5DJYB

Fc heterodimer design 20.8 y349s/t366v/k370y/k409v + e357d/s364q/y407a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
total genus 33
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyB01
1S9VB 4MA7H 1G9MC 3JWOC 1P7QD 4M7LT 3MPCA 4DVBB 4R96B 3T8XB 3MCG1 4JAMB 2IH1A 3L7EB 4ZD3L 3QDMB 4WI9A 1Z9SA 4F7EA 5D2NA 4BZ2L 1R3HA 3VXRB 5I0DA 1MJ8H 4CBPA 3TV3L 3BUYB 2HFGH 1FAIL 1BJ1J 1FE8L 4UDTA 3DTXB 4N8CL 4J4PC 5T3XL 1DTUA 4JN2A 3VD7A 1NMAH 5LCVL 4OCYH 4I3SL 2IWGA 4CKVX 4PJBE 1ZHLB 2NXZC 4NJ9H 4RBPK 3HRZB 1QLEL 2WANA 3EO0B 2D0HA 1NLBH 1I1FA 3IJHB 4XP9L 4PJXE 3QNXA 2HKHL 3LKPA 4FABL 4BFIB 1AGFB 4KTEH 3WFDH 5I0ZA 5FO9A 3VFNA 4DEPC 4JJHA 4YHML 4ALAL 4GG6F 3I3DA 3U1SH 4E0RB 1LP9F 3C60D 2GT9B 1E28A 3VFPB 2W60A 2W60B 1QR1A 5E6ID 3VRIB 1PDKA 2WBJB 1CFQB 5F93C 1RJZA 1N64L 3GFUA 3ECBB 3N85H 3QUZB 4CN4A 2OI9B 3DYOA 2CRYA 3VXOB 2HKFH 4CU6A 5DFVC 4U7SA 2X70A 3HNSL 1AGDA 5MI0C 1BBJB 2R2EA 4QKXB 1GH7A 3OB0K 4KTYA 4D94A 1IMHC 3HRZA 4HXBH 3V5DA 2XI9A 1T6VN 1JHKH 3DIFA 2BHYA 5DEGB 2GEEA 4PP2A 5EWIL 5E70A 1A7NL 5IW1B 1JYXA 1U2CA 3QEQA 5IHBA 5HHOA 1IC5H 3C8KB 4NQDB 5I1CL 2OSLA 3PWLB 4S0TD 5T3XE 1ED3B 3WV0A 3L7EA 4LCUB 5SWZA 1PVHA 4TNWF 2QSQA 4FNLL 5HJ3B 3TF7C 3Q5OA 1RURL 2F19H 2P24A 2IADA 5MEQA 3QG7H 4JKLA 1QSED 1S9VA 3LEXB 4FQHB 4CJ1A 5MEOA 2BDNH 5F1SA 4OAWB 2APWA 5GS0C 2W9DL 3ZT5A 2J8OA 4KK8D 3QIWA 2OXHA 1P4IL 1QO3B 4NZTL 4H8WC 5FYJL 3TZVD 2F15A 3EJJX 1CFNA 4YHZL 5I2IA 1CLOL 1TDQA 5C0CB 3SGEH 3SKNB 5C71A 4WEBL 4LMQE 3QUML 3X17A 4TVPE 1Q0XL 4WENB 5FXCH 1MRDL 2CDGA 1MIEL 4L3EE 1HI6A 3H0TA 1C5CL 3RWIB 2Q86B 3TJHC 5LXGH 2ADIA 3BKCL 5H2BA 3HMXA 4WCYL 1QG3A 1DLHA 4LLYB 4O2CB 5GISH 1TZHA 3GSNH 4PJIE 2UV3A 1ZLUH 4LSQL 4K7PH 1CFTA 4LSPH 4FNLH 1MJUL 4Y19A 5L2KB 2D7TH 5FO7B 4NQXA 5T1KA 5DVLA 4RISL 3LN9A 2GAZA 3MV11 1FRGL 1MUJA 4EI6A 5IMLA 4N0UB 3IDXL 1CF8H 5C7XH 3QO1B 4Q2ZA 5EBLA 1EAPA 2J8UA 4U1KA 3PL6D 4NWTL 4Z7OF 4NKMB 5F7DB 2Z8SA 4NNXB 3ZYJA 1IAII 4LLVB 1FAKT 5FF6B 3RVWC 2XY2A 3QUMH 5ADOL 3GO1L 3C6SB 3MUGA 4I3RL 1RZIB 4PRAA 4EOWH 4OF8A 5E56A 3O2WH 4WI4A 2BX5A 3NCYP 1RZJH 2VQUA 5C3LD 2HVJA 2I24N 2DM4A 5ISZD 1XH3A 3ULUC 4WY7L 5E1AB 5BXFA 2RBLA 3PL6C 2CDFA 4NZRL 1AKJA 2EH7L 5ADPH 3QO1A 4Q2ZB 3SDXF 2E7BA 4LVHB 4ODHL 3L5HA 3RZWA 2VZ1A 1B0GA 5JDSB 4OGYL 1LWRA 2VLME 1YYLL 1LO3L 2CRZA 1BM3H 4UTAH 3MRHA 1MHEA 1NFIB 1JGLH 5L88H 1X3DA 3FO1A 4Y1AA 4LAQL 1CK0H 3TFKD 2HJKA 2GJ6A 1MCCA 3STLB 3U7WL 2A83A 2X4NB 3CDGA 1QOKA 3HN3A 2IPUG 2CLRA 2AXGA 1JL8A 4DN4L 3SDAA 5IV2A 2BNRD 3U9UA 5DS8B 4HIJA 5HHPA 4KQ3L 3SQBA 5HI4C 4PJAF 5B3NA 1S5IL 4OKDA 4CVXA 2V17H 4L4TE 5D71L 2EKJA 1C7SA 3RNKB 4JJ5A 5HYIA 5I8EA 2EDHA 3K2UH 3BUTA 3DX9B 3DROB 3IXTB 2EXWC 4P5TD 4J8RA 4X83A 3M8OH 1BPVA 3VWJB 2MKLC 2FBJL 3S4SB 2ITDA 1D5ZA 3G5YB 3CH1B 3H3KA 4NHUB 1EHLL 5EOCH 4WUUD 3O6KH 3BRDA 5I8CA 1JNJA 1VFMA 5KG9B 3C8HA 3RGVC 1NFDF 3CU1A 4FQQB 3HG1B 4ZAKA 3MYZA 2RR3A 4Y4HD 4KTEL 3L9RA 4ETYA 5GRVL 3KPOB 1FFQA 1GGCL 3H8NA 2JCCF 3TVMA 5MEPB 4F9PA 2D4FA 1I1YB 3HPJA 1C16B 2VLKD 3MLXL 4HPYH 2BHZA 4OV6F 3NACH 3GMQA 3C09B 5HHQB 4OFKA 2AXHA 4G3YL 1NC2B 1FLRH 2D7QA 1G7JA 2R1WA 2I5YH 5I1DA 1UWGL 1YPZE 2PCPB 5B39G 4DVRH 4OQTL 1A1NB 4ZQKB 4CADA 2BJMH 2J8UE 5IESL 1BD2B 2AQ1A 1BQLH 2DWEA 3AB0C 1QRKA 3UTQB 2CQVA 3QPQD 5D2LE 3ESUF 4F7MB 1F11A 1OSPH 2PCPA 3KYMB 1S7RA 2QADD 3RUGB 1K85A 1N5AA 2AJZB 2RCSH 1KEMH 3O6KL 5CZXD 3BDBA 4E9LA 4WTXA 2YD5A 2XQYG 2FIKA 1CXHA 4LLWB 4KHTL 3C60C 4MAYC 3V0VA 1O7SA 4ONFL 3WFZA 1OGAA 3SKMA 1S9YA 4HF5H 4JFZH 5FKAA 1BF2A 1WSST 3F7VB 3MRRB 1G6RA 3VRLE 5KAQG 3FO1B 1UCBH 4Y16D 4P0DA 2F8OA 3NPSC 4ELMA 1FNSH 4E41D 3HMXH 1N6QL 5AD0A 4GRWH 4G5ZH 3WFEL 5J11B 2XXCB 5D72L 2JJWA 3MJGX 4L3EB 2DDQL 1BEYL 4R90L 3FO2B 5HY9B 1I75A 5DJ8A 3A67L 4MWFB 3V79C 2EXYC 3T09A 1UZ6F 4PJDA 3A0OA 3RDTD 3BP7A 1D9KA 3DURB 5T1MA 3O9WA 1U3HC 1D6EB 3EUUA 4D0CB 3GIVB 2VLKB 5DT1L 3AXLB 2P5WB 1YZZA 1DJSA 1XZ0A 3IDMA 3CLFH 4ZSOA 4CN6A 2VDQL 2ERJC 2CIIA 4KKCC 1NJ9A 4ELKB 4I4WA 5MP6H 1QKZH 1MJ7L 3QUYD 1TVHB 3RVXC 4DUWA 1JWMA 3L6FA 2ATPA 3MJ8A 5EPMA 4AK1A 1FGVH 2SEBA 2G9HA 2XQYK 3CD4A 3QDME 3NFPB 3K46A 4D9LL 5E8DH 5IT2L 3D2UA 3A6BH 3RIFF 5BXFB 5IB3B 2D9CA 3VWKB 4GBXD 1JTTA 5FUZH 1ND0B 4I0KA 4PG2C 2J7LA 2AS5M 4TULH 3VFUA 3OJDB 4LCWD 1FORL 3IDUA 5I8OH 4HWUA 2DWEB 3QA3B 1NAMH 3ILQC 4IHOA 5E4EC 3T0ED 2R0WL 4Y2DA 4XPTL 3RKPA 3VFMB 3ZL4L 1WIPA 1B4JL 3PQYD 2AVGA 3O0RL 3MUHL 5J11C 4NQUA 3MMEA 1GVIA 4TQEH 4P3WA 5IW6A 4RGNE 3BKYL 2A6JA 1Q0XH 2AK4D 3BEVB 2UZIH 1GIGH 3CZJA 1QACA 5EOCJ 2I9TB 5I1GH 1VEPA 4PJ7F 5SWSB 2VZVA 3T0VA 4G9DA 3V0AC 2DQEL 2OTUA 4X6CE 5JUEL 2DIAA 2BSED 3FT2B 3JVGA 3NH7L 1NC4A 1E27A 5FFLA 4F7PA 5DVMA 3BGMB 3IDNA 5CEXA 4CMHC 1N5YH 5IJKC 3SKMB 1AO7D 3QFJE 5B4MC 1NUFA 4JO3H 2J6EA 3LIZL 5I8OL 3LKNB 1VGEL 3VWKD 2QSCL 2ZCLH 5EU3A 2V5SA 4X98B 5EH1A 5B3JE 3VGBA 2B0SH 1A4KA 4JRXB 1AHWA 3HZVB 3L3IA 3TO4A 1MCSA 1FCCA 1F4AA 3MXVH 3N1PC 4I5BB 3VRLF 5I1JL 4U1GB 4PYHA 2P49B 4YZFE 3MV9D 5KOVC 4KVNL 5JMOC 2UWEF 3QUYB 1A7RH 3UTQA 5HVHC 5I76A 1IARB 1YECL 5KVEH 1X9QA 3RWJB 5INDB 1X7QB 2VQ1A 