5DJZB

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
GQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 13
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzB00
3MLSH 2FWOB 4TQEL 2FIKA 5GGRA 2PXYA 1YEKH 2H2PD 2GUOA 4O02H 4MMXC 2YPLB 3PUCA 4GQPH 5T1LD 4DCQB 1A3LL 3TO4D 3QWRD 2IANE 4QRRA 4IS6A 4DZ8B 5IVOA 5F7FA 1I8MB 4MXQC 4KVCL 1JUFA 1OT1A 4NZDA 1PG7X 1KLGA 1NCNA 4LFHG 1TZHA 3LQZB 1RZGB 5D1QD 1J05A 1MRCL 4Q9RL 4OZHF 3FMGH 1CGTA 4BFIA 3X12A 5IROA 3MRLA 2YBRA 4JRYB 3PP4H 3T0VA 2QHRH 1T83A 1C7TA 4OLZH 2D9CA 2XACC 4JY5L 4KI5F 2X44D 4LLDA 2UYLA 3Q5OA 3GIVB 2Q87A 4OT1L 5HD8D 2A6IB 5CZXD 4L8CB 3NGBC 4E5XA 4GRLD 1Z6JT 5FEBA 4TULL 4ZAKA 4I0PB 2Q3AA 1GC1L 3TLRA 4FXKA 5CUSL 1OTUD 5AG9A 3NN8A 4YDLB 5DVNA 3ZKNC 5JUEH 3MBEB 1AR1D 3MUZ1 1NSNH 2H8PA 3DYOA 3D48R 2PO6D 3C5JB 4OF5A 3RWDB 3SQBA 4G42B 1C5BH 1FAIH 3EYVA 5TE6L 1FBIL 4JM4H 1WTLA 3TWCH 4JN1H 4U2ZA 5JW3H 2IF7A 3VRIA 4BSVB 1NFDB 3LKOA 1R5IA 2DQUH 5FHBL 4XCFL 1DQQB 4CVZB 5CMAB 2R2EA 4NO5A 4TTDD 4N0FA 3BD4A 5E8NB 3MRKB 4B53A 1MCKA 3AMKA 2GI7A 4R4BA 4ZXBD 3LQAH 1XF5A 1J1OL 1N4XH 4JY4B 4NCDA 3DHMA 2R8SH 3O6LH 1A21A 4XP6H 1FLTX 1TNMA 3CFCH 4M9OA 2ATKA 1J10A 3P73B 5GS0D 1NBZA 4HMEA 3DO7B 5KSUA 1CK0L 4P4KC 4Z95L 1K4DA 3BP5A 4MA7H 1H8OA 4Y5XC 2X1PA 1QBAA 4KUZH 2YPKB 3K3QA 3MGOA 3UDWA 1F97A 2AJZA 4P2RE 3SDCB 2BCKA 1FVCB 3UBXB 1TCRA 1ED3A 2RJMA 4G6MH 4HJGA 4HWEH 1JI1A 3CLEL 2XXCB 3BKML 5I1EL 3LN5B 4HIJB 4J7RA 5C0RH 3C2AL 4D0BA 4PTTB 5F9WC 5HJ3B 4HUXB 3GI8L 4XXDA 5EDXA 3S7GA 4XBPA 1HKFA 3NCBB 4XNXH 4BQCA 3C6LB 1ZLUK 4M7LT 2CUMA 3X11A 3DETC 1BBJB 5CJQH 3SQOH 1VGKA 3GDBA 1AGEB 3I75B 2X4SB 3V79C 3SKNA 4JFQA 1UJ3C 4MB5A 4OZFA 3CPLA 2I07B 3ULVC 4KUCD 5SWZB 4DEPC 3WS6C 3DURB 1N8ZB 2C9AA 3JV5A 3QNXB 3V5HA 5J8OA 5F9AC 1VEPA 4RIRB 4XCYB 3BGMB 5HI3C 3TESA 2F58L 1Q9LA 1NDGB 1NAMH 4JZOA 5EUKB 4WNQA 4YAQA 3IETB 5KW9H 1HSBA 3CXHJ 3CLFH 3UTOA 4CU8A 3H9SA 4Z7OE 3O2VH 1J8HA 3QQNA 3SDDD 1JTTA 1UWGH 3EFDL 3ZHKA 3D1MC 2FLBT 3VXTA 2ZG3A 5A3IC 5BZWB 5IFAH 3VXPA 2E9JA 2ZSVA 4P2YA 2ADFL 2JLLA 3MXVH 4YHNB 4MQ7A 4AEIL 2DDQH 5FYKL 3X13B 4RISL 3VCLA 1ZLVK 3IS0X 2Y06L 3MJ9A 5J9PB 5MEND 2ZZUT 5D7LD 3BN9D 4MAYD 3F7YA 2VN4A 4PG9B 4GG6A 1JGUL 4U6VH 5T1KB 2R2BA 3ARPA 3RU8H 4D8PB 3AS0A 3B9KB 1P6AB 4LKXB 3PV6A 2V7HB 4KGJA 2A6JB 1YEKL 1S9XB 2E7CA 5DURD 4F80A 4YFLI 3U30B 4LSRH 3VXUA 2H3NB 5L2KB 4Q7DA 3VWKD 1ONQA 5FDWB 4NQTA 2VAJA 3REVA 4KXZH 4WW2F 4CKVX 2XQBL 5DJCA 1MAJA 4BSWA 1TJGL 1EFXB 3WLBA 2DL2A 3BEVB 5IMOB 4JFOB 3MV7D 4NFCA 1Y0LA 3O6KH 1T7VA 4OZ4A 1J1XH 3BP7A 1LEKA 1NMBL 5JORA 2CDFA 3PP4L 1TCMA 5T5NG 3QA3A 5CEXB 1X5GA 4OZGF 4JN1L 3QWOB 4PJXF 1P7QD 3CFKB 3GRWH 3T0XA 5BS0E 5FUZH 1MFEH 2C1PB 5L9DH 3FAWA 5HSFA 4AM0B 3HE6B 2VQ1B 1YEEH 2YMXH 3BP6B 4PJHF 3IDJA 4PRAA 4P23A 5ANME 4U1SB 4JB9H 5I8CA 4NPYA 1JPTH 1K2DB 4L8SC 3FOMB 2BXZA 5E99L 4Y4KC 2BY1A 4BH8A 2V5YA 4L8DB 3RVTC 2M8XA 1UB5B 1XGPB 1KIUA 5MEPB 1S7VA 3VFUB 3ZE1E 5C08A 3O81A 1A7PL 3NFPA 4OZGE 1CU4L 2H9GA 2DM3A 1MWAH 3LQAL 4WY7L 1C5BL 1K9TA 1UWXK 2OL3A 3H9HA 1MVUB 4GRWF 2XN9D 4KMTH 2C4XA 4L4VB 1QFHA 3CD4A 4XP4L 2H6PA 3KXFE 3AAZA 4U1JB 2YRLA 1N6VA 3L5WB 1AR1C 3RFZC 5C09B 1JYXA 5EZJB 5DDHA 4APQC 1U3HD 4X6CA 2KQNA 5JTWA 2A73A 2X40A 1T1WB 4HWNA 3PWPE 1K8IA 3RZCB 2WWMC 1KB5B 4TUJB 1YJDH 1IEAA 1BD2E 2JJVA 5DD5L 1S9YA 3HRPA 2J6EA 3WFHB 3CVIL 4HZLB 1OSZA 4KWUA 4M48L 5IKCB 1UZ8A 1MHHB 3MV7A 3NIDF 4NHCL 3KPOA 3TBYB 2ICWI 5IM7B 3ARDC 4AIZB 3KYAA 5C3TA 4MS8C 4KK5C 2VWEE 4G9FD 3D18A 1KB9K 5D7JA 4P9ML 5FM4A 3C60D 3LKRA 1JRHL 5D7IE 4H25B 3BPNC 3FQNA 1T0NB 5DEFA 2W9LA 4HWEL 1DSFH 1DUYB 2R0WH 3Q6GL 1M7XA 1BZ9A 1YPZA 3KYKH 2MPAL 4PY7B 3ORJA 1DEEA 5DT1H 1YMME 2EXYC 3BPOC 3M17A 4YZFF 3IRPX 1JE6A 4ZFOA 1OWWA 4LLYB 2IQ9L 5DRNB 4UV7L 3ZDZE 3JTSA 3QQ9D 1BZ7A 3T0EB 4Z76A 4PY8I 3PQYA 4X6DE 5CKGA 2VOTA 3I2CH 1AKJB 2FECL 5EOCH 5T3XL 4BK5A 4XC3H 3LPFA 2VDOL 2AV7B 4POZD 2J4WL 4OCLC 2NYYC 3C08H 1MFDH 5IP4A 5BV7B 5JHDD 1S78C 5E7FA 3UC0H 3QXTA 5GRXG 3ECBA 4N90D 5HGGS 4XMPH 2JCCA 3UJTL 4FA8A 2H1PL 3RGVC 1RUKL 5MHSD 4MHHG 3OJ2C 2HKHL 3OR7B 1G9ML 5KSAD 1JFQH 5FCUL 2VISB 4R4FL 3NZHL 3V4VH 4LLWA 2K3TA 4BFEA 3VA6A 2ZOKA 4XHQA 3UTSB 1OAKL 2NY1C 3VFWB 1IEBA 43CAB 2EIDA 1KLUA 2VSCA 3C09C 1ZGLP 4M43L 4Y88A 1AXIB 4HWBH 4FFYH 1FZKB 5I75B 1CT8A 1KB9J 2JELH 2JIXD 3CUPB 4HDIA 3G08A 5HVHC 1NJ9A 1CN4A 4GLRI 4XBEH 3C8HA 1WBYA 1RIHH 2KBGA 3MNZA 5A1AA 4EIGB 5JDJA 4FZEL 1WZMA 4N0YL 3B2VH 2BC4B 2HJKA 5F7EL 5T5FL 1AXSA 3OKOB 5T1MA 2X4OA 3VGGA 5E70A 3DV6A 4Y5VB 5JW5B 3D3VE 4LF3B 4EOWH 4LVHC 1LHZA 2AK4B 5E2TL 5TQ2L 5IBTH 2VERN 2MKLC 4QYOB 4ESKA 2FJFA 3WEXB 3MRHB 5E6ID 1IL1B 1KCUH 3CU7A 4X6DB 1JV5A 5E99H 2WLYA 3VMOA 5CIPH 3KPPA 1B2WH 3RVTD 1MI5B 1EGJA 2DQCH 4PG2C 5FKPB 3VFNA 2XZQL 2X41A 1NFIB 1A7OH 3QCTH 2VXQL 2W0LA 2KDGA 4Q0XL 2XQBH 2IPTL 5M95B 5K59F 2VMFA 3HR5B 3PQYD 3ZDYF 4RX4A 5KS9B 1TJIL 1T03L 1NBVH 4GRMB 4ZO7A 4RQQB 3IDGB 1DDHB 4ZXBB 4RSVA 4Y2OA 2AJ3A 5GS2H 4HH9A 4JB9L 5D7IF 5CBEB 4FQXC 1KB5H 4IRSC 2DQIL 4FS0A 5D9SA 4RZCA 5ELIA 3THML 3BW9B 1IZKA 4JJ5A 3VFPB 4U0QB 4P5MA 