5DJYB

Fc heterodimer design 20.8 y349s/t366v/k370y/k409v + e357d/s364q/y407a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLEASRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREDMTKNQVQLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNAYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djyB01
3ARED 3D1MC 3MOQA 4KK5C 5BXFA 3CFKA 1K2DA 1LNUA 3HZYA 3QCUL 1PQZA 3DVGA 4DVBA 5K9KB 3C8DA 2PYEB 4LSVH 4FQHA 3G5YA 3AREB 4IRSC 2XA3A 4YDIL 4XHQA 1QFUL 4GH7B 5D8JH 3GSWB 3RUGB 1X4YA 2FJFB 4YR6B 5IGXL 1KCRH 2NYYC 2P8MA 4N68A 3ZDYF 1SEQH 2XWJB 3VWKA 3MPCA 1FFQA 2IAMC 2X4QB 5DMJB 5F1OB 4JCMA 4AL8L 1GHFL 4JHWH 2D7NA 4PRPD 1GZPA 3M45A 1PG7L 4PJDF 4PJIA 1X5ZA 2X42A 3MRPA 5DJCA 1OAZH 2G5BB 2WINA 4C83B 4QYOA 3F7RA 3F7QA 3IXTA 1B0RA 3CZFA 4LNRA 4ODSH 3S5LA 2CSPA 4OIIH 5LJYH 4RAUB 3CPLB 5C0CE 3GI8H 2JCCB 2VXQH 5LQBH 1PVHA 1I9JH 4GRMB 3O2DL 2IGFH 1MIEH 3E2HB 3RVUD 3IFLH 4PS4L 4ZS6D 3BP4A 3KAAA 5ACLA 4OSUL 3AS3A 4YAQB 4W68A 3VFSA 3D9AL 4MAYA 4NHUA 4PLJD 1FV1A 3V6FB 2A0LD 3PWUA 4PBWD 5DLML 5FA3B 2RGSA 1YN6A 4BZ2L 1AHWC 3LQAL 3MRHA 4RIRA 4CUCA 4NWUH 5C0NC 4UIMB 4G9FE 1PX4A 3EJZD 4J4PA 4XXCA 5MHSE 3UJTL 1VPOL 3QI9B 2FGWL 5FGBC 3OAZK 3NIGF 5EFIB 5HBBA 4NN7C 3ES6B 3VXUE 4F9LA 1QFWM 2Y36H 2ZKHL 2R56H 5FM5O 4AEIH 3TVMC 3MLVH 2EYSA 1JV5B 4UAOC 5D1QA 3WV0A 3OJMB 3C6LD 1P4IL 5JZ7D 3EOTH 2KL6A 1DDHA 3H3PH 1KN2H 3ARUA 3FT2A 3GK8L 5IF0B 4P5MA 2HTLD 1UH2A 2BRRH 4LIQH 4I13B 5FB8B 4E0RA 5E8PB 2JB6B 1EBAA 4PREB 1WFUA 3C6LB 1MCOH 3EOBB 3CMOL 1DL7H 1FORH 5INDA 4QHMB 3VFVA 3BEVB 4JZJB 1U8LA 1EMTL 3EGSB 4S1QH 4XNQB 3RJDA 3LN5A 5BV7C 3ULVD 4XNMB 4YPGA 2ATPB 4LAJH 5L2JB 2NY7H 3ROLA 2UZXB 1JL8A 2X4PB 5DDHB 5L0QB 3RI5K 4YE4L 4LAQH 4OKVA 3MUGB 5ELIA 2EXWD 4XX1G 5CIPB 5D1XB 1MEXL 2WWMC 4P2RA 4P4RA 4U0RB 1IC5H 1JNLH 5D7KE 4EQ2A 3TBWA 4R7NB 4JY5H 2IPTH 4GJTB 1CWVA 1DBBH 1KT2A 2R9HC 4GLRI 4ZXBC 3H0TA 5D9SB 1FZOA 2NY0D 3VXQA 4BJLA 3MRRB 2C1PB 3HZMB 3SE8L 5C0AB 3QQNA 3IJHA 5J9PA 5D6CA 1KIQA 3CXDL 5HHOA 3G9AB 4PG9B 4OCWL 4KMTL 3UPAA 2DLEA 1FHGA 1KC5H 4ODXB 2EKJA 4AK1A 1CTOA 4LPTA 3PQYA 4O9HL 5C70A 1N0LA 1IM3A 4ZUTB 3UYPA 3H9SD 4LQFL 1UB6A 1XMWA 2J4WH 3G6DL 5E03A 3D0LB 1IAII 4I0CC 2FX8L 1V3KA 3CNKA 2H6PB 2VZOA 3GBLA 2C7UA 3H9SB 3S3JA 3WHE1 2AXHA 3RU8L 5GRJH 3OKMB 2RBLA 1AKJA 3OB0H 3DO3A 2VH5L 4OZHA 4S10A 1Q38A 4KZDL 5D7SL 4ODTL 1J8HA 3KS0J 3ZKXB 4GRWB 2XTJE 2FATL 3VD7A 1T03H 4GRLD 5E94A 1J1PH 2QR0A 3OJ2C 3RWEB 1XT5A 2F53A 4RQQB 5HPOA 4Q9RH 1HK6A 5KG9A 3HNTH 4ODHL 2BY0A 2DYPD 3V7AE 1PY9A 3O3BB 3GDBA 2H9GA 5IM7A 1A2YB 1F4WL 4DKEL 3CFIC 3UTTA 3GMOA 3MV9E 4KGJA 5I8EA 3P3YA 1NAKH 1BFVL 1DQLL 3O8XC 2DQUL 2DYPB 1I1YB 5BV7L 4CMMA 4OZFA 4ZFOL 2GITB 1MJ8H 3OZ9H 1YJDC 3TP4A 1YY8A 5D5MF 1QEWB 3QXUA 3RKDC 4R4NC 5BMFH 5B39G 1B6UA 2XY2A 2FO4A 1VFOA 3HA0A 4XNUL 4X7DC 2ZUWA 1YNLH 1DP0A 1E4WL 3ULUC 4JM2F 3PP4H 2W0KA 1GYAA 3WN5A 5C9KA 1FFNA 4FFYH 2K7PA 3O4LE 1URLA 3CDGA 4IEFB 5JHLH 4FN0A 3KXFE 5C0CD 5EBMB 3LEYH 1MCCA 3KGRA 2V2WB 4QOKE 3MLYH 3JWNC 5LKNA 5I0ZA 2IC2A 5D2LF 4M6MH 4RX4A 5JXAH 4NQSA 1NGYA 3QO0B 1HH9A 2VMFA 3GHEH 3RVTC 3GIVB 3S98A 5C0CB 4PV9B 3BP5B 4LFHG 1BX2A 1MFDH 2F19L 1A6WH 1JN6B 3FQRB 1Y18A 2J1KA 2Z35A 4G9FD 5FKPB 5CEYB 2YD1A 3HKFA 5CD5C 3MJ9L 4XVJL 5JQHC 1F2QA 4OCSL 5EIIB 3EYVB 4BFIB 4PJ9C 5JO5B 1LO3H 5MHSD 3GMMB 1CGSH 5DQ9B 4JPWH 3QUML 1YEHL 3INUH 3VXUD 3L1OL 2CDFB 3MRQB 3CUPB 3UPCA 1G9NH 1CG9B 4XTRD 3FCTA 4I48B 5EWIL 1SY6L 1YEIL 2B4CH 2X05A 5IESH 5ALCH 5EUKB 1M7DA 2BNUB 4KUCF 3LEXA 5CZKA 4Y5VC 3JBG7 4KKLC 1Q94B 1FSKC 1GRWA 2QADB 5DD5L 4AMKH 1X44A 2IG2H 2NZIA 3RKPA 1VHPA 4H25A 2VE6B 3MRDB 3MOBL 12E8L 3TJHC 4S1DC 3B2UC 1YJDL 5DJ0A 2DQHL 3V6OA 3VFGL 1JUFA 2CK2A 4HJGA 2GSIB 5EPMA 4PLNC 4RDQG 5F9OL 1UENA 1JTTA 2R8SL 3KYNB 1RAMA 3ULUL 3RNQB 5TE7H 4E5XA 5D7KD 5E24E 4HKJA 3L5JA 1RFDH 3O9WC 4NQXA 1QBML 2APWA 3QSKB 2X4NA 4WVRA 5I17B 4O2EB 4L8CA 1WBYB 1UEYA 4XH2B 4QNPF 3IFNH 1KOAA 4NKDA 3QIUA 2HMID 2Q7NA 5JPMA 1CFTA 2CIIA 3BPCB 4ISVB 1M1SA 1DANU 3RGHA 3VMPA 2VLKD 4KJYA 1N6UA 4NO0B 4WI8A 3OKDA 5IKCA 2NQCA 4OI8A 2D0FA 4HHAA 2JJSC 2NY5C 5HHPA 1DTUA 6FABH 2VDOL 3O6KL 2VLKB 3CFEB 4Q9BA 1A1NB 1FBIL 2HAZA 1WIPA 3TH4T 4J8RB 1G7HB 4RSVA 4EOWL 2R4RH 1SYSA 4OZFH 3NIFF 4XVTL 2DBLH 3G04B 3CFDA 3C60D 1D6EB 4OLVH 5HGBB 1G7QA 1UYWL 1ND0A 2PTUA 2YHGA 1OTSC 1KN4L 1ZT7A 2NY2C 5DRWA 5FYJU 1XR9B 1EJ6A 4OUUA 3C60B 3RWJB 2L0DA 5K59E 1NANI 2QBWA 3HMWL 3NPZB 2LVCA 1CXLA 1G6RA 3B8SA 4WFEE 4I5BA 4MJ2A 2V2TB 3DHMA 3MV9D 2UWEA 5HVHB 1TVBA 4X9HA 2HFFA 4NFBA 5E08L 2Q8AL 4LK4A 1CIDA 2MHAA 1PZ5B 4HFUL 4JG0H 3MV9B 2DJ4A 1RJZB 3OBAA 4PPTA 5DMKB 1G1CA 3B3IB 2YPLB 5DRNA 1MJ7H 3KJ4C 4P46C 3N1QC 3PWLA 3MRIA 5EU5A 1ED3A 3WIHL 4R26H 5EBGA 3ARDC 1U8NA 4BFBD 1KTLB 3P0YH 1NBQA 1XIWB 3IRPX 1HHIA 1T2QH 1I7RB 1KCUH 4FZ8H 3SE3C 3O4LD 3NZHL 3QHFH 3O6LH 4PGEB 3U2SA 3BQUC 1SBSL 4JKKA 2AJUH 4QOKD 1XCQB 4Z7VA 4RDQF 4F33B 5JMOC 3DLQR 3O4LB 3DTXB 5MENE 3HZVB 4XMLH 3NN8B 3O6FB 3QUZC 5JW4R 2V7NA 2ZJSH 4QOKB 4IM8A 4NT6A 3D39E 4LPYA 2X1OA 3W9EA 4UILH 2UY6A 4R9HA 2NY5L 3QWOB 1HHJB 4M7LL 3OXSB 4Y4FD 3PDOB 