5DJZB

Fc heterodimer design 7.8 d399m/y407a + t366v/k409v
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
87
structure length
87
Chain Sequence
GQPREPQVYTLPPSREEMTKNQVSLVCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 13
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5djzB00
5T1LB 3MBEB 5E8NB 3RGVD 5AEAA 1TZIA 3MRDA 4G42A 4HAFA 4WFGD 5J0BA 2UWEB 3D0LA 1K2DB 4PGDB 5IMOA 1XF4A 3IFLH 4FXLA 3QUZA 4OLVL 5C8JA 3ILQC 2EDTA 3IFOA 5ITFA 2M2DA 3WFCL 1AQKL 4PB9H 4XVTH 4WI2A 4E9LA 3OWEA 5EORL 1FZJB 4R4BB 3MRQA 4FNLH 2VXSL 3PWJA 4RA3A 5D7SH 2JJVA 4YBLB 1KENL 5JXED 2Y5TB 4DEPC 2AXGB 4S2SA 3L95B 2YPLE 3KVQA 5EO0B 5BZDA 1Z9SA 1T83A 1FDLL 3DBXB 2Q7NA 4I9WD 3WNKA 1D5IH 3CLFH 5FUCE 2OJEB 1DCLA 4PRHD 1I1CA 4H8WL 4Z7UE 4JO1H 1RZ7L 1XGUB 4TQEH 1UJTA 1A9EA 4JQXC 2E8ZA 3QIUB 1LE5B 2X1PA 4HUUB 5CEXA 4LCIL 1M7XA 4YEFA 2FR4B 4LSDA 5ETUA 3W9DA 4I3RH 4CMHC 5KSAC 3O6LH 3ULSA 3AFLA 5EU4B 4G8EB 4E41B 2QSTA 2NXYD 5ADOH 5AYUL 2W0FA 4M1DH 5T5NG 1A6WH 4O02L 1MPAH 4NQEE 2XG4A 3O3BB 1QQDB 5IQ9A 5F9AC 1EO7A 2V9TA 2Z93B 3D25B 1D5ZA 5HGAA 2NY5L 3BH9B 1CLOH 4LQFL 1R3JA 4GRWE 3EW3B 4M7LH 4OI9A 5ESAA 3SDDD 1JNHB 3EFDL 4Z18A 4F7TA 3RVUC 3S98A 4NO3A 3MBXL 3BQUA 4WJ5B 5JR1L 1JGUL 1IM3B 3TH4T 5FGCB 1LE9A 1BBDH 1T83C 3IFNH 4OCXL 5E0QA 2MCG1 3UTQB 4ONHB 3C87A 4PGEB 3FQXB 1PZUB 1BZ9B 4PJDB 1RUMH 2VZTA 3KPSD 2F54D 4FFYH 4X4MA 1YN6A 3OKLB 4Y5VC 1CL7L 4XCYB 4OCLC 2P45B 1CGSL 1F58L 4JRYE 5DFTA 3QEGH 3JVGC 4KI1A 2K9UA 4ODSH 4DOHE 5F1NB 2R2EA 2X89D 3ZDXE 4WI4A 1B4JH 1QNZL 2P5WB 4ETQB 1YEJL 1YNTA 1A7QL 3PL6D 1DQJB 1YEEL 5GGTL 3F58H 5C7XH 2SEBA 4JO2L 4UIMA 4L4JA 1LO5A 1T4KA 3O4LB 3W0WB 2GSIA 5J6HB 1JWUB 4PRPD 4R0LB 1G7PB 4HUMB 5CILH 4MB3A 3DYOA 1KLUA 3TJHD 3WEXB 1CICB 3QQ4A 1YEKL 4BSVA 3BQUC 4KJWC 4LLDB 4KZEH 3VFGH 1MVUA 5FGRA 4HW6A 3BP5B 4F37K 3FOLB 1UC6A 4KK9D 5HI3D 3WDJA 4EJ1C 4M7ZB 3WIHA 3TVMB 4EI5A 1IL1A 1IZKA 4XAKD 4MNQE 1KLGA 3K4DA 3CFCH 3UPRB 1NC4A 2BOBB 1ZEAH 2J5LB 1LEIB 4KQ3H 2W9EL 5FKPB 1KIQB 1SEQL 4Y1AA 5I8CA 3C60D 2CSPA 1U2HA 3P4NB 3VGDA 1KPVB 1R5WB 1ZA3A 3K1KC 2D0FA 1Q9KB 3FN0H 4QNPF 5DT1L 4KDWA 3DMMB 3O11A 4AZ8A 4P2RB 2JJTC 4M48L 3OKNA 2PCPA 4F3FB 4HXBL 4M61A 3EZJB 3MV9B 1NEZG 3L3JB 4A6YL 5DHYB 2JKXA 2D0GA 5IM7B 4NZTH 3S35H 4KV5F 3KYKH 4GW5A 3C6SB 1AC6A 2AJ3B 2CO6B 5GRXG 3VWKA 4L4VA 1AO7B 3S5LG 4M8QA 2R0KH 3FO0L 1FLRL 4H88L 4G6MH 4GMSH 1OAQL 1Y0LA 2DQUL 2YPVH 3PWLB 3KPLB 3SE4C 1YPZB 4HKJB 4KTEL 3T3ME 1WIOA 1GPOH 1BIHA 1U36A 4OD1L 2PUQT 2DBLL 4Z0BL 5E4EC 5T1DL 5BXFB 3RIAF 3CSBA 2BY0A 1Q72H 2VDKL 5BRZD 5BQ7A 3BJLA 1FYHB 2WK2A 2YRPA 1FIGH 5F1KC 3EOTH 5DEFB 4ZSOA 3QEQE 4N68A 5I74C 1CS6A 2GJ6B 4S1QH 1CDUA 5D2NE 5CD5C 4I5BB 4XPFL 4ETYA 1QYGH 3O2VL 1RIVL 3HG1B 4NKIH 3H8NA 3VGBA 3VWKC 4TUOA 1NGYB 1TETH 3MA9L 1J9CT 2AAVA 2Y6SD 4Z76B 1MI5D 5J12B 2ZG3A 5K59F 1A22B 1E27B 4DVBB 4EDWH 3AY4C 2GITA 5GGSB 3VFRB 4UIKL 1N64H 1L9MA 1U8KB 4TPRH 5JA8B 1DVFD 4HFWB 1HK6A 3RZCA 2NY6D 4XPBL 4WI8A 3C08H 3SJVB 5GQBA 4YDIH 5L7XH 3IU4L 1OD9A 4TRPH 5INCB 3QZWB 1KNOB 1RHHB 3TC9A 4OZIA 3V0WL 3QCUH 2XA3A 5IBUB 3FFCA 2W9DH 4ZG1A 1FYTE 2R15A 4Y4FD 1FG9C 4MZ3A 3DSFH 2J8UF 1IM9A 1D9KA 4XPAL 4Q2ZB 4QTIL 3T04D 5L6YH 4XZUA 1LGVA 2FX7H 2F15A 4NRXB 1AC0A 2NY4C 3ULUC 1GXEA 5EB9A 2BHYA 5EZJA 3D3VE 4YDVB 4U1NB 1MFAL 2P1YA 3B9DA 3HI1A 5JOFB 5I30L 2AQ2A 2EDQA 1AFVH 3TBTB 2VLME 1FO0L 4JREC 3PP3K 2LAAA 3NIDE 4MD5B 3HFMH 4XPTH 3BP4B 3RWFB 4KVNL 2ICEA 4XH2B 4NN7B 3I3DA 4EN3B 5DQDH 1UWEH 4MB4A 1QOKA 3RZCC 3CFIC 2YPKB 4AENB 4FQXC 4FXKB 4R8WL 3W11D 5E9DE 3L9RA 3NABL 5F7MC 5F70A 2OL3L 1KACB 1M71A 3S9DB 2VQ1A 1PSKL 3ULUF 1TCRB 3HUJB 4MAYD 1L4IA 1G6RL 1T1ZA 4G6KH 4JN2A 1D9KC 4NP4L 3QWRA 4LCCC 4Q0XL 5EUOF 1Y18B 2XN9E 1IGIH 5TGBA 3WLWD 2XPGB 4ONFH 4CVWA 1ZHNA 4U1KA 2CK2A 4PJAA 4AH2A 1NUNB 4FG6C 3ISWA 1SMAA 1G7JA 5IOPB 4IOSD 4U1HA 2P7TB 5IB1A 2YD4A 1A7PL 3T1FA 1G9NL 3L5JA 3Q5OA 3MA7B 3T0XA 3SEPA 4LSVH 4XP6H 4XP9H 1BREA 5DA0B 4PUBH 5FUOH 4OZIF 1I9RL 3CXDH 1RZFL 3ZKXB 3W9EA 5E2WL 4LRNL 2X9YA 3I02A 3VG0H 1RZKC 1YN7B 2BVEA 3UC0H 1QPPA 3MLRH 4KUZL 1IEHA 2BCKB 4ZODA 4HT1H 1BFOA 4N5EC 3BKYL 4UAOC 2B0SL 1ORQA 4RGNB 4U4BA 4EQ2A 3S8WA 3LV3A 2VZ1A 4CAGA 3U4EA 4M02A 3KYNA 5GJSH 4N0FB 4L9LB 4JR9H 1GIGH 5DWUL 4JFEB 4XT1C 3K46A 2I07A 3VFOB 2FLBT 4DKEH 3PQYD 5FYKH 3TP4A 2NXZB 3ZSTA 3KYOA 4JO3H 1FFNB 2DQFB 3S37H 1A2YA 2BVQB 3WIHH 3QUXC 1WF5A 3KJ6H 1QEWB 1F97A 2R56H 4ZPTA 3UTZB 1JI2A 4PD4J 3W2DH 4OZ4A 2Q8AL 4RWYL 3FT3B 5FHBL 5JXAL 5C0DB 1BLNA 1TJIL 2X1XR 2J88H 2MJWA 1NCDL 3MJ7A 4H5SA 1KB5L 3IGAA 3MACH 3VD7A 1MH5A 4UQ3B 1C16B 5E99H 2V5MA 5LAXA 1J8HE 1T1WA 4PJ5D 3ARBA 1ND0B 3GEWB 1BOGA 2DJSA 1AD0A 1UA6H 4M5YH 4P2YA 1F4XH 1C08B 1KJ2A 1WC7A 1A7NH 2HKHL 4D9LL 4OZFA 4QKXB 4MWFB 4L4TE 4HS6A 5CINH 4G6AD 3AMKA 1KF9B 4FABH 3LSOB 2DI9A 2AK4D 3CGTA 4JPKH 5FM8A 4OZGB 4WTXA 5J1AB 5FIEA 2ZCHL 1RUAH 4FXGB 3RQ3A 4MDJA 4TSBH 5T5FL 3HR5A 1DFBL 4EEEA 5JIHA 1NLBL 5DUBA 2QHLA 4K3JH 3G5YB 