5DJTA

Crystal structure of lov2 (c450a) domain in complex with zdk2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
144
structure length
144
Chain Sequence
SLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NPH1-2
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Avena sativa
molecule tags Signaling protein
total genus 48
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djtA00
3GECA 4GS9B 2QJ7A 4R3AA 1GSXA 3H7WB 2L4RA 1LL8A 4XT2B 2I9VA 4KUKA 2D02A 3ULFA 3GDIA 4L9EA 3UB8A 4GS9A 3BY8A 5HD3A 3H7WA 2PD8A 4NXEA 3B33A 4XT2A 3F1OB 4H6JB 3P7NA 1S1ZA 2V0UA 2PHYA 1OTDA 2GJ3A 2V9AA 2JN7A 4PKYG 4HJ4A 2JHEA 1OJ5A 3MQQA 1GSVA 1DRMA 3F1OA 4H6JA 1TS6A 3E4OA 1EW0A 3A0RA 5F68A 1LSWA 2PDRA 1S1YA 3NOUC 5TBMB 1T18A 3LIAA 4GCZA 2OWHA 1T1BA 3C8CA 3UB9A 3A0SA 2CMNA 3OLOA 4KQDA 3K3CA 1F98A 4NXGA 5F69A 2OWJA 4HJ3A 2W0NA 1G28A 5HWWA 4WF0A 2YKHA 3SW1A 4LRZE 5TBMA 3FC7A 2V0WA 3UB7A 5I5LA 4HH2A 1LSVA 1P0ZA 1XFQA 3VE3A 5DKKA 1UWPX 1OTBA 2ZBBA 2D01A 1XJ3A 3BY9A 4EEUA 4R70A 3PYPA 1T1CA 4EXOA 4HP4A 4R38A 5HDDA 1V9YA 2PYRA 1S4RA 5DKLA 3RH8B 1DP6A 4WLAA 2Z6DA 3MR0A 4DJ2A 1UGUA 3A0VA 2ZOIA 2PD7A 4HI4A 3VE4A 4LRXC 1WA9A 3NJAA 4DJ3A 4BBUA 4L9GA 3VOLA 2PR6A 2W27A 5F5YA 2VV8A 1TS8A 4NXFA 3UE6A 4EW7A 1T1AA 3LI9A 2V1AA 4NXBA 5J3WA 4HP9A 1N9OA 1T19A 3C2WA 1P97A 5G4YA 3IBRA 1XFNA 1TS7A 1OT9A 4HHDA 1XJ2A 3LUQA 3LI8A 3PHYA 3LIBA 5HD5A 3ICYA 2M1CA 4EETB 4MN6A 1MZUA 3BWLA 5DJUA 4BBTA 1OTAA 1NWZA 4E04A 4BBVA 2L0WA 2VLGA 4GHIB 1LSXA 2QWSA 4I3IA 5HSQA 2VV7A 4YWZA 5HZHA 2PR5A 2YKFA 3IS2B 4GHIA 4I5SA 1Y28A 4LLOB 2QJ5A 4HIAA 2EA9A 1XJ4A 3K3DA 4LRYC 1VB6A 5EFWA 3IS2A 3UMDA 1D7EA 3NOPC 2B02A 5HWTA 4I3JA 1LT0A 3H9WA 3MQOA 2ZOHA 1N9LA 2H28A 3F1PB 4M4XA 2KDKA 3H82B 1BYWA 3CWFA 3ZQ5A 4JGQA 2J80A 3RTYA 2OOLA 3F1PA 4EEPA 4MN5A 5AVFA 3H82A 5AVEA 4L9FA 1DP8A 4LPZA 5HWVA 3HJIA 4I3AA 4F3LB 2L1MA 1D06A 4HNBA 1V9ZA 4HJ6A 4JGRA 5IU1A 2HV1A 3E4PA 4B9OA 5HDCA 4F3LA 4I38A 4R6LA 3LYXA 1DP9A 3MJQA 5J7EA 2WKQA 1ODVA 4EESA 3E4QA 1JNUA 3MFXA 1X0OA 1OT6A 4WL9A 4EERA 1OTEA 4GW9A 1XJ6A 1GSWA 2WKRA 4JGPA 4PKYA 2PYPA 1KOUA 3UB6A 4I39A 2K7SA 5HDSA 3LIEA 3LIFA 5IS1A 3CAXA 3EEHA 4HH3A 4KUOA 4HY8A 2A24B 3G6OA 2VV6A 5G4ZA 4EQ1A 5F6AA 2P7JA 3F1NB 1S67L 4RQ9A 4WUJA 4JGOA 1OJGA 3D72A 1UWNX 2VEAA 2A24A 3LICA 4WN5A 3CLOA 3UMEA 2BASA 3F1NA 4HOIA 5DJTA 5J4EA 3EWKA 4HQAA 3NOTC 4K08A 3NHQA 5KIZA 2INWA 1F9IA 3T50A 2Z6CA 2KX6A 2WKPA 2QHKA 3KX0X 2R78A 1N9NA 3FG8A 1OTIA 2QKPA 1TS0A 1S4SA 3MXQA 5A8BA 2V1BA 1S66L 3LIDA 3HJKA
chains in the Genus database with same CATH superfamily
3VV4A 3QP8A 5EOEA 1GSXA 3H7WB 2L4RA 1LL8A 1O07A 3V39A 4XT2B 3ZVWA 4BJPA 3ULFA 5AQAA 2WGVA 1A0KA 3UB8A 3UDFA 4MBFA 4GS9A 4LV1A 2PU2A 2ZQDA 2PD8A 4ZJ3A 2W3EA 4PAUA 3JYIA 1BLCA 3D3OA 4H6JB 1W8QA 1SDNA 2HP9A 2V0UA 3MMHA 3C7UA 1OTDA 2V9AA 4Y7PA 1K6RA 2JN7A 4KQRA 2GDNA 4HJ4A 3MQQA 2WAEA 3F1OA 4Q8IA 5HAQA 3N8RA 1TS6A 3PAGA 3E2LA 2QMIA 3HUMA 3WRZA 3A0RA 3KSFA 2PDRA 3NOUC 3AGFA 4WYYA 1T18A 3LIAA 3VOYA 2Z2MB 3OLOA 3O88A 4X1LA 3A3JA 1D1JA 1G6OA 2OWJA 5FA7A 4HJ3A 1K6SA 2W0NA 3C38A 2YKHA 4X55A 4X56A 5TBMA 3BW6A 1CI9A 4HEFA 1JWVA 2BTFP 1ZKJA 5I5LA 4DXBA 1YLPA 5AQBA 4HH2A 4R1GA 2WUQA 3K2NA 1XFQA 3MBZA 5J8XA 2XA7M 3MS6A 1H3QA 4II7A 5DF7A 4UA6A 1OTBA 5FATA 2D01A 4QB8A 4EEUA 4OPZA 3P01A 2J9OA 4MLLA 3NBLA 1W63Q 5DKLA 1H5XA 3CITA 4IVIA 3SZTA 1DP6A 2Z6DA 2VGKA 5HPFA 5CEBA 3C4PA 1L0DA 4N1HA 3DWKA 3PBRA 4KZ3A 3A0VA 5CERA 4E6XA 3VE4A 4CLCC 3G4PA 4R4RA 4CLCD 4DJ3A 2I72A 2PR6A 4OPRA 2W27A 2DNSA 1TS8A 1K38A 1W79A 2X02A 2KOIA 4NXBA 2QYBA 1N9OA 3NIAA 3D9YA 2Y2KA 4KZ5A 1Z09A 3V3SA 5GHZA 4MBKA 5HFOA 3T4QA 1TS7A 1L0GA 4R4SA 4S2NC 3VFFA 4E3IA 2FFFB 4JXGA 3LI8A 3PHYA 3W4QA 1JVJA 5KSCA 5A92A 2M1CA 3I7JA 3IX4A 1IOUA 1IYQA 1MZUA 1S0WA 2BLSA 1OTAA 1NWZA 3UB5P 4GHIB 4NEED 3HLWA 3P98A 3S7NA 2VV7A 2Y8HA 2J3WA 3EEAA 4LV0A 3OC2A 1IEMA 2YKFA 1MY8A 3LR4A 4KG6A 1MBLA 5GHXA 5FL3A 4KZBA 1MWTA 4FSFA 3L7HA 5L2FA 3V5MA 3G31A 4BL2A 1SKFA 4YFMA 1D7EA 3NOPC 2J3TC 4XUZA 1BUEA 3GTCA 2P04A 2PAVP 1LT0A 2J3TD 1ZG6A 4WZ4A 3C30A 5FEFA 5CECA 3SS4A 2H28A 1VEUA 4Z1WA 1CQAA 1DJAA 4M4XA 3PTEA 4DDYA 3BFEA 5F1GA 3ZG8B 3ZQ5A 2PRFA 2J80A 4GNUA 4P6ZM 1PWGA 4OONA 1YQSA 3F1PA 2V8CA 1SKOB 1ONGA 4KG5A 5FDHA 4FOFA 1K56D 2Y2PA 3GRJA 5EVEA 1MPLA 3T4TA 5EOOA 3T12B 4HNBA 4JXVA 5L8MA 2Y2IA 3C5AA 3JVUA 4S2JA 1YLZA 4IEDA 1IFQA 1JTGA 2VX8A 5F83A 3LEZA 4CLCA 4I38A 4CQHA 3DTMA 3N8SA 3N8LA 4UA9A 4DE0A 3FPVA 3FZCA 2W3FA 3BRMA 4MCWA 5FQ9A 3Q7VB 1KE4A 2WGWB 4BD0A 1XGIA 4BWIA 3DTKA 4WL9A 2G2WA 4ZBEA 5CHMA 4EERA 1YSPA 4GW9A 2HJ9C 1GA9A 1XJ6A 1GSWA 3CUEC 2XR0A 4OP5A 1KOUA 3PBQA 5MC7A 1TF1A 4BD1A 4O0PA 1PYYA 2O99A 2ZC3B 2DCFA 4B93A 5IS1A 4K91A 3R7WA 1XA7A 4S2MA 2A24B 3VP0A 1P9WA 4WZ5C 2WKHA 1YPRA 3TW8A 3UO9A 2P7JA 3F1NB 1S67L 3BJNA 3S22A 1OJGA 3O86A 2E8IA 3QP5A 3D72A 1QMFA 5DTTA 4OQ0A 3W4OA 3BFDA 1PIOA 5DTKA 1PI5A 3KSHA 3MKFA 2O0YA 5J4EA 4M3KA 5CGXA 4FUWA 4K08A 3NHQA 5KIZA 3ZHHA 2W3HA 3QHYA 3Q82A 2INWA 1IELA 3VP1A 4DE2A 3TJZC 2VGJA 3T50A 4JLFA 4PPRA 3KX0X 5JYPA 3T1XA 1CEGA 2J9PA 4S2LA 5FQMA 2QKPA 3MXQA 