3NA9H 5DD1L 4V2BA 3P73A 5CCKH 2GHWB 2D4DA 1S7UB 3MA7B 3U7YL 4JQVA 3RGVB 3BMVA 4LSRL 5H37H 1UADC 4NOFA 2X89D 4CL7A 4FQQA 3ULUH 4Z7WA 2DM3A 3W39A 1KIRA 3G9AB 3RVUC 4E5XA 1PQZA 1Z0NA 5I74C 3UYRL 2YK1H 4Q58C 4G8FA 5E8OB 3KPSE 3ZHLA 2KH2B 1A47A 3TGXA 3BRGC 1HQ4A 4F3FA 1FVCA 1UQSB 4NC0B 1FL6B 5F9DC 4DKDC 4DZ8A 2A6JB 2JIXB 3MNVB 3U6RA 4C54A 3QULB 3OKLA 3NTCH 2Z92B 3QUXA 3D85B 2X09A 5IHZA 1HYSD 4OCRH 1A2YA 3DI3B 4YHLH 1OM3L 3KHOA 3PDOA 3MFFB 3EFDL 4EXKA 4M7ZC 5DUMH 2FJGA 1KC5L 4N0FB 1OARH 3GK8H 3FTGA 4J4PA 4J3TA 5I73B 5JO5B 3CZFB 5BZDA 5JORB 1CIDA 2ED7A 4I2XE 4QOKA 1FHGA 4JM2C 4P9HL 5D1ZB 1I85A 2L7UA 1FFNB 3CFDA 5DF0A 3S37L 1FPTH 2OX5A 1UT9A 5DUBA 1EEYB 3KDMA 4GKNB 3M17A 1OAKH 1I7RB 2R1XA 3RBSA 3UTTE 1ZANH 1ACZA 1QVOB 4ZOEA 3GNMH 1WCQA 5IB3A 1IBGH 1MCPH 3MOBH 4UDTB 5D7KD 1NGPH 3LKSA 3MNZB 3NFNB 5HYSG 5IJVB 5E6ZA 2I5YL 3RL2A 1IT9L 5EUOE 5EZOL 4PJBF 3V4PL 2XZAH 4AEHL 1I7ZB 3G6JA 1IFHH 1M7XA 3HC4L 3UXFA 1CICA 1DLFH 1T20A 1U91B 1HOCA 2UZYB 4HBQA 3V6ZA 4LSPL 3OXRA 2P5WA 1DL7L 3CMOL 4OM0H 4NRZA 4RGNC 4QOKB 4IRZH 4P59H 4R8WL 1U8KB 2VDNH 5DD5H 5ITFB 1VKXA 4EI6B 3BSZL 2V2WA 3KPPA 3LPWA 2YUVA 3P30L 4W6XB 4X80L 1Z9LA 3BQUA 1A2YB 1K3IA 3PWUA 3QCTH 2AABH 4QCIA 1R3JA 1BQHG 3UP1A 4L8CA 3VFTA 4ZO8A 4ZFZA 5I16A 5T5FH 4GRWF 3VE0A 3D39A 1YPZA 5HBBA 5HPMA 5I9QB 1L7TH 2GK2A 3JZ7A 4PUBH 4KV5E 2A6DB 2YXMA 4O02L 2DQCL 1G7MA 3FB5A 5L9DH 3ZHKA 2XG5A 1P4IH 4NZTH 1AI1H 4N68A 3MCLL 2AJYH 3EFDH 1MFNA 12E8L 1MWAL 3FL7A 3LHPL 3SKUD 4L4VD 1LVEA 2J88H 1QUNA 3OGCA 4I77L 2HYMA 3I6LE 2LVCA 3HAEA 5C9JA 5JR1H 4NQDD 2VH5L 4TPRL 4RX4A 3R8QA 3BJ91 4NCC1 4HUMB 1MAJA 1S9KC 1MCRA 3SPVA 5LGHH 3LKQA 3PL6A 3D6GA 1U8QB 1GGTA 3BIBX 2HA1A 1LE5A 1D5BB 4IRJD 4LAQH 2ZSWB 4S1QL 5JOPD 2HWZH 1LEKA 3IFOB 2D7PA 1HKLH 3TBSA 1DVFC 1EHAA 3VXRE 5GRUH 3UTPD 4MD4A 2OSLB 4LLDB 4QYOA 3WHXB 4MXQD 5IROA 4X6BB 5MP6L 1TQBB 1FV1B 2IAMB 5HSFA 1U8JB 2NY5C 1BFOB 5I1KL 4KJYA 3RHWF 2DI8A 5D7IF 3LKOB 2B2XH 5HPOA 3T4YB 3OZ9H 1EEZB 1FVDB 2R8SL 2X9XA 3PL6B 1KULA 1IZKA 3GI8L 2W92A 4K3HA 1Y18A 1T0NA 3FQNA 1N3NA 4J2XA 2AQ2A 4H1LG 3GSVA 4YK4C 3TZVC 3P9LB 3ZKSD 1ODAA 1F2QA 4KI5F 1IGCL 4YHIA 4YH6A 1NCCL 3HR5A 4Y16B 5DD0L 1MVFA 4QHNA 2ITDB 1LO4H 1TPXC 2QHLA 3P9LA 5JIPA 4NQEE 3KS0J 4CMMA 4AM0B 1WWWX 1NKOA 2ADFH 5IMKB 5JXEA 4XXCA 1CVSC 3SY0B 1YN7A 3GMNB 3QFJB 4X7TA 4JO4L 5GRJH 5JW4N 1UCTA 1YY9C 4PBXA 4ZPTA 4QWWC 3FB8A 5DJ2B 3GSNA 3PP3K 1RFDH 4X9BA 1FV1A 2IAMA 1T1ZB 1OAQL 1ZEAH 4ZUTA 1QFPA 1QSFE 2PXYA 5KAQF 1ES0A 5I30H 1GGBL 2FJHB 2V7NA 5F7HA 1IGIH 4JPIB 4MAUL 4ODUB 4K7FA 5I15H 4O51B 1CGSH 3D9AH 5HD8C 4NQVA 3IKCA 4GW4B 1P84J 4XCFH 1JK8B 3QQNA 1NBYB 1MJJA 4P2QE 4OZHA 4K8RD 5EU4A 1YN6A 1RUAL 1TXKA 1A3QA 5BQ7B 3U36B 4GG6E 4FHBD 4WO4B 1K6QH 3I9GH 1KEML 1J8HE 3OX8A 4MA7L 2FSEA 3DGGB 4R0LC 2CGRH 1U3HA 3B9KD 3DTXA 4HPOL 2OQJB 4U6YA 1I9JL 4NNYB 1NBVH 1ZVSA 3PWVA 1EFQA 1KGCD 3NPZB 1JI2A 4HBCL 1HCVA 4ETQA 5C08D 5C3TA 4HKBA 1M05B 1WFOA 2RGSA 3QPXL 1DBMH 4K94L 1JGEB 4GXVH 4OCWH 5FGBC 5C6WH 1MCOL 2GTWA 1A64A 4I3SH 1ACYL 1HILB 4MD0B 1F4WL 1U93B 3HB3D 2R56H 1KTDA 4D8PA 1JZ7A 4XMKH 4O51A 1BAFL 4YHYB 1QBBA 1R3JB 4P4KA 4TVPD 1QLRB 3S9DB 3V7AE 4JFEB 1TZGH 1ADQH 2NY1D 5E9DD 2QQKH 4PRBA 4N0UA 4ZAKC 2P8MA 3MV8D 5BV7B 1Y6NR 3VXPA 3NZ8A 5J9PA 1RZKH 3GJEA 2VAJA 2HLAB 3BH9A 4XBEL 4ZOCA 3BISA 4O00A 4L1DA 1XCTA 3QUMA 3G6DH 3N1FC 5E2JA 3VJ6B 3DGCR 3TIEA 1N64H 5GS1C 4JRXE 4NUJB 1R24A 5J13C 4ZFOA 4K7PX 2NY3D 4EDWH 4LSSL 4EN3B 3QAZC 4XVSH 1QNZH 1QQDB 4DKEL 1IM9D 3WKMH 4PV9A 1A7PH 1F58H 2XWTA 4RA3A 2V7NB 2E27L 3PDDA 4UV4L 4Q9RH 4IOIB 5C09A 3UZQA 4XXDB 3BHBB 5IJKA 1DEEB 3W0WE 1LQSR 4OZIB 2FZ3A 4XVTH 4C55A 2G2RA 5JOFA 3I3BA 3OMZA 4HK3N 3B2UD 4UAOB 2N7BA 3GMNA 4TTDC 2P5EB 1A0QL 5I18H 4I9WD 4JRWA 2D31B 1ZA6A 5E6YA 2IADB 3ARDC 3OKNA 4ZMAT 3Q6GL 2R0ZL 2F54E 3OF6D 3QI9A 3WXWL 4WWKB 3IDGB 3QCVH 4ENEC 4OIIL 1MCEA 2QQQA 4AIZB 3NCBB 5FDYA 3WL9B 3RTQC 4I48B 1EO7A 2UZIL 4DN3H 3GIZH 4R7DB 3V7AG 1JGDB 1P7KB 5GS2D 5L6YL 2NMSA 3LKOA 4POZD 4TOYH 1NANH 1TNNA 4FFWD 4X9IA 1AXSA 2PYEB 5IK3A 3V5DB 4AENA 1JYVA 1SEBA 2HH0L 2ZUTA 1UA6L 5D9SB 3T2PA 4POZC 3DXAB 5IMMB 1PQZB 4NT6B 3QDHA 4L5FL 3P4OB 2ID5A 5CGYC 4Z8FL 2OTUB 3D39B 1ZGLP 1VACA 3SBWC 5DMYA 1FNHA 4MXVE 1WISA 3KVQA 1PG7X 1Z9OA 4U1SB 4YGVB 4ZFGH 1RZ7H 4EDWL 4OCYL 5E2TL 4B7IA 5KJRH 3ARDD 4O5LL 4PJAA 2CLRB 4JFOA 3GI8H 3GJFB 5T3XH 1GJIA 2R1YA 1I7UB 3ULVE 3HAEB 4HFUL 3OGCB 2CO7B 2HN7A 5T3ZL 3FOMA 4JY6B 2C3WA 5I76B 1PSKH 1IKNC 4Y5XA 1HXMA 3MTRA 1FJ1A 1P4BL 6FABL 4NKDB 1F4XL 4Y19D 5GZOD 5T1KD 3DOSA 5F88A 3K8KA 2OS7A 3SDCC 1AKJB 5HPMB 2X9YA 1DQDH 4A6YL 3MRNA 1QEWA 2FECL 2FNBA 4XPAH 2YMXL 3L3OA 4HSQA 4X8JB 4YO0A 3G6JE 3HE7A 1I8LA 3B5HA 3TYFA 4MQ7A 3KS0H 2ATKB 2FDBP 2I60H 1HE7A 5DA0B 4AL8H 43CAA 1X6LA 1KJVA 2XIDA 3WHE1 1WCBB 4G6KH 2A9NL 1A6AB 5JXAH 1A6TA 4JZJA 3WXVH 3PABA 3AC0A 5E5UB 1BVKA 3IKKA 1XIWD 5GS0H 3INUH 5HI3C 5T3ZD 2CR3A 2AKRB 2NPLX 2NY1C 4G80A 6FABH 3EYVA 4XPBH 5F6HI 4F8TA 1WC7A 4U0RC 1W72B 4YO0B 1J1PH 5SX4I 2WBWB 3VA2C 3T08A 4U6YB 2ARJB 1FSKB 4YX2L 1EXUB 4LNVA 2ILLA 4Y19B 4ZO6A 