5CP7B 4XCNB 2WUBL 5LCVH 1D6VL 2P8PA 4NZJA 4UOJA 5FK9A 5GS0C 2JJTA 1T22B 4Z95L 2A9NH 4TNVF 4P5KB 4Y4FB 1U8PB 4WW2B 1CXKA 2AXJA 1BVLA 1RUKL 3JTTB 1MCPL 3MBEC 1TJIL 4I9WE 5IK3B 5I1JH 4OB5H 1A6VH 3OPZL 2D0HA 4XNZC 4UUJB 4GXVL 5I15L 2V17H 3MX0A 3PHQA 4U4BA 2W9DL 4NZTL 2BMKA 1B4JH 1R3LB 1VESA 1KGCE 3DO7B 4TN9A 3MMEA 5ETUB 1C1EL 3PXJA 3LEVH 1AXTL 5EZIH 3C6SA 2E9BA 1XH3B 4HUWA 3LV3A 2DWEB 4U6YB 1J1XL 5I8CB 3WIFA 5EO1B 3B6SA 4D0BB 4NNPH 1UZ6F 5EOCH 5DGQA 5HI5D 1EUUA 3F7PC 3MJ7B 4NQCE 5EU3B 5I1CH 5KBNC 5KS9F 2EDLA 2F74A 4H0GA 4LPUA 4ALAH 3BP6B 3WNNA 4RMRA 2AQ2A 5J1AB 5JQ6L 4QGTA 4Y5YA 4K8RH 1K4CB 3K4DA 5DYOB 1NBZB 4HT1L 5BJTA 4F57L 4EBQH 2XZQL 3ZKNC 5CJQL 3W39A 4Y1AE 1NC2A 1IGCL 3FO9A 5J3HD 2BVUA 1FRGH 5J6HB 4Q2ZA 4UT9L 1CFQB 3LMJL 1MRCH 3M1BA 3OAUH 4L8DB 4HZLA 1OGAE 1DEEA 3G08B 1Q9LB 2XACC 1TZGL 4OD1H 3L7EA 3O2DA 1J0JA 4P4KD 3HE6A 5I2IA 2PTTB 4Z76A 1N2RA 2B1HL 4OF5A 3UTOA 1N64L 3H42L 5GS0L 5EU6B 2QKIB 3BPLC 2GY5A 4ZUVB 5L6YH 4WGVB 4OLXH 5E8EA 4P4KB 1A7RL 2PO6D 4U1NA 4KUZL 3QQ3B 1AXIB 1I7ZB 4YDVA 3OAYK 3UJIL 5GGSA 5KJRL 5AD0A 1HWGB 1KBGL 1LO5B 3DX9A 5IW6A 4CGTA 4KDTC 1I85A 2CR3A 3NFPA 4R8WH 2PO6B 3SKJL 2VQ1B 5BZWB 3VFTB 1WBZA 3BD3A 4HGWB 1N0XL 5F89B 3I85A 3AXLB 3VGEA 4WFED 1H3XA 1HILB 4XGZB 1J0KA 4LP4A 3P9LA 3UTPE 3HNSL 1XGQA 3ZL4L 3MV8B 5LVEA 5DFVC 3BUYA 2DMCA 5ILTH 2Z92B 5BW7A 5IB3B 1X4XA 3CVIH 1Y6KR 1FIGL 3LVEA 2FNBA 1I8LC 1UQSA 3QQ9D 4HUVB 2VR9A 2DQGL 3IJSA 5DQJA 1A1MA 3CVHL 3QG7H 5HYIA 1G7LA 4IRSA 4TUKH 3QDMA 2AQ3A 2M1KA 5IFHL 3G6JA 2FR4B 2HN7A 4CNIB 1K4DA 5J7CC 1NAMB 2AQ1A 5MP6H 3KYAA 3T08A 1AGEB 3WIIH 2V5TA 3MCKA 2E7CA 2J8UE 3WDHA 2IAMA 1IQDB 2ADFL 5FIEA 5K9JL 1YMHB 4PJAE 5F72S 1C08A 1F4HA 1IAIM 4NGHL 5T5FL 4XCCL 4KK9D 5BOZG 3VGDA 4DJMA 3DYMA 3CC5B 3A6OA 2FEDC 4F7TA 3D39D 6CGTA 2GI7A 4PJ5A 4YHIA 1Q72H 3I6GA 5K59F 3D3VA 15C8H 4HIJB 3MJ6A 1G9MH 4Z7OE 4JDVA 3X13A 3D39B 4NSKB 4C59B 5MEPB 3VXRE 4HKBA 4HIEB 1T0NA 3DROB 3CSYB 4H88L 4R7DB 4LLUB 1AHWA 3G5XB 4G8IB 2CDEB 3FO0L 5ID0B 4JFFE 2UY7A 2MNUA 3WL9B 4ZFGL 4I9WD 3OGOE 2GJ6A 2YD6A 4WI9A 4LSUL 5A2JH 4MDJB 1ZHBA 4PRHE 3QNZB 5FGBA 4TNWF 4YDIH 2HTKC 2Q3ZA 3RIFF 5BVPL 3GJFA 1FZMA 1GIGH 4N5ED 3TVMA 1KGCD 4PGJA 2GSGA 3BKJL 3IXAB 4Y2DC 3TIDB 2FX7L 3AM8C 1VFMA 3C5JA 4R3SB 2D0GA 3MRFA 1GHFH 1CGYA 4NO2B 1PG7H 3BIKB 3RTQD 4MS8C 1Z0NA 2V6HA 2YC1A 3REWB 4QHNB 3STLA 2BSRA 3B9KD 3QIBB 1IAKA 5F7DB 3I2CH 2EDOA 3P4OA 1QNZL 3SY0B 3BDXA 1ZT1B 2X6MA 3RTQB 3FQNB 4IJ3C 1QA9B 1NSNL 4NQCD 2JIXD 4HUMB 3KPLA 5DZLA 2YUXA 1OP3K 3B9KB 3O2DH 4ZFOA 5GJTL 1X7QA 2V9TA 1TVHA 4MMZC 1I1AD 4X99B 5JHDE 3NZ8A 2P46B 1EEYB 4NQCB 1U9KA 2JIXB 5I9QC 1GZQB 4OD3L 2ENYA 1DJSA 4HJ0C 2V9QA 1ETZB 3H7BA 2A6JB 1UC6A 2WAHA 4YFDB 2WW8A 4L29A 2YSSB 5DLMH 4BZ2H 1I1AB 4I3GA 3LQAH 3VFNB 4P0DA 5IWLC 4JJ5B 3GEWB 4ZXBA 3OKKA 1OGAD 2BOCA 2I07B 3UJTH 1VPOH 5SV3A 2FGWH 2XXCB 3T3PF 3I02A 1JPFB 2R4SL 3CLFL 3HZKB 1AFVH 2I25N 3RHWK 5C0JA 4BH8B 3PP3K 4JVPA 1MF2H 1CGWA 1XFPA 4JVWA 3VDCA 2X4TB 1CIUA 5DJ2B 2VWEC 3FB7B 1GOHA 4PJEF 5C7XL 3FQWB 1QBLL 1L0XA 4ORZC 1CLOL 5CZXC 3MJ9A 3P0VL 5SX4H 2F9BT 2R29L 4D9QE 4LASL 3EYFA 3QUMA 1EMTH 4HKZA 4D3CL 2WIMA 1WCQA 2YPVL 3TJEL 4AG4L 1X4ZA 3DX8B 1SY6A 2HLFD 4HK3N 5F7YC 5D1ZC 3U82B 2CPCA 1I4FB 1S7RB 1YQ2A 4YE4H 1J18A 3O41A 1JNHB 1I9RL 3ALWA 1WICA 5EZLA 1UZ8B 3S34L 1R3HB 3WUZA 5ESVB 1F6LL 1PJ9A 4UBDD 3UO1H 3U30B 2X70B 4DKFL 3PWJB 3TH3T 3O8XA 5TDOB 1F02I 5B4MD 4PYGA 4OZGE 3U0TA 5H94B 5EN2A 1GXEA 4POYA 5DJXB 3SE8H 4EI5D 3CXDH 3X3GH 5IFAL 1ADQH 1W0VA 1P5UA 2P42B 1FGVL 3U48A 3UC0L 3BZFB 4KMTH 4YDLB 2B5IC 4PBXA 5I1EL 4DW2L 2H26B 2J8UB 3ZDXE 4O9HH 4UNTA 2AS5M 4D9LL 4IIQB 4OGZA 1MCSA 4UOW1 4LQFH 4LL9A 1AP2A 1OSPL 3MV7A 2G9HB 4PJAB 3G6DH 4K3GA 3VH8A 1CBVH 5BS0A 4XPAL 1EHLL 3BVNA 3U0PA 4G9DA 4O51B 1TDQA 1A1OA 3EO1A 4NDMA 5TQ0L 1KIRA 3RU8H 3GJFH 1DQJA 4OLUL 3SKUD 4JVUA 2A6IB 2FL5B 2VH5H 3PV6A 3VXRD 2WWKO 3SGJC 4KZDH 4ODTH 1CICD 2UZYB 5H8DA 3IETB 2FATH 4X7TB 2PNDA 4M7LT 5C08A 4OF7A 3WDJA 5KTEL 2H1PL 3IDNB 2RFXA 4ODHH 2A83B 2GJZB 4JFFD 5DJAA 1J12A 5F1KC 3SDYH 3K7UA 4NQVA 3VXRB 3F8UB 1CICB 1F4WH 4DKEH 4PJ9A 4PRHD 1BFVH 1DQLH 2DQUH 3ARBA 3LH2L 5FA4B 4U0QB 1SEBA 4IDJL 5HDQH 1RUML 1H8SA 5BV7H 1P1ZB 4LCWA 2B0SL 4S2SA 4O4YL 5CLWA 4DK6A 3NA9L 4OTXL 5C2UB 1XF4B 4X5WA 3T65B 1IC1A 4NQUA 1HQRB 2NY6D 4UINL 4LCIL 2NZ9C 2EH7L 4PRIA 2YK1L 5J1SC 4PGCB 4ELME 1KFAL 4XNUH 5CHNB 1T21B 3QEGL 4QXTB 4Y5VA 4Z77A 5I1GL 3BHBB 1I1CA 3VRIB 4YXHH 1E4WH 2NY6B 4MLSA 3HPLB 3SGEH 4E41A 1T4KA 1CXFA 4OD2A 5IIEA 4I8DA 3RDTD 1P2CB 3WJJA 2EEBA 1KJ2H 3ZKMC 3RZCC 3BZEA 1WWCA 4WJ5B 4Z7OF 2NNAA 4WUUE 5KSVB 3MLXH 3QPXH 5JHDD 3RDTB 3BW9A 1Z9SA 3SDCD 4KTYA 3WIHA 3BAEL 4NCDA 2DLIA 1TTFA 1VFUA 1QYGL 5SWZD 4X6DF 3MRNB 4H1LA 1U58A 3LKSB 1B88A 1YEJL 4XVJH 3SDCB 3TO2B 3LPFA 4YEFA 4ORGA 1TENA 8FABB 5SWZB 3QUMH 5CS7A 1YEHH 4MJ6B 2GTZA 4OT1L 4G8FA 4OQ1A 3L1OH 1KLGB 1WSST 3FB5A 5L2KE 1XF3A 4OAWA 5EWIH 5HYQB 1SY6H 2N1KA 3ZYOA 1OAUL 3NAAL 4RRPA 2D03L 2Z4QA 2ITDB 3RVUC 4X5XB 1CU4L 3LKNB 2ZNWA 2KZWA 3PWNA 1FL6A 2R15A 2JJSA 5DUPL 4FP8L 2X4UB 4XPHH 2YD7A 4PLJC 