2XF3A 1PZOA 5A8BA 4E3NA 4CLCE 5FAPA 3MFDA 5EECA 3HJKA 1E3UD 2W3DA 1NZOA 1K57C 4R3AA 5U47A 4PHTA 1FQGA 4S2KA 2OSUA 4LCMA 4OLDA 1SZVA 4U0TA 1TDGA 2I9VA 2VA0A 4PM5A 5FQKA 3FKVA 4UQIS 2A2LA 4ZAMA 2MJ6A 2H0TA 4EBLA 3B33A 4MMNA 1FCOA 3Q1FA 1S1ZA 2XROA 2PHYA 2GJ3A 3HLEA 4FH2A 1NRJA 3TG9A 3Q7ZA 5HW3A 4N9KA 2P08A 5E43A 3UPNA 3HL9A 2E8JA 5E2GA 4JXWA 1LSWA 4KZAA 2VKSA 2NUPC 3A3FA 2OWHA 3DAVA 1OMEA 2ZL1B 3KYZA 1TD5A 3CUEA 5FI6A 4QPRA 1VETB 1PRQA 1RGZA 2B18A 3G2ZA 1NXYA 3KYQA 3WS4A 4N92A 1YLTA 2JKFA 4OOMA 3FC7A 3UB7A 5EVIA 2W1TA 3VP4A 4WZ5A 3FYZA 3TOIA 4PM7A 1P0ZA 5C5KA 3LY4A 2H10A 4PM9A 2HDUA 1UWPX 3S7PA 4KQOA 2HP5A 4XUXA 4G3VA 1XJ3A 2WGIA 3BY9A 2CC1A 2W3GA 3LCEA 3BQ8A 4ZJ2A 1NLZA 3SH9A 4RYEA 3GSGA 4OQGA 4JPMA 5HDDA 2PYRA 1S4RA 3NECA 5GL9A 4WLAA 4DJ2A 1UGUA 2P9VB 3B47A 3SH8A 3IXDA 1YMXA 3IXGA 2C6WB 4E3JA 4YNRA 1ZC2A 2ZOIA 1W8YA 3GR2A 3G34A 3MSHA 3T1SA 3WS1A 3M2JA 3NJAA 5L09A 2IWCA 2J7VA 1J3WA 3LFVA 3QP4A 3R4KA 4WMCA 5GHYA 5GLCA 5J3WA 1FILA 3ZG7B 1T19A 3C2WA 2VJWA 4EQIA 2ZM8A 5G4YA 1IYPA 3O3VA 1XFNA 3Q81A 5FDSA 4GB7A 4HHDA 1XJ2A 4MDZA 1HD8A 2XK1A 1G6AA 4EETB 5FI7A 3A3DA 4MN6A 5GLBA 4ETXA 4P87A 4E3LA 1VQQA 4PM6A 1Q2QA 4S2OA 1FCNA 2Y79A 3ZFZA 2LB5A 1IKGA 2OAQ1 4UEYA 4EUZA 3DBAA 3W4PA 4I3IA 5HSQA 4LGWA 5HZHA 1VM1A 2ZC5B 2HZ5A 3EQUA 3IS2B 4IBXA 4ARZB 3IF6C 2OAP1 5TR7A 3PBSA 4HIAA 5FSRA 4S2PA 5CGSA 1XP4A 5AQ7A 4LRYC 5KMWA 1BT5A 5LBRA 3OCLA 2HDSA 2B02A 3HLDA 2Q9MA 2EX2A 3NC8A 3OOVA 2M7VA 5DTSA 5HWTA 4EV4A 4I3JA 1LI0A 3H9WA 3E0YA 2ZLYA 4O7DA 1N9LA 4ZTKA 2QZ6A 3PBNA 3IWOA 4GD8A 2XFSA 3IWQA 3ZNTA 4ETZA 1BSGA 1BYWA 3Q07A 3WRTA 1WE4A 3WS0A 5A90A 3V50A 1H0MA 3CWFA 5TJJA 3EGXC 1K4EA 3NDEA 4QJGA 4HESA 5TFQA 4EBPA 2C5WB 4R3BA 1MKMA 4MN5A 3H82A 5AVEA 3CZDA 1AXBA 3UE3A 1CEFA 4Q0HA 3MZEA 1E4DA 5JYOA 3G30A 4F3LB 3JPUA 1NZUA 4EWFA 1K55A 3IHAA 4JGRA 4ID4A 3V3RA 4OQIA 2A49A 5IU1A 4B9OA 5HDCA 2Y91A 1K4FA 3OZHA 3IHBA 3BLMA 2WZXA 1DP9A 2V8FA 2R9WA 2ZD8A 4RA7A 1ODVA 2AVXA 4EESA 1JNUA 3VP2A 1X0OA 4R3JA 5DVAA 1OTEA 2EWVA 2Y2HA 4BENA 5CXWA 5IT5A 2PYPA 4GN2A 3M2KA 3UB6A 4X68A 2V2FF 4Y0UA 2K7SA 2ZQ9A 3WWXA 3NI9A 4IUKA 2EWWA 1GCEA 4DMZA 3IH8A 4E3KA 4HY8A 4NKPA 3ZYTA 5G4ZA 4QU3A 1UWNX 3RXXA 1E25A 1TEMA 1JWPA 3O5YA 5HX9A 2VEAA 2EX6A 3LICA 2XGNA 1KE0A 1NYYA 1I2SA 3G32A 1WYBA 2BASA 3EQVA 3CPTA 4GDNA 3IF6A 4HQAA 4LENA 2K2NA 3VP3A 5G18A 2VGLM 2Y2MA 1FSYA 4Y15A 4PM8A 1F9IA 1NYMA 2OV5A 4G3WA 4DDSA 2WKPA 3QP2A 2V1ZA 2R78A 1N9NA 1H8YA 5CTNA 1CF0A 2O9BA 5KSHA 1OTIA 3HLCA 3MKEA 1BLPA 1S4SA 4F94A 4OH0A 5CRFA 2V1BA 1PZPA 1S66L 4GS9B 2QJ7A 4JKTA 3BM6A 4FD8A 3A3IA 3CMZA 4X25A 2EXBA 3GDIA 1YLJA 4L9EA 3U2AA 1YMSA 4H8RA 2NUTC 2Y55A 5HD3A 3H7WA 5A93A 3UY6A 3SH7A 1YSQA 4XT2A 3F1OB 2HDRA 3LR5A 3BYDA 2XA7S 3BFGA 2BG1A 2LB9A 4QD4A 4PKYG 4S2NA 3CHWP 2VZWA 4ZJ1A 1OJ5A 1U60A 4QHCA 1GSVA 3AGDA 1DRMA 4H6JA 1ZTUA 5F68A 3KYEA 1DJBA 3NY4A 5TBMB 3D4FA 2XD5A 3C8CA 3A0SA 1ERMA 3GMWA 4C3QA 3IQAA 4KQDA 2P74A 3K3CA 4RX2A 3T1RA 2JKGA 4NXGA 5EVLA 3HVFA 3HLGA 4WF0A 3SW1A 3BLSA 4NG2A 1SHVA 4K0WA 3MF0A 3QNBA 3M6BA 3ZDJA 3KO6A 1IYSA 1YAXA 2WKEA 1GA0A 5AQ9A 3VE3A 5DKKA 2VK3A 3BFCA 1I2WA 3B42A 4KQQA 5E2HA 4CJNA 1K25A 2O9AA 5FQJA 1BULA 4OQHA 4R38A 1V9YA 4N1XA 4LFUA 3DW0A 2EX9A 1L2SA 2FFYA 3SS3A 4B88A 3HUNA 4YOFA 4E3OA 3RJUA 4LRXC 4GDBA 4YINA 3IF5A 4X6TA 3PBOA 4WBGA 4L9GA 3VOLA 1K56A 5F5YA 4P0MA 4NXFA 4ESPA 4MN7A 3N6IA 2B95A 3LI9A 4HP9A 1L0EA 1GHPA 5D3OA 5E2FA 1LI9A 1GHIA 5CGWA 3HREA 3DWZA 4BLMA 3IBRA 4B4ZA 4Y17A 1YLWA 1MC0A 1MWSA 1KGFA 3T4JA 3LIBA 2IWDA 3ICYA 4S2IA 2M7UA 5CTMA 1KGGA 4KG2A 2O9CA 3BWLA 1YLYA 4BBTA 2UV0E 1ALQA 4E04A 3EOIA 3WS2A 4B4XA 4BBVA 2VGLS 3OCNA 2XRNA 4WELA 2K31A 4P6ZS 1SDEA 3N7WA 3OPLA 4UA7A 1KGEA 3LO7A 1GHMA 4IJGA 3IT9A 4C6YA 2ZM2A 1BTLA 3DTIA 3NCKA 5EM0A 4GHIA 2WAFA 3UN7A 4I5SA 1Y28A 2RCXA 2JKTM 4LLOB 1PW8A 4RVAA 4D2OA 2EA9A 3K3DA 4JF4A 4JF6A 5CHUA 1Y4OA 3VMAA 1VEUB 4QY5A 1VB6A 1BLSA 3UMDA 1ACFA 1KE3A 3M6HA 4K0XA 3CJMA 2JKRM 3MQOA 3IH9A 2ZOHA 2JC7A 3F1PB 4DRTA 4OOYA 3VOZA 3OBFA 1O7EA 1XGJA 4JGQA 3CI6A 1Z6FA 3RTYA 2Z2LB 2J8YA 3TRCA 4EEPA 3NDGA 4L9FA 4LPZA 4ZDXA 3T4SA 3HJIA 5M18A 4E3MA 3SOIA 4I3AA 4CLCB 4OLGA 1MWUA 1D06A 3MXSA 1H8ZA 1V9ZA 1PNEA 2WKIA 1SKOA 2Y2NA 2UWXA 3P09A 1E3UA 4WEKA 1H8MA 1FR1A 2HV1A 4BQMA 2XD1A 1K57A 1RCJA 4R6LA 2ZMAA 1NLYA 4U0XA 1ZHHB 3MJQA 2WKQA 5EUAA 3UPPA 2GNXA 1PWCA 1OT6A 1SCWA 3R7WB 2WKRA 3HCYA 2PBDP 2DMWA 4I39A 4KZ4A 1F5MA 2OLUA 3Q7VA 3QP1A 5HDSA 3LIEA 4Z9QA 2WGWA 4KZ6A 3LR3A 1AWIA 3MXRA 2ACGA 3MZDA 3EEHA 3W8KA 2Q0OA 3LR0A 3G6OA 3UE0A 5BOHA 2VV6A 4EQ1A 3MZFA 1CI8A 5F6AA 3A3EA 5L10A 1PI4A 1PW1A 4OOLA 5M1AA 3ZG5A 1WYCA 2A24A 1FIKA 4KZ8A 2Y2QA 1CJFA 4WN5A 3U4LP 3ZNYA 1L3LA 1FSWA 2EFUA 3F1NA 2B5RA 4OKPA 3LY3A 2ZC7A 3MQ0A 1MWRA 1XKZA 2HGVA 3VSKA 3NOTC 2W1RA 4LV2A 2HPBA 3ZG0A 3W2ZA 3L9KA 2ZQCA 4P85A 4UHUA 1M6KA 1HZOA 2EX8A 3HLFA 1ESIA 2Y2OA 4OVDA 1TS0A 1G68A 5GLDA 3G2YA 4HBUA 3LIDA 4GZBA 3GECA 4L0LA 5IHVA 2PBYA 4Y5FA 3UDIA 1C3BA 1LLBA 3FWLA 3GVBA 4KUKA 4LCLA 2D02A 1L0FA 4FH4A 3SS5A 3BY8A 5DF8A 2Y4AA 3PBTA 4OPYA 2XQZA 3E98A 4Y13A 2Y2JA 4NXEA 4PMAA 3ITAA 