1Q94B 3VA6A 4OGXH 5C0GA 4HUVA 3ZDXE 4U3XA 2YC1A 3CVIL 1JJUA 1J1XL 5DHVH 4BZ1L 5GJSL 4Y5XB 4R3SA 32C2B 3GBML 4DZBA 1EMTH 2FJFA 4YHMH 5DMJB 1F6FB 3B9DA 4RMVA 3OJ2C 5D7IB 3SCMA 5IB4A 4AEIH 1K2DA 4YPGA 5TQ2L 4F9LA 1PKOA 2A74B 1I7UA 2IPUK 3JV4B 3MACH 2ARWA 4YGVA 3U30C 2QQNH 3BAEL 2DS4A 5IEHB 2FO4A 5MEOB 3CAFA 1G7LA 4LEXH 4MDIA 5FDWB 4DJMA 3SE3A 2C1OA 2P8LB 3KYMA 2QR0A 3VI4E 4U7KA 1BIIB 4DGYH 4H1LA 1MPAH 1XGQB 3EYUL 1MH5B 4LQFL 4M1DH 3IRZA 4QRRB 5E8NA 3WIHL 4X99B 1KBGH 3RVVC 2Y6SC 4JDZB 3L3OB 4P2RB 4XNXL 3IU4H 3RP1A 3VMNA 2VZUA 3NIGE 2XACC 4GAGL 2RCSL 3JV0A 5C0BD 3BGFC 4LDOB 5HHOB 3SGDI 4H26B 3VXSA 2B1HH 2EDEA 2CPCA 4OGAD 2EH8L 5E2VL 1F90H 4UILH 4PRDA 1KB5A 5E2UH 3QDGE 3CDFA 1JZ5A 1MFCH 4P46D 4BQ6A 3FMGH 3LRHA 2C4FU 3JWDC 5HVFB 3PV7A 5FOJA 3D5OF 4QF1B 3VG0L 2P5EA 1BVLA 3NCYS 3RX5A 5F6HJ 3SJVA 3CVHH 1CFSA 4PRPE 4UDUA 4PRHE 1N5YL 2YUXA 3X13B 2A74A 3EDEA 5CUSL 1F6AA 1J86A 1WFNA 2VTFA 1H3UA 1OGAD 1R3KB 4D0BB 1S7QA 3ZE1E 1C5CH 1JP5A 4XZUA 3MRIB 1TFHA 1PZ5A 2AEWA 2DB8A 1TJHL 3L5IA 4OT1H 3KPSD 4FQLL 1KLUA 2V2TA 1XGPA 4PJEA 4EXPX 4S1SL 5AZ2H 2VQTA 4K2UH 4ZUVB 5C6TH 3SDXE 4PRNB 3G08B 4S10A 4F7CA 1OY3B 5FGCB 1C16A 1YDPB 3P4NA 1WTGT 3V4VH 4D0DB 2AJVH 5CWSB 3V2AR 3HLAB 4Q7DA 4LCWE 3LD8B 2YPLD 3VXRA 4U1MB 1EPFA 4HKJB 2NYYC 3U4EA 1RD6A 4WNQB 4OLEA 3FRUB 3GRWA 2CIKB 3HG1A 3BPLB 2D7OA 1A5FL 3CSPA 4PB9H 4AH2B 3ARFC 4JG1L 2X7LB 5F3HA 3NAAH 3RDTA 4CAGA 4P2RD 3TT3L 1NCCH 4NFDA 4KU1A 4JFEA 4L8SA 2OJZH 2EYTB 3LN4A 5GS3A 1GC1L 4UTBH 3ROOA 3ARGC 4JDZA 4W4OA 2J5LC 1HIMH 1AJ7L 1WT5C 2MNUA 1Z2KA 4H25B 5MERB 5J4MA 4MA1C 1XGQA 4P2CG 4FFVC 4X4MA 3TV3H 3RNKA 5IOPB 4NC1E 1N7ML 1HILA 5IQ9A 2AK4B 4YNYA 1KNOB 1H8NA 3KNBA 4XH2B 1HXYA 3O4OC 3MRNB 2XTJC 1AR1C 1CE6A 1M6OB 5CJ5A 3WO4C 4ZYKB 1NBQA 1VHPA 4H1LH 4CW1B 1B90A 5JMRA 1KJ2A 3C6LC 4YHNA 4HC1H 1LHZA 4M43H 5FYLD 2R4RH 4JHAH 3O8XD 1JNLH 1HDMA 3FQRA 4G6FB 1DE4A 2NXYC 4AZ8A 4DQOL 5FGSA 5D2NE 1OAUL 4IDJL 3DSFH 1OAYL 3QXDA 5DURB 5C0GB 2CLVB 5EA0H 1V7ML 4FZ8L 2Z35A 1INDL 2BVTA 3O9WB 5DWUH 3DETD 3FQWA 3FFDB 3TBWA 5EBGA 5GS1B 4YHPA 2NCMA 2AK4A 5DHVA 5ITBH 3TNMB 5HY9A 3WS3B 1IEBA 1FL6A 4MNQE 2EO9A 4Y5VA 3VFRB 5DK2A 5IEKB 4N8CH 1JGEA 3C5ZA 1CYGA 3U0TB 3VG9C 3AAZA 3NCEB 3QCVL 4UT9H 4ZS6D 4JHZA 3MZGB 4LLQA 1OW0C 1I1AC 1U8PA 3X14A 3LDBC 4ZXBC 1ED3A 4NZJA 1HYSC 3E6FA 2WSKA 2XQBL 5ICXA 4Z7WB 5FKAB 4S1RH 4L8BB 3QO0A 3IFLL 3OXSA 1AXTL 3UROR 4P4KC 1MRFH 1IC4L 3HCVB 3PWPA 2C3VA 4X7FC 2Q76A 1I1CA 4FMKA 3DV4A 4Z76B 5E99H 2QQNL 4LSTH 3MRMB 2A2QT 3GBLA 1Y0LA 2GJJA 4RQQA 1P53A 3H42H 3UO1H 5ICYA 5ISZB 2J8UF 5CD5C 3GMRB 2UZXB 1JPSH 4XPGH 4MQXC 3D0VB 3RTQB 1NAMB 1DVFA 3IFPA 1TENA 5BOPA 4WVRA 1LGVA 1U8MA 4ZSOE 3TN0A 1A1NA 4Y4FD 5MENE 3UTSE 4BUGA 2DBLL 1YEHH 3SGJA 1CBVH 1T0MB 3B2VL 3QHZH 4K07A 4LCYB 3UJIL 3MUY1 5I17B 3UTZB 4QRPB 4LSUH 5F7EH 5FB8B 4M03A 5JHDB 3RWDA 4UDUB 5BMFL 2ZG1A 4JO2L 4L3CB 3SGDH 2ESVD 2A1WL 4ZUSB 2V9RA 4LKCA 1ADQL 1ZLWH 3HB3C 3O45A 1Z6JT 3GMPB 1M1SA 4NT6A 1P9MA 5JW3H 4ZNCD 4WTZA 3C87A 4NP4L 4XMPH 3AU1B 5CCKL 3QDJD 3O0RH 5JQHC 4JFPB 1NAML 2IGFH 1CGVA 1HHJB 3EO1B 3WD5H 3ULUE 1OWRM 3WSQL 5E5MA 1YNLL 2Y36H 1RMFL 1X5GA 4QOKD 3DETC 2YA0A 3QDGD 4URTB 2FX7H 4NPYB 5KS9A 1ZVHA 1ZMYA 3EIFA 3GHEH 1OTTC 1E4KC 3QUZC 1MRFL 4ISVB 4X0KB 3X12B 4JO3L 5CMAB 4JQVC 4R97C 3LS4H 1WGOA 3T0WA 3IU4L 5E2WL 2X1PA 1RK1B 1PD6A 3L5JA 4PS4L 5E94B 5CAYB 1UXSB 2WUCL 1JF1B 5IMLB 2CDEA 2HRPL 1NUDA 2HT4D 4WGVB 3ILQD 2HT3D 1EX0A 4ELKA 5F89A 4NQED 2X4UB 5F8RC 5I19H 4ENED 2A6IA 9CGTA 1FZOA 1CXLA 3M17B 4P2OA 3VXMD 1YECH 1MJJB 4KPHH 4N8VA 3L3DA 2MCPL 2Z8WC 4MZ3A 4HJJH 4NKDA 2BVYA 4OLVL 3BP4A 4LCCA 3PP3H 4ZUTB 2FYYB 3E2HC 3MRIA 3FTGB 3LVEA 1LNUA 4GUPA 4IIQB 2XA3A 4LVOC 1W72A 5KN5B 2B8OT 1ORSA 3WEXA 1L0XA 4P48A 4FXGA 3WEXB 3LZFL 3BZDA 4O2EB 1CL7L 2IJ0C 4GG6B 1LNUB 3DX8A 4IIQA 4WI8A 4LGSB 4I0PD 2BNQA 4Y4KA 5DR5L 5IF0B 4G9FE 2DD8L 2P24B 4NPYA 3GI9H 2JIXA 3U6RB 3VGFA 1KTRL 3T0EB 1G6RB 2FWOB 1KN4L 4PJ9D 1OAXL 2OJEA 4XBGA 3SDYH 4IRJC 4KZEL 3QQ4A 5E5MB 1WEJH 4PJHB 1MQKH 3MCKA 2UYLB 2ZCHH 5C0BB 1WICA 3JWDL 1BZ9B 2FR4A 1K8DA 5A2IH 2VL5A 1EUUA 2H2PC 2COQA 5FO8B 4ZUWA 1NPUA 3WYRA 3LCYA 4OCMC 4C4KO 1F6AB 4X4YB 2PO6A 5GRYA 4G42A 3V5KA 3ZTNL 5DC0A 3X3GL 3W9EA 3BJLA 3NCMA 4I1NB 4WUUB 3ARQA 5MEQB 5LGJA 1M7DB 4OLYL 1KIQB 3V4UH 4PG9A 4G8IB 5DJZB 3U2SB 1U8QA 5JHDA 2DYPA 4RGMB 3SOBH 2HTLD 3PWLA 1OAXH 3ALWA 5D4QA 5F9AC 5MEPA 2DI7A 1BD2E 3O3AB 5FKPA 4PJGA 2QADC 3VFNB 2OR7A 4OFPA 4OZ4A 2X1OA 2Z9TA 3TPUB 1VACB 5IFAH 1I7TA 1I9RL 5IW1A 1G7QB 4JFFE 1AHWB 3L3IB 2E9WA 3LQAH 1JI1A 3CUPB 3EOBA 1RZGB 5B8CB 4YQXH 1CU4H 4G43B 5CEZL 3CLEH 1IVLA 3FCTB 1FO0B 4BQ9A 5AEAA 3G9VA 3MYJA 3VXOA 5JXED 3I6GB 4JN2B 1H3VA 1II4E 1OTSC 4D3CL 4QXUH 4EN3C 4M1GH 4MS8D 4Z7WE 4YWGH 4EI5C 2RAMA 3MJ7B 2MPAH 5FB8A 4XMLH 1QTYT 3JTTB 3D1MC 4QTHA 1ZVYA 4FXGB 3V6FA 2NNAB 1RIHL 1U8PB 5E2UL 5TFSH 3U0WL 2G5RA 4NO3B 3IRPX 2LTQC 3MRLA 3U9PL 2X4NA 3BT2L 2CLZA 3CDGB 1E4WL 2EXWD 5FUCC 4M6OH 1GL4B 1OSZB 4UB0H 3GUTA 1OAKL 1CTNA 3ROLB 2XQBH 2Q7YA 2HJLB 3GGWA 4K23L 1ND0A 1F3RB 4RZCB 2C5DC 1HEZA 