5FUZL 3VFPB 2VLME 2A0LC 2ICWJ 2J6EH 5I6XC 3VDBA 3EYOA 3MLSH 5C07E 4K7PY 5IW1B 4NKMB 5F7FA 2NW3B 3MOBH 3EJZC 12E8H 3K4ZA 3QEHA 4GMTL 4JKPL 4EN3A 1U93A 1K8IA 2AXFB 2DQHH 2IH1B 3VFGH 1EEZA 2IADB 3X12A 3ZMRA 4O2CB 5L8LB 1WZMA 2VLJA 3TO4C 2AJYH 3Q3GB 1H5BB 4IOIA 2P44B 3LQZA 2BVEA 3I6LD 2ERJC 4XB8A 5F9OH 3IDGA 2R8SH 5DD1H 3CJJA 4X6EB 3QIWC 4L4TE 4L5FL 5JZ7C 2DM4A 1QBMH 3KLSA 3GSQA 4F8TA 5HY9A 2HTLC 3L3IA 4WY7L 1ZGLB 3PHSA 5DC9B 1ZVSA 4XP6L 1EO5A 5D7IA 4WHTA 4P46A 1WQVT 3DGCR 4WI7A 4OZGB 2DBJA 1RUPL 5IROA 1D5BA 3MYZA 5F3HB 5ADPL 4AEEA 4GQ9H 4AIXA 3QXAA 4NWTL 3ARDA 3EDFA 3MGOB 4OLYH 4HUNB 4ZSOA 3ZE0F 3NCYS 2YZ8A 5F7HA 3TPUB 2VDOH 3O6KH 3QDGE 3MGTB 1ZA6A 3EFDH 4L8SB 1FBIH 1FLRL 4PRBA 2EXWC 1HSAB 3BQUA 4EOWH 4GG6E 1FNSL 4DN3L 1MQ8A 4PJ7A 2WK2A 3N50A 1DBJL 2H32B 1UYWH 2NY0C 3QUZA 3ARRA 4FOMA 2VDRL 4X8JB 1IAOB 5DS8A 2QSCL 3QXWA 4KRPC 4D0DB 4LLWB 4C58B 4YJZL 4TVSa 4G42A 5DVOA 5A2FA 1GC1C 3HMWH 2F5BH 4G43A 1QSFD 5MI0B 3S36L 2XG4A 1FVCA 1A3RL 2YZ1A 3BUTA 2DS4A 1QFOA 1HKFA 1LDPL 5SWSA 2W91A 3GJEA 5HD8D 2XI9A 3TA3B 1QSFB 4MAUL 1I3RA 1TIUA 4JM2C 4OF6A 4GAFB 2Q8AH 4ZAKD 4A2MA 5I76A 3UAJD 4KVNH 4HFUH 3MBEA 4XWOD 2OTWA 1X5FA 3HN3A 1QTYT 3ZDXF 3WIHH 1NGZB 4ZQKA 4ZAKB 5ANMB 3L3HB 5AWNL 3MQIA 1W72L 5JW4N 4H26A 4H1LH 5I18L 4GRLC 1FZKB 4JCLA 5FYKE 3D2UB 2W9EL 1E27A 4ELMB 1KPRA 4LBEB 5GGRB 4MNQE 1SBSH 2P49B 4RGMB 3P4MA 1SYVA 4WUUD 5DURD 2OBGA 4G6ML 3CVHA 4MA8L 1SJXA 1AO7E 1J0ZA 2AEIT 3VRLE 4MB3A 1M71B 2C4FT 1DBAL 5HHXL 3V9FA 3ILQD 4WUUB 5DURB 3MRBA 1HXYA 2KH2B 1BD2A 4OGAD 5HYJB 5FECB 1MI5D 4ZPTB 5TGBA 4LKXB 2Q87A 1MREL 2WUBH 4NRZB 1VFAB 3NABL 2F53E 1CL7I 5FKAB 2FIRT 3FMGL 3H9ZA 1DE4A 1FNFA 1MI5B 5L2KD 1NGXB 4OLZH 3W0WE 1OP9A 4OIBA 4P5TD 5TFSL 1TJIH 3WFHB 4HW6A 1QSEE 5CMAA 5BXFB 4QY8B 3OPZH 3VE0B 3CFKB 3MJ8B 1K2DB 1LNUB 3HZYB 2I60H 3SE4C 3DVGB 4GXVH 2CUIA 4CL7A 5L2KB 1GC1L 4DGYL 1R5IA 2HRPL 5EOTA 4LHUD 4P5TB 4FQHB 1E4XI 3B4NA 1RI8A 4NZTH 4J1UA 4G8EA 5IEKB 4NQDA 1R3KB 2VLMD 4BSVA 3SDDA 5C07D 1C1EH 1HXMA 3X3FL 1N6VA 2P8MB 1AXTH 1VDGA 3VWKB 1A6ZA 2VAJA 3SKMA 1ZGLP 1NUNB 1J1XH 1FJ1A 3DIFB 4UQ3A 3WFDL 4PP1D 4KDTA 1GZPB 1FFPA 4O02L 5DJCB 4NN6B 5CFHA 2WINB 4JN2B 3R1GL 4QYOB 1MCQA 2BERA 1MIML 2Y07L 4AM0B 1LP9F 1KB9K 3IXTB 4K2UL 1B0RB 3CZFB 4HIHB 4JRYA 5I1DB 5JQ6H 2ZSVA 1M6OA 4BSWA 4HIXL 1U8KA 4PJCF 4QRRE 5TQ2L 4WV1C 1I8LA 3E6FB 5DHXB 4M62L 2XQYG 1KJMA 4F57H 1EFXA 3O3EA 2XZQH 1AGFA 3U1SL 1BLNA 5CJQH 4XNXL 3VFSB 1KIUA 4NHUB 1IGCH 5E8OA 5DEZA 3PWUB 4UT9H 4O5LL 2BVQA 1YN6B 3EW3B 4Y4HC 4X6BB 1BZ7A 2X7LA 1CFSA 1BREA 3EJJX 2EH8L 4XC1H 3QDGD 4CADA 2B1HH 1OAQL 4JEGB 1N64H 3H42H 4YGVB 2MCPL 5GS0H 2R0KL 1FG9C 4PYHA 4WEUD 1A7RH 5F44A 4KUZH 2KPNA 4ZFZA 1OVZA 1YEEL 3WNMA 5JOPE 3UJIH 5KJRH 1KBGH 3WNPA 3OKOA 2HMIC 3FT2B 2E3VA 4O2FA 2A6DA 4P5MB 3SKJH 2PW1B 4U1HA 2FECI 1N0XH 5E5UB 4WWID 4XBGA 3DVNB 1KTDA 1JRHH 4MZ3A 5B3NA 5INDB 3BD4A 3HNSH 3ZL4H 4WWKA 1YYML 2PW2A 1KENL 1TNMA 3BESR 4MB4A 3LN5B 4YPGB 2YPKA 1B2WL 1FIGH 4OFIA 1A7PH 4NM8H 5JTWA 3ROLB 4M5YL 2JKXA 4HGKC 3NCYP 4G6AD 2XFXB 5J13C 2EYTA 4PJXE 2EC9T 2EICA 3VG0L 3RBSA 4OKVB 2Z31C 2HJKB 1GGUA 3LPWA 1AE6L 5IFHH 2Z8SA 1DQQA 2QQKL 5EUOE 3O4OB 4P2RB 4P4RB 2VSCA 4AT6B 2XTJC 3TBWB 3SOBL 4NN5C 2XG5A 5T1MA 1MHHA 4Y2DA 5FYKD 5LAXB 1MAML 4FXKA 1IGYB 2JLLA 1FZOB 3S8WA 2ADFH 4RMWA 5K9JH 3D85D 4KRNA 4MNQD 3IJHB 4NGHH 3MA7B 1KIQB 1JBJA 5HHOB 5T5FH 4G3YL 4XCCH 2HKFH 3OF6D 2A77L 1AO7D 3D85B 1U3JA 3T0AA 4KHXL 2CRIA 4MNQB 1IGFH 4Z7WE 1IM3B 5J6GB 3OAZH 1BIIA 3M8OH 1EJOH 1MCIA 5E00A 1BWMA 1NFIA 1AO7B 1AKJD 5HSFA 1JHLH 3TT3L 1TCRB 1FL5B 3WNLA 1S9WA 3KHOA 1J8HD 1JGVL 2OXHA 1JMZA 2F53D 1AKJB 2DLFH 3D25A 3IDYC 3NPSB 4H88H 1FNEA 3VXNB 3S35X 1JPTL 3HNVL 4K71B 3FO0H 3W0WD 1MFAH 5IWLA 1J8HB 1DFBL 4ZFGH 2EDJA 1S7QA 2DL9A 1EEQA 1QSED 2QR0B 3C2SA 5E94B 2ZUTA 4HH9B 4L8BA 2F53B 2ORBL 4LSUH 3GGWA 4WI2A 5EU4A 5KG9B 2V2XB 3VA6A 1J8KA 2W0PA 2NY1D 2H9GB 1B6DA 4QKXB 4YUEH 5HVFB 3KPQA 3UTTB 5BVPH 3GMOB 5I73C 5I8EB 1VB9A 4RFEA 2OX5A 2BNRA 2W07A 4LSDA 2FX7H 1D7FA 1NCBL 1U8QA 2E6JA 4CMMB 5C1MB 3VD4A 1N6QL 4KK6D 5D7LE 3C2AH 1WAAF 3RY5A 3RWDA 1QKZL 1NFDE 1BM3L 1JYVA 1MLCA 1YY8B 4WW2C 4JO4L 2LU4A 3VRLF 1I8KB 1IEBA 2FO4B 4N1EA 4LOUD 3P2TA 3DYOA 1IZKA 2WBKA 4JAMB 4WENB 1IM9D 5HHQA 1NSNH 2WV3A 2VXSL 4H0IA 2XYCA 5D96B 5GJTH 3CDGB 4HS8L 5DEFA 5E4EB 1N7ML 3H3BC 3PL6C 1A5FL 5D1ZA 4CN1A 2ID5A 4PJFA 4QRRD 3BP7B 1KPVA 4NQSB 1NGYB 1UJTA 4G8GA 2VITA 1RZJL 4QRRB 1I1FA 4F7EA 3MYJA 3NCJL 3LIZL 5CJXA 4GG8A 1Y18B 3S88L 1S7VA 3ZZ1A 4R2GD 1U95A 1A6UL 2R4SH 3CLFH 4Y16D 2HJFA 2GEEA 4U1IA 1FFRA 5KW9L 4XI5D 1INEL 3KDMA 5EC1B 3EBAA 1H3PL 5HI5C 3W2DL 3BH8A 3BDBA 1F97A 1UA6H 3VXTA 4Y16B 4ODVL 4TYUA 3RL2A 3FCTB 3QNYA 4Q9QH 5C7XH 4R4BA 5DZNA 1QBLH 5JOPD 1CLOH 1CGXA 3FB8A 1ZSDB 3P0VH 5F9WC 5GS1C 1JYNA 1M7DB 2R29H 4IRJC 3NBNA 1HINH 5DA4A 4LASH 3LEXB 1S7XA 5J3HC 5KVEL 4D3CH 2YPVH 3DRQB 4UV7L 1T1ZB 1IBGL 2LABA 2FCBA 3SGJA 3DUSA 5IB5A 2DTMH 2D7MA 1O0VA 3ZYZA 1QRNE 3H9HB 3QEQA 3DURA 4JFZH 1I9RH 4DUXA 4JREB 1UFUA 1JUFB 4NQTA 2VXTL 32C2B 2UVEA 4PJDA 5EPMB 4EIZC 4DKFH 4JR9L 