3G35A 2X01A 4KZ9A 3P7NA 4BMWA 1K0KA 2HP6A 1HTZA 3RXWA 2JCHA 1KVLA 3CG5A 4P6BA 2ZMFA 1LHYA 1J9MA 1ES4A 2GZAA 2JHEA 2WADA 2R9XA 4R0QA 3RFBA 3E4OA 1EW0A 1KDWA 5FI2A 1W5DA 5CX7A 3OPPA 3UE1A 1STZA 1S1YA 2XH9A 5A91A 1NRFA 4NETA 4GCZA 1S6RA 1T1BA 5M19A 3B3XA 3UB9A 2CMNA 5EVIB 1F98A 3QNCA 2W1TB 1Y54A 3AGEA 1YT4A 5F69A 1IYOA 4JF5A 1G28A 5HWWA 4LRZE 2OLVA 4UQIM 2V0WA 2V20A 3IBJA 2ZL1A 5HAIA 1VETA 3UPOA 4X1MA 1LSVA 4DE3A 1HLUP 3HUOA 1CK3A 4O01A 3HLBA 4NK3A 4O8GA 4GOGA 1DY6A 3JVVA 2ZBBA 3ZGAB 3LEQA 5HL1A 4R70A 1BLHA 4LV3A 3PYPA 2JBFA 5FASA 1T1CA 1LL9A 4EXOA 1ES5A 3KSIA 4HP4A 1EI5A 4ME4A 3RH8B 1N4OA 5CHJA 4AFIA 3MR0A 3FKWA 1EROA 2XFTA 4IBRA 2H5SA 4GLQA 2QPNA 2Y59A 5FQQA 2PU4A 4KZ7A 1ONHA 4A5RA 2PD7A 1BZAA 2H0YA 4HI4A 1NY0A 5HARA 3S4XA 1WA9A 3BQAA 1RP5A 4CPKA 4BBUA 1TDLA 2P9VA 2VV8A 2PT7A 3TE8A 3UE6A 3ZCZA 4WEJA 1W63M 2FZ0A 1T1AA 4EW7A 2V1AA 4OP8A 4GKUA 1Q2PA 4DN0A 1P97A 2ZC6B 4N9LA 4HBTA 3BEBA 3TSGA 2HDQA 4QY6A 1OT9A 2RL3A 4GD6A 4X69A 1FOFA 3LUQA 1VHMA 4FTXA 5HD5A 1P9RA 1K54C 2WK0A 3ISGA 5DJUA 5F82A 1W7FA 3DTEA 1MKIA 1EWZA 1LL5A 1QMEA 2G2UA 4G3KA 4D60A 2L0WA 2VLGA 1LSXA 4U3TA 2QWSA 4Y0OA 4DE1A 3VFHA 1N9BA 3S7OA 2XLNA 4YWZA 2PR5A 2A3UA 5DFYA 5EM1A 2KLIA 3OPRA 4BL3A 5EE8A 5DFXA 5EVIC 3N4IA 2XDMA 5EVID 4JXSA 3IXBA 1YM1A 4IHQA 3BFFA 2X71A 2QJ5A 5HL6A 1XJ4A 2DRWA 5EFWA 2JE5A 2HJEA 3IS2A 1G5UA 3S1YA 4ARZA 1YKDA 3HBRA 1IKIA 4E6WA 5E2EA 4DXCA 1ERQA 3GQZA 2KDKA 1RGYA 3H82B 2ZJ9A 2EXAA 3BECA 5GLAA 3V67A 1KVMA 4Y0TA 3VSLA 3T4LA 2OOLA 2GX5A 1F2KA 2EFXA 3E2KA 5K5BA 1JTDA 5AVFA 4Q0IA 5AJGA 5EPHA 2WZZA 1DP8A 4MEZA 1TVFA 5HWVA 5EV0A 3NULA 4WMCD 2L1MA 4IVKA 3PR6A 4DF6A 3T4OA 2ZQ8A 4HJ6A 1JWZA 1XX2A 1I5QA 1ZG4A 2HF6A 3PAEA 2ZC4B 2ZQ7A 2ZQAA 4FCFA 5KZHA 3E4PA 5HPIA 3C7VA 4QWOA 4F3LA 3T4KA 4EBNA 3QP6A 4EU0A 3IX8A 3EGDC 3LYXA 4Q0JA 4IUHA 2XSSA 5J7EA 3OPHA 2G7UA 3E4QA 5L07A 1PWDA 5F1FA 4MBHA 3MFXA 4RX3A 5I94A 3O87A 3C4OA 1FR6A 4XXRA 3IWIA 3T1QB 4JGPA 4PKYA 5TGFA 1OPXA 5FQIA 2WYXA 3UNWA 4Y2FA 4EUVA 3LIFA 2FH5A 3ZVTA 5CEDA 4C75A 2Q9NA 3CAXA 1K54A 1MXOA 5HAPA 3FV7A 4HH3A 4KUOA 3ZG9B 2Y2LA 3S7QA 3KSGA 1ESUA 1NJ4A 2XEPA 4RQ9A 2JKTI 3LGOA 4WUJA 3CPTB 4JGOA 4JBFA 4GJ4A 3IF6B 1HVBA 1XPBA 2ZMVA 1DJCA 3CLOA 3UMEA 3ITBA 3PXPA 1FCMA 4HOIA 5DF9A 5DJTA 2IWBA 2JKRI 4KENB 3EWKA 4WM9A 4R23A 5FAQA 1ES2A 4ZRRA 3IXHA 3IX3A 1XXMA 3FPWA 4DKIA 5FEGA 4OPQA 3WS5A 2Z6CA 2KX6A 2QHKA 1PFLA 4Y3IA 3GV9A 2Y2GA 3FG8A 4X53A 4MNRA 2IA2A 1KDSA 4UAAA 1K55C 2ZM0A 5FAOA 1M40A 1XA1A 3UDXA 1ES3A
chains in the Genus database with same CATH topology
3VV4A 3GECA 4GS9B 2QJ7A 2W3DA 4L0LA 4R3AA 1GSXA 4PHTA 3H7WB 4Y5FA 2L4RA 1LL8A 4XT2B 2I9VA 4KUKA 2VA0A 2D02A 4BJPA 3ULFA 3GDIA 4L9EA 3U2AA 3UB8A 4GS9A 3BY8A 4UQIS 3PBTA 2NUTC 3E98A 5HD3A 2A2LA 3H7WA 2PD8A 2MJ6A 1YSQA 4NXEA 2W3EA 4PAUA 3B33A 4MMNA 4XT2A 3D3OA 3F1OB 4H6JB 3P7NA 4BMWA 1S1ZA 3LR5A 2V0UA 2XA7S 3MMHA 2ZMFA 2XROA 2PHYA 2LB9A 1OTDA 2GJ3A 2V9AA 2JN7A 1NRJA 4PKYG 2VZWA 4HJ4A 2GZAA 2JHEA 2P08A 1OJ5A 3MQQA 1GSVA 1DRMA 3F1OA 4H6JA 1TS6A 3RFBA 3E4OA 1ZTUA 1EW0A 3A0RA 3KSFA 5F68A 5CX7A 1LSWA 1STZA 2PDRA 1S1YA 3NOUC 2VKSA 2NUPC 5TBMB 1T18A 3LIAA 4GCZA 2OWHA 1T1BA 3C8CA 3UB9A 3KYZA 3A0SA 2CMNA 1TD5A 3OLOA 3CUEA 4KQDA 3K3CA 1F98A 2W1TB 4QPRA 1G6OA 4NXGA 2B18A 5F69A 2OWJA 4HJ3A 3KYQA 2W0NA 1G28A 5HWWA 3C38A 4WF0A 2YKHA 3SW1A 4LRZE 5TBMA 4OOMA 4UQIM 3FC7A 2V0WA 3BW6A 3IBJA 3UB7A 3MF0A 5I5LA 2W1TA 4HH2A 1LSVA 1P0ZA 3K2NA 3KO6A 5C5KA 1XFQA 1YAXA 4O01A 2XA7M 4O8GA 3VE3A 5DKKA 1H3QA 4II7A 1UWPX 3S7PA 4KQOA 3JVVA 1OTBA 2ZBBA 2D01A 4G3VA 1XJ3A 3B42A 3BY9A 4EEUA 2O9AA 4R70A 2W3GA 3PYPA 3BQ8A 3P01A 1T1CA 1NLZA 4EXOA 3KSIA 4HP4A 4R38A 5HDDA 1V9YA 2PYRA 1W63Q 1S4RA 5DKLA 4ME4A 3RH8B 3CITA 1DP6A 4WLAA 2Z6DA 4AFIA 3MR0A 4DJ2A 5HPFA 1UGUA 3B47A 4GLQA 3PBRA 4YNRA 3A0VA 2ZOIA 4YOFA 2PD7A 4HI4A 3VE4A 4LRXC 4CLCC 1WA9A 3BQAA 3NJAA 4CLCD 3PBOA 4DJ3A 4BBUA 4L9GA 3VOLA 2PR6A 2W27A 5F5YA 2VV8A 1TS8A 2PT7A 4NXFA 3TE8A 3UE6A 4MN7A 3LFVA 4WEJA 1W63M 2FZ0A 1T1AA 3LI9A 4EW7A 3R4KA 2V1AA 2KOIA 4NXBA 5J3WA 4HP9A 2QYBA 1N9OA 4DN0A 1T19A 3C2WA 1P97A 2VJWA 5G4YA 3T4QA 3IBRA 1XFNA 1TS7A 1OT9A 1MC0A 4HHDA 1XJ2A 3LUQA 1VHMA 3LI8A 3PHYA 3LIBA 3T4JA 4MDZA 5HD5A 1P9RA 3ICYA 2M1CA 2M7UA 4EETB 4MN6A 2O9CA 1IOUA 1MZUA 3BWLA 5DJUA 4ETXA 4BBTA 1OTAA 1NWZA 4E04A 3EOIA 2Y79A 2LB5A 4G3KA 4BBVA 2L0WA 2VGLS 2VLGA 4GHIB 4NEED 1LSXA 3OCNA 2XRNA 2QWSA 4WELA 3S7NA 2OAQ1 4UEYA 3DBAA 2K31A 4P6ZS 3S7OA 4I3IA 5HSQA 2VV7A 2Y8HA 4YWZA 5HZHA 2J3WA 2PR5A 3EEAA 3OC2A 5DFYA 2YKFA 2KLIA 4IJGA 3EQUA 3LR4A 5DFXA 3IS2B 4GHIA 4ARZB 5FL3A 4FSFA 4I5SA 4IHQA 1Y28A 2JKTM 4LLOB 2OAP1 2QJ5A 3PBSA 4HIAA 5HL6A 2EA9A 1XJ4A 3K3DA 4LRYC 1VB6A 5EFWA 3IS2A 2HJEA 3OCLA 5LBRA 3UMDA 1D7EA 3NOPC 4ARZA 2B02A 2M7VA 2J3TC 3OOVA 5HWTA 4I3JA 1YKDA 2P04A 1LT0A 2J3TD 2JKRM 3H9WA 3E0YA 3MQOA 3C30A 2ZOHA 1N9LA 3PBNA 2H28A 3F1PB 4Z1WA 4M4XA 2KDKA 4ETZA 3H82B 1BYWA 3OBFA 3V67A 3CWFA 5TJJA 3ZQ5A 4JGQA 3EGXC 3CI6A 2J80A 4P6ZM 3RTYA 3T4LA 2OOLA 2GX5A 5K5BA 3F1PA 3TRCA 4EEPA 1MKMA 4MN5A 5AVFA 4Q0IA 5AJGA 3H82A 5AVEA 4L9FA 1DP8A 4LPZA 