5DJTA

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
SLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
molecule keywords NPH1-2
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djtA00
4HHDA 4NXBA 1LL8A 4JGOA 3GECA 1TS7A 4EESA 1T1AA 2L0WA 2I9VA 1D06A 2V1BA 1OT6A 2D01A 3CAXA 3H82B 3LIBA 4LLOB 1VB6A 1ODVA 4F3LB 2PYRA 4EQ1A 3GDIA 3EEHA 4H6JA 4L9FA 4WUJA 2PD8A 1Y28A 2WKPA 3ICYA 4HNBA 4M4XA 5F68A 3UB6A 4HY8A 3OLOA 5I5LA 3F1OA 4KUOA 5AVEA 2D02A 1UWNX 1TS0A 5KIZA 1S1YA 3B33A 4HIAA 3RTYA 4RQ9A 3RH8B 3UE6A 1D7EA 2INWA 1DP8A 3ULFA 3FC7A 3CWFA 3IS2A 4XT2A 3LUQA 4I3JA 4XT2B 4EW7A 2VEAA 3E4OA 5EFWA 3PHYA 1TS8A 1T1CA 5J4EA 1EW0A 5HSQA 1OJ5A 4GHIB 4L9GA 4WLAA 2ZOIA 4GCZA 1MZUA 3BY9A 1F98A 3H82A 1BYWA 3LYXA 2KX6A 4DJ3A 1OTIA 5A8BA 3LI9A 4LRXC 5HZHA 5HWWA 2V9AA 1DP6A 3A0VA 1GSWA 5AVFA 5IU1A 5IS1A 3T50A 3HJKA 3LIFA 2VLGA 1F9IA 3F1PB 4PKYA 4BBTA 4JGPA 2CMNA 1XFNA 4K08A 5DJTA 4EERA 3MQOA 1KOUA 4YWZA 4NXEA 1N9OA 5HDCA 4EXOA 2OWJA 3NJAA 4EETB 2QKPA 3MQQA 1LSXA 2PHYA 2WKQA 4MN6A 5DJUA 3MFXA 2YKHA 5TBMB 3UMEA 3F1NB 3ZQ5A 1WA9A 1XJ2A 4E04A 3VOLA 4MN5A 2WKRA 2V0WA 3D72A 4I38A 3MXQA 3BY8A 1XJ4A 4I39A 4NXFA 1S67L 2KDKA 4GW9A 5HDDA 5HWTA 4R6LA 3SW1A 4GS9A 3K3DA 4LRYC 1N9NA 1P97A 3LIAA 4GS9B 4JGQA 4BBUA 2A24B 3EWKA 5J7EA 4I5SA 1OTAA 4F3LA 2QJ5A 1DRMA 3HJIA 2OWHA 4HP9A 1V9YA 2J80A 1GSXA 4L9EA 3F1PA 3F1NA 1DP9A 3C8CA 3VE4A 4B9OA 1G28A 2VV6A 4KQDA 1N9LA 2JHEA 2QHKA 2R78A 1LSVA 1UWPX 3P7NA 5F69A 2Z6DA 3IBRA 1NWZA 4HH3A 1OJGA 5DKKA 1OT9A 3G6OA 1JNUA 1X0OA 3LIEA 1OTEA 4HH2A 2L1MA 4I3AA 1V9ZA 2ZBBA 1T1BA 3LI8A 3NHQA 2YKFA 4HJ6A 5TBMA 4EEUA 1XJ3A 3E4QA 1S1ZA 2V0UA 2ZOHA 3E4PA 1P0ZA 1UGUA 4KUKA 4WN5A 3VE3A 4EEPA 4H6JB 5G4ZA 2V1AA 2QWSA 3UMDA 5HWVA 3NOTC 2QJ7A 3UB7A 3MJQA 2HV1A 2P7JA 1S4RA 3FG8A 3BWLA 2K7SA 4WL9A 1XFQA 2VV7A 4LRZE 2GJ3A 2PR5A 2H28A 4I3IA 5HD3A 3H7WB 1S4SA 3NOUC 4HQAA 1T19A 4LPZA 3MR0A 3IS2B 1S66L 2EA9A 3H7WA 3K3CA 3KX0X 1LSWA 4DJ2A 1T18A 1OTBA 4PKYG 3NOPC 2B02A 3A0RA 4GHIA 4BBVA 5J3WA 2OOLA 5F6AA 2PD7A 4HJ3A 2JN7A 4JGRA 2A24A 5F5YA 2PYPA 2PR6A 1TS6A 1GSVA 3A0SA 3LIDA 4WF0A 1LT0A 2PDRA 4R38A 2VV8A 3LICA 4R3AA 5HD5A 4HJ4A 1XJ6A 2L4RA 4HOIA 5G4YA 4R70A 2W0NA 1OTDA 3F1OB 3H9WA 3C2WA 5DKLA 3UB8A 5HDSA 4NXGA 2W27A 2Z6CA 3PYPA 4HI4A 3UB9A 4HP4A 2BASA 2M1CA 3CLOA
chains in the Genus database with same CATH superfamily
2ZMFA 3VOYA 4CQHA 4HBTA 4JF6A 4WYYA 5FQJA 3FZCA 5KSCA 4ID4A 2V20A 1UWNX 5GLBA 2ZJ9A 4UAAA 1IYPA 4GHIB 2HP5A 3ZDJA 5L2FA 2VGJA 3BQ8A 4HESA 3LI9A 3HLDA 2V9AA 1KDWA 4F94A 3MSHA 4KZ9A 1CJFA 1N9BA 1XFNA 1S6RA 3IXDA 2XD5A 4YWZA 4EXOA 4JXSA 4S2NC 5EPHA 4Y17A 1MY8A 2PHYA 4X1LA 3HUMA 1ES5A 2J9PA 2WKRA 3U2AA 3SH7A 1BZAA 4DN0A 3Q7VA 2W3GA 2W1RA 1XPBA 2CC1A 1FQGA 2UWXA 4L0LA 2P9VA 3LEQA 2QHKA 2WGIA 3ZG8B 4KZ8A 1K54A 3G6OA 2L1MA 1K56A 4YINA 2ZOHA 3ISGA 3NOTC 4RVAA 3MJQA 2XA7S 5FSRA 5HD3A 4HQAA 4C6YA 3K3CA 4X68A 2Y2LA 3ZNYA 2X02A 5GHZA 4P87A 1TEMA 4PM9A 2B95A 2PYPA 3LIDA 1KE4A 1LT0A 2HJ9C 4R0QA 3BQAA 2XD1A 3GV9A 4GN2A 3IX4A 3BFDA 3WWXA 3DTMA 4K0XA 2IWCA 4I5SA 1LL8A 5F1FA 5EVIB 4LLOB 4PAUA 3GTCA 1N4OA 5FQIA 2R9WA 3P09A 4RQ9A 3FC7A 4G3KA 4S2JA 4I3JA 3MZFA 1EW0A 3S7OA 2J8YA 3QP4A 2RL3A 4LV0A 3BFCA 1K55A 1MWRA 1NLYA 3MQOA 1KOUA 4S2PA 1BT5A 3DWZA 1P9WA 4EETB 2FFYA 4MN5A 2V0WA 1TF1A 5AJGA 3IXGA 2G7UA 4NXFA 2B5RA 3L9KA 1E25A 4CJNA 1ONGA 3QP6A 1ES2A 5GLAA 4KZ6A 4MBFA 5FQ9A 4DE0A 4OVDA 1NXYA 1OT9A 3E98A 1K57C 4UA7A 2JC7A 1T1BA 5AQ9A 2A3UA 3NCKA 4BL3A 1LL9A 1P0ZA 2WZXA 1HZOA 3G35A 4MEZA 2ZC3B 5I94A 4OP8A 5F1GA 3NOUC 3QP1A 3KX0X 4DJ2A 1EI5A 3A0RA 3C5AA 3IWIA 4FH4A 3ZG0A 5F5YA 2OAP1 3BFFA 1H3QA 4PM5A 3IWOA 1K55C 2HJEA 4R70A 5G4YA 3B3XA 4HP4A 2KOIA 4DKIA 2A49A 3BEBA 4WBGA 2V1BA 3CAXA 1NJ4A 4QJGA 5C5KA 1NRJA 4UHUA 4H6JA 4HY8A 2HPBA 3QNBA 2XRNA 5CXWA 5DTSA 4DRTA 3DTEA 3CWFA 1MC0A 1OJ5A 3IHAA 1CQAA 1MWSA 2XFSA 4DDYA 4NETA 3T50A 1E4DA 1LLBA 4GD6A 2VX8A 2ZL1B 5HDCA 3NECA 4EWFA 3MFXA 3PTEA 1TD5A 1LHYA 3UPNA 1P97A 5FDSA 2HP6A 1LI0A 4FOFA 4F3LA 2P08A 2IWDA 3BLSA 3P7NA 5KMWA 2RCXA 2Z6DA 3FV7A 4HH3A 3KSFA 2Q9NA 4I3AA 4UQIM 3NHQA 2P74A 3VE3A 4RX3A 5G4ZA 3T4KA 2QPNA 3LGOA 5CRFA 2VV7A 2WGWB 2X71A 3T4SA 4CLCE 4I3IA 3H7WB 1L2SA 4DXBA 2EA9A 1T18A 4DXCA 1FOFA 2ZQ9A 1YMXA 4LENA 2M7VA 1CEGA 1FSYA 4ETZA 5FAPA 3BECA 4C3QA 3C7UA 1XJ6A 3V3RA 2OAQ1 4QWOA 3LR0A 2WKHA 4KQDA 3ZYTA 3GRJA 3O5YA 1MBLA 4PMAA 2PBDP 2XROA 3IF6A 3MKFA 2G2WA 1NY0A 5CERA 3RH8B 3UE6A 2INWA 4UA9A 3LUQA 1IOUA 3IF6C 3LR4A 3BY9A 2J3TC 5L07A 1KE0A 1MWTA 4NEED 4OPZA 4BBTA 1ES3A 3G32A 2Y2IA 5JYOA 4XUZA 4EBLA 4X1MA 1VEUB 1JWPA 2W3FA 4GS9A 4JGQA 2A24B 5CGSA 4KZ7A 3BJNA 3MBZA 3LCEA 1DP9A 3VE4A 3CUEC 4ZJ3A 3T4OA 3IBRA 4OONA 1JNUA 1AXBA 2ZQDA 4HJ6A 5FI7A 2XEPA 2DMWA 5EOEA 4P85A 1BTLA 3MXRA 4P6ZM 4IEDA 3TRCA 1WYCA 4X6TA 1LSWA 4E3IA 1MPLA 4PKYG 4Y13A 3OPPA 1FR6A 2PD7A 3ZVTA 4S2KA 3UE0A 1YSQA 3C2WA 2EFUA 2JKFA 4Y5FA 3UB9A 2GZAA 1PWGA 4EESA 2C6WB 3PR6A 3IXHA 4NK3A 4B9OA 4WEKA 3DAVA 3PAEA 4E3OA 4OQHA 1Y54A 4RX2A 5DF7A 1I2WA 4HIAA 3KSIA 2VK3A 1KDSA 3G2ZA 4G3WA 2VA0A 2WADA 4B88A 