3RDTA 3CVHH 3T3ME 3HNTH 3MRBB 2B2XL 4YC2C 5F7DA 43C9A 1C1EH 2ZUXA 3LZFL 3PHQB 3DXAD 1U42A 1CFSA 5JLZA 4YDIL 4LIQE 4OGAC 1IGJB 2WBJC 4WTXA 4ZFFA 3CVIH 5CINL 1N64H 3RAJL 2AXJA 2VITA 1CE6B 1MWAB 1MWAL 2E3VA 1RIVL 3FRUA 4P5MB 5C0CD 3QT2A 4MCYB 5K59E 2GITA 3IDNB 1T5XA 1N0XH 4GXUM 4PRNB 3VRLF 2MJWA 4LCWB 5EPMA 1F4WH 5IB3A 3KHOA 2BNRB 3KR3L 3FQUA 4HXBH 4C56E 4QHMA 3PXJA 4YXKL 3OKEA 1Q9OA 2PW2A 4Q58C 1DSFL 4P3WA 1CU4H 2APTA 4JFFE 3MA7A 3EJYC 4I48B 3UPAA 2JTDA 3O9WB 3P4NB 5H35A 2Z91B 3P2TA 1E4XH 4LSTH 2R1WA 4RAVB 4NOBA 3RGVA 1GYAA 2OJEA 1JVKA 5EA0L 3VGHA 2GTZB 5KVEH 4FTVE 2LTQB 4PGZA 4YDVB 3L3OB 1JV5B 3NIFE 4JHZA 4JVPA 1T2XA 5C86A 4A6YA 5LXGH 1G7IB 2PTTB 3CFBB 1Y18A 4JRWA 4M7ZC 2YD4A 2WV3A 4MJIB 3QDJE 4QHKJ 2BVUA 2P49B 5C9JA 1AHWB 3CH8A 2EE2A 4U31A 1AD9B 4ODTH 4WU5A 5CZKA 1MCLA 3FN0L 3EUUA 2NTSP 4MJ2A 2YN3A 5D2LB 3FFCB 3FO0H 3OPZL 2HLAA 1BHGA 4OLWH 3ZKQD 1CL7I 2AEQL 1NEZB 3OKOA 3SGKC 4DN3L 1FIEA 5IK3A 4XNUH 5ID1A 1LDSA 2LTQC 4MA3A 1NJ9B 1UM4L 4HDIB 1JHKL 1R3KB 4OCRH 4QTIL 1GSMA 5SX5K 3L9RA 4UT9H 2H26A 1VCAA 4ODXB 1CGXA 2Q76A 5GJSH 3TT1L 3RDTD 2LAGB 5B21A 4PLNC 5KSBF 5MEQB 3N85L 1KJ2A 2Q6WB 3SDXA 4Y2DB 2ESVB 3QIWD 3ARED 5ALBL 1U8OB 3OXRA 3UC0L 3CXHK 1YN7B 3ZE2E 2DQEL 3TA3C 3GMQB 3DXAE 1EEYA 1EFQA 4WI7A 1DN0A 4OCXL 1DJSA 1CD8A 1IAII 1PVHA 3CFIC 1SM3L 1MUJA 4WHTB 5D70H 1MH5B 3MLZH 4OFIA 5JR1L 4ZDHB 5IMMB 1D5IL 3MLTB 2CJUL 5J3HD 1AO7B 3MREB 4K7PL 1AKJA 2X10A 5CGMA 4KRMB 2YD1A 2XWBB 4P2RA 1BZ7B 4F7EB 4YWGL 4Z76B 1WFUA 3BIAX 2E7HA 3BI9X 2MMXA 5HYSG 2BDNH 4S1RL 1IQWH 4IRJC 4F9LA 3AXLB 4YO0B 4ZO9A 4P46D 4QF1A 1FV1A 1NAMB 5CJ8A 4D94A 2G60H 3WNMA 5D7LA 3Q5YA 3KG5A 1BBDH 4AEHH 2CKBH 4LMQE 5IBUB 2Z31A 4APQA 5DURB 3TFKD 2D7MA 1KCRL 2EC9T 4C58B 5KZCB 3MV8B 3D85B 1H15A 2DN7A 4MQSB 2JELL 1PX3A 4Q74A 4X6CF 5IM7A 3R0MA 5J56B 1YYML 1AIFA 1FSKC 3U0TB 1MCBA 4Q2ZB 1MHHA 2EE9A 4UIKH 2BSED 4YHIB 3BVNB 1WITA 4NWTL 3Q1SL 5IVXE 4XPGH 4X80H 1OSZB 2OR8A 1EEZB 3VMPA 4KKLC 3LIZH 1DBJH 3ULUC 3C09B 2AQ3A 1I9RH 5DUPL 1JK8A 1ZSDB 4OV6F 4HV8A 1XGTB 3CMOL 2AXFA 3QH3B 3QPXL 5JNYA 1OP5K 5L8KB 2OTWB 4YHPB 5CZXC 1F6AA 1SEQH 4L8BA 2PNDA 3DMMB 5I19L 1B2WL 4N9GB 5DJ8A 5EOTB 1CCZA 3QIWA 4JANB 3WXVH 2ED7A 4M5ZH 1F4WL 4ZQKB 2ADJB 2NY4D 3SE9L 4L4VA 1OAXL 2B5IB 3H9HB 1XGQB 2I5YH 4PJ5A 5T3ZL 3UTQB 1C5DA 4YXLL 1C1EL 4V1DD 4LCUA 1RZ8B 1W72A 3DGCR 4HS3B 3C9NB 3N1PC 4JN2B 1N4XL 1RUML 1A6TA 4MXVF 4F9PA 1KB5L 1UB5A 5EO9A 4ERSL 2RAMA 3BDYL 1MIEL 2AK1L 4Z95H 3V2AR 4NO2A 2VLRA 2J8HA 3CH1B 3BQUB 3P0VH 5EZLA 2DQFB 2R9HC 1RI8A 5ISZD 4M1DL 1CTNA 1V3JA 1YNTB 5IW1A 5FYLE 1KELL 1I1YA 1NL0H 1UWXH 4OLWL 3CLEH 4RMTA 1RIVH 3X3FH 4L4TA 4NO0D 3S37L 1JNNH 1X4XA 2IBZY 3B4NA 1HOCA 4X99B 4PB9H 3MROA 2Q8AH 4JZJC 4DTGL 3S36X 5T1DL 3KR3H 4HXBL 4XNQB 4KTEL 1Q9KA 5JORB 3SDDC 3CFDA 1KENH 4OZ4B 4OCYL 3ULVL 1LNUA 3UTTB 4FQCH 3SQOL 3BEVA 5IMOA 3L3JB 4GW1B 1S7UB 4F57H 1OD7A 1S5HB 3CFJA 3OAUL 3AFLA 5M94B 1AGFB 2ZG1A 4OZFG 2ZCKL 4GW4A 3P0YL 1UJ3A 3REVB 5MEOB 3QO0B 3K74B 2Y6SC 5C9KA 3FRPG 2HFEB 1JNLL 3O3BB 1NC2D 1A6AB 5D7SH 2X42A 5DR5H 3OKNB 3B5TA 3SJVB 3TZVC 5JHDA 1MRDL 3W5MA 5F7MC 3ARYA 1QVOA 4LSUL 4DUWA 3PL6D 2BY3A 1WGOA 4ZO6A 1JHKH 3RJQB 2APXA 3U1SL 1KJ3H 4FQHA 4L3ED 1PZUB 5I75C 1Q94B 5DD3H 5FYJU 1XMWA 3FJTA 1IGYB 2CLVB 2AI0L 5D72L 2CLRA 4OCSL 4JQXA 1T20B 4NSKB 4BKLB 1WF5A 4KK6D 4U1GC 3RVVC 4AEIH 4XP9L 1XCTA 1ODAA 3KLHC 3CFJB 4FQJH 2FATL 4Q9BA 2DQJH 1DANT 1HILA 2DQEH 3U7YH 3GSUA 1N5AB 2JCCF 4JQIL 3LRSB 1GZQA 4LDLB 3SPVB 4AEHL 1U6AH 1A6WH 3FO9A 5LCVL 4M93B 3U0PB 1HHHB 3LS5L 2B1AL 2CXGA 2HTKC 4BJLA 3LEXA 1UCBL 3WE6B 3MA9H 1HSBB 2DKUA 1VFBB 1QA9A 4WNQB 4JFED 1NUDA 4EN3D 3IF1A 2DMKA 1Q9LB 3C60B 4G7YL 1JCKA 4LCIH 3EYQC 3WIIH 2AJXH 4GS7C 3AMLA 2DQFA 4ETQB 2UUDH 5DUBA 4IEFB 1FPTL 4QGTA 3BQUA 4FFWC 4ZPTA 1D5MB 3CPLB 4I13B 3CH1A 4LARL 2F19L 4MSWA 2C4FU 3G6DH 4OQTH 3T3PF 5EBLA 4ZTPL 5EO9B 4ALAL 1EJ6A 5EU4A 3NIGF 3RI5K 3GNMH 4L5FL 1T1ZB 4JN2A 3B9DA 4LGPB 4XXDB 4NQED 5DVKA 2R0LL 3LD8C 1KTKE 3VD3A 3MCLH 2PYEB 4ZMAT 4NN7B 2E7MA 1PAMA 1C5DB 5I1HH 3LSOB 1MPAL 1XGQA 1MI5D 1NEUA 4L3EA 3MX0A 2EDYA 5DVLA 4C83B 1I3GL 2AJZB 3SDCA 5EOTA 1A3RL 5DJ8B 1II4E 2LFGA 1SJXA 4Z78A 1CICA 1EHAA 1F2XK 1EERB 2Z35B 1ZVSA 2AXFB 3O6FA 5CAYB 3DO7A 1JK8B 2M26A 4IRJA 2H2SD 3DUUB 4NJAL 3H0TB 4XVUC 3WFEH 3LMJH 5D71L 5T3XE 4H0HB 2V17L 4MDIB 3VJ6B 3Q6FB 2E6JA 4RX4D 5LJYH 3P4LA 1AIFB 1MJ8L 3U0TA 1FZMB 4G8EA 1K3ZA 3MRKA 4L1DA 5D93C 3UTZA 5I6XB 1KCLA 5CMAA 2NY6D 4MDJA 5E9DB 3LN4A 1CLOH 4G6AC 5I19H 1MNUL 3LKOB 5FO8B 2Y6SD 3PWNB 2D2OA 3MV8A 5IG7A 4DJMA 1GOFA 1NMCC 2P8MA 4WFGD 5T3ZD 3EBAA 3AREC 1ZGLA 4JFEA 4D9QE 3HZYB 5DZOA 5CWSB 5EO1A 3AS2A 1ND0A 3HAEG 1HE7A 1DVFC 4XBGA 2WUCL 2EEDA 3KPSE 4HJJL 4YO0A 3AXLA 4FABL 1KELH 4ZAKB 4NKDB 4MXQD 1MQKL 1YNKH 1CQKA 3LQMA 4L8CA 5GZNC 1SMOA 2AK1H 5F7YC 1HCFX 4O2FB 3INUL 5H94A 5JXEA 2OZ4L 1TQBC 2XWJA 2WQ8A 4G6KH 4ZUVA 5FO9A 5T1LA 2VDML 2CIKB 4PJDB 2Y5TB 4D9LL 4BFIB 1MCNA 1F3RB 3QUYC 3OL2A 1D7FA 5C0GB 3MLVH 4HKBB 2DQHL 1UEMA 1BFVL 1TZHB 2B0SL 4F9PC 5IFHL 1S7TA 4WI3A 5F71A 3WSQH 3JV0A 4PB9L 