5HWVA 3UE3A 4FOFA 4Q0HA 3T4SA 3HJIA 3T4TA 4I3AA 4F3LB 4CLCB 2L1MA 3PR6A 1D06A 4HNBA 1V9ZA 5L8MA 3T4OA 4HJ6A 4JGRA 2HF6A 3JVUA 4WEKA 5IU1A 1H8MA 2HV1A 3E4PA 4B9OA 5HPIA 5HDCA 1IFQA 2VX8A 4F3LA 4CLCA 4I38A 3T4KA 4CQHA 4R6LA 4EU0A 3EGDC 3LYXA 1NLYA 4Q0JA 1DP9A 4IUHA 1ZHHB 2XSSA 3FPVA 3MJQA 5J7EA 2W3FA 2WKQA 1ODVA 4MCWA 2G7UA 4EESA 3E4QA 1JNUA 2GNXA 3MFXA 1X0OA 4BWIA 1OT6A 4WL9A 4EERA 1YSPA 1OTEA 4GW9A 2HJ9C 3R7WB 2EWVA 1XJ6A 1GSWA 2WKRA 4JGPA 5IT5A 4PKYA 3CUEC 1OPXA 3HCYA 2PYPA 1KOUA 2DMWA 3PBQA 3UB6A 4I39A 1F5MA 4Y2FA 2K7SA 5MC7A 5HDSA 1TF1A 4EUVA 3LIEA 4IUKA 2EWWA 3LIFA 4O0PA 2FH5A 3LR3A 2O99A 4B93A 4DMZA 5IS1A 3R7WA 3CAXA 3EEHA 4HH3A 4KUOA 4HY8A 2A24B 1P9WA 3LR0A 3G6OA 3S7QA 3KSGA 4NKPA 3TW8A 3ZYTA 2VV6A 5G4ZA 4EQ1A 5F6AA 2P7JA 3F1NB 1S67L 2JKTI 3BJNA 4RQ9A 4WUJA 4OOLA 4JGOA 1OJGA 4GJ4A 3D72A 1UWNX 3O5YA 2VEAA 2A24A 3LICA 4WN5A 2ZMVA 3CLOA 3UMEA 2BASA 3KSHA 3PXPA 3F1NA 4HOIA 3EQVA 5DF9A 5DJTA 2O0YA 2JKRI 3MQ0A 5J4EA 3EWKA 2HGVA 4ZRRA 4HQAA 2K2NA 3NOTC 4K08A 2W1RA 3NHQA 5KIZA 2VGLM 2W3HA 2INWA 3FPWA 1F9IA 3TJZC 3T50A 2Z6CA 3W2ZA 4G3WA 2KX6A 2WKPA 2QHKA 3KX0X 2R78A 1N9NA 4Y3IA 3FG8A 2IA2A 2O9BA 5KSHA 1OTIA 2QKPA 1TS0A 1S4SA 3MXQA 5A8BA 4CLCE 2V1BA 1S66L 3LIDA 3HJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEC A;  4GS9 B;  2QJ7 A;  4R3A A;  1GSX A;  3H7W B;  2L4R A;  1LL8 A;  4XT2 B;  2I9V A;  4KUK A;  2D02 A;  3ULF A;  3GDI A;  4L9E A;  3UB8 A;  4GS9 A;  3BY8 A;  5HD3 A;  3H7W A;  2PD8 A;  4NXE A;  3B33 A;  4XT2 A;  3F1O B;  4H6J B;  3P7N A;  1S1Z A;  2V0U A;  2PHY A;  1OTD A;  2GJ3 A;  2V9A A;  2JN7 A;  4PKY G;  4HJ4 A;  2JHE A;  1OJ5 A;  3MQQ A;  1GSV A;  1DRM A;  3F1O A;  4H6J A;  1TS6 A;  3E4O A;  1EW0 A;  3A0R A;  5F68 A;  1LSW A;  2PDR A;  1S1Y A;  3NOU C;  5TBM B;  1T18 A;  3LIA A;  4GCZ A;  2OWH A;  1T1B A;  3C8C A;  3UB9 A;  3A0S A;  2CMN A;  3OLO A;  4KQD A;  3K3C A;  1F98 A;  4NXG A;  5F69 A;  2OWJ A;  4HJ3 A;  2W0N A;  1G28 A;  5HWW A;  4WF0 A;  2YKH A;  3SW1 A;  4LRZ E;  5TBM A;  3FC7 A;  2V0W A;  3UB7 A;  5I5L A;  4HH2 A;  1LSV A;  1P0Z A;  1XFQ A;  3VE3 A;  5DKK A;  1UWP X;  1OTB A;  2ZBB A;  2D01 A;  1XJ3 A;  3BY9 A;  4EEU A;  4R70 A;  3PYP A;  1T1C A;  4EXO A;  4HP4 A;  4R38 A;  5HDD A;  1V9Y A;  2PYR A;  1S4R A;  5DKL A;  3RH8 B;  1DP6 A;  4WLA A;  2Z6D A;  3MR0 A;  4DJ2 A;  1UGU A;  3A0V A;  2ZOI A;  2PD7 A;  4HI4 A;  3VE4 A;  4LRX C;  1WA9 A;  3NJA A;  4DJ3 A;  4BBU A;  4L9G A;  3VOL A;  2PR6 A;  2W27 A;  5F5Y A;  2VV8 A;  1TS8 A;  4NXF A;  3UE6 A;  4EW7 A;  1T1A A;  3LI9 A;  2V1A A;  4NXB A;  5J3W A;  4HP9 A;  1N9O A;  1T19 A;  3C2W A;  1P97 A;  5G4Y A;  3IBR A;  1XFN A;  1TS7 A;  1OT9 A;  4HHD A;  1XJ2 A;  3LUQ A;  3LI8 A;  3PHY A;  3LIB A;  5HD5 A;  3ICY A;  2M1C A;  4EET B;  4MN6 A;  1MZU A;  3BWL A;  5DJU A;  4BBT A;  1OTA A;  1NWZ A;  4E04 A;  4BBV A;  2L0W A;  2VLG A;  4GHI B;  1LSX A;  2QWS A;  4I3I A;  5HSQ A;  2VV7 A;  4YWZ A;  5HZH A;  2PR5 A;  2YKF A;  3IS2 B;  4GHI A;  4I5S A;  1Y28 A;  4LLO B;  2QJ5 A;  4HIA A;  2EA9 A;  1XJ4 A;  3K3D A;  4LRY C;  1VB6 A;  5EFW A;  3IS2 A;  3UMD A;  1D7E A;  3NOP C;  2B02 A;  5HWT A;  4I3J A;  1LT0 A;  3H9W A;  3MQO A;  2ZOH A;  1N9L A;  2H28 A;  3F1P B;  4M4X A;  2KDK A;  3H82 B;  1BYW A;  3CWF A;  3ZQ5 A;  4JGQ A;  2J80 A;  3RTY A;  2OOL A;  3F1P A;  4EEP A;  4MN5 A;  5AVF A;  3H82 A;  5AVE A;  4L9F A;  1DP8 A;  4LPZ A;  5HWV A;  3HJI A;  4I3A A;  4F3L B;  2L1M A;  1D06 A;  4HNB A;  1V9Z A;  4HJ6 A;  4JGR A;  5IU1 A;  2HV1 A;  3E4P A;  4B9O A;  5HDC A;  4F3L A;  4I38 A;  4R6L A;  3LYX A;  1DP9 A;  3MJQ A;  5J7E A;  2WKQ A;  1ODV A;  4EES A;  3E4Q A;  1JNU A;  3MFX A;  1X0O A;  1OT6 A;  4WL9 A;  4EER A;  1OTE A;  4GW9 A;  1XJ6 A;  1GSW A;  2WKR A;  4JGP A;  4PKY A;  2PYP A;  1KOU A;  3UB6 A;  4I39 A;  2K7S A;  5HDS A;  3LIE A;  3LIF A;  5IS1 A;  3CAX A;  3EEH A;  4HH3 A;  4KUO A;  4HY8 A;  2A24 B;  3G6O A;  2VV6 A;  5G4Z A;  4EQ1 A;  5F6A A;  2P7J A;  3F1N B;  1S67 L;  4RQ9 A;  4WUJ A;  4JGO A;  1OJG A;  3D72 A;  1UWN X;  2VEA A;  2A24 A;  3LIC A;  4WN5 A;  3CLO A;  3UME A;  2BAS A;  3F1N A;  4HOI A;  5DJT A;  5J4E A;  3EWK A;  4HQA A;  3NOT C;  4K08 A;  3NHQ A;  5KIZ A;  2INW A;  1F9I A;  3T50 A;  2Z6C A;  2KX6 A;  2WKP A;  2QHK A;  3KX0 X;  2R78 A;  1N9N A;  3FG8 A;  1OTI A;  2QKP A;  1TS0 A;  1S4S A;  3MXQ A;  5A8B A;  2V1B A;  1S66 L;  3LID A;  3HJK A; 
#chains in the Genus database with same CATH topology