3MODL 5JDSA 4K8RC 2R8SL 3ROOB 1QFWL 1NMAH 3BUYA 3UDWA 4BZ1L 1JTOA 2AGJH 5D8JL 1YYLH 4WGVB 4YHNB 1A3QA 4NSKA 3O3EB 1YC8A 4GRLD 4D94A 5CBEB 3ZTJG 2DQCH 3ARBC 1DQDL 3VGAC 1JK8A 5D72H 2N56A 4QYOA 4QXUL 3DUUB 3EJYD 4ZUSA 5IMKA 4X5XA 3WE6B 3I3EA 4MJIA 3QI9C 4MSWA 2VJXA 2Q6WA 3GSNB 4OCSH 2EDKA 5FYJD 1QBAA 4LHJB 4CADB 4ZPVA 3FO2A 3QG7H 1ZVYA 4MJ5A 5IHUL 3B83A 1NJ9A 2AEPH 3OR7A 2FRGP 1HZHL 3PHQA 3LKQA 4KROB 1XZ0B 4JFQB 2AEQL 1CGWA 4KRLB 2AJZB 1GL4B 3VRJA 4PJGA 1JL8A 1UYWH 5JHDD 3MRBB 3ILPA 2FYYB 1MAMH 1MIEL 1I4FA 4ZAKC 2QR0B 1Z0NA 3WL9A 1JZ5A 3IJYB 3DHJA 4G9FB 3MOAL 1YY9D 4TSAL 5C9KA 3HE7B 3M07A 2ILLA 4TOYH 4YDJB 3M17A 1A1OB 2A1WL 1MCRA 4JCMA 4QCIA 3EZ8A 1AXIB 1MWAL 5JIKA 3O8XA 1N4XH 4QHMA 3KWWB 4PP1C 2CRYA 1DBKH 5MEQB 2CIKB 4X7CC 3BIKA 1KTDA 1W0YT 4LL9A 5IB5B 3RHWK 3CH8A 4P2CG 2NYYC 1J1PL 5AZEL 1DBAH 1T7XA 3GSQA 4XRCA 5D96B 5CEYB 4POYA 5ICZA 5DMYA 5E8DH 1I1AD 3CNKA 4KMTH 3RUGB 2Q8BH 2NY2C 3SDXB 3ALWA 1AGBA 4F33B 1RFDH 3QFJA 1IEAA 1XGPA 1RZKH 1OY3B 1XH3A 3BRFA 5HDOA 5B4MD 8FABA 1A6TA 4PJFF 3QDJA 3CZFB 4XNQB 5E24E 2EDEA 2J4WL 4HKZB 4YNYB 2B4CL 1GYAA 5FO8B 1FN4B 3TV3H 4N0UB 1D5BB 2Y72A 3QIWB 3H9HB 3Q0HA 3U0WL 2YN5A 3RGVA 2JELL 2VLKD 1FL6B 1WZMA 5AUMA 1XIWC 1UWXH 1BM3L 3O8XC 4K9EC 4KKAC 1G7MB 2BVOB 1HI6B 1NAKH 5L9DH 3WUWB 3F7YA 4JG0H 4MHHG 4X9IA 1H0DB 4TTDD 1G1YA 3LKPB 1PDKA 4KY1H 1U8HA 1XAUA 1KYOK 3BGMB 4UOJA 3N9GH 4JDTH 1QLEH 4PRAA 4MHHI 5IW3A 2P24A 1BJ8A 3H7BB 4ZUVA 4WO4B 4PRHA 2V7HA 1L7TL 4ZFFB 1GGTA 4WW2C 5KVDL 3GHEL 3FQRB 3QXDA 5KVMC 1K5NA 4GAYA 5BV7C 2D7PA 3F7QA 4DZ8A 4HZLB 3TBYB 2A83B 1DLFH 4YDLB 1F4AA 1I3GH 2Z9TA 3TWCL 5D4QA 1S9XA 4XPGL 4W4NA 2ATKA 2FATL 1WFUA 5IB2A 5FYKE 3WNLA 4QHUA 2ZPKL 4NBYB 4NRYA 3HC0A 4HXAH 1P9MA 3VH8B 5KAQG 1RMFH 3UYRL 5DJ6B 4LSTH 4X6DB 4H25B 1JZ7A 3BN3B 2CJUH 2OR9L 1RSFA 2AJXL 1BBJB 3CSYB 3SDDA 5JXEC 1SJHB 4QRRE 4HS3A 3EOYG 5BVPH 3GMNB 4WW2F 2VERN 4Y1AE 4JJ5B 5K59E 2IMMA 1HKLH 5D7LA 3EDJA 1WWBX 1WZKA 4K8RH 1MJJA 4NO5B 1I8LA 2DB8A 2BSTA 3KPSA 2F54A 5DJ2A 4LSPH 4TVSa 2C1PB 1OPGL 3IETA 4Z6AT 5IVOA 2MTPA 1ACYL 3QXTA 4TULL 4LPYA 1T0MA 4MD0A 3VXRB 2J3SA 4QXWA 2X89A 3L5IA 1RULL 4M03A 4IOFD 3O2DA 3GSRB 3PL6A 2HTLD 4GRWB 3S5LA 4F57H 1KJ2H 4OZFH 4M4PA 5FB8B 2NXYC 4L4VE 1KCVL 3MRRA 4GXUN 1RVFL 5HVHB 3A6CH 4NBZB 1EO8L 1NDMA 1FZKA 5TH2B 3OAZH 4PB0H 3P4MB 1UQSB 3QO0B 5TE4L 4U1GC 3NGBC 2R0WH 3LMJL 1T2JA 4QRUA 3ZL4H 3DVNB 1BZ7B 2DMCA 4JE4B 4KAQH 3NPSB 5IIEA 2P43B 2M8XA 2NCMA 5GSVB 3HLAB 2GIYA 3QNZA 1JGEB 4JRYB 2W0LA 4BZ2L 1S3KL 4CNIB 5IFJA 4DOHB 1RJZA 3IU3A 2CMRH 2NX5D 1YQVH 1IQDB 4Y2DD 2EIBA 1NDGB 3SDCB 1EA9C 1ZHKB 2WINA 3CFKB 4RZCA 2YKLL 4LKXA 4OM1H 4ZSOE 2X1QA 1NKOA 5IEKB 3WN5A 1U92A 3MLPA 3U4BL 1DEEB 2D3VA 3C60A 5ICYB 1M1SA 1D5MA 3V79C 4JPWH 1XT5A 4X9FA 5ICXB 5DRNB 4LKCB 2DQJL 3TLRA 4Y4KC 2MPAH 5TFSL 3LN4B 3ZYOA 5EIVA 4DVRL 1RJYB 4CU7A 1T7YA 5JLZB 1YJDC 2AERT 1SY6L 5GRVK 5GS2H 1SHMA 3L3DB 4DZBA 2VDPH 3BPCA 4WCYH 4YE4H 1N6UA 4Z7QF 1RPQA 5GRYA 1D6EA 1WAAA 3SDAD 4N8CH 3GSWB 3GGWB 5TDNA 4ZTOL 2DS4A 4KHTL 1L9NA 4JFOA 4Z9KB 4OZIE 2HLFD 3KPQA 4IRSD 5F9OL 5HI3C 5K9KB 2XQBL 2XYCA 1QBBA 3FFCE 1F4HA 3FQNA 4IJ3C 3OB8A 1YEFH 2ZG1A 5C0AA 4CL7A 3FONB 5GGRY 3UZQA 3WIIL 2G2RB 4U1IB 2F19L 3BW9B 3WN5C 3MO1B 2FD6L 4P48A 5GHWH 4I0PA 3C60C 5IK3B 3PNWA 4K9EH 5EFIA 3RA7H 4ZUTB 4MXVE 4PY8I 5FO7B 4XMKL 2UZIL 3HCVB 1ZHBA 1Z3GH 5HYSG 1S7UB 5C0BB 5BRZA 4LBEA 5CZVL 1NMBH 5B8CB 4O51A 2JTDA 2VSCA 4IM8A 4XTRD 4W6YB 4Z8FH 5D1ZC 1KEGL 4C4KT 1T5WB 1KULA 2PW2A 2PYEA 1CVSC 5MHSD 4ZD3H 1TJHL 2XZQL 5HHOB 4EVNA 2ZNXA 4OGZA 5DHXB 1ZXQA 1MI5A 3RNKA 1XGQA 1EMTH 5M94B 5ENWA 4N9GB 1AKJB 5IMMB 2YD8A 5DRXA 1A14H 4LIQL 1C5BL 2V2WA 1TQBC 1DVFA 4KHXL 4OIAA 1U8IA 3E3QC 4BK5A 1I7UA 4X7FC 5DD3H 4LDLB 3FTGA 4PJAE 3EHBC 2BNUA 1XR9A 3HI5H 3QQ9D 1CE1H 2AK1L 2RFXA 4P5TD 1LDSA 4OAWB 3E6FA 4U1LB 4Y4FA 3B9KB 3MNWB 4UTAL 3BEVA 3LH2L 5IFHH 3FQTB 5FOBA 4EOWL 3L5XH 2XWJB 3TF7C 3UJTH 2Q76B 1K85A 4UV4L 5F3BB 5C71A 5K9JH 4HV8A 5FHAH 2OK0H 1AP2A 1CZ8H 4HGWA 3PXJA 4NJAH 3OXSA 3DIFA 2QQNL 5DUPL 2Z4QB 3BP6A 1PG7L 4K7PY 3MLUL 5HHPB 5FECA 5K9OA 1EJOH 1CWVA 2NY6C 4HJJL 1EZVX 2DYPB 1YMHA 1GOGA 5KSVA 3HNTH 3Q1SH 1FVDB 1QUNA 2HTKD 1W8NA 3LRSB 2ZUXA 4FQQB 5H37G 2VXVH 4YXLH 2AXFA 4MAYA 4CVUA 3N1PC 4Z7VF 2DMBA 3OKOA 5H35B 4WWKA 1ZKAA 2A0LC 3RWCB 1P7KB 1DR9A 1HXMB 4H0IA 5C0IA 1AJ7H 4OF0A 4YFLI 5FYKU 4DKDC 3SPVA 2LTQB 2NZ9D 4J2XA 5DA4A 1H9VA 4HKXA 4RMTA 2OTPA 1YEDA 1E6JL 2B1HL 5A3IC 3AUVA 4WI6A 1UCTA 3NAAL 4ODHH 1ZLSH 5E9DB 5MEOA 1VERA 5ADPL 1OF2A 5C6PB 3DV4A 1F3JB 1RUPH 3VXUD 3CH1B 3QJFA 1W0VB 1J7VR 2XTJB 4Z7WF 5F96L 5F7LB 3P77A 5E6IC 1TVHA 2OSLA 2D4DA 3RBGA 1U8QA 2MCPL 4M6OH 1S9WB 1WFOA 5I8EA 1YEHH 5IB4A 4ALAL 4PJIA 1X5ZA 2Y06L 2R23B 3TGXA 2X44D 4EUPG 1BJMA 4R7NA 4GS7C 4E41D 1Q0YL 5HPMA 4KJYB 3O81A 1RK1B 3IKKA 5F88B 2DQEH 4G8GD 3CU7A 4TYUA 1MCPL 4LP4A 2A9ML 3PIQB 3FN3A 2YWZA 3CX2A 3MRGA 1XGYH 4LHUB 4J3OC 5IJVB 1MCBA 4RAHA 1U3JA 3PXHA 1CVRA 