5JIIA 3GMPB 1OP3H 3N1FC 1K6QL 2I26N 4QRRB 3MRCB 3ULVD 4X9IA 4E41D 1G7HA 5IT2H 1JPFB 2Q76B 2P42B 1KJ3L 4NUGL 1FRGH 3TNMB 1ZHBA 1MHEA 5KVFL 1H3TA 2VLME 4GAGL 4JCMA 4LDEB 3M1BA 1YMHB 3MOBH 3QRGL 4OLUL 1V3KA 1J88A 4MA3B 3V8OA 4TUOA 5EWIL 3ZKXC 2BX5A 1A4KA 3VXSE 4WI2A 2XZZA 4ZUUB 3FFCA 1JNHB 3SDDB 5GISL 5ICZB 5F96L 4JZJA 3NAAL 1G9MC 1IGMH 4MJIA 1MCOL 3ZL4L 5DHVA 4X6BA 2VIRA 4DZBA 2PTTA 4BZ2L 2WINA 4E0RB 5GRWA 3DX7B 1FNGA 4E41B 1YEGH 1A6PA 3GJFK 2IBBA 5I15L 1F6LL 1KPVA 2AI0H 4U6YB 5SWZD 4JFHD 5ITFA 3DRQB 1FP5A 1U3JA 5DMIH 5F6IB 4MD5A 4ODBD 3ARRA 3S36H 4RFOL 5H35B 1WBZA 3B6SB 3QZWA 4D9QD 4R9HA 3MLUH 1QOKA 3BKMH 5D1QA 5I1EH 4DGVH 3T3PE 4LPTA 4XPFL 3ZYJA 2UY6A 1F6FB 2DOCA 5CEZL 4TOYL 1QFWH 3MV9E 4OKDA 4HGWA 5FV1L 4JFDD 4PJFF 4GRWE 5IB3B 2A9MH 4PJEE 4XNMA 4M5YL 1GGTA 1BFSA 1FNSL 2GITB 4QO1A 2BRRL 3B2UD 3KJ6L 4W6XB 2J88L 3SDCD 3RUGA 4XMLL 3LKQA 1NCAH 2VXUH 4KJQC 4F33A 1IGJA 4J3XA 2P5EA 4ZFFB 4XWGL 1F13A 3OB0H 5CEYB 1NBQA 3PHQA 5CS7A 5HHOB 5KOVC 5EOQH 4WI6A 5CLWA 5FM5O 1DVFD 3NH7L 4JJ5B 3F65A 1EHNA 4AMKH 4QXUH 4K94C 1A64A 4FQLH 5CBEA 2V2XB 4HH9B 1BD2D 4JZNB 5CJBA 1ZXQA 1G9NC 4S1QL 1MJ7L 1X7QA 3UTTD 1TPXB 4QRTB 5I71B 3QO1A 4TUKH 1LEIB 4PJEF 3V5DB 3QB7C 4M61A 2VLMD 3FN3A 4WUUE 3GSQA 4PJBB 3TZVA 5I1JL 4NQDD 2AQ1A 5E2VH 3FQRB 1N64L 2FNBA 3RAJH 4E42B 3BKCL 4K55A 1AE6L 2HFFB 2XTJC 3KPPB 7FABL 3JSSA 1KPVB 4R97B 1FNGB 5E00A 4NHUB 3QCUH 1QNZL 1CLOL 1TDQA 3CFEB 2O5YH 3HI6L 3WEXA 4WHYH 3NACH 1LQSR 4LCCB 2IAMC 5MENB 2FX7L 4LHUB 2AK4A 1GXEA 4LFHD 2ARJA 4KK8D 4LF3A 3U7WH 2Y5EA 3HG1D 4Z9KB 3W11C 3VXNA 5LAXB 4HKJA 1CGWA 4LRIC 5T1MB 4H8WL 5I8EA 1CXFA 1CIUA 5EBGA 1YMHA 5J1AB 2B39A 2J6EL 3P3YA 1BFVH 1RJCA 3UAJD 1RJZA 3MFFB 1JTPA 1QLRA 4N0UB 1IEBB 1UH4A 3DUSA 3TO2B 1CLZH 1ITBB 1I1AB 1NMBH 2NLJB 2OSLB 2VDNL 4NDMA 5EBMB 3G5ZB 3DIFB 5DQDH 1I7UB 4LSVH 1RURH 1HSAB 4HFWB 4Z7UB 3PIQA 3B9KC 4G6KL 4EQ3A 1DBAH 4OFVA 3O4OC 2LQRA 3DMMD 4ODTL 5MI0B 5C0GA 1P2CA 3VFMA 4HXAL 4JKMA 1U2HA 1DQTA 1YNKL 3I3EA 1GGIL 1YEJH 2CIKA 1U92A 5E5RB 3EOAA 5LGHH 1JPTL 1Z9OA 1MOEA 3QQ3A 1Z0NA 3MUGB 2VE6A 2YD2A 3ZKND 3EYSH 2J7LA 5MENE 5KVMC 4URTB 1OGAD 5GZOC 1OTTC 1BWMA 4G8GA 2VE6B 1GPOH 3QQ3B 2FX9H 2NY7L 1YN6B 3DETD 2EYTA 5EIQA 4LLYA 4LAQH 2QR0B 5KVFH 3NA9H 4LHUG 1LO5B 5GRYA 1DEEB 2XZCL 2P1YA 4OIIL 4PJFE 1ND0B 3GSXB 3PIQB 2EO1A 4LAJH 3VFOA 1T0NA 5DEFB 2F74B 1ZGLB 3IVKA 4X98B 5E9DE 4K94H 2OSLA 1JWUB 3ZTNL 1D6EB 3SDYL 3CDGA 4UV4H 3PDGA 1CTOA 3O0RL 1N5YH 4LVNC 3LD8B 1NC2B 1YQVL 4LL9A 4PRDB 3TBYA 4Z7VF 2H32B 5EWIH 5FAAA 5C6WH 1IC1A 2RCSH 3KPOB 4EDXA 1UZ8B 3MV7B 5HYSB 5FB8B 3TA3D 3Q6FA 2BSRB 2G2RA 32C2A 1T3FA 5INDB 4HZLA 3MRGA 3VWJD 5CD3A 2Y07H 3DUUA 1DUZB 2WP3O 2NMSA 1XF4B 1RIUL 4BELD 3KAAA 3RZCA 3GKZA 4XP1L 1L6ZA 3GSRA 1TVBB 4FQ1L 3NH7H 3IFOA 5IB5B 3LN9A 4Z77B 2FIRT 3TVMC 3KNBA 4XI5C 1YMMD 5DDHB 5C09A 4U0RB 4FRWA 4P2OD 5C7XL 5EUOF 3KLAA 4NO0B 3SDAC 5GQBA 3FQRA 4TNWK 1MFBH 1MVUA 2OJZH 3AM8A 3OMZA 4IRJD 3QFDA 4GBXD 1UYWL 2K9UA 3NIFF 3GSQB 3D2UB 4NKMA 3B5GA 4I0CC 4GKNA 5F3BA 1QBBA 4DQOL 4M6OH 1V7NH 3V5DA 5HHPB 4XVTL 4R7DB 4DFHA 3QO1B 2IQ9H 3VH8G 1X7QB 1LDPH 1QBLL 5D5ME 4FZ8H 1XGPA 4YK4B 5JHDE 2N4IA 1OP3K 5HHVL 4P23C 3GUTB 1XF2A 2LVEA 3BRDA 2HMIC 3KS0H 1D5MA 5DLMH 5IHUL 5I8CB 2YRZA 1B3JA 2CMRH 2VXUL 5L2JA 4HLZG 4U1SA 4NQCB 2IAMD 5HDBE 1D6VH 4WO4B 4JQVA 3SGEI 4WI4A 1IAIH 2P5EB 1MHPL 5E7BA 3SO5A 2COQA 3IDMB 4HK3J 5ID0A 1YA5A 4MJ5B 3CFKA 1EHLL 3ARFC 3JWOH 5C0BE 2UZIL 3FQTA 2BVYA 3ARGD 3NZHH 3WCYA 1I85C 1SBSL 2XOTA 3QA3B 2C5DC 3FO9B 4NQXA 3PWJA 5CLTA 5J6HB 1QR1A 4XNMB 5HYIA 1KXTB 3UCRA 5J11B 2XG4A 4JEGB 1GZQB 3FB7B 3SPVA 4YDJA 1DE4A 3ULUE 3MZGB 1CD9B 3BXNA 5GGQL 4X7SH 1HHIA 3BPCB 1RURL 4KTDH 1QSFE 1XCTB 4PJ7F 1BAFL 4XPAH 3K4ZA 1U8NA 1NL0L 3IU4L 2H3NA 4MJ4A 1INDL 2GQHA 3OKMB 2BOCB 1G0YR 3WMSA 4LKXA 2BOCA 4Y7MA 5DYOB 4FQ2L 1WAAE 1AGCB 3HUJF 4E41A 4JY5H 2FB4H 4YDLC 1DVFA 3RIAK 4KTEH 4P5TD 3QHZL 2HFEA 3O3BA 3O8XC 2I24N 1BVKB 3I85A 5I1DA 2VXVL 3QO0A 1JNHA 3SDDA 2ESVE 1A4KB 1YNLL 1E4XI 3QIBC 3BXNB 1CD1A 3FFCD 4N9OB 4PJHA 3P0YH 3MLYL 1KFAH 4BM7A 4KVNH 4YHNA 12E8L 1GCFA 3DVGA 4NO3B 2ZSVB 5EO0B 4I8DA 1DQLL 4Y0GA 5E2UH 2WSKA 4MJID 1S7WA 1Q9KB 2C3HA 3GBNH 4OLVH 5F7KC 5J6HA 5I1CL 1BREA 3MBXL 4LVHB 4X99A 3B9VA 3RZCC 2DQIH 4WENB 4RGND 4DVBA 3WDIA 2QADB 4Y16A 3VGEA 4UOW1 4R3SA 1NDGA 3K4AA 1RJYB 4ZSOE 4NBYB 4J23A 2X4UB 4HKBA 5I74C 4NQCA 2AJVL 4P4KD 2CO6B 5E6IB 1QKZL 5SWZA 1JZ7A 2V7NA 4W81A 3JZ7A 3O6LL 4Z7QE 3SKNB 1XF2B 3I75A 4S0SD 1INEL 4NP4H 3L5HA 3QXDA 1NGYB 35C8H 4KUCF 5EU6A 5D2LF 1CDJA 2R69L 3SDYH 1MCQA 4PD4K 5HDBF 5KVGL 4HS3A 4HUXA 1QEWB 3JWNC 3WFBL 4FZEH 1S7SB 4KU1A 2EXWD 3K8LA 3KDMB 4NKMB 3MV9D 4X7EC 3D2UA 2DKSA 4Q9CA 2RBLA 5J89A 3RP1A 3LN5A 4XBGB 3NGBB 4Z7VE 1RY7B 4UAOB 3DXAB 2ADJA 5KSAB 1FVCA 3MODH 5IJVA 2EDEA 1DFBH 4YGAB 4J1UA 4JANA 2A0LD 2ITCA 4PP1D 5K9JH 1TJHH 2P8MB 5J11C 3MBEC 3GSRB 5JNYB 3C2SA 5FO8A 3G6DL 1LWRA 3DO3A 1DUZA 3D5OF 3IAGC 4LVOC 5JW4N 3KPRD 2RR3A 1DANU 3VFTB 4HUNB 2VLJE 4RGNC 3V4UL 1G84A 3UYOD 4UNTA 4PG2A 4XP5H 2H32A 3BSZL 1TMCB 5GGUA 1DQMH 3F5WB 