5DJZB

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
b'GQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzB00
1FFRA 5A2KH 2H45A 5TPWH 1N2RB 1PDKA 2ZUQC 1JGVL 3NN8A 4HULB 3VFPA 2Z8RA 4APQA 1S5IL 1YQVH 3UAJC 1P7QB 3FB5A 5I74C 3FFCD 1H0DA 1S9WA 3MYZA 4MD5A 2BDNH 5ERWB 1T7WA 2BY2A 2ZOLA 5HHVL 5BOZG 3DVGB 3ULVL 4MAYC 3GSUB 4HKJB 4TQEL 1BIIA 1NAKL 2XYCA 3F7VA 5A40E 1FLRH 1BM3H 2AV7B 1EUUA 4P5TC 4OCSH 4WWKD 4X9GA 2ADGA 4LCCC 1HNFA 2EE6A 1U92A 1DBMH 3NIFE 4HS6A 4Y89A 1DVFC 1FIGL 5H94B 4QNPE 1WFNA 4RAVA 5D7KD 1G0YR 2YPLE 4LMQE 4FQXD 3IJSA 1UM5H 4Y19E 2ARJB 2NX5E 3MRBA 4I77L 5CJOL 5DRNB 5KSAC 4ZAKC 3L95B 3PL6B 4WFEE 2KL6A 5CGMA 4PRID 3MJ9L 1AGCB 4F58H 4GSDH 4OBRA 1QFWL 1U8IB 2CIKA 5BV7L 1JK8B 3S35H 2X4NB 2N7AA 7FABL 3BP6A 5DURD 1BOGA 4XNYL 2L4OA 3GRWL 4MS8D 3KYKH 4POZC 5F3HB 1T21B 3SE8H 4JZNB 5CSBA 4FQIL 1MCRA 2C26A 5CFHA 1JGDB 4MNQD 3CSPA 1XGPB 4WW2F 4AMKH 4LIQH 1UM4H 3RPKA 5ENWB 3D2UD 1HQRA 2BOCB 3T0ED 2R15A 3VXME 2JB5L 4LVEA 5JDSA 2YD6A 1SVCP 1A3RL 2IQAB 3DGGB 4ZUTA 3RL2A 2LU3A 2PXYB 4LF3B 4M6NL 3S3JA 2VO5A 3ULVD 2FH6A 1AKJB 1FVEB 5TF0A 1FFNB 4WI4A 2C3VA 2EEAA 3QWRD 1QSFD 2LTQB 3PWLA 4UV7L 5ID1B 1QNZH 4H88L 4OLUH 5I1HH 5MP6H 2ZUUA 1ED3B 1QLEL 1YEEL 4QEGA 1CGUA 4HJ0D 4KMTH 5EC2A 2HRLA 2Y9RT 4G8FA 5D1ZA 4K71C 3QZWB 1EDQA 1SEQL 4DTGL 2BSSA 5IMLA 4LVOC 2J12B 1TVBB 1BP3B 1VA9A 2Q20A 1CDGA 1UWGL 3MRPA 5D1QB 2MCG1 1UG9A 5DI8A 4PGCA 5E6IA 43CAA 4OCYH 1L0QA 5MEPB 3FHQA 1D5ZB 3BZFB 2AEIT 5EA0L 3BO8B 4UMGA 4OV6F 3WBDA 3C5JB 3TPUA 3SDDA 1JNJA 5I66A 1T1YA 4YK4B 4CMMA 5I17B 4N0RA 4WJ5A 2AK4A 4U1GC 4EN3C 1CVSC 3U30B 5KW9H 4X80H 2J4WL 3BQUC 2BDNL 1S8DB 5L7XH 3KPRA 4ONFH 1J8HB 4WI6A 5J1AA 4KQ4H 4XAKE 1LMKA 3B9VA 3NMEA 4Z18A 3MRRA 3BXNA 4MLSA 5DS8A 4PJGA 3V52L 1MLBB 1CQYA 2IFFH 5GSRA 5DR5H 2W9LA 4G6JL 3UTZA 2DMKA 4QHLA 3SDAC 4W4NA 2ZSVB 2IAMD 4R3SA 1JNNH 4ETYA 3TBTB 4YDIL 4RIRA 4LQFH 1DBML 2Y06H 1RZKC 4JG1H 4HMDA 3B3IB 1QFWM 3ARQA 4LOUC 3EBAA 4JFYB 1BFSA 2QLVB 5T1LB 2W60B 3C9NA 3BT2H 5JPNB 4F9PC 4Z7WE 3GBMH 3OG6B 1KC5H 1B90A 2NY1D 5EOTA 4NP4H 3CLFH 1J0KA 3K7UA 3C5ZD 4KJPC 2P8MA 3S35L 1QRND 2CGRH 4JDZB 5IFJB 3H0TB 1OT1A 3B9KD 5GGTA 1J1OL 3OR7A 4LCUB 1U8KB 5HHOA 1K9TA 3KYKL 2Z8VC 3RHWK 4EUPG 4YDKL 1FPTL 3RY4A 5EU6E 3WHE0 4RAUA 1DQMH 3BWAB 3M1BA 4AMKL 1V3LA 4LIQL 5SWZA 4MJ5B 1Y0LB 4QRRB 5CKGA 5F3BB 1G0DA 3BH8B 1CFBA 1QOKA 3VGHA 1X6LA 1A7OH 2VR5A 3QH3B 1V7NH 1U8JB 4JRXB 5IVZB 1OQOA 3C60C 1AR1D 2ZOKB 1H3XA 2DWEA 2UZIH 3DMMA 3QO0A 6FABH 5DD5H 1CGVA 1T4KA 5SX4I 5T3ZD 4Q6YA 2HLAA 1KJ2B 3BIBX 5GS0H 1G7HA 2AJZB 2X1PA 3EGSA 1S7UA 1VACB 3X14B 4ZFOL 2AEPL 2ZJSL 5MP6L 3B9EA 4IHOB 4LVHC 4QRSA 2Y1VA 3SEPA 4PJ7F 4S1DD 1ZLVK 5E2WH 2FGWH 1T5XA 4G80B 1NGYB 4V1DB 3WKNA 5E9DB 1OQXA 1U58A 1X5AA 4EI5C 3TC9A 2YOCA 1N5YL 4RFNB 4UT7H 4OCNC 3ARXA 5HI5C 5J6HA 1M6OA 3MREA 2YRPA 4NQVB 4PRNA 1MJJB 2NW2B 1K3ZA 4YLQT 3C87A 4BQ8A 5I8KH 4N90D 2HRPH 3GM0A 3HMXA 3MJGX 3G04A 4UTAL 2FR4A 3X11A 3HR5A 2EXYC 4OLYH 4HWEL 4IS6A 5ICYB 3KYAA 1N3NB 1CLYH 3VWJB 1B3JA 5E4EC 2P45B 1T2QH 2R23B 4PJ8B 4KROC 3HI5L 3BSZH 5HHQA 4X6FA 1ZV5A 2VR9A 4KK5D 4PGDB 2BXYA 3QPQC 4OB5H 3LD8B 4QWWC 4K9EL 3D2UB 3OJMB 3GSWA 3P4LA 3WCYA 1IAKB 4J3UA 2OTUA 5TQ2L 1ND0B 3RIAK 5DR5L 3TJEH 1IARB 3QCVH 3QI9A 5DZOA 1BVKA 1RVFH 3E8UH 3VWKA 1NFDB 3EOBA 3VXTA 2GKIA 1MRFL 3HAEA 4XP9H 1OLLA 2VUOA 4U6TA 5E00B 1KSRA 2Y06L 5DHYA 1DE4B 5TH2B 5EIVA 3OAZK 3MLZH 3EDFA 5JO5B 1KTLB 1U8MB 4ODSH 3CFJA 1PZ5B 1TCRB 2GFBA 1PKOA 3GGWA 1UJ3A 3HG1A 1S7RB 4S11A 4Z5RA 1S9KC 3LKPA 4J3VA 1KC5L 1P4BL 4NO2A 3CLFL 4KH2A 4L9LA 2VDOH 4BFBD 3EHBC 5J11B 4X8JB 4FFWC 2X89D 4WFHD 3T0AA 4P4KC 1I7ZB 1XF5B 2AXGA 3S97C 5KVGH 3RWCB 5IVOA 5JIPA 5EBLB 2PTTB 3ISWA 3EZ8A 4Y5YB 2BMKB 4Z6AT 3QIUD 1ZHNA 1IT9L 4M93B 4NBYB 4D0BB 1DCLA 2XZAH 3NPSC 3UTPD 4Y16A 1C5DB 1V5JA 2FX8L 4JPIA 3UTOA 3RDTD 4H8WH 5DVOA 4OLEA 3T8XA 5F9OH 4ZPTA 3V5KA 4AY0A 4JHBA 4LP4A 4KZDL 5CD5C 2X4QA 1X5KA 2RR3A 1FYTB 4LASL 4NO0B 5IVXF 7CGTA 3BEWB 3OKEA 1OVZA 5DD5L 4JO2H 3GSQA 5E8EA 5AYQA 2DM4A 1AY1H 5IHZA 3VGAC 2YBRA 5JHLH 2F8OA 4GRWE 5C9JA 4UU9B 1INEL 2ATPA 3B8YA 2C3WA 2AJYL 3BMWA 1OSPH 3HPJB 4TULH 4KKBC 4Y4KA 4NHUB 4X9BA 2WIIB 4G9FA 4U1IA 1RPQA 1RULH 2XQYK 4ZODA 4UT7L 5DEFB 3CVIL 5ELIA 4X5WB 4JFEB 2HJLA 4YBQD 3F65A 2EZ0D 5EH1A 2FBOJ 3I84A 3C6SA 4IBLT 5LGHH 5K9JH 3QISA 5DMJB 2CRYA 3MQIA 4KHXH 3FOMB 2Q7YB 1ZT4A 5E1AB 3BZEB 4OLYL 4PJHA 3ARFC 4UNTA 4DUVA 3LKSB 1NC2A 5IB4A 1D5MB 1WIUA 4WO4D 1T2QL 2DQGH 4KDVA 2G75A 3JUZA 2W65B 5J3HD 3MRFB 1V3JA 3MYJA 1P2CA 1SY6L 4FS0A 3WE6A 5C0FB 5FO8B 2FJHA 2GTZA 4HFUL 2I9TA 2XTJD 4P2QD 4XNMB 2HFFA 5DSCB 3TWCL 4HHAA 2P8LA 4S1SL 5B21A 2R9HD 5I75C 3I6KB 1CTOA 1JHTA 3MV9A 3L3OB 3H6JA 1UQSB 1XMWA 3HZKA 3MRNB 3RWJB 5IG7B 4OZGA 3R0NA 5E8NB 4X6DA 3O9WB 1AGEA 2E5EA 3KPNA 4WY7L 4Z8FL 5KJRL 1QUNA 4H5SB 3WFDH 15C8L 1GYAA 4F7TA 4ZS7L 4ODSL 4JVUA 1EZVX 3RX7A 3MGTB 3CXDH 3QXAB 3QIBC 1DR9A 2NPLX 1CL7H 3P4MA 2VXTL 3UJIL 2AJ3B 4HIIB 2FHBA 1FAIH 5JW4R 4ZSOA 3TBVB 4MSWB 1QVOA 2NMSA 4LSUH 2W92A 5FYKU 4L3EB 4FABH 3D3VA 5DJDA 3FO0L 