2DOCA 5D1XD 1IKFL 4M7JH 4U1MA 5DJ0A 5I76B 3T0ED 4JQVA 1NUDA 5C0RL 3VI4F 3MGTA 4DJMA 4LEOA 2OQJB 4MJIE 4YHPB 5DHVA 1JF1B 3N1QC 5DQ9B 2EH7L 1S7XB 4KTDH 3GI8L 4UU9B 2V9RA 1JYWA 4Y5YB 3W5MA 2ZKHL 1NLDL 1UVQA 2VAJA 2GT9B 1PYWA 2XWBA 4AT6B 3MRCA 3O45A 2I24N 4JPVH 4Y8DC 1Z9OA 3GIZH 4P4KA 4BH7B 3AU1B 3KPRD 5DJ8A 5DXWA 5EO9B 3WFEL 3SQBA 1A3LH 3OQ3B 3S96B 5DS8A 4PGZA 3FT4A 3BP7A 5EC1A 4HZAA 3O4LD 3W0WD 3TYGH 3S3JA 3EOBB 2H3NA 4PV9B 2AK4A 3RAJH 1P4LB 1VESA 1YY8A 4GBXD 4X7TB 2FB4L 3L3HB 3QDHA 3V6ZA 2D31B 5HJ3B 2OJZL 1X7QA 5FF6A 4JQVC 2AEIT 2ZNWA 3VGHA 1BAFH 3TVMD 4LLMA 1F11B 4XMLH 5JUEL 4CU8A 1PX3A 2WIIA 1MUJB 2X4UB 3U82B 3KR3H 1JGVH 1IFHH 1VFUA 2IFFL 1VFAB 1X5IA 4HS8H 4BELD 3GSVA 1D7FA 5I1GH 2VTFA 3H9SA 5CSGA 1V5JA 1FNEB 1QZ1A 2FGWL 4P49A 3SDYH 4U6XA 5A16A 3MGOB 5IBTH 3WDHA 3DMMD 1FBIL 2IBZY 4P2RD 1P5VA 3QFJE 4RFOH 2R4RH 1H8SA 1JHLL 4QRQA 3MV9D 1DTUA 3QDJE 2OMBA 1U8PB 3DXAE 1X3DA 5LJYH 4D8PB 4P2OC 4N0YL 3FB6B 5C0JB 4GW1A 2MOVA 3RNQA 3M45A 5FEBA 1CG9A 5ESQB 4BZYA 4QHNA 4HWZB 1YEGH 4WFGE 2R2BB 1HILA 4E42B 4HUVB 4L8BA 1AO7D 3R1GL 4Y0GA 5JHDA 1BGXL 3UTOA 3L7EA 1VGKA 1J0YA 2AABL 3INUL 1UWGL 1NC2B 1BFVH 2VQTA 4NYLA 4LSSL 2WUCL 1HQ4A 3TESA 4A6YA 3TCLB 2A6IB 3MMEA 4O9HL 3EYVA 3A6BL 4JGMA 4WY7L 4GRLC 3L3GB 1KT2A 2DLTA 4X4XA 5EBWA 2D7TL 3AAZA 3V2AR 4JY5H 3ZE0F 3LN5A 2RHEA 4I9WE 2Y1VA 3L6FA 5JHLH 5C9JA 4UT7H 4G42B 4PRHE 3ARUA 4U3CA 3DTXA 4L3CB 5IMOB 5GGVY 2X05A 3QUZB 3BSZH 1L0QA 2BVTA 4N1CA 3VFTA 4UT9L 1I1AA 3MZTA 1S8DB 3MUZ1 4WNQA 3MRQB 5F8QC 2FNBA 4FQ1L 4NZUH 3BDYH 1TZGL 2QBWA 1GCFA 1NCBH 3QNXB 1U8LA 1AD9B 3ZKQD 3VFWB 3G9AB 4UT6H 3LIZL 5F21B 2B5IB 3RRQA 3N1FC 5JPNA 1YY9C 4NHCH 2EO9A 3QG6A 5FCUH 15C8H 3GJFB 1CK0H 2YK1H 4TSCL 1HHHA 3LY6A 4QHKJ 3EO9L 2VLKA 3A67H 3SJVD 1A9EB 4DFHA 4LQ1A 3IJSA 1X4ZA 5CEXB 3BT2L 3IDJA 5DVKA 3BPNC 2DRUA 5D7LE 1FCGA 5BW7C 6CGTA 5D7JD 3WO4B 4K3HA 2X70A 2HN7B 4AYFA 3X3GL 1U8MA 3V4VL 5ID1A 1EHXA 3KPSE 2F54E 3QULB 1HH9A 1WICA 1CGXA 3UCRA 2OR8A 3P30H 5KSUA 5C6TL 1KJ3L 2DIAA 3H7LA 5DD5H 1I1AC 3MLZL 1VFMA 4OIBA 3RWEA 3OPZL 1MELA 1IGFH 1TLKA 1WSST 4NWUL 3TBWA 1KGCD 5ESAB 2PO6C 4F7TB 3RVWC 4OLVH 4HLZG 4WTZG 1G9MC 3WFCH 5GISL 1LE9B 5EORH 5IGXL 2ICCA 4TNWK 3C5ZB 3F7RA 2RQ8A 4PRPE 1ZE3C 2RJMA 1NGQL 1J0JA 1YN6B 3EYFA 3ZE2F 4AG4L 1BD2B 2CRZA 1XF3B 3FB7A 4ZO6A 3EAKA 1FDLH 4DCQA 3K80A 3JWOL 2YSSA 2AJVH 4H8WH 1YNTB 1RZ7H 5F93C 1HKFA 4XAKE 3ZTJH 1EEYA 5E08L 1FO0A 2VDQH 2SEBB 4PRBA 3ZT7A 5MI0B 4LVEA 4TTDC 1GZQA 4X8XA 4ZUUA 1T4KB 3TZVB 1ES0A 2Y4SA 3JBG7 1YNKL 1H8OA 4XXCC 4MXWL 2WWKT 5I1CL 3STZA 1KLUB 3HTLX 3QQ4B 5DHVH 3RIFK 4AQOA 5JTWA 3SKMA 3UTPD 3Q6FB 4O02H 3P0YH 2OL3A 1UZ8B 4WEMB 1O5DT 3BVNB 4RAVA 1FE8L 3BWUC 4K3DH 4GQPH 5SX4I 4EXPX 4QXGL 4M1GL 4LQFH 4EI5B 1IL1B 5ERWA 3NFNA 1KLGB 5DEGA 4E0RA 3MBXH 1MNUH 4U0RC 1S9VB 1WAAE 3MFFB 4NPYA 4JZJA 4OCXH 4N0CC 4RGND 2V2XA 3QDGB 3DWTA 1A9BB 4OJFH 1B0GB 1F2QA 3CSGA 4YK4B 2FJGA 2WIMA 1YQ2A 1CDGA 4JFED 2ZSWA 5D9SA 1F58H 5GSRA 2QSVA 2XZZA 2W0KA 2NXZD 4H1LG 3RVTC 5F7WC 1P4BL 3HZVA 4BFIB 1X5FA 1QLFA 1S7SB 1YEEH 2NX5A 4Z7OE 4LPTA 1ZHLA 4JO2H 1UKSA 5BJTA 5BRZE 3MRKA 4CKVX 4ODUA 4ZYKB 2P42B 2NTSP 2EKSB 3G6JA 1ZWIA 3D9AL 4MNHA 1OCWH 5F72S 2YZ8A 1R3IH 4RFNB 4S0TD 3QP3A 3OF6D 3LQAC 1Y0LB 1MAJA 2B1AL 1N7ML 1JNLH 5DZNA 1YEKH 5FKAA 1DLHB 1WVZA 2HJKA 5EOCL 1E4XL 5IKCA 1IAKA 2Q20A 4U6HA 5FYJH 2Q87A 7FABL 2P8LA 4X7DC 3IF1A 4KTYA 3MJ8A 1MI5E 1KFAL 4ZS6D 5EOTB 3GBLA 2ERJC 3T2NL 4JM2D 3QQ3B 1JN6A 1Q9WA 5BQ7B 4BQBA 3L7FB 1SBSH 2W9EH 4NNPH 1FC2D 5EU7C 2IH1B 3RWGB 4LSUL 4PJEB 1K4DA 2NY3C 5CUSL 2IH3A 2FZ3B 1T5XB 2FX9L 3SDAA 1CGUA 5FK9A 2C4FU 5DT1H 3ZKND 1I7ZB 4F37F 1FZMB 1BVLB 1KB5A 4GG6F 3VD4A 2HP4A 4IRSA 4M48H 3SCMA 1R0AL 4Y2DC 4TUOB 1A6VH 2XZAL 1KB9J 3KPOA 4N0RA 2GSGA 4CGTA 2EXWD 3N1MC 4YHIA 1H3WM 5C0EA 1NANI 4FQCL 5MEPA 1PVHA 4ERSL 3NIFF 4B0MM 3ESUF 1EHNA 4JY4B 4OLXH 3TA3A 3BIAX 4P46B 2OP4H 3FO0H 4LLQA 4R4FL 4PJXB 4LP5A 2J2ZA 4HIXH 1IC5L 3FFCB 3WV0A 1C5DA 1PY9A 4J3SA 5E1AA 3U7AA 1IM9B 1FG2A 4MYWB 4XZUB 5IVXF 1CLZH 2NLJA 4MQ7A 3GRWL 5ACLA 2HLFC 1AGEB 2VDKH 5FDWB 5IROC 3HI1B 5E94A 4C57C 2B2XH 2CRMA 3OJ2C 5E2VH 3WDIA 1PG7X 5ITBL 3T8XB 1OM3L 3K8MA 3DI2B 3T4AB 1JWMA 3VXNA 2P8MA 4XPFH 4CRPA 3LD8C 4MQXC 1RIVH 5HDQH 5I16B 1ZAGA 3IXAA 1ZGLP 3HE7D 4P5TA 1TZHB 3NACH 1R3KA 3JV6B 2A6DA 3MA9H 3BZFA 1ZA6A 3S3SA 5KVFL 3L9RB 4RMSA 3C09C 4JKWA 4MLSA 2EYSA 3B9EA 3E6HB 3NH7H 4XTRC 1M71B 5IW6B 4UIKH 2VQ1B 2YUXA 1FGNL 5CJ5A 4C4KO 3MRNB 1ZLWK 2YXFA 2ZG2A 3X12A 3MRIA 3QHZH 2DQGL 4ZNEA 4WU5B 5TGBB 3IU4H 5TE6L 1ZGLA 1FFRA 2YRLA 4U1KB 1S7VA 4M9OA 4PJAB 1MCFA 3V0WH 3EO0B 4XVJL 4EUPA 5L88H 4L1DA 4P23D 5IESL 4GRMA 1G7JB 1KCSH 2BY3A 4U1HB 2R0LL 5IB1B 4XPAH 2D9CA 3UYOD 5E8EA 2VWEE 1YYML 2KL6A 3KPNB 3RDTB 3PQYE 4K7FA 3D5OF 2CLRB 4FQIL 4YHML 2CDFB 3QQ9C 3OSKA 5I30H 1DL7H 3QIWD 1FVEB 3HNSL 1FVCA 1FO0H 4JVUA 3R06A 4NZRH 3GI9H 3R0MA 2UWEA 2Z0BA 1OB1A 1CGVA 5FA3A 3CVHB 1OP9A 4XP4H 4KVNH 1BFOB 1L7IL 