3T1XA 4WLAA 1K0KA 3M2JA 1OTIA 1SHVA 5HZHA 1L0EA 2E8JA 5AQAA 3LO7A 3LIFA 2LB5A 4PKYA 5DJTA 3BFEA 4JXGA 2B18A 1HTZA 4H8RA 4OQIA 4S2MA 3T12B 3F1NB 1WA9A 1YLPA 4U0TA 3BY8A 2XGNA 3GR2A 1F5MA 3P98A 4DE3A 5FA7A 3EWKA 2QMIA 3MXSA 3UPPA 2WZZA 4D60A 5L8MA 1BLHA 3O87A 2A2LA 2ZMAA 2VV6A 1PI5A 3C7VA 3P01A 1PYYA 1WE4A 4KG2A 3WS5A 1NWZA 4KG5A 4PM6A 1V9ZA 3UDIA 1XJ3A 1S1ZA 2V0UA 3PBSA 4ME4A 5A91A 4AFIA 1KGGA 4U0XA 4EQIA 1OPXA 1TDGA 3V3SA 4WL9A 1F2KA 2H28A 1S4SA 5HPIA 4WM9A 3CZDA 2WK0A 3NOPC 3MS6A 4HJ3A 4OPRA 3Q7VB 3RFBA 3N8SA 4HJ4A 1PZOA 4DE2A 1HLUP 5DKLA 3FKWA 2Z6CA 3PYPA 4UA6A 1ZG6A 3EGDC 4GLQA 3S7QA 1TS7A 1T1AA 4HEFA 4QHCA 2Y2MA 4OOLA 4ZTKA 1Y28A 4KUOA 3LFVA 4X56A 5AQBA 5K5BA 4MN7A 1SZVA 2H0YA 1MZUA 2EWWA 5EVID 2KX6A 4EBNA 4E3KA 4GB7A 1S0WA 4EV4A 3VFHA 3IX8A 5AVFA 5M1AA 3F1PB 3FWLA 2EXBA 1JVJA 1NZOA 3C4PA 5TBMB 4S2LA 1PWDA 3VP2A 4JF5A 3QNCA 5HDDA 5HAIA 3GMWA 4GDNA 2Q0OA 1YLYA 5CHMA 1RCJA 1PW8A 3TG9A 3HLWA 2WGWA 3C8CA 5DTKA 4KZBA 3E2LA 4K91A 5CECA 3LIEA 3NDEA 4JLFA 1EWZA 1UGUA 2H0TA 3V67A 3FG8A 1K54C 4LRZE 3MQ0A 2HP9A 1PI4A 3CUEA 5FATA 1T19A 2XR0A 4R4RA 2WUQA 5EVIC 4GZBA 4B4ZA 2A24A 4OPYA 2ZQ8A 1GSVA 2VV8A 1W7FA 2L4RA 3IXBA 3O88A 3U4LP 1SKFA 3PBQA 3O86A 3EOIA 3LEZA 4B4XA 4FCFA 1MKIA 4WZ5A 3FPWA 3KYZA 4L9FA 3SZTA 4QPRA 5I5LA 3QP2A 1CI8A 3DTIA 3R7WB 1ONHA 1XXMA 1PIOA 4R3JA 1T1CA 3Q07A 5HSQA 3OCNA 5A93A 2DNSA 2PU2A 5A8BA 3NI9A 2K31A 2I72A 3A0VA 4ZJ1A 5IS1A 1IYQA 1BLSA 4MBHA 3KYQA 3M6BA 2Z2MB 1N9OA 4GD8A 3C38A 1YAXA 5DTTA 2Y55A 2W3EA 4DMZA 3N6IA 2VGLM 4OOYA 4PM7A 4IHQA 1L0DA 1ZC2A 2DRWA 2Y2JA 3PBTA 1G28A 3ZG7B 1LSVA 3WS4A 1YSPA 3S4XA 4R4SA 4HH2A 2XFTA 4CPKA 3E4QA 4PHTA 1YKDA 4WN5A 4Q0HA 2W3HA 4ZRRA 1ERMA 4IBRA 1JWVA 3IS2B 3H7WA 4KZ3A 3TOIA 3QHYA 5CGWA 4LCMA 2XLNA 4GHIA 2XK1A 1KGFA 2Z2LB 1KE3A 2PR6A 1GHPA 1HVBA 3C30A 3G34A 3FYZA 4Y2FA 2HZ5A 1L0GA 3JPUA 1K56D 4MBKA 3O3VA 4NXBA 4GKUA 2NUPC 4PM8A 4OP5A 2QYBA 4II7A 1QMEA 3VP4A 4F3LB 1HD8A 2O99A 2OLUA 3ICYA 4HNBA 2V2FF 5IHVA 1YMSA 1RP5A 1NLZA 3IF5A 4CLCD 3V50A 2O9BA 1H8YA 1XGIA 3TJZC 3HCYA 2ZOIA 3Q82A 4LRXC 3VP0A 4Q8IA 1VM1A 4D2OA 4G3VA 5FQKA 5IU1A 2BG1A 3EQVA 5FEGA 1FCMA 5EUAA 3V39A 1LSXA 3SH8A 4QY6A 4DE1A 1VEUA 4Y15A 5HWTA 2PRFA 2QJ5A 3HJIA 3Q7ZA 2X01A 2ZM8A 3GQZA 4P0MA 4BL2A 1UWPX 2JCHA 1NRFA 1X0OA 1JWZA 1OTEA 3CITA 2PAVP 2V1ZA 2YKFA 4FTXA 3N7WA 5TBMA 3VP3A 3UMDA 3TSGA 3ZNTA 2GJ3A 1W79A 4LPZA 3ZCZA 3R4KA 2XQZA 2ZQAA 3OOVA 2J3TD 4JPMA 5TJJA 3WS1A 3G31A 2OOLA 5F6AA 2EWVA 2Q9MA 4QU3A 3UB5P 3DWKA 2OV5A 4HOIA 3ITBA 5HDSA 3AGFA 4Y0TA 1Q2QA 5TGFA 3A3EA 1D06A 1OT6A 2O9CA 1IKGA 4Y0UA 2JKTI 2WKEA 3GDIA 3ZG5A 3EEHA 1WYBA 2PD8A 2J7VA 3IT9A 5KIZA 5HARA 1ES4A 3SS4A 3ULFA 2C5WB 2DCFA 3HVFA 4XT2A 2QZ6A 4P6ZS 2VEAA 1H8MA 1EROA 1TS8A 2OSUA 5J4EA 4L9GA 4GCZA 1M6KA 5L09A 3VV4A 2IA2A 1JTDA 3Q81A 4N9KA 2PT7A 4JGPA 3CPTA 2BLSA 2J9OA 2K2NA 5LBRA 2QKPA 4UEYA 1M40A 4K0WA 4I38A 1XJ4A 4I39A 1FCNA 4GS9B 3FKVA 1NZUA 2ZL1A 2IWBA 1K6RA 3VP1A 4L9EA 3G30A 3CJMA 3NULA 3ZG9B 5FASA 2JHEA 3FPVA 4YNRA 4OOMA 1W63M 3T4JA 3WS2A 2KLIA 4WMCD 1CI9A 4S2OA 1GHMA 4MDZA 4BLMA 3GSGA 1YLJA 3BM6A 4ARZA 5CHJA 5HAPA 5FDHA 1LI9A 3HL9A 2VZWA 4QY5A 2GNXA 2R9XA 1IFQA 1FILA 2UV0E 3B42A 3EQUA 5DFYA 5FAQA 3LICA 4NG2A 3QP5A 3C4OA 2Y79A 1AWIA 2HDSA 2BASA 2FFFB 3HLFA 1IKIA 1TVFA 3MMHA 4WZ5C 2Y2HA 4Q0IA 4M4XA 3OLOA 3CHWP 1CF0A 3HLGA 3UPOA 4E3MA 1S1YA 3E2KA 1G5UA 1DP8A 5EFWA 4RA7A 4X25A 4DJ3A 1W8QA 4BQMA 1ESIA 1VQQA 3UDFA 3Q1FA 1IYOA 2VLGA 2CMNA 1XA7A 4FD8A 3N8RA 5DVAA 1SKOB 3HUNA 3T4QA 4EU0A 5FAOA 2XSSA 3I7JA 1PZPA 3MKEA 2EFXA 2JE5A 4GDBA 2OWHA 3S22A 3GVBA 1GSXA 4LCLA 5DFXA 3WS0A 1MKMA 1O07A 4GJ4A 4KG6A 3ZGAB 1YQSA 5EV0A 1DJBA 4EEUA 5M18A 3PBNA 4KQQA 4O7DA 5HFOA 4KUKA 2W1TB 4H6JB 1DY6A 5HWVA 5KZHA 1GA0A 2Y4AA 1S4RA 2PR5A 4UQIS 4E3LA 2FZ0A 5J3WA 1ZHHB 5EOOA 2JN7A 1GHIA 4KZAA 2ZQ7A 3JVUA 3MZEA 3KO6A 3IH9A 4CLCC 3HLEA 1SKOA 4ZJ2A 2GDNA 4CLCA 3CMZA 5FI6A 1KVMA 3DTKA 1SDEA 5F68A 5AVEA 4R1GA 3CI6A 2JKGA 1KVLA 3IBJA 5TR7A 3IWQA 3PHYA 4XUXA 2Y2GA 3T1RA 2Y2PA 1F98A 3LYXA 3A3FA 1LL5A 4X53A 3MFDA 5HWWA 1MXOA 1GSWA 3ZVWA 4IBXA 4EERA 1RGYA 5BOHA 2P04A 4DF6A 1YLWA 3UMEA 4E04A 3ZQ5A 4IUHA 1PNEA 1P9RA 2Y8HA 4E6WA 3W4QA 5HX9A 2ZQCA 3OC2A 3ZFZA 4WZ4A 4BBUA 4YFMA 4LGWA 1L0FA 1OTAA 3BLMA 2H5SA 2FH5A 4Z1WA 1ERQA 3WRZA 1VETA 4Z9QA 4BMWA 3M6HA 1KGEA 2JKRM 1NYYA 3RXXA 2MJ6A 3UB7A 2HGVA 5M19A 5HL6A 3IX3A 1XFQA 3V5MA 2EX9A 1W5DA 2BTFP 5CHUA 4MCWA 3RJUA 1GCEA 3HLCA 4JXVA 4WF0A 1TS6A 4BBVA 4E3NA 4MMNA 5EVLA 5E2GA 4HHDA 3GECA 3HBRA 4LV1A 3N4IA 2H10A 3UNWA 1VB6A 1ODVA 5JYPA 3UDXA 4DDSA 5GHYA 4OH0A 4RYEA 4ZAMA 4KENB 1PW1A 2V8FA 3HJKA 2G2UA 4WELA 1XGJA 2HDQA 2YKHA 5AQ7A 3UE3A 4Q0JA 4GW9A 1E3UD 1G6AA 1W63Q 1U60A 3F1PA 2PBYA 2ACGA 3M2KA 1ZKJA 1YLTA 1N9LA 5CTNA 4EQ1A 1DJAA 3D3OA 4ETXA 1Y4OA 3VSLA 4OLDA 3EGXC 3W4PA 2M7UA 1NYMA 4FSFA 3OZHA 2HV1A 3MF0A 1IELA 3W2ZA 1JTGA 1H8ZA 1IYSA 1SDNA 4IJGA 3CG5A 4JGRA 5HPFA 1SCWA 5IT5A 1K38A 4R38A 4CLCB 4GOGA 4R3AA 4HBUA 4BJPA 4R3BA 5E2FA 5FQQA 5MC7A 4OLGA 1XKZA 4OQGA 3QP8A 2W27A 4HI4A 2M1CA 4N92A 5G18A 1Z09A 3VSKA 