 3VV4 A;  3QP8 A;  5EOE A;  1GSX A;  3H7W B;  2L4R A;  1LL8 A;  1O07 A;  3V39 A;  4XT2 B;  3ZVW A;  4BJP A;  3ULF A;  5AQA A;  2WGV A;  1A0K A;  3UB8 A;  3UDF A;  4MBF A;  4GS9 A;  4LV1 A;  2PU2 A;  2ZQD A;  2PD8 A;  4ZJ3 A;  2W3E A;  4PAU A;  3JYI A;  1BLC A;  3D3O A;  4H6J B;  1W8Q A;  1SDN A;  2HP9 A;  2V0U A;  3MMH A;  3C7U A;  1OTD A;  2V9A A;  4Y7P A;  1K6R A;  2JN7 A;  4KQR A;  2GDN A;  4HJ4 A;  3MQQ A;  2WAE A;  3F1O A;  4Q8I A;  5HAQ A;  3N8R A;  1TS6 A;  3PAG A;  3E2L A;  2QMI A;  3HUM A;  3WRZ A;  3A0R A;  3KSF A;  2PDR A;  3NOU C;  3AGF A;  4WYY A;  1T18 A;  3LIA A;  3VOY A;  2Z2M B;  3OLO A;  3O88 A;  4X1L A;  3A3J A;  1D1J A;  1G6O A;  2OWJ A;  5FA7 A;  4HJ3 A;  1K6S A;  2W0N A;  3C38 A;  2YKH A;  4X55 A;  4X56 A;  5TBM A;  3BW6 A;  1CI9 A;  4HEF A;  1JWV A;  2BTF P;  1ZKJ A;  5I5L A;  4DXB A;  1YLP A;  5AQB A;  4HH2 A;  4R1G A;  2WUQ A;  3K2N A;  1XFQ A;  3MBZ A;  5J8X A;  2XA7 M;  3MS6 A;  1H3Q A;  4II7 A;  5DF7 A;  4UA6 A;  1OTB A;  5FAT A;  2D01 A;  4QB8 A;  4EEU A;  4OPZ A;  3P01 A;  2J9O A;  4MLL A;  3NBL A;  1W63 Q;  5DKL A;  1H5X A;  3CIT A;  4IVI A;  3SZT A;  1DP6 A;  2Z6D A;  2VGK A;  5HPF A;  5CEB A;  3C4P A;  1L0D A;  4N1H A;  3DWK A;  3PBR A;  4KZ3 A;  3A0V A;  5CER A;  4E6X A;  3VE4 A;  4CLC C;  3G4P A;  4R4R A;  4CLC D;  4DJ3 A;  2I72 A;  2PR6 A;  4OPR A;  2W27 A;  2DNS A;  1TS8 A;  1K38 A;  1W79 A;  2X02 A;  2KOI A;  4NXB A;  2QYB A;  1N9O A;  3NIA A;  3D9Y A;  2Y2K A;  4KZ5 A;  1Z09 A;  3V3S A;  5GHZ A;  4MBK A;  5HFO A;  3T4Q A;  1TS7 A;  1L0G A;  4R4S A;  4S2N C;  3VFF A;  4E3I A;  2FFF B;  4JXG A;  3LI8 A;  3PHY A;  3W4Q A;  1JVJ A;  5KSC A;  5A92 A;  2M1C A;  3I7J A;  3IX4 A;  1IOU A;  1IYQ A;  1MZU A;  1S0W A;  2BLS A;  1OTA A;  1NWZ A;  3UB5 P;  4GHI B;  4NEE D;  3HLW A;  3P98 A;  3S7N A;  2VV7 A;  2Y8H A;  2J3W A;  3EEA A;  4LV0 A;  3OC2 A;  1IEM A;  2YKF A;  1MY8 A;  3LR4 A;  4KG6 A;  1MBL A;  5GHX A;  5FL3 A;  4KZB A;  1MWT A;  4FSF A;  3L7H A;  5L2F A;  3V5M A;  3G31 A;  4BL2 A;  1SKF A;  4YFM A;  1D7E A;  3NOP C;  2J3T C;  4XUZ A;  1BUE A;  3GTC A;  2P04 A;  2PAV P;  1LT0 A;  2J3T D;  1ZG6 A;  4WZ4 A;  3C30 A;  5FEF A;  5CEC A;  3SS4 A;  2H28 A;  1VEU A;  4Z1W A;  1CQA A;  1DJA A;  4M4X A;  3PTE A;  4DDY A;  3BFE A;  5F1G A;  3ZG8 B;  3ZQ5 A;  2PRF A;  2J80 A;  4GNU A;  4P6Z M;  1PWG A;  4OON A;  1YQS A;  3F1P A;  2V8C A;  1SKO B;  1ONG A;  4KG5 A;  5FDH A;  4FOF A;  1K56 D;  2Y2P A;  3GRJ A;  5EVE A;  1MPL A;  3T4T A;  5EOO A;  3T12 B;  4HNB A;  4JXV A;  5L8M A;  2Y2I A;  3C5A A;  3JVU A;  4S2J A;  1YLZ A;  4IED A;  1IFQ A;  1JTG A;  2VX8 A;  5F83 A;  3LEZ A;  4CLC A;  4I38 A;  4CQH A;  3DTM A;  3N8S A;  3N8L A;  4UA9 A;  4DE0 A;  3FPV A;  3FZC A;  2W3F A;  3BRM A;  4MCW A;  5FQ9 A;  3Q7V B;  1KE4 A;  2WGW B;  4BD0 A;  1XGI A;  4BWI A;  3DTK A;  4WL9 A;  2G2W A;  4ZBE A;  5CHM A;  4EER A;  1YSP A;  4GW9 A;  2HJ9 C;  1GA9 A;  1XJ6 A;  1GSW A;  3CUE C;  2XR0 A;  4OP5 A;  1KOU A;  3PBQ A;  5MC7 A;  1TF1 A;  4BD1 A;  4O0P A;  1PYY A;  2O99 A;  2ZC3 B;  2DCF A;  4B93 A;  5IS1 A;  4K91 A;  3R7W A;  1XA7 A;  4S2M A;  2A24 B;  3VP0 A;  1P9W A;  4WZ5 C;  2WKH A;  1YPR A;  3TW8 A;  3UO9 A;  2P7J A;  3F1N B;  1S67 L;  3BJN A;  3S22 A;  1OJG A;  3O86 A;  2E8I A;  3QP5 A;  3D72 A;  1QMF A;  5DTT A;  4OQ0 A;  3W4O A;  3BFD A;  1PIO A;  5DTK A;  1PI5 A;  3KSH A;  3MKF A;  2O0Y A;  5J4E A;  4M3K A;  5CGX A;  4FUW A;  4K08 A;  3NHQ A;  5KIZ A;  3ZHH A;  2W3H A;  3QHY A;  3Q82 A;  2INW A;  1IEL A;  3VP1 A;  4DE2 A;  3TJZ C;  2VGJ A;  3T50 A;  4JLF A;  4PPR A;  3KX0 X;  5JYP A;  3T1X A;  1CEG A;  2J9P A;  4S2L A;  5FQM A;  2QKP A;  3MXQ A;  2XF3 A;  1PZO A;  5A8B A;  4E3N A;  4CLC E;  5FAP A;  3MFD A;  5EEC A;  3HJK A;  1E3U D;  2W3D A;  1NZO A;  1K57 C;  4R3A A;  5U47 A;  4PHT A;  1FQG A;  4S2K A;  2OSU A;  4LCM A;  4OLD A;  1SZV A;  4U0T A;  1TDG A;  2I9V A;  2VA0 A;  4PM5 A;  5FQK A;  3FKV A;  4UQI S;  2A2L A;  4ZAM A;  2MJ6 A;  2H0T A;  4EBL A;  3B33 A;  4MMN A;  1FCO A;  3Q1F A;  1S1Z A;  2XRO A;  2PHY A;  2GJ3 A;  3HLE A;  4FH2 A;  1NRJ A;  3TG9 A;  3Q7Z A;  5HW3 A;  4N9K A;  2P08 A;  5E43 A;  3UPN A;  3HL9 A;  2E8J A;  5E2G A;  4JXW A;  1LSW A;  4KZA A;  2VKS A;  2NUP C;  3A3F A;  2OWH A;  3DAV A;  1OME A;  2ZL1 B;  3KYZ A;  1TD5 A;  3CUE A;  5FI6 A;  4QPR A;  1VET B;  1PRQ A;  1RGZ A;  2B18 A;  3G2Z A;  1NXY A;  3KYQ A;  3WS4 A;  4N92 A;  1YLT A;  2JKF A;  4OOM A;  3FC7 A;  3UB7 A;  5EVI A;  2W1T A;  3VP4 A;  4WZ5 A;  3FYZ A;  3TOI A;  4PM7 A;  1P0Z A;  5C5K A;  3LY4 A;  2H10 A;  4PM9 A;  2HDU A;  1UWP X;  3S7P A;  4KQO A;  2HP5 A;  4XUX A;  4G3V A;  1XJ3 A;  2WGI A;  3BY9 A;  2CC1 A;  2W3G A;  3LCE A;  3BQ8 A;  4ZJ2 A;  1NLZ A;  3SH9 A;  4RYE A;  3GSG A;  4OQG A;  4JPM A;  5HDD A;  2PYR A;  1S4R A;  3NEC A;  5GL9 A;  4WLA A;  4DJ2 A;  1UGU A;  2P9V B;  3B47 A;  3SH8 A;  3IXD A;  1YMX A;  3IXG A;  2C6W B;  4E3J A;  4YNR A;  1ZC2 A;  2ZOI A;  1W8Y A;  3GR2 A;  3G34 A;  3MSH A;  3T1S A;  3WS1 A;  3M2J A;  3NJA A;  5L09 A;  2IWC A;  2J7V A;  1J3W A;  3LFV A;  3QP4 A;  3R4K A;  4WMC A;  5GHY A;  5GLC A;  5J3W A;  1FIL A;  3ZG7 B;  1T19 A;  3C2W A;  2VJW A;  4EQI A;  2ZM8 A;  5G4Y A;  1IYP A;  3O3V A;  1XFN A;  3Q81 A;  5FDS A;  4GB7 A;  4HHD A;  1XJ2 A;  4MDZ A;  1HD8 A;  2XK1 A;  1G6A A;  4EET B;  5FI7 A;  3A3D A;  4MN6 A;  5GLB A;  4ETX A;  4P87 A;  4E3L A;  1VQQ A;  4PM6 A;  1Q2Q A;  4S2O A;  1FCN A;  2Y79 A;  3ZFZ A;  2LB5 A;  1IKG A;  2OAQ 1;  4UEY A;  4EUZ A;  3DBA A;  3W4P A;  4I3I A;  5HSQ A;  