5AAMA 5HDBF 1NGXB 3LAFA 5JQHC 4KZDL 4IMLA 3KYNB 5MP6L 2VUOA 4R4BA 1T1YB 2J6EL 5C6WH 4R8WH 4EZMA 4NZJA 3V7MA 1RZJL 2I07B 3U0PB 5HGHB 1B6DA 1SJEA 3AXLA 5HY9B 3KYOB 3EDDA 4PJ5E 1PSKH 2EC8A 3VXUA 3J7HA 3DBXA 1A2YB 4TNVK 3QSKB 3H9YA 4DTGH 1QFUL 3O2WL 2VH5L 4WO4D 5I1IL 5DFVC 3ARXA 5EBMA 1XGUA 4RMUA 4Y88A 1LD9B 1P6AB 4KDTC 1RZ8B 1WWWX 4OZ4B 5CP7A 1MLCB 4HUUA 4P4RB 4YXHL 2WWMD 2HTKC 1XEDA 2FR4A 4JQIH 2AK4E 3ARGB 1A7PH 4ODVL 1CLYL 2DM3A 3OGOE 1INDH 5EU6A 5EU4A 3O6ML 3IGAB 3MBEC 5I1KL 5IHZA 1RIUL 3RJDA 1WZ1L 1NUFA 4AEHL 4E41A 2VO5A 4JN1H 5LAXB 4G8GA 1T1WB 3JWDL 1I9RH 4PTTA 1LHZA 4YHLL 4JDVA 3ARWA 4AIZB 3G5ZA 2Z93A 3D25A 3DNKA 1XCQB 6FABL 3EDKA 1AD0B 2NZ9C 1WC7B 3BH9A 3I50L 4OZFB 4YBLC 1QSFA 1VPOL 2O26U 5HI4C 5FA4A 3QPQD 4HS6B 2BY2A 1NH6A 2B0SH 1IM3A 5I73C 3WXVL 2A6KB 2H2PD 3UPAA 5D1XA 5E00B 1RU9H 3VWJB 3T0EA 3FQXA 1A3RH 1BQLH 1EFQA 4OLYL 4B7LA 4OCMC 4PJDA 4MDJB 1B6UA 2IC2A 1T2QL 3KPPB 2UWEF 5FYJE 3WUWG 1NCAH 3QIUC 3ARVA 2Z31B 3MCG1 5DI8B 5KBNC 5DUBB 5ILTL 3VXRD 5JDSB 5JPMB 4Z77A 4ETQA 3O9WA 2LU7A 3KPRA 4CJ0A 2GUOB 4NSKB 4OLWL 4ODBD 2VZUA 3C5SA 3T0DA 2YBRA 1JJUA 5JHDE 4ENED 1TJIH 2CD0A 3W0WA 1OSPH 5IB3A 4JLRA 1CTOA 1F13A 1NCDH 3RWIA 5LQBL 1P4IL 1JWUA 4X5XB 4MJIB 2EDWA 3WJLC 4GBXA 4LLDA 5C0GA 3CFDB 3FO2B 4ZPVB 2I60L 3LKNA 2E7LA 3WKML 3BP5A 3PHQB 3FOLA 3TEUA 5GS1A 2HKHH 3TVMA 2H8PA 1GHFL 1E4KA 3SDCD 3ZE2E 1XMWA 3UPRA 3IJHB 2BOBA 4PJGB 1LEIA 2YA1A 3ILPB 1KIQA 5F89B 1ED3B 2WBKA 4HWBL 3SE8L 1CFBA 3WL9B 2VYRE 3LZFL 2DQIL 2EYTA 3WYRA 2BNQB 4TUKL 2RCSH 2ZCHH 1R5WA 1GGCL 1T89A 1Q9KA 1T04A 3OMZA 3O3AA 3DMMA 4XMPL 5T5FH 3VW3L 1A47A 3LDBB 1IAII 5IV2B 4JFZL 1YNLH 3MV9A 3DARA 4LDOB 3G6DL 1NLBH 3PV7A 4XI5D 5DHYA 5H37H 4QHMB 3WJJA 4DFIA 5IM7A 3DYPA 4I18B 4ZDHB 1F45A 1QFWH 4R0LC 1CBVH 5FO9B 2DLIA 3BIKB 2JJSA 5D8JH 1KTDB 4ORZC 3VFUB 1GGYA 1U6AL 1CICC 3K74B 4PJDF 3ZT6A 1UXSB 3X13B 3LS4H 2VLKE 3C6SA 2HFFB 2C4XA 2VLRD 4U3HA 3GSQB 1LK3H 1OTUD 5LCVH 1AO7A 4D9QD 5ICZB 4OZHB 2V5TA 3PP3H 4BSJA 4XC1L 5DLML 5IWLC 4M7ZC 3CVIL 4LMQI 3TVMC 3PWLA 3KPLA 1E4KC 1AGBB 5D1QC 1YPZA 4HKJA 1XGPB 2J5LC 4OTXL 5IHUH 1PEZA 8FABB 1A6TB 3CX5J 2CK0H 5I8OL 2FGZA 1MY5A 3BZDA 1SY6A 4P5KB 3JTSA 5IT2L 3LQZB 1LNUA 3MV01 2AEQH 4NQXB 2WLZA 4M7KL 4PRIB 4WWID 5C0BD 3DMMC 2DKUA 4ZXBB 4WTZA 3RGVB 5E1HB 5AUMB 1A6UL 1MIEH 4OI7A 1T7ZA 3S7GA 3KHQA 4O5LL 3MOAH 3C9NA 4EUPH 2Q86A 2XV6B 3RVVD 1J87A 2BX5A 4PJBB 1GJIA 3RP1A 3HZMB 4Q9QH 1EBAA 2A1WH 5HGDB 3QRGL 4KXZI 1M6OB 3UROR 5HHOD 1U8HB 1E27A 4JRXD 3EFFA 3WNNA 5GGSA 1AKJD 4PG9A 3SE3A 1U8KA 3BOVA 3PWPD 2P24B 1QACA 1J1PH 4HFWA 4KU1A 4ZUVB 3QPXL 4PRHB 2V7HB 3F6IA 1CFNB 3IXTB 4ESKA 1F6FB 4XBGA 5INCA 1K5NB 1MCJA 3TN0B 2QKIB 5D7JA 4OCWL 2JB6A 1UJ3C 2XKNB 4JKPL 4OCYH 3B9KD 1S9XB 2VDNH 3RHWF 2ATKB 4YHOL 4MA3B 2J4WH 4E5XA 1B88A 4ORGB 4MJ6B 1IC7H 1LDPL 3OKDA 4U1NA 1WTLA 2JELH 1DANT 4XP1H 1NFDB 2D2OA 1UACL 1JCKA 1MFCL 1A7OH 3V4UL 3QIBC 4YXKL 4QGYA 5DJZA 1MAKA 1OTSD 1H8NA 4X80L 1JZ4A 2VITA 5GRJL 5J12C 4JRWA 2LE9A 5D7LB 4M4RA 1HSBB 3RWFA 3DVIA 2F58L 3U7YH 3SE3C 3MJ6A 1OTTC 1MJJB 5JW4M 3MJ9L 3SGKA 5D71H 4AK1A 4H1LA 1CU4L 2F54B 5DJ2B 4MX7B 2DYPD 5EU7E 3GMOA 5FV1L 4HAGA 3IETB 3IFPB 4QF1B 5FDYA 3MRLB 4ODWB 3NVQA 4GAGL 2NX5E 1G9EA 4PGJA 2AJUH 3HUJA 4N1HB 1QHPA 3S5LB 3VFMA 4KK5D 2MFNA 3BEWB 1ZT7B 3G6JE 3AS0A 5KVDH 3GHEH 4ODTL 3ULVL 1UWXK 5T3ZL 5LKNA 3NCJH 4XCFH 1KN2L 1NDMB 2EDNA 2X5PA 1CFTB 4XAWH 1FZKB 2CKBB 2NY1B 5TQ0H 5IOPA 4XPGH 3RL1A 1Y6KR 1JMZA 1HN1A 3VXQA 5ANMB 4MCYB 3PDGA 4W81A 5IIEB 4K55A 5HHNA 5E9DD 3IAPA 3MA7A 3PP4L 1R3LB 4AJ0A 5JW4R 2WQRA 3UYRH 1RJZB 1FNLA 4EN3C 2E9WA 5CLTA 2YXMA 2XTJD 1YUHB 2AJXH 3D48R 3H3PL 3MOBH 4RNRA 4RZCB 2JE8A 1J0IA 4GJTB 4XCEB 4YPGB 1N8ZB 1U92B 4M1CD 4Z5RB 1FFOA 5FYJU 1T0NB 1D5MB 4J4PD 4UOW1 4C83A 5CZKA 5TDOB 2V17L 4N0FA 4L9LA 4XHQA 1I7TB 1OPGH 2PR4H 4JFEA 5CSBA 3VFOA 3MCLH 1CYGA 1ACYH 3T2QA 3CFEA 4PPTA 1H3PH 4Z95H 4QOKA 1QSVA 2AV1B 1NCTA 1REIA 4LHUD 4DZBB 3BPCB 4LASH 3WIFB 1QEWA 3IKCA 5DTFB 2CGRL 2FWOB 4WHDA 1RVFH 2A74B 2EDBA 4AEIL 3FT3A 1IGTB 2R0ZH 2L7JA 5DMKB 4O58H 2P4AB 3ZKXC 5I8KL 4M00A 3OF6A 3LMJH 1QO3B 3FQNB 4AY0A 1I3RB 1ORSA 2CDEA 5C0AB 5BVJB 2FSEA 3TYFB 5MHSE 5F3HA 1KELL 1S3KH 1EAPA 1C16A 3N06B 4I0PB 2VAAA 4OQTL 3PNWB 5IMLB 3EJZC 5HDBE 1ND0A 3OBAA 4FZ8H 1HE7A 1WIUA 1CFSB 4JM2A 1NQBA 4L9LC 5BRZB 1C08A 2X09A 3GHBL 4LBEB 4WFED 3ZKMD 4W68A 3RTQB 1A1NB 2NXZC 1J5OH 1TPXB 3LSOA 3OAZK 3P9MB 2PW2B 1B2WL 4OZGA 2PYEB 5J1AA 4M43H 1BWMA 4FXGA 4XC3L 4JFFB 2IAMA 4LU5H 2HFEA 3RU8L 5TFSH 4ZFGH 1IJ9A 4RDQG 1W72L 5DZLA 1MI5B 3RNKB 1XGQB 1SY6H 4NUGL 5ENWB 3P0VH 4G7YL 3BMWA 5LG1A 3ROOA 2V2WB 4X5LA 5J7CC 1DVFB 4HLZH 1C7SA 3I6GB 1U8IB 4YHNA 4ZTOH 3SO3B 4LHUG 5CBEA 4HULB 1LO0L 4WEUD 2ED7A 4LPWA 2YMXL 1XR9B 2XQBH 1PEWA 3ARDB 5KS9A 2RFXB 2DD8L 3SN6N 1OAZH 3GBNH 4Y4FB 3WIIH 4YHYC 1MCDA 3BEVB 2F19H 1M05A 2FD6H 3GSNA 1I3UA 5EZOH 3BGAA 4CADA 5BOPA 1Z9MA 5FOBB 1U8NB 2UZIH 4NKDA 1I8IB 2GYSA 2B7DT 