2D01A 3H82B 1H0MA 4QD4A 5J8XA 3NDGA 1A0KA 4E3JA 2Y2KA 3CPTB 4LV2A 3B33A 3UY6A 3PBOA 1J3WA 3DW0A 4WMCA 1G6OA 2W3DA 4EUVA 3H82A 1VETB 5TFQA 3IF6B 4IVIA 5EM1A 1DP6A 3AGDA 4O01A 2WGVA 4A5RA 2VGKA 4KQOA 4EUZA 1Q2PA 1QMFA 5A90A 5DJUA 3N8LA 4XXRA 4OKPA 5EECA 1S67L 2KDKA 4R6LA 3K3DA 1N9NA 3ZHHA 3LIAA 4OPQA 1DRMA 2O9AA 3AGEA 3B47A 4N1XA 1XX2A 4E6XA 1I2SA 5DKKA 5E43A 1K57A 3LI8A 2ZM2A 3OPHA 3OCLA 4BENA 1Z6FA 2K7SA 4IUKA 5A92A 4C75A 2GX5A 1S66L 3UN7A 3UO9A 1XP4A 3HLBA 3TW8A 3A0SA 5HD5A 3E0YA 2AVXA 5CX7A 1OTDA 1K4FA 4IVKA 4KQRA 1FSWA 3S1YA 2ZC5B 2I9VA 2ZLYA 4R23A 4X69A 1YPRA 4WUJA 2ZC6B 3K2NA 1IEMA 3LY4A 1D7EA 3D4FA 3OPLA 4ARZB 4XT2B 4EW7A 2XH9A 4ZBEA 3IHBA 5KSHA 2XDMA 1YLZA 4U3TA 4YOFA 2Y2OA 3PXPA 2EX2A 3BFGA 4K08A 2WYXA 1ALQA 4JXWA 5CEDA 2OWJA 1C3BA 4X55A 4MN6A 2HDRA 3KYEA 5L10A 4MNRA 3JVVA 5EVIA 4P6BA 3WRTA 3SW1A 2EXAA 4MLLA 2ZC7A 5J7EA 4B93A 1V9YA 2J80A 3OPRA 3F1NA 4JF4A 4S2IA 5E2EA 2R78A 3SH9A 2Y59A 4LFUA 3T4TA 4GNUA 4N9LA 1D1JA 3E4PA 1DJCA 1RGZA 2QWSA 2EX8A 4FUWA 1CK3A 3T1SA 3JYIA 1FR1A 4BD0A 1MWUA 3UE1A 4O0PA 4OQ0A 4ZDXA 3RXWA 3BW6A 4FH2A 3DBAA 3HUOA 3W4OA 4EBPA 1PFLA 3NIAA 4QB8A 2L0WA 4LV3A 3S7NA 1CEFA 5FI2A 4BWIA 4KZ4A 3F1OA 3NC8A 2JKTM 1TS0A 1BLCA 5CTMA 3E4OA 5HAQA 3T1QB 2ZC4B 1BYWA 1ZTUA 5DF9A 3LY3A 4PPRA 5EVEA 2PU4A 5F82A 1F9IA 4ESPA 2HDUA 5CGXA 2O0YA 2WAFA 3SS5A 3NJAA 3MQQA 3ITAA 5CEBA 5U47A 1XJ2A 3VOLA 3D72A 4WEJA 3MXQA 4KZ5A 2XA7M 2J3WA 2JKRI 1ZG4A 3OBFA 3HREA 3LR3A 4HP9A 2Y2NA 3PBRA 2Y2QA 3SS3A 5F69A 3TE8A 1BULA 2ZD8A 2ZBBA 2VGLS 2EX6A 1J9MA 5F83A 1O7EA 5HL1A 2HF6A 2QJ7A 4S2NA 2P7JA 4JBFA 5GHXA 3BWLA 4JKTA 3MZDA 4O8GA 1BLPA 1OTBA 1XA1A 1BUEA 2PDRA 4N1HA 1K4EA 2W0NA 3F1OB 3G2YA 2WAEA 5D3OA 2XF3A 2Y91A 4JGOA 1E3UA 3W8KA 5GLCA 5FL3A 3LIBA 1W8YA 2PYRA 2WKPA 3UB6A 1YT4A 2D02A 3KSHA 3RTYA 2NUTC 2ZM0A 1GA9A 3D9YA 1ESUA 3A3IA 3IS2A 2VKSA 4BD1A 1L3LA 4NKPA 3BRMA 1FIKA 3G4PA 1K6SA 1PRQA 1YM1A 4NXEA 3VFFA 2WKQA 5FEFA 2E8IA 1TDLA 5EM0A 1H5XA 4Y3IA 1PWCA 1I5QA 2OLVA 4LRYC 1BSGA 1ACFA 2VJWA 5FQMA 3IQAA 3EEAA 1G68A 3SOIA 5GL9A 3A3JA 1OJGA 1OMEA 3NY4A 5DF8A 1VHMA 2WKIA 3LR5A 5HW3A 3PAGA 4EEPA 2JBFA 1K25A 2W1TA 2V1AA 3KSGA 5EE8A 5GLDA 4Y7PA 3MR0A 3R7WA 3S7PA 3T4LA 3VOZA 2B02A 2LB9A 1FCOA 3VMAA 5E2HA 3L7HA 3IH8A 3NBLA 2ZMVA 2P9VB 3BYDA 4Y0OA 3H9WA 1STZA 2V8CA 3UB8A 4NXGA 4M3KA 3A3DA 3CLOA
chains in the Genus database with same CATH topology
4EESA 2ZMFA 3PR6A 4CQHA 1D06A 1OT6A 2D01A 3H82B 2O9CA 2JKTI 3GDIA 3EEHA 4B9OA 2PD8A 4WEKA 1UWNX 5KIZA 3B33A 4HIAA 3KSIA 3PBOA 3ULFA 4G3WA 4XT2A 2VA0A 4P6ZS 2VEAA 1H8MA 1TS8A 1G6OA 5J4EA 4GHIB 4L9GA 4WLAA 4GCZA 2W3DA 4EUVA 3H82A 3VV4A 1OTIA 3BQ8A 3LI9A 2IA2A 5HZHA 2V9AA 1DP6A 4O01A 2PT7A 2LB5A 3LIFA 4PKYA 4JGPA 1XFNA 5DJTA 4KQOA 2B18A 4YWZA 4EXOA 2K2NA 5LBRA 2QKPA 2PHYA 5DJUA 3F1NB 1WA9A 4UEYA 2WKRA 4I38A 3BY8A 3U2AA 1XJ4A 4I39A 1S67L 1F5MA 2KDKA 4R6LA 4DN0A 3K3DA 1N9NA 2W1RA 2W3GA 3LIAA 4GS9B 3EWKA 1DRMA 2O9AA 5L8MA 4L0LA 2A2LA 4L9EA 3B47A 2VV6A 3P01A 2JHEA 2QHKA 3FPVA 4YNRA 4OOMA 1W63M 1NWZA 5DKKA 3T4JA 3G6OA 2L1MA 1V9ZA 3LI8A 2KLIA 1XJ3A 1S1ZA 2V0UA 3PBSA 2ZOHA 4ME4A 4AFIA 3OCLA 1OPXA 3NOTC 3MJQA 2XA7S 4WL9A 2K7SA 4IUKA 4MDZA 2H28A 5HD3A 1S4SA 2GX5A 4HQAA 5HPIA 4ARZA 1S66L 3K3CA 2VZWA 3NOPC 3TW8A 2GNXA 4HJ3A 1IFQA 3B42A 3EQUA 5DFYA 2PYPA 3A0SA 3RFBA 3LIDA 5HD5A 1LT0A 2HJ9C 3E0YA 3LICA 3BQAA 4HJ4A 5CX7A 1OTDA 5DKLA 2Y79A 2Z6CA 3PYPA 2BASA 4I5SA 3EGDC 1LL8A 4GLQA 3S7QA 1TS7A 1T1AA 2I9VA 4LLOB 4PAUA 3MMHA 4OOLA 4Q0IA 4WUJA 1Y28A 4M4XA 3OLOA 4KUOA 3LFVA 1S1YA 3K2NA 5K5BA 4MN7A 4RQ9A 1D7EA 1DP8A 3FC7A 4G3KA 4ARZB 4I3JA 4XT2B 4EW7A 5EFWA 1EW0A 3S7OA 1MZUA 2EWWA 5KSHA 2KX6A 4DJ3A 4YOFA 3PXPA 5AVFA 2VLGA 3F1PB 1NLYA 2CMNA 4K08A 3MQOA 1KOUA 2OWJA 1P9WA 4EETB 4MN6A 5TBMB 3T4QA 4EU0A 3JVVA 4MN5A 2V0WA 1TF1A 5AJGA 2XSSA 2G7UA 4NXFA 5HDDA 3SW1A 5J7EA 4B93A 2OWHA 1V9YA 2J80A 1GSXA 5DFXA 3F1NA 3C8CA 1MKMA 2R78A 4GJ4A 1OT9A 3E98A 3LIEA 3T4TA 1T1BA 4EEUA 3PBNA 4KUKA 3E4PA 1P0ZA 1UGUA 2W1TB 4H6JB 2QWSA 5HWVA 3V67A 1S4RA 3FG8A 4LRZE 3MQ0A 2PR5A 3CUEA 3NOUC 1T19A 3KX0X 4UQIS 4DJ2A 3A0RA 2FZ0A 5J3WA 1ZHHB 2JN7A 2A24A 4O0PA 5F5YA 2OAP1 3BW6A 1GSVA 1H3QA 3JVUA 2VV8A 2L4RA 3DBAA 3KO6A 2HJEA 5G4YA 4R70A 4CLCC 3PBQA 4HP4A 2KOIA 3EOIA 2L0WA 2V1BA 3FPWA 3CAXA 3S7NA 4CLCA 3KYZA 5C5KA 1NRJA 4H6JA 4L9FA 4BWIA 4QPRA 5F68A 4HY8A 5I5LA 3F1OA 5AVEA 2JKTM 1TS0A 2XRNA 3CI6A 3CWFA 3R7WB 3IBJA 1MC0A 3E4OA 3PHYA 1T1CA 5HSQA 1OJ5A 3OCNA 5A8BA 1F98A 3LYXA 1BYWA 1ZTUA 5DF9A 2K31A 5HWWA 3A0VA 1GSWA 5IS1A 3T50A 1F9IA 4EERA 3KYQA 2O0YA 1N9OA 2VX8A 2P04A 5HDCA 3NJAA 3MQQA 3UMEA 4E04A 3MFXA 3ZQ5A 3C38A 1TD5A 1XJ2A 4IUHA 3VOLA 1P9RA 2Y8HA 3D72A 4WEJA 3MXQA 1YAXA 3OC2A 2XA7M 4BBUA 2J3WA 1P97A 2W3EA 2JKRI 4DMZA 4FOFA 3OBFA 1OTAA 4F3LA 2VGLM 3LR3A 4HP9A 4IHQA 2P08A 3PBTA 3PBRA 1G28A 2FH5A 4Z1WA 1LSVA 3P7NA 5F69A 2Z6DA 3TE8A 4HH3A 1YSPA 3KSFA 4HH2A 4I3AA 2ZBBA 4UQIM 4BMWA 3NHQA 2VGLS 3E4QA 4PHTA 2JKRM 1YKDA 4WN5A 4Q0HA 3VE3A 5G4ZA 2MJ6A 2HF6A 2QJ7A 3UB7A 2HGVA 2W3HA 2P7JA 4ZRRA 3T4KA 5HL6A 3BWLA 1XFQA 2VV7A 