3VW3L 2BY2A 4A2MA 3R06A 5IMOA 2BCKB 1CLYL 3MOAL 2EKSB 4Z0BL 2ZCKL 4I9WE 2CUHA 2LAAA 1LMKA 3CDCA 5DEFB 1SEQL 1XFPA 4M8QA 2UVEA 4MB5A 4G8EB 4EI5D 1LDPH 2BSSA 3MV7B 1YEFL 3ARPA 1RHFA 2XN9A 4G7YH 4QRQB 1QSFA 1W8OA 1KB5L 3S36H 4K55A 3X14B 1LK3H 2OQJA 1A9BB 1HH9B 5IBLD 3A67H 4UIMA 3CIQA 3RNQA 1R24B 3L3GB 3NABH 4OZGF 3BE1H 3WIFA 4OM1L 5FF6A 2AJ3A 2BC4B 3C6LD 1XZ0B 4WEUD 5D7JA 3UTTA 4P23A 5KS9B 2FJGB 3GSRB 1A6WH 3MMEB 1N2RB 4HXBL 2OR9L 1MI5D 4PRBB 5M94B 4KJPC 2P7TB 4BUHA 1OOAA 4NO2B 3LEYL 5JA8B 4OLUH 3QEQD 1NDMA 4L8DB 3EYUH 4CDHA 3N1QC 1S5HB 2ICWA 3ARFA 4O9HL 4JGMA 25C8L 4Z95H 4LSRH 4N8VB 5A2JH 3MBED 2ED9A 2XNAB 4YPJA 2XT1B 1QRND 3MRGB 4L29B 3MGAA 3I3EA 4JCMA 5CEYB 1FO0H 3WXVL 1CDIA 1CR9H 4XPHH 4KDVA 5IVOA 1P7KA 1EHXA 1N8ZA 4OFYA 1WBZA 1OGAB 2ADGB 4PJ5D 1N26A 5GRWA 3QZWA 1RHHB 2CIIB 3H6JA 1MVUB 3UEZA 5D1QD 5DYOB 3D18A 2X4OA 4HUXA 2XICA 1MREH 4YK4B 5T1LD 3TZVB 5J06A 3RPIA 4UTAL 4E42B 1YQVL 4D0CA 4GRMA 5L88L 3O81A 4CRPA 1QPXA 3G5VA 1ZA6B 4YDIH 4R4BA 4QYOB 4P2QB 1F11B 1KJ2H 1XR8A 1LDPL 1I9JH 3V5KB 5D1ZA 1NBVL 2AJUH 3P0GB 3K1KC 2R1WB 4I0PC 3G5VB 3R1GH 4M6NH 4QRPD 1MQKL 3BZFA 1AQKH 2XWBA 1RU9L 4GKOA 2H6PB 3ZDYE 1LP9E 4PGCA 3DIFB 4JZNB 1CFSB 5D8JL 2AW2A 2A77H 1AC0A 4MYWB 4UQ3B 1SJEA 3S5LB 3ZYOA 3TO4D 1J11A 1DQLH 3T0EC 1RHHA 2NY4C 5C9JB 3MV9A 3AY4C 3P11H 3K80A 4F3FB 4MCZA 4AQ1B 1VESA 4RAUA 4ZUVA 5K9QI 4KDTC 4DCQA 3H3PL 4W6YB 4NUJA 5T33H 2XZQH 3OAUH 4GW5A 3PWJB 4R26H 5E5RB 4F58L 1BFVL 2M8XA 1ZHBA 2YKLH 3UTZA 3HA0A 4PGCB 5JNYA 1QLFA 3EJYC 1Q9LB 2HT4C 3HMXL 4N8VG 5T3ZE 1N6QH 4G7VH 5DK0B 4M6AA 5B38A 5DJ6B 5FO9B 5IVXF 1KPUB 3EYFA 1EZVY 3BQUB 1KCLA 4S1DC 3KXFE 4MAYB 4JREB 5CGTA 3EYQC 2GSIB 1TMCB 3K3QA 5JW5A 1ZANL 3DVIA 3BD4A 3MRMA 4P2OB 1SY6L 3PWPB 5BW7A 5ENWA 3UTPE 1FGNL 4HUXB 3D25B 4G42B 4X9HA 2Q8AH 2BXZA 4PRID 4I5BA 2VLLA 3PXJA 4DGVL 4LASH 5CILL 3CXHJ 1FNEB 5IFHH 4WHTA 5HDQH 1UB6B 5KJRL 3ZTNH 2Z31B 1A0QH 2CMRL 3SE8H 3BP5A 1FG9C 32C2A 3K74B 5D96C 4PJCB 2VXUL 1E6OH 4U4BA 2B4CH 4YXHH 2X1WL 3SO3C 3S4SG 4GLRI 4K71C 4FZ8H 1MRCL 3C6SA 3R0NA 1KYOK 3GGWB 2Q7YB 5L0QC 4MD5A 3B6SA 1DUYB 1OSZA 5K9OB 5BVPL 1ES0B 4KK6C 3OKEB 3CZFA 1KSRA 3FOLB 4U33A 5JHLH 4LHUA 4OZIF 5CEZD 3PGFL 3UPCA 2H2PD 3R8BB 1ONQB 2X7LA 5F3HB 2DQCH 5CZXC 5DZOA 4NUGH 4DN3L 5KN5A 2Y9RT 3VGAC 3G5XA 3CC5B 2F54A 4JB9H 3STBA 1NMBH 3QPQC 4XRCB 5EFIA 4NOBA 1HH9A 5BO1L 4MNGB 3IVKB 1QA9A 1JN6B 1MHEB 4NKOB 3A6CL 2JJSC 3IFNH 3WKNA 3MGOB 1QSFB 3OKKB 3QIUB 3MLVL 4Y4FB 4JY5L 3REVB 4HD9A 1VA9A 2APTA 3QEGH 1XF1A 3F58L 1PG7W 3RFZC 4LIQE 1GPOH 2CDGB 3TO2A 3HE7C 1CFNB 5C08B 3T0BA 1IQWH 4NN7B 4UU9B 4LFHD 1WZKA 4WV1C 3WIIH 1TVBB 1F4YL 3PP4L 3ISWA 4TNVK 3LS5H 4RFOH 1A8JH 4TNVF 4PJ9B 1OGAE 4QHLA 4WU5B 4MD4B 1I1AD 4M6ML 4LRNL 5HGBB 5E00B 4OQ1A 4AM0A 4KGJA 2HG5B 3C2AH 1GGCH 1KJVB 4MSWB 1J1OH 5HGHB 1MAMH 2F5BH 1H3PH 3QXVA 1HZHH 1S9XB 2DLFL 1RV6X 2AJXH 5EZIH 4GS7C 4OB5H 3MLVH 1MUJB 4OZHF 4LP4A 1R3IL 4M3JA 1J87A 4WWID 3TT1L 2BFVH 4ONGL 4PTUB 4ZS7H 4OZFG 1R0AL 3L9RB 3U4BL 1UJ3A 1HWHB 3HE6B 4YHOH 5ID1A 3MLZL 3S34H 3IXAA 2EDTA 3MREA 2VLKE 3BO8A 2H26A 5ISZE 3S3PA 3VG9B 4HEPG 4JVPA 4YDKL 3RRQA 5IG7A 4IS6B 2X70B 3IAGC 4GRLD 2CRMA 1X5XA 4JO4H 5BRZD 2NXYD 1WBYA 2VLJE 1FL5A 4G9FA 5L2JA 4WHYG 1KIRB 3WS3A 3MLRL 2NZ9C 4NJAL 2UUDH 4I8DA 1CL7I 1LEKB 1CDHA 1S7VB 2ICES 1VPOL 4OUUA 4ZO7A 2FD6H 2D03H 3O3EA 5IFJA 3O9WC 1Q0YH 1CFQA 2OK0H 2EYRB 4R7NB 3FAWA 3JV4A 4B0MM 4KRPC 5DSCB 4F2MA 1QFOA 4CNIA 2AJZA 1FC2D 3CH8A 3D2UD 5EO9A 3QJHA 3QWQB 2Q87A 4NRZB 5ESVB 3EOTH 2YN5A 1RZJC 1A21A 4YHZH 3B2UC 4IHOB 3VW3H 4HX1A 4NO0A 2VLRE 3W9EB 2NR6D 1YEKL 3T1FB 2ITCA 1UXWA 5FOBA 4ZXBB 5C07D 4TQEL 1I1AB 1JGVH 1GAFH 3TYGL 3MBEC 4YUEL 4NNPH 1B4JH 2G75A 1DDHB 1VADB 3L5XH 3QG7L 4LRNH 5GGSB 1YPZB 1KCUL 1BX2B 3BWAA 2EDNA 1CD9B 1UWGH 2QKIB 1VFBB 3W11D 5D7LD 1HCFX 4DGIL 3TVMB 2VITA 2SEBB 3QP3A 3O6LL 1M4KA 3ULSB 3W9DA 3BKML 8FABA 4Q6IC 3EOAB 1FRGH 4ZFOB 2VZTA 3X11B 5CEYA 2YA1A 4OLXL 4Q9RL 2EECA 1ETZA 2VISA 3ARGB 3OAZH 4NNXA 2GCYB 4RGND 3FT4B 1VGEH 1A7BA 2KQMA 2QSCH 3N9GH 1OAUH 4GAYB 43CAB 1EUTA 3MRDA 4L8SB 4PPTA 2H3NA 3IDYC 4NQEB 5GSVB 4XMPL 5HHXH 2AJVL 2DBJA 2HLFD 3GSNL 2IF7A 3T2NL 3VI4F 2ZUXA 3Q6FA 2VL4A 5IVNA 3D85A 3LQZA 4KZDH 5DLMH 3GSUA 5TDOB 3QEUA 2ZUQB 4HFUH 5D93B 4HZLB 5C0RL 5J12C 2GIYA 1L7TL 3IAPA 5C07B 4FQ2L 3MRKA 4M02A 5IB1B 1H3TA 3GM8A 3ARXA 2DQIH 1NGYA 5FM5M 1JHLL 3BKJL 3MLTA 4KUZH 3FHAA 3KWWB 3BH8A 5BZDB 5JO5A 5JORA 4PRIE 5C0FB 5KBNC 1KB9J 3X13A 4I4WB 3B43A 1Z3GH 4BFEA 1I9IL 1KCKA 2E7CA 2P45B 1BWWA 1YMMD 1UWEH 1HEZB 3L5XL 1ZHKA 2YD3A 4E41A 3O2DA 2ZUVA 1CDUA 1OTSD 3L7FA 3QEHA 3V4VL 3ARTA 5C0EA 1MJ7H 3AREA 1NAMA 4ODHH 3HRPA 5DRWB 4H25A 2YD4A 2Q3ZA 5MERA 3BP7B 3O8XC 4Z7QE 2GW5A 1T03H 1DANT 3GMOB 4PD4K 1X44A 1WLHA 4KAQL 4ZPTB 4AQOA 2Z31A 5CBEB 2H32B 4PFEA 4LF3A 1CN4A 3LDBB 2G75B 3LMJH 5F1KC 5EOQH 5DJYA 4EI5A 5JA9A 3N9GL 5K59E 3O4LB 1KC5H 4BSWB 3GSQA 3T1FA 1J0KA 4BM7A 2BOBB 4RGOL 3SJVE 5KVFL 1RUKL 1Z3GL 1S5IH 3FOMB 4FQIL 3WUWG 3IDXH 3MA7A 3K81A 4OI9A 5I8CB 1MCWM 1CI5A 3RA7L 3H9SD 2CKBA 2P8LA 3SGKC 3LH2L 