3ZLQC 3KLHC 5CZVH 1AXTL 2ARWA 2AJZA 4BM7A 2UWEE 3WSQL 4HGWB 2GCYA 5SX4H 2DQDL 1MFDH 4PG2A 4U6VL 4B7IA 5H94B 1VB9A 3DIFB 1KEGH 2VLJB 2QR0A 3IJYA 4NHUB 3BP6B 4R90L 4OD3L 2XT1B 5I9QB 4IEFB 4J23A 3HE7A 5FECB 5K9OB 3MR9B 4YDJA 1A1OA 3BESR 3CLEL 5KSVB 1LO4L 4U7SA 1SM3L 1MF2H 2NMSA 1NSNH 2ENSA 4UNTA 3VXUE 4LIQH 1HHKB 3WFBL 4KHXH 4K7PL 4OZGF 3UMTA 4MAYB 3P0GB 1FAIL 4WWKB 4LPUA 3GNML 3QUZD 3STBA 4I4WA 5CEYA 4X7EC 4HJGA 2AK1H 5BO1H 2QQKH 2VDML 4P23A 4KROC 3RUGA 5TDPB 4NO2A 1U91A 5CJOH 4UTAH 1YEDB 3LH2H 3BPOB 4E41E 1Z2KA 4H1LH 4DUWA 5C1MB 3HE6C 4G8GE 3WHE0 4XNQA 4HPYL 4HKZA 4YNYA 1WWAX 2A9NL 3QJFB 5FO8A 1FN4A 4GXVL 1D5BA 3HE7C 4DN3L 3ROLB 5GGUB 3QIWA 4MQTB 5C3TA 2OSLB 1RUKH 3SKJL 5MERB 2QQNH 5DUPH 5I8EB 5FGCE 2O5ZL 1KXQE 4PJIB 1FP5A 2BVOA 1B0RB 1HI6A 3T0EE 1A6ZA 3MLUH 3WUWA 4PJDE 4HJJH 2ADFL 5HPMB 5T33L 3TJEL 1FNHA 1H0DA 1V8HA 5CZXD 4U7MA 3LKPA 3S3PA 5D96C 2DDQL 1UH3A 5KW9L 1DN2A 4FQHB 4X5WB 1ULVA 1MIML 1HDMA 2Z91B 4S1SH 1UXWA 1T20B 4KJQD 4D3CL 4FQLH 1SJVA 1FFQA 3KPRE 4WO4A 5CJXC 1NANH 2G60L 3ZT5A 3O4LE 3W0WE 5EBLA 3FQRA 5DJ0B 2EC9T 3F8UB 1HSAA 2HH0H 2LV4A 3C5ZD 3FO1B 2YR3A 1HH6A 3RX7A 3MJGX 1E0OB 5AWNH 2MHAB 1L6ZA 2A83A 4DAGH 3VE0A 1EBPA 1NL0L 3NAAH 3UTTB 3KHOA 1EIBA 2EO1A 3L3KB 1BD2D 1NFIB 1FNSL 4XP5L 3RVXC 5CEZD 2BVPB 4JAMA 1PYWB 5DRWA 2ZJSH 3O45B 4P4KB 1AGFA 3P4LA 4P9HC 2DI7A 5JA9A 3CAFA 3RUGF 5DJ6A 1IQWL 3GO1L 2NW3A 4JO4L 1FIEA 4X6DA 4H25A 3SDXF 2VKXA 3EYSL 1BBJA 3CSYA 5DS8B 4NWTH 5GJTL 1SJHA 3ARYA 3SKNB 3LVEA 3TZVD 4ZMAT 1IGMH 4JJ5A 1ZS8B 5D2LB 4OFKA 4NCDA 3FAXA 3ZDZE 2H3NB 5LGKA 2VIRB 4KK6D 2AK4B 5LBSL 1YY8B 2R1XA 4P2RE 4WO4C 4MA7H 3V6ZB 2QLVB 3MV9E 2H32B 1NGPL 5T1MB 3CX5K 2VB5A 2A2QT 3QUML 4UNUA 2HRLA 1N5AB 1HYSC 3VXRA 4LLMB 1BHGA 1HXYA 3CK0L 5IFAL 4POZD 4WIQA 3ULVD 4YDLC 5T3ZD 1MRFH 3WFZA 5BOZG 2WIIB 2GI7A 4V1DD 3EIFA 3K7UA 5J56B 1B90A 3VD3A 4GKSA 1AO7E 1IKFH 1UM6L 4NO0B 3GSVB 1QVOB 2EIZB 1UB5A 3BISA 3H9SB 1G6VK 1Q1JH 3QDGD 4U6XB 3TH3T 5A16B 4PGCA 5TH2A 5DRZA 1S7TB 3WLBB 2BXYA 1CDHA 3QFDB 4ZOAA 1NAML 2XQYG 1YPZE 4JHAL 4IMKA 3DVNA 3CDYA 4LNVA 2X4TA 5K93A 3HLAA 1RY7B 1W0WB 5TQ2H 4CNIA 2EYRB 3THML 1OAKL 1LO3L 3EGSB 4BUHA 3VI3F 3WFEH 3MLWL 2H26B 1IQDA 4QHNB 3MRJA 1RAMA 1NDGA 1HILB 3SDCA 3T09A 4L8BB 4YHKL 2D9QB 1IBGH 3PWUB 4JFPA 2VXUL 5JHDB 3MC0A 1F8TL 2LU3A 5LGJB 3L7EB 5IEKA 1VGKB 4N1EA 1I85A 1DEEA 1A6PA 4NYLB 1V3MA 3SBWA 5FXCH 1JZ3A 2CPCA 4X6DF 4A6YB 3MMEB 1QBLL 5DVMA 3EYVB 2G5BA 1A64A 1INEH 5DRNA 2OJZH 4QRPB 3GSNH 1KT2B 4HWNA 2N7AA 4ENEC 2LAGB 3BGFB 2XG5A 4KKLC 4X4XB 5HVHC 3TFKD 3LN4A 1RURH 2QADD 5GS0C 5JLZA 3LN5B 5JUEH 1SJXA 1U3ZA 5C9JB 3DX8A 4IMKC 4KUCD 4P3CH 2OM5A 2DKSA 1QD0A 3OZ9L 3DTXB 3NPSC 2IFFH 4NC1E 4JFYB 3SJVE 1R6VA 2VLRA 2WAHA 2O5XL 3HMWL 3GGWA 2FGWH 3P11H 5DJYB 4L8CB 4GKNA 4DK3A 4NQDB 1GC1L 1FBIH 1LK2B 5K9KA 3TNMB 1WISA 4GRWF 4I48B 1T22A 3KPTA 5GGVL 5EC2B 1WZLA 3MO1A 4N0YH 4YGAB 4XCCL 2Y7QB 5IG7B 4OI8A 4LIQE 2Y36L 4LRIC 5GS0L 3LB6D 3QG6B 3HCVA 4GO6B 2BRRL 2B39A 4PY7B 5C0BA 1KGCE 4P46D 2VLKB 4OGYL 3ZTNH 3IJSB 3SQOL 5B8CA 1IC4L 4NM4L 4PY8J 5GZND 1K3ZA 2C7UA 4XI5C 2AABH 1ZVHA 3WO3B 1UWGH 1X5HA 2AKRB 3MRPB 5DD0L 2R4SH 1H3VA 4LLUA 4U6YA 3ZDXF 1F5WA 4O9HH 1AGCA 1MY7A 2Q1EA 5F97E 5ID1B 3A6BH 4BQCA 1HH9B 2VN7A 5HHOA 1BFTA 2D7TH 3VRLE 5KSUB 4LCWB 2E27L 2N7BA 5C2UB 4MVBC 4LSRL 4JRXA 3WD5L 1IKNA 3HUJE 1AKJA 1T7WA 5IMMA 4DKFL 3HMXL 3PWPA 1TVDA 1URLA 2KDGA 4K94L 2FBJL 4HX1A 5E03A 4ZFOL 2DI8A 2GFBB 3QCVL 1EEZB 3UAJC 4JPIA 1PLGL 4FQ1H 3V8CA 3RKPA 5HI5D 1O7SA 1TZGH 4P9HH 1LEGB 2F8XC 4U1LA 1UFUA 3EYFB 3MNWA 1FL3A 4JVWA 1C5CL 5B8CC 3UTPE 3GRWA 3C6LD 3NBNA 3FB7B 4DCQB 2HT4D 3GMMA 5D5MA 4IRJA 4TSCH 5J11B 3U4AA 1TITA 2Q76A 5DZOA 3VD5A 1EEYB 5F3BA 3EO9H 1CXLA 1KN4H 3RWDA 1GZQB 3HR6A 1S5IL 4M6ML 4ZUUB 1T03H 5SWSB 2VLLA 1A4JA 1CD9B 3BYTA 3PGFH 4RGNE 2D7OA 1IKNC 1X5KA 4KK8D 2P49B 4FQ2H 3STZB 1OSZA 3K8LA 4XHJD 1XGTA 3SKMB 4HD9A 3NCYP 4JFEE 2HRPL 4NNXB 1JZ8A 2OL3B 5C6TH 1KJ3H 4HFUL 3RDTD 3MLZH 4FHBD 3HZYB 3RKDC 1FVDA 3OPZH 4NKOA 5A2KH 4M9PA 4RAVB 3MUGA 5D2NC 1G6RB 1HHIA 4RWHA 4ELKB 4HSQA 1IAIH 2R2HB 4FQQA 1NGZB 2V2TB 4E0RB 3B9KC 3A0OA 1UEYA 1U93B 4FQPA 3T3MF 1P84J 2HVKB 3RWCA 3C8KB 1XF2B 4RMVA 1HXMA 1EXUB 5D6DA 2AXHA 4NCC1 2G75B 3MRFA 3DO3A 2FJGB 4K2UH 1FRGH 4NRZB 1KIPA 5GSRB 7CGTA 1WBXA 5HYFA 1ACZA 1OTSC 4UILL 4CMMB 2GK0A 3JWOH 4J8RA 1EUUA 4KPHH 4TNWF 1F3JA 5T3XL 5E08H 1FZOB 4WI3A 4R2GD 1C12A 1P69B 1GGIL 3CH1A 3MRKB 3G6JB 4Q58C 5ALCH 4M7LT 4HCRL 3S36X 5E2UL 1N5YL 2ZUQB 1YNKH 1J10A 3DV6A 4MXWH 1MCSA 3D39A 2J6EA 3ARGD 4Z78B 2Y23A 5I1CH 5JOPD 4OZGE 4J4PA 5EA0H 4KK5C 5FKAB 2HJKB 1Q94A 3ZO0A 5IKCB 1IAKB 4KJYA 3IFLL 1DE4A 1RK1A 5F88A 2XICA 4U6HB 3IF1B 1FE8H 3MJ8B 4F9LC 4PB9L 4XVTL 4JY6A 4M93B 3T4YA 2XKSA 2LTQC 3PIQA 4OF7A 1MHHA 2O61B 2DQTL 1Q9WB 1MCQA 2ADJA 4X9BA 4LHUA 4MA8L 2CIIB 2DLGA 3RIFF 2UVFA 3OG6B 1K4DB 4YGVB 2IH3B 3SDAB 5FK9B 1WIPA 1KB5B 5I76A 1EVUA 3VWJD 1D5IL 2NPLX 3CLFL 3SCMB 1OGAA 