3T4SA 4CLCE 4MCWA 4I3IA 3H7WB 4O8GA 3IS2B 3H7WA 2EA9A 1T18A 1OTBA 4GHIA 2M7VA 4ETZA 4WF0A 2PR6A 1TS6A 4BBVA 2PDRA 4MMNA 3C30A 1XJ6A 2W0NA 2OAQ1 3F1OB 3LR0A 4Y2FA 4KQDA 4HHDA 4NXBA 4JGOA 3GECA 2NUPC 3ZYTA 5FL3A 2QYBA 3LIBA 4II7A 1VB6A 1ODVA 4F3LB 2O99A 2PYRA 3O5YA 2WKPA 3ICYA 4HNBA 3UB6A 2XROA 2D02A 3KSHA 3RTYA 2NUTC 4CLCD 1NLZA 3RH8B 3UE6A 2INWA 3IS2A 2VKSA 3LUQA 1IOUA 2O9BA 4NKPA 3LR4A 3TJZC 3HCYA 2ZOIA 3BY9A 2J3TC 4LRXC 4NEED 4G3VA 5IU1A 3HJKA 3EQVA 4BBTA 4NXEA 4WELA 1LSXA 2WKQA 2YKHA 3UE3A 4Q0JA 4Y3IA 5HWTA 4GW9A 2W3FA 4GS9A 4LRYC 4JGQA 2A24B 1W63Q 2QJ5A 2VJWA 3HJIA 3BJNA 3F1PA 1DP9A 3VE4A 1N9LA 3CUEC 1UWPX 3EEAA 3T4OA 3IBRA 1OJGA 1JNUA 1X0OA 1OTEA 1VHMA 3CITA 3LR5A 4EQ1A 4HJ6A 2YKFA 5TBMA 3D3OA 4ETXA 2DMWA 4EEPA 2W1TA 3EGXC 2V1AA 3KSGA 3UMDA 4P6ZM 4FSFA 2M7UA 2HV1A 3TRCA 2GJ3A 3MF0A 3W2ZA 4LPZA 3MR0A 3R4KA 3R7WA 3S7PA 1LSWA 3OOVA 3T4LA 2J3TD 5TJJA 4PKYG 4IJGA 2B02A 2LB9A 2OOLA 5F6AA 2PD7A 4JGRA 5HPFA 2EWVA 5IT5A 4R38A 4CLCB 2ZMVA 4R3AA 4BJPA 4HOIA 5MC7A 1YSQA 3H9WA 1STZA 3C2WA 3UB8A 5HDSA 4NXGA 2W27A 4HI4A 4Y5FA 3UB9A 2GZAA 2M1CA 3CLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HHD A;  4NXB A;  1LL8 A;  4JGO A;  3GEC A;  1TS7 A;  4EES A;  1T1A A;  2L0W A;  2I9V A;  1D06 A;  2V1B A;  1OT6 A;  2D01 A;  3CAX A;  3H82 B;  3LIB A;  4LLO B;  1VB6 A;  1ODV A;  4F3L B;  2PYR A;  4EQ1 A;  3GDI A;  3EEH A;  4H6J A;  4L9F A;  4WUJ A;  2PD8 A;  1Y28 A;  2WKP A;  3ICY A;  4HNB A;  4M4X A;  5F68 A;  3UB6 A;  4HY8 A;  3OLO A;  5I5L A;  3F1O A;  4KUO A;  5AVE A;  2D02 A;  1UWN X;  1TS0 A;  5KIZ A;  1S1Y A;  3B33 A;  4HIA A;  3RTY A;  4RQ9 A;  3RH8 B;  3UE6 A;  1D7E A;  2INW A;  1DP8 A;  3ULF A;  3FC7 A;  3CWF A;  3IS2 A;  4XT2 A;  3LUQ A;  4I3J A;  4XT2 B;  4EW7 A;  2VEA A;  3E4O A;  5EFW A;  3PHY A;  1TS8 A;  1T1C A;  5J4E A;  1EW0 A;  5HSQ A;  1OJ5 A;  4GHI B;  4L9G A;  4WLA A;  2ZOI A;  4GCZ A;  1MZU A;  3BY9 A;  1F98 A;  3H82 A;  1BYW A;  3LYX A;  2KX6 A;  4DJ3 A;  1OTI A;  5A8B A;  3LI9 A;  4LRX C;  5HZH A;  5HWW A;  2V9A A;  1DP6 A;  3A0V A;  1GSW A;  5AVF A;  5IU1 A;  5IS1 A;  3T50 A;  3HJK A;  3LIF A;  2VLG A;  1F9I A;  3F1P B;  4PKY A;  4BBT A;  4JGP A;  2CMN A;  1XFN A;  4K08 A;  5DJT A;  4EER A;  3MQO A;  1KOU A;  4YWZ A;  4NXE A;  1N9O A;  5HDC A;  4EXO A;  2OWJ A;  3NJA A;  4EET B;  2QKP A;  3MQQ A;  1LSX A;  2PHY A;  2WKQ A;  4MN6 A;  5DJU A;  3MFX A;  2YKH A;  5TBM B;  3UME A;  3F1N B;  3ZQ5 A;  1WA9 A;  1XJ2 A;  4E04 A;  3VOL A;  4MN5 A;  2WKR A;  2V0W A;  3D72 A;  4I38 A;  3MXQ A;  3BY8 A;  1XJ4 A;  4I39 A;  4NXF A;  1S67 L;  2KDK A;  4GW9 A;  5HDD A;  5HWT A;  4R6L A;  3SW1 A;  4GS9 A;  3K3D A;  4LRY C;  1N9N A;  1P97 A;  3LIA A;  4GS9 B;  4JGQ A;  4BBU A;  2A24 B;  3EWK A;  5J7E A;  4I5S A;  1OTA A;  4F3L A;  2QJ5 A;  1DRM A;  3HJI A;  2OWH A;  4HP9 A;  1V9Y A;  2J80 A;  1GSX A;  4L9E A;  3F1P A;  3F1N A;  1DP9 A;  3C8C A;  3VE4 A;  4B9O A;  1G28 A;  2VV6 A;  4KQD A;  1N9L A;  2JHE A;  2QHK A;  2R78 A;  1LSV A;  1UWP X;  3P7N A;  5F69 A;  2Z6D A;  3IBR A;  1NWZ A;  4HH3 A;  1OJG A;  5DKK A;  1OT9 A;  3G6O A;  1JNU A;  1X0O A;  3LIE A;  1OTE A;  4HH2 A;  2L1M A;  4I3A A;  1V9Z A;  2ZBB A;  1T1B A;  3LI8 A;  3NHQ A;  2YKF A;  4HJ6 A;  5TBM A;  4EEU A;  1XJ3 A;  3E4Q A;  1S1Z A;  2V0U A;  2ZOH A;  3E4P A;  1P0Z A;  1UGU A;  4KUK A;  4WN5 A;  3VE3 A;  4EEP A;  4H6J B;  5G4Z A;  2V1A A;  2QWS A;  3UMD A;  5HWV A;  3NOT C;  2QJ7 A;  3UB7 A;  3MJQ A;  2HV1 A;  2P7J A;  1S4R A;  3FG8 A;  3BWL A;  2K7S A;  4WL9 A;  1XFQ A;  2VV7 A;  4LRZ E;  2GJ3 A;  2PR5 A;  2H28 A;  4I3I A;  5HD3 A;  3H7W B;  1S4S A;  3NOU C;  4HQA A;  1T19 A;  4LPZ A;  3MR0 A;  3IS2 B;  1S66 L;  2EA9 A;  3H7W A;  3K3C A;  3KX0 X;  1LSW A;  4DJ2 A;  1T18 A;  1OTB A;  4PKY G;  3NOP C;  2B02 A;  3A0R A;  4GHI A;  4BBV A;  5J3W A;  2OOL A;  5F6A A;  2PD7 A;  4HJ3 A;  2JN7 A;  4JGR A;  2A24 A;  5F5Y A;  2PYP A;  2PR6 A;  1TS6 A;  1GSV A;  3A0S A;  3LID A;  4WF0 A;  1LT0 A;  2PDR A;  4R38 A;  2VV8 A;  3LIC A;  4R3A A;  5HD5 A;  4HJ4 A;  1XJ6 A;  2L4R A;  4HOI A;  5G4Y A;  4R70 A;  2W0N A;  1OTD A;  3F1O B;  3H9W A;  3C2W A;  5DKL A;  3UB8 A;  5HDS A;  4NXG A;  2W27 A;  2Z6C A;  3PYP A;  4HI4 A;  3UB9 A;  4HP4 A;  2BAS A;  2M1C A;  3CLO A; 
#chains in the Genus database with same CATH topology