5HGHA 4RSVA 4LLUB 4YDLC 2YKLL 2D31A 1QR1B 2E7MA 4K7FB 4S2SB 3HI1B 2VIRB 4NCDA 5EUOB 3QZWG 3I75B 1B0WA 2DQTH 2PNDA 3HC3L 5HHOD 4J3WA 3KHQA 1XGTA 5CHNB 1FDLH 1S7QB 3BI9X 4K7PY 2BXYA 4MHHG 3D0VA 3RTQA 5J7CC 1XMWA 1RJYB 4WEBH 3S34L 3S35X 1AGEA 1CTOA 1W8NA 4HHAA 3TM6A 1EDQA 3MC0A 3CNKA 5C86A 5HGAA 1XF5B 3P0YL 5CSGA 1SEBB 1G1CA 1LK2B 1KT2B 1KIQA 3LPFA 3BPOB 5CJXC 3DECA 1RJLA 1XGUA 2X6MA 3LN5B 4M6NL 3PGDB 5F7MC 3STZB 1F3JA 2E9JA 3FT2A 1FYTE 1S8DB 1U6AH 3PQYA 1TTGA 4U1NA 5D1XD 3C5JA 4KMQA 1RULL 5JPNB 3CXDH 3H9ZA 4AIOA 1GOHA 2I9LA 1A7OH 2XFXB 3ARDB 1QHOA 2ATPB 2VWEC 1VFAA 3TC9A 4JFDD 3VD9A 1JMZA 2JE8A 2IH3A 4R96A 4JR9L 4ELMF 3QNYA 1A7QL 3HZMA 2VXQL 5DZLA 1LEGA 3UYOD 2EEBA 1X5AA 1DBML 3MCKB 1YEGL 4Y89A 1A6TB 3D39D 5ILTL 5J13B 3DBXB 5EU6E 1AGDB 4Y5VB 4RIRB 4ODWB 2AAVA 1CGXA 4HS3B 4KVCL 3AS3A 3OJDA 4TSAH 3RPKA 4LVNB 4L1HA 1NGPL 4KDTA 3DUSB 2DQDH 1OAZH 5DI8B 1KLFA 5KSBA 5D96B 4LU5H 5IVXB 3DX8B 4OGAC 4F57L 3GMMB 5EORL 4YEEA 3O3UN 1UM4L 4JB9L 3WIHH 1N59B 4RX4D 3JTSB 2OZ4H 1QQDA 2ESVB 1EVTC 4MAUH 3K2UL 3CXHK 5I15L 2Y25A 5SX5K 2YPVH 4DUXA 5FYKD 3C60B 5T1KB 4UUJB 1XEDA 4WFED 1P4LA 1JGUH 1LEIB 5CJQH 3U7YH 1OGTB 3MLTB 1CGWA 5F9OH 4ZTOL 4DZBB 3EO0A 1G7MB 4P2YA 1AE6H 2R23A 4NJAH 2BVQA 3MACL 2A73A 2NY0D 2DLEA 5JW5B 3DARA 1NH6A 4HIIA 5E6IC 1F58L 4P23C 5FK9A 2IQAA 4GH7B 4YHYC 4APQD 1MFDH 3Q6FB 3AVEA 1G9NH 1I7RA 2R1XB 4PJIB 4LFHG 3DUSA 2VDLL 2O5ZH 2BNQD 1EGJL 2XPGB 2UUDK 4N9GA 4HGMA 3BRFA 3NA4A 4LSDA 1RK1A 1AGBA 4PRAB 4ZUUA 4AT6A 3DRTA 3EGSA 4HIHA 4J1UA 1D6VL 1IM3A 4GAGH 3DSNA 5DURD 5E8EB 1CICB 3RGHA 4OCLC 5KSVB 1WCBA 4PJ8A 2NNAA 5FYJH 3GKZA 1CD1B 3C5SB 4YAQB 3DJ9A 3WJJA 1QPPA 5AAMA 5DJ0A 1TJGL 5C2BH 4LVOB 1IGIL 2ZWLT 4K3GA 4NM4H 2R0WH 4OZFA 1KEGL 4UQ3A 4HFWB 1HKLL 4HKJA 4OLZL 4G6AC 1OAQH 1EEZA 3PV6A 5BV7L 1XGUB 2DQFA 3LN5A 2R0LL 1MHCB 5DRNB 4X4XB 2XWBB 3PNWB 3UCRA 1CE1L 5EU4B 1I9IH 5BRZB 2PR4L 4PRNA 3FHQA 1OT2A 4P5KB 3ZKXB 3PXHA 5JTWA 4PRPD 4OTXH 4KMLB 2FLBT 3UX9B 2GK0B 3MR9B 4R0LB 1L0YA 1O5DT 3DROA 3RBGA 2D7TL 1IGML 4XI5D 4OSUL 3FQUB 1ZLSH 5EO1A 3I50L 5FDWA 3B5TA 1ZLUK 4LCIH 4MHHI 3UBXI 1IGCH 4WWKC 1X5KA 3RWDB 3LRSB 4PJAB 1S7UA 4GMTH 2X4OB 4I18C 2VRAA 2JB5L 2HFEA 1JWUA 1MFBL 3I75A 2EEDA 4V1DB 3O3EB 5EO1B 2WINA 3IDIB 4TUJA 2OZ4A 1W0VA 4HK0A 4ZOAA 5D70H 4M9PA 4W70A 4WO4D 5D7IA 4BKLA 3TESA 4NM8H 4JKPH 3CSBA 1XGYH 2HFFB 1A22B 1XCTB 5KOMC 1BAFH 2FHCA 3MV7D 1OW0A 5EO0A 4Z7WF 1WTLA 5BV7C 2IAMC 3OR6A 1S7SA 4P5TC 2F53B 3NZ8B 4TULL 5HHNA 4L9DA 5ID1B 4IDJH 3CFKB 2ARJA 3NACL 3BGMA 3BW9B 3IDNB 4Z18A 4F8QA 1A14H 1UJ3B 2E7HA 4U1JA 4TOYL 2HVKA 1ZA3A 2W9EL 1BIIA 1DQQA 1P84K 4U6XB 5FUZL 4ODSH 2AXFA 3GSRA 4JG0H 4ERSL 5EWIH 2WINB 3IDIA 3EBAA 5D7JB 4V2CB 3JUZA 2MQ0A 5D7SL 3ARBA 3V0WL 1V3MA 4JFYA 2R8SH 1YMHB 5DMIL 2VDQH 4O2EA 3NIDF 5JQ6H 2LE9A 3SDYL 4ZDHA 5HYJE 1DFBL 1RK0A 5DHVB 4HKXA 4HJ0D 2YD7A 4HH9A 1YEJL 1YY9D 1R5WA 5CSZB 1QSFD 3FQWB 2FCBA 3OX8B 3EYOB 3IJHA 2YC1B 1S7XB 1MEXH 5BRZA 1UH4A 2AI0H 3WJLA 2BNRE 4NQVB 4P4RB 1FZOB 3QQ3A 1GGYA 2PW1A 4J3VA 5DJAB 2CSPA 2XZCH 4XRCA 1B6DA 5F96H 1JNHA 2EO1A 3MUGB 1CQKA 2DTSA 1QA9B 4KQ4H 1BEYH 2D7NA 4FZEH 4Y5YB 4ODVL 4JRYA 4N0CC 4XNYH 3MRLB 1KGCE 4WW2A 5D1XC 4KMTL 1EMTL 5D2NB 2PYEE 3RZCD 4IIQC 1I3GL 3T3PF 4LQ1A 4WCYH 4GJTB 4XVUC 5KW9L 3BKCH 3GJFH 3QUKB 2P46B 3ARFD 3GMMA 2ICWI 5IMKA 2EDYA 4P23B 4XVJH 1IBGL 3MNVA 3WDJA 2RFXB 2YPVL 4WUUE 2W65A 2ATKA 4LDLB 5SWZB 4Y2DD 4PGBB 1BZQK 1L6ZA 4TSCH 4PLJC 1U6AL 4PJFF 1PFCA 3DXAD 4LAJH 3X11A 3OKMA 3VD4A 1IAKB 5ECJE 2XN9B 1HSBB 4ODTH 1OLLA 4QRUB 3C8KA 5CBAA 4G8GE 1WWCA 4GAFB 5DRZB 1P2CB 4WHYH 4A6YA 5DFTA 2EKSA 2R4SH 1E4JA 1AO7B 5DUBB 5EBWA 5F70A 2EDRA 2FX8L 4YBLB 1NJ9B 4I48A 4DTGH 2HJLA 2O5ZL 3DO7A 4P3CH 1KTLA 4Y16C 2R2EB 5FYLE 5D6CA 5TFSL 3L3KB 3MXVL 1JRHL 3KPMA 4POYA 3ULVC 2P43B 1NAKL 2DLTA 2DWDB 3V6BR 3TA3A 3H7BB 3ZTJG 3B8SA 3FT3B 1MEXL 1CLYH 3QT2A 5A16B 2J88L 4R7NA 5CJ8A 4MJ5A 1WITA 4MB3A 1IGTB 4AMKL 3RAJL 1GHFL 2R2BB 1NL0L 4LBEA 2KUTA 5FA4A 1YQ2A 1J8KA 3LKNA 5TE6H 4PJBB 2O5XL 4KJQD 1S3KL 1CT8A 1O0VA 2DAVA 1E0OB 1AXSB 2PYEA 1GOFA 2HT2C 1JV5B 2IFFL 3RKDD 2VLJB 1TZGL 1UZ6E 1ZWIB 3EKCA 4V1DE 3ZYIA 4PJBA 2BRRH 1UKSA 2PUQT 3C9NA 5FM4A 2X05A 5C8JB 2X89A 3MV8A 3O6FA 5IB5A 2X4SA 3KPTA 1CK0L 1U36A 5D2LB 2NY7H 1R3HB 3RGVD 3P77A 4LEOB 3RWGA 1YEGH 2ZJSH 1RUKH 5I17A 1HINH 5CEZE 1KV3A 3D69B 3TT3H 1KPRB 2W91A 15C8H 3SQOL 3AAZB 4O2FA 1BECA 3V6ZB 1RZ8A 5J1SC 3BIKB 1JHKL 4OF6A 4X6BA 4JN1L 5ERWA 3ELAT 3H9HA 4Z0BH 1CR9L 1DQDL 4OD3L 2Y7QA 1PKQE 1F97A 3O11B 2VXSL 1I8KB 1NUNB 2G2RB 1G7JB 4O58H 1FIEA 5EBWB 4NHCL 4MCYA 2NZIA 2VUYA 2DL2A 4XXDA 3SCMD 3QDJA 4GRMB 1TCRB 3VXUB 4HIJB 2C3VB 3QXTA 3M8OL 4OCSL 3VFSB 1J1OL 4N5ED 4S2SA 2ADGA 4J4PD 5M95B 4HIIB 3EAKA 1J88A 3EZJB 4BK4A 1IAKA 5F7WC 2QSTA 3S36X 1CXKA 5H35B 4JZJC 3JV5A 4MXQC 3T8XA 1NFIA 2MSPA 3VWJA 5E95B 1YY8A 3ZE2F 5HDOA 1MIMH 4NYLA 4EDXB 5IB1A 1U3ZA 1PKQB 4FQCL 3RVUD 1KCRH 1B2WL 4JJ5B 3KLAA 3IJYA 4Q9CA 5E1AA 1UACL 4K7PL 2NY5L 3DLQR 3VRJB 3TH3T 2WQ8A 3O4LD 4X5XA 2FJHA 4OGXL 3CFEB 5ALBH 1P7HL 1UCBL 2AK1L 4TSBH 3G5ZB 3NCCB 