4LGW A;  5HZH A;  1VM1 A;  2ZC5 B;  2HZ5 A;  3EQU A;  3IS2 B;  4IBX A;  4ARZ B;  3IF6 C;  2OAP 1;  5TR7 A;  3PBS A;  4HIA A;  5FSR A;  4S2P A;  5CGS A;  1XP4 A;  5AQ7 A;  4LRY C;  5KMW A;  1BT5 A;  5LBR A;  3OCL A;  2HDS A;  2B02 A;  3HLD A;  2Q9M A;  2EX2 A;  3NC8 A;  3OOV A;  2M7V A;  5DTS A;  5HWT A;  4EV4 A;  4I3J A;  1LI0 A;  3H9W A;  3E0Y A;  2ZLY A;  4O7D A;  1N9L A;  4ZTK A;  2QZ6 A;  3PBN A;  3IWO A;  4GD8 A;  2XFS A;  3IWQ A;  3ZNT A;  4ETZ A;  1BSG A;  1BYW A;  3Q07 A;  3WRT A;  1WE4 A;  3WS0 A;  5A90 A;  3V50 A;  1H0M A;  3CWF A;  5TJJ A;  3EGX C;  1K4E A;  3NDE A;  4QJG A;  4HES A;  5TFQ A;  4EBP A;  2C5W B;  4R3B A;  1MKM A;  4MN5 A;  3H82 A;  5AVE A;  3CZD A;  1AXB A;  3UE3 A;  1CEF A;  4Q0H A;  3MZE A;  1E4D A;  5JYO A;  3G30 A;  4F3L B;  3JPU A;  1NZU A;  4EWF A;  1K55 A;  3IHA A;  4JGR A;  4ID4 A;  3V3R A;  4OQI A;  2A49 A;  5IU1 A;  4B9O A;  5HDC A;  2Y91 A;  1K4F A;  3OZH A;  3IHB A;  3BLM A;  2WZX A;  1DP9 A;  2V8F A;  2R9W A;  2ZD8 A;  4RA7 A;  1ODV A;  2AVX A;  4EES A;  1JNU A;  3VP2 A;  1X0O A;  4R3J A;  5DVA A;  1OTE A;  2EWV A;  2Y2H A;  4BEN A;  5CXW A;  5IT5 A;  2PYP A;  4GN2 A;  3M2K A;  3UB6 A;  4X68 A;  2V2F F;  4Y0U A;  2K7S A;  2ZQ9 A;  3WWX A;  3NI9 A;  4IUK A;  2EWW A;  1GCE A;  4DMZ A;  3IH8 A;  4E3K A;  4HY8 A;  4NKP A;  3ZYT A;  5G4Z A;  4QU3 A;  1UWN X;  3RXX A;  1E25 A;  1TEM A;  1JWP A;  3O5Y A;  5HX9 A;  2VEA A;  2EX6 A;  3LIC A;  2XGN A;  1KE0 A;  1NYY A;  1I2S A;  3G32 A;  1WYB A;  2BAS A;  3EQV A;  3CPT A;  4GDN A;  3IF6 A;  4HQA A;  4LEN A;  2K2N A;  3VP3 A;  5G18 A;  2VGL M;  2Y2M A;  1FSY A;  4Y15 A;  4PM8 A;  1F9I A;  1NYM A;  2OV5 A;  4G3W A;  4DDS A;  2WKP A;  3QP2 A;  2V1Z A;  2R78 A;  1N9N A;  1H8Y A;  5CTN A;  1CF0 A;  2O9B A;  5KSH A;  1OTI A;  3HLC A;  3MKE A;  1BLP A;  1S4S A;  4F94 A;  4OH0 A;  5CRF A;  2V1B A;  1PZP A;  1S66 L;  4GS9 B;  2QJ7 A;  4JKT A;  3BM6 A;  4FD8 A;  3A3I A;  3CMZ A;  4X25 A;  2EXB A;  3GDI A;  1YLJ A;  4L9E A;  3U2A A;  1YMS A;  4H8R A;  2NUT C;  2Y55 A;  5HD3 A;  3H7W A;  5A93 A;  3UY6 A;  3SH7 A;  1YSQ A;  4XT2 A;  3F1O B;  2HDR A;  3LR5 A;  3BYD A;  2XA7 S;  3BFG A;  2BG1 A;  2LB9 A;  4QD4 A;  4PKY G;  4S2N A;  3CHW P;  2VZW A;  4ZJ1 A;  1OJ5 A;  1U60 A;  4QHC A;  1GSV A;  3AGD A;  1DRM A;  4H6J A;  1ZTU A;  5F68 A;  3KYE A;  1DJB A;  3NY4 A;  5TBM B;  3D4F A;  2XD5 A;  3C8C A;  3A0S A;  1ERM A;  3GMW A;  4C3Q A;  3IQA A;  4KQD A;  2P74 A;  3K3C A;  4RX2 A;  3T1R A;  2JKG A;  4NXG A;  5EVL A;  3HVF A;  3HLG A;  4WF0 A;  3SW1 A;  3BLS A;  4NG2 A;  1SHV A;  4K0W A;  3MF0 A;  3QNB A;  3M6B A;  3ZDJ A;  3KO6 A;  1IYS A;  1YAX A;  2WKE A;  1GA0 A;  5AQ9 A;  3VE3 A;  5DKK A;  2VK3 A;  3BFC A;  1I2W A;  3B42 A;  4KQQ A;  5E2H A;  4CJN A;  1K25 A;  2O9A A;  5FQJ A;  1BUL A;  4OQH A;  4R38 A;  1V9Y A;  4N1X A;  4LFU A;  3DW0 A;  2EX9 A;  1L2S A;  2FFY A;  3SS3 A;  4B88 A;  3HUN A;  4YOF A;  4E3O A;  3RJU A;  4LRX C;  4GDB A;  4YIN A;  3IF5 A;  4X6T A;  3PBO A;  4WBG A;  4L9G A;  3VOL A;  1K56 A;  5F5Y A;  4P0M A;  4NXF A;  4ESP A;  4MN7 A;  3N6I A;  2B95 A;  3LI9 A;  4HP9 A;  1L0E A;  1GHP A;  5D3O A;  5E2F A;  1LI9 A;  1GHI A;  5CGW A;  3HRE A;  3DWZ A;  4BLM A;  3IBR A;  4B4Z A;  4Y17 A;  1YLW A;  1MC0 A;  1MWS A;  1KGF A;  3T4J A;  3LIB A;  2IWD A;  3ICY A;  4S2I A;  2M7U A;  5CTM A;  1KGG A;  4KG2 A;  2O9C A;  3BWL A;  1YLY A;  4BBT A;  2UV0 E;  1ALQ A;  4E04 A;  3EOI A;  3WS2 A;  4B4X A;  4BBV A;  2VGL S;  3OCN A;  2XRN A;  4WEL A;  2K31 A;  4P6Z S;  1SDE A;  3N7W A;  3OPL A;  4UA7 A;  1KGE A;  3LO7 A;  1GHM A;  4IJG A;  3IT9 A;  4C6Y A;  2ZM2 A;  1BTL A;  3DTI A;  3NCK A;  5EM0 A;  4GHI A;  2WAF A;  3UN7 A;  4I5S A;  1Y28 A;  2RCX A;  2JKT M;  4LLO B;  1PW8 A;  4RVA A;  4D2O A;  2EA9 A;  3K3D A;  4JF4 A;  4JF6 A;  5CHU A;  1Y4O A;  3VMA A;  1VEU B;  4QY5 A;  1VB6 A;  1BLS A;  3UMD A;  1ACF A;  1KE3 A;  3M6H A;  4K0X A;  3CJM A;  2JKR M;  3MQO A;  3IH9 A;  2ZOH A;  2JC7 A;  3F1P B;  4DRT A;  4OOY A;  3VOZ A;  3OBF A;  1O7E A;  1XGJ A;  4JGQ A;  3CI6 A;  1Z6F A;  3RTY A;  2Z2L B;  2J8Y A;  3TRC A;  4EEP A;  3NDG A;  4L9F A;  4LPZ A;  4ZDX A;  3T4S A;  3HJI A;  5M18 A;  4E3M A;  3SOI A;  4I3A A;  4CLC B;  4OLG A;  1MWU A;  1D06 A;  3MXS A;  1H8Z A;  1V9Z A;  1PNE A;  2WKI A;  1SKO A;  2Y2N A;  2UWX A;  3P09 A;  1E3U A;  4WEK A;  1H8M A;  1FR1 A;  2HV1 A;  4BQM A;  2XD1 A;  1K57 A;  1RCJ A;  4R6L A;  2ZMA A;  1NLY A;  4U0X A;  1ZHH B;  3MJQ A;  2WKQ A;  5EUA A;  3UPP A;  2GNX A;  1PWC A;  1OT6 A;  1SCW A;  3R7W B;  2WKR A;  3HCY A;  2PBD P;  2DMW A;  4I39 A;  4KZ4 A;  1F5M A;  2OLU A;  3Q7V A;  3QP1 A;  5HDS A;  3LIE A;  4Z9Q A;  2WGW A;  4KZ6 A;  3LR3 A;  1AWI A;  3MXR A;  2ACG A;  3MZD A;  3EEH A;  3W8K A;  2Q0O A;  3LR0 A;  3G6O A;  3UE0 A;  5BOH A;  2VV6 A;  4EQ1 A;  3MZF A;  1CI8 A;  5F6A A;  3A3E A;  5L10 A;  1PI4 A;  1PW1 A;  4OOL A;  5M1A A;  3ZG5 A;  1WYC A;  2A24 A;  1FIK A;  4KZ8 A;  2Y2Q A;  1CJF A;  4WN5 A;  3U4L