4HX1A 1WZKA 4QRPA 5AAWA 5B38A 4PJXB 1UJ3C 4E5XB 1I8IB 2UUDK 5C0BE 1XF1A 4HKJB 4NQXB 2IALA 4KRLB 1LHZA 1JZ7A 1MCJA 4LSRH 4MCZA 5IFAH 5CWSA 4L8CB 4HCRH 1FGVH 2W1NA 3BOVA 5HDOA 1NMCB 2HT3D 5I1EH 1ZLVK 3Q6GL 5JPMB 1CDGA 2CIIB 2BSSA 2CUMA 5K9KA 5L8KB 2PYEA 1OSPH 1C5CL 1WFOA 3AREA 1PYWA 3QQ9C 4XPAH 3ME0A 5FYKU 1FDLL 3OKDB 5F8RC 3P9MB 3GSWA 1NLDH 2AJVL 1P6AB 4YR6A 1KIPB 5TQ0H 3WFCH 1NCCL 3RZCA 2XWJA 1DLHA 4Z7WB 4M1CD 5F97E 1SQ2N 3ARFD 4LLDA 4JY4A 5CKGA 5CINL 5CEXB 2Q8BL 5KTEH 3TCLA 2H1PH 1ND0B 4K94C 2PXYD 1EO7A 3ARFB 4PRPA 4UT6L 5DRWB 2ZOKB 5ID1A 5B8CC 3LAFA 4OUUB 2H8PB 4MNGE 4RAUA 4KK9C 1PEWA 2JCCA 4YGAB 1FLTX 1G6RB 4GRMA 4I5BB 5ESAA 3EYSL 4IDJH 1RUMH 2PXYB 5T1KD 3TH2T 5HGHB 1CR9L 2B0SH 2UWEB 4O4YH 3BPNC 5AUMA 2DMKA 1TVBB 2HFFB 2AJXL 3NA9H 3WCYA 4OTXH 4YAQA 3SDXE 5DD6A 5D7LD 5FUCE 4Z0BL 5E5MA 3OMZA 1I8MB 3TCXA 4LCIH 5T1KB 5FA3A 2EH7H 5SX5K 3CGTA 2YK1H 3SGKC 2JJVA 4DEPB 3ZKSD 1KFAH 1CCZA 3PWLB 3BH9A 5EU5B 1YUHA 1ED3B 2VIRA 2IFFL 3ULSA 2XN9E 1NFDB 4R96B 3Q5OA 5KSBF 3RFZC 3GMNA 4YZFE 3V6BR 3D5OF 1U2HA 3ES6A 1G84A 4KJWC 3IDXL 2X4SA 3F7VA 2IPKB 1JV5A 1K6QL 3UZVB 3U2SB 3VW3L 1OAYL 3KG5A 4N5EC 3R4DA 4Y19E 2AV7A 3D3VE 3QIWA 1QYGH 1W72A 4OGXL 5I0DA 3SPVB 4GKSA 5FB8A 5TE6H 5E8PA 4HH8A 4PREA 3C6LA 2APFA 3L5WA 2V5YA 3EOBA 4NT6B 1YEJH 3W9DA 4LEOA 1L7TL 5KAQG 3BEVA 4RGNE 4JZJA 3RTQC 2FEEL 3W9EB 3EGSA 1MCNA 2AJSL 2W9LA 3U0WL 4XNMA 4JDZB 4MB5A 4OT1H 1J5OL 5L2JA 4W81A 3O45B 5GISL 1A7QL 1OP5K 3D48R 5FK9B 1QFPA 1OAUH 4N1HB 1I3VA 2E8ZA 2D03H 1BQLH 4DOHE 4QGYA 1BVLB 2R2HA 4UZGA 4YK4B 5D2NC 5DUPH 1EVTC 2XKNB 3BE1L 4FP8H 5FUZH 2AABH 5AG9A 3LDBC 2Y23A 1AIFA 1ZLSL 2ZNXA 5DC4B 2P7TB 4M7ZB 5DFWH 5GGUA 4JKPH 4GMTH 3MMEB 2AV1A 2DRUA 5LBSL 1QRND 4N0FA 1NCDL 3C6SB 3PG2A 4ZUTA 5EC2A 1RHFA 4MA3A 1ZA3A 5I8KL 3WIFB 1AQKL 2L7JA 3B6SB 1M7XA 3QEUB 5D5MA 4DTGL 5KANI 2XIDA 5EOCJ 1QRNB 3MFFA 4L5FH 5DT1L 1ZVYA 3H9SA 4KK8C 4PD4J 1BECA 3ARYA 2PN5A 4MYWB 4JM2A 1UWEL 5C0BD 5CILL 4AYFA 4XP6H 4P9MH 4JRWA 5J89A 5GRWA 4U1KB 3KS0H 4YLQT 1K5NA 1RUPH 5HYSG 3RWEA 5BJTB 4RQQA 2J5LB 3EZ8A 5D2LA 5C0BB 2C5DC 4BH7B 4NWTH 1KV3A 3FO9B 2HLFC 4HWUA 4Q2ZB 4JFQA 1ROWA 3HE7C 1KCVL 4GRLA 4LSQL 4NKQB 1Q9WA 4HZLB 4RZCB 1DEEB 2DYPA 1ZK9A 3E8UH 1U3HD 1FLRH 3L7EB 2P5WE 4MD4A 2GITA 2FBJL 4UBDC 4Z76B 1N2RB 1FNSH 4DN3H 1U3HB 5B4MC 1QEWA 4LNVA 3ZYJA 5E8EB 1C8PA 2VDRH 4U1NB 2J88L 4H0HB 3UTQB 2QSCH 4YDVB 4EI5C 5GGSB 2HT4D 5AD0B 1Z5LB 4PR5A 5IW6B 3ZYIA 3S36H 1A3RH 4NKOA 4ODUB 3JWDC 4D0CB 2R0WH 4FQIL 3TFKD 2P24B 1RULL 4MAUH 3GKZA 3P9LB 3QO0A 4H5SB 4KI5F 3P4NB 4K3DL 4MNGB 5C0CA 1T66C 3W81A 1I7UB 1CN4A 2YD8A 4XC3H 2MQCA 1OCWH 2VR5A 3SE4A 5DQJB 4ZUWA 1A1MB 3RP1A 1HNFA 2O26U 5AWNH 1RK0A 4JQXC 1W72H 4WO4D 5FKPA 2E9WA 1G7LB 3SDXB 4IRSB 1CICC 3EYVA 2IAMD 3SKOA 1WEJL 2XN9D 3G6JB 3GMMA 5DQ9A 2UYLB 1K4DB 1FNAA 3B9VA 4KMLB 2W9EH 4UDUA 2ICWI 3KPNA 3MCKB 2CDFA 4G9FA 3WNOA 2VQUA 2EKSA 1XGUB 2IAMB 4N0CC 2QTEA 2XN9B 3HCVA 5T33H 1C08B 4MA8H 3ZTNH 2IEPA 5BS0E 1KF9B 2DIAA 3VXUA 1RSFA 5EUKA 2AGJL 3ULVH 1A14L 2BNUA 5FF6A 5HHXH 3D3VD 5CIPH 2FHFA 2YRZA 1KYOK 2JB5L 4ZFFA 3FQTA 2XNAA 5IV2B 1RZFH 4F7TB 1QZ1A 4PJ5B 3WFEH 3I6GB 3OKNA 1MREH 4EQ3A 3D3VB 1RJLA 4KH2A 4HPYL 3MRDA 3KJ6L 3NABH 2C9AA 4JDVB 2AK1H 3X13B 5GIRB 5C0ND 3UBXI 3HG1E 3FMGH 4QHLA 2BSTA 2JK5A 4KVCL 4LSTL 4HKBB 2ARWA 5TFSH 1T0NB 3GSRA 2FH6A 4JHAL 1F58H 2GSIA 3DHJA 1AHWB 2D9CA 3KYNA 4OCLC 2EDKA 1GC1H 2GJ6B 4DGYH 1A6TB 2JELL 1XF2B 3T4AB 2F58H 3TVMD 5F70A 1ZHBB 2DLHA 2VZ3A 1WBYA 4DOHB 1NL0L 4NN7B 3JWDL 4YZFF 3GJFB 1MH5B 2AEPL 3TVMB 3BPCA 4ZOCA 5IW3A 4UAOB 3C5JB 1XZ0B 3MRFB 4BA8A 4GRWH 3WFDH 4O02H 2IMMA 2YC1B 2ZCKL 3STLB 2BSRB 3LKRB 1EGJL 3R1GH 1IAKB 2YUZA 2Y07H 2Y5TB 2CLVB 3P4OB 3Q5YA 3B8YA 2Z91A 4K2UH 1A1NA 1JNJA 2EE6A 1NMBL 1VCAA 2QV2A 3L3GB 3KPLB 3OX8B 4HIXH 5TQ2H 1TVHB 3G04A 5IFJA 3U1SH 3NZ8B 2W0FB 4XNXH 5CGTA 3H7BB 1XCTB 1XR9A 1S5HA 2WQ8A 4L29B 5E6IC 4O5LH 5H37G 1UWGL 3TT1L 3RQ3A 1DVFC 2V2TA 1KXQE 2OZ4H 3PWPE 2GFBB 4ZXBB 1II4E 1T89C 3STBA 1WWAX 5I1KL 3I02B 1HQ4B 2P5WD 5DRZA 3GNMH 1DBML 2QSTA 4JO2H 2EYRA 2NY4C 1RK1A 3B3IA 4WTWA 3PHOA 3F5WB 1D3CA 1YEEH 2GY7B 1T80A 4JB9H 1Z6JT 4NNXB 1FC2D 1ZHKB 4NRYA 1TTGA 2HP4A 4DZBA 3EJYD 1T1YA 2BY3A 1YDPB 2EIBA 4C4KT 2N4IA 1ZOXA 4P3DB 2LTQC 3MGAA 4X83A 4X4ME 4BFGA 4I2XE 3QUMB 4C57C 2IPUG 2DDQL 1W8NA 1KENH 4NBYB 1HYSC 5IHUH 1MELA 4CJ0A 3GZKA 1B2WH 5DD0L 3O4LA 2M2DA 1CD0A 3KXFA 3HZVA 3ZO0A 3NN8A 3BGFC 4QOKA 3O8XD 3VG0H 4PB9L 1MJUL 3RNKA 3AMKA 5EZLB 3B5TA 1OP3H 2QQKH 1JTPA 3QWOA 1I7TA 4UNVA 1JYXA 3OXSA 4LF3A 3PDOA 3SOBH 3O8XB 1NLBL 3VFRA 4XCNA 1MAMH 4N8VA 4QXUL 2XWBA 4ZOEA 4R4ND 3RKDD 3WSQH 4TTGA 1T22A 3UX9B 4ZUUA 3HAEA 2AEQL 1QLRA 4WW2A 1W0VB 3ULUD 4G3YH 4ZSOE 4QHKJ 2A77H 2JE8A 5BS0D 1O7SA 5HD8C 3VU2A 4KHXH 4EIGB 2BX5A 1FVDA 1HHHB 5HPMB 1IT9H 2NLJA 2NW2B 1AP2B 4I18C 4LCCB 1J05B 4B41A 4XWOC 1R3LA 1RZGA 4BSJA 5BS0B 1ZEAH 3RVTD 3U0PB 4G9DB 1CTNA 3PP3H 2DM2A 1AD0A 3TT3H 2OL3B 1JGVH 4OV6F 1EUTA 1DQJB 3JV4B 5HYEA 1FQ9C 3V52H 3QQ4B 2OI9C 3HG1D 4U6YA 3KR3L 5CD5D 1JPTH 3HNVH 4JLRB 5IB4A 4PJ9D 2VUYA 1DFBH 4OF0A 4BQ6A 