;  3BQA A;  4PAU A;  5M19 A;  1OME A;  3UPP A;  4LRX C;  4MN6 A;  3CG5 A;  4OQG A;  1K25 A;  3BRM A;  5M18 A;  2EX6 A;  3HLB A;  3KSG A;  2QPN A;  1ZTU A;  1TS8 A;  2JKG A;  1KDS A;  3W2Z A;  3BFD A;  2OSU A;  4P0M A;  1CF0 A;  3HJK A;  1E3U D;  3MS6 A;  4IBR A;  3Q7Z A;  4OLD A;  4MEZ A;  2JCH A;  1YSP A;  2O9C A;  3ZDJ A;  4FH4 A;  1ERO A;  4U0X A;  3G32 A;  3QP1 A;  4GNU A;  4RVA A;  3F1N A;  2H0Y A;  1ERM A;  4FSF A;  1TVF A;  2Y4A A;  3BFC A;  5F82 A;  5FA7 A;  3SZT A;  1L0F A;  1XGI A;  5DKK A;  5TBM A;  3GDI A;  1AXB A;  3C4P A;  2V8C A;  3HLC A;  4R3J A;  3N8S A;  5IS1 A;  3CPT A;  1K57 C;  3Q7V A;  3A3F A;  4R38 A;  2KDK A;  3LIB A;  3VOL A;  2PU2 A;  1K4F A;  1VB6 A;  4JXV A;  2ZC4 B;  3HLW A;  5FQ9 A;  3SH8 A;  1GSX A;  2E8I A;  3WS1 A;  1J9M A;  5HZH A;  1DJA A;  1BUE A;  1JNU A;  3VE3 A;  2XA7 S;  1OTI A;  4JGO A;  4HH3 A;  4JBF A;  3KSI A;  3NOT C;  3VSL A;  2Y8H A;  3M2J A;  4HH2 A;  2JC7 A;  4MBK A;  2W1R A;  4Q0I A;  3E4Q A;  1LSW A;  3BY9 A;  2W1T A;  2JKR I;  2O0Y A;  1SKO B;  1V9Z A;  4B93 A;  1M40 A;  4BMW A;  5BOH A;  5CHM A;  4KZ7 A;  4PKY G;  3KO6 A;  3EOI A;  2VGL M;  1SKO A;  4Y13 A;  1N4O A;  3Q07 A;  4PMA A;  4GCZ A;  4NEE D;  3DWZ A;  2R9X A;  3S22 A;  4ARZ B;  3MZD A;  4LV1 A;  1KGG A;  5CHJ A;  4E3J A;  3VOY A;  5CGS A;  4EBN A;  4MDZ A;  3HLF A;  1LSX A;  4P6Z M;  3MJQ A;  2OAP 1;  4PPR A;  1BT5 A;  4R1G A;  4GZB A;  4WF0 A;  1ONG A;  1YKD A;  3AGE A;  1MC0 A;  4GKU A;  1OTA A;  4B9O A;  3HUN A;  1GHP A;  4S2N C;  4QD4 A;  3IF5 A;  1OTD A;  2ZQ7 A;  3N4I A;  3T4L A;  4WLA A;  2G2W A;  1SCW A;  3PBO A;  4HNB A;  2ZC3 B;  1CEG A;  2Z6D A;  4IVI A;  5E2H A;  3CMZ A;  3CJM A;  4L9E A;  2W3D A;  1PZP A;  4OPZ A;  4OPR A;  3ZFZ A;  1PRQ A;  2INW A;  4GDB A;  3PR6 A;  4CLC B;  1GSW A;  1H8Y A;  3BY8 A;  3MMH A;  1XFN A;  1PWC A;  5FDH A;  2EXB A;  4XXR A;  5TJJ A;  4Y0U A;  4WEL A;  5DJT A;  5A93 A;  1YLT A;  3M2K A;  5DTS A;  4ZJ3 A;  4Z1W A;  2V1B A;  4XT2 A;  3IWI A;  1ZHH B;  1T18 A;  1W7F A;  1L0G A;  4GB7 A;  5G4Y A;  1PFL A;  4XUX A;  4X6T