P;  3ZNY A;  1L3L A;  1FSW A;  2EFU A;  3F1N A;  2B5R A;  4OKP A;  3LY3 A;  2ZC7 A;  3MQ0 A;  1MWR A;  1XKZ A;  2HGV A;  3VSK A;  3NOT C;  2W1R A;  4LV2 A;  2HPB A;  3ZG0 A;  3W2Z A;  3L9K A;  2ZQC A;  4P85 A;  4UHU A;  1M6K A;  1HZO A;  2EX8 A;  3HLF A;  1ESI A;  2Y2O A;  4OVD A;  1TS0 A;  1G68 A;  5GLD A;  3G2Y A;  4HBU A;  3LID A;  4GZB A;  3GEC A;  4L0L A;  5IHV A;  2PBY A;  4Y5F A;  3UDI A;  1C3B A;  1LLB A;  3FWL A;  3GVB A;  4KUK A;  4LCL A;  2D02 A;  1L0F A;  4FH4 A;  3SS5 A;  3BY8 A;  5DF8 A;  2Y4A A;  3PBT A;  4OPY A;  2XQZ A;  3E98 A;  4Y13 A;  2Y2J A;  4NXE A;  4PMA A;  3ITA A;  3G35 A;  2X01 A;  4KZ9 A;  3P7N A;  4BMW A;  1K0K A;  2HP6 A;  1HTZ A;  3RXW A;  2JCH A;  1KVL A;  3CG5 A;  4P6B A;  2ZMF A;  1LHY A;  1J9M A;  1ES4 A;  2GZA A;  2JHE A;  2WAD A;  2R9X A;  4R0Q A;  3RFB A;  3E4O A;  1EW0 A;  1KDW A;  5FI2 A;  1W5D A;  5CX7 A;  3OPP A;  3UE1 A;  1STZ A;  1S1Y A;  2XH9 A;  5A91 A;  1NRF A;  4NET A;  4GCZ A;  1S6R A;  1T1B A;  5M19 A;  3B3X A;  3UB9 A;  2CMN A;  5EVI B;  1F98 A;  3QNC A;  2W1T B;  1Y54 A;  3AGE A;  1YT4 A;  5F69 A;  1IYO A;  4JF5 A;  1G28 A;  5HWW A;  4LRZ E;  2OLV A;  4UQI M;  2V0W A;  2V20 A;  3IBJ A;  2ZL1 A;  5HAI A;  1VET A;  3UPO A;  4X1M A;  1LSV A;  4DE3 A;  1HLU P;  3HUO A;  1CK3 A;  4O01 A;  3HLB A;  4NK3 A;  4O8G A;  4GOG A;  1DY6 A;  3JVV A;  2ZBB A;  3ZGA B;  3LEQ A;  5HL1 A;  4R70 A;  1BLH A;  4LV3 A;  3PYP A;  2JBF A;  5FAS A;  1T1C A;  1LL9 A;  4EXO A;  1ES5 A;  3KSI A;  4HP4 A;  1EI5 A;  4ME4 A;  3RH8 B;  1N4O A;  5CHJ A;  4AFI A;  3MR0 A;  3FKW A;  1ERO A;  2XFT A;  4IBR A;  2H5S A;  4GLQ A;  2QPN A;  2Y59 A;  5FQQ A;  2PU4 A;  4KZ7 A;  1ONH A;  4A5R A;  2PD7 A;  1BZA A;  2H0Y A;  4HI4 A;  1NY0 A;  5HAR A;  3S4X A;  1WA9 A;  3BQA A;  1RP5 A;  4CPK A;  4BBU A;  1TDL A;  2P9V A;  2VV8 A;  2PT7 A;  3TE8 A;  3UE6 A;  3ZCZ A;  4WEJ A;  1W63 M;  2FZ0 A;  1T1A A;  4EW7 A;  2V1A A;  4OP8 A;  4GKU A;  1Q2P A;  4DN0 A;  1P97 A;  2ZC6 B;  4N9L A;  4HBT A;  3BEB A;  3TSG A;  2HDQ A;  4QY6 A;  1OT9 A;  2RL3 A;  4GD6 A;  4X69 A;  1FOF A;  3LUQ A;  1VHM A;  4FTX A;  5HD5 A;  1P9R A;  1K54 C;  2WK0 A;  3ISG A;  5DJU A;  5F82 A;  1W7F A;  3DTE A;  1MKI A;  1EWZ A;  1LL5 A;  1QME A;  2G2U A;  4G3K A;  4D60 A;  2L0W A;  2VLG A;  1LSX A;  4U3T A;  2QWS A;  4Y0O A;  4DE1 A;  3VFH A;  1N9B A;  3S7O A;  2XLN A;  4YWZ A;  2PR5 A;  2A3U A;  5DFY A;  5EM1 A;  2KLI A;  3OPR A;  4BL3 A;  5EE8 A;  5DFX A;  5EVI C;  3N4I A;  2XDM A;  5EVI D;  4JXS A;  3IXB A;  1YM1 A;  4IHQ A;  3BFF A;  2X71 A;  2QJ5 A;  5HL6 A;  1XJ4 A;  2DRW A;  5EFW A;  2JE5 A;  2HJE A;  3IS2 A;  1G5U A;  3S1Y A;  4ARZ A;  1YKD A;  3HBR A;  1IKI A;  4E6W A;  5E2E A;  4DXC A;  1ERQ A;  3GQZ A;  2KDK A;  1RGY A;  3H82 B;  2ZJ9 A;  2EXA A;  3BEC A;  5GLA A;  3V67 A;  1KVM A;  4Y0T A;  3VSL A;  3T4L A;  2OOL A;  2GX5 A;  1F2K A;  2EFX A;  3E2K A;  5K5B A;  1JTD A;  5AVF A;  4Q0I A;  5AJG A;  5EPH A;  2WZZ A;  1DP8 A;  4MEZ A;  1TVF A;  5HWV A;  5EV0 A;  3NUL A;  4WMC D;  2L1M A;  4IVK A;  3PR6 A;  4DF6 A;  3T4O A;  2ZQ8 A;  4HJ6 A;  1JWZ A;  1XX2 A;  1I5Q A;  1ZG4 A;  2HF6 A;  3PAE A;  2ZC4 B;  2ZQ7 A;  2ZQA A;  4FCF A;  5KZH A;  3E4P A;  5HPI A;  3C7V A;  4QWO A;  4F3L A;  3T4K A;  4EBN A;  3QP6 A;  4EU0 A;  3IX8 A;  3EGD C;  3LYX A;  4Q0J A;  4IUH A;  2XSS A;  5J7E A;  3OPH A;  2G7U A;  3E4Q A;  5L07 A;  1PWD A;  5F1F A;  4MBH A;  3MFX A;  4RX3 A;  5I94 A;  3O87 A;  3C4O A;  1FR6 A;  4XXR A;  3IWI A;  3T1Q B;  4JGP A;  4PKY A;  5TGF A;  1OPX A;  5FQI A;  2WYX A;  3UNW A;  4Y2F A;  4EUV A;  3LIF A;  2FH5 A;  3ZVT A;  5CED A;  4C75 A;  2Q9N A;  3CAX A;  1K54 A;  1MXO A;  5HAP A;  3FV7 A;  4HH3 A;  4KUO A;  3ZG9 B;  2Y2L A;  3S7Q A;  3KSG A;  1ESU A;  1NJ4 A;  2XEP A;  4RQ9 A;  2JKT I;  3LGO A;  4WUJ A;  3CPT B;  4JGO A;  4JBF A;  4GJ4 A;  3IF6 B;  1HVB A;  1XPB A;  2ZMV A;  1DJC A;  3CLO A;  3UME A;  3ITB A;  3PXP A;  1FCM A;  4HOI A;  5DF9 A;  5DJT A;  2IWB A;  2JKR I;  4KEN B;  3EWK A;  4WM9 A;  4R23 A;  5FAQ A;  1ES2 A;  4ZRR A;  3IXH A;  3IX3 A;  1XXM A;  3FPW A;  4DKI A;  5FEG A;  4OPQ A;  3WS5 A;  2Z6C A;  2KX6 A;  2QHK A;  1PFL A;  4Y3I A;  3GV9 A;  2Y2G A;  3FG8 A;  4X53 A;  4MNR A;  2IA2 A;  1KDS A;  4UAA A;  1K55 C;  2ZM0 A;  5FAO A;  1M40 A;  1XA1 A;  3UDX A;  1ES3 A; 
#chains in the Genus database with same CATH homology