5GJTL 4B50A 5KVGL 1YJDH 3RQ3A 4JKPH 3H9SA 4JFDA 3C09C 2JKXA 3I2CH 3V79C 3O4LD 4MJIA 4LPUA 2X7LA 4PB9H 3GSNB 3GK8L 5FYJD 4OGYH 2GTWA 1KT2B 3U4EB 1TNNA 1YMMB 3ZT6A 3DVNB 4E5XB 1FO0B 1TQBC 4KV5E 4H0GA 5AG9A 4PJ5D 4HWBA 2R2EB 2FWOA 3SKMB 3H3PL 3FQWB 1OP3K 3PWUB 4ACPA 3FQRA 2Y07H 4DVBA 2AEQH 3T65B 1QSEE 5C0AD 1I8IA 4B53A 3EDKA 3AREA 1Q9LB 1E4KA 3GSRB 4ZS6D 2VLLB 2HTKC 3PWPA 3SDXF 5DHVB 4Q6IC 4U6HA 3KPTA 1LNUB 1U93B 5DQJB 4IRZH 4PJEB 1HOCA 5DRXB 4FQHA 4FP8H 5IW1B 3QWOB 4Q2ZA 1ZHBB 5E0QA 4GMSL 4QKXB 4WWKC 5HY9A 4L4JA 3A6BL 3K8LA 2YPKA 2A6JA 5MERB 4P4RA 2X9XA 1YEHL 2PO6A 1AGFA 3QEUA 4FQXC 3KYMA 3AM8C 2V2WB 1LWRA 3HC0A 4RQQB 1FHGA 3ZMRA 3T0WA 4D3CL 3X3GH 1R3IL 5LGHL 5K9JL 4EN3A 1ZT7A 1ZXQA 1RZ7L 3ORJA 2J8UE 5HDBF 4F2MA 3BQUA 1S7SA 4MS8C 4KI5F 5ETUA 5C0RL 3P30L 4WFGD 3MRKA 3C8KA 1ACZA 1TTFA 3GB7A 5CJQH 3VI4F 5F7UA 1IEBB 2R0ZH 3OAUL 5E5UB 3TFKD 3QDJE 3ARBD 4XNQA 3CFBB 4FXKB 4KDTC 3SDAA 3T0EC 4Y5VC 4ZO7A 3GI9L 1CI5A 4JHZA 2OJZL 3X12A 5H35B 2H9GA 3R06A 1DQLL 1LO5A 2JB6A 1ZAGA 5B38G 3ULVC 5DA4A 4XC3L 3L3JA 3CSYA 5IR1B 5AUMA 1GIGH 1NGZA 5D8JL 4XP5H 3L3IA 3DXAE 1QZ1A 4OUOA 3MLVH 2W0FA 2VLRE 2EDOA 4M5ZL 2GSIA 4HJ0C 3CXDL 1HNGA 3OKLA 3D39D 4XVJH 3QO1A 1CS6A 1NJ9A 4UIKL 1MUJA 3EYOA 4WENB 4IMLB 4E41A 2Z93A 4FABL 4IJ3C 1A6TA 1YJDL 1NMBH 3T08A 5BV7C 3ARVA 1DEEA 4OLWL 1ZKAA 1S7WA 1CE1H 5BVJB 3Q0HA 2EDEA 5GSVB 4OGYL 3NIDF 1EPFA 1B4RA 4ODXA 4IRSA 2EDJA 4UBDD 2UYLB 4R7DB 1RIVH 5EIIB 4W68A 2JELH 5I71B 4N0CD 2Y07L 3TO2A 4LLUA 1KTDB 5ESVA 3M17B 4MD4A 4NQED 4XTRD 4YHPA 2XZCH 1JF1B 2YUWA 3S9DB 5DK0A 5EN2A 4Z77B 4O58H 4FQJH 4Y4HC 1KPUA 4Z7QF 4IRZL 3BP4B 1BZ9B 1HSBA 3HFMH 1WWCA 4FP8L 1E4XL 4M8QA 4U49A 3QEQE 1IMHC 1ZWIB 1G1CA 5TDPA 3H7LA 4Z0XA 1K8IB 3EO0A 5BRZB 1F4YL 1I1YA 3LH2L 1EGJH 1WAAF 5CGTA 5D2NC 4PYGA 1RZFL 1KJMB 1OWWA 4FZEH 4XRCA 3U83A 2H2PD 5DA0B 3D9AL 3VG9C 2P5WB 1DSFL 3HS0A 2EDYA 3K81A 3MLRH 4ODUB 2OJEA 2NY1C 1F02I 1YPZB 5IQ7H 2AGJH 1JV5B 2ICEB 4QRQB 3C5ZC 4OF3A 4PR5A 4R4BA 4WV1C 1WC7A 1QRKA 4AM0B 2P5EA 1VCAA 1OAQL 1H3GA 4GS7B 4PRDA 4P46D 4DGVH 3KS0J 1NLDL 4I0CC 1MJUL 4HKBA 4LRIC 2UWEA 1CLZL 2FZ3B 1Z9OA 4OZHF 4PTUB 1ZEAH 1Q1JH 2E8ZA 3HE7C 3MLYL 3O6MH 1PY4A 4H1LA 3TBWB 2GK0B 1XCQB 1X7QB 1UEYA 4GW4B 2O61A 1UH2A 3IKCB 3TNMB 4PJIA 4BFIB 4M4RA 4MMXC 5IMMA 1VERA 4Q0XH 3OKOB 1QACA 1T3FA 5I18H 5FK9B 2FDBP 2YPLD 2OZ4A 1XF4B 2BVQA 3MLVL 2BZDA 1UA6L 4Y19D 3MFGB 4PGZA 1PX4A 3MBEC 4WFED 4LSVL 4NJ9H 1DLFH 4XVJL 1NEZA 1OCWH 3INUH 4GO6B 1PW3A 4DEPC 2HYMA 3QDAA 1PSKH 1EO5A 1CT8A 1FAKT 1HHJB 3WEXB 4LLMB 2V7HA 4YQXH 3BPOB 5KSBA 1MCFA 2R2HA 1NMBL 5DD0H 5FO7A 4YX2H 4YO0B 1F6AA 5BQ7A 4R90H 1BQLH 4XCCH 2FB4L 3EJJX 3VXMD 1MCDA 2E7MA 5LGKA 1IGFH 3EFFA 4JLRA 2FX9L 1IGIL 4ODBD 5IFHL 1RIVL 2MQCA 5CP7B 4PJ9D 4KRNA 4JY4A 1H9VA 4RNRB 4HUXB 3ZDZF 1LE9A 1OSZA 2ZZUT 4WNQA 3SOBH 4WW2A 4JFFA 4YAQA 3ARBB 1SJXA 5D7JB 3RZCD 1A4JB 1LK3H 4G6KL 5GGQL 1PAMA 3E6HB 4NO5B 4JM2B 2PYEA 3OJDA 2BXZA 4O58L 3IDJA 2VXQL 5CHNA 1M7DB 4JRYB 3HFML 3U9PL 5D1XC 4WI7A 2VAAA 4GRLB 3O3BA 4XCEB 3RTQB 1S7VA 1NCNA 1WISA 3T09A 5C0IB 3IFPA 4M9PA 1P1ZB 2Z8WC 4FZEL 3LKNA 5AD0A 1IAII 1O7VA 2BK8A 1KJ2H 2DIJA 5CSGA 1VFOA 4QY8B 2GAZB 5CZKA 3GMNB 1TQCB 4MCZA 5F7FA 2FSEB 4XP6H 2AGJL 2FJFA 4X7DC 5FA3B 4ONGH 2VZ1A 3TBYA 1N0XH 1RZIA 1CF8L 2A77H 2AAVA 4YGVA 5GGRA 3P4NB 3SKOA 3OGCA 3VXRB 1AIFB 1B0RA 3GMLA 1IAOA 1WTLA 1CDCA 5D7LB 4FA8A 1JRHI 3SCMC 2OTWA 3QIUC 1TDQA 4XAKD 2YZ1A 4GW1B 1F3JB 4OLZH 4UT6H 3PQYE 1MQKH 3G6AA 2GJZA 4WGVB 3RDTC 3O6ML 3EO1A 3HCVB 4NM8H 4X6EA 1A1NB 3ROLB 1ONQA 3QUXD 4FZ8H 4K9EC 1II4E 2Z8SA 4ODWA 4YFLF 3UBXG 1C8PA 1JN6A 4XHQA 4M6OH 3VH8G 3QIBA 4LHUA 2P42B 5J8OA 1NC4D 5D7SH 4KI5C 4Q0XL 1GZQA 2NXZD 1J05B 1OGTA 3Q2CA 5C07E 5I18L 1UWEH 1CGSH 3MA7A 5IB5A 5SWQB 5D2LB 4MA3B 3WNLA 3BP7B 3NH7L 1EFXD 1TIUA 5E94A 2G60L 1AD9B 1YYMH 2MMXA 5I1GH 4ZMAT 1GGCH 3ZE0F 4KFZC 3HI1A 3WFBH 5SX4H 4ETQA 5EU6D 4JO3H 1A22B 2EZ0C 1SJVA 1TTUA 4YX2L 4HF5H 1EEZA 5I1DA 1T6WA 5I8OL 3MUGB 1ZGLB 1U2CA 3VXSB 3UTQB 3PF2A 1R5IA 3SKJH 1JZ2A 1AQKH 3HZVB 4LNRA 5B38A 2O93L 1BHGA 1AJ7H 3QUMA 4XGZB 4XI5D 3U6RB 2NY4B 4TUOB 2EKSA 4Q6IA 1U8QA 4D9QE 2OS7A 2PW2B 4FQQB 4NUGH 3IFOA 1MVFA 2VDRL 4UQ2B 4ELME 2R9HC 4HWZB 2H3NA 3P9LA 5CBAA 3O41A 1PG7L 4GBXC 3T0BA 4DGIH 3V6ZB 3AM8A 4P5KB 4LNVA 4P3WA 3T2OA 5C8JB 4M6AA 3D85D 3QUKA 2WQ8A 1Z3GH 5I8EB 5KS9B 2R0WL 1OB1A 1MHEA 3TN0D 5DD1H 3NFPB 1R24A 5EU3A 2A6KB 5EFIB 4MA7H 5CCKL 2NX5B 1KJ2L 1KN4H 3V7AE 2QADB 1FRGH 2H8PA 8CGTA 3QEHB 4PJFE 5L2KB 4UDUB 3BKCH 6CGTA 1BD2B 1XF1A 3OKNA 4JN1H 4U7MA 3CGTA 2A74A 4C83B 4ONHA 4KDTA 3EYSH 5E5MA 2FATL 1G6RB 1T1WA 3QNXA 1CGYA 3PP3K 5BS0B 5IOPA 1FNEB 2PN5A 3AMLA 3OXRA 1YN7B 1C5CL 4OIBA 2NLJA 4U1LA 2C1OA 2NYYC 2ICWA 4PRBA 2ADJA 3V6FB 3QDHA 2N4IA 1MQKL 5C0BA 4CMHB 1Z5LB 2BC4B 3MFFA 3MNVA 1P84J 1NUDA 1NMCB 4FZ8L 5TDOA 1OY3B 3PP4H 4HXBH 1KB5H 4NM4L 5DJ8B 3WKML 1BQSA 1QEWA 2BNRE 1YDPB 1I3RA 2XNAA 3CXHJ 2AXFB 1NLBH 1ZHLB 3MRIB 4M6OL 4UOJA 1MCOH 1FC1A 1P69B 4ZS6C 3CLEL 1EXUA 4NRZB 4LLWB 1TZIA 5EORH 2DYPD 1EJ6A 2GITB 4LLAA 4OQTL 5EZOL 4JGMA 