5GRUL 2O5XL 3C8HA 2RFXB 3IYLW 5DJAB 2EIDA 3HG1B 2VLRE 3MJ7A 3S4SG 4U33A 4NQVB 1ACYL 4LVHC 3BP6A 4PJ9B 5J1AA 1X5YA 5ESQA 3DI3B 5FO8A 5I30L 1M4KA 4FA8A 1K4CA 1NCBH 1SEBB 2R0LL 1N6QH 4MJ4A 4S2SB 3KLHC 4P9HC 1DQDL 1QKZH 2ZUVA 4J12A 1BM3H 2VYRE 4XPGL 4BUGA 4WNQA 2AVGA 2ZWLT 3FZUC 2ATKB 2DL2A 2IJ0C 1BZ9B 1CFQA 4O00A 1ZTXL 4DCQA 4TUOA 3K8KA 4L8DA 4W6YB 4N0UE 3G08A 4Y5VB 1Q9LA 3TJHD 1FSKB 3B2UD 1ZANL 2VXSH 4E41B 1T4KB 5DHVA 4XP1L 3BSZL 4CVZB 4OD2B 3JVGA 4HS8H 5GXBB 3V7MA 2VXUL 4FFZL 1N7MH 4X4ZA 1A5FH 1DUZA 2ZUQC 3UYOD 1I7ZA 3B43A 1FAIL 3I3EA 3BW9B 4A2LA 3O9WD 25C8L 1RZJH 4DFHA 2PO6A 3FFDB 3K8MA 1D5MA 3NCJH 3LIZH 4HGWA 4IS6A 4LLAA 1KG0A 4YHLL 1UJ3A 2VDKL 1U58B 3QUYD 3B83A 4XGZA 1A6UH 3L5IA 3O9WB 5FHAH 4B53A 3PWPD 5KW9H 4ORGB 5ENWB 2X41A 3VXOA 2DIJA 5IBLC 3IVKB 1H3PH 2GTZB 2VZUA 4G8FB 3QUYB 2C3XA 3FB5B 2WLYA 2BY2A 4ODVH 4ENEC 4OAWB 1NEZA 2YA1A 2J8HA 5HDBF 1P9MA 2Z4QB 3QBTB 1X5KA 2E27L 1P4BL 4P2YA 3PWNB 1FL6B 1JGDB 2LU3A 2IBZY 3SQOL 2BC4A 1UEMA 2F54E 3CXHJ 3GFUA 4UV7H 1T7WA 3EYOB 3CX2A 4IRZL 1YMHA 5IT2L 1IBGH 1OTSD 3TM6A 2NY2D 2VLJD 2XZAL 3VFWA 5E6ZA 4P9HL 1FYTA 1OD9A 5GGQL 3H7LA 1VKXB 3IU4L 4ZTOL 1ES0A 2NY2B 4Y5XC 2VLJB 3BFOA 2VISA 4IOIB 5B8CA 2VXTH 3LQZB 4UQ2A 4Z18A 3ZDZF 3IDGB 4QRSB 4J6RH 5AZ2L 3A67L 3D69A 3T1FA 5MENA 1VEOA 2OYPA 4ZD3L 2Q6WA 4HIJA 5KSUB 2ZPKL 1KXVC 3QA3B 3D39A 3GSQB 5HY9B 3AU1B 3KHQA 2ZP0T 2QQNL 2Q3AA 1I9IL 3DROA 4HIEA 3CSYA 4K7PX 1RZKC 1YNKH 1ZVSB 3G5XA 4G8IA 3DPBA 1NC4D 3Q6GH 4WHTB 3K74B 4P46B 2H2PC 3WL9A 5B3JE 5E4IA 1TJGH 1TZIA 1OT1A 2HG5B 1D5BB 3WE6A 2DICA 3S5LG 3QXAB 3ARDB 2Z8WC 2VRAA 3DSFL 1FDLH 2VZSA 1CDIA 4ZSOB 4G6AC 1KULA 3NCEB 1NCCH 5IJKA 3IXAA 1TETL 1ZA6B 4ZO6A 4YHYC 4PRBB 4DUWA 2YD9A 1H3UA 3V5KB 1JF1B 3QCVH 5LGHL 2VO5A 4R3SA 3TIEB 1E6JL 3HI6L 4NOFA 4NO2A 3BIKA 1J0IA 5J11C 3REWA 5CINH 2Q8BH 3QUZB 3HC0B 5F7DA 1GL4B 1PEZA 5DS8B 3SY0A 1ZT1A 3V8CA 4X6CE 3RTQA 5SWSD 1REIA 4I77L 3FQNA 4HC1H 1LQSR 2VLRD 3B9KA 1FVCB 4L4JA 3EYSH 1FYHB 4W4NA 5DHVH 5SWSB 3GJEB 1KLUA 2AJXH 4NQCA 3QFJE 2JIXA 2LAGB 1GZQA 2WANA 1ZLUK 3JTSB 1ETZA 2A6JA 4Z0BH 5I76B 2YSSA 1E4XL 1ORSA 4GW5A 3Q2CA 3MBEB 3EYQC 3K2UH 2OTWB 3BGMB 1ONQA 3MRGA 3MUY1 4XNZB 1HEZB 1B0GB 3C8KA 4G5ZL 3IF1B 1QUNA 4Y1AA 4H26B 1JPFA 2EDBA 3HZKA 3GSOA 4GKNA 4TRPL 3IDXH 1FNHA 1YECL 1OGAA 1E27B 1KPRB 2DQIL 4P59H 1K6QH 2NY1C 1BQHB 5DJ2A 3FOLA 3VW3H 3HC3L 3K1DA 3T77B 1OAYH 2GT9A 4M8VA 4YQXL 4GKZA 3P4MB 5JUEH 5I16B 4EUPB 5EA0H 2YBRA 3GBNL 3CVHB 1JGEA 4OGXH 1TPXC 5JIHA 4KHTH 1L7TH 4P2QE 1NAMH 2WP3T 4PJIF 1UG9A 1BD2B 2VL4A 3CU7A 3ZKND 4FQLH 3DX8A 1J5OH 4MQTB 2CR6A 4K23L 5GISH 3VFMA 3DXAE 3BT2H 3BWAA 2XZCL 4HWZA 1DE4B 5T1LD 3VI3F 4U1GC 4TSCH 1R3HA 2W92A 1OTTC 4NQDD 1S7UA 5CMAB 1RZ8A 2ESVE 1T1WB 2MSPA 1OM3L 2W60A 5TDOA 3FAXA 5ICXA 5IHZA 4HQQL 3BI9X 1MCBA 5TJWK 2VWEE 1QD0A 3HRZB 1G0DA 3A6BL 4G8EB 4J1UB 4NQDB 5DJXA 1ZLSH 1A9EA 2F54D 3CX5J 4NQEE 5JIIA 3BPLB 3QZWB 1NUFA 1JHTA 3BPOC 5DQDH 4N90D 4Y89A 5IBTH 1EDQA 1DR9A 5LBSH 1P84J 4R2GC 4M3KB 2J8UA 1A47A 1NCDH 5GJSL 4EI5A 4OCXH 2F54B 5IVXE 3ARXA 1XGTB 4PBVC 2QL1A 1FJ1B 4UQ3B 5I8KH 4PJAA 4XCYB 1AQKH 2G2RB 2FYYA 5E8NB 1FFPB 2AEWA 2FGZA 3KYOA 4DTGH 3P77B 5F96L 5DT1H 3QAZC 4OZFG 4X7SL 5E6YA 1YMME 2FX9L 2Y6SD 3GUTB 1YC7A 4JRYB 1EFXD 5HHME 3AS1A 2FL5A 4JFXA 3I50H 5DF0A 3L3JA 2HFGL 2DJSA 1QO3A 1U8KB 1EBPA 3IETA 2Y5EA 3LZFL 1KJMB 4LQ1A 1EFXB 3O3EB 3IDNA 1AGFB 4KV5E 1BLNB 4ONGL 4JQXA 1EGJA 3MODH 1CICA 3UROR 2EDFA 1KCVH 4LSQH 1BZ7B 4OCRL 5GSRA 2X7LB 2N56A 3KPSE 5FA4A 2Y06L 4JFFA 4OZ4A 5FCUH 2DLTA 1RVFL 4D94A 5H35A 2FBJH 4FQJH 1QPXA 3N06B 3RWHB 4PRHA 4CADB 1D5IH 2I9LA 1HQRA 4TTDC 5EZOL 1DQML 3DMMD 2HFTA 1OB1B 3O3DA 2AI0L 4ZFZB 3BHBA 1R5VB 4JQIL 5SWQB 5IQ7L 4WCYH 1MFEH 2LAAA 3HPLA 4X80H 4M6AA 4NC2B 4O2FB 2A6DB 2HT3C 5LWYH 1P2CA 2EDQA 3KWWA 4BUHA 4L4VE 3ZDYE 1YEFL 1JE6A 4XBGB 4ZUSA 1KTDB 3QCTL 1RULH 4GUPA 5HHNA 2CLZA 2K9UA 4X6CB 3RDTA 4K3DH 3QFJD 4TSAH 3W5NA 2YPKB 4F80A 5DJ6A 4MMXC 4QRPE 3MRNA 3FT4B 5JHDA 1WTGT 3LKSA 4OZHF 3TO2A 4V2CB 4JPIA 5L88L 1OOAA 2DMBA 5CSBA 3NGBC 1DQQB 5HGAA 8FABA 3JZ7A 4XNYH 2XWTB 2D7TL 1KLGA 4MS8D 3MUHL 5T1MB 1CDUA 2VB5A 4FXKB 1QRKA 1RIVH 2HLAA 4LGSB 4NRXA 4X4XA 3BRFA 1X6LA 1T2XA 3HI1A 3WS3A 1A9BA 2ITDA 4TSBL 1ZS8B 2AGJH 4X7EC 5TH2A 5KVGL 1A14H 3LKNA 1NQBA 5A16A 4N8CL 4JJHA 4J3TA 2JB5H 2WBWB 1BBDL 4HBCL 3VFPA 1UWXK 3MXWH 4Z78A 1JI2A 3V5DA 1BIIB 3NIGE 4IJ3B 3RL1B 4ELKA 5E00B 1NFIB 4HJ0D 5IW1A 5INCA 4HFWA 1LK3L 2A1WL 2Z8VC 2NW3A 3KJ6H 4C56E 4FTVE 5F93C 1S9WB 2A6KB 2V9RA 2IH1A 5I9QB 4O2CA 4WU5A 2XXMB 4KVCH 3DXAD 4LSTH 1J88A 4FMFA 3R0MA 4S1RL 3Q3GA 3D25B 4JHAH 1J9CT 1FNEB 1GOGA 5GRXG 1YY9D 1GH7A 4X6EA 3BEWB 3IJYA 1DVFA 1PW3A 1ZLWK 1S7QB 2JELH 1U0QA 2ESVD 3DXAB 4L8BB 2X40A 4RCAA 1T89A 3B9DA 1NL0H 4M4PA 3KPQB 1A0QL 2MWCA 3X14A 2AEPH 4NC1C 1N5YL 2ESVB 5H2BB 4RFEB 2BNRB 4W4OC 4NQED 1AI1H 2BY1A 1F3DH 1U8QB 5CZXD 4OZGA 5F6HJ 3RX7A 1NGQL 3S35L 2GJJA 3RWDB 1FC1A 3GBML 1CD1B 3MRLB 3VRJA 1U6AH 5C09E 4NQEB 4KKCD 1YN7A 3C5SA 1EGJH 1BGXL 4NZRL 1IEBB 3TPUA 3Q0HA 3D0VA 3P11L 4NO3A 3TF7C 2MCG1 4L8SA 1ZXQA 4JRXE 