 2ZMF A;  3VOY A;  4CQH A;  4HBT A;  4JF6 A;  4WYY A;  5FQJ A;  3FZC A;  5KSC A;  4ID4 A;  2V20 A;  1UWN X;  5GLB A;  2ZJ9 A;  4UAA A;  1IYP A;  4GHI B;  2HP5 A;  3ZDJ A;  5L2F A;  2VGJ A;  3BQ8 A;  4HES A;  3LI9 A;  3HLD A;  2V9A A;  1KDW A;  4F94 A;  3MSH A;  4KZ9 A;  1CJF A;  1N9B A;  1XFN A;  1S6R A;  3IXD A;  2XD5 A;  4YWZ A;  4EXO A;  4JXS A;  4S2N C;  5EPH A;  4Y17 A;  1MY8 A;  2PHY A;  4X1L A;  3HUM A;  1ES5 A;  2J9P A;  2WKR A;  3U2A A;  3SH7 A;  1BZA A;  4DN0 A;  3Q7V A;  2W3G A;  2W1R A;  1XPB A;  2CC1 A;  1FQG A;  2UWX A;  4L0L A;  2P9V A;  3LEQ A;  2QHK A;  2WGI A;  3ZG8 B;  4KZ8 A;  1K54 A;  3G6O A;  2L1M A;  1K56 A;  4YIN A;  2ZOH A;  3ISG A;  3NOT C;  4RVA A;  3MJQ A;  2XA7 S;  5FSR A;  5HD3 A;  4HQA A;  4C6Y A;  3K3C A;  4X68 A;  2Y2L A;  3ZNY A;  2X02 A;  5GHZ A;  4P87 A;  1TEM A;  4PM9 A;  2B95 A;  2PYP A;  3LID A;  1KE4 A;  1LT0 A;  2HJ9 C;  4R0Q A;  3BQA A;  2XD1 A;  3GV9 A;  4GN2 A;  3IX4 A;  3BFD A;  3WWX A;  3DTM A;  4K0X A;  2IWC A;  4I5S A;  1LL8 A;  5F1F A;  5EVI B;  4LLO B;  4PAU A;  3GTC A;  1N4O A;  5FQI A;  2R9W A;  3P09 A;  4RQ9 A;  3FC7 A;  4G3K A;  4S2J A;  4I3J A;  3MZF A;  1EW0 A;  3S7O A;  2J8Y A;  3QP4 A;  2RL3 A;  4LV0 A;  3BFC A;  1K55 A;  1MWR A;  1NLY A;  3MQO A;  1KOU A;  4S2P A;  1BT5 A;  3DWZ A;  1P9W A;  4EET B;  2FFY A;  4MN5 A;  2V0W A;  1TF1 A;  5AJG A;  3IXG A;  2G7U A;  4NXF A;  2B5R A;  3L9K A;  1E25 A;  4CJN A;  1ONG A;  3QP6 A;  1ES2 A;  5GLA A;  4KZ6 A;  4MBF A;  5FQ9 A;  4DE0 A;  4OVD A;  1NXY A;  1OT9 A;  3E98 A;  1K57 C;  4UA7 A;  2JC7 A;  1T1B A;  5AQ9 A;  2A3U A;  3NCK A;  4BL3 A;  1LL9 A;  1P0Z A;  2WZX A;  1HZO A;  3G35 A;  4MEZ A;  2ZC3 B;  5I94 A;  4OP8 A;  5F1G A;  3NOU C;  3QP1 A;  3KX0 X;  4DJ2 A;  1EI5 A;  3A0R A;  3C5A A;  3IWI A;  4FH4 A;  3ZG0 A;  5F5Y A;  2OAP 1;  3BFF A;  1H3Q A;  4PM5 A;  3IWO A;  1K55 C;  2HJE A;  4R70 A;  5G4Y A;  3B3X A;  4HP4 A;  2KOI A;  4DKI A;  2A49 A;  3BEB A;  4WBG A;  2V1B A;  3CAX A;  1NJ4 A;  4QJG A;  5C5K A;  1NRJ A;  4UHU A;  4H6J A;  4HY8 A;  2HPB A;  3QNB A;  2XRN A;  5CXW A;  5DTS A;  4DRT A;  3DTE A;  3CWF A;  1MC0 A;  1OJ5 A;  3IHA A;  1CQA A;  1MWS A;  2XFS A;  4DDY A;  4NET A;  3T50 A;  1E4D A;  1LLB A;  4GD6 A;  2VX8 A;  2ZL1 B;  5HDC A;  3NEC A;  4EWF A;  3MFX A;  3PTE A;  1TD5 A;  1LHY A;  3UPN A;  1P97 A;  5FDS A;  2HP6 A;  1LI0 A;  4FOF A;  4F3L A;  2P08 A;  2IWD A;  3BLS A;  3P7N A;  5KMW A;  2RCX A;  2Z6D A;  3FV7 A;  4HH3 A;  3KSF A;  2Q9N A;  4I3A A;  4UQI M;  3NHQ A;  2P74 A;  3VE3 A;  4RX3 A;  5G4Z A;  3T4K A;  2QPN A;  3LGO A;  5CRF A;  2VV7 A;  2WGW B;  2X71 A;  3T4S A;  4CLC E;  4I3I A;  3H7W B;  1L2S A;  4DXB A;  2EA9 A;  1T18 A;  4DXC A;  1FOF A;  2ZQ9 A;  1YMX A;  4LEN A;  2M7V A;  1CEG A;  1FSY A;  4ETZ A;  5FAP A;  3BEC A;  4C3Q A;  3C7U A;  1XJ6 A;  3V3R A;  2OAQ 1;  4QWO A;  3LR0 A;  2WKH A;  4KQD A;  3ZYT A;  3GRJ A;  3O5Y A;  1MBL A;  4PMA A;  2PBD P;  2XRO A;  3IF6 A;  3MKF A;  2G2W A;  1NY0 A;  5CER A;  3RH8 B;  3UE6 A;  2INW A;  4UA9 A;  3LUQ A;  1IOU A;  3IF6 C;  3LR4 A;  3BY9 A;  2J3T C;  5L07 A;  1KE0 A;  1MWT A;  4NEE D;  4OPZ A;  4BBT A;  1ES3 A;  3G32 A;  2Y2I A;  5JYO A;  4XUZ A;  4EBL A;  4X1M A;  1VEU B;  1JWP A;  2W3F A;  4GS9 A;  4JGQ A;  2A24 B;  5CGS A;  4KZ7 A;  3BJN A;  3MBZ A;  3LCE A;  1DP9 A;  3VE4 A;  3CUE C;  4ZJ3 A;  3T4O A;  3IBR A;  4OON A;  1JNU A;  1AXB A;  2ZQD A;  4HJ6 A;  5FI7 A;  2XEP A;  2DMW A;  5EOE A;  4P85 A;  1BTL A;  3MXR A;  4P6Z M;  4IED A;  3TRC A;  1WYC A;  4X6T A;  1LSW A;  4E3I A;  1MPL A;  4PKY G;  4Y13 A;  3OPP A;  1FR6 A;  2PD7 A;  3ZVT A;  4S2K A;  3UE0 A;  1YSQ A;  3C2W A;  2EFU A;  2JKF A;  4Y5F A;  3UB9 A;  2GZA A;  1PWG A;  4EES A;  2C6W B;  3PR6 A;  3IXH A;  4NK3 A;  4B9O A;  4WEK A;  3DAV A;  3PAE A;  4E3O A;  4OQH A;  1Y54 A;  4RX2 A;  5DF7 A;  1I2W A;  4HIA A;  3KSI A;  2VK3 A;  1KDS A;  3G2Z A;  4G3W A;  2VA0 A;  2WAD A;  4B88 A;  3T1X A;  4WLA A;  1K0K A;  3M2J A;  1OTI A;  1SHV A;  5HZH A;  1L0E A;  2E8J A;  5AQA A;  3LO7 A;  3LIF A;  2LB5 A;  4PKY A;  5DJT A;  3BFE A;  4JXG A;  2B18 A;  1HTZ A;  4H8R A;  4OQI A;  4S2M A;  3T12 B;  3F1N B;  1WA9 A;  1YLP A;  4U0T A;  3BY8 A;  2XGN A;  3GR2 A;  1F5M A;  3P98 A;  4DE3 A;  5FA7 A;  3EWK A;  2QMI A;  3MXS A;  3UPP A;  2WZZ A;  4D60 A;  5L8M A;  1BLH A;  3O87 A;  2A2L A;  2ZMA A;  2VV6 A;  1PI5 A;  3C7V A;  3P01 A;  1PYY A;  1WE4 A;  4KG2 A;  3WS5 A;  1NWZ A;  4KG5 A;  4PM6 A;  1V9Z A;  3UDI A;  1XJ3 A;  1S1Z A;  2V0U A;  3PBS A;  4ME4 A;  5A91 A;  4AFI A;  1KGG A;  4U0X A;  4EQI A;  1OPX A;  1TDG A;  3V3S A;  4WL9 A;  1F2K A;  2H28 A;  1S4S A;  5HPI A;  4WM9 A;  3CZD A;  2WK0 A;  3NOP C;  3MS6 A;  4HJ3 A;  4OPR A;  3Q7V B;  3RFB A;  3N8S A;  4HJ4 A;  1PZO A;  4DE2 A;  1HLU P;  5DKL A;  3FKW A;  2Z6C A;  3PYP A;  4UA6 A;  1ZG6 A;  3EGD C;  4GLQ A;  3S7Q A;  1TS7 A;  1T1A A;  4HEF A;  4QHC A;  2Y2M A;  4OOL A;  4ZTK A;  1Y28 A;  4KUO A;  3LFV A;  4X56 A;  5AQB A;  5K5B A;  4MN7 A;  1SZV A;  2H0Y A;  1MZU A;  2EWW A;  5EVI D;  2KX6 A;  4EBN A;  4E3K A;  4GB7 A;  1S0W A;  4EV4 A;  3VFH A;  3IX8 A;  5AVF A;  5M1A A;  3F1P B;  3FWL A;  2EXB A;  1JVJ A;  1NZO A;  3C4P A;  5TBM B;  4S2L A;  1PWD A;  3VP2 A;  4JF5 A;  3QNC A;  5HDD A;  5HAI A;  3GMW A;  4GDN A;  2Q0O A;  1YLY A;  5CHM A;  1RCJ A;  1PW8 A;  3TG9 A;  3HLW A;  2WGW A;  3C8C A;  5DTK A;  4KZB A;  3E2L A;  4K91 A;  5CEC A;  3LIE A;  3NDE A;  4JLF A;  1EWZ A;  1UGU A;  2H0T A;  3V67 A;  3FG8 A;  1K54 C;  4LRZ E;  3MQ0 A;  2HP9 A;  1PI4 A;  3CUE A;  5FAT A;  1T19 A;  2XR0 A;  4R4R A;  2WUQ A;  5EVI C;  4GZB A;  