1U8OA 5DQ9A 1Q0XH 3S88L 4TQEL 4UU9A 4Y5YA 2Z31D 1P4BH 2GT9A 4IS6B 4X7SH 4YHIB 5MEPB 1YC7A 4I3RL 1LP9B 5IUSA 1JRHL 2C3XA 3TA3B 3D9AH 3IDMB 5ADOL 3S96A 5I66A 1DUZA 5KG9B 1MPAL 3TCXA 4JKMA 2DWEA 2ZUUA 4PV9A 5DMGD 4BYHA 1P4LA 4M7LL 5EOCH 4OUUB 5DO2D 2O5YL 4EBQL 3V5KA 4OLUL 2Z8SA 4X7TA 7FABH 2D31A 3Q5TA 4KFZC 5HJ3A 1X4XA 3O3DB 2VZ3A 4YUEH 2K7QA 3IFNL 5GRUL 3T2NH 1GGUA 2VR9A 1CFVL 3NIGF 1OWRM 5HGBA 1TTUA 2ED9A 1TJGL 5ID0A 2YD1A 1YDPA 4FFYL 5E94B 4RDQF 3X3FH 4LSUH 4IRZL 3DX9A 4RGMB 5CUSH 3NZHH 4Y5YC 3AMLA 2FX9H 1DSFL 3H9ZA 4YR6A 3QEGL 5EPMB 1JWMB 3CZJA 5KOMC 1VFAA 1R0AH 4I0CC 2BNQD 2BERA 3RUGE 1UEMA 3IXAB 4P5TB 3MGOA 5DMJB 43CAA 3F58L 4P0DA 1R3KB 2FJFA 2A6DB 1P5UA 1HINL 3AM8C 5CBAA 2B20A 2X4RB 4HH8A 3ZKMC 2FEEL 3HB3C 4J1UA 1VFBB 4S1RL 3OB0K 4ERSH 4D8PA 4PS4H 5C0JA 1E6OH 5HHMB 5I0ZA 5CILL 3BN9D 4N0UE 3ARQA 3OJVC 4Y2OA 5ESQA 3AROA 1UENA 3O6FB 3V6BR 5AAWA 3LEXA 4AM0A 1ZGLB 4KKCC 1IAIM 4HUVA 4HWBA 4R4FH 1S7VB 3VFGL 5E8PB 5T1KB 3T77B 5KOVC 4HC1L 4J12A 4JHWH 2EICA 1VA9A 1MWAB 2FECI 3PHOB 5EUKB 2ITDA 4K7FB 5CKGA 43C9B 3MNVB 1WFTA 3OX8B 4IIQA 4WHCA 2H2SD 3FN0L 1ZLVH 4PRID 1FPTH 4UV7H 2WLYA 4ZXBD 1FVCB 2LVEA 5ITBH 3R06B 4I77L 1VEPA 1OB1B 5EH1A 5FA3B 4L3CA 1EGJA 1UGNA 4NZTL 3CFJA 4XX1G 3NN8B 4IMLB 3S35L 3VI3E 4IHOB 4F7PB 3DUSB 1S8DA 2W38A 1RIHL 3I9GL 4F8TA 3CUPA 4F7MB 4OCRH 4F58H 2OTUA 2EEBA 1QLRA 1GGBL 1ODAA 1SJEB 1OW0A 3AXLB 3NTCL 5DJCB 4APQC 3QNXA 1MRDL 5FV2A 1AD9A 1FGNH 3VFWA 4GMSL 2PYFA 4F9PA 1BQUA 3HI6L 3VXUB 3V5HB 2DQGH 3SOBL 4X6DE 5CLWA 3VD9A 4MXQD 5TE6H 2APXA 3GJFA 2W92A 3I2CH 5EBMB 2EZ0C 1EK3A 2K7PA 5CP7B 3QHFH 1P1ZA 3LEYL 3TN0D 2KQNA 4F7CA 3V4PL 2DICA 5EU6B 2HN7A 1X5JA 5IHZB 1Y6MR 3EOTL 1S7WA 4HF5L 3QULA 1AR1C 2XNAA 3QUZC 4G8GB 4LMQE 3V0VB 5L0QB 3LQMA 4FQIH 3ZHKA 4BA8A 4PTTB 4S1QL 4JDVB 3G5ZB 3VXRE 1QYGL 2EDXA 3HRZB 5JZ7C 3IS1X 5DMIL 4NOFA 4I3SL 3R0NA 1QSFB 4GT7A 2XZCH 5FA4B 3BD4A 1GZPB 1AI1H 1TETL 1L7IH 2HKFH 5D7LD 4EDWL 5D1XB 3T0EB 3G04B 2J6EH 3C5ZA 4TPRL 2XOTA 1VEMA 4F7EB 3MXWL 3S6CA 3C08L 3JV4A 1FLTX 4YDIL 5IW1A 4TRPL 1BD2A 1G0DA 2OYPA 1XF3A 5F9JB 3FL7A 3QEHB 4Z77B 1FORH 3WO4C 2D03H 1MJ8L 2W9DL 3O9WB 1QFUH 3O2WH 4KGLA 2VH5H 5KTEL 2H1PH 3KPRB 3DSFL 3AB0B 1S78D 4NZDA 3C5SB 4JJHA 2YBRB 4PLKD 1U0QA 5L6YL 1N6VA 5FUZL 4YXHH 1A7BA 2FX7L 5CHNA 3TZVA 2WMPA 4JLRB 3CJJA 5IB3B 1FV1A 1Q8MA 2W91A 2X6MA 3RWIB 4FFWD 4KJQC 3MJ9A 4P3DA 1J86A 1NMCB 2NY1D 2GKIA 3KLDA 3LPFA 5I1KH 4XVUD 1WZ1H 4TNVF 3Q6GL 1HIMH 4GBXB 3M8OH 2IBZX 3M1BA 3Q6FA 5C0GB 1TQCB 2AV7B 4ZUWB 3HFML 1UZ8A 1ZLUH 3QNYA 3LKNB 3WNPA 3RPIA 4R26L 3BVNA 1KYOJ 2KH2B 1HQRB 3C5ZC 3WXWL 2BDNL 5GS1B 3V6OA 1VPOH 2H8PB 5D93B 1CIDA 4V1DA 2OS7A 1S9VA 1CCZA 2VLRE 4M6NL 3VG9B 3MFFA 3WXVH 4D9QE 2IBGA 4EKXA 1MREH 4XNZB 2EYTB 3TBSB 1Z0MA 2OI9B 3OKKA 5HHXH 3QDGA 1G7QB 1A9BA 1T04B 1OWWA 1B0GA 3O3AB 2QQLH 1NBVH 3E8UH 4G6KL 3LEVH 1CI5A 4CW1B 3CD4A 3HS0A 5E7FA 4LLYB 2HVJA 3IDXH 1FH5H 5ILTH 5T3XD 4GXUM 2BMKA 2N4IA 5EZIH 3DSNA 4BFIA 1OAYH 1S7SA 1UZ6E 3D2UD 5B38B 2PETA 4RISL 5C0BE 3MPCA 1NBYA 1V7ML 4ZYKA 2EKSA 3RY6A 4XP6L 4XP9L 2FEDD 1JGLH 5LQBH 1P4IH 3EO1A 4WV1A 4EI5C 3GIVB 1JZ6A 3T08A 1KJMB 5C0AD 4OBSA 1DQLH 2E7BA 1DLHA 3UC0L 2WQ8A 2I60H 1N26A 3MLRL 5HHOE 4I0PD 3U9UA 3DVGB 1U42A 3JTSB 5EOTA 3ELAT 1K6QH 1LNUB 4JRXE 1A8JH 1V3LA 1GHFH 1BPVA 5GJSL 4YK4C 1FHGA 3QQ3A 1X4YA 2VZVA 4RAUB 1GIGL 1ZLWH 3PWPE 3L7FA 4XNMB 4EIGB 3IVKA 1HHGA 2GAZA 2IH1A 4N5UA 5HD8D 3RWGA 3RTQD 4PJEA 4HWBH 5FYKL 2FZ3A 3LZFH 2DQIH 1T5XA 2NW2B 1JHTA 1BQSA 1SYSB 2V5YA 1GOHA 3C9NB 4JO3L 4TUKH 3OGCA 2Q86B 1I7ZA 4OM0H 4QT5A 1FZMA 1BVLA 2PYED 1PKOA 3KJ6L 4JFZH 4JFFD 2R56L 1WBZB 2W65A 2W60A 4OQTA 5DD1H 3L5WA 5B3JF 3MRHB 1VACB 1CD1B 1MJUH 2VDLH 4TN9A 5JO5A 4RFNC 3GKWL 2YS4A 3EFFB 5J3HD 4PG9B 2ID5A 3MACL 2DL2A 4JY4A 2DF3A 5BMFL 4P46A 3QT2A 4KJPD 1P84K 1M7DB 4XC1H 5DLMH 4XBGB 3D69B 1EGJH 3SHSA 3TFKC 3ARDD 4PJXA 2I5YH 3CVIH 4Y7MA 1AXSB 3IS0X 5D7JB 3D85B 1UA6L 2JB6B 1F4XL 1JNJA 4OTXH 1EHLH 1ZVSB 1W72A 5CINL 4E5XB 2JJWA 4FABL 3LOWA 1A1MA 1DN0B 4M7KH 1AGEA 3OKDB 5HSFA 3KS0J 1OD7A 3QCTH 5FDWA 2OMNA 3VXPA 3TPUA 2VSDA 4TSBL 3V5DB 3GJFH 2H9GA 2R1YB 3U46B 2VL5A 4NQVB 5DJZB 3T8XA 5D1ZB 2VITB 3B2VH 2VLJD 3T4AA 2IQ9L 1YEIL 2AJYH 4XVSH 4PJ9A 5I16A 3LB6C 1NMAL 3QRGH 3UJJL 1YYLL 4H1LB 1TZHA 4P46C 3GMOB 3JV6A 1EDQA 2DQCL 4PJEF 3G5XA 1T80A 1WEJH 2P46B 3C6LA 1ADQA 5D72L 3E6HA 5I2IA 3KLAB 2AQ3A 1I1RA 5IW6A 1A5FH 3ULUL 3KXFD 4K23L 1TQBB 2N1KA 3QPXH 4D9RD 3MRNA 2XTJE 3VFMB 5L8LB 4OCSL 1JI1A 4PRNA 4WU5A 4WWKD 1Z5LB 4DUVA 2EDYA 4HJ0D 3QG7L 4Q9BA 1QRNB 4DK6A 2AEPL 3EO0A 4EXKA 5GXBB 4OCWH 4NCC2 1DQMH 3NIGE 4JKPH 3N1GC 4Q74A 3RL1B 3BI9X 1RUQL 4LARL 3VXQB 5L2KB 4YHOH 2VDOH 5KSBA 4LLVB 3P9LA 5HHNB 3KPNA 4DGIL 1MAML 3A6OA 3RDTA 4JZNA 2VISB 1LDPH 4PJXF 5CEZH 2CLRA 3D18A 2CDFA 1UACH 3V4UH 5HI5C 4YXKH 4BKLB 1FVEA 4RNRB 2RIKA 2AVGA 4PJ8B 1KIRB 4KC3B 5GRJH 3CVHA 4Y5XA 1N4XL 3BHBA 2F58H 1FFOB 1DBKL 3IB4A 2E6QA 5I1HL 5IBLD 1NGXA 