 3VV4 A;  3GEC A;  4GS9 B;  2QJ7 A;  2W3D A;  4L0L A;  4R3A A;  1GSX A;  4PHT A;  3H7W B;  4Y5F A;  2L4R A;  1LL8 A;  4XT2 B;  2I9V A;  4KUK A;  2VA0 A;  2D02 A;  4BJP A;  3ULF A;  3GDI A;  4L9E A;  3U2A A;  3UB8 A;  4GS9 A;  3BY8 A;  4UQI S;  3PBT A;  2NUT C;  3E98 A;  5HD3 A;  2A2L A;  3H7W A;  2PD8 A;  2MJ6 A;  1YSQ A;  4NXE A;  2W3E A;  4PAU A;  3B33 A;  4MMN A;  4XT2 A;  3D3O A;  3F1O B;  4H6J B;  3P7N A;  4BMW A;  1S1Z A;  3LR5 A;  2V0U A;  2XA7 S;  3MMH A;  2ZMF A;  2XRO A;  2PHY A;  2LB9 A;  1OTD A;  2GJ3 A;  2V9A A;  2JN7 A;  1NRJ A;  4PKY G;  2VZW A;  4HJ4 A;  2GZA A;  2JHE A;  2P08 A;  1OJ5 A;  3MQQ A;  1GSV A;  1DRM A;  3F1O A;  4H6J A;  1TS6 A;  3RFB A;  3E4O A;  1ZTU A;  1EW0 A;  3A0R A;  3KSF A;  5F68 A;  5CX7 A;  1LSW A;  1STZ A;  2PDR A;  1S1Y A;  3NOU C;  2VKS A;  2NUP C;  5TBM B;  1T18 A;  3LIA A;  4GCZ A;  2OWH A;  1T1B A;  3C8C A;  3UB9 A;  3KYZ A;  3A0S A;  2CMN A;  1TD5 A;  3OLO A;  3CUE A;  4KQD A;  3K3C A;  1F98 A;  2W1T B;  4QPR A;  1G6O A;  4NXG A;  2B18 A;  5F69 A;  2OWJ A;  4HJ3 A;  3KYQ A;  2W0N A;  1G28 A;  5HWW A;  3C38 A;  4WF0 A;  2YKH A;  3SW1 A;  4LRZ E;  5TBM A;  4OOM A;  4UQI M;  3FC7 A;  2V0W A;  3BW6 A;  3IBJ A;  3UB7 A;  3MF0 A;  5I5L A;  2W1T A;  4HH2 A;  1LSV A;  1P0Z A;  3K2N A;  3KO6 A;  5C5K A;  1XFQ A;  1YAX A;  4O01 A;  2XA7 M;  4O8G A;  3VE3 A;  5DKK A;  1H3Q A;  4II7 A;  1UWP X;  3S7P A;  4KQO A;  3JVV A;  1OTB A;  2ZBB A;  2D01 A;  4G3V A;  1XJ3 A;  3B42 A;  3BY9 A;  4EEU A;  2O9A A;  4R70 A;  2W3G A;  3PYP A;  3BQ8 A;  3P01 A;  1T1C A;  1NLZ A;  4EXO A;  3KSI A;  4HP4 A;  4R38 A;  5HDD A;  1V9Y A;  2PYR A;  1W63 Q;  1S4R A;  5DKL A;  4ME4 A;  3RH8 B;  3CIT A;  1DP6 A;  4WLA A;  2Z6D A;  4AFI A;  3MR0 A;  4DJ2 A;  5HPF A;  1UGU A;  3B47 A;  4GLQ A;  3PBR A;  4YNR A;  3A0V A;  2ZOI A;  4YOF A;  2PD7 A;  4HI4 A;  3VE4 A;  4LRX C;  4CLC C;  1WA9 A;  3BQA A;  3NJA A;  4CLC D;  3PBO A;  4DJ3 A;  4BBU A;  4L9G A;  3VOL A;  2PR6 A;  2W27 A;  5F5Y A;  2VV8 A;  1TS8 A;  2PT7 A;  4NXF A;  3TE8 A;  3UE6 A;  4MN7 A;  3LFV A;  4WEJ A;  1W63 M;  2FZ0 A;  1T1A A;  3LI9 A;  4EW7 A;  3R4K A;  2V1A A;  2KOI A;  4NXB A;  5J3W A;  4HP9 A;  2QYB A;  1N9O A;  4DN0 A;  1T19 A;  3C2W A;  1P97 A;  2VJW A;  5G4Y A;  3T4Q A;  3IBR A;  1XFN A;  1TS7 A;  1OT9 A;  1MC0 A;  4HHD A;  1XJ2 A;  3LUQ A;  1VHM A;  3LI8 A;  3PHY A;  3LIB A;  3T4J A;  4MDZ A;  5HD5 A;  1P9R A;  3ICY A;  2M1C A;  2M7U A;  4EET B;  4MN6 A;  2O9C A;  1IOU A;  1MZU A;  3BWL A;  5DJU A;  4ETX A;  4BBT A;  1OTA A;  1NWZ A;  4E04 A;  3EOI A;  2Y79 A;  2LB5 A;  4G3K A;  4BBV A;  2L0W A;  2VGL S;  2VLG A;  4GHI B;  4NEE D;  1LSX A;  3OCN A;  2XRN A;  2QWS A;  4WEL A;  3S7N A;  2OAQ 1;  4UEY A;  3DBA A;  2K31 A;  4P6Z S;  3S7O A;  4I3I A;  5HSQ A;  2VV7 A;  2Y8H A;  4YWZ A;  5HZH A;  2J3W A;  2PR5 A;  3EEA A;  3OC2 A;  5DFY A;  2YKF A;  2KLI A;  4IJG A;  3EQU A;  3LR4 A;  5DFX A;  3IS2 B;  4GHI A;  4ARZ B;  5FL3 A;  4FSF A;  4I5S A;  4IHQ A;  1Y28 A;  2JKT M;  4LLO B;  2OAP 1;  2QJ5 A;  3PBS A;  4HIA A;  5HL6 A;  2EA9 A;  1XJ4 A;  3K3D A;  4LRY C;  1VB6 A;  5EFW A;  3IS2 A;  2HJE A;  3OCL A;  5LBR A;  3UMD A;  1D7E A;  3NOP C;  4ARZ A;  2B02 A;  2M7V A;  2J3T C;  3OOV A;  5HWT A;  4I3J A;  1YKD A;  2P04 A;  1LT0 A;  2J3T D;  2JKR M;  3H9W A;  3E0Y A;  3MQO A;  3C30 A;  2ZOH A;  1N9L A;  3PBN A;  2H28 A;  3F1P B;  4Z1W A;  4M4X A;  2KDK A;  4ETZ A;  3H82 B;  1BYW A;  3OBF A;  3V67 A;  3CWF A;  5TJJ A;  3ZQ5 A;  4JGQ A;  3EGX C;  3CI6 A;  2J80 A;  4P6Z M;  3RTY A;  3T4L A;  2OOL A;  2GX5 A;  5K5B A;  3F1P A;  3TRC A;  4EEP A;  1MKM A;  4MN5 A;  5AVF A;  4Q0I A;  5AJG A;  3H82 A;  5AVE A;  4L9F A;  1DP8 A;  4LPZ A;  5HWV A;  3UE3 A;  4FOF A;  4Q0H A;  3T4S A;  3HJI A;  3T4T A;  4I3A A;  4F3L B;  4CLC B;  2L1M A;  3PR6 A;  1D06 A;  4HNB A;  1V9Z A;  5L8M A;  3T4O A;  4HJ6 A;  4JGR A;  2HF6 A;  3JVU A;  4WEK A;  5IU1 A;  1H8M A;  2HV1 A;  3E4P A;  4B9O A;  5HPI A;  5HDC A;  1IFQ A;  2VX8 A;  4F3L A;  4CLC A;  4I38 A;  3T4K A;  4CQH A;  4R6L A;  4EU0 A;  3EGD C;  3LYX A;  1NLY A;  4Q0J A;  1DP9 A;  4IUH A;  1ZHH B;  2XSS A;  3FPV A;  3MJQ A;  5J7E A;  2W3F A;  2WKQ A;  1ODV A;  4MCW A;  2G7U A;  4EES A;  3E4Q A;  1JNU A;  2GNX A;  3MFX A;  1X0O A;  4BWI A;  1OT6 A;  4WL9 A;  4EER A;  1YSP A;  1OTE A;  4GW9 A;  2HJ9 C;  3R7W B;  2EWV A;  1XJ6 A;  1GSW A;  2WKR A;  4JGP A;  5IT5 A;  4PKY A;  3CUE C;  1OPX A;  3HCY A;  2PYP A;  1KOU A;  2DMW A;  3PBQ A;  3UB6 A;  4I39 A;  1F5M A;  4Y2F A;  2K7S A;  5MC7 A;  5HDS A;  1TF1 A;  4EUV A;  3LIE A;  4IUK A;  2EWW A;  3LIF A;  4O0P A;  2FH5 A;  3LR3 A;  2O99 A;  4B93 A;  4DMZ A;  5IS1 A;  3R7W A;  3CAX A;  3EEH A;  4HH3 A;  4KUO A;  4HY8 A;  2A24 B;  1P9W A;  3LR0 A;  3G6O A;  3S7Q A;  3KSG A;  4NKP A;  3TW8 A;  3ZYT A;  2VV6 A;  5G4Z A;  4EQ1 A;  5F6A A;  2P7J A;  3F1N B;  1S67 L;  2JKT I;  3BJN A;  4RQ9 A;  4WUJ A;  4OOL A;  4JGO A;  1OJG A;  4GJ4 A;  3D72 A;  1UWN X;  3O5Y A;  2VEA A;  2A24 A;  3LIC A;  4WN5 A;  2ZMV A;  3CLO A;  3UME A;  2BAS A;  3KSH A;  3PXP A;  3F1N A;  4HOI A;  3EQV A;  5DF9 A;  5DJT A;  2O0Y A;  2JKR I;  3MQ0 A;  5J4E A;  3EWK A;  2HGV A;  4ZRR A;  4HQA A;  2K2N A;  3NOT C;  4K08 A;  2W1R A;  3NHQ A;  5KIZ A;  2VGL M;  2W3H A;  2INW A;  3FPW A;  1F9I A;  3TJZ C;  3T50 A;  2Z6C A;  3W2Z A;  4G3W A;  2KX6 A;  2WKP A;  2QHK A;  3KX0 X;  2R78 A;  1N9N A;  4Y3I A;  3FG8 A;  2IA2 A;  2O9B A;  5KSH A;  1OTI A;  2QKP A;  1TS0 A;  1S4S A;  3MXQ A;  5A8B A;  4CLC E;  2V1B A;  1S66 L;  3LID A;  3HJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...