A;  1FIL A;  4A5R A;  2J3T C;  4ID4 A;  3FZC A;  3GQZ A;  3P09 A;  4DF6 A;  3NI9 A;  5EE8 A;  4I38 A;  3LI9 A;  2PYP A;  3MBZ A;  4LRY C;  4OVD A;  4Y0O A;  5FAO A;  3N6I A;  5DVA A;  3B42 A;  1OTB A;  3EGX C;  1FR6 A;  1S1Z A;  1MXO A;  2HV1 A;  2O99 A;  4OOM A;  3SS5 A;  3UB5 P;  3BFE A;  3GTC A;  4R4S A;  2Y2I A;  4QWO A;  4CLC C;  2JKT M;  3V3S A;  4KZ3 A;  4PKY A;  2R9W A;  1P0Z A;  1DP9 A;  4ZTK A;  2A24 B;  3CAX A;  4KUK A;  1M6K A;  5DF7 A;  3UDX A;  4MMN A;  3QP5 A;  2HDQ A;  2WAF A;  4ZDX A;  4HJ6 A;  3T50 A;  1NLZ A;  4WZ4 A;  5J3W A;  3UMD A;  2QHK A; 
#chains in the Genus database with same CATH homology
 3EEA A;  1N9O A;  2PT7 A;  2VKS A;  2LB5 A;  1X0O A;  3E98 A;  2XRN A;  3KX0 X;  2V0U A;  3IS2 A;  3LR3 A;  3EGD C;  3K3D A;  3U2A A;  3MQ0 A;  2O9A A;  4HY8 A;  5F68 A;  2XSS A;  3FG8 A;  3PBS A;  4IUK A;  3F1P B;  3D72 A;  3MQO A;  4BJP A;  4CLC D;  3S7P A;  5AVE A;  3OC2 A;  2KX6 A;  3MQQ A;  3UME A;  1TS0 A;  2P04 A;  1TF1 A;  2GX5 A;  3SW1 A;  4BBU A;  1OJ5 A;  4ETX A;  4EXO A;  4MN7 A;  1W63 M;  4GLQ A;  4L9F A;  5HWT A;  2VZW A;  3NOP C;  3S7N A;  2OAQ 1;  4KUO A;  1WA9 A;  4JGQ A;  2VGL S;  3GEC A;  4K08 A;  2B18 A;  4IHQ A;  4EQ1 A;  1G6O A;  5AJG A;  5HD3 A;  5HDD A;  1F98 A;  1NLY A;  2G7U A;  5TBM B;  4QPR A;  5HD5 A;  2VA0 A;  1BYW A;  1S4R A;  2J3W A;  4R70 A;  2HF6 A;  3E0Y A;  1S1Y A;  2QYB A;  3LUQ A;  4M4X A;  3JVU A;  3IBJ A;  4WL9 A;  2ZOH A;  3K3C A;  1KOU A;  4P6Z S;  2PR5 A;  1XJ3 A;  2BAS A;  2L0W A;  2ZMF A;  3KYQ A;  1UWP X;  3D3O A;  3O5Y A;  3UB6 A;  5HPI A;  3S7Q A;  2M7V A;  2J3T D;  3ZYT A;  3A0V A;  3LID A;  3LYX A;  4YNR A;  4UQI M;  4KQO A;  2YKF A;  1XJ4 A;  1P97 A;  3PHY A;  3V67 A;  3UB8 A;  2I9V A;  4FOF A;  3B33 A;  4GS9 B;  4DJ2 A;  4HJ4 A;  4NXF A;  3NOU C;  1V9Y A;  3MF0 A;  1OT6 A;  2W3F A;  3T4Q A;  4Y3I A;  2NUP C;  1T1B A;  3ICY A;  3T4O A;  5HWV A;  3TW8 A;  4JGR A;  4O8G A;  4IJG A;  2VV8 A;  1H8M A;  4GS9 A;  4WEK A;  3TJZ C;  4HP9 A;  3PYP A;  4H6J A;  1F5M A;  1MKM A;  5EFW A;  4Y2F A;  3BJN A;  3CUE A;  