4Z7NF 1NCBL 4PTTA 3WUWB 2ARJQ 3WHE0 2XOTA 2Z35B 3DMMD 1T7WA 4O02H 3RVWD 3HUJB 1OLZA 3H9SB 2HRLA 3NMEA 5CD3A 4O4YH 3VXUD 2E7LA 3ROOB 3VFGH 1K4DB 2PF6A 3FT4A 3WE6B 5F97E 5GZOC 1DE4B 1FYHB 4XCNB 4LU5L 2X4UA 1N7MH 1LEIA 1ZHNA 3HHRB 5CZVL 7CGTA 2IH3B 3U30B 1I7ZA 3G6JB 3HFML 2P42B 3OSKA 4QRQA 4ALAH 3W9DB 8FABB 1RURH 1RIUH 1IGYA 2Q6WA 4LEXL 1FLTX 3BYTA 1H5BB 3GSVB 1UXSA 4RWYL 3PJSA 2HP4A 3VWKC 4HUUB 3IDMB 4ZSOB 5DJXB 5MENB 2BSTB 2OXGA 3OAZK 3DV6B 4ODSL 4MXWL 5BVJA 1F8TL 5A43C 4LCYA 1QFWM 1I1AA 3X12A 5LGHL 4WGWB 3HI6L 1OP9A 1MHPH 1YC8A 2X4PA 4HIEA 4U2ZA 4J3OC 4PTTB 3WUWA 1YUHB 5J6GA 2NY2C 2M2DA 4NWUH 2Z91B 2J2ZA 1NEUA 3GUTB 2Q8AL 1PEZA 1OP3K 2OP4L 4NN6C 4MQSB 2DQJH 3F58H 3BW9A 5TPWL 3GKWH 3X3FH 3KLAB 1T5XB 5HHQA 5F7NC 4LSSH 4IBLT 2ZOKA 5B22A 2MKWA 3ZSSA 1B88A 3SDAC 2VIRA 1A6ZB 2EDBA 5F6IC 3MJ7A 3DPBA 3GZKA 3RQ3A 1MCJA 4TRPL 1IGJB 3FCTA 3FZUC 1HQRA 3THMH 3GSOA 2NLJB 5E03A 3BDXA 3C9NB 1RVFL 1RJLB 1KN2L 1FO0A 5CJBA 4J12A 4JM2D 1LE9B 4ODVH 2VKWA 1DQTA 1W72H 1ZXQA 3ZE1F 3QB7C 3ZSTA 2H9GA 1MLCB 4BH8A 5D1QB 2DYPD 3E6HA 2RB8A 4FRWA 2W9EH 3WHXA 3NOIA 3QUYC 3RVXD 4GSDL 1CZ8H 4OAWA 3O3AA 4QRTA 3FN0H 2YA2A 1DUZB 4K94H 2DQHH 4FXKA 1SYSB 3MJ6A 2OLDA 4LARH 4MNGE 4NO0D 4RWYH 2VLRA 2G60L 1H9VA 3K4DA 1KLGB 4JPKH 1K6QL 3VRIA 5DMGD 4JY5H 5LGJB 3F5WB 3ZE0F 3WNPA 1UENA 2CGRL 4XCYB 1NCDL 3OTTA 1IAIH 3RDTC 1CXIA 5GGTL 4G6MH 5MHSD 4GOSA 1OSPL 2EXYD 1H15A 5ACZB 4KTDH 3NZHL 3CFJB 4WW1B 3TO4B 4TUKH 2YR3A 3AMLA 4Z7VF 1E4KA 1T2QL 1RZ7L 3ABZA 2XNAA 5I73C 4NWTH 4MA8L 4UNTA 3CK0L 4YDVB 5GS2H 5BVPH 5DD6A 2WWKT 4XAWH 1BBDH 1WUNT 2VOTA 3JV6A 3U4AA 4X7CC 1QNZL 5FM8A 4PJDF 3S5LG 3FFCB 5AYUL 3DO3A 4G5ZL 1FSKC 2VDPL 3WJJC 5FAAA 5F6IB 1G6RH 4GG6A 1HHGB 4JAMA 3UJJH 5I1EL 2JELL 1P4BH 5EBMB 4KXZI 3TVMC 2NY0C 1FVEB 4HWBL 3MROA 3FONA 5BZWA 1A6AA 1CG9A 1QFWI 4ELMB 2NW2A 2MFNA 4N0YH 3KR3L 1F3DH 4Y2DB 5EDXA 3RWFA 3UTSB 5LWYL 2FGWL 1HDMB 5C09E 3B9KC 3LRGA 2X4QB 4PJFA 1Q72H 35C8L 2HMID 4LHJB 4B53A 5DXWA 2ERJB 3FB6B 3BESR 1DQML 2EIDA 2QHRH 3AFLA 4PJHF 2OMBA 1FORH 2BSTA 2W1NA 4HKBB 1J18A 3CFBB 3PIQB 4ZPVA 1PLGL 4YNYB 1XH3B 2PR4H 1G7HB 4Y4HC 2VYRE 4TUOB 3OQ3B 4YBLC 1EEYA 3BOVA 3KDMB 3I02B 3CFDB 2ITCB 4AG4H 2W65B 4GBXA 2NY4D 4LPVA 4MVBD 3ROLA 3WNOA 1T80A 2F8XC 1YA5A 1CLZH 5IT2H 2FH6A 2VAAB 4XP1H 5B3JF 4K3EH 2Y23A 3OL2A 3LPGA 5GJTL 1T1WA 2HFTA 1PZUB 3HZMB 2X42A 1RIVH 2Z31D 5KS9F 4JFQB 3QULA 1QBAA 4DKFH 1KPUA 3JTTA 3QIWD 3MJ9A 1FL3A 1G0YR 5F9JB 4MB4A 3ZKMC 5JZ7C 1U58B 4OFYD 4PJ5A 3BWAB 4IJ3C 5I30L 5C0IB 3VXSB 4LPXA 1A3LL 3QFJA 1NMCC 1DLHB 4KKCD 2G5BB 3WNLA 4X6DE 3P4MA 3BXNA 5F1OB 1INEL 5BS0A 3ZE0E 3MLYL 3QWRA 4X99A 1G7IB 3S35L 3UJIH 1HNFA 3SKJH 4X80H 4XWGL 3P30H 3IXTA 4FQCH 2C4FT 2UY6A 2XRAL 5JLZA 3ULVH 5AZEL 1I7TB 4Q0XH 4KGLA 3WFDL 3ZT7A 2VZ3A 1IQDA 4HUWB 4RISH 2NLJA 3SDDA 2GSGB 3FMGL 2VLLB 1J8HA 1C5BL 5HGDB 1IFHL 3HC4H 5EU6A 4Z0XB 4QRPA 2IMNA 3ALXA 2EDFA 5KVMC 5CSBA 1FZJB 5IP4A 3U48A 2AJYL 4WWKA 1AI1L 4JFZL 1JHTB 2ZOKB 1ZOXA 1BGXH 4BSJA 4N0RA 3LV3A 4R2GB 5EUKA 1NEZA 4HF5L 3MRJA 2FHBA 2NX5E 1ZSDA 1RSFA 1MNUL 5EIIA 5CZVH 2GK0A 1AGCA 5JOFB 5GZND 3PQYE 5FO8A 4EUPG 3N0PB 5FHAH 1R3LB 4WY7H 1UH2A 4HUVB 4X4XA 5JDSA 4NFCA 1OP5H 1XF2A 3MBXH 4WI3A 1ZLVH 3DV6A 4QT5B 4JFDA 4M7JH 4Q9BA 3FQTB 1JRHI 5KS9E 2DM2A 1XT5A 1GZQA 2IPKB 4WFFE 1CZ8L 4GSDH 5IBLC 4GRLB 4MA1B 4XHJC 3QIUA 4PJHE 1TJIL 2FWOA 4Y4KD 3WIIL 1S9WA 5F1IB 2JF1A 3HZYA 3ZDXF 1KCRL 4LKXA 1IC5L 4DN4H 4RNRA 3TWCL 3V6OE 5LG1A 4NKMA 4Y88A 3WKML 1FO0L 1FIGL 2H6PA 1V7NH 3MNWB 5I8EB 5JZ7D 2VDML 5DD0H 5DDHB 3I2CL 5GS1A 1D9KB 4IEFB 4MJIA 1OP3H 1DP0A 3H3BC 5L2KA 4IOSD 1XGRA 3VRJA 2DIBA 4U6HA 3IDJA 3WLBA 5A40E 3QH3B 2AV7A 4IMKA 3QRGL 5DD6B 3RWIA 4J6RH 2O5YL 3L3DB 4Y4FA 4JFHD 3RAJH 4EVNB 3LSOA 2AJUL 3L6FB 4U6TA 5FCUL 3ZDZF 3DVGA 1MSPA 5DMIH 4NSKB 1JZ3A 3CVHA 3NA9L 5DD1H 1MLBB 1A6PA 4JFOB 1KJ2B 4LIQL 1C12B 3GHBH 3NCJL 5IQ7H 3IGAA 1JF1A 5HI4D 3WO3B 1UA6H 3BQUC 5EZLA 4HMDA 5CBAB 1FBIL 3ARBB 1MWAB 1NGXA 1C1EL 2LAGB 2EDJA 2RIKA 3GSXB 4Q9QL 5IBUG 4QHMB 4D3CH 4GQPH 4U6HB 4RMQA 5ALCH 5F72S 5K9JL 1LDSA 1K3ZA 5E7BA 4K8RL 1CICC 4G6ML 1G0XA 4CADB 3MCLH 2YEZB 5IK3B 4HWNA 1UZ8B 3HI5H 4BSVB 3S88H 1MIEH 3SE4C 4GKZB 1SVCP 1C12A 5TF0A 3GO1H 5F8QC 3NCFB 1Q9WB 3N1MC 5D7SH 5EB9A 2HKFL 1CFVH 5IHZB 4Z78B 1MLCA 2BNRB 1XCQB 2FECI 3DVGB 3RJQB 5CWSA 4UB0L 4M5ZL 5ACMA 3ULUD 5KW9H 2D0GA 1BFSA 4LL9A 1OM3H 4YHLL 1OT1A 3MRRA 1MCNA 1CFTB 1DBKH 4LKCB 2W9DH 4ZFOL 3P4NB 3HR5B 3QG6A 2W0LA 4Y16A 5IHUH 1YN6B 3DX7A 2DQTL 2N7AA 5EO9B 1U92B 4AEIL 5GXBB 1CLZL 4KRPD 3F65A 3WLWD 1VSCA 3MRQA 5KTEL 2HKHH 3W39B 1ITCA 5ESQA 3Q1SH 1S7RB 3RUGA 2O61A 3BZFB 3MXWH 2KL6A 2MCPH 4LPWA 4NIKB 3WNKA 2DICA 2IBZX 2VO5A 4G7YL 1HHKB 2VZOA 1ZSDB 3HC0B 5SX4H 2FGWH 4GAJL 4HKZB 2DMCA 1YUHA 1YEEL 2JKXA 1JPTH 1MFEH 3FO0L 5JOPE 5D7KE 5B4MD 2GQHA 1KACB 3CLFL 3TJHD 3QXAA 4LPCA 1TTUA 4XVUD 1J1PL 4LPYA 1NC2A 2CKBB 3IB4A 1KCVL 1BQSA 1RZKC 4F9PC 3DO7B 1IKFL 2RJMA 5IUSA 3VGAB 5ANMB 1WAAF 4NBZB 4PBVC 4PY7A 4LRIC 1S8DA 3PQYB 1BZ9A 3QHFL 2ZPKL 5EO0B 1G84A 1EERB 2HG5A 2DDQH 1CXFA 5SWSD 5KVGH 