2R2EB 4CVZA 1BQSA 1I4FB 1TZGL 4R96A 4DGYL 3GI8H 1AXTH 5GRJL 1R5IB 3O6FB 3KHQA 4QRRD 3FQWB 1NFDA 3GIZH 1CICB 2M1KA 4Z78B 1KC5L 2ITCB 3VFOB 5J12C 3RIAF 4QGYA 3BD3A 4APQB 5IJVB 3O2DL 2D7NA 3DVFA 4YX2H 5JOPE 3VXUD 3RWDA 5IFAL 3GSXA 3DXAA 5HVHB 1GC1H 2VRAA 4QF1B 1SVCP 2AXGA 3NN8B 4PP2A 3O6FC 3RKPA 2EYTB 1S7SA 3L3KA 5DD1L 4XVJH 3WNNA 1KSRA 1MCPH 2X89A 2Z4QA 1X5HA 2A6IA 1QSED 4WIQA 2FO1A 2YA1A 1AO7A 3MREA 5EU4B 3OWEA 1F42A 2HT4C 5DVOA 4FFVC 5JZ7C 3VMNA 2MSPA 2MWCA 4WHCA 2BNRE 3CNKA 2FB4L 4ZPTB 2CK0L 3TPKA 3WNKA 5MI0C 3VFMB 1JHLL 5BJTA 4HKZA 3T2NH 1U8OA 3OXRB 3C60A 1RJYA 5FCSH 3IF1B 1WWAX 5HDQH 4BFGA 3TEUA 1FFRA 1H3WM 2VB5A 3WE6A 2CKBL 1PSKH 3DIFA 5F93C 4DVBB 4P3DA 4KKBC 1C8PA 12E8H 4PJXB 1I1AA 2NLJA 2IMNA 3U0WL 5FUCC 4N0UA 3HE7D 4EZMA 4LBEA 3MFFA 1R3KA 5I73C 4OJFL 8CGTA 1UKSA 5J1AA 2YR3A 4PJHB 4MCZA 4X8JB 4EEEA 2F53D 2FX8L 3RUGE 5IHLB 4XX1G 4GSDH 3KJ4C 2HLAB 1OW0C 3VI3F 4LPUA 3GKWH 1NLBL 2O61B 1F11B 2HFGH 2ARJB 5C9JB 3MOQA 5HGHA 1X4YA 2XIDA 4QEGA 4MA8H 3L6FA 2CLVA 1U8HB 3CFBA 4OLEA 3MRDA 3TO4A 4A6YB 2FHBA 5E00B 5DYOA 2APBA 4YXHL 3GMLA 4UB0L 1S5IH 1T7YA 2OJEB 4NP4L 3JUYA 3OKMA 4HG4J 5ESQB 1H5BB 1Q72L 2V5MA 1OLLA 4U1GB 2BMKA 4PJBA 3WNOA 1BFOA 3WKNA 3GSNB 4GW4B 1WICA 3BPCA 1U8KA 1ZTXL 3CLFL 3HG1E 4LCWE 1LNUB 1BX2A 4FOMA 4HBCL 4ORZC 3BH8B 3RZCD 4XNQA 4PRNA 3IDXL 1T5XB 3O2DA 1FNAA 2Y7QA 3MXVL 2HVKB 3SKOA 2A38A 2EC9U 1HI6A 5DZLA 4E9LA 2QBWA 1PW3A 5FYKH 2FL5A 5CSZA 4MJ5A 4N8PA 1YJDL 5ID0B 2VITB 3IDMA 4JQVC 2AP2A 1CDHA 1IKNA 1CFSB 3RUGB 3V4UH 1YNTA 3MRBA 4JPWH 3X3FL 1Z5LA 3VFPA 2IMMA 2EH7L 3T1WA 3T65A 4RZCB 4NO2B 4DKFH 4D0DA 3MGTA 3N1GC 1A1OA 4CMHB 1V7ML 1GIGL 2ZUQB 5KJRL 3OB0K 4CMMA 2IEPA 3UO1L 4S2SA 3BESR 3QAZB 1QSFA 4LKCB 3SE8H 2WLZA 3TJEL 4NZUL 1D3CA 5C0JA 3IDGA 4O9HL 1A6TB 5FUOH 1X5YA 3C9NA 4Q6IB 4LCUB 4MS8D 4WWKD 3EDDA 4R2GC 3HR5A 1M6OB 5J1SC 2FO4B 5DJZB 3WDHA 3QQ9C 2NY3B 3VGAC 2Z8SA 4PR5B 4L3EE 2AGJH 2OXGA 3K2UH 4P0DA 4JO1H 4J3WA 2MCPL 3X17A 4M03A 5SX5H 5DJ0A 3VG9B 1M7DA 1U3HB 2XTJD 4Z77A 3JWDL 3SJVD 4AMKL 4DZBB 5DHVB 1I3VA 1ZSDA 1MFDL 1EA9C 2C3XA 2K7PA 4JZJB 5BO1L 3Q6GH 2EDRA 2BJML 4IOFD 1F58L 4M7JH 2BC4A 2DMCA 4TTGA 1S7XB 4JLRB 3WN5B 1B0GB 1CLYL 1IFHL 5HYSA 3UTPE 4MX7B 1F90H 5E4EB 4PJ8A 1J11A 1NC2A 5F1KC 43CAA 1QRKA 1FGVH 3UTSA 1H15B 4JFEE 2W9EH 4OZFH 3MRCA 4LLWB 4MAYC 4NKOB 4KMLB 3QEGH 3S6CA 4NT6B 3F8UB 5FGBA 3HI6H 1S7TB 1H8NA 1X5ZA 4QRUB 1SYVB 3OF6A 1N6QH 1ZLUH 2VH5L 2X1QA 3B2VL 3KVQA 4XC1H 5IMLA 4Y4HA 3RY6A 2EH8H 2Y5TA 4WWKC 1JNNL 1ZKAA 1EO7A 1C7SA 1YN6A 4X6DF 1NCBL 3UPRA 3D69A 4FTVA 5HI4C 4LARH 4NQEE 1XR8B 5IWLA 1IVLA 4ZDHA 5IMMA 4WU7A 1D9KC 3MUGA 2R4SL 5ESVB 5I8OH 4YXHH 3U0WH 2YS4A 4FTVB 4Y8AA 4LNVA 1Z3GH 3ARDD 4NKDA 4F7CB 2A1WH 3UPRB 3PG2A 3I84A 1Q72H 3MR9A 1NCWH 2P5WB 4F58H 3GJFH 4YIQB 5E6IC 3V7MA 1LO0H 1YN7A 3OGOE 1WV7T 3OG6B 4PY7A 5DR5L 3MLWH 3NCYP 5D7IB 4XB7A 3HZYA 1KBGH 3BN3B 3EOBB 4HGMA 1I7UA 4JFEB 3FQNB 3KS0J 1PZ5A 2OXHA 1RZJL 5IBTL 5GGTH 3MRRB 4OM1H 5EBMA 3PWNA 5DO2C 3W5NA 1FC2D 3AGVA 3TO2A 4OJFH 3O3EA 1UACH 1T0MA 4OLZL 1QBMH 3IDXH 4I0PD 4OGXL 3L9RB 5FYKU 4JFYA 4GRWH 4Q6IC 3THMH 2FX8H 4NJAH 4XP9H 4I3SH 5D1XC 3SDAA 5ID1B 5DFVC 4XAKE 4RRPG 3WN5A 2FATH 4UAOC 4UBDC 1NEZA 4LAQL 1D5XB 2Q20A 3LHPL 2DLFH 2YA0A 3H0TA 1JF5A 1T66D 1G7QB 4IRJB 1U8QA 2B1HL 4L9DA 1CXHA 3NOIA 4NN7C 3MPCA 5HVGB 3EOYG 4BQ8A 1SJVA 2HT3D 5F7NC 3WFCH 3CFEA 4HPOL 3W82A 4QXTB 1T1WA 2JJTC 4NHUA 5JOEA 1M7DB 1N2RA 3KYMB 5EZJA 5EZOL 4L3EB 5DWUH 4M1GL 2ZJSL 1MCWW 3LSOA 2XQYG 3TZVB 4MQXD 3TYGH 2FO4A 5DJZA 2YPLD 1JZ8A 3V0WH 4YDIH 1PKOA 2UZYB 5B4MC 3RL1B 4GUPA 2HKHH 3C8DA 2VLLA 4P99A 1OAYH 3OKEB 2F19H 1DLFH 2YUXA 4WFHE 1E4XL 4DN4H 4OI8A 1QSFB 5C0JB 4JZNA 3FQUB 4JO1L 1A6ZA 3G9AB 2YD8A 3KPRE 1A6UH 1KCKA 4H1LG 3IDNA 2Z9TA 4WW1A 4PRPB 2X9YA 5DUBB 3ARGC 3ILQD 2HRPL 5F7HA 5JW4Q 3BP6A 4WUUD 2J5LB 4KKCC 4AM0A 4Y16D 3RHWK 4TSCL 1UKQA 1KTDA 3LKPB 3MLVL 2AEQH 1ADQH 3LKQB 5JLZB 2EDKA 3OX8B 4XNUL 3OKDA 3EYOB 3SE3A 4WGWB 3QWOA 3RDTB 5JIHA 2O26U 2IGFL 1MCSA 3U0PA 3EHBC 3S35X 2NW3B 3ARFD 2OBGA 2HTLD 3BO8A 5I30H 4J6RL 1N5AA 3QBTB 3CIQA 3QFJE 1JHTA 2AABH 4QNPF 4HGWB 5B39G 4W4OC 1EZVX 4LDOB 4I2XB 4EI5B 3QNYA 5DSCB 3ARUA 1QSVA 3OG4B 5KS9A 3GSNA 5FIEA 5INCB 5D1QB 4M7JL 1WBZB 5SWSD 1P53A 1A7QH 1NFIA 3BDXA 5AWNL 2R29L 3MJGX 1OY3B 1TZIB 1NAML 3CK0L 5KVDL 3OSKA 3OR6B 1IGCH 1Q94A 3WXWH 1TTUA 1AC6A 3DX6A 3PV6B 3MJ6A 1U58B 3QEQE 5I73B 1I1AD 5JR1H 2R2BB 1MCIA 3MRDB 1FNFA 2VIRB 2FJFB 4K7PH 5JHDB 3OKNA 4NZTL 2VDKL 1RU9L 2YOCA 5J9PA 5BW7C 1JMZA 1B6UA 5ICZA 3DV6B 4GXVH 3W81A 3V6ZA 2HJKB 2ICWB 4MA1B 4TUOB 2DI7A 3MNZB 3UYPA 1BJMA 3UTTA 4X8JA 2X05A 4MQ7B 1T22A 1MHEB 1CT8B 4DW2H 1QFWL 2M2DA 4LBEB 1EBAA 2D9QB 2GCYA 2HWZH 2PTUA 3AUVA 3VFWA 1VEMA 2DYPB 5IR1A 1G7HB 3MROB 5HDOA 2YUVA 4Z7NE 2VDPH 1LO2H 2P5EE 3GMPA 3MRJB 3VA2C 4Z7WE 4IMLB 3O41B 3V7AG 1CDUA 3HRZA 4ONGL 1RJLA 4LP4A 2DQHH 2DLGA 1U3YA 3BZEA 2B0SH 2EH8L 4HKZB 3LQAC 3HMXH 5KTEL 5EBWA 4IOIB 2VXVH 3DURA 2ZWLT 4KH2A 4XT1C 4D9RD 4F7PB 1Q8MA 5TJWK 3IFLL 3ME0A 2XWJB 4ZUVB 5T1LB 5SWSB 3TCXA 3K0WA 2CH8A 5F88B 