3LKPB 2FBOJ 5HHQB 1UM4L 1DLFH 1MHCA 4M7ZC 4WIQA 5C71A 4GXUN 5HHMD 2ED9A 2H32A 1JWSA 1NCUA 3E0GA 4X8JA 1YEKL 3AAZB 1KPVB 4G8GB 1L6ZA 5ICZA 2HJLB 1UWGH 3TT1H 4P2OD 1I1FB 2EECA 3LS5L 4GG8B 3CD4A 1S7VB 3KPSD 4HEME 2DB8A 5H37H 5I1KH 1U95B 4WEBL 3D6GA 3WUWB 4P3WA 1Q9OA 1RZ7L 4CW1A 2YD3A 2EC8A 2B5IB 2C4FU 3C5ZC 3BH8B 2VZVA 4P57A 4FZEL 3VXTB 3VMNA 4CU8A 1DBKL 3RL2B 1NGZA 1T20B 3QNYB 3L3HA 5A2LH 4KI5C 1BJ8A 4ZO8A 3GMQA 3QYCA 3L5XL 2IBGA 2NR6D 5M94B 5I8OL 5GGRA 1FE8L 1S7XB 4L4VD 2AK4E 2DDQH 3MLWL 4K55A 5C0FA 4N9GA 1P7HL 4XT1C 5DK0A 1OAKL 2EIEA 3DUSB 1OARH 1JGUL 3FN3A 1X5GA 3LD8C 3QEQB 4RMVA 3DURB 4GBXD 4QRPD 4WUUA 5GRVL 2LE9A 5JOEA 2VERN 1GAFL 4PJDB 5DR5L 4HX1B 3IS0X 1NLBH 1V3LA 4QRPB 5HGDB 1T5WA 3IDIA 2NZ9D 3GO1L 4QXUH 3V5HB 5B38B 4OZIE 2HT4C 4XMKL 1TCMA 3ZSTA 4XX1E 2IALB 2AEQH 4MCZB 1F4AA 3N1MC 3Q6FA 4PY7B 2HVKA 1X6NA 1NEUA 3WFHA 4QY8A 4FQXC 3VE0A 3GSNL 3MJ8A 3V4VL 1FN4A 3TFKC 4OLWH 4C55A 2BSSB 5L2KA 1PBYA 5EU7C 4P5TA 3ZKMD 1M05B 4G80A 3RZCD 5IEKA 1PYWB 1R3KA 3WYRA 5FUCC 1UM6L 1BOGB 5AZEH 4DAGL 4LHUA 4DGIL 3JUYA 4WO4C 3RZCB 3TZVD 2IF7A 1DLHB 4C56D 3QXTA 2YEZB 5AG8A 3QO1A 1JHKL 3MROB 3DIFA 5C07A 3KR3H 4LLDB 4JY4B 2Q1EA 1S7SB 3ESUF 1TQBC 2FHCA 3C87A 1XF5B 5JLZA 1BQSA 4JN2A 5GRUH 2O5XH 3TCLB 3FTGB 4D9RE 5LG1A 4Z7VF 4AM0A 3K46A 3ZE2E 1BVKB 2OMNA 1ACYH 3MJGX 4PRPB 1WLHA 3U46A 4OF8A 5ID1B 4HIHA 5I1DA 5CJOL 3VFUB 2ZCLL 5DVLA 2MPAL 5I30H 1A7NL 3NTCL 4KC3B 4LLQA 3FL7A 5ESAB 2H2SD 3E6FA 4OM0H 4L4TA 4UTAL 5AUMB 1DQDH 3HUJE 4XPGH 4RGNC 5DD6B 4APQD 2H32H 5E5MB 1NBYB 2CKBL 2HKHH 3DSNA 3MRCA 4X6BA 3QH3B 5C09D 1ZE3C 4U3XA 1NPUA 3BH9B 3GSUB 1YUHB 4M43H 5HHVL 2VIRB 1ZANH 5SX4I 3ULSB 5I6XB 3N85L 1R0AH 4XP1H 3BSZH 4QNPE 4JRXD 3GMNB 3K3QA 5C09B 3FN0H 4YGVA 3TO4D 4L1HA 2VXUH 2RB8A 2X4SB 4FFZH 3F7VB 1YYLL 5DFTA 4KROD 1ZLVH 1G7IA 1EV2E 1Q1JL 3CFJB 3QDGA 3QIWD 2EC9U 1JZ5A 1FAIH 3FRPA 3TO4B 4GG6A 2CO6B 4KROB 2ERJB 25C8H 5FGCE 2HH0L 2AV7B 2PW1A 3DV6A 3QIWB 1W72B 4L3AA 4GKSB 2NPLX 2W65B 3DVNA 2VDKH 4Y88A 3L5WB 1O5DT 5F7NC 3W9DB 1MHEB 4LEOB 3LRHA 4N8PA 1KSRA 3LKOB 5F9DC 1LE9B 3NIFE 1YQVH 1HYRC 4HUUA 2R0ZL 4U6TA 1XR8A 1SVZA 2XFXA 2MTPA 1OSZB 1LGVA 4QHKI 1AY1L 4O58L 2HJKA 3FO2A 4Q0XL 5JA8B 1A64A 1C12A 5GGVH 2EDYA 1J0YA 1LILA 1P4BH 2R2HB 2VDNL 3AB0C 1V7NL 1IC4L 4P3CL 4AT6A 4ONFL 2I5YL 5TF1L 5LAXA 3SQOH 1IGYA 4IRZH 2DQJL 1AIFB 2AK4D 5IT2H 5F9JA 4KRPD 1T3FA 3MA7A 5SX5H 3RX5A 5GGUB 2C3HA 2GIYA 1MRDL 5GGQH 2AV1B 4A6YL 4LKCA 5ITBL 2ADIB 2NY0B 1H3WM 2ITCA 3D85A 2AK4B 4MNQA 5C92A 4N0FB 3IU4H 4ZTOH 4KRPB 3UYRL 5J6GA 4HPOL 1U8IA 3QISA 5EC2B 2C1OA 4MA3B 1H3VA 3OKLA 1ZA3B 4I3SL 3A67H 3OF6A 4NZUH 1AO7A 4JM2D 5D5MB 5MEQA 1T7ZA 2CMRL 3U7WH 4ZD3H 1GPOL 4IOFD 2A73A 5J12B 3MFFB 3BZ4B 1PZUB 1TCRA 1FL5A 4QF1A 1ZHNA 1F2XK 3BKYH 43CAA 2OK0L 2OSLA 3EJYC 3VI4F 1AC0A 4JM2B 5IMMB 2XY1A 2QQNH 1CFVH 1GGBL 1I9IH 2R69H 2GQHA 4TQEL 3VXNA 5E8DL 3QJFB 4AQ1B 3SE9H 5CSZA 1K5NB 4HH9A 2JJUA 5D2LB 2V2XA 3FFCE 3SDAC 3ZHKA 4RAHA 3DSFH 3W0WA 4JFQB 3KPRE 2WLZA 4GRLB 1QSEA 5C0DA 3SGEI 3T0WA 1Q9WB 4HV8B 1TETH 1OP5H 4NM4H 4UV4H 5HGGS 4WHYH 3GM0A 2NXYC 5LGHH 4MD4B 4GKOA 1VGKA 1E6JH 1SM3L 3CK0L 3JWOC 4NUGL 5JORB 4Y2OA 4KQ3L 2ARJQ 2P1YA 1NH6A 1NJ9A 2PR4L 4KJQC 5GZNC 3V8OA 2O5YH 2IWGA 1IGML 1I8KA 1WIOA 4UB0H 4B5EA 4KUCD 2FWOB 4JAMA 1T0MB 1QVOB 4I77H 1M7IA 5BO1L 4LCCC 4D9RD 4FQCL 5GPRA 4GW1A 4PR5B 5D70L 2WMPA 4AIZB 3IKCA 3VJ6A 4QTIH 3PF2A 4NKOB 4HWBL 4P23D 2B1AL 1CLYH 1IM9A 2SEBA 2YOCA 2ARJB 4OZIF 1F6FB 1NKRA 9CGTA 3BP7A 5DK2A 2XPGA 3MRKA 4UU9B 5DO2C 1E4XH 3QNXB 1HHKA 1U42A 4QRRA 1UZ6E 4YDKL 4ZUWB 1RK0B 3BJLA 1DN0B 2ICCA 5KS9E 2FJGA 3MTRA 1F4YL 1T6WA 4P99A 4JGJA 5FOBB 2RR3A 3SKOB 4X8XA 2IANE 3GIZL 2YMXL 4UDUB 5EC1A 3KPNB 2DQIH 4G9FB 1CLZL 2BSED 3F6IA 5C6TL 4Y16A 2EKSB 3HC3H 4YQXH 3HCVB 4JM4L 3SCMD 3QULA 4NNYB 3VXUB 1ZSDA 4S11A 1QHPA 5GHWL 4LLMB 5FF6B 5J56B 1Y0LA 4I3RL 1FGNL 3VXME 3SCMB 4ZFFB 3QRFM 3ZE2F 3FQTB 2XNAB 3DRQA 2A38A 1T1ZA 3K80A 3OKNB 4M1DL 5FGCB 5B21A 4AIOA 2R2CA 4Z7UF 4LFHD 1RJLB 4K23H 2EO1A 1U91A 4WV1B 4Y4HD 1T83C 3JWOL 3H9HA 4IHOA 2NY3C 4BYHA 1BF2A 5E9DE 3HUJF 5FYKH 4QHLB 2BSTB 3RIAK 4GAJL 2JK5B 3VH8G 1X5LA 1UM5L 3GSRB 4X0KB 1QLEL 32C2A 3MRMB 4Y4HB 3RWFA 2FB4L 1HZHL 1ORQB 5KVMC 1OM3H 4BZ1L 2Q20A 1J86A 4LLYA 4Z6AT 1RUQL 4HQQH 3LN9A 3DVIA 4PJXA 1I8IA 3ARGC 3A6BH 4L9LC 1CXIA 1EXUB 2OL3L 5EUOA 1CFNB 1CFBA 3QUYC 1XGYL 5DHYB 3RVXC 5GJSH 1VA9A 5C2BL 1QLFA 3H6JA 2BP3A 4HZAA 4K9EC 5F3BA 2YRLA 2GK0A 3HTLX 3P9MA 4RFNC 5DZOA 1MLBB 2DD8L 5F96H 3FHQA 1KIPA 4HWEL 1CK0L 2Z91B 4Z7WA 1MCRA 3BO8B 1LEGA 3I9GH 3WKML 4MHHI 2FHBA 1ZT4A 2HFGH 3NFNA 3FONA 2Z31D 3VWJC 2YKLL 2P8LB 3OXRA 4ETYA 5CEXA 1FNLA 5IFJB 1MCEA 8CGTA 5J13B 1A02N 3VFOB 4X7CC 2XTJD 4I0PC 3ARFA 3MLUL 2Z31B 2ZOKA 1S5HB 5D8JL 1BFOA 2D2OA 4MHHG 3FFCD 3U4EA 2H8PA 4XXDA 2AJZB 2DWDA 1KCRL 4OCRH 2YRPA 3CH8A 3A6CL 2Y06H 3ZTJH 5HGHA 2E9JA 2XTJB 2PXYA 3KPRD 4NN5B 1RVFH 2V5RA 2GW5A 3DVFA 1UADC 3BMVA 4WEMB 4GSDL 5J1TC 2NTSP 4OFPA 3MO1A 5DRZB 1I8MA 4YH6A 5T1KA 3KPRB 2EYRB 3PABA 5EZOH 3TEUA 1RK1B 3PHOB 4C4KO 1L0QA 4H1LG 2AI0H 3FT3A 4EI6A 