3IU4H 1VKXB 1I85C 1YEKH 4WRLA 1YY9C 1NSNH 2QHLA 4JFPB 3VE0A 2NXYB 1EX0A 1DN0A 4LSPL 5I1GL 4OV5A 4BH7B 5I15H 3QNYA 4LAQL 3PHOA 5DRWA 5IM7B 4TNVF 4LCIH 3GRWA 3LN9A 1BX2A 5HI4D 3H7BA 1QLFB 3QQNA 1PQZB 3MO1B 2VZSA 4NCC2 4JO3L 4RGMC 5L9DH 2DLGA 5T3ZH 4M1DL 1N7MH 3U4BL 5JUEH 3NTCH 1N6VA 2GJ6B 3JV0A 4FMFA 3I75B 3MBXH 2CRMA 3FQTA 3RWHA 3RGVD 2UV3A 4ZQKA 2X4TB 1OAYL 5IGXH 5HHNA 4XWOD 3O3EB 1AJ7L 2CJUL 5MHSE 4J2XA 5F7DA 2E9BA 4QOKA 5ESAB 4Y4HA 5F6HI 4NCDA 4NUGL 4GRMB 1FFPB 1CICA 5A3IC 2W91A 3QCUH 3KXFD 3NAAH 1NL0L 2Z4QA 3JTTB 2FJGA 1DBKL 4JHWL 4X99A 1AC0A 4YBLB 4IOIA 1PLGH 1ZA6B 4JVWA 4LKXB 5IVXA 5DZNA 4DGIL 3O8XD 4AH2A 3GSNH 3CSBA 4MZ3A 2YSSB 1QSZA 2VXVL 3BD5A 4AEHH 4XXDB 3T1FA 1JFQL 1AXIB 2HH0H 2VZUA 5HHPA 1FO0H 1UWXK 4Z78A 3RUGE 3F7PC 4F7EB 3UDWA 2G2RB 4NWUL 4QRPE 4LQ1A 4Z7WB 2VLKB 4YUEH 5FDWA 2I9LA 4GUPB 1KN4L 5F7YC 2F58H 4M00A 1BPVA 1FRGL 2MHAA 3DUUA 1V7ML 5K9QI 1TPXC 5J12C 4U1KA 4OIAA 2G5RA 1DQJA 5FYLH 4JN1L 4YC2B 4F15B 5DHVH 4N8VG 5E8PB 3VD7A 1HXMA 2DJUA 3HNTH 4HIJA 4NO3A 1INQB 2GW5A 3HE7A 4D0CB 4IIQB 1R3KA 5T5NF 3STZA 1D5IH 5K9KB 3LHPH 2H41A 4MHHG 1TCMA 1UJTA 3LOWA 3OQ3B 4G9DA 5KSVB 2QQQA 4O02L 4KKNA 3O4OC 4MJ2A 1BWWA 4UBDC 1YUHB 3X13B 1AGBB 3LN5B 4MDIB 3PP4L 4HXBL 5JLZA 4N0CC 1JNLL 1HH9B 3RL1B 4MDJA 1NLBL 4U0QB 3TPKA 4ZTPL 2AK1L 3WXWL 1MLCA 3G08B 3V0WH 3MLXH 3V6OC 3SBWC 4PG2A 5FM5O 4YNYB 3AXLA 1A0QH 1B6UA 3FAWA 3KPQB 3R0MA 3MRJB 5ACZB 2XWTA 1JGEB 2GK2A 1GOGA 3PV6B 1R3LA 3Q5TA 2A9MH 4WI9A 3FO9A 1FH5L 3KPRE 2JIXD 5I1CL 1OOAA 3IU4L 1VEMA 3MV11 3NZ8B 3TT1L 1NSNL 5CMAB 3QG6B 4PJGE 2X44D 3CMGA 4WU7A 3SJVA 2H2SD 3MA9H 5TE6L 1GGIH 3TV3H 4DOHB 2H2PC 1I1AD 4F37K 2CLZB 5ALCL 1BQHG 1P9MC 3DX8B 1EV2E 5CIPB 4DCQA 3ILPA 1JPTH 1L4IA 1N7ML 1JVKA 3GO1H 3NTCL 1KXTB 1YNTB 3MBXL 3BWUC 4PLOB 5D6CA 3WFHA 3VFNB 3WNKA 1FV1A 5H2BA 2Z31B 2WWMC 3L6FA 2FGZA 4DW2H 1HHGB 2H1PH 2F54A 4LLVB 3TM6A 1K85A 3EYVA 2AVGA 2NR6C 3VFVB 3IJYA 1BEYH 1A9EA 3LKRB 4WEBH 3VGDA 3HUJB 4AL8H 3WJLC 1WFOA 2OYPA 3MODH 1AGDB 5C92A 3VGGA 3MRGA 1W72L 5HHOE 1S7XA 1C7SA 1FGVH 4ZFOA 3NAAL 3MJ8A 2SEBA 5SWZE 4AJ0A 4G6FB 2QHRH 4UAOB 3RIFF 3MXVL 4DKEH 3B2UD 1QBMH 4N1CA 5CBEB 2BCKA 2LE9A 1IQDA 1NGPH 4OF8A 3LKOA 4RBPK 4TUKH 4WHTA 3SDXA 3QUYD 3SE9L 1FO0L 1FG2B 1M7IA 4K3DH 2C3GA 1IGTB 2AABL 5IBUB 4BH8A 1E28B 5C09E 4YUEL 2E8YA 4K94H 1T2XA 2F58L 4QT5A 1T22A 5F6HJ 2QSCH 2VDNH 2VQ1A 5FYLL 1UADC 3U9UB 5D93C 1C1EL 3GJFA 5B4MC 3SCMA 4MWFA 3MRHA 1D5XB 2PF6A 2XY1A 4NC1C 1IC4L 3QDJD 3CUPB 1I3GH 3KLAA 1J18A 4RWHA 4YFEA 4Q7DA 5IMOA 3RI5F 1BLNB 4OF7A 4P5MA 1U3HB 3OX8B 1F11B 5LXGH 3ARDB 1NBYB 2FYYB 2YHGA 3I6LE 3VXOA 1FZKA 1BFOA 4PJ9C 3OZ9H 4NQTA 2XKSA 5EUOE 2R1YA 3DXAD 3MRDB 3RZCC 4BELD 5JMOC 3BKYH 1CFSA 4Z7NE 5HGHA 4P99A 2CIIB 2VLRD 4HJGB 3P77B 3IJHB 2JJSC 4YDVA 2KH2B 2G5BA 4HIHA 5KG9A 2VITA 5KBNC 5TQ0H 4L8DB 2V2XB 5JORB 1JUFA 3IVKA 4JFZH 4KJWC 1J0IA 5FYJH 1IKNA 4WUUB 1P7HL 1RHHB 5GHWL 1CBVH 3WS6C 3FONB 1JZ7A 2QSTA 2VIRA 3QDGA 3TV3L 3WFCH 1T0MB 3CVHL 2C4FT 2F19L 3OR6A 3LS4H 1XGTA 1JPTL 5MENA 5J13C 2ZCLL 5KZCD 3CZFA 4PJXA 4YH6A 4LSTL 4PREA 3BVNA 1PY9A 3IETA 4MD0B 3TNNB 4OZIE 1QFUL 3HG1E 4LCWA 1YNKL 2H1PL 1NUFA 4PV9B 4G3YL 4WHCA 4BQBA 4PGEB 3OAYK 3G9AB 2NY5L 4MNHB 3P9MA 4KJQC 4WEBL 3FT2B 2O5YH 1CXLA 4FQLL 4AL8L 4GBXA 1NGWB 5DEZA 3PXHA 4BSVB 3RVXD 5EZLA 3F7YA 1MOEA 1DEDA 3VRIB 2R4RH 4F7TB 4X6CA 5F21B 3K3QA 3QUXC 3LPGA 1AO7D 4K3EH 4HLJA 4X7EC 1CDUA 3QEQD 2QHRL 3C8DA 5DLML 4DKEL 1QBML 2X4RB 4PRHA 5F9AC 2CDEB 1RZ8A 1H3WM 4ODHH 2NXZC 1B4JH 2CXGA 3Q6GL 4TUKL 5DFWH 4EIGB 2VL4A 5DQ9B 3RWDA 3GSXA 1E4WH 5FGCE 3O2DH 1WSST 4W6YB 4XVSL 3SGJC 5BMFL 3MSPA 4X0KA 4K94L 4LEXH 4Y5XB 3OG4B 3Q3GA 4KVNL 4O2CA 2VDNL 3IAPA 3ETBF 5I1LA 3ULUL 1A1OA 5ADPH 1CN4A 5C0DB 5FYJU 4FFVD 4JPVH 1MFCH 3D1MC 5IIEB 3FB7B 4G9FE 1I3GL 3UROR 5T1KD 3Q1SH 5F88A 5GRJH 1TVHA 1W0VA 3U46A 2VLMD 5FEBA 2ILLA 3CH1B 3CFKA 4XH2B 5DQDH 3GIZH 1MCEA 5LXGL 5ESQA 3ECBB 4IDLA 1J5OH 4XI5C 3OZ9L 4P0DA 4FNLL 3IDYC 3TO4D 1QSEB 5D1QC 3MC0A 3NCJH 2GHWB 1B2WL 2ESVA 3DV4B 4OZHA 4XCNB 3TA3D 5HYJD 1Q9WB 4NN6C 2X05A 3HE6B 1MWAB 1I85A 4CVUA 3CDYA 4OGXH 1RUKH 1CK0L 2FRGP 3JWDL 4PIRF 4M61A 2GCYB 2OK0H 2VRAA 5E7FA 5TQ0L 4ZXBA 3MX0A 4GAGH 5IMKA 3T2NL 3V9FA 3RVVD 3STLA 4X7TA 1MEXL 2XWBB 4N8VA 3B6SB 3BW9A 3MV9E 3NIGE 4HBCH 3IS0X 1A02N 1FJ1A 2WQRA 5SWSD 1CXEA 4OZGE 4X6DE 4AIOA 2XQBH 3VDBA 2BVOA 4YEFA 3ULUD 2BSTB 3FB6A 3O6FB 3LS4L 1DBJL 1XR8A 3EJYD 1N59B 5J7CC 4WWID 1AHWA 3C6LA 1HH6B 2IADA 1F5WA 1GZPA 3IB4A 3RVTC 2VDLH 5CP3H 5JHDA 1I75A 1FQ9C 3LRSB 3TVMB 3WXVH 4CW1A 3PIQB 2FHCA 5LAXA 4XB8A 5HYSA 4HUWB 4XNXL 4QYOB 5B8CC 2VL5B 1H15B 4ZSOE 1G7PB 4Y88A 5C86A 1PKQE 1JWMA 5FYKE 5I19H 3VD5A 4N0UB 1NFIA 4PJCF 3FHAA 4G8GA 1ORSA 1IGJA 1NAMB 1CU4L 1IAIH 2CO6B 3H9SE 4JFDE 4LGRB 4NIKB 2F53B 1OD7A 2YUXA 4I3SL 4MJIE 4NRXA 5BO1H 3DO7A 1ZHKB 4RMSA 4U31A 2P8PA 5FA4A 1RD6A 5JW5A 5DMGC 4ZYKA 3I9GL 5E03A 2WIMA 1WICA 4HIEA 2HLFC 3L5WB 4C58B 3MV7A 3QUZB 4ODHL 4PRPA 3ARRA 1B4JL 4ZDHB 5HHME 3W9DB 1U8OB 1J11A 4PJEF 4HS3B 3MNWB 1CZ8H 1FCCA 1AD0A 4HGKC 4D9RE 