3A0S A;  3BQA A;  2FH5 A;  4HJ3 A;  4PAU A;  2WKR A;  4HOI A;  2JN7 A;  2EWW A;  3P01 A;  4LRX C;  4MN6 A;  1OT9 A;  3LIC A;  1F9I A;  3OBF A;  3KSH A;  5I5L A;  5IT5 A;  3RTY A;  2M7U A;  1OTE A;  4EET B;  1S4S A;  3KSG A;  2VEA A;  1ZTU A;  2VX8 A;  1TS8 A;  4BWI A;  5C5K A;  3ULF A;  4MCW A;  4ETZ A;  2QWS A;  3W2Z A;  1T1A A;  5LBR A;  1ODV A;  1XFQ A;  1YAX A;  3E4P A;  3A0R A;  3HJK A;  4HP4 A;  2H28 A;  4LRZ E;  3MXQ A;  4LPZ A;  4DMZ A;  1W63 Q;  3LR5 A;  1YSP A;  2OWH A;  2O9C A;  3H7W A;  2O9B A;  3TE8 A;  1LT0 A;  3EWK A;  2ZOI A;  4EW7 A;  2ZBB A;  3F1O A;  2QKP A;  2MJ6 A;  3LIF A;  1T1C A;  3F1N A;  4XT2 B;  4HHD A;  4FSF A;  3BQ8 A;  5DJU A;  3P7N A;  2NUT C;  5HSQ A;  5F6A A;  5DKK A;  3T4K A;  5TBM A;  2EA9 A;  2J80 A;  4EEU A;  3GDI A;  2A24 A;  3KYZ A;  5MC7 A;  2HGV A;  2W0N A;  3NHQ A;  3R7W A;  4NXE A;  5HDS A;  3H7W B;  4MN5 A;  1XJ6 A;  4Q0J A;  2GNX A;  5IS1 A;  1TD5 A;  3H82 A;  3K2N A;  2R78 A;  3F1O B;  4R38 A;  2KDK A;  2L4R A;  3LIB A;  3VOL A;  3VV4 A;  1EW0 A;  1VB6 A;  2PR6 A;  2W27 A;  3FPW A;  3HJI A;  4E04 A;  3H82 B;  3LIA A;  3C38 A;  3EEH A;  2GZA A;  3C2W A;  3IS2 B;  2KLI A;  2VV6 A;  1GSX A;  3UB7 A;  4KQD A;  5HZH A;  4H6J B;  1JNU A;  2OOL A;  2XA7 S;  1OTI A;  1S66 L;  4JGO A;  1NRJ A;  3CWF A;  3VE3 A;  2K7S A;  4HH3 A;  2VLG A;  3KSI A;  3NOT C;  4ZRR A;  2EWV A;  1DP8 A;  4F3L A;  3DBA A;  2Y8H A;  4G3V A;  4HH2 A;  4AFI A;  3F1N B;  2W1R A;  4Q0I A;  3E4Q A;  1P9W A;  1LSW A;  2QJ7 A;  2IA2 A;  3C30 A;  3PBR A;  3BY9 A;  2W1T A;  5HDC A;  4CLC A;  2O0Y A;  2PHY A;  2JKR I;  2VJW A;  4UEY A;  3CI6 A;  1V9Z A;  3T4J A;  4F3L B;  4B93 A;  4RQ9 A;  4G3W A;  4O01 A;  2QJ5 A;  4BMW A;  3TRC A;  4PKY G;  5DF9 A;  3KO6 A;  3FPV A;  2PD7 A;  2LB9 A;  1Y28 A;  3EOI A;  2VGL M;  3G6O A;  5J4E A;  5DFY A;  1YSQ A;  2W3G A;  3LR4 A;  4GCZ A;  1GSV A;  4NEE D;  1STZ A;  1UGU A;  3C8C A;  1N9N A;  3PXP A;  5G4Z A;  3E4O A;  3RFB A;  4ARZ B;  5F69 A;  3CIT A;  3LI8 A;  5K5B A;  1IOU A;  2K31 A;  4MDZ A;  2W3E A;  4EU0 A;  2ZMV A;  3HCY A;  