4JQIH 4ODSL 5D7LA 1B4RA 3PWVA 2ZUUA 4NRYB 3L3DA 1NFDA 4DZBB 1I9JL 4R96A 3CCHB 1T1YB 5CJBA 1D5ZB 4YEEA 4LCYB 4RFOH 3WXVH 4UDTB 1FYTE 5I1LA 1YEFH 2IPKA 3LHPL 3DWTA 3KXFD 4YHPB 5KVFL 3IDMB 3Q5TA 4PJBE 4RRPG 4YNYA 4M93B 1XAUA 2G60L 4S1SL 3QJHB 3IDYB 4NWUL 5HTSA 2BDNH 4JG1L 4KTDL 4YX2L 2X1PA 3KXFB 4ZO9A 4JKMA 4XVUC 3SPVA 2VL5B 5DVMA 4B50A 3TWCH 1KB5L 4XWGL 1QSZA 1YPZE 3RNKB 4K9EL 4PP2B 2I9TA 4L3EE 3HS0B 1HWHB 3LCYA 2FDBP 1I7TB 2R56L 5I73B 4M9OA 4JDZA 1RUAL 5CGYC 4LF3B 4ZNCD 2F8OA 2CRMA 4M4RA 3VFRB 4W4OA 3O45A 2IAND 5IEHA 4N8VB 4OI7A 2XWBB 5D7JD 3IU3B 1P7KB 4HF5L 4ZUUB 3HAEB 1F42A 1KCLA 1QLRB 4TSBH 3L6FA 4HD9A 5KVGH 3QDJE 4B7IA 3KNBB 4N8CH 2OTUB 5IMLB 4GW4B 2BJML 2XKNA 1FVDB 3N1FC 4JZNA 2NLJB 3PL6D 2VXVH 3T3PE 3BDYL 3VXMD 2QJDA 2BNQA 1RZGB 2P7TA 1LK3H 3PNWB 4AENA 4U1MB 1AD0B 1WF5A 2FIKB 3PL6B 5DSCA 4MAYC 3VXMB 4R90L 2FLRT 4LAQL 4BK5A 4S1RH 3GSNA 3R06A 4PJEE 5DMGC 5E9DD 3GKWH 4KZEL 1UACH 2NTFA 5IB4B 4JY5L 4POZC 3QEUA 4XXCC 4PJ8D 1QRNA 1MCHA 5EB9A 2WUCL 5FO7B 3I75B 4YDJB 5E9DB 1NDMB 3PGDB 2FD6L 1A0QH 5ESQB 5FO8B 1OPGL 1KC5L 4LVOC 4U1KA 5D1QC 5D2NE 4ERSL 4F37F 1IKNC 5KOVC 5DRXB 1NGQH 3S35H 3F7YB 4IRJD 5IMKB 4JFOA 5C0BA 2J4WL 3GBMH 4BH7A 1YC8A 4WNQB 1R24A 1IFHL 4ONHA 4QHUB 1BGXH 1QFHA 4GS7C 5F9WB 5GS1B 4JQVA 4DCQB 4TUOB 4IRJB 1AXSA 5JW5A 3P11H 4RZCA 3LRSA 2E5EA 3MNWB 1G6RH 1UM4H 4CN4A 1G9NC 5DHVB 5HVWA 3FQXA 2B4CC 1JRHI 3SO5A 1U3HA 2MMXA 3DBXA 3HNTL 1DUZB 3KYKL 2CKBA 1V7ML 1YEKH 3UTQA 3MOAH 4H20L 1B3JA 4H8WH 1Z5LA 1NAKL 4U1LB 1RHHA 5I66A 1JGLL 3GI9L 1PKQE 3S97C 1D5MB 4ZPVA 3TNNB 3LS5H 4MX7A 4ODUA 4IS6B 35C8L 1KG0B 5JXED 1UJ3B 4D0CA 1MJ8L 1QOKA 1F8TH 2P24A 4WEBH 4WGWB 4H5SA 2CRYA 1RZ7H 3P4NA 5BMFL 4MNGA 3VXOB 1SBBA 4V2BA 5KVDL 2QEJA 1I7UA 4FQXA 1BP3B 5EOQL 4FZEH 2Y6SC 4HMDA 1BAFH 1YNLL 4NFCA 4JO3L 4LHQB 1HNGA 2DQTL 4U7KA 3ARPA 1NEZB 2DLGA 3SDXA 5JHLL 2EDEA 4X9GA 5D7IF 2UYLA 3LEYL 5SV4A 5E2WH 4HK0A 3VXSA 1LEIB 1FE8H 1CD8A 1D9KD 4WO4A 5JXAL 1FYTD 3IKKA 3HC4L 5C0GA 4PGDA 1S78C 2DF3A 4BELD 2BC4B 1XGUA 2XN9A 4M7JL 4J23A 5DI8A 2BVPA 2C26A 5E7BA 1OAKH 4PRAA 3OV6A 3VFWB 1MFDL 3NH7H 1A6WL 1JGUH 1FYTB 1K3IA 3SBWC 1NMAL 3RRQA 5JNYB 1UKSA 5MEND 1R3JA 4EJ1C 1ES0B 1CGSL 1GAFH 2VISB 1IL1B 1YEDA 4JPWL 4PJ7F 5B8CB 5IV2A 4UQ2B 1L9NA 5DR5H 3V0VA 3DMMC 1UCBL 4L3ED 1OGTA 5JW3L 1MUJA 4Y19A 3D69B 4PJGE 3T1FB 4BZYA 5MENB 4TPRH 2Q6WB 1G9NL 3GO1H 4XMKH 2B4CL 3BPNB 5GIRA 1KNOA 4A6YA 5IESL 1WIUA 1Q0XL 1TJHL 3V4VH 4JFEE 2VR4A 3QCUH 3QDJD 4KJWD 4X6DE 1A6TA 1TZIB 2EDTA 1XF2A 3T4AA 3WE6B 3WN5C 2D3VA 1UM6H 2VOTA 3UJJL 1QFUH 3C9NA 4DAGH 2DOCA 3NIDF 3U36A 1MH5A 5IGXH 4EKXA 4DGIH 1EEUA 4K7PL 1QFWL 4HGMA 3WHE0 4WW1A 1XZ0A 4PJBF 1JHKH 4AL8H 4V1DA 3UEZA 3EOYG 2GKIA 3JUZA 2ICWA 5ITFA 4ZNEA 5TE7L 3LKRA 1W0WB 5I74C 5BVJA 3TN0D 2Y5TA 2CLVA 3TYFB 1YPZF 1SHMA 4PJEB 4M48L 5FXCH 5CJOH 2ZG1A 3UMTA 3L3GA 3S37X 2MPAH 3OX8A 1A7NH 4KKNA 3NTCH 2BZDA 2KQMA 4PS4H 4UTAH 4YHML 5HI4C 3RWIA 1KLUB 1MAKA 2W0FA 4OSUH 3D9AH 1XCTA 1ORSB 4GW5B 4Q6IC 4Y1AD 6FABL 1ONQB 4MJ5A 5D2NB 3MRGB 3EUUA 4BQ8A 1OAXL 3UBXA 5JPNB 1FAKT 2YUWA 5HHVH 4MXWL 2GFBA 1K8DA 3C8KB 2VDLL 2OR8A 3LDBB 4HWBA 4Y1AB 1YY9C 1AQDA 4GKNB 1HQ4A 2B7DT 2DBLL 3GSOB 3QHTC 4PG2C 1RPQA 3WFBL 3RGVC 2ZKHH 1YYLH 2BOBA 5TDPB 1KCKA 3V6OC 3F5WA 1OGAB 1Q1JH 2A74A 3FOLB 2P5WA 1P4IH 2GT9B 4NNXA 4ZODA 1J1OL 1ZHKA 3MNVA 4GKZB 4KK8D 3T0EE 1A21A 3GK8H 4G6KL 2WP3O 2YBRB 1AGDB 4G6JL 4DZ8B 2HH0H 4HAFA 5GGRY 3ZE0E 1YDPA 1JGEB 1WCBA 4P3DA 4Y0GA 1G0XA 1WITA 4GOSA 3CMOH 4Z7NE 1AJ7L 2V5SA 1WC7B 2X1QA 4AY0A 2VKXA 4KKCC 3QIUC 4URTB 3BISA 1TLKA 1MJ7L 3UTPD 5GGVY 1PKQB 1VFBB 3G9VA 5KOMC 4R26L 2MFNA 3HE7D 3VFMB 1G7MA 1F5WA 3BWAB 4HWZB 3SDAA 4X98A 4Q0XH 3ZE1F 4NOBA 3RI5F 4FFWD 3G6AA 3UDWC 1MEXH 2VDNH 4MD0B 4LPWA 1KCUL 1S7UB 2D7QA 1RZ8B 4FZ8L 3HE7B 4WRLA 3PGFL 4OM1L 1V7NH 3QHFL 1IC4H 4P3CH 1HH6A 1TTUA 4ONFH 1CT8A 2W60B 2A2QT 5ICXB 5TF1H 5IHZB 5J8OA 2AJUL 3MNZB 4BQCA 3ZT5A 1OLZA 2BCKB 3HLAA 1ZLUH 3AGVA 3VGHA 2DQJH 3F65A 1PSKL 1DUYA 4X9BA 2EXYD 4P2OC 1A9EB 3O2WL 2GHWB 4HAGA 1IGTA 1OY3B 1MRDH 4OCWH 4A6YH 5ITBH 1JHTB 1F6AB 5IB1A 1JK8A 4HKXA 2KBGA 3ROOB 4NIKB 1P4LB 2RQ8A 3UYRH 4EI5B 1HHHA 5HPMA 4HPOH 4LVNC 2NW2A 2OR9L 2XA8L 4LCCA 4PLOB 1J05A 4XCFL 5F88A 4I3SH 1JFQL 2FYYB 1MWAB 3KYOB 4CVXB 2CMRH 2FX8H 1CDHA 1GPOH 4HSQA 4HXBL 4HK3J 4TNVK 2X2YA 1T66D 3WO4C 3C09C 2OL3A 2A9NL 2IQAB 3JV4A 1L4IA 3RUGE 1GGBH 3RWCA 1KELL 3QQ4A 4EDWL 1JI1A 4TQEH 4JFXB 3OB8A 2NR6C 3L3JB 1QO3B 4JLRA 5D7SH 3LPGA 3B2VL 4FQ1L 4JFED 2Q76A 1S3KL 1FIEA 3HG1A 1B4JL 3PIQA 4N0CD 1X5IA 2IH3B 5T1DL 1KUMA 3WLWC 5GSRB 4JFEB 4GBXC 1ERNA 3E6HA 4JFFB 4OZ4B 4X6DB 5T3XE 4EEEA 2D9QB 3S96A 5H35B 4B7LA 4U6VL 3M07A 1EZVY 1SM3H 3CK0H 4PRHB 2XKSA 3MC0A 4KQ3H 2I9LB 3T2PA 4RMUA 3BIAX 2PR4H 5CBEA 5FOJA 1HCVA 1TQCC 2ATKA 1IGMH 3FOMA 5EOCL 4NP4L 1BZ9A 4X7FC 3O3DB 4HLJA 5DJDA 4OV5A 2X10A 1QR1A 5BO1H 2FZ3B 4FQCH 4FNLL 4F37K 3CFBA 5LGJA 4HIIA 3VGGA 4OCNC 4CVZA 1EO8L 5EBLA 1WBXA 3KWWB 3SGDH 4HWBH 4PJGF 2B1AH 1BMGA 4ZUSB 4HS6B 5LXGL 3RWGA 2PYFA 3LSOA 1EHAA 4GUPB 5HHNB 2CLZB 1FRGL 4OFYD 3V6ZA 3DV4A 2EO9A 1R5WA 