3KPOB 1RZGB 5H37H 4N68A 2JE8A 2OM5A 3PWPE 4HUMB 3ES6B 4PLJD 1K4DB 2ZUVA 1ZS8A 2EYTB 4QXUH 1XIWB 4LARH 5E24E 3BZ4B 5EPMA 1QKZH 1LD9B 1MCWW 2CO7B 1F4XH 2I24N 4NN7B 1RSFA 4GOSA 1F2QA 4JPKH 2E6PA 3FQNB 2NW3A 5HVFB 4OCLC 1A3LL 3CCHA 3L5XL 5C0CA 2BRRH 4GAYA 1I9JH 3HMWL 1OWRM 1K5NA 3LV3B 1OM3H 3LAFA 1CDJA 4FMKA 5DQDL 1KXVC 1B0WA 3PNWA 4XWOC 2AJSH 4X4XB 5F6IB 5EO0A 3RWEB 4RMUA 1J5OL 4I2XB 4HX1B 2XN9A 1CFQA 1KYOK 4RFNC 3VI3E 4U4BA 1TETL 4OLXL 1T1ZB 2EDHA 3GMOA 3NCJL 3CX5J 5TE4L 5C07D 3UTTB 2YPVL 1O7SA 5KN5B 2ENYA 2NY6D 1XGRB 5IW6A 1M1SA 2A6DA 1G6RH 2HJKB 4OFYD 1E0OB 3GHEH 3GMPA 1A6VL 3ZKMD 2HVJA 1L7IL 1RFDL 3QDMA 2P7TB 3VWJC 3DO3A 4U2YA 5CZXD 5BZWB 3IDGA 4R2GB 4Z0BL 1P9MA 3OPZH 5EO9B 4P3DA 2NY2D 3MUJA 1QFOA 3DPBA 5GGSA 2ICCA 3AU1B 4J12A 3LD8C 5F9JA 3TF7C 5GS2D 1AE6H 3RWGA 3PHQB 3EOTL 4TVPH 1A4KB 4HKZB 5CSZB 5ANMB 4QHKI 2HVKB 3BIKA 3NACH 5F1IA 4HK0A 4OUUA 1S78D 4EVNA 3ARPA 4YDJB 2KUTA 1NGXA 3W0WA 1RK1A 1A2YB 3THML 4X7SL 5IJVB 3WJLA 5FF6A 4NZUL 1ZVSA 3WXVL 4KK9C 1JHKL 1RUQH 3MZGB 4D9QD 5T1DH 1W2KT 4Q74A 3T3PE 2GT9A 3QFDA 3M45A 2EIBA 3C08H 4IRJA 4NNYA 2R0LH 4E41E 3DRTB 1KLGA 4NYLA 3SE3A 3BMVA 4RWYL 2BNUA 1WWBX 4P57A 1IAIL 1MFAL 4QHMB 5SV4A 1AFVL 3L3GA 1MCPH 4XBGB 1TZGL 3D69A 4LSQH 2XWJA 3RPIA 2B7DT 2W0LA 3MLTB 3R1GL 2XG4A 1Q72L 3KLSA 3TA3B 5IEHA 3W11C 1UZ8A 2R29H 3BUYA 4U1SA 4XMLH 2EECA 4HV8A 5J6GA 1JRHL 3WS3A 3UJTL 4PBWD 1HQ4B 5ICXB 5I1EH 3JBG7 1SMAA 2BOBA 3BEVA 3BPCA 3KAAA 4GXVH 3SE4C 4FQ2H 1P4IL 4KTEH 1AXTH 2W9DH 3KDMB 5J9PB 2DQJH 2Y25A 1AXSB 2H2SC 1XR9A 5KVDL 3TBSB 5BOPA 1EFQA 3KYOB 1I1AC 1MI5A 3JVGA 4LHJB 3IDIA 1T04B 1IM9A 2J88H 1YPZF 1F58L 1WF5A 5AYUL 4QF1A 1U9KA 2DQUH 4NKQB 5JXEC 1QTYT 5HYFA 1HXYB 3U7AA 4HKXA 4JZOA 1JZ3A 3BE1H 1OM3L 1DUYB 5KVMC 3MRMA 4RGNE 2AJSL 3MR9A 4N8CL 3H8NA 2BNRD 4LL9A 3WL9A 4X4YB 1I8MA 3CFDA 5FXCH 1FNGA 5BXFB 1CFNB 4KU1A 2EICA 2ZSWB 2FCBA 4R4ND 4M7LL 3EYFB 1N2RA 2CKBB 2IANB 4APQD 2EC9T 2P47B 1ERNA 3M8OL 1D9KC 2DLEA 1IZJA 1YN6B 1H3VA 5IFAL 1P7QA 3T2PA 3ALPA 4M43H 2UWEE 1I8KB 1FIEA 4PTTB 5ERWA 1FSKB 3IDNB 1OGAB 1XGQB 3B2UC 3RAJH 3VFSB 3DVGA 2CLVB 3GSUA 3LVEA 4HKJA 3NZHH 3WO4B 4M1GH 4KQ3H 4M7KL 3WNOA 3S34L 2YMXL 3T3ME 1KENH 1ZLVH 3LPWA 1MRDL 2AV7A 4PJIE 2XKNB 2IPKB 4TSAH 2FO1A 3FQXB 3P0GB 4XVUD 5CINH 1K2DB 1KTKE 1RUMH 1UH4A 2JJTC 5F9WC 5DDHB 5H94A 1J1XH 4GFTB 2B1HH 5DUPH 3O9WC 1X4YA 2ARJA 5DRNA 5MHSD 3ELAT 3ZYJA 1A6UH 3L95A 3RBSA 1IAIM 2GEEA 3PL6A 3RWFB 1RUQL 3F5WB 4NBZB 1AGCA 4TPRL 1CXHA 1U8IA 4KUZL 4L4VE 3ZTNH 1JK8A 1UYWL 2X4NA 2VLJB 3C08L 3PDDA 1ZGLM 4M4PA 4HS8H 3L3DB 1J7VR 3QIWB 3PQYB 3ABZA 3I50H 3S36X 5F70A 4LLDB 5F3HA 5KSBE 1T21A 2OTPA 4JZNA 3CDGB 1JGDA 1F97A 3ARZA 3E6FB 5CIPH 1MCPL 3CFCH 1XGPA 4TSCL 4LSQL 4JJ5B 5ENWA 2C7UB 4QHKJ 1D6VH 5IWLC 2BOCA 5DWUL 3RY6C 4JM2F 2IQAA 1EGJA 3DGGA 4JREB 2PXYA 4LF3A 1MAJA 5MEQB 1K8DB 4A6YB 3VXUB 3MRLB 2OQJB 2R29L 2DD8L 3U1SH 5J1TC 3DI3B 4LSSL 1AKJA 1FVEA 4CU6A 1FZOB 5DC0A 1FFNA 2W38A 4LVNB 5I1EL 2VABB 3UEZA 3BP5B 4AIXA 1TXKA 4OCXL 5ID1A 3MLUH 4ISVB 3D5OF 4KTEL 2XZZA 1ED3A 4PG9B 5D1ZD 3DVIA 3DYMA 2WUCL 2DI8A 3LQZB 5EO1B 3QZWA 2J88L 4NNPL 4HUVB 4JB9H 3ZHKA 1HEZB 5LWYH 1TVBA 3OWEA 1KEMH 4OJFH 5DJ0B 4GW5B 3BE1L 5IBTH 3MOBH 5D1QA 1QO3B 4N5UA 5GGTL 3KPMB 2HFEB 1G9EA 3QJHB 3G6JB 5MEPA 2W0PA 1D5ZA 3BZFA 1LDSA 1NMAL 2BVUA 3BO8A 3SDDD 1Q8MA 3H9ZA 3LRGA 3U0PB 3BPNB 3C5JA 3V5HB 3WIIH 3EO9L 4JO1H 4H25B 2AK4D 3O45B 4ELKB 4PY7B 4WW1B 5I17A 1MHHB 2Y36L 4P2RE 3MUHL 3KPRD 4IMKC 4TTDC 3ZKXB 2XXMB 1S8DA 4PJ7B 3RAJL 4HZAA 5TDNB 1J8HA 5GGVL 1A7QH 2X1XR 1CD9B 4Q9BA 4C56B 1MLBA 1I9RH 1XGUB 2IFGA 4FTVB 1FYHB 1KENL 3VGEA 2ZSVA 4G42B 3RNKB 1DBBH 3TBTA 4RRPG 4TSAL 2R1WB 1KJVB 1MJ7H 3ARWA 3TEUA 2APXA 1DBAH 3B3IA 1RUML 4YJZL 4PJFB 1Y6KR 4JFYA 2Q3AA 3QXDB 1UZ6E 2PTVA 4AIZB 5INDB 5T1LA 2W60A 5JPNA 4P23B 5KOMC 2GQHA 5T33H 3LEXB 4FFVC 2DBLH 5JPMB 4UUJB 1C12B 4M7ZB 1FZMB 5GGUB 4JDZA 5HHOD 3HMXL 5IFJA 2WBJB 4ZTOL 3H0TA 1SYVB 4LCUA 1IGML 3I50L 1U8KA 5D71H 5CGYD 2NY5C 3QQ9C 5IHUL 4K2UH 5SWZD 3VFWB 5D5MB 3V0VB 3WUZA 3BWAA 3N1PC 4HAGA 3LEYL 4C57C 4JO4L 4MJ5A 1Y0LA 1ADQH 2IMNA 3ALWA 2RQ8A 4QRRA 5F3BA 1D6VL 3BH8A 5CEZH 1YEFH 3QPXL 3QH3A 1U8JA 4JRXA 2NNAB 5IVZA 1ZT1B 2EYRB 3DMMD 1HINL 2ZOKA 5E2UH 2YWZA 3NCMA 3BN3B 3S98A 3FT3B 3OB0K 5IK3B 1KJ2A 1MNUL 3MOQA 2AJZA 2UVEA 4EXPX 5AWNL 1OHQA 1VACA 5CD3B 3NBNA 4U7KA 4QNPF 3RVVC 3X14A 5KS9F 5I71C 1D5BB 2H26B 1WCBB 1SJEB 4IHOA 3BYTA 4K94C 1T1XB 2LAGB 2CMRH 2ZP0T 1U95B 3AY4A 1DQQB 1BVLB 3ULUC 3HNVL 3PGFL 4G80A 3EJYC 1NGYA 4V1DA 4JB9L 2XOTA 2DMBA 2YA1A 5E9DA 5LWYL 3WSQH 4OJFL 2XZQL 5IBTL 2A83B 3MOBL 3I3BA 3I6LD 4NQVA 1MJJA 4JZJB 4KUCD 4DKFH 5GZOD 2NW2A 3DV6B 4MNQE 2JLLA 4BK5A 4WFFE 5ICYA 3WIIL 1N3NA 3VWJA 1NDGA 2R23A 4PJ8A 1OP3H 3S5LB 4ONOA 1GGYA 1G7LB 3WUWB 1WZ1H 4JVPA 4PGDA 5B39G 3ULVE 2B1AL 4GS7C 3D2UA 5C0BE 2WNGA 1BOYA 1IAKA 4JFQB 3JWDC 2D7TL 4GMTL 3QI9D 1ND0A 4U2ZA 4X98B 3RUGB 3VWKD 3MACL 4GKZB 3SGKC 3F7RA 4QRPB 4P9HL 1NFDA 4YZFE 5DJXB 5FM5M 3QRGH 1YYLH 1FVDA 5E00A 5ITBH 3DWTA 1DE4A 5TH2A 5ECJE 5JO5A 3LZFH 1KTLA 1U8MA 