4Y19B 4C83B 1OGAE 3MJ9H 3QDAA 4MXVF 4WUUD 3GM0A 1CU4H 2PXYA 4ODXA 5L8JB 5ABDE 4NGHL 5E5RB 1T1YA 4A2MA 2EDDA 3LKRA 5INDB 3U0PA 5DK0B 5HGHA 5HY9A 3CFEB 4HBCH 4LVHB 5E8DL 4QHLB 4QOKB 5CGTA 5JIIA 4Z7WB 4CDGC 2Q8BL 4RQQB 3U83A 1NGWB 4G8IA 1I1YA 4I3GA 3AC0A 2Y25A 1FFPB 4XHJC 4ODTH 3ULVH 4G7VH 2ARJB 1RZKL 3IKCB 5T3ZH 1DUYB 4WFEE 1LD9A 3RDTC 1RZ8A 2WBJA 1MLCA 4P4RA 3ZYJA 2YZ1A 3K4ZA 3DJ9A 1F02I 3ARGA 5KJRH 1ORSB 2CDEB 2PTVA 2DTSA 4RX4D 3OAYK 3UTTD 1U8JA 2FSEB 3PP4H 2CRIA 4TUJB 5F3HB 3MCKB 3DOSA 4M5ZH 2OXGA 1EAPB 2ARJQ 4R96A 2VAAB 4PJAF 4ZS7H 1IVLA 1NAKL 2IG2H 4P4KD 2I26N 4AIZA 1XCQA 2WSKA 1VEOA 4JG0L 4JM2B 5E6IB 4AIXA 4FZEL 4PLJD 4EQ3A 1IEBB 1TTGA 2R1WA 3MUJA 3C2AL 3GUTA 4EIZC 3WHXB 3VGFA 5FFLA 3HNVH 1DZBA 2A6KA 4JFDB 2V17H 5IHLB 2ENYA 5E00A 4PP2A 4JDTL 3VWJA 3DX6A 1QLEL 2IGFH 4C56B 5I1LB 2YOCA 3P73A 2IAMB 3L1OH 2HFEB 4MAUL 1MQKL 3UJIL 3KPPA 4C54A 3OL2A 2Z31A 4OFVA 5DI8A 3U1SH 3MV11 3O41B 3TBVB 5JPMA 5DUML 2DQHL 1DLFL 3RVUD 5IR1A 1MSPA 4PJCA 2X7LA 2CGRH 2GUOA 4KRPB 3K2UL 2BVYA 3KYAA 4G43A 4NO0D 5CGYD 3LS5L 2RGSA 3H9SD 5CCKH 1VADA 5KS9B 1G7HB 1RMFL 1CD0A 5FM5O 1S5HB 4LSTL 2YWYA 3S36H 3EBAA 2CJUL 1I8MA 4HK0B 3L3OA 2CLVB 1M05B 3T2OA 5BVPL 3RWHA 3QUMA 4OQTH 1JTPA 2F74B 3CFDA 1ERNA 4NKDB 1JHKH 3VWJC 4K8RL 4K3EL 1KLFA 2APVA 2M1KA 5GGQH 1ZANH 5I1DA 2AI0L 1I9JL 4WDIB 2QHRH 1E28A 5EDXA 4LSPL 3IJHA 1CR9H 2GCYB 4FMKA 4WW1B 4JDZB 5F89A 2C3VB 1ED3A 5DFWH 3ALPA 3GMQA 1ROWA 3DX7B 1U3HB 2BNQA 3UDWC 4XC3H 2DWDA 2E7MA 3NCMA 5C0NC 1RK0B 4NQCB 4QRPD 1QBML 3C5JB 5IV2A 1QFHA 2FHCA 5KVEH 4RSVA 4FFVC 3A6CL 1QR1A 4G7YH 2X4PB 1PY4A 4ZFZB 3ZHDA 2BNRB 4I18A 4ZDHA 2NTFB 4EDXB 5DMGC 5FO9A 3T65B 1TIUA 3S35X 4S0SD 4XNXL 3CSPA 4KAQL 5DO2C 3VFUA 1UXSA 3X13A 1LO0H 1MEXL 2HFFA 2YPLA 2Q7YB 4I4WB 4U1JB 1CL7I 3MUY1 4HJGB 4OZHA 5C08D 4NQDD 2DD8H 3NA9L 4OKDA 5FYLL 1YQVL 4P23B 1ZTXL 1KJVB 2ORBL 3AGVA 4NO2B 1U91B 4XB8A 1G0XA 3DGGA 5HYEA 3MLXH 4OM1L 5DK3A 4YH6A 1WT5A 3HC4L 4XBEH 1ADQH 4H26B 4P5KA 4FTVB 4N8VG 3LQZA 4JPWL 2BSED 4NQXA 4PRIA 4YO0B 4ZXBA 3AVEA 2E7CA 3LDBC 3QUYB 1QFOA 4RBPH 4U1SB 4AMKL 4DN4H 4Q9RL 3U36A 4R90H 1A6ZB 4OFPA 1N59A 2AJSH 4PJBA 1JGDB 3DETD 2VDPL 4X83A 4WCYL 3L3IB 4YE4L 1GH7A 3HZMA 4X4ME 3LKOB 4H0GA 5HGDA 3MROA 4PLNC 3B43A 4HWEH 3MLSH 1M6OA 4N8CL 4PJGF 4J7RA 1BD2E 4LCWD 5I1AB 5CEZE 1HDMB 1UXWB 4OFYD 3WFBH 1V7NL 3HAEB 4PR5B 3NPZB 3EYQD 2Z92B 1FAIH 4P59L 3SGDI 2IAND 2QTEA 1FSKC 2FBOJ 4AL8L 2FX8L 3IYLW 1WT5C 1CFNA 3IXTA 5GHWL 2XWTB 3CVHH 5EBLB 3LPGA 3OKMA 4K9EL 1HSAB 3RA7L 3TN0A 1HH6B 2H2SC 2QKIA 2R2CA 1CXFA 2Y5EA 4NKMA 4ZXBC 3VE0B 5D7IB 3RGVC 2XKNA 2EH8H 2ZUSA 4HIIB 2HT2D 4JGUA 4MA3A 1WV7T 4HPYH 5IQ7L 4JAMB 5DRWB 4ORGA 4OZHF 3VDCA 4Z8FL 5IVZB 4TVPL 2A9NH 4MJ6A 4UTBL 1AGFB 4DN3H 2Z8WC 3CC5A 1BFSA 3V6OE 1HWHB 5LVEA 2NW3B 1YMMB 2QSQA 2I9TB 4YQXH 5T5NF 3ULVE 1P7QD 5T3ZE 4L29A 1NFDA 4ZD3L 3VGEA 3SKJH 3NA4A 5B3JE 4V1DE 4NC0B 3BPNB 2O5ZH 5SWSD 1N3NB 1ZT4A 1EMTL 5BV7L 1HSBA 3H3BC 3QDGE 1BWWA 4MNQA 1BQHG 1A14L 5F6HI 4GKZA 2R1XB 3TJEH 4MNGB 2AP2A 1I8KB 1WUNT 2J8HA 1H5BB 4OB5L 5DD3L 4MX7A 5KW9H 3QR2A 4UDUB 2R69L 5EOQL 3ULUD 1MIMH 3IFPA 4D3CH 3TN0C 5LWYL 4QF1A 3MRLA 4ODWA 5DC0A 1CE1L 2PF6A 1HXYB 2PO6B 5GGSY 1ZSDA 4MS8D 3NFSH 3T0AA 1BF8A 3BEWA 1ZT7A 5IFHL 5EO1B 4GKSB 4M3KB 1UB5B 1W8OA 2MQCA 4KQ4L 1P9MC 5E8OA 3GJEA 4ACPA 2ESVB 3UJTL 1CFTA 4PGCB 1H15B 4FFZL 5DRZB 2CKBA 4R97B 3WBDA 4LVNB 5K9JL 4FQXD 4HBQA 4KMLB 5FHAL 3SDDC 4O2CB 3F7VA 5ANMA 4MCYA 2X4TB 1CZ8L 4XP5H 5TE7H 3DO7B 4NJAL 3MNZA 1R3LA 2A6JA 4XBPA 4XNYH 1IQWH 3GO1H 1ZMYA 1I8LC 3MRJB 1YUHA 1IT9H 1XCTB 3HNTL 4FG6D 4PJEE 4XCEA 4JFPB 4YPGA 4FN0A 1J1XL 1N8ZA 4HG4J 4Z5RA 1FNFA 1KTKE 5LBSH 2VXVL 1T0NA 4YXLL 3H3KA 3U7WH 2L0DA 5TDOA 3PL6C 5K9QG 2VR5A 2G5BB 1NFDF 2ZSVA 1S78C 1DDHA 1NGPH 1I7TA 3ZDYF 5C07D 4PLKC 3QUMH 1L6XA 1AJ7L 3CK0H 2AV1A 1S7QB 4FFWC 4NC2B 3ALXA 3F6LA 3DX8B 4XVUC 2M26A 1L0YA 3D2UA 4R4ND 3TJHC 5K9QI 3WS6A 1KXTB 3BWAA 4HCRA 3WIFA 1UM6H 1AGDB 1LVEA 3CDGA 4N5ED 5DTFA 2EECA 2FWOA 2VLRB 2A74A 4M62H 4PJXE 4GKNB 1RUPL 1IGTA 5DMKA 4KK9C 5DDHA 5E6YA 4MD4A 3SCMD 3RBSA 4JHAH 1QO3A 1I3RA 3DRTB 3GKZA 1T22B 5BVJA 3TYFA 5HHVL 4M6OL 4QRSA 3C8DA 5AZ2L 1YEHL 1OAKH 3T0VA 4BH8B 5IMLA 2ICWB 2DIBA 3QUXD 3MLWH 1YJDL 1G7IA 1QKZL 4OCNC 4MB5A 4LVOB 3TA3D 1CFSA 3ARTA 5ECJE 1CDIA 4RMRA 2VXUH 1F8TH 2C7UB 3RTQA 1A1NA 4YBQD 4XWOD 5ESVB 3BRDA 4UB0L 1TMCB 2MWCA 4LLUB 4NJ9L 4KVCH 4U6YB 4OF5A 1HWGB 1XGYL 3P9MA 1YECH 1AGCB 2KUTA 1KPRB 1QPXA 3BZ4A 1HNFA 4MJ2A 1FGVL 3MOQA 4JFFA 4D0DB 1C1EL 4D0CA 2FEDC 3WFHB 1IAOB 3ZYZA 3NOIA 1MCOH 5HYQB 4JRXB 1F42A 3PWPB 4KTDL 3H42L 3EYUH 3I6GA 4WUKL 2O5XH 3HMWH 4HX1B 5EN2A 2K1MA 3PGDA 4I0PC 4XGZB 5D70H 4JPVL 5HYJB 4NOBA 3ARDA 4JPIB 4OFDA 4OV5A 1KEML 2ZOLA 4CN6A 2D4FA 1A3LL 5I17A 1FL3B 2CDGB 3GMLA 4YHZL 1J1OL 4JM4H 1U41A 1U95B 3RTQC 4LPCA 5EWIL 1P53A 1WAAF 2V7NB 1PFCA 5C92A 2Y36H 3TYGL 1TPXC 3LRGA 1U8NA 3V6FA 3GMMB 5D5MB 1I8IA 5HHMD 4IRJB 2UY7A 4YEEA 