3D3VA 3MLYH 3BIKA 5H94B 4O2FA 1J1XL 5E2UL 3WO3B 1E4KC 4HPOH 4XBPB 3BRFA 5H8DA 1Z0MA 3T0EA 3MNWB 1UM5L 2BNQB 1CGVA 4KROB 3N9GL 2AXGB 4PP2B 3MV7E 4PJ5B 4NUJB 3ARQA 4I3SL 4UTBL 3JV4A 5CWSA 2XA8H 3FOLB 3QIWB 5FYKE 4BQBA 3W0WE 3DMMA 4KJWC 4H25A 4XAWH 5C0DA 4WWID 4YBLC 2NY0B 3OTTA 5D7JB 1XGTA 3QCUL 5KSUB 3IAQA 3LN4B 3P73A 1OP9A 1I4FA 3P77B 4EN3C 3UTZB 5ESAB 1EEZA 2F53B 4GW5B 1FZMA 2BHYA 4PYGA 2MQCA 4JY4A 3NFSL 4M1GH 2KZWA 3ILQC 2WBWB 4ELMF 1NSNL 4GW5A 1UGNA 2F53A 5TFSL 4QHUA 3WFHA 3H3PH 1CLCA 2OMNA 3P77A 2VUOA 3PL6A 2WUBL 1ZVSB 3D85A 3GM8A 4JGMA 3PWVB 2DLTA 5C0DB 3VFGH 1TJHL 2W59A 4GJTB 3FOLA 2ZJSH 5I8KL 4G42A 4G9DA 4HKXB 5GZND 3JV4B 2X4RA 4P2OA 9CGTA 1L9MA 2NY4B 1E6OH 4HMDA 4R6UA 3MBEA 1AFVL 4A2MA 1YEFH 4EUPH 4IBLT 1YEHL 4QRQB 4KZEH 1E0OB 4M4RA 3V9FA 2PYEA 1OAYL 3QEHA 5I18L 1EMTL 2UWEE 3MLXL 2QQLL 5C0BD 3RTQC 4G8GE 1IBGL 4ODHH 3PWPD 5AWNH 3MLTA 3GIVA 3EO9H 4OF0A 5HYQA 1IC4L 4LLDB 2VZ3A 4Y2DC 4TRPH 3BIKB 1R3IL 2EDQA 2OL3L 2C4FT 5SWSA 4MSWB 1LK2B 3GJFA 2OQJA 4F7PA 2YBRB 1K2DA 5KBNC 4NPYB 1DN0B 1EEYB 1X5LA 5E6IA 4JKPL 1J05B 5EBWB 1H3GA 5TF0A 4Z7NF 2MPAH 1CL7H 2P7TB 3LCYA 1HKLL 4FNLH 3S37X 4KJPC 3HE6A 3KPSD 4R3SB 1QA9B 1VFBA 3O11B 1WT5A 4IMLA 2DMBA 3MRJA 3LEXB 4IS6B 4DZ8A 3QPXH 3FT4A 5CJQL 4LU5L 3QHFH 3QP3A 4ZTOL 5F6HJ 2GCYB 3QXVA 2H26B 4ODXA 4GS7B 4YFDB 3GSUB 4FP8L 4ZOAA 3F62A 2VC2H 4UBDD 1YQVH 1S7QB 4WJ5A 4LGSB 4AL8L 4JG1L 4BSWB 2F58H 3NCYS 5DJCB 2CK0H 3V6ZB 3T0EC 3J8F7 1QPXA 1FJ1A 5DHVH 1AD9A 5FDWA 4NSKA 1TQCB 1AHWA 4WU5B 5L2KA 4NN5C 4FQJL 1VHPA 4BQ9A 1IGYA 2HN7A 2KUTA 2VWEC 4TSAL 1S9XA 3DARA 3L3OA 5TGBB 1ZLVH 1U58A 3BMWA 4M8QA 4JPKH 3DX6B 4Z7QF 4RMVA 5DQDL 5C0AD 3HZKB 4MQXC 2YD9A 3A67H 5T1KA 1SMAA 3TT3L 2B1AH 3SJVA 4PV8B 5GHWL 3PGCB 4FFWD 3O9WA 5HHOE 1U8NB 4HWBL 1A6VL 3MA7B 1CFVL 2APFA 4KY1L 2AW2A 3N9GH 1Q9OB 2PW2B 2BXYA 4I2XA 5DSCA 4EI5A 1S7UA 1R0AL 5BOZG 4YPGB 3X13A 1DE4B 3P11H 4YDJB 5EIIA 4Q97A 3FB7A 4G9FA 3VXPB 1NGZA 1TETL 3VXTB 4B0MM 4O4YH 5HHVH 3MFGB 3PWJB 4KKLD 2QSCL 1QR1B 1IKFH 3VGDA 2PXYD 3KLSA 1E27A 4M62H 3GEWB 4NC0B 1HOCB 4MGXA 3FRUB 3WJJC 3H9SB 3QUXC 3OKDB 3OX8A 1A22B 1J9CT 4L4TB 3WFEL 5D8JL 3UMTA 4RFNC 3LB6C 4NQCE 4XCYA 5C3LD 2GSGB 5DO2D 3QNXA 3V5HB 1G0XA 5L2JB 1MRFH 3BW9A 3ZYZA 5D9SB 2EDXA 5C2BL 2NY3D 2XY1A 1A6ZB 2NY6B 4I9WE 1FYTA 3WLWD 2AJ3B 4UQ3B 4S11A 2WBJB 4RQQA 4JAMB 3BPNB 2XICA 5HTSA 4GRMA 1HIMH 4GUPB 1W72B 2EE6A 2Q8BL 4H8WC 2YPVL 1TNNA 1MIML 3QULB 1T5WB 4GLRH 3VFNB 1OQOA 3UJIL 4E41E 1J1PL 1E4KA 2J8UF 2DL9A 3W2DL 2B20A 4HLZH 1XZ0A 4UINH 4M8VA 1F4XL 1T21A 5LKNA 4PJDF 2IFGA 4QXTA 3RA7L 4WHDA 3IFOB 5IB5A 1TVBA 1TFHA 4TRPL 2DKMA 3LKNA 2D0FA 4DOHB 5J13C 4K7FA 1CR9L 4HV8B 5KJRH 1U8QB 5C0IA 2J8OA 1UYWH 4TN9A 4I3RH 3BUTA 5CD3B 5I8KH 1AGDB 3ABZA 1I9IH 1G7MA 4YZFE 2VLRE 4AEFA 3TVMD 1T3FB 5INDA 2BSRA 2G2RB 3BVNA 5B38B 4DK3A 4ELMA 1XF5B 4Q2ZA 2PR4L 3BISA 5B8CC 4PLOB 4KZEL 3CUPA 5GS0C 4QXGL 3V6FB 1FZKA 5HI3D 5E8NA 4JFYB 4FZ8L 1ACYL 4NO5B 1MLBA 2WIMA 3QFJD 3VWJC 4NNXA 1QYGL 1AHWC 3V0VA 4MHHI 5IOPA 1D6EA 4PB0H 3DV4B 3VD5A 3SO3C 1KJVA 1XR9A 1PZ5B 4X98A 1FVDA 5TF1L 2EICA 5I66B 5D7IA 1B0WA 2WK2A 4HIXL 4K3HA 2AV1A 2GJ6D 2OR9L 4UILH 2HLFD 1MHPH 4NRXA 1Q1JL 2E6PA 1HHGB 5T5NF 2QR0A 2P5WA 3RJDA 3MRFA 1B0RB 1JL8A 1VENA 2CSPA 1VDGA 3QEQD 3RKDC 4F7EA 2XNAA 5JIPA 3FO2A 3BHBA 3RX8A 2Y72A 5J0BA 4R8WL 1KEGH 3QIBB 1XR8A 1WFNA 1MH5A 1ETZA 4J4PD 1MUJB 4WHTA 1P5VA 3S9DB 7CGTA 3JTSB 1U92B 1F8TL 4KHTH 5DRNA 4X83A 3FZUC 3MRLB 4Y4HB 3GMQA 4RFOH 3M17B 4F15C 5JHLH 4QRUA 1YPZB 3R1GH 1YECH 1HSAA 4Y2DA 2AAVA 4DOHE 1I8MA 1CVRA 5MEQA 4HEME 3F7QA 3GJEA 2G9HA 1FE8H 3G5ZA 3LKRB 2BERA 1OTSC 2QADD 3ZL4H 3KXFD 1BGXL 3DUSB 1OTUC 4LSRL 3KPLA 1P9MC 1XEDA 4QLRA 2VZ1A 4Y5YC 3MACH 4PJ8B 4MX7A 1RJZB 2DRUA 3EZ8A 4N5ED 2LAAA 5D1XB 5IKCA 5FHAH 3HZVB 1S7XA 4JLRA 1EFXD 4PJIA 3PJSA 1QHOA 2UY7A 4LOUC 4H20L 4HKJB 3VXNB 3NPSB 4KY1H 1IEAB 5GGSY 1KB5A 4TUJA 2G60L 1DQML 3T0ED 1K8IB 3ALWA 4LCCA 3D0VA 2B4CL 3FL7A 5MENA 1Y18B 2I60L 4GQ9L 4EKXA 4JE4B 1DL7H 4QXUL 3TCLA 4X6CB 3WNLA 2GTZA 2PO6B 5JXAH 4PJEB 5HI4D 1VFOA 4MA1C 5L9DL 4JG0L 4RAVA 2R0ZH 3RGVB 4XBEL 3U6RB 1C08A 1N0LA 3AB0B 1UZ6E 1GAFL 3S4SA 3RTQD 4M61B 1DZBA 3OKKA 4RDQG 4Q6IA 3S8WA 1IGIL 3LRGA 4M00A 3M45A 3VFUA 1V05A 5CILH 1XF3B 3F6IA 4S2SB 1XGYL 2BNRA 4CMMB 2V2XA 2DICA 3MGTB 3ZT5A 2BSSB 5KZCD 3RA7H 3HC0B 1EHXA 4MCYA 3HCVB 4M7ZB 2NY5C 2VXQH 1IM9D 3NBNA 5E56A 1CE6A 1MWAA 2MQ0A 5CEYA 3O2WH 2F5BH 2Q8BH 4HSQA 3T2NL 3DJ9A 3VXSB 5F7DB 4P48A 43C9B 2IBZX 3V0WL 3ZE0E 4U1IB 3RWIB 4JHWH 5E2VL 3BKCH 2V9TA 4TVPD 3BP7B 1UT9A 3ROOB 4G8FB 2P43B 1NUNB 3HNSL 3BDYH 1LP9F 1BX2B 4DKEL 3FRPA 3HNTL 5IF0A 3WUWB 1EFXA 3NCCB 1U8KB 3O3DA 4HUUB 3L5JA 4M48H 5ACMA 5L0QC 5CUSH 1IEHA 4G6JL 4RWYL 3UTPD 4LHUD 1ONQB 2AEPL 3BOVA 4XVSL 1SVZA 1RK1A 1GH7A 1XGUA 2FBOJ 1H3PL 4PLJC 3DRQA 1H5BA 1CXLA 3C5ZC 3P40A 3D85D 4U6YA 4EVNA 3HNVL 2V7HA 2V2TB 2BVOA 4U4BA 4KZDL 1LK3L 4X7DC 4IOSD 1WSST 4X6DA 4YC2B 2WINB 1CLZL 1IL1A 3MRHA 1I9EA 4XCFH 1U8HA 4ONFH 4X6BB 3LEYH 5FGCE 1JYWA 3F7YB 5HGHB 4YUEL 1P84K 4L4JA 4ZSOB 2O61A 4XMLH 4Y5VA 