4XRCA 1PKOA 3FFDA 5DJ6B 3TZVC 2C3VA 1F3JB 2F19H 4N0YL 3VCLA 4JFHE 1KB9J 1T6VN 1RJYB 2PTVA 5JHDB 1LP9E 1G9MC 1NCWL 3MJ9H 3O9WA 4G7YL 4OCSH 4Z8FL 4L3CB 4JPIB 4F8QA 1Z3GL 4R4FL 4QXWA 5ENWA 5HGAB 3GIZH 4TOYL 1A3QA 4PJCE 3IVKA 4RISL 1K85A 4NYLA 2R1WB 3QUYA 1CLZH 3K4AA 5C6TH 3IAPA 3PWPA 4WTZA 3UZQA 3U9UB 3IAGC 2K3TA 2BK8A 1YEIH 4JM4H 2HLAB 4NRXB 4X4XB 4U6XA 1KB5A 5JW4Q 3HI1B 3WS3B 1A9BB 2H2SC 5IMOA 5TH2B 3T0ED 5GHWH 3S6CA 3DECA 5A16B 3ULVE 1FGNH 4Z7QF 1JGDA 2JF1A 4LRNL 2R39A 4APQC 1BFSA 1OQXA 1U36A 4Z78B 3V5DB 4D9QD 5DD5H 3CVIL 4ELKB 5I75C 2HFEA 5INCB 4HFWB 4PB0L 5E6ID 5FAAA 3ZHLA 2F5AL 4X4MA 1YJDH 1WWWX 4UNUA 1VKXA 2COQA 5C0AE 1DVFD 4I2XA 4I0PA 4GAJH 4WU5B 1G1YA 3BXNB 2V5MA 5E6IB 2QQLL 5K33A 3WO3B 4KROC 2FB4H 1HZHH 2KDGA 4QRSA 4PJFF 3IJYB 4PJHF 1DVFB 3ULUH 1RUQH 1SMOA 2GK2A 2NY4D 5KSUA 4I1NB 3QA3A 1AR2A 2NX5E 4WI4A 2EE2A 3AU1A 2WBJD 5K9QG 2OL3H 1MVUA 4CU7A 2X9YA 1OT2A 1IAMA 3X14B 3TGXA 2NY4B 1W8OA 1F3DJ 4K3EL 3LQAC 1B90A 4IOSD 1XGYH 1GGYA 1WISA 4PV8A 2E7MA 5L9DL 1S9XB 4MDIB 1W0YT 4ZS7L 3V4PL 2HG5A 5C2BH 2OLDA 5FYJE 5IBUB 5C6PB 1Q72L 5F7LB 3VRJB 4F9PC 2Z93B 1NC4A 1YN7B 1HYSD 3C5SB 2DD8H 1C5BL 2LTQB 4HWEH 1CK0H 3CIQA 3D0VB 4NO3B 3SE3A 1IILE 4Z7NF 3V5KA 5BW7C 1JF1A 4TVPE 4QRTA 3TIEA 3WKMH 1MHCB 2YKLH 4XVTH 4UTBL 4XPFL 1EPFA 4K3HA 3RVVD 3BYYA 3BGFB 1JWSB 1UKQA 3HC0A 2CDGB 4TNWK 3V95A 1UWXH 4LSPL 3RIFK 1KN4H 3MLUH 1F45A 3LKQB 2X4OA 1GIGL 5ICZB 5F6IC 3W11D 3CH1A 3JXAA 3A6CH 3ILPB 5J12C 3FO1B 4M00A 3OG6B 4WI6A 1VADA 4GSDH 5C8JA 2DI9A 1H15B 2VLRA 1U8MA 5T3XD 1TXKA 3JTSA 5E08H 4YC2C 1Q9OB 1N3NA 2ADGA 3WEXA 4IOFC 4N5UA 4CW1B 1U3ZA 2AXGA 1ZLWH 3BGMA 3I2CL 5FFLA 4P57B 4KTEL 1HEZA 1KEML 1B0GA 1DCLA 1ZMYA 4OBRA 1NDGA 3IFOA 3HRPA 4I18B 3IF1A 5TPWL 1YNTB 3OQ3B 4HS3B 3ZKQD 2EDRA 3GMQB 4Y4KC 4P48A 4ESKA 1EHXA 3QR2A 4N0UA 3LHPH 3NZHH 5KVFH 1BQHA 2APTA 4U1JA 3OR6B 1WAAE 2OJEB 3T77A 2G60H 3QI9D 4S1SH 4NUJA 5C0FB 3MBXL 4N9GB 1U2CA 3RUGF 5E5RB 2OI9B 3ARSA 5DK0B 4EUPA 5I16A 2CIKA 4EDXA 4JG1H 4HEPG 4KTDH 1S8DA 4YX2H 4EXKA 1KB5H 2AAVA 3GM8A 3S3SA 2N7BA 4XWGH 3D87B 4DVRL 2H3NA 4K9EH 5FHBL 5L8JB 4JFHD 1AFVL 5EDXA 1HIML 4JY6A 4LVHB 3KLHD 2NY5H 1IE5A 4M7LH 4KI1A 1RUAH 1MF2L 3OGCB 1IKNA 3FZUD 1T5WB 3IDIB 1D6VH 4D2NA 1LP9B 4X4YB 1A8JH 3VDAA 4HF5H 4Z95H 3MLTB 2JCCF 5EZJB 3Q6FB 4QLRA 1H3TA 1S9VA 2HVKB 1RUKH 1MCPH 1GCFA 4FG6C 4HLZH 4PJCB 4P23C 1WJ3A 1LD9A 2BJMH 1T1WA 2OQJA 1FN4B 2BXZA 3RY6C 5T1LA 4WFHE 5I15H 3MUZ1 3BDYH 2EDWA 2W9DH 3HRZA 4G80B 1CVRA 1IZJA 1LMKA 5D1XD 2DQDL 1N5AA 2VNCA 3QZWA 2FSEA 3BGAA 4LHUB 4R90H 5E70A 4K7FB 3V0AC 2ZUQB 5CCKL 4LPCA 2F54A 3UO1L 3QO1B 1XGTA 5C0AD 1UB5B 5C07B 4KZEH 2Y72A 4XCYA 2G2RA 5E8NA 3VD3A 5HXMA 3MACL 1F4XL 3P77A 5JLZB 3RPIB 2WUCH 5IBLD 3SCMC 4L4TD 3GUTA 3X3GL 3U46B 1ADQL 3NVQA 2FD6H 4ENED 5JIKA 1WFNA 3DYPA 2NX5D 1OPGH 1RMFL 1UH3A 4JPKL 4J3WA 2VLKE 4LLQB 1OLLA 4ERSH 3LQMA 4L4TB 3MLRL 3QWRD 4HT1H 5MERA 4GXUM 2NX5B 1CBVL 1QACA 1V8HA 1IFHH 5FYJD 3VD5A 3MRCB 2E7LC 1C16A 3LMJH 3VXPB 1U92A 3AFLA 1EVUA 3ULVF 1TZGH 5T3ZE 1CD9B 4X9IA 2APVA 4QRUA 3RWHA 2B39A 1C7TA 4TVPD 1X5XA 1SJVA 5EBWA 2WIIA 3SBWA 3KYKH 1G7IB 3SDYL 1OB1A 1V7MH 1IAIL 3QDGB 4OLEA 4H20H 1R5VA 3IAQA 5SWQA 4CN6A 3LN4A 3MUJA 4Y5XB 2PKDA 2YPLE 4GG6B 1JGLH 3GI9H 3DMMA 1G7PB 3Q48A 5HDQL 3R8QA 3DV6B 7CGTA 35C8H 3N1GC 3T0DA 3GMLB 4ODBD 2H2PD 2XKUA 4EVNA 4X6CA 4U6HA 4PRNA 2IMNA 2ZG2A 5KVDH 2CKNA 2ZUXA 5EOQH 3RAJL 4HUUB 1XR8B 1U8JA 4YXHL 4NO5A 4WTXA 2DQGH 4EUPH 5F7UA 4JO3H 3CVHH 1JWMA 2DQTH 3FT4A 5LGKA 3DARA 3QFJA 2HRLA 4YFEA 3FO2B 1C12B 3RA7L 3LRGA 4GRWF 1KJ2L 3IRZA 2XWTA 2YD5A 1GJIA 3HC4H 4HG4K 4YHYB 4GQPH 4RGOL 3MLXL 3QPXL 3AM8A 3AC0A 1T04A 4M03A 4M7JH 2BVYA 1T2JA 1F3RB 5D71L 1T3FB 5F9JB 2DKMA 4WU7A 1ZS8A 5J11B 43C9A 1NMAH 3CMGA 4E9LA 4LKCB 1PFCA 2ITCB 2CJUL 1BEYL 2DQFA 5B22A 1U8IB 5C0IA 2C1OB 4J3XA 5KSBE 3OKLB 3RL1A 3ARBC 1UCBH 3NFSL 5JW3H 2EEDA 4MLIA 5MEQB 3D18B 2A73B 4MA7L 3VGFA 3EYQD 1KXTB 1ZHNB 2A6KA 4QF1B 3UPRB 43CAB 3O3AB 4L1DA 2OSLB 4P2QA 3OHXA 5EORL 4M93C 2QADD 4EZMA 5DA0B 1Q0XH 1TJHH 5EH1A 4Q6IA 4JKWA 1PG7W 3GSVA 1B0WA 4RAVA 1IGJB 4XPHL 2FO1A 3BEWA 5CSZB 1P53A 2J6EL 3DXAA 2EEAA 2EIZA 4XBPA 3MLSL 2CD0A 4UOW0 3KLAB 4WFHD 4QTHA 3WJJC 5FGSA 3UJJH 3ZHDA 3W0WB 5DWUL 4ACPA 4PG2A 3SO3C 4U49A 5M95B 3RGVA 1QSEB 5C0DB 2ESVA 5H2BA 5ABDE 3L9RA 3T2OA 1C5DA 3BKJH 4MVBD 2NY1B 4K7PH 1QFWH 3VA2C 2AJYL 5E1AA 1VGKB 3GMRA 3N9GL 3QFDA 1RY7B 1OWRM 5DD1L 1CD1A 2IBBA 3MRLA 1NJ9B 1TITA 4NQEA 2W0LA 1TPXB 5D7JC 1CF8L 1NUDA 4QT5A 1QNZH 3V7AG 3ARZA 3FN9A 4M48H 3LKPA 5IVXA 1M7IB 4G7VL 3QDHA 4GW1B 4NO0D 4E42A 3IKCB 4NPYB 3VJ6B 1OTTD 4YHMH 5GGSY 4GQ9L 1IM9B 2SEBB 1YMMA 4OD3H 3BWUC 3AAZA 5CSGA 5DK2B 4OLYL 2XPGB 3MRKB 4M6OL 4U1GB 5EU6E 1GGIL 3UDWA 2HJLA 1HHKB 3SJVE 2RCSL 4NC1E 3EFDL 3WNKA 1OAXH 1CDJA 4MXWH 2APXA 2VAAB 3L7FB 2VDLH 2QHRL 4HUXA 2FJGB 5T3ZD 3WUWA 4P2OA 4EN3C 4PJ8C 3WFBH 1T1XB 5GZOC 3RHWF 3BPOB 3KPSA 2OXGA 3K8LA 4R2GB 3MV8E 4ETQA 3UTSA 1E4KC 3TC9A 1T20A 1J1OH 5MEOB 2F5BL 4G6KH 3QULB 4G6JH 2BNQE 4LSSL 1HOCA 1S5IL 3N1PC 2YPLD 4XAKE 4N8VG 3QAZB 1Y0LB 5ERWB 2VQTA