4B4Z A;  2A24 A;  4OPY A;  2ZQ8 A;  1GSV A;  2VV8 A;  1W7F A;  2L4R A;  3IXB A;  3O88 A;  3U4L P;  1SKF A;  3PBQ A;  3O86 A;  3EOI A;  3LEZ A;  4B4X A;  4FCF A;  1MKI A;  4WZ5 A;  3FPW A;  3KYZ A;  4L9F A;  3SZT A;  4QPR A;  5I5L A;  3QP2 A;  1CI8 A;  3DTI A;  3R7W B;  1ONH A;  1XXM A;  1PIO A;  4R3J A;  1T1C A;  3Q07 A;  5HSQ A;  3OCN A;  5A93 A;  2DNS A;  2PU2 A;  5A8B A;  3NI9 A;  2K31 A;  2I72 A;  3A0V A;  4ZJ1 A;  5IS1 A;  1IYQ A;  1BLS A;  4MBH A;  3KYQ A;  3M6B A;  2Z2M B;  1N9O A;  4GD8 A;  3C38 A;  1YAX A;  5DTT A;  2Y55 A;  2W3E A;  4DMZ A;  3N6I A;  2VGL M;  4OOY A;  4PM7 A;  4IHQ A;  1L0D A;  1ZC2 A;  2DRW A;  2Y2J A;  3PBT A;  1G28 A;  3ZG7 B;  1LSV A;  3WS4 A;  1YSP A;  3S4X A;  4R4S A;  4HH2 A;  2XFT A;  4CPK A;  3E4Q A;  4PHT A;  1YKD A;  4WN5 A;  4Q0H A;  2W3H A;  4ZRR A;  1ERM A;  4IBR A;  1JWV A;  3IS2 B;  3H7W A;  4KZ3 A;  3TOI A;  3QHY A;  5CGW A;  4LCM A;  2XLN A;  4GHI A;  2XK1 A;  1KGF A;  2Z2L B;  1KE3 A;  2PR6 A;  1GHP A;  1HVB A;  3C30 A;  3G34 A;  3FYZ A;  4Y2F A;  2HZ5 A;  1L0G A;  3JPU A;  1K56 D;  4MBK A;  3O3V A;  4NXB A;  4GKU A;  2NUP C;  4PM8 A;  4OP5 A;  2QYB A;  4II7 A;  1QME A;  3VP4 A;  4F3L B;  1HD8 A;  2O99 A;  2OLU A;  3ICY A;  4HNB A;  2V2F F;  5IHV A;  1YMS A;  1RP5 A;  1NLZ A;  3IF5 A;  4CLC D;  3V50 A;  2O9B A;  1H8Y A;  1XGI A;  3TJZ C;  3HCY A;  2ZOI A;  3Q82 A;  4LRX C;  3VP0 A;  4Q8I A;  1VM1 A;  4D2O A;  4G3V A;  5FQK A;  5IU1 A;  2BG1 A;  3EQV A;  5FEG A;  1FCM A;  5EUA A;  3V39 A;  1LSX A;  3SH8 A;  4QY6 A;  4DE1 A;  1VEU A;  4Y15 A;  5HWT A;  2PRF A;  2QJ5 A;  3HJI A;  3Q7Z A;  2X01 A;  2ZM8 A;  3GQZ A;  4P0M A;  4BL2 A;  1UWP X;  2JCH A;  1NRF A;  1X0O A;  1JWZ A;  1OTE A;  3CIT A;  2PAV P;  2V1Z A;  2YKF A;  4FTX A;  3N7W A;  5TBM A;  3VP3 A;  3UMD A;  3TSG A;  3ZNT A;  2GJ3 A;  1W79 A;  4LPZ A;  3ZCZ A;  3R4K A;  2XQZ A;  2ZQA A;  3OOV A;  2J3T D;  4JPM A;  5TJJ A;  3WS1 A;  3G31 A;  2OOL A;  5F6A A;  2EWV A;  2Q9M A;  4QU3 A;  3UB5 P;  3DWK A;  2OV5 A;  4HOI A;  3ITB A;  5HDS A;  3AGF A;  4Y0T A;  1Q2Q A;  5TGF A;  3A3E A;  1D06 A;  1OT6 A;  2O9C A;  1IKG A;  4Y0U A;  2JKT I;  2WKE A;  3GDI A;  3ZG5 A;  3EEH A;  1WYB A;  2PD8 A;  2J7V A;  3IT9 A;  5KIZ A;  5HAR A;  1ES4 A;  3SS4 A;  3ULF A;  2C5W B;  2DCF A;  3HVF A;  4XT2 A;  2QZ6 A;  4P6Z S;  2VEA A;  1H8M A;  1ERO A;  1TS8 A;  2OSU A;  5J4E A;  4L9G A;  4GCZ A;  1M6K A;  5L09 A;  3VV4 A;  2IA2 A;  1JTD A;  3Q81 A;  4N9K A;  2PT7 A;  4JGP A;  3CPT A;  2BLS A;  2J9O A;  2K2N A;  5LBR A;  2QKP A;  4UEY A;  1M40 A;  4K0W A;  4I38 A;  1XJ4 A;  4I39 A;  1FCN A;  4GS9 B;  3FKV A;  1NZU A;  2ZL1 A;  2IWB A;  1K6R A;  3VP1 A;  4L9E A;  3G30 A;  3CJM A;  3NUL A;  3ZG9 B;  5FAS A;  2JHE A;  3FPV A;  4YNR A;  4OOM A;  1W63 M;  3T4J A;  3WS2 A;  2KLI A;  4WMC D;  1CI9 A;  4S2O A;  1GHM A;  4MDZ A;  4BLM A;  3GSG A;  1YLJ A;  3BM6 A;  4ARZ A;  5CHJ A;  5HAP A;  5FDH A;  1LI9 A;  3HL9 A;  2VZW A;  4QY5 A;  2GNX A;  2R9X A;  1IFQ A;  1FIL A;  2UV0 E;  3B42 A;  3EQU A;  5DFY A;  5FAQ A;  3LIC A;  4NG2 A;  3QP5 A;  3C4O A;  2Y79 A;  1AWI A;  2HDS A;  2BAS A;  2FFF B;  3HLF A;  1IKI A;  1TVF A;  3MMH A;  4WZ5 C;  2Y2H A;  4Q0I A;  4M4X A;  3OLO A;  3CHW P;  1CF0 A;  3HLG A;  3UPO A;  4E3M A;  1S1Y A;  3E2K A;  1G5U A;  1DP8 A;  5EFW A;  4RA7 A;  4X25 A;  4DJ3 A;  1W8Q A;  4BQM A;  1ESI A;  1VQQ A;  3UDF A;  3Q1F A;  1IYO A;  2VLG A;  2CMN A;  1XA7 A;  4FD8 A;  3N8R A;  5DVA A;  1SKO B;  3HUN A;  3T4Q A;  4EU0 A;  5FAO A;  2XSS A;  3I7J A;  1PZP A;  3MKE A;  2EFX A;  2JE5 A;  4GDB A;  2OWH A;  3S22 A;  3GVB A;  1GSX A;  4LCL A;  5DFX A;  3WS0 A;  1MKM A;  1O07 A;  4GJ4 A;  4KG6 A;  3ZGA B;  1YQS A;  5EV0 A;  1DJB A;  4EEU A;  5M18 A;  3PBN A;  4KQQ A;  4O7D A;  5HFO A;  4KUK A;  2W1T B;  4H6J B;  1DY6 A;  5HWV A;  5KZH A;  1GA0 A;  2Y4A A;  1S4R A;  2PR5 A;  4UQI S;  4E3L A;  2FZ0 A;  5J3W A;  1ZHH B;  5EOO A;  2JN7 A;  1GHI A;  4KZA A;  2ZQ7 A;  3JVU A;  3MZE A;  3KO6 A;  3IH9 A;  4CLC C;  3HLE A;  1SKO A;  4ZJ2 A;  2GDN A;  4CLC A;  3CMZ A;  5FI6 A;  1KVM A;  3DTK A;  1SDE A;  5F68 A;  5AVE A;  4R1G A;  3CI6 A;  2JKG A;  1KVL A;  3IBJ A;  5TR7 A;  3IWQ A;  3PHY A;  4XUX A;  2Y2G A;  3T1R A;  2Y2P A;  1F98 A;  3LYX A;  3A3F A;  1LL5 A;  4X53 A;  3MFD A;  5HWW A;  1MXO A;  1GSW A;  3ZVW A;  4IBX A;  4EER A;  1RGY A;  5BOH A;  2P04 A;  4DF6 A;  1YLW A;  3UME A;  4E04 A;  3ZQ5 A;  4IUH A;  1PNE A;  1P9R A;  2Y8H A;  4E6W A;  3W4Q A;  5HX9 A;  2ZQC A;  3OC2 A;  3ZFZ A;  4WZ4 A;  4BBU A;  4YFM A;  4LGW A;  1L0F A;  1OTA A;  3BLM A;  2H5S A;  2FH5 A;  4Z1W A;  1ERQ A;  3WRZ A;  1VET A;  4Z9Q A;  4BMW A;  3M6H A;  1KGE A;  2JKR M;  1NYY A;  3RXX A;  2MJ6 A;  3UB7 A;  2HGV A;  5M19 A;  5HL6 A;  3IX3 A;  1XFQ A;  3V5M A;  2EX9 A;  1W5D A;  2BTF P;  5CHU A;  4MCW A;  3RJU A;  1GCE A;  3HLC A;  4JXV A;  4WF0 A;  1TS6 A;  4BBV A;  4E3N A;  4MMN A;  5EVL A;  5E2G A;  4HHD A;  3GEC A;  3HBR A;  4LV1 A;  