3HG1D 4OZFH 5E70A 1PZ5A 1TCRA 3BGMB 3I02B 4XBPB 5L2JB 2BERA 4NKDB 1KCVH 4U1NB 1NGQH 1S7RA 5I8CB 2DBLL 2RFXB 4HUUB 1X5YA 1J0YA 3MLWH 5TF1L 4DVRH 4X8JA 1JPSL 3BGAA 1I7ZA 1XF5A 3GUTB 3D0VB 3RWCA 4ZO8A 5EBLA 2PTTA 2V9RA 1LDPL 5CJ8A 4Y5YA 2OXHA 2BMKA 5ADOL 3DX9B 4Y16D 2XFXB 1ADQL 1EHLH 3MOAL 4D0BA 4Q9RL 1C5DA 1NPUA 1UM6L 1J1PH 3NABH 3WN5B 3V4UH 1QR4A 4LP5A 2IH1B 5E2UL 2VQTA 5EU5B 5LCVL 2Y7QB 1FYTA 4NO0A 2UY6A 3BEWA 4QOKE 1GOHA 2EXWC 3DTXB 4TUJB 4JQIL 1YA5A 2AP2A 5CZXC 5D72H 4LRNH 2X1OA 5IQ9B 4UU9A 4XPGH 3RHWF 1NAMH 2R0KH 2A9NH 1PX3A 5IVXE 3V95A 5JXEA 3BIAX 1UT9A 4Z7WF 4MNGB 1FC2D 5D7JC 4J7RA 1A7NH 4OD3L 3HPJA 2WW8A 4G9FD 5EU7C 5IJKC 3LN4B 1S3KH 4NHUA 3D87B 5C08B 1RIHH 5DFVC 1G6VK 2WIIA 5JNYB 1UC6A 3SQOL 1S78C 4LKCB 1MIEH 3VCLB 3WSQL 4KK8D 1NDMB 5HGDB 5DEFA 3RVWC 5J56B 4GKNB 3RTQC 4X5WA 4JFEA 5DVLA 4POYA 3G5ZB 3CU7A 5EOQH 4BZ2L 1TFHA 1NC2D 3FOMA 4PLKC 4H20H 2Q7YA 1HZHH 3IDMB 3PWNB 4HUKB 5E1AA 3BZEA 1E6JH 3LKSA 5FHAH 2BFVL 4JE4B 1D5MA 1S7TB 4IOSD 1ITBB 2W07A 1HKFA 3VFTB 1TQCC 3DIFB 2WINB 3SDCB 2W65A 3MRFA 5DO2D 1UVQB 3IAGC 1AQDB 4P2OB 4S0TD 5C0FA 5FO8A 2VDML 4XNMA 5DSCA 3MRCB 1DLHB 4M7JH 5I0DA 2R8SL 3MV9D 3EKCA 1DVFD 4YHYB 3I6KA 5L8JB 2ORBH 5DUBB 3EIFA 3L3OA 2JJTA 1UQSA 3RWJA 3MRNA 3W81A 4RX4A 5IG7A 1YEDB 2FX7L 4FFZL 5C09B 5E8NA 4KRPB 3O9WA 5B3JE 1YYLL 1BFVH 1D3CA 3MGAA 2WWKT 4JG0H 5D7IE 4MA1B 3UTSB 4H5SA 1MWAL 4Y4FB 3UX9B 5IKCB 2AQ2A 3MGTA 5KVEL 3QXAA 3SO3B 3JV6B 2XKUA 4POZD 2AJ3A 5DJYB 4HIIA 2EYSB 4JKWA 1INDH 3AS3A 3TBVA 1I8LC 3D3VD 4MSWA 2YN5A 4N90E 3SJVE 3VA2C 4DVRL 4Y7MA 3QHFH 4L3EA 4ZFGH 1GVIA 5IWLA 3H9SD 4JFDD 1VFUA 4HXAL 4TOYH 4KTDH 1A1MB 4MJID 1IL1B 4LIQE 4QHUB 2H32B 1PD6A 3RNQB 3HUJF 4XP1L 3GSNA 5EUOB 3L1OH 4CJ0A 1KT2A 3U4EA 5FKPB 1YMMA 3EFDH 1WEJH 4APQC 3DVNA 4E5XA 1FO0A 2C4FU 3ARUA 2F54E 3RX8A 3PJSB 3RRQA 2R2EA 3CNKA 4D9RD 3SKMA 5EC1B 3FQWA 2DLHA 3PWUA 3WJJA 2B4CH 3ARED 3T65A 1YECH 2YD5A 3PWPD 1JYVA 1Q9LA 3T0DA 5BJTB 3GSRA 2VLLA 2IEPA 1OP5K 1LK2B 5KANI 5DHVA 2J5LC 1S9YB 4XPGL 3V7AG 1VADB 1NAML 1LNUA 2R0KL 1U91B 1JTOA 3H3KA 1U93A 3FRPG 5DQJA 4PJEA 5DRXA 5IW1A 3QWOA 1VFAB 1A7NL 1ZHBA 1C7TA 4XVUC 4Y2DB 1JGLH 2PO6D 5MERA 2BVEA 4U6VH 3SDXE 5E1HB 4OKDA 5BVPH 4OTXL 4ZO9A 1BZ7B 1UKTA 3P2TA 4BKLB 4OZIB 3VRJB 2AXJA 2V2WA 5MEOB 2WUBH 3DETD 4WFHE 4RQQA 4EN3D 1R5WB 2R4SH 1R0AL 3H42H 2DLFH 3BQUD 4IMKA 3LEVL 1ZLUK 5F7HA 1AR2A 3EYQD 1IEBA 5T5FH 3SDAD 2FD6H 1RU9L 3CFBA 2QKIB 4FXKA 4M7JL 3K0WA 4LOUD 5F1SA 3GJFK 5H35A 3AUVA 4KI5E 5I1LB 5JIIA 2MFNA 1VEOA 3VD3A 2F5BL 5FGCB 2YZ8A 4EDWL 3FCTB 1KN2L 1JHLL 3ZO0A 1BF2A 5IR1A 4CMHC 3SDYH 1BFVL 2GIYA 4PJBE 4BFEA 4JG0L 2CUIA 2CKBH 1WZKA 1ORQB 4KJPD 4UQ3B 3ARGB 4RDQG 1JI1A 1VSCA 5EWIL 4N1EA 4Z7VB 5D1ZC 5T3XH 4NJAL 1NCBH 1FDLL 2DM7A 3S3PA 3UZEA 1H5BB 4P3CL 4D8PB 4E41D 2XV6B 4HPOH 2BJMH 4OM0H 4IMLA 3QXTA 1FL6B 5E6IC 3QHFL 4K23H 4ZFGL 3N85L 4U3HA 4WVRA 2DQEH 2PCPB 1OTSD 4TOYL 2ZUQB 4RCAA 1BBDH 2H6PB 2FH8A 1EAPB 4YHLH 4PJXE 1E27B 3SDDC 5BVJA 1GC1H 4IRSD 4AENB 5GSVA 1LP9B 4W6WB 2KZ1B 5HI3D 3EFDL 1WEJL 4LCWE 4CN4A 2UYLA 4KGLA 4MAYB 4R7DA 5EIIA 3WFEL 3OKDB 1IZKA 2ZCKH 3C2SA 1VDGA 4MXWH 1YECL 5J89A 3U0WH 4HT1L 1KTDA 3PGDB 4FQPA 4P5TB 3M17A 2B8OT 3RFZC 1JF1A 4LCCB 2V5TA 2DIBA 4Z77A 2Q6WB 5FO9B 1DVFB 2O5ZL 4X6CE 4XPBH 1GPOL 1BGXL 1U8HB 3BP4A 5HI5D 4U3XA 1BZ9A 4JEGB 4UTBL 1ZWIA 4PRHE 5KSAB 4HCRH 4MVBD 4ZAKB 1MCWM 3BDYH 4M48H 1K8IA 3D25B 5BRZA 2HKFH 4S10A 4YBLC 4ZOEA 1A5FL 1E4JA 4J4PA 4MJ6B 1KJMA 1WZLA 4A6YH 4Z7QE 3LS5H 4RGND 4CL7A 2P5WA 2C1PB 2WUBL 4HIXH 3TZVB 4KROD 2QQNL 4QXGL 4ODUA 5FCUH 3B2VH 3HHRB 1YPZA 1JV5A 2ICEA 3H42L 3PABB 4QRQA 4YWGH 5DMYA 1ZVHA 3FJTA 1QLRB 1PKQB 4B7LA 3I85A 3DYOA 4AM0A 1MRCH 2F5AL 4CDGC 5E2VL 3ZTJG 4KV5F 3WIFB 5DJ2B 4NQDE 3NCFB 1UB5B 3OMZA 2FD6L 3WNMA 3HB3C 2FZ3A 4PTUA 4J8RB 2OR8A 3DGCR 4XP4H 4WTWA 3HC3L 4U0RC 4H26B 2A6IB 3AVEA 4G6MH 4IIQC 3TBWA 2GK0A 3DMMC 5HHMB 3B83A 1XCQA 1X7QA 1RMFH 1RJYB 4NQCB 2AJVL 1ZLSH 4GW4A 1KB9J 3WNPA 4XMKH 3DSFH 3IKCA 5DMKB 3TNMA 4BFIA 5JDJA 2ESVE 3NCCB 4OZHE 4QGTA 1QFHA 3KPSB 2X2YA 1C08B 3OKOA 3TCLB 1NEUA 5FK9A 1XF4A 4AEFA 1VFBB 3N1QC 3ZL4H 1LO2H 5I1IH 5I1KH 3HLAB 1MAML 3NOIA 1RIUH 1WBYB 2VZ3A 5HDLA 5FUCC 1T83C 1GL4B 2M8XA 2J8OA 1R5VB 2J8UF 3QFJB 4HPOL 5I6XC 1HHJA 4HDIB 3WEXA 4UDTB 4OM0L 1YEGH 4EUPB 3T04D 4HH9B 5TFSL 4LLMA 3RA7L 2OBGA 5CD5D 4YO0A 1BBDL 1XGYL 4DGYL 4U1GB 3NA4A 2Q8AL 1HIMH 2P44B 4CGTA 5E8DH 3PE9A 1N4XL 4G7VH 5F7NC 2ADIB 1CCZA 2FECL 2DS4A 1YEIL 5CP7A 4JFFD 3O2DA 4RNRA 4HUXA 4Y2OA 4YHNB 2X9WA 4I0PB 1Q0XH 3N0PB 3ARBA 4QHNB 4KKBD 5E6ZA 5D7JA 1A4JA 2P1YA 2PYED 4G8GE 4DAGH 1F13A 2YEZB 1X5IA 1BZQK 3E6HA 4NO5A 4JM2A 4N0YL 1JYNA 3JV5A 3QI9C 4XPBL 2BNQB 1A6AB 1M7DA 5DD3H 1UB6B 4JRYA 1QBLH 4PBVC 5KAQG 1M4KA 3IFLL 3KHOA 3K2UH 4GG8B 5DJ6B 4GRLA 2NY7H 4XCEA 4JY5L 3RTQA 4HCRL 5JW3H 4K7PY 3MV7E 2HKHL 4PRPE 4HJJH 5E2TH 5C0IA 4C55A 5F9DC 4DZ8B 1UJ3C 2WV3A 4UAOC 1P1ZA 5IHLB 4X9HA 3DRQB 1A64A 2HT3D 4OLVH 4QY8A 2OL3B 2MWCA 2GAZA 2YN3A 3B2VL 3GMNA 2FSEA 3G5XB 5C71A 3VJ6B 3HZMB 4L4TB 5E99L 3ZHDA 4GG6B 1RZJC 5FA3A 