4KROD 5JPNA 5E8OA 2BNQD 4ZUUA 1AJ7L 1RULH 3VCLB 4QXGH 5D2NE 5FOBA 1WBYB 3VGFA 3G08B 1BMGA 4PJ9A 3I2CL 3TNMA 5DHYA 3HA0A 4U1MA 4WV1C 4AH2A 1GL4B 5EA0H 1A5FH 4Y4FC 1JPFA 2UZXB 4XRCA 1RZFL 1BOGA 5ERWB 1FH5H 2ATPB 1FZJA 3D9AH 4Z0XA 4R8WH 4O02L 3RHWF 3ZE1F 3DX8A 1P84J 4X8XA 1N5YL 2WANA 1U8IA 1LILA 3EZJB 2GT9A 1IM9B 3FONA 5CCKL 5T33H 2RCSL 5BV7L 4PRIA 1FVEA 1OARH 5KN5A 1VB9A 2JCCB 3SKJH 5SV4A 4QTIH 5C2UB 4OZFB 1E28B 2F53E 3V52H 4LOUD 4PJDA 5F6HI 3RY5A 1OPGH 5FO9B 4R26H 3O4OB 1NC4D 4XMKL 3TVMA 3UYRH 4ZG1A 1WQVT 1QFWI 4JQIH 4P49A 1MY5A 3HI5H 2NZIA 5E2WL 1HYSD 4K07A 1JI2A 1DL7L 5C71A 3DMMC 3UO1H 5LWYH 2MQ3A 1ZV5A 1QLEH 1VGEL 2BY2A 2SEBB 4X9GA 4HBQA 4F3FB 1BWWA 4KTYA 1NKRA 3L3KB 3Q5TA 5CJOH 5EC1B 5ILTL 4HFUL 5DJ6A 1C5CH 3WS6A 2J3SA 5IQ9B 1W2KT 4WCYL 3MLSL 5EO1B 4BK4A 4IRSD 2ZOLB 3MGOB 1LDPL 1QBLH 3K8MA 4KDTA 4FMFA 5BRZA 1EO5A 5IG7B 4FHBD 3GSWB 3IDYC 3ZKSD 4WO4D 1BEYH 4ENED 4KI5E 2NTFA 3T0AA 5E9DA 1KPRB 4R96B 4NQCD 3H42H 3RY4A 2ATKB 2R56L 3F5WA 2VXTH 3K8KA 3QXWA 4AIZA 5GGUB 2UVFA 1LE5B 5C7XH 2E7LA 4G8EB 2WBKA 1AC0A 3CSGA 4K71C 4H20H 1WEJH 4K9EL 4GMSL 3FMGL 4MDIA 4N68A 1ZTXH 3MCLL 4G7VH 3SBWC 4RA0C 1M05B 1VFAA 4HWZB 4N0FB 4HCRA 5H37H 1YC7A 2D03H 3VFRA 4YQXH 1G7PA 5BXFB 3VRIB 3A0OA 4BSVA 2Z35A 3BGFC 3U9UB 1QZ1A 1T6VN 2AQ2A 4JHBA 4PYHA 1KCVH 4J1UB 3L5WA 2PTVA 5AD0A 1T80A 4BUHA 5KSAA 1FYHB 3AAZB 4PJ7B 3U2SA 3VDCA 2O5ZL 2P5WE 2WW8A 4DKEH 2OL3B 1X6NA 3CSBA 2H9GB 1IGIH 3WFDH 4FXKB 4AQOA 4PJCE 4GT7A 4DKDC 4TSBL 4I0PA 1BP3B 3B9AA 4XXCA 5C08B 1QEWA 1T83C 4MWFA 2R1YA 1W8NA 1T1ZA 4AQ1B 1J0HA 5MEPA 3JUZA 1PY4A 4LLQB 4YR6A 1EUTA 3H2WA 3ALPA 3T2PA 4N1EA 3QXDB 4PJ9C 1ZWIA 5B22A 2L7UA 5F72S 4BH8B 2IJ0C 4WV1A 2N1KA 4LQFL 2YD5A 3QWRA 3FOMA 4FG6D 2YD6A 1A7RH 1OAXH 4R0LB 1OM3H 1KYOK 3U9PH 1XF1A 4P9HC 1LEGA 4P23B 2FEDC 1RZGA 3IDJB 3LQZA 2X4UA 1CWVA 2BVTA 2YN5A 1KLGB 1HXMA 1YEFL 4O58L 1HN1A 3S96A 1JUFB 3CX2A 3MLRL 5DUMH 1SY6L 4P2OC 2C1PA 2NYYD 1QFUH 4PJGF 5J1TC 3MV11 1QPPA 4FABH 4XCNA 3ZSTA 5E8EB 4ERSH 2W60B 3GFUA 4XX1E 1HHHA 1P9MA 1UENA 2GUOB 2YC1A 2PXYB 3TN0B 1S7WB 2IALA 2YWYA 2QL1A 1BOYA 3DVIA 3ESUF 3IU3A 2APVA 1HILB 1CD1B 2R1XB 4OGXH 4ONFL 4G6JH 1TIUA 3CC5B 4R90L 3NZ8B 1UM6H 2ADGA 1IRAY 2Y1VA 4WFFE 4BKLA 4M6OL 3GK8L 2PXYC 3DSNA 1BVKA 1T20A 5I1DB 2I9LB 4DUVA 1TITA 1RULL 2E9IA 4OZIE 4CRPA 3UTSD 3K80A 4NQVA 1R24B 5SX4I 2A6JA 1CS6A 2BK8A 4FQHB 3LEYL 5IGXH 4HC1L 1MI5E 5IBLC 4K3EH 4D8PA 1T89A 4GH7B 4M7KL 1P69B 3QWQB 5DD5H 4PG9A 1WAAA 4L29A 2QQNL 5JDSA 1QLEL 1UJ3B 4FP8H 3NPSC 1AGFA 5CCKH 4O2EB 5ICXB 4JO3L 4S1SL 3VXRD 5ICYA 2I9TB 1S5HA 3QFJB 1JNLH 1HHIB 5D7SL 1N26A 4Y8DC 4S0TD 4YHOH 1A47A 3L3JA 4GW1A 2DTMH 2W9DL 2CLZA 1PG7H 4Z7OF 3L7EB 2VLRD 1CDYA 1CD0A 2BOBA 2FRGP 5BZWA 5DQ9B 3S98A 1UWGL 3EFDH 4DUXA 1G6RH 2R4SH 5I8OL 3T8XB 3I9GL 4JDTL 2G75A 5D4QA 1WCBB 3G5VB 1FCCA 2IWGA 4OCSH 2R69H 4L4TD 1A7NH 1NMAH 1FZOA 4RFNB 1WZ1H 1Q0YL 4ODSH 1I1YB 3OAZH 4GAJH 4WO4A 1A3QA 3MLWL 2QADC 2XTLA 4RCAA 1YEEL 2NPLX 3OJDA 3GMOA 4PJFB 4R26L 3PGFL 3QUZA 4XAKD 4C56D 4JHAH 2X4SA 1BBJA 3F12A 4YQXL 5LWYL 3V6OC 3MA9L 1BEYL 1KXQE 4R7DA 4FQPA 4HH8A 4U05A 3TN0D 1RZ8A 2YKLL 3Q1SH 4PTTA 4GKNB 4P4KB 5EU3A 4ZAKD 3HR6A 3EHBD 4L4VE 4FG6C 3UTQA 3DX9A 3BAEL 4HJGB 1ED3B 1U3ZA 2Y36H 2JCCE 3UBXA 3WUZA 4B41A 4ZS7H 1IGCL 3EDKA 4N9GA 2HT2D 4ENEC 3WXVL 3RRQA 2OTWA 4YHPA 5C1MB 4N8CH 1U8PB 1K4DB 1RUQH 3BP5B 5HHMB 1XF4A 4EUPA 1NBZB 3ARBC 4UI2A 1DBML 4LQFH 3HS0B 5HDLA 1KV3A 2CDEA 2IPUK 1JYVA 1HYRC 4K9EH 5DXWA 3TH2T 3SGDI 4YNYB 3OKLA 4KRPD 1A14L 1N7ML 3U4BH 4R4BB 3FQXA 3QEUB 4JREC 1YEDA 4ZD3L 4PRDA 5I1KH 2C3WA 1CGSL 1V3LA 2E6QA 2FJGA 3E0GA 4HCRH 2NX5D 5BS0B 2YZ8A 2VABA 1AE6H 1JWUA 1J1PH 6FABH 4KK5D 2E7LC 3W2DH 1KPUB 2F74A 1MLCB 3EYVB 1W0VB 5KVGH 3LMJL 2Z31B 2HRPH 2LABA 4J8RA 3C5JA 5I2IB 5D7LB 1M7IA 1Y6KR 1FV1B 1NAMA 4NQDE 5FECA 3RNQB 4I3RL 3IGAA 4PJ5D 5F8QC 1TJIH 1KG0B 2MTPA 4O2CA 3ARGA 1ZEAH 3MRIA 2XWBA 4P2RB 3MLRH 4R97C 5DUML 2PR4H 3V4PH 3IFLH 2G5BA 1KENL 2NZ9D 5SWSE 1F3JA 3F7PC 1U41A 3MNVB 2Y4SA 4UB0H 5C6TL 4K3DH 3PHOB 3EOAB 4CUCA 5GGSA 3HTLX 2CUHA 4JRYA 4QOKA 1D9KD 3V5KA 3NA4A 4P9HH 2Z8VC 5AUMA 1UM5H 4HS8H 3BT2L 1X5KA 4O58H 1LE9B 1SHMA 1CI5A 3G9VA 1JGVL 1O0VA 1REIA 1R5VB 5LGJA 2W65B 2H1PH 5BRZE 1BJ1H 1RUKH 4UTBH 1X5IA 3FTGA 4WO4C 4I4WB 3WYRA 1HINL 1L7IH 2GHWB 4PJHE 5GGRY 3SY0B 3V4VL 5C09E 1L0YA 4AZ8A 1KIPA 1QLRB 5E03A 2FWOA 3LEVL 1OAUL 1RV6X 5AYUH 5GXBB 4HC1H 4N0UE 4GXVL 4AENB 1Z9LA 2F8OA 2GTWB 4UUJB 1I3UA 2DBJA 1OL0A 4KJWD 5IFHH 4HJ0C 4PLKC 4KRPB 1WZ1L 3LKSA 3ES6B 3PWPB 4UV7H 3WSQL 2DJUA 1MCPL 1FFOB 3UJJH 3T0BA 4LHUA 5FXCH 4QNPE 1EUUA 1HXYA 2XA3A 1G7IA 4EOWL 5IT2L 2VDOH 1RQ5A 2E7BA 1ORSA 4YDVA 1HDMA 1NGXA 3BFOA 2EDNA 2P48B 3C08L 2ZCHL 2HJFA 3L5IA 2HG5B 2OX5A 5DA4A 2XN9A 2NX5E 3HPJB 1KJMB 1RK0A 4E42A 5C0AA 2R1WB 4NGHL 3O0RH 1WBXA 3VXMB 2Z91A 4QHLB 4G7YH 4LCIL 3P4NA 2DQCL 2CK2A 5KSVA 3ULUF 1CG9A 2BNUA 4NRYA 3VWJB 4S1SH 2D0GA 1A7NL 2DTSA 1TVDA 5TDPB 2PN5A 2EDWA 3OAZK 5F9DC 1AO7D 1JN6A 1NBVL 1MRCH 4Q9RH 4QHMB 5TE4H 1BM3H 5HYJE 1X6LA 1QSEB 3C6LD 1OAKH 4LCWA 5EPMB 1OAQL 