1T66C 1AGBB 4ZUUB 2Y5TB 4LCWA 1EJOH 2KPNA 2Y07H 4CVXB 4FQJH 1KIPA 2R2BA 1T3FB 3VFTB 43C9B 3ZKQD 2MJWA 4NN5C 1EGJA 2XV6B 4XBPA 5FYJU 1QBLL 3DRQA 3I9GL 4DOHB 5DQDH 4JFED 2BERA 4PJIF 3WFCH 3EO9H 2PW2A 4BK5A 1JGUL 2GITB 5CJOL 4AYFA 4J3XA 3VXTA 2DQEH 2X40A 3MA9L 4MX7A 2MCG1 4LARL 5FYLL 5D7LA 1RUPH 1HYRC 5T1LA 3OKKA 3TP4A 2FL5A 1J7VR 4FQXD 3BPNB 5FGBA 3IS1X 3I02A 1JZ6A 1X5IA 5DJAA 4IRSC 1ZLSL 1NC4D 2XZZA 4OCXH 1MAML 1G9NL 1QHPA 1ZHLA 4XC1H 4JRYD 1AO7A 4LF3B 4KFZC 2Q8BH 3LKSB 1U3HD 1S5HA 2ICWB 3B9KA 2Y07L 4YR6B 3RZCA 4HV8B 3VFSA 1I3UA 1FNAA 3NFPA 1F2XK 3FOLA 4AG4L 1FNSL 1U3JA 3L1OH 4Q97A 4JFQA 3SE8L 4GFTB 3SGJC 3MNWA 4KUCD 5T5NG 4QXTA 2E8ZA 5ITFA 4HBCH 2H3NB 4UT7H 1N2RA 2IH1B 1ZHKB 3D3VB 5HHMB 5LCVH 4GW1A 3DNKA 5E8EA 2JJUA 5FGRA 2CLZB 1J05B 2VXTH 1T83C 4GBXB 4GXUN 3L3GA 4G8GD 4MQ7B 3RI5K 2Z8RA 4K94C 4C56D 5I1KH 4U1KB 3I85A 1DQQB 1QP1A 2Z92A 3QUXB 5I18L 4NQSA 4MLIA 1I85C 2QL1A 2YBRA 1BQLL 2Z4QB 3C5ZC 4NUGL 4X8JA 3V5HA 2Y06H 3MV8E 4YIQA 1LO5B 4YR6A 4D0DA 3EO1A 4ERSH 4PJXA 1K4CA 1OPGH 2J6EH 3L1OL 5DMGC 3NGBC 1KT2A 2R29H 2P4AB 1C1EH 1A6WL 2VLJA 1T7YA 4G43A 3TA3D 3T3ME 4AJ0A 2AV1A 2PYFA 1ITBB 3UDWC 4M93C 5HXMA 3NN8A 3CSYB 1DCLA 1C5DB 3VXQA 1QBML 2WIIA 3EW3B 4HJGA 4NQCB 3QCUL 4DUVA 1RUMH 4HDIB 5I1AB 1KB5H 3HFMH 3S36L 2R1YB 4FQHA 3CVIH 1JF5A 4JKWA 3V8CA 3FN3A 2WZPD 1VGKB 1EVUA 3KYKH 1INQB 3RIFK 4F15B 2ZOLB 2X9WA 3O2DL 5F44A 43C9A 1YMME 4M5ZH 4GO6B 1NBZA 5INDA 4BYHA 5J8OA 4MZ2A 2FX9L 4PRDB 2OZ4L 1WBXA 3MV9B 5D71H 2VITB 3VDBA 2AEIT 4GXUM 2QV2A 1IAMA 1MI5A 5E2WH 3KPRD 3D3VD 5FYJD 4RQQB 4LLAA 1Y0LB 4JANB 2RQ8A 5LAXA 4QO1A 2DRUA 2NTFB 4WHDA 4PJ7E 4PJ5B 2EIBA 4HGKC 1CXEA 1XF4B 1WV7T 1U8JA 2Z4QA 3V5HB 2ADJB 3G6JF 4C56B 1A7RL 1L9NA 4JRXD 4PJHA 4PLKD 4LPUA 1E4XL 2V5MA 4HH8A 2A0LC 3WS6C 1CDCA 1UGNA 3GSOB 5CZKA 4OI7A 5HYQB 2HT2D 4MDJB 4RFEA 1VGKA 1Q1JH 1CDGA 3E2HB 1ZV5A 1LO2H 3OXRB 3S6CA 1UB5A 4L3CA 5D5ME 5GGVL 1IKNA 1JHLH 2GT9A 4JPWL 1DBJH 4R4ND 1AGEB 4HHAB 1KJ3L 3U7AA 1DEEA 5DMKA 2GSGA 3S37H 3KR3H 5CS7A 4JHWH 1AO7E 3QFJD 1BWMA 1HNGA 4ONFH 2AGJL 4XGZA 5DR5H 2AV1B 5IROC 5AAWA 4X9GA 2P8PB 5I8KL 1L0QA 4PV9B 4M7KH 1PY9A 2A73B 4ESKA 4M48L 4ZFGL 5IKCB 3VH8B 4X6EA 4N90D 4OD3H 5KTEH 4XP5H 4KMTH 2X4TA 1NFDA 3W0WB 3NTCL 2F5AL 1MY5A 2LU3A 3IT8D 2VC2H 3OG6B 4Z7VA 1CLCA 4OZFB 4Y19E 1SM3L 1A6UH 1YYML 3O4LA 5EFIB 5C0ND 3T3PE 4KJPD 5IW6B 3SBWA 3UO1L 4DVBA 1WC7B 1MCFA 3C5SA 2GITA 3PDOB 5GJSH 4QXGL 4AEFA 4GKZA 1MCHA 1TCMA 1RY7B 4RGOH 5KSBB 2NY6C 1BM3L 1KTDB 4D8PB 5D93C 1TITA 2AP2A 1YEFH 4Z7UA 4YX2H 3GMLB 2ESVE 3JXAA 1FAIH 5DFWH 2C1PA 2XKNB 5DVKA 1J0JA 1TVBA 2VDOL 5T1DL 1DFBH 4OIIH 4PS4H 2B2XL 1JZ2A 3KPQB 3B9EA 1BQUA 1VDGA 2D9QB 4WV1A 3DUHA 1T04B 3RUGE 4MJIE 5J6HA 3INUL 2G60H 3DWTA 1H5BA 5F89B 1FN4A 1MNUH 4X5WB 1LO2L 3L3JA 3SDCA 3EOTL 5TE4H 1OQOA 4UINL 3LQAC 3ZKMD 1FNEA 3CVHB 1I9EA 5DO2D 1HINL 3IS0X 3HS0B 2BSRA 5IB2B 4NN7C 4I18B 4KK8C 5MHSE 4XVTL 3BAEH 1N0XH 4BKLB 2NXYB 5H35A 4UI2A 5IKCA 2CR6A 5C0CD 1QFUL 4DFHA 2B0SL 3DX6A 5KZCB 2FH8A 3TNNB 1D5XA 5L7XL 2F58L 3S97C 1M6OA 4QXUL 1W72L 5ID0A 3RWCA 2QHRL 4M7KL 4MCYB 2XY1A 4EBQH 4BFGA 2AEPH 2N56A 4FMFA 4Y8DC 5L2KD 1TQCB 1HSAA 1FL5B 4R4NC 2GTZA 4ODWA 5HVWA 1T1XB 3P0YH 3P0VH 1T7XA 3F12B 5E4IA 3I2CH 1D3CA 3UJJL 4PG2A 1BQHA 5ICYB 4JM2A 5D7LE 1YEIH 3DUUB 2OK0L 3EYSL 4QEGA 1I8MB 4AH2A 4PLKC 3WL9A 4M4RA 1UM5H 1TNMA 4FFYL 4RMUA 1WAAA 5GGQL 2F58H 4ZOBA 3QRFM 5EC1A 1ZT4B 3SQOH 2X41A 1T0NB 3FQNB 5KG9A 1RIHH 4HGWB 1F3JB 3LRSA 3NVQA 1XF2B 3G08A 3H2WA 3C8DA 2VXQH 1UYWH 4PJAE 2WWMD 3FB7B 5I71B 1LK3L 2ZCLL 1C7TA 3Q0HA 4Z5RA 2IMMA 5GIRA 3TCLB 1JFQL 1L7IH 5IEKA 1JIBA 4WU5A 1R5VA 4YUEH 3IFLH 5TDNA 1AXTH 5TE4L 2X4PB 1RIUL 2VNCA 1QKZL 2P5ED 3ZKND 4BZ1H 1N6UA 2EE6A 2WBJA 3VGGA 2Z0BA 4PB0H 3MRQB 4PJIA 4HWEL 3VFPA 1DN2A 2DD8H 5DQ9A 3QIBD 2O5XH 3SJVB 4WRLA 3QWOB 4L9LC 4HXAH 3GJFK 3WN5B 3OAYK 3VWJC 1ADQA 3MUZ1 4J7RA 5IB4B 4WU7B 2NQCA 1YEHL 1CBVL 2K1MA 5LJYH 5CUSH 3BSZH 1AR2A 1EO5A 4XNZC 1WFTA 3LSOB 4R3SB 1SJEB 4J3SA 1AP2B 2Y4SA 5CLTA 3A6OA 4PRHB 3QCUH 1U8LA 1YNKL 4CW1A 1L4IA 4NN6B 4AT6B 3KXFA 1MI5E 5A2LH 4RMTA 3ARBD 1CWVA 4NJ9L 3S96B 4KI5E 4ZODA 3CX2A 3G5ZA 2XPGA 2PXYC 4JPVH 3ULVL 1IL1A 4N0CD 1Z5LB 5E8DL 1F00I 2ZUQC 2V2WB 3O3DB 3DXAE 4P2RE 3C6LA 1A7NH 4FFZL 1T1WB 4HXAL 2DMKA 2C1OB 2A83B 2XWJA 5HHOE 1UFUA 1CLOH 2FB4L 4YHKL 1KF9B 1NC2D 1F3DJ 1UC6A 3IDYB 3QISA 3ARGA 1FNLA 2NY6B 3HZKB 5HVGB 3RNQB 4WW2B 4HEME 1R5IB 3O3BB 3MSPA 1R5IA 1ZS8B 1ZHNB 5DQJA 5LGKA 2IBZY 3GHEL 3ZT6A 2JB5H 5I1EH 1BX2A 3KLDA 3C5JB 1H3XA 1JWSB 4PY8J 2FIKB 4JPVL 2VR9A 1CDBA 4XH2A 4QXGH 2YXFA 4G8GB 4KKBD 4KKLC 4XNZB 4L8SC 4GRWB 2WIMA 3O8XA 3S7GA 3WD5L 1UXWB 5FOBB 4LHUG 5C07A 3DVFA 4U2YA 2B20A 4R9HA 4G6JL 3SE3C 4CVZA 4XP9H 4LPTA 3KYNA 5TH2A 1RULH 5B38B 3B3IA 1K8IB 4NZDA 5DZNA 1RZFL 2XKSA 3PHOB 2DQGL 3ME0A 1BMGA 3OJMB 2DKUA 1ZGLA 3HPJB 1LO0H 4L3EA 4KRMB 4LRIA 4KRNA 1QSEE 2X4SB 3DYPA 4UQ2B 4Z95L 2FX9H 4HCRL 1Z0MA 4U6VL 2E9IA 3OWEA 3QQ3B 1IJ9A 3UC0H 1NCWL 3QCTL 4I2XB 2DTML 2I26N 5BS0E 1YPZF 4LSUL 2BSSB 4W4OC 2CK0H 3AMKA 1QFWL 3SDDD 5ALCL 3V0WH 