3N4I A;  2H10 A;  3UNW A;  1VB6 A;  1ODV A;  5JYP A;  3UDX A;  4DDS A;  5GHY A;  4OH0 A;  4RYE A;  4ZAM A;  4KEN B;  1PW1 A;  2V8F A;  3HJK A;  2G2U A;  4WEL A;  1XGJ A;  2HDQ A;  2YKH A;  5AQ7 A;  3UE3 A;  4Q0J A;  4GW9 A;  1E3U D;  1G6A A;  1W63 Q;  1U60 A;  3F1P A;  2PBY A;  2ACG A;  3M2K A;  1ZKJ A;  1YLT A;  1N9L A;  5CTN A;  4EQ1 A;  1DJA A;  3D3O A;  4ETX A;  1Y4O A;  3VSL A;  4OLD A;  3EGX C;  3W4P A;  2M7U A;  1NYM A;  4FSF A;  3OZH A;  2HV1 A;  3MF0 A;  1IEL A;  3W2Z A;  1JTG A;  1H8Z A;  1IYS A;  1SDN A;  4IJG A;  3CG5 A;  4JGR A;  5HPF A;  1SCW A;  5IT5 A;  1K38 A;  4R38 A;  4CLC B;  4GOG A;  4R3A A;  4HBU A;  4BJP A;  4R3B A;  5E2F A;  5FQQ A;  5MC7 A;  4OLG A;  1XKZ A;  4OQG A;  3QP8 A;  2W27 A;  4HI4 A;  2M1C A;  4N92 A;  5G18 A;  1Z09 A;  3VSK A;  2D01 A;  3H82 B;  1H0M A;  4QD4 A;  5J8X A;  3NDG A;  1A0K A;  4E3J A;  2Y2K A;  3CPT B;  4LV2 A;  3B33 A;  3UY6 A;  3PBO A;  1J3W A;  3DW0 A;  4WMC A;  1G6O A;  2W3D A;  4EUV A;  3H82 A;  1VET B;  5TFQ A;  3IF6 B;  4IVI A;  5EM1 A;  1DP6 A;  3AGD A;  4O01 A;  2WGV A;  4A5R A;  2VGK A;  4KQO A;  4EUZ A;  1Q2P A;  1QMF A;  5A90 A;  5DJU A;  3N8L A;  4XXR A;  4OKP A;  5EEC A;  1S67 L;  2KDK A;  4R6L A;  3K3D A;  1N9N A;  3ZHH A;  3LIA A;  4OPQ A;  1DRM A;  2O9A A;  3AGE A;  3B47 A;  4N1X A;  1XX2 A;  4E6X A;  1I2S A;  5DKK A;  5E43 A;  1K57 A;  3LI8 A;  2ZM2 A;  3OPH A;  3OCL A;  4BEN A;  1Z6F A;  2K7S A;  4IUK A;  5A92 A;  4C75 A;  2GX5 A;  1S66 L;  3UN7 A;  3UO9 A;  1XP4 A;  3HLB A;  3TW8 A;  3A0S A;  5HD5 A;  3E0Y A;  2AVX A;  5CX7 A;  1OTD A;  1K4F A;  4IVK A;  4KQR A;  1FSW A;  3S1Y A;  2ZC5 B;  2I9V A;  2ZLY A;  4R23 A;  4X69 A;  1YPR A;  4WUJ A;  2ZC6 B;  3K2N A;  1IEM A;  3LY4 A;  1D7E A;  3D4F A;  3OPL A;  4ARZ B;  4XT2 B;  4EW7 A;  2XH9 A;  4ZBE A;  3IHB A;  5KSH A;  2XDM A;  1YLZ A;  4U3T A;  4YOF A;  2Y2O A;  3PXP A;  2EX2 A;  3BFG A;  4K08 A;  2WYX A;  1ALQ A;  4JXW A;  5CED A;  2OWJ A;  1C3B A;  4X55 A;  4MN6 A;  2HDR A;  3KYE A;  5L10 A;  4MNR A;  3JVV A;  5EVI A;  4P6B A;  3WRT A;  3SW1 A;  2EXA A;  4MLL A;  2ZC7 A;  5J7E A;  4B93 A;  1V9Y A;  2J80 A;  3OPR A;  3F1N A;  4JF4 A;  4S2I A;  5E2E A;  2R78 A;  3SH9 A;  2Y59 A;  4LFU A;  3T4T A;  4GNU A;  4N9L A;  1D1J A;  3E4P A;  1DJC A;  1RGZ A;  2QWS A;  2EX8 A;  4FUW A;  1CK3 A;  3T1S A;  3JYI A;  1FR1 A;  4BD0 A;  1MWU A;  3UE1 A;  4O0P A;  4OQ0 A;  4ZDX A;  3RXW A;  3BW6 A;  4FH2 A;  3DBA A;  3HUO A;  3W4O A;  4EBP A;  1PFL A;  3NIA A;  4QB8 A;  2L0W A;  4LV3 A;  3S7N A;  1CEF A;  5FI2 A;  4BWI A;  4KZ4 A;  3F1O A;  3NC8 A;  2JKT M;  1TS0 A;  1BLC A;  5CTM A;  3E4O A;  5HAQ A;  3T1Q B;  2ZC4 B;  1BYW A;  1ZTU A;  5DF9 A;  3LY3 A;  4PPR A;  5EVE A;  2PU4 A;  5F82 A;  1F9I A;  4ESP A;  2HDU A;  5CGX A;  2O0Y A;  2WAF A;  3SS5 A;  3NJA A;  3MQQ A;  3ITA A;  5CEB A;  5U47 A;  1XJ2 A;  3VOL A;  3D72 A;  4WEJ A;  3MXQ A;  4KZ5 A;  2XA7 M;  2J3W A;  2JKR I;  1ZG4 A;  3OBF A;  3HRE A;  3LR3 A;  4HP9 A;  2Y2N A;  3PBR A;  2Y2Q A;  3SS3 A;  5F69 A;  3TE8 A;  1BUL A;  2ZD8 A;  2ZBB A;  2VGL S;  2EX6 A;  1J9M A;  5F83 A;  1O7E A;  5HL1 A;  2HF6 A;  2QJ7 A;  4S2N A;  2P7J A;  4JBF A;  5GHX A;  3BWL A;  4JKT A;  3MZD A;  4O8G A;  1BLP A;  1OTB A;  1XA1 A;  1BUE A;  2PDR A;  4N1H A;  1K4E A;  2W0N A;  3F1O B;  3G2Y A;  2WAE A;  5D3O A;  2XF3 A;  2Y91 A;  4JGO A;  1E3U A;  3W8K A;  5GLC A;  5FL3 A;  3LIB A;  1W8Y A;  2PYR A;  2WKP A;  3UB6 A;  1YT4 A;  2D02 A;  3KSH A;  3RTY A;  2NUT C;  2ZM0 A;  1GA9 A;  3D9Y A;  1ESU A;  3A3I A;  3IS2 A;  2VKS A;  4BD1 A;  1L3L A;  4NKP A;  3BRM A;  1FIK A;  3G4P A;  1K6S A;  1PRQ A;  1YM1 A;  4NXE A;  3VFF A;  2WKQ A;  5FEF A;  2E8I A;  1TDL A;  5EM0 A;  1H5X A;  4Y3I A;  1PWC A;  1I5Q A;  2OLV A;  4LRY C;  1BSG A;  1ACF A;  2VJW A;  5FQM A;  3IQA A;  3EEA A;  1G68 A;  3SOI A;  5GL9 A;  3A3J A;  1OJG A;  1OME A;  3NY4 A;  5DF8 A;  1VHM A;  2WKI A;  3LR5 A;  5HW3 A;  3PAG A;  4EEP A;  2JBF A;  1K25 A;  2W1T A;  2V1A A;  3KSG A;  5EE8 A;  5GLD A;  4Y7P A;  3MR0 A;  3R7W A;  3S7P A;  3T4L A;  3VOZ A;  2B02 A;  2LB9 A;  1FCO A;  3VMA A;  5E2H A;  3L7H A;  3IH8 A;  3NBL A;  2ZMV A;  2P9V B;  3BYD A;  4Y0O A;  3H9W A;  1STZ A;  2V8C A;  3UB8 A;  4NXG A;  4M3K A;  3A3D A;  3CLO A; 
#chains in the Genus database with same CATH homology