1JGDB 1WISA 1JIBA 1U93B 3ZDXE 5A2LH 1G1CA 5TQ0L 1A0QH 3EYUH 5KG9B 4OT1H 1AH1A 1B9ZA 1Q0YH 1ORQA 2PKDA 2EYRA 4JKPH 4MNGA 1MPAH 4XVUD 3HHRB 2BJMH 2FZ3A 2IH1A 3U48A 3LZFH 5T1KD 1JGEB 3TF7C 4MAYB 4PV9B 3PABB 4DQOH 1FNHA 4X4ZA 3O6FD 2DBLL 2HKFL 2VDQL 4XCCH 5BRZD 4M5YH 5D7KE 1CGSH 4N5UA 4UU9B 1FAIL 4RMWA 1WAAF 1XGYH 3HUJE 4U6TA 2W9EL 5D6CA 2A77H 3SGDH 1DDHA 4ZXBA 1NAKL 1FG2A 4JJHA 2DQUL 2GJZB 3IDUA 3KPMA 1ROWA 1QP1A 4JG1H 4NNYB 1J0KA 4LNRB 4PJ7E 1QFPA 3IDYB 4MD5B 5C6PB 1DLHA 4PGCB 5ITFB 1CFQA 3U7AA 1OWRM 1CXKA 2DS4A 1UA6L 1FFPB 1P4BL 3DX7A 1I75A 2YSSB 5K9QI 4JPKL 5F9WB 1XCQB 2HT4D 1B88A 1ZT4A 4U3XA 4P2QB 2AJSH 2B2XH 4TVPH 1CQYA 5JW5A 2GK2A 4K3DL 4R4NC 2IPUG 3PDOB 2X4OB 4UIMA 3S35L 1AXSB 2XXMB 4PRHB 3RVUD 4X5WB 5DFWH 1YUHB 3LVEA 5I18H 5ADPL 5J7CC 4JFFD 2JB6A 2ZSWB 3PWUB 5C0BA 3M1BB 3P30L 5DJ2A 1NCDH 2JIXA 1SJEA 1JGVH 4PJIF 4AT6B 1ZHBB 4JPIA 1KGCD 2DD8L 4CU7A 1CVSC 1GIGH 4ONHB 1P4IL 4IMKC 4OCRL 1SEQL 1HINH 1L7IL 4ODUB 4LHQB 2CXKA 5FA3B 1PJ9A 4OTXH 4WI5A 1H5BC 5LQBH 2VISA 4XZUB 3OR7A 3G04A 4NQSB 3HE7C 3RVWD 2X1OA 3LEVH 3QDGA 5AYUL 1T1XB 4H8WH 4HZAA 5E5MB 3L3DB 4OBSA 1RZKL 1ZEAL 1GGUA 4H1LA 4YBQD 4MD4A 3QUZC 4IHOB 4I77H 2P5WD 4HJ0D 3KYOB 4FXGA 1RVFL 3TBWB 2JJTA 1XGRA 4M6NL 1QO3A 1CFBA 3GSOA 2AV7A 2DQDL 4F7TA 4OGZA 3ZTJH 2W0FB 3QI9A 3RPIA 5GRUL 4NN6C 3T08A 3S88H 5DJDB 5I1CH 3PQYB 1FL6A 3RPKA 4M1CC 3STZB 1NLDL 2CUIA 3FO0L 3OPZH 2IAMA 4CL7A 1OAUH 4LLAA 4Y19B 2VQTA 4P4RB 2YXMA 4ZFOB 2HT3C 3UTTE 1GHFL 2LU4A 4P5TB 4PJBE 5F3HB 2BDNL 4S1RH 1GGIH 1YEJL 2HP4A 2IPKA 5SX4H 4BZ2H 4HPYH 3PGDB 5CHNB 3STBA 4CN1A 2N7AA 2FYYA 5IMKA 3E6FB 4RGNE 1T89C 2OLDA 1GOGA 3HG1A 3OBAA 3HZMA 1WIOA 4UINL 3EO1A 3FHQA 3RU8L 3D18B 4JFHE 2P44B 4OCYH 4Y4KA 4MDJB 4GRLB 1QFOA 1I8LA 4POYA 5DC9B 4KKCD 4FQCL 4NBXB 4PRPD 1I8KB 3D87B 4EI6A 4TNVF 3M8OH 3VU2A 3QIBD 3P9LA 4F57L 1JPST 4H5SA 4KK9C 2CD0A 3EYUL 5KSAC 3EIFA 4LLMB 1IGFL 1MREH 3VJ6A 1EXUB 2FCBA 1DQJB 1BIIA 3OZ9L 3EOTL 3GGWB 2OTPA 3ELAT 3CJJA 1NCBH 1TVHB 3QDJB 5K9OB 4NC2B 1I7ZA 1JJUA 3X3GH 2NCMA 1FNSH 2VYRE 2CJUH 2CRYA 1FO0H 3KLHD 1T04A 5DRWB 5DD3L 4Z8FH 5B38G 4C83A 4CADA 3RIFF 2EDBA 1NDMB 4WW2A 2R23A 2H6PB 2HA1A 4J6RH 2CGRH 1IQWL 4G8IA 4HIXH 1A0QL 5M7QA 4GAYA 1F45A 5D5MB 1FGNL 4Z7VA 2W0PA 4Y4FB 5BZDB 1JZ2A 1CIDA 4AYFA 4GMSH 1PYWA 2IANB 4FN0A 4HQQH 3RWEA 4XHJC 3PNWA 5GGTL 3KPRA 3SBWA 5EBLB 2CPCA 5EU7C 4L8DA 4M02A 2NY2D 4MLIA 1MJ7H 1MEXH 2QHLA 5J6GA 3WS3B 4TUKL 3W9DB 5ITBL 1N3NA 4JR9H 4ETQA 3A6BH 2YPVH 3AU1A 4OD3H 4PRAB 2B5IC 1FFNA 2C26A 2VQ1A 3MXWH 1V7NL 1AR2A 3GI9H 4LIQH 3MRQB 3VI3E 1A4JA 5BMFH 1I8IA 4ZFZA 1K5NA 4HMCA 1BQHA 2XI9A 5IV2A 2CIIA 4NFBA 1U91B 1KN4H 2BVQB 4P46B 1CDIA 1IQDB 4XP4H 5CEXA 3NACL 2C7UA 2CDFB 1BGXH 1LEKB 1WWCA 2BFVL 1P4BH 1D9KB 1F00I 3D39D 5BCAA 3LRSA 1Y0LB 1IT9L 2WBJD 4ZFGL 3C60C 3ZMRA 2XRAL 2XYCA 1N59A 2APWA 2X89D 5LQBL 5HYJB 2VDKH 4KQ3L 1FC1A 5GS2D 2NXZD 2EKJA 4PJBF 3CCHB 2FHFA 4PJ8D 3C5SB 3KYNA 2CLRB 1C12B 3MOAH 1EHLH 4PIRF 3BWAA 5F1NA 4JFXA 2R2HA 5GS1B 3P30H 5BVPH 1SY6H 2NX5A 4Y1AE 2B4CH 1QFUL 3K7UA 3GBMH 4ZXBC 1P1ZB 1A8JH 2RFXB 2W91A 3KXFA 5GSRB 1QVOB 2WWKO 4GG6B 3V8CA 4X7SL 5I76A 1IAOB 1OTTD 1A6AA 1EIBA 4QRSA 3WIFB 2XT1B 4Z5RB 5MEOA 4LASL 4POUB 3MO1B 2R0WL 4NYLB 3RGHA 2UWEB 5EN2B 2P46B 3JBG7 3TIEA 2DM2A 4PJCF 4O51B 1MHCA 4JDVA 5LGHL 1KOAA 4LQ1A 1IGTB 2DWDB 2XKNA 3JWOC 4OAWA 1SJHB 2IGFH 3QUKB 5DFTA 3UZVB 5A2KH 3DTXA 3FHAA 1LP9B 3UP1A 3CFDB 5T1DH 4P57A 4NQUA 4LMQI 5HPMB 4PBXA 4MD0A 4LK4A 1OP5H 1GPOL 1RAMA 4M6NH 5F1IB 4LRNL 4JRXA 4Z7UF 4F9LC 1VFUA 3S5LG 5EOCL 5T3XH 3U4EA 1U8MA 3SGKA 3U79A 2J4WH 4ELMB 4JZOB 4YAQB 5EUKA 1RZKH 5ANMA 2ZCKH 2NZ9C 4HJJH 1ZT7A 5DD6A 3CVHB 3A6CL 1T4KB 3R1GL 3T2OA 5IW1B 4P59H 3VW3L 2VLKA 1N8ZA 5EZLB 1AP2B 1GHFH 4JKWA 5D2NB 2AJXL 2OR7A 3RBGA 3CK0H 1QR4A 5F7LB 1NGWA 2VLRB 1HHKB 3ZTNH 4TTDC 3Q3GB 5CJXA 1VGKB 3O9WD 4HD9A 3T4AB 4QRPB 4WEBH 3JWDC 3X11B 1VFMA 3BX7C 3C6LA 3UEZA 3GHEL 3Q48A 4BQ6A 3PP3H 4OQTL 3T0EE 5AEAA 1NLDH 4NWUL 3D39B 3HNSH 2J5LC 4ORGB 5TE7H 4KXZI 4WI9A 4ZTPH 3O3AB 3W0WB 1ZHKA 2ARWA 2AERT 3MRNB 4ALAH 5HJ3A 2MCG1 1D5BB 2F54A 1HZHH 2H2PC 4X4XB 4D0BB 1J5OH 5F97E 5DJYA 1MCEA 3RDTC 5A2FA 5D1ZC 1KJ2H 3ARBD 4CVXB 1OVZA 4C56B 4U3HA 3L3GA 4HIIB 4BH7A 5FYJL 3ARWA 4ZQKA 5IB4B 1MCFA 2C1OA 3QAZC 3TNNB 1H3PH 2QQLH 4YHZH 1ITCA 1F6AB 4L8BB 4U7SA 4DKFL 5E2TH 5TQ2H 1I3GH 5HHQB 3QH3A 3ARBB 3RWFB 4Z7WB 1J0YA 3QG7H 4FMKA 1BQUA 2X4QB 1KULA 4QKXB 2AJUH 5I74B 2AJYL 3TJEH 1OHQA 4XH2A 3HFML 4QWWD 5AZ2H 1BLNB 4WY7H 4YHIA 2CGRL 2KH2B 2XZQH 4ZNEA 5BVJA 1ZA6B 3DVNA 3PF2A 5IVXB 4AG4H 4KK9D 5K93A 3AS3A 2GFBB 2PYFB 3MRMA 4QRPD 3IAPA 1DQQA 2VSDA 1PQZB 4I5BA 2HVJB 2Q86A 4LSSH 4HHAB 4K23H 1I7RA 1KACB 1U8LA 1EO8L 3QDGE 1B4JL 5HHOD 4MJIE 1NCCH 3VH8A 2EDOA 1YMMA 2PETA 3H6JA 3UPCA 1IM3A 1KEMH 3QIUB 2VC2L 1IAIL 2JJSA 3C8KA 1ADQA 2R0KH 3CXDL 5BO1H 3CVHL 2WP3T 4NM8L 5BV7H 2Q7NA 2P45B 4M3KB 2UZIH 2W0KA 1MAMH 3HMWL 1U3HC 2WIIB 3CAFA 4NZRH 4XWOC 1A3RH 4ISVA 3VD7A 1F90L 4JFDB 5JO5B 3SDAD 2UYLB 2XKSA 1RZIB 4U0RC 5LBSL 1IAIM 4M6ML 2HMID 1XIWD 4OGYL 4LVOB 3V0AC 3CZFA 