5FV1L 3F6IA 1TITA 5FUZL 1MRCL 4ZUVB 1KELL 2NY0D 1VESA 5C2BL 4ZD3L 3RVUC 4XNUH 4P2RD 3O2VL 3P4NA 3ULSB 3C60B 4U1HB 3VXRA 1AIFA 3QUML 3DUSB 2GI7A 5D7LA 2M2DA 1I7UB 5D70H 5C0CE 2B20A 4GW1A 1F3JA 2IALB 2V17H 4G6ML 3GIVB 1FGNL 3HCVA 5CILH 4F7CB 1A1NA 3ROLA 3MROB 3W9EB 1OTUC 2YC1B 4JDVB 3WNNA 3PV7A 2XN9E 4LVHB 3QIBD 1MFBL 3CSGA 4LHUD 4XMKL 5C6TL 1F4AA 4HZLB 2FEDD 3RGHA 4JDTH 1TJHL 4DN3L 4R8WL 3BKML 1UWXH 1S9VB 4PJDE 3DX7B 1J05A 3N50A 4P9HC 3MLSH 5CP3A 5GRUH 4EI5B 2QJDA 1LO2L 5D2LA 4MA3A 5SWQA 2D03L 3BP7A 3UJJL 3QDME 4Y4KC 4GQ9L 1AD9A 4J1UB 3W82A 1LEIB 5HSFA 4KK8C 4BUHA 1HE7A 4U1MB 4I9WE 1P53A 5E4EB 1J8KA 3F12B 1CDBA 4YE4H 3TT3H 5IBUG 1NCAH 4YXLH 3MUGA 3MV8B 1ZGLA 3W0WE 4J6RL 3VXSA 4NZTH 1HIML 3UTQA 1T20B 2FIRT 4X5XB 2HTKD 1GOFA 5FM4A 3JSSA 3HZVA 4OCWH 5D9SB 4XVTH 2LAAA 4XGZA 5DO2C 2V7NB 1HKLL 3U6RA 4TUOA 5MI0C 1MPAH 3K74B 5KTEL 1EO8L 2PW2A 1Q0XL 4FQQA 4RMRA 1OAXL 1CGWA 4UQ2A 4D9LL 4HWZA 4NZRH 4X4ZA 1REIA 1T0NB 4NKIH 4Q9CA 2MOVA 4OIIL 1X5HA 3FO1B 4YHOL 3WDJA 3K2UL 1KOAA 2GY5A 2WM0A 3V6ZA 4P5KA 3OXSB 5DJCB 2ZG2A 4K8RH 5C8JA 1LVEA 5I8EA 2CH8A 5KS9A 4HJJL 4KVCH 1MCIA 3NFPA 2E27H 2AI0H 3F62A 2A6KA 5EFIA 2NX5A 4P4KB 1QSVA 2Z9TA 3L9RB 3QEHA 4NC1E 4L4VB 1DFBL 4WFFD 5L2KA 4UDUA 1A7RL 1BD2A 1S5HB 4C83A 1R3HB 1JYXA 4ODVH 2AERT 1HYSD 2EIDA 2I5YL 3C8HA 5CZVL 1F45A 1MI5E 5FKAB 4XNUL 4L8CB 1G6RA 3KPLB 5BS0A 1FNEA 2APTA 2J8HA 1YN7A 4BYHA 1HILB 5C0BD 3V6FA 1X44A 1AH1A 1DP0A 5CILL 3VGAB 1Z5LA 2BC4A 2E9IA 3FRUB 4W4OA 4YHKL 1A7PL 4JPWH 4B0MM 5DJ8A 3EW3B 3AREC 1YDPA 4NWTL 2EH7L 2AXFA 4U7SA 3MRIA 1ZHLA 1E4KC 4EOWH 1G9ML 2Y6SC 1KXQE 1TZHB 4JDTL 5EBGA 1U3JA 3ZKND 4NRZA 4ODTL 1A6ZB 4YHZL 2E9JA 1GHFL 4LLWA 1IILE 1OTTD 2Z91B 4ZFFB 5LJYH 2GITA 3O81A 3G6DL 3P40A 3ARTA 1VKXA 4GKSB 1U36A 2AJUL 4JFPA 1NCWL 2PO6C 3CK0H 5I1JH 4BH7A 5IM7A 4BQCA 1FNSL 3MZTA 5FOBB 5D4QA 5TPWL 1QLFA 1PQZA 3MO1A 3ARFB 1QQDB 3DETC 4M02A 1YQVL 4YE4L 3TT3L 5IB1B 2GJ6A 4YXLL 2EE3A 2R2CA 1U42A 3I75A 4KZEH 3AB0C 4XXCC 3EYQC 1UXSB 2C4XA 2X4TA 4EJ1C 3O6FC 1JP5A 5I75B 2EEBA 3O3EA 2V5MA 4QOKD 4XVTL 1W0WB 2Z35B 4P2RB 4Y4HD 5ISZB 3K1DA 4WI5A 3D48R 3KGRA 1FLRL 1BM3L 5ESAA 1CICD 4K7FB 4GRMA 4OI7A 1U41A 1DL7H 4OCSL 4RZCB 2W9EH 1FFPA 5GRXG 3TVMC 1FL5B 1WWWX 2PYFB 4NZRL 3P3YA 4NSKB 1GAFH 3JTTA 32C2B 5F7WC 5LBSH 1ZA6A 4LKXA 4M8VA 3EZJB 3VXPB 2H32H 1UM5L 3O0RH 4MQTB 3O6LH 4POUB 4MB5A 1O5DT 2Q87A 2DL9A 2YSSA 1KFAH 4ERSH 4F58L 4XXDA 4GSDL 4OFVA 2JJUA 4AK1A 2E27L 4ORZC 2AI0L 4F7EA 3NCEB 2G2RA 4RMVA 4WCYH 4Z7WA 2VLKA 3SE8L 4GUPA 3P4OB 1KEGH 3MNZB 3C09B 2X9YA 1UM4L 4Y1AB 4LEOB 1EUTA 3S36H 4XPHH 1L9MA 5E8PA 3HE7D 3OV6A 2QSQA 3G6JF 1INQA 2DTMH 1OTSC 4D0CA 4IIQA 1JNHB 3L3KB 5K9KA 1XIWC 2D0HA 3FFCB 1CGTA 4IRSC 3V7MA 5KSVA 3NFNB 5HI3C 3P11H 1YUHA 5CUSH 3X13A 1QNZL 1AGBA 3LN5A 4OLUL 5I1HL 1IBGH 4MDIA 1HI6B 4F80A 3MBED 3RL1A 1HH9A 4KMTL 4OQ1A 1SYSB 5DYOB 4L8BB 4MXVF 5F6IC 3G08A 4WWKB 2WBWB 4AEIH 1T83A 4YNYA 1CXIA 3OJVC 1VGEH 3KPQA 5JA9A 3MRJA 1I1CA 1HSAB 5ACZA 2ERJC 1JGEA 1JZ4A 3PV6A 5TJWK 3OKYA 1DQDH 4FQXB 1IC5H 5DUMH 3NZ8A 1J8HE 3RX5A 1UGNA 3CX2A 3JV4B 4OCYL 5IT2H 2EDLA 3S96B 4MVBC 2A0LD 3CK0L 4PJFF 4PRIB 3SJVD 5I1JL 5CMAA 3QG6A 4L9DA 3K8MA 2JCCE 5DURB 4RGNC 1NDGB 2CLZA 5DC4B 1QYGH 3DX8A 5CIPA 3ROOB 1X5ZA 5KW9L 4MNQB 1NCDH 4X80L 1YNTA 1J88A 5L7XL 2WP3T 4ONFL 4HW6A 2GJJA 4O00A 1CQKA 4WTXA 3U36B 3VFNA 2QEJA 4KQ4L 2F54D 3LQAH 3T0EB 4Y5VB 2Z31A 3I6GB 1HHGA 5D5MF 4NT6B 4LLVA 2IFFL 5I1AB 4UIMB 5CAYB 4LPXA 3UXFA 3VFVA 3LKRA 5D1XD 3HUJA 1JNNL 1IEAB 1AGDA 5C9KA 2E7BA 1FVDB 4NN5C 4LQFL 3BJLA 3AAZB 1FNFA 2DQCH 4JG1L 4QLRA 1QSFB 1CXFA 4I18B 5E95B 3BT2L 1FZJB 3HI6H 2XACC 2UZXB 3O0RL 4QRRE 1YEJH 1CE6B 3UZQA 3O6LL 3GBML 5CBEA 5JXAH 2X1QA 4TYUA 4OT1H 4JRXE 1KFAL 1KCRH 4NP4L 4XAWH 3BKJH 1FG2A 5DK3A 2CGRL 1LGVA 1IGTA 2I26N 4MQ7B 1E28A 4IJ3B 2P49B 4N9OB 1KEGL 5BV7B 1DQML 3BOVA 3SCMD 1V3KA 3S36L 4PBXA 3U9UA 3GFUA 4XPHL 2YKLH 4JFHE 1IGCH 2HA1A 1A7OL 3ESUF 2BY1A 1V7NL 4G7YH 1D5XA 4HFWB 1B9ZA 1G9NH 5EOCJ 3CUPA 3KPPB 2UZIL 4V1DE 6FABL 5L6YH 3CU1A 5GRZA 4L3AA 4RGOH 5E9DE 4OCMC 5GS0L 4OD1H 3KR3H 1BLNA 1T7ZA 4NZJA 2VUYA 1U3HA 3LB6C 4KI5D 3G9VA 3OX8A 3P11L 1F11A 3ARDA 1NBYA 2FYYA 2N7BA 3IGAB 5CUSL 3FT4B 3KXFE 4WW2C 4YXKH 4H1LG 4PP1C 2NY3D 3EOAB 1OAKH 5HTSA 2F9BT 2IAMB 5FYKH 2Y5TB 5E2WL 2FGWL 5HGGS 3FQUB 3MRDA 1ZA3B 4HK3J 1Q94B 3RUGF 2CIIA 4HJGA 3P77A 2P43B 3BHBB 3IJHA 2WMPA 5D2NB 5HPOA 4JFOB 1DQDL 3VG9B 2PUQT 4L8DA 2V2XA 5JORA 5IT2L 1KB5B 3O3UN 5I8KL 4WUUA 1RHHA 1NEZG 2HRPL 2NY1B 4JGUA 4ZUWB 3QDGD 2ARWA 3VDCA 4J3SA 3FONA 1FFOB 3C5ZB 4HWBH 4WV1B 1FSKC 1QRNB 4RAHA 1CLYL 1ETZB 1NFDE 3B9KB 2ZUSA 5MEND 1QYGL 1T0MA 2HT3C 3BSZL 5D6DC 4AQ1B 1ADQA 4L1HA 1MJ8H 1HK6A 4OB5L 4LCWD 5C6WH 4MD0A 2NY0C 3TNNA 3AS2A 5HYIA 4AT6B 1P4LB 3P0YH 4PV9A 3UBXI 5GS0D 1P5VA 4XMPH 4PGEA 3TJEL 3HC4H 1T7VA 5JTWA 4GBXD 3QCVL 3E8UL 1RVFL 1CIDA 4MNHA 5L0QB 2HFTA 3FT2A 2F8XC 1NGWA 4XP9L 1NCUA 4BSVA 1I4FB 4EUPH 3VRIA 4F37F 3ZDXF 1GCFA 4S1QH 2GUOB 2E9WA 3MLZL 8FABB 1MVUB 3UYRH 1D6EB 4PRHD 5FUOH 4QTIH 3MBEB 1CTNA 2X4RA 2FEDC 