 4EES A;  2ZMF A;  3PR6 A;  4CQH A;  1D06 A;  1OT6 A;  2D01 A;  3H82 B;  2O9C A;  2JKT I;  3GDI A;  3EEH A;  4B9O A;  2PD8 A;  4WEK A;  1UWN X;  5KIZ A;  3B33 A;  4HIA A;  3KSI A;  3PBO A;  3ULF A;  4G3W A;  4XT2 A;  2VA0 A;  4P6Z S;  2VEA A;  1H8M A;  1TS8 A;  1G6O A;  5J4E A;  4GHI B;  4L9G A;  4WLA A;  4GCZ A;  2W3D A;  4EUV A;  3H82 A;  3VV4 A;  1OTI A;  3BQ8 A;  3LI9 A;  2IA2 A;  5HZH A;  2V9A A;  1DP6 A;  4O01 A;  2PT7 A;  2LB5 A;  3LIF A;  4PKY A;  4JGP A;  1XFN A;  5DJT A;  4KQO A;  2B18 A;  4YWZ A;  4EXO A;  2K2N A;  5LBR A;  2QKP A;  2PHY A;  5DJU A;  3F1N B;  1WA9 A;  4UEY A;  2WKR A;  4I38 A;  3BY8 A;  3U2A A;  1XJ4 A;  4I39 A;  1S67 L;  1F5M A;  2KDK A;  4R6L A;  4DN0 A;  3K3D A;  1N9N A;  2W1R A;  2W3G A;  3LIA A;  4GS9 B;  3EWK A;  1DRM A;  2O9A A;  5L8M A;  4L0L A;  2A2L A;  4L9E A;  3B47 A;  2VV6 A;  3P01 A;  2JHE A;  2QHK A;  3FPV A;  4YNR A;  4OOM A;  1W63 M;  1NWZ A;  5DKK A;  3T4J A;  3G6O A;  2L1M A;  1V9Z A;  3LI8 A;  2KLI A;  1XJ3 A;  1S1Z A;  2V0U A;  3PBS A;  2ZOH A;  4ME4 A;  4AFI A;  3OCL A;  1OPX A;  3NOT C;  3MJQ A;  2XA7 S;  4WL9 A;  2K7S A;  4IUK A;  4MDZ A;  2H28 A;  5HD3 A;  1S4S A;  2GX5 A;  4HQA A;  5HPI A;  4ARZ A;  1S66 L;  3K3C A;  2VZW A;  3NOP C;  3TW8 A;  2GNX A;  4HJ3 A;  1IFQ A;  3B42 A;  3EQU A;  5DFY A;  2PYP A;  3A0S A;  3RFB A;  3LID A;  5HD5 A;  1LT0 A;  2HJ9 C;  3E0Y A;  3LIC A;  3BQA A;  4HJ4 A;  5CX7 A;  1OTD A;  5DKL A;  2Y79 A;  2Z6C A;  3PYP A;  2BAS A;  4I5S A;  3EGD C;  1LL8 A;  4GLQ A;  3S7Q A;  1TS7 A;  1T1A A;  2I9V A;  4LLO B;  4PAU A;  3MMH A;  4OOL A;  4Q0I A;  4WUJ A;  1Y28 A;  4M4X A;  3OLO A;  4KUO A;  3LFV A;  1S1Y A;  3K2N A;  5K5B A;  4MN7 A;  4RQ9 A;  1D7E A;  1DP8 A;  3FC7 A;  4G3K A;  4ARZ B;  4I3J A;  4XT2 B;  4EW7 A;  5EFW A;  1EW0 A;  3S7O A;  1MZU A;  2EWW A;  5KSH A;  2KX6 A;  4DJ3 A;  4YOF A;  3PXP A;  5AVF A;  2VLG A;  3F1P B;  1NLY A;  2CMN A;  4K08 A;  3MQO A;  1KOU A;  2OWJ A;  1P9W A;  4EET B;  4MN6 A;  5TBM B;  3T4Q A;  4EU0 A;  3JVV A;  4MN5 A;  2V0W A;  1TF1 A;  5AJG A;  2XSS A;  2G7U A;  4NXF A;  5HDD A;  3SW1 A;  5J7E A;  4B93 A;  2OWH A;  1V9Y A;  2J80 A;  1GSX A;  5DFX A;  3F1N A;  3C8C A;  1MKM A;  2R78 A;  4GJ4 A;  1OT9 A;  3E98 A;  3LIE A;  3T4T A;  1T1B A;  4EEU A;  3PBN A;  4KUK A;  3E4P A;  1P0Z A;  1UGU A;  2W1T B;  4H6J B;  2QWS A;  5HWV A;  3V67 A;  1S4R A;  3FG8 A;  4LRZ E;  3MQ0 A;  2PR5 A;  3CUE A;  3NOU C;  1T19 A;  3KX0 X;  4UQI S;  4DJ2 A;  3A0R A;  2FZ0 A;  5J3W A;  1ZHH B;  2JN7 A;  2A24 A;  4O0P A;  5F5Y A;  2OAP 1;  3BW6 A;  1GSV A;  1H3Q A;  3JVU A;  2VV8 A;  2L4R A;  3DBA A;  3KO6 A;  2HJE A;  5G4Y A;  4R70 A;  4CLC C;  3PBQ A;  4HP4 A;  2KOI A;  3EOI A;  2L0W A;  2V1B A;  3FPW A;  3CAX A;  3S7N A;  4CLC A;  3KYZ A;  5C5K A;  1NRJ A;  4H6J A;  4L9F A;  4BWI A;  4QPR A;  5F68 A;  4HY8 A;  5I5L A;  3F1O A;  5AVE A;  2JKT M;  1TS0 A;  2XRN A;  3CI6 A;  3CWF A;  3R7W B;  3IBJ A;  1MC0 A;  3E4O A;  3PHY A;  1T1C A;  5HSQ A;  1OJ5 A;  3OCN A;  5A8B A;  1F98 A;  3LYX A;  1BYW A;  1ZTU A;  5DF9 A;  2K31 A;  5HWW A;  3A0V A;  1GSW A;  5IS1 A;  3T50 A;  1F9I A;  4EER A;  3KYQ A;  2O0Y A;  1N9O A;  2VX8 A;  2P04 A;  5HDC A;  3NJA A;  3MQQ A;  3UME A;  4E04 A;  3MFX A;  3ZQ5 A;  3C38 A;  1TD5 A;  1XJ2 A;  4IUH A;  3VOL A;  1P9R A;  2Y8H A;  3D72 A;  4WEJ A;  3MXQ A;  1YAX A;  3OC2 A;  2XA7 M;  4BBU A;  2J3W A;  1P97 A;  2W3E A;  2JKR I;  4DMZ A;  4FOF A;  3OBF A;  1OTA A;  4F3L A;  2VGL M;  3LR3 A;  4HP9 A;  4IHQ A;  2P08 A;  3PBT A;  3PBR A;  1G28 A;  2FH5 A;  4Z1W A;  1LSV A;  3P7N A;  5F69 A;  2Z6D A;  3TE8 A;  4HH3 A;  1YSP A;  3KSF A;  4HH2 A;  4I3A A;  2ZBB A;  4UQI M;  4BMW A;  3NHQ A;  2VGL S;  3E4Q A;  4PHT A;  2JKR M;  1YKD A;  4WN5 A;  4Q0H A;  3VE3 A;  5G4Z A;  2MJ6 A;  2HF6 A;  2QJ7 A;  3UB7 A;  2HGV A;  2W3H A;  2P7J A;  4ZRR A;  3T4K A;  5HL6 A;  3BWL A;  1XFQ A;  2VV7 A;  3T4S A;  4CLC E;  4MCW A;  4I3I A;  3H7W B;  4O8G A;  3IS2 B;  3H7W A;  2EA9 A;  1T18 A;  1OTB A;  4GHI A;  2M7V A;  4ETZ A;  4WF0 A;  2PR6 A;  1TS6 A;  4BBV A;  2PDR A;  4MMN A;  3C30 A;  1XJ6 A;  2W0N A;  2OAQ 1;  3F1O B;  3LR0 A;  4Y2F A;  4KQD A;  4HHD A;  4NXB A;  4JGO A;  3GEC A;  2NUP C;  3ZYT A;  5FL3 A;  2QYB A;  3LIB A;  4II7 A;  1VB6 A;  1ODV A;  4F3L B;  2O99 A;  2PYR A;  3O5Y A;  2WKP A;  3ICY A;  4HNB A;  3UB6 A;  2XRO A;  2D02 A;  3KSH A;  3RTY A;  2NUT C;  4CLC D;  1NLZ A;  3RH8 B;  3UE6 A;  2INW A;  3IS2 A;  2VKS A;  3LUQ A;  1IOU A;  2O9B A;  4NKP A;  3LR4 A;  3TJZ C;  3HCY A;  2ZOI A;  3BY9 A;  2J3T C;  4LRX C;  4NEE D;  4G3V A;  5IU1 A;  3HJK A;  3EQV A;  4BBT A;  4NXE A;  4WEL A;  1LSX A;  2WKQ A;  2YKH A;  3UE3 A;  4Q0J A;  4Y3I A;  5HWT A;  4GW9 A;  2W3F A;  4GS9 A;  4LRY C;  4JGQ A;  2A24 B;  1W63 Q;  2QJ5 A;  2VJW A;  3HJI A;  3BJN A;  3F1P A;  1DP9 A;  3VE4 A;  1N9L A;  3CUE C;  1UWP X;  3EEA A;  3T4O A;  3IBR A;  1OJG A;  1JNU A;  1X0O A;  1OTE A;  1VHM A;  3CIT A;  3LR5 A;  4EQ1 A;  4HJ6 A;  2YKF A;  5TBM A;  3D3O A;  4ETX A;  2DMW A;  4EEP A;  2W1T A;  3EGX C;  2V1A A;  3KSG A;  3UMD A;  4P6Z M;  4FSF A;  2M7U A;  2HV1 A;  3TRC A;  2GJ3 A;  3MF0 A;  3W2Z A;  4LPZ A;  3MR0 A;  3R4K A;  3R7W A;  3S7P A;  1LSW A;  3OOV A;  3T4L A;  2J3T D;  5TJJ A;  4PKY G;  4IJG A;  2B02 A;  2LB9 A;  2OOL A;  5F6A A;  2PD7 A;  4JGR A;  5HPF A;  2EWV A;  5IT5 A;  4R38 A;  4CLC B;  2ZMV A;  4R3A A;  4BJP A;  4HOI A;  5MC7 A;  1YSQ A;  3H9W A;  1STZ A;  3C2W A;  3UB8 A;  5HDS A;  4NXG A;  2W27 A;  4HI4 A;  4Y5F A;  3UB9 A;  2GZA A;  2M1C A;  3CLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...