5E2WH 5GGQH 2HJLA 2ENYA 4OUUA 4YHKH 3A67L 5GJTH 1VGEH 3QEGL 3X12B 4K8RD 4WFFD 1DBBL 4AL8H 2L7JA 2BVPA 3H8NA 5TFSH 5C07B 4P3CL 3O4LD 2ESVA 3SDCC 5ISZB 1XAUA 3ULSA 1KJ2B 2Q6WA 3SDXB 3QRFM 1CICC 3VXQB 4CW1B 3DYPA 1FORL 1J8HD 1MNUH 4LEOB 4KZDH 4YEFA 3I02B 1LP9E 1M71B 1UXSB 2YPLA 4X4MA 1HEZB 4OV5B 3OXSA 3SE4C 5JW4R 2FIKB 2QQKH 5GGRB 5HI5D 5MERA 1Q9WA 3LV3A 2DLIA 1JPGB 3WL9B 5AG8A 2P47B 4KAQH 1NQBA 4V1DB 1D5ZA 1VSCA 5GZOD 3MSPA 1DBKH 5IK3B 2DM7A 4JM2F 1HNGA 5DJAA 3IJHB 4BZ1L 1TTGA 3FN0H 1G9MH 4JRXD 5D2LA 5FGCB 4PJAB 5GS0H 1ZHLB 4R4FH 5DK2B 5BVPL 3BRGC 4NQEA 4FQQA 4NJ9H 3GBNL 1S8DA 4OLVL 4WHYG 2X4NA 3EAKA 4IRSB 3T77B 3KGRA 5L2KD 2D4DA 1IC4H 3HUJB 1ZANL 3QG6A 1MCOH 4OZHA 3IXAB 3QNZB 1TETH 1SEBA 1WC7B 4NCC1 3QR2A 1IKFL 4KJYB 1CXIA 3GMMB 3QDGD 3BDBA 2O5ZH 4CVWA 3BQUC 4GSDL 4PJGB 4I48A 4U1NA 3S36L 1Q38A 3IJSB 5DJAB 3G6JA 3QXAA 3N0PB 3V52L 2NY2B 3TYFA 1WFOA 3VRJB 1EK3A 1D5ZB 4XPFH 3VW3H 1KN2L 4OI9A 2VAAB 5JUEL 4ELKA 1JF1B 4EXPX 4YFLF 3RNKA 5T3ZE 5CEZH 2EE3A 1VACA 1I7TA 4OCXH 5EU5B 1WLHA 4Q6YA 5CD5D 4L1HA 5DK0A 1H0DA 3SCMA 4UDTA 2F15A 4LEOA 3QCTL 2GJ6E 3KJ4B 2VL4A 1CR9H 4LCYA 5DMGC 2FJHB 4PJIE 4ZYKA 4KRNA 5IEKA 1NGPL 4AIXA 4RGNB 3TBSA 2DJ4A 4P23D 1WK0A 4OSUH 4HIHB 2P8LB 3G5YA 4F7MB 1I9JH 3ZT7A 5SWQB 2OM5A 1QYGH 5FO7A 5TE4L 5L6YH 1VPOL 4OFYA 4K23L 1KCRH 1RZIA 1OAQH 2IQAB 1A6UL 3DECA 3GMNB 1Y6MR 1OSPH 1HNFA 4UZGA 3IDIB 1ZHNB 3SE3C 1CYGA 3FB5B 4DGVL 5FYLH 1KEML 4OM0L 4WFHD 4HIEB 3MJ8A 4UILL 3DROA 3DWTA 3FT3B 5FYJH 5A40E 4NM4L 3C8KB 5IJKA 3HI1A 5FKPA 5TDOB 4X80L 1MI5A 2V5SA 3C6LC 4L3CB 1JWSA 4ODWB 2PW1B 3LIZL 2ICEB 4K94L 5HGAB 4XGZB 3VH8B 5CZVH 5D7LE 2CKBB 5HVFB 4PGEB 4HHAA 4QYOA 1FL3B 1JWMB 3NPZB 3KJ6H 1G9NL 1PQZA 4I5BB 4OQTA 5D1ZA 2O5YL 5EIVA 1ES0A 1KCSL 3SE4A 4JPVH 3MRMB 2KKQA 2QQNH 2PYFA 4XWGH 3MCKB 4Z18A 3RX7A 4CNIB 5BVJB 4XVJL 2R9HD 1L9NA 1NGQH 4PRPE 4J3SA 4JGJA 2MCPH 1OB1B 1KLUB 1PKQA 1BVZA 1G7LA 1P7QA 2VLJB 2Q7YB 3RWHB 3IJYA 4ELME 3S3PA 3SCMD 2ZOKB 2Q1EA 1BJ8A 1EBPA 2D0HA 1UG9A 2NW2A 3GMRB 3U9PL 4OGAD 5DGRA 3QJHB 1FO0B 3QI9C 5KS9E 5E1HB 4U1HB 5IIEA 1A1NA 5F89B 2R0KL 4JKLA 1UWEH 1ZLSH 1UXWB 2AJSL 4YGVB 4CJ1A 3AM8C 5FHAL 2FHCA 2BNQE 1EGJH 1PDKA 2NXYB 3S35H 4CBPA 3ECBB 3ZKMC 2Y06H 1D5BA 3OGCB 3ILPB 3ZHLA 3AVEA 3O3AA 1FYTD 3W0WA 4QTHA 5A16A 4JHAL 1QNZH 4ZUSA 2VQUA 1IC5H 4YHKL 1LD9B 2HLFC 4N8VA 3RTQB 3M07A 4HS6B 4QOKE 3SKMB 1MCCA 3T4AA 5IHUH 5FFLA 1A1MA 1PEWA 1NGWB 3P0GB 5ACZB 4G6FD 3AROA 2NY7H 4TULH 5IFJB 5CP7A 3W9EB 4PY8J 5H37G 5FV2A 1R3JB 3N06B 4PJCA 5IVZA 1BZ9B 4HX1B 1SM3H 5KSBA 1DUYA 3UBXG 1P7KB 3IXTB 3MLZL 3X14A 5C0CA 2LVCA 1KN2H 1U8MB 4CU6A 5ABDE 4I77L 4X5XB 2UV3A 5TE6H 3ARFA 4K3EL 4MXWH 5GIRB 3TFKC 4KROC 1IE5A 2VLJD 5HY9B 2DQDH 4G80B 3TA3B 3U30C 2ED9A 1O5DT 3HC4H 5ETUB 5FHBH 3PWLA 5FKAB 4PRHE 2DWDA 2R0ZL 5I1GL 3GB7B 1QLFB 4BZ1H 4JDVB 5CBAA 3MRPB 5K9KA 4AJ0A 5DS8A 4XPAL 3TIEB 1GAFH 4Y5YB 1VKXB 2OK0L 1KBGL 4NYLA 1H9VA 1R3HB 4RWHA 3T1FA 3TN0C 1S9YB 1F4HA 2ORBL 4WDIA 3WIFA 1SYSA 4XP6L 4WWKA 4CVUA 4OB5H 2OI9C 3LPWA 3P4OB 4Y5XA 5JOPD 4X7TB 1NEZG 5IJKC 3UDWC 4WVRA 2A73B 3VD4A 1AGBB 4NQDA 4G3YH 4U1JA 5E8PA 4M6AA 5L6YL 3FB8B 4XPTH 3LS5H 4NWTH 3BWAB 2OI9B 4U1LB 3C6SA 3NFPB 3P9WB 2PF6A 1HH9B 3CCHA 1P4LB 3EDJA 5CJXC 4X4YB 1CDGA 1P6FA 3PDDA 3LRHA 1S7VB 5HYJA 5FA4A 5E08L 3MJ9L 3FCTB 3D25A 4OZIA 3HE7B 4S1DC 3DUHA 4N0CC 2CRZA 2QTEA 5IB1A 1T1YA 4LVEA 3DNKA 2IH3B 3I50H 4KK8C 1FHGA 5DMKB 2R4RH 3SO3B 1FIGL 5JQ6H 1U91A 3QIUD 4Y5VC 5C6TH 3K1DA 5IW6B 2GIYA 4RGMC 2F54D 4LSPL 1BECA 5CIPA 2KZ1B 1I8IB 3RUGF 4KKAC 4OQ1A 4UQ2A 1E6OL 3MRQA 1KIQA 3F58L 4WW2C 2Z31C 2JK5A 4W68A 5CIPB 5IVNA 4KDVA 3L5XL 3QDAA 4KV5F 3F6LA 4F2MB 3U46B 5J6GB 2FD6L 4HC1A 4U2YA 1BFTA 3P4MA 4Y4HD 2NY4C 4I0KA 4H26B 1CFNB 1U8JB 3OQ3B 2IADB 3PNWB 3D25B 4K2UL 4JFOA 2ENSA 5DHXB 2IANA 3RWJA 5FA4B 4YE4H 3WLBB 5EZIL 4P5KB 1X5JA 4WFGE 4FQXA 1WT5C 4JFFB 5DA0B 2ID5A 5T33L 4OBRA 4PRHD 3C6SB 5HGDB 5DT1L 2N7BA 3G6JF 1CF8H 3QEQB 3SKJL 3VXUB 4YBQC 4APQD 5L0QB 4G9FE 3FB8A 4WEMB 3IU4H 2XPGB 5DEGA 4NQDB 3B9KA 4JM2D 4FXLA 1T04B 5E6ZA 2OTUA 1GGBL 4RNRB 1K8DB 4CN6A 1TQCC 1HH6B 3W0WD 4NGHH 1R3HA 3BPOB 1T2QH 4WFEE 5JMOC 2KQMA 3NCFB 5HHXL 1S9WB 1A2YA 1X3DA 1XIWC 5IUSA 3E2HB 3LS4H 1UC6A 5ETUA 3TH4T 4EI6B 2KPNA 4UNVA 3TA3A 4G80A 4GRLA 3I6GA 1JRHH 1VESA 1DQLH 3ARFB 4F37K 1KUMA 1J8HB 3V95A 3ET9F 3HI5L 3HG1B 3HLAA 2DB8A 1UWEL 3BUYA 1P7KA 4HS8L 3IETA 4N90E 1ZLSL 5F9OH 3U83A 3FN9A 1PG7W 4N0RA 3BGMA 1MFEL 4RIRA 1JZ6A 3BZFA 1E4JA 5L2KE 5C07E 4P5TA 1C5CL 4N0YH 3EYQD 2I07A 4DW2L 5GGTA 4JFQB 1RUAH 1A1MB 3OJVC 4U6HB 3STZA 1AGEA 4NRZA 3WJJA 2BP3A 3WIHH 4X9FA 1LO4L 1FL6B 1IC5L 4GOSA 1QRNB 2V9QA 1LD9A 5FUCE 5C92A 2FH8A 3TIDB 3OHXA 5I1AB 5A16B 2YD3A 3RL2A 1ERNA 4G8GD 2X70A 4M62L 3QUYD 3H42L 1BPVA 2QKIA 4FXGB 3WKMH 2VXTL 1AJ7H 2UVEA 2WM0A 5EC2B 3HE6D 4HIJA 5I6XC 3O45A 2GEEA 3WFDL 5E5MA 1UXWA 1TCRB 4TSBH 4JDZA 3QSKB 4IM8A 3L7FA 2BCKB 4U1HA 1OT2A 3I6LE 2MNUA 2YPKA 1IMHC 1RZFH 5IEHA 3EDEA 4RAUB 1X5FA 4KV5E 2R4RL 1IAMA 1MFCL 3I3DA 3MYJA 1NCTA 2A6KA 5C0EB 2WNGA 3S5LB 4D3CL 1EAPA 1F3DJ 5I1H