2CDEA 5ABDE 4OT1L 1F90H 1KCRL 5D7IB 4KDWA 4Q58C 1AI1H 4MCYB 4XAWL 4MX7B 3QHZH 1FYTE 2VDOL 5DQ9A 2FEEI 2DQHH 3L7FB 4QRTB 5CJBA 5DD6B 2WP3O 3N9GH 4Y5XA 5LG1A 2CPCA 3UPRB 4OFDA 1UACH 2NYYD 5BW7A 4U1JB 2YR3A 5HVGB 2YKLL 3EDJA 2XZAL 2OR9H 5C0DA 3GKZA 4OCRH 4H8WL 2DQTH 4NPYB 4NQDD 4PGBB 1N64H 4UV4H 4PJCB 1EAJA 5F9OL 1Q9KB 2XICA 1LO3H 1EEYB 5GQBA 1G9NL 5CLWA 1QA9B 5IIEA 3FB7A 1XH3B 5EBMB 4JO2L 2IQ9H 4JQVA 1NBQA 4JAMB 2ZUXA 2EKJA 5CEXB 3KNBB 1WCQA 4OD1L 3RKPA 1BAFH 1YQ2A 1AY1L 5FDYA 3CH1A 2EDDA 4XH2A 3ESVF 5JHLL 3UBXB 3ECBA 1EERB 3OKKB 4LBEB 4TRPH 3LDBB 3VH8B 5FV2A 3E0GA 2IGFH 2OL3H 3WIHH 3WHXB 4JFXB 3HTLX 2IF7A 2ESVD 1QSEA 4HH8A 4N8PA 1OAKL 1OSPL 2D31B 3QEGH 5D1XB 3UP1A 1YY9D 4JJHA 4TULL 3DV4A 4XCNA 2XA8H 1Q9WA 3HE6A 1MWAA 2COQA 1PJ9A 1RHFA 4QXWA 4K7PX 4LHUG 1RULL 3OL2A 1I1FB 3MLPA 3I3DA 4ZXBD 2APBA 2GCYA 4X4MA 1E6OH 4BFGA 4KKAD 2BHUA 2LFGA 2XWBA 1P7KB 3B6SA 4ZFZB 4KHXL 3ZKXC 2IMMA 4R4FH 4YEEA 2EDWA 3ZKQD 2DQGL 4XXCA 4O9HH 2BSTA 3O6FA 2Q76B 3C6LD 1YZZA 1N59A 5EU4B 4OZ4B 4KY1H 2XPGB 1MJ8L 5JHDD 3FO2B 1HH6A 5BCAA 1MIMH 1XCTB 4EDXB 3QIUB 5A3ID 2A2QT 1HYSC 4LU5H 2DICA 4KJYB 3RDTB 3LRSA 3TVMA 3PIQA 1JWUB 4WI2A 4XMPL 1T7XA 3BDXA 3HC4L 4HUWA 2VDQH 4QYOA 1I7TB 4FXGB 5EUOF 2VL5A 1H15A 4L5FH 1G7PA 3WO3B 3REWB 4JN2B 4G8GD 4N0UA 5DEGB 5AZEH 4L3EE 4Z7NF 3IAQA 2ID5A 1CYGA 4GAJH 1NAMA 3QYCA 3WFDL 2DDQH 3PWVB 2F53A 4DK6A 5JOFB 2D7PA 1ZHKA 4JM4H 2NTSP 1CL7L 4QTIL 3MV7D 4PRPD 3SKUD 4GKOA 3L5WA 1YMME 5EZJB 4PJBB 1FAIL 2KZWA 3DXAA 3QUZA 3ZKNC 5C7XH 4ZDHA 3QHZL 3W9DA 1U8OA 1OTTC 3P0VH 4HS3A 3MNWA 3TH2T 4LSUL 2X09A 3KPOA 1FL3B 1RZGA 1KNOB 3VFRB 4JKPL 2OR7A 4R9HA 3QA3B 4XX1G 3NGBB 3I2CL 5FYLE 3ES6A 4HK3N 1WIPA 1K4DA 4PB9L 4FOMA 2EYTA 4PJEE 1XIWA 5DTFB 4OZIF 4NZDA 2A73B 3BZ4A 3ZYZA 1LD9A 1N64L 1KBGH 2V9TA 3C2AH 1DN2A 4WO4B 1CD1B 3KWWB 3FQNA 4U6YB 3ZDYF 3TYFB 5C0CD 4HGMA 4ZPVB 4OAWB 4OKVB 2AEQL 1OD9A 1A47A 3UC0H 2OZ4H 1BBJB 1IAMA 3VXQB 3KJ6H 2HT2D 2XTJB 4P2QB 3LV3A 4F3FB 1CG9B 4G43B 5CWSB 4X4XA 4TRPL 2XN9D 3CAFA 3RWEA 3QNZB 1SBBA 4G8EB 4I2XA 4WHYG 3WIHL 3LIZH 4HX1A 1CFVH 1T2JA 1AO7E 4DFIA 4I4WB 1CICC 3ZSSA 1T1ZA 1MF2H 5F8RC 3UTTA 2Q7NA 4OGAC 5KN5A 1XGRA 5HGBB 4M1CC 1GGBH 2HJKA 1M71B 1G9MC 3QDMD 4HLZG 4Z9KB 2FL5B 2P7TA 2O5XH 3O2WH 1KG0B 5BZWA 3X3GL 2WZPD 4HUNB 3QCTH 5DJAB 5EO9A 1OARH 3UDWC 1A6WH 2VISB 4I9WD 3AU1A 4Z7VF 2DQFB 5EB9A 4R4FL 3QQ3B 1EEUA 2WWMD 5DMIH 4LAJH 3PHQA 3PDOB 1A4KA 2BRQA 4HKZA 4O9HL 5CSZA 5ANMA 2HVKA 2WLYA 5CJQL 3W0WD 1I7RB 2R0ZL 2NR6D 3K80A 4KY1L 4YDJA 5F7KC 3O4LB 2VKWA 1KPRB 1TJGH 4FFYH 2PTUA 1A2YA 4Z7UE 1IFHH 5IJVA 2VLME 4IOFD 3REVB 4NQDB 4NRYB 4OI8A 4YPJA 4CRPA 4CVZB 3OTTA 4PJ5B 4IRJD 3JUYA 1LP9F 2FBJH 1N8ZB 5F7MC 3DRTA 1T03H 5C0AB 3RWIB 1GIGL 4XP5L 3WV0A 2VH5H 5HYJE 4QHMA 5EULV 5E08H 2YRZA 4XBGA 4JM4L 2HT4D 3MLTA 4PG2C 3CFIC 3TA3A 2EDQA 1KIRB 3ARYA 1ZGLP 4F8QA 5A16B 4MXQD 3VFGH 3P0VL 3JTSB 5B4MD 2VAJA 2VDPH 4CU7A 1J0JA 3GJEB 5DRZB 3WN5C 4DK3A 5SWSE 4DQOH 1HQ4A 5ICXA 2C5DC 5DVMA 3DROB 2A0LC 3ULUE 2MQ0A 1CE1L 5FGBA 3KDMA 5J9PA 3EUUA 1AXSA 5K9OB 1MI5D 3TBSA 1W8OA 3KYOA 4WTZA 1IM9D 4GLRI 5C0JB 2Y23A 3K4ZA 3C2AL 1Y18B 5FB8B 1T04A 3X17A 5FIEA 2JELL 3T0VA 3OSKA 5BRZE 1A14H 3PGCB 1HXYA 1I9IH 4LCYB 4O2EB 4WDIB 1S9XB 4CJ1A 3O6KH 2XZCL 4UOW0 1DUYA 4C4KT 4I48B 4JRWA 4FQJL 4X4YA 3SPVB 5BXFA 1CFNA 1Y6MR 3LIZL 4F9LA 4L3CB 2ZSWA 1MF2L 1OW0A 5K59F 1PEWA 1H3PH 1R3JB 2YWYA 3EYFA 2R69H 2CKBA 2IANA 4KJWD 5IV2B 4EI6B 4R97B 1GJIA 2EDKA 5C6PB 4PD4K 4Z95H 1P7QD 4XCFH 1RY7B 1EGJL 1YN6A 4PRAB 2CK0H 4HD9A 1MAKA 5F71A 2EO1A 4BZ1H 1I8KA 4PTTA 2LQRA 4QCIB 3IDNA 3T77B 1PGRB 1OGAA 1XGQA 3VFSA 4HG4J 3D39B 1Q0YH 2B39A 3MLRL 3SDCC 4QRUB 2CLVA 5IQ7L 1J9CT 3CDCA 4U33A 4ORGB 5D6DA 1TPXB 1RJZB 1BQHB 2EO9A 2VXSH 2OMBA 2YXFA 5I9QC 2B2XH 2XKNA 5DMIL 2IPKA 4DGVL 3Q5OA 3NA9H 4X6BB 3FQXA 1K2DA 3PG2A 2CRIA 4JHAH 4KJQD 5DDHA 3U2SB 3EYUH 2XG5A 2I25N 4DKAA 1ZEAL 5GJSH 1O0VA 1Q1JL 3PL6D 5EOCH 3TLRA 3BRDA 1G7JB 3O4OB 4M3KB 3RWFA 3F5WA 4ZO6A 1EHXA 2DI7A 3VI3F 5T1MB 1KPVB 2IH3B 2HMIC 2PW1B 2HWZH 1MFEH 4NOBA 5FECB 4GJTB 2J2ZA 2VLJA 2FBJL 3C5SB 3L3DA 3QIWA 1T03L 3PQYA 2MQ3A 4KAQH 4LLDA 4RSVA 3IFNH 3HR6A 4XNZB 2YS4A 4NQEB 3CDGA 1EK3A 3ALXA 1GGUA 1CDIA 5E56A 3E6FA 1MY7A 2Y4SA 5HBBA 4LMQI 2NY3C 4JJ5A 1QG3A 3LSOB 2C7UA 4NJ9L 1DLFL 4HCRA 2MSPA 1OCWL 4JY6B 2PXYD 1JGVH 5GRVL 3INUL 4PJDB 1PSKL 1QHOA 5HVHC 1S5IH 5DK2B 1K8DA 5MEQA 1AKJD 3VFGL 3VXUA 4A6YA 3MRLA 2OQJA 2C9AA 1Z6JT 4YQXL 1FZOA 5A1AA 2CDGB 5DD0L 4DQOL 1IKNC 5FCSH 3VU2A 3ULVH 4PJAB 2VABA 3AFLA 4R90L 4TQEH 1BQLL 1NBVH 5EU7E 3BP5A 4XCCL 2OI9C 4ISVA 2K7QA 3OF6A 3U82B 1U3YA 2BHYA 4PG9A 4HMCA 1IGFL 4YDLC 3FTGB 1CFTB 3LQZA 5EO1A 4XCYB 2YA2A 5L8KB 3T3PF 4P46B 4GG6F 4UNVA 3VDAA 4HUVA 1HEZA 1XAUA 2EDRA 4OD2B 3SOBL 2X4SB 5D1QD 4HEPG 5ALBH 1I9IL 3GMMB 5DJ0A 5D96B 4GW5A 1IC7H 4I77H 1QO3A 1LK3L 5CJOH 3KPMA 2HFEA 4TNWF 3QXUA 3MJ9H 3QJHA 3G6JA 5GS0C 4XPTH 3AGVA 3HPLB 5BV7H 3VGBA 3U0PA 3PWJB 3BD4A 4XNYH 3V5HA 4R0LB 4H25A 5IHBA 3O45A 1GRWA 4FQIH 4I5BB 4ELKA 3JZ7A 4XCFL 4PY7A 4WW1A 3GM8A 3VXRE 1MHHA 1AP2B 