4H5SB 4X7SH 1AXIB 3GSQB 2ENYA 3VG0H 5EU6D 4OQTH 1PAMA 4NO5A 4OD2B 4C58B 1DDHA 1X6NA 2IANA 2VERN 2R56L 5FYKE 4WWKD 5F88B 1V05A 5AG9A 4X6FA 2HFFA 4PJ7B 3T1WA 5IGXL 2CMRH 4ZDHB 2NY2B 1FZMA 3KAAA 5TDNB 2Q1EA 5EUOA 1RUQL 4Q6YA 4XNQA 4A2LA 5IV2B 4FTVA 2QQLH 3GHBL 1W0VB 4HK0B 5K33A 2AEQL 4MJ6B 3QJHB 1SMAA 4PV8A 5JIIA 5GGTH 2F8VA 4E42A 1FZJA 4OCSH 1V3KA 1SY6H 4DKAA 3WCYA 4K2UL 4KUCF 2V9QA 3O2VH 3N1GC 2C3HA 2EYRA 1XAUA 2BNQE 4G6AD 3SKOB 5E08H 4ZD3H 2LABA 5DD3H 5TGBB 4X4YA 1SJVA 1RUAH 3O6FD 2FR4B 1C5DA 3VXQB 5HHNB 5C08E 3WO4B 4FG6C 4OBRA 1T5WB 1YMMA 5GGTA 3KPNB 1NCAH 3MLSL 4N1HB 4YXKL 1TTFA 2VUOA 4XVJL 3MO1A 3J7HA 4NZUH 4ZS6C 1V5JA 1K4DA 3ARED 4AENB 3OKMB 1L9MA 2G5BA 4UV4H 3WDIA 3ZKNC 5C7XL 2FD6L 1I3VA 3BXNB 3ULUF 2YD2A 2DQFB 4L8DA 4R26L 3SO5A 3OHXB 2XTLA 3OR7B 5FKPB 1JPFA 2RFXA 5DWUL 3TNMA 4MJ5B 5SV4A 4NP4H 5FCUH 5EU7C 3RWHB 3VCLB 3EJZD 4L3AA 4WEMB 5F7LB 4NKIH 3VXPB 4ZTPH 2AKRA 4G80B 2OL3B 5FM5O 2R4SL 5F9OL 3T3MF 3FO9A 2BVOB 2UWEB 1A3LH 2YRPA 4R2GD 4Y5YA 5E00A 5EU7E 5TH2B 3KPMB 3MLZH 4LVEA 3KYOB 3NGBB 4N8PA 4JKMA 5M7QA 3QA3A 1ORQA 4KROB 4XWOD 1GCFA 1WZLA 4PRPA 1WZ1L 1GZPA 2AXJA 4ZFFA 1NGQH 2CXKA 1P9MC 2P5EE 4HZAA 4OB5L 4OJFH 4DEPB 4JM4L 3H9SE 2R0KH 4A6YB 1G7PA 1YEEH 1G1YA 3F7PC 2APXA 3M1BB 2BJML 3PIQA 1G7PB 3AROA 5C0BA 5JIKA 2AEQH 5HHMD 1FNFA 5IBUB 2OYPA 4EEEA 2DL9A 3DMMB 4RZCA 4KXZH 1P69B 3CSGA 5J3HC 1F4YH 2YSSA 3H9HB 3GMLA 2FL5B 1NDGB 1D5IH 3CXDL 2NW2B 2F5AH 4JFDE 1EK3A 3GB7A 4X4ZA 3K4AA 1W0YT 2VLRB 4C56E 5J9PB 2BZDA 3GSWB 4JY4A 4N0FA 4LEOA 5EN2A 3IETB 4FQ2H 4XNMA 5DJ8B 5DI8A 1FYTD 1PSKL 3WMSA 3S37X 4JEGB 1AIFA 1INEH 3T4AA 2LVEA 1SBSH 1GHFH 1TZHB 3QJFA 4OFDA 5GHWH 1JTOA 3KXFB 1DSFH 5DHYA 2QQKL 5IMMA 3WFCL 5JQ6L 5HYJB 4ONHA 3EOBB 4P2OC 2E3VA 2EE9A 3OPZH 4Z6AT 1URLA 4Y4KC 5B39A 4QHNB 3CU7A 2YD6A 5FYKH 2CDEB 1H15B 2WW8A 1GZQB 3QXUA 4AL8L 1LILA 1UKQA 3JTSA 5E94A 4Z77A 1I8IA 1E4XH 1JPGA 4JGJA 4YXHL 3GBMH 4OM1H 3NIGF 3CLEL 5GSRA 4XP6H 4JFEE 3T0DA 3LEXA 2HTKD 4PV8B 4X6DA 2YOCA 4P3CL 3BKMH 4YC2B 2WQRA 1KLGA 1AGFA 1ZTXH 1BD2A 1A6VH 5EIIB 4U6XA 3DHMA 3TN0B 1SJHA 1UH3A 5AUMA 3S3JA 4W4NA 4AEEA 3UJTL 1S7TB 2Q3AA 4U05A 4JFXA 4KI5C 5GIRB 4J3UA 1JGVL 1GAFL 3GMQB 4OZIA 4BH8B 3Q6GH 2R0ZH 3E6HB 1MELA 5EZJA 1E4WH 2YZ8A 2VXSH 3SY0A 3R4DA 4PRIB 3AU1A 3P9MB 3GM0A 1I1YA 2WLZA 1EZVX 1BBJA 4HT1L 4UV7L 5C0JB 4L8BA 4ZAKB 2Y36L 3CFCH 4PJ8D 3PHSA 4GRLC 1FIGH 4LK4A 4OGZA 1IGJA 3CVHL 4XCNA 4BSWA 4EZMA 1INDH 1X5YA 4JG1H 1ZT7B 5CIPA 1FNGB 3CUPA 5GRXG 3F12A 1ZGLB 1KPVA 4PREB 3CFIC 4JZNA 4PP1C 1BF8A 4XVSL 1FFPA 1CE1H 5ETUA 5CEZH 4KZEH 3FQUA 5LQBL 1C08A 3IFPB 4BFBD 1P7QB 2O5YH 2XXMB 2Z31C 3MRFB 4OZIE 3F7QA 4JQXA 3WDHA 3TN0C 5DJZA 5I1LA 2J4WH 4QNPF 4FP8L 4HIXH 1RU9H 2EDXA 4ZNEE 2ZSWA 4WUUA 3BPNC 1IC1A 4GMTL 2AJXL 2WLYA 3C08H 1NEZG 5HYFA 1JUFB 5D2NC 5C0AA 5A2FA 4XNUL 3D18B 4UIKL 1PG7L 3V4UL 1JWMB 4MS8C 1U3YA 2BY0A 1ZTXL 3WBDA 3K4ZA 5EU5A 1JCKA 2HLFC 2XZAL 4AEHH 4ZTPL 3TCXA 1QVOA 4UOW1 3OKOA 1QFHA 2R9HD 4MXWH 1YEDA 3MLPA 3MLXH 4HPYL 2N1KA 1FFOB 4OF3A 4EKXA 4XBGB 4M7LH 1PX4A 1CD8A 4S11A 3RWFB 4ORZC 5TDOA 5D7JD 1MCKA 1DBAL 1MJ8L 4KROC 2WBJD 1WZ1H 2WBKA 1KCVH 4PJDB 1HHIB 2YPKB 3CCHB 2ICEB 3ARRA 5L9DL 3BP5B 4F80A 4FA8A 2CKBL 3MLSH 2A6KA 4X7TB 2LTQB 1YY8B 3BX7C 4M7ZB 4W81A 3RL1B 3KJ6H 3W0WA 5D6DC 4PRHA 2VDKL 5AD0B 4GW5B 3WIFB 4OLUL 4PGDB 4UBDC 2VLJD 4JDTH 1NGYB 2PTTA 3PGDA 1E4XI 5LQBH 4OF0A 5DUML 2PO6C 1FCGA 1W0WA 2GFBB 3UBXG 1Q9KB 1JK8A 1HI6B 4G8EA 1OTUD 4RGMC 1XR9A 1EJ6A 4RRPG 5H94A 2WAHA 4OTXL 4MNQA 5ABDE 5D72H 1EV2E 2YD9A 5TDPB 2B4CL 5BW7C 1QO3A 3RWEA 5GGRB 1R3KA 3L95A 3CPLA 3BN3B 5KSAC 1JGLL 4BQCA 4D0BA 1U8MB 3O6LH 5DK0A 4H88H 1QLEH 1AHWC 2LFGA 3HUJE 4TUKL 3V52H 2ZZUT 3BZ4A 2YMXH 1LO3H 4XT1C 1CU4L 1T83A 1WJ3A 4F33A 2HFGL 3MOBL 5EUKB 2EIEA 1KPRA 1M71B 4QHKI 4X0KA 1RZ8B 1NCNA 4TYUA 4NM4L 3KPRA 3P77B 3RWGB 4IOFC 2JTDA 4FTVB 3QWRD 5I66B 2WP3T 4PJCF 2BOBA 3QUYA 4FQ1L 3CJJA 4GMSH 5DYOA 4RDQF 3RTQD 3QO0B 2VDRL 3NBNA 4KV5F 2KZWA 5D7IE 4FOMA 3OR7A 1BP3B 2ADJA 1A4KB 4JRXA 5CKAA 4P99A 4JM2F 3I84A 3CH1A 3AGVA 5E2TH 1N4XH 5EULV 4UMGA 1J5OL 3KLHC 4OCNC 4XP6L 5SWZD 1M71A 1CDYA 5F3BA 5DRWA 2V6HA 1A14L 1HSBA 2OCFD 3DX9A 2ADFL 5AUMB 1A5FH 4H1LB 4TTDD 1CT8B 3LB6D 3T0EA 3MREB 3FZUD 2HT3C 5FHBL 3KJ4B 3U79A 4NDMB 2WUBL 1G6VK 1T0PB 2EYSA 3HE6A 1HSAB 1T66D 1F4XH 1AIFB 5CHNA 2LQRA 5F9JA 1PX3A 2ZOLA 4U1LB 3BEVA 4JCLA 3FKUS 4YZFF 5KSAA 4EUPH 2I9TA 4PD4J 1ZK9A 2GY7B 2ZP0T 3FFDA 4GQ9L 3RWEB 4H0IA 3TZVA 4GRWE 5GGUB 1DR9A 3LKQB 2R2CA 3H3PH 5BJTA 1RUPL 3G6DL 1MAKA 3FJTA 3ZZ1A 2XWTB 4XAKE 4M3KB 3P73B 2BVPA 4RAVA 4DGVH 1OTTD 3TNNA 4DFIA 1FC1A 2FATL 1WBYB 4EIZC 5JLZB 2ICWJ 4ZS7L 1CFVL 2JIXD 5FYKU 2EC9U 5TPWH 4Y1AB 3VFWB 3QDGB 2ZKHL 1B9ZA 4RRPA 3F7YB 2DQJL 3VWKA 4LDEB 1Q9WA 1A1OB 1K4CB 5J6HB 3ZYZA 4QRUA 5D1QC 4NQCE 2EE3A 4OZHE 5DRZA 4UT7L 1QZ1A 2FLRT 3BVNA 4FS0A 1T22A 1MREL 1J9CT 2EDLA 4U3HA 2BHUA 5DDHA 5KVGL 2VR4A 5I1JH 5K59F 3BDYH 4QHKJ 5HHVL 5EZOH 1PLGH 2EH8H 2BOCA 1MFAH 2ZSVA 5BZWB 2EDKA 5J12B 1LP9B 3DHJA 2H45A 5KANG 3QDAA 3VFRA 2WP3O 3DMMC 4GW1B 3EHBD 4R97B