1LSX A;  4GW9 A;  3T4T A;  2JKR M;  2PYR A;  3JVV A;  2PDR A;  2D01 A;  2CMN A;  1TS7 A;  5IU1 A;  1UWN X;  2OWJ A;  4P6Z M;  3T4S A;  3MJQ A;  3NJA A;  2OAP 1;  1OPX A;  2JKT I;  1OJG A;  1LSV A;  5HPF A;  4WF0 A;  3FC7 A;  2B02 A;  4I3A A;  2W1T B;  1YKD A;  2WKP A;  3MFX A;  4G3K A;  4WN5 A;  2P08 A;  1XJ2 A;  1MC0 A;  1OTA A;  2FZ0 A;  4B9O A;  1OTD A;  3OLO A;  3T4L A;  3CLO A;  4UQI S;  2DMW A;  3KSF A;  4WLA A;  1VHM A;  1D06 A;  3PBO A;  3OOV A;  4HNB A;  4CLC E;  2Z6D A;  5F5Y A;  4PHT A;  5DFX A;  5HWW A;  2M1C A;  4L9E A;  3PBQ A;  2W3D A;  2JHE A;  4ARZ A;  5J7E A;  1T19 A;  3H9W A;  1G28 A;  2INW A;  5FL3 A;  3PR6 A;  1P9R A;  4CLC B;  1GSW A;  4L9G A;  4CQH A;  4Y5F A;  3MR0 A;  2HJE A;  3BY8 A;  1MZU A;  3PBT A;  3MMH A;  2VV7 A;  1XFN A;  4NXG A;  2XA7 M;  4GHI A;  5TJJ A;  3R4K A;  4WEL A;  5DJT A;  2YKH A;  4GJ4 A;  4II7 A;  3F1P A;  4NKP A;  4L0L A;  4OOL A;  5KIZ A;  3OCL A;  4Z1W A;  2KOI A;  3LIE A;  3CUE C;  2V1B A;  2P7J A;  1DRM A;  3LFV A;  4IUH A;  4R3A A;  4XT2 A;  3RH8 B;  2HJ9 C;  4I3I A;  4HIA A;  1ZHH B;  3R7W B;  3LR0 A;  1T18 A;  2WKQ A;  5G4Y A;  2V0W A;  2PD8 A;  3OCN A;  3UB9 A;  1IFQ A;  2L1M A;  1LL8 A;  2J3T C;  3BWL A;  2XRO A;  2Z6C A;  4ME4 A;  4I39 A;  2GJ3 A;  4I38 A;  3LI9 A;  2PYP A;  4LRY C;  4JGP A;  4EEP A;  1D7E A;  4NXB A;  5DKL A;  4DN0 A;  3ZQ5 A;  3PBN A;  3B42 A;  1OTB A;  3EGX C;  2V1A A;  3IBR A;  2W3H A;  4YOF A;  3BW6 A;  5KSH A;  1S1Z A;  1H3Q A;  2HV1 A;  2O99 A;  4OOM A;  4BBV A;  3UE3 A;  4EER A;  1DP6 A;  3EQV A;  2A2L A;  4R6L A;  5AVF A;  4EES A;  1NWZ A;  2V9A A;  4WEJ A;  4CLC C;  2JKT M;  4HQA A;  4WUJ A;  1TS6 A;  4EUV A;  4O0P A;  4BBT A;  4PKY A;  4I5S A;  4HI4 A;  3S7O A;  1P0Z A;  1DP9 A;  4LLO B;  2Y79 A;  2A24 B;  5HL6 A;  3UE6 A;  3CAX A;  4KUK A;  3EQU A;  5CX7 A;  4MMN A;  4Q0H A;  5A8B A;  4HJ6 A;  4YWZ A;  3T50 A;  1NLZ A;  2K2N A;  3B47 A;  5J3W A;  2D02 A;  1S67 L;  3VE4 A;  1N9L A;  4DJ3 A;  4GHI B;  3UMD A;  2QHK A;  4I3J A;  5L8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...