2YPLB 5FGRA 5D7LE 4L8SB 3U7YH 1J8HD 4Y19B 3KJ4B 3SGEI 4PJ7A 5CKAA 5TDNA 2ED9A 4K3JH 3HZYB 1MHCB 1A3RH 4XHJD 4XP6L 4ZOCA 3FN9A 3DURB 4XT1C 2LU7A 4C56A 3RVTD 3PXJA 4M6NH 4ONGL 1XGUA 2VXSL 4FTVA 4NDMB 5JOPE 5D93B 4F33B 2CDFB 1N0XL 4G42A 1YMHB 2A77L 2ATKB 3MXWH 1JF5A 5F1KC 3RNKA 1TNMA 3GKWH 2R1WA 3NA9L 5F93C 1KJVA 4UV7H 4FQCH 4H88H 4PJFA 5T1LD 4C4KO 3QXDA 4XB7A 1YEEH 2BVPB 5INDA 4AIZA 5D2LE 3VXMB 5CJXC 2HG5B 4OLZL 4UT6L 1WBXB 4P23A 5EUKB 1LQSR 5HDOA 3LEXA 4NM8L 1LO0H 1SEQH 5JPMA 4QTHB 4UUJA 1C12A 4PJ9B 4PV8B 1FZMA 5GGUA 3VFMB 5DMGD 4JGJA 2WBJA 1TTGA 2HLFD 1UWGH 1SYVA 4Z7OE 3IXTB 3ZSTA 2X5PA 1N5AB 4KAQL 5D7SL 3AMKA 4F7MB 3BI9X 3RZCB 2VKXA 4ENEC 3JWNC 1UWEL 5D5MA 1CGSL 3V0VA 3VFWA 2UWEF 4QRRD 5EA0H 3VXSE 2D7OA 4JRXD 4O2FB 2NNAA 1YYML 1ZT1A 2EYRA 1P84K 5GRWA 4KKCC 1DDHB 5IEKB 1GGCL 3P73B 3T3MF 3FT3A 2J4WH 4PJIF 4Y8AA 4ZXBC 3CXHK 5IK3A 3WFBL 4KKAC 3IXAB 5CD3A 4HF5L 1NBVL 5IB2B 4JFHD 3V52H 1D5BA 1ACYH 2H26A 5J13B 2X70B 4G6JH 1WCBA 1SJEA 3SKJL 2XTLA 1T1XA 4M6MH 2NTFB 4YDIH 1AQKL 1QHPA 1U95A 3TIEB 4V1DD 1DQQA 1BVLA 1AHWC 5E9DD 1H3UA 3C6LC 5HYQB 5KS9E 2L7UA 4H8WC 1FNLA 3TH3T 5ALBL 5KANG 3H2WA 3B5TA 1G9NC 5KSBF 3KLHD 2A83A 1IC7L 1FN4B 3SKNB 4JZJA 3DV6A 5GGVY 1BQUA 4XPTL 3QUXB 5L2KE 4UT9H 2P48B 1BD2E 3VA6A 4EEEA 2OCFD 3VWJD 1J1OH 1HHKB 3TH4T 3TZVC 4PJ8D 2UUDH 3VFUB 3ZZ1A 1NC4B 1Z3GL 4MAUH 3S5LA 5BS0E 4YDKH 1FPTH 4NKMB 2NXZB 5DD1L 3MUY1 1G7LA 4MA7L 3U7YL 3WUWA 3BH9B 4ZG1A 3FAXA 1OP5H 1JZ5A 4K3JL 3VG0H 1EFXB 1B0GB 1KLUB 4X8XA 1HHHB 4JFQA 2JF1A 4X98A 2F8VA 3BKCL 3S7GA 3RUGA 1LE5B 1DUZB 4GKZA 4TVPE 4QRPA 1MCKA 3EYSL 3MXWL 1FBIH 5DJXA 4KK9D 3GKWL 1SBSH 1U8PB 5EU6B 2X41A 4FQCL 2AEPH 2ZJSH 5IP4A 1C16B 3BGMA 3H3BC 3I02A 4XBPA 5L2JA 2BSRB 4NKDA 4U1NA 1RUAH 5ILTH 3ZLQC 1LO0L 4KXZI 5I8CA 1MH5B 4V2BA 2C3XA 2RFXA 5ACLA 1ZLUH 4N9GB 1KB5L 4HUUA 3VRLE 3QAZC 3IDYB 1N5YH 3RBGA 5HYSG 3S3SA 2OX5A 3B9DA 2YD4A 2B5IC 4ZOAA 1MCOL 1CGXA 2HT2C 3GUTA 3S37X 3D0VA 4FG6C 3HRZB 4NN6B 5LQBH 2F74B 5AEAA 3W11D 2AK4E 3BX7C 5AAMA 5EORL 2VN7A 2GJ6E 1WTGT 3DX9A 1IVLA 2XFXA 5C1MB 4UTAH 1LEGB 1YY8B 1FE8H 4HWEH 1T6VN 1YEKL 2VXUH 3GJFH 1Z9LA 1ZANH 2G9HB 3WN5A 1FYTD 4NO0D 3HI5H 2IH1A 5I15L 5EU5A 4LSDA 3D85B 2Y7QA 2IC2A 2XI9A 4LCIL 3TN0B 4J23A 1UXWB 1IM3B 3DTXA 2I27N 3CMOH 4I8DA 4TUJA 4K9EH 5L9DL 3HNSH 5T3ZL 5JUEL 5TQ2H 1L6ZA 5IBLD 1UZ6F 5IQ9A 5JXED 1ACYL 2EIZB 4NUJB 4I0PC 1YJDC 3IYLW 2JCCB 3DARA 4MNGA 3GEWB 4M6ML 1MRFH 5IGXL 3MMEB 3UYPA 5INCB 5E8OB 3LN4A 5HYEA 5C08A 3MJ7B 3UPCA 1KGCE 5JNYA 2APFA 4CKVX 4LKCA 3VCLA 5B8CB 5EBWB 5BZDB 4JFED 1NDMA 5HGDA 3CC5B 2OSLB 1KIQB 1FFQA 4GKNA 1SQ2N 2VLKE 3QCUL 1D9KD 4IOFC 1ODAA 2M26A 3G5ZA 3QG7H 1P4BH 3B4NA 1B6DA 1C5BH 3TGXA 4U05A 1PLGL 4IRJC 4UT9L 3S4SB 3IDMA 4JCMA 3PWNA 3GSNL 3SE3C 4TVSa 1PYWB 1S7TA 4UZGA 4AEHL 3VFTA 3DIFA 2WINA 2EH8H 4MAUL 3SDCA 2HH0L 2DM3A 1UVQA 1AQDA 3AROA 2LVCA 4D2NA 1RAMA 4P2OA 1IT9H 2DYPB 2QSVA 5KSUB 1BIHA 2HT4C 2FX8H 3MRCA 1DLHA 1WUNT 3VG0L 1PG7W 1DANT 3RZWA 5DUBA 4KZDH 4LASH 4MXQC 4RX4D 2QTEA 4XZUB 2RBLA 3O9WD 5I73B 2VJXA 1YEDA 3HNTL 1FBIL 3F6LA 5F1NB 5C09A 2QQKH 3QBTB 1SBSL 4X83A 1KULA 2P4AB 5FUCE 1D5IL 3LHPL 3UTSA 1INEH 4Y4FA 5IKCA 4U6XB 2AJYH 2EDXA 3CPLB 3JV6A 3JVGC 1GGTA 3FZUD 3RGVB 2CD0A 1RUAL 5ILTL 3HN3A 4R96B 5DJYA 3R8QA 1Q9OB 2EYSA 3FOLB 1X9QA 5M7QA 4CN6A 3W5MA 4L3ED 2NQCA 3GSOB 4PUBH 3CVIH 2FEEL 4DOHE 4CADB 3V0WL 3MLXL 2XT1B 4G8IB 3QQ4B 1A0QL 2YXMA 4GRWB 5LQBL 1A1MA 1IL1A 3KXFB 4KRLB 4QHUA 2H32A 5A2JH 4IEFB 3RNQA 2A9ML 3ULVF 5EUOA 4N0FB 1WVZA 1FE8L 1YMMD 1NANI 2VXUL 3O8XB 5FKPA 1ZANL 1HHIB 4FHBD 4I3GA 3PJSA 2BSED 1CIUA 1D7FA 5EC1A 3MA9L 1SY6H 1GGIL 4YZFF 4CVXB 2R2BB 3HUJE 4HFUH 3TWCH 3CMOL 4S1SH 5FYLD 3HNSL 3MRQB 2Q8BH 5BJTA 1VB9A 3GO1L 1LK2A 2IBZY 2X42A 1S9YA 1VADA 1U91A 4RMQA 1VFAA 5I2IB 4DW2L 1ES0B 5F44A 4WY7H 4Z8FH 2WAHA 1I9EA 5KJRH 1WJ3A 4Y2DA 3UO1H 2YD2A 15C8H 1BEYL 5CLTA 4ZS7H 1BZ7A 4NFCA 5HXMA 5JW4Q 3MODL 5C0NC 4BKLA 4OZIA 3PL6C 3VRJA 1FGVL 2VXTH 3UJIH 5MEOA 2AV1B 3NVQA 3QG7L 3RY5A 1R5WA 4NKOA 1C5BL 2AQ1A 4TTDD 4RISH 5IUSA 3VXNB 1YC7A 3FO0H 5GJTH 3D0LB 3IDUA 1NGPL 4M03A 5C2UB 3E3QC 2EH8L 3MCKB 4M3JA 5JW4N 4K3DL 1WV7T 4BM7A 3GK8H 2QKIA 4ZNCD 4L29B 2JIXB 2ARJQ 5DXWA 2PXYC 1F6LL 1UKSA 2QSCL 5C0EB 2DLTA 3V5DB 2A1WH 3H3PH 5F1OB 1WAAA 2BX5A 4YPGB 2WBKA 3FCTA 5CJXA 4D0DB 1I1AB 3K4DA 2LTQC 2QQKL 2HN7B 3BAEH 3MPCA 4NQSB 3U79A 1ORQA 4UQ3A 4JKLA 3ARGA 1A9BB 3BDBA 2D7NA 2V9QA 3VFOB 2P24B 4E42B 1ULVA 4Z7VA 4BSWB 1KIPB 1F8TH 1SJHB 5HD8C 3QQ9D 4GMSH 1MCSA 3A6BH 1RURH 4G6AD 4WUUE 1H5BA 2X4OB 3EOYG 4D8PA 5GS1B 1YEHH 4URTB 1QPXA 1EIBA 4PUBL 2JJWA 1KACB 4PJHE 1X5LA 1FL6A 3BKYL 3G5VB 1VHPA 3OBAA 2PCPA 4D3CH 4OZFB 1R3IH 1D9KB 2H6PA 1RZ7H 1EAPA 3W5NA 1E27A 3O3DB 5CEZE 2FIKB 4YK4C 4AENA 1LP9A 3MUZ1 4LLYB 4JFZL 3DBXB 1U8NB 5FYJL 1CBVL 4GLRH 3P30H 5HJ3B 1WITA 4MAYA 3SHSA 3U30C 1CLOH 5C0RH 4LHQB 3OAUH 3OKDA 3QUYB 5A2IH 3WFCL 1EMTH 5B3JF 5H8DA 3PGDA 3GI9H 4HGWB 4P5TA 5D7IF 2Q8BL 1ZSDB 1Z0NA 2OJZH 2CUMA 4LCCA 2ZG3A 4XHJC 1OF2B 1YC8A 1VGKB 1DQLH 5FO9A 2Q6WA 1DVFA 5F9WB 2J8UB 3T4AB