5DJAB 3MV8B 1G84A 2DLFL 3O6FD 4OSUL 2PN5A 2F53B 4V2BA 3RWDB 3SQOH 4NM4H 5I75B 1KCRL 1JFQH 4DQOL 1DQQA 2VLLB 1A4JB 4K07A 5DD0H 1U58A 2ADGB 2IJ0C 2Y6SC 5T1KD 1MCLA 1KCUL 3GMPA 2E9IA 5H94A 4OGAD 2VLJA 35C8H 5A1AA 1BAFL 5J3HC 2IPTL 3MXVL 4NHUA 3F5WB 5E4IA 1OSZB 1DVFC 4Z7OF 1AE6L 1XGTB 1X6LA 3MR9A 2E7HA 1JGVL 4KJPC 2E27H 4HS8L 4MA1B 5M95B 4NKOB 4LSRH 3MUGB 3B5HA 3MYJB 1HHIB 5B39B 5JOEA 4DKFH 1NBZB 2HYMA 3KXFA 5ACZA 1HHKA 4RFOL 3HA0A 4Y4FC 1CN4A 1XFPA 3B6SB 4G80A 4K94H 4PLOB 3SKOA 5F7UA 4ZAKD 5FYLD 1VCAA 2BC4A 3GMRA 4HC1A 2QEJA 4YX2L 2R29H 1OP3H 3MRFB 5JOPE 5TDPA 3F65A 1UKQA 1QFWI 3C09B 1KIPB 1WBXB 3VXTA 3CCHA 2GK0B 3VFNB 4RIRA 4C58B 4J8RB 4IBLT 3DROA 4GG8B 1P2CB 4YAQB 32C2B 4I2XA 1C12B 3RWJB 3ROLA 1S5IH 5I1JL 3O2DH 3P40A 4M6MH 5GGUA 1J8HA 2HJLB 4MJ4A 3W11C 1JYXA 5MERA 1JPTH 3DV6B 1M7IB 3D39B 5FGBA 4V2CB 2APBA 3TIDB 5EU6D 1B0RA 2FO1A 3ARRA 4MAYC 1V3JA 2CKBH 3HC3H 4WUUA 2HRPH 4L4TA 1Q94B 4QLRA 2RB8A 4WWKC 3REVA 4HFUH 5J13C 1DE4B 5DJDA 3WLWC 4FQHA 4X5WA 4JY6B 3T4YB 3EDFA 4LLAA 4MCZA 1MHEA 3FHQA 1DANU 2Z91A 3BX7C 1MHHB 5F9WB 1T20A 3DRQA 2ADJB 4PJCE 4NZUL 4RMQA 2DN7A 1QSFD 3BDYL 3BPOC 3H2WA 3K0WA 1NCBL 1QHOA 3O6KH 5EULV 4UT6L 1JVKA 2DIJA 2Z8VC 3OXRA 3FO1A 4NHCL 1OGAB 1KOAA 3ZSSA 1EFXD 1U8OB 2MHAA 4RX4A 2DLEA 4POUB 3UTTA 3A67L 4UILH 4TVPD 1E4WH 1N2RB 3L3KA 3EDEA 3SGEI 1NFIA 4P2QB 1MFBH 3W82A 2BVPA 5FGBC 5T3XH 3O9WD 2YN3A 1DBBL 1ONQB 4FQJL 4Y4HB 2G9HA 2VWEC 4XX1E 3IDGB 2HG5B 4PJGE 5I66B 4L8SB 3P30L 1DUZB 4NQSA 5IF0A 3PWVB 3SKNA 5DD5L 1ZS8A 5D2LA 2DWEB 4H8WC 5F1OB 2VIRA 1IGFL 2BNQE 3ZYIA 3UTSD 3U2SA 3EYOA 3V5KB 4UQ2A 5DR5H 2ZOKB 3KNBB 1F4WL 4WHYG 1T1XA 2H32A 1MCKA 5T1MA 1Q9OB 3VFSA 4PIRF 2ZP0T 2DQTH 4PJIF 1JPGA 1N5AA 4BUGA 4MA8H 5F7EL 5GGTA 5HGBB 5ID0B 1YDPB 1BEYH 5EIQA 2NQCA 1OAUH 4PV8B 3DX9B 3G08A 4YR6B 5I73B 3IDYB 5DF0A 4OZHE 4NO0A 3W39A 2NY5C 1QVOA 2EIZA 4JKLA 4P4KC 5MENB 2AJVL 2YD2A 5C0CD 1AHWB 4R3SB 1S7TA 3WLBA 3S88H 2WUBH 43CAB 2VDQL 3QFDA 2FJFB 4PLJC 2YC1B 4Y5VA 5CBAB 3BXNB 3FB5B 5TF1L 3JXAA 3JVGA 4FP8L 2WBWB 4J1UB 4G6AC 4N8VA 2GEEA 3RI5F 2EIEA 2P5ED 4J6RL 1JRHH 2K3TA 1W0WA 2F8OA 2EYRA 3ESVF 3IDNB 3EGSA 5F9DC 5C86A 2XKUA 1OARL 4PRIE 2H26A 3LEXB 4AM0B 2PNDA 3QAZB 1I9EA 3P0YL 4WU7A 4LNRA 3MLYL 3PWUA 3DLQR 5CIPB 5C09D 2BXZA 1LO2L 5LGJA 4K3DL 2H41A 3UO1H 4L1HA 3DURB 4PJBE 1TDQA 2O5YH 4EBQH 2D7NA 4OLUH 1MNUL 4WGWB 2ITDB 4QRPA 5GRUH 2V6HA 5CGYC 1CFVH 1B4RA 4JHZA 1CFQB 5D2LF 4IIQB 4OJFL 1TJGH 2ZCLH 3OV6A 4XPHL 3EJYC 4IRZH 4JKKA 5DVNA 5C2BL 1OT2A 1DSFH 4NDMA 2NZIA 1KBGL 1KTRL 4J3UA 4JFYA 5B21A 1AH1A 3CFJB 1EEUA 5DJYA 4L8CA 5C08A 4NQDA 2EEDA 4ZO9A 2JJTA 1LK2A 1HCFX 1HINH 3CUPB 3TNMA 2EE2A 4Y4KD 2OTUB 3PGCA 1QLRB 2VR4A 4I48A 1QSEB 5GIRA 1OCWL 4S1RH 5EC2A 1OQOA 1PX4A 4OGXL 1R3IL 2PYFB 4GOSA 4XCNB 2LQRA 2Y7QA 3OR6B 3LN9A 3TT3H 5IG7A 2IFGA 1A7RL 1JNLL 4BK4A 4CVZB 1NFDE 4PY7A 3FQWA 2FJHB 3HHRB 3ZDYE 3RY5A 5FYJL 1P7HL 1VENA 1B0WA 5B38G 1P1ZB 3BGFC 1BQHA 4JB9H 3GSUB 4F7CB 4HC1H 1BVZA 2AKRA 3MRPA 4PJHB 3D85D 3SE4A 5D1QB 1DBMH 1RJLB 4ZOCA 2AS5M 3DHMA 1D6VH 2HWZL 4JEGB 1SBSL 3IAQA 4NNPL 4QRRA 1J8KA 4GAJH 3QQNA 1S7WB 2XNAB 3STLB 1JBJA 2X9WA 2XI9A 2OXHA 1WFNA 4LCWA 1MHPL 3JTTA 5A2FA 4OFYA 3UBXB 3NCEB 4I77H 4JG1L 2IANA 1NCCL 1H3GA 4DGVL 1ZT1B 2Y07L 1A6VL 2OTWB 2FLRT 2XY2A 5B4MC 5D1ZD 5I6XC 4HG4K 1AQKH 2GFBA 3BJ91 3MYZA 5F7DA 1EEZA 3I9GH 1RIHH 5D6CA 2VXSH 4G8FA 2J8UA 1KENH 1JPST 4OLXL 1GGBH 1X6NA 5ANME 3NTCH 1LEGA 3JV4B 5F1IA 1MRDH 2OP4L 4HIEB 5IW1B 3WKNA 3AY4A 3HI6H 4HIXL 3SOBH 1ZLVK 4GQ9L 4U33A 5CGMA 5A2IH 3CFBA 3DETC 2HFGL 4MMXC 1P7QA 3EHBD 1PQZB 4OT1L 3OAUL 1CLZL 3GB7B 3LEYH 4LCIH 5KAQF 1QRND 5CHNB 5SWSA 1G9ML 1DBJL 1FV1B 3V4PH 2FIKB 3BPLB 4P3DB 1UJ3B 1MFEL 3EYQC 4NQUA 2B2XL 1WTGT 5L2KD 5E2VL 4HF5H 5SV3A 3FN9A 3NCCB 5C70A 5AYUH 2JIXB 3M1BB 2VZOA 2QQQA 4NNXA 4OD2A 3QNYB 5BS0B 2B8OT 3RPIB 5T3XE 3HZYA 1S9YA 5AD0A 5HDQL 2NY5H 5DMIH 1G6RA 4ELKA 4I3SH 2NR6D 5EUOA 3QIBB 2R2HA 3NACL 3EFDH 1RQ5A 1NGZA 4CUCA 2V2TA 1WCBB 4B41A 4PJ8D 5JR1H 2HT2C 4V1DB 1JGUH 1U93A 2W0PA 1UB6A 3NH7L 4GMTL 2HVKA 3C8KA 5EU5A 1XF2A 2X9XA 1EXUA 4B50A 1IGJB 3OKKB 4Y19D 2WP3T 1MHCB 4S1DD 2XA8L 3MXWH 5J11C 2G75A 2JK5A 1HHJB 3I75A 3QHZL 4FQXA 1SYVB 5C0AE 2YA2A 1CL7H 3HS0B 1INQA 2HVJB 1CGSH 4NRZA 4WHTA 2H32H 4CMMA 2BMKB 1I3VA 4QOKD 5L88L 1MJ8H 1JPSL 1QNZH 1KCSL 5I19L 5KTEH 1YEJH 1A7QH 5DVOA 5GGTH 1J0HA 1FZOA 4LCCA 5CJQL 1NBYB 2A0LD 3IRZA 3PWNB 4WEBL 5FUZH 2E9BA 4R6UA 5CJ8A 2EC9U 4YC2C 3EO1B 1JPFA 5FM5M 4WV1B 2ZUTA 4Z78A 3Q6GH 1DL7L 4X9GA 4MS8C 2PYEE 5A3ID 4IOFC 4JCLA 5J06A 2DKMA 3HKFA 2HTLC 1D3CA 3GI9L 4JFFE 4NZRL 4XP4L 4R26H 4JZJC 5AG9A 4KMQA 5C07A 3U9UB 4ZO7A 3WXWH 1JMXA 4LOUD 4RGOL 2BDNH 2X4SA 1X5GA 3OB0H 2QADB 1MCNA 1G9NC 2O61A 3G9VA 5E6ID 1PW3A 3PABB 3DECA 1NFKA 1Q9LB 2CIIA 1IAMA 2IWGA 3IVKB 1HHGB 2GAZB 4M6NH 1SEQH 3PG2A 5DGQA 4YGVA 2L4OA 3V7AG 2IEPA 1JHTB 5ELIA 1MCEA 3SGDH 3OGCB 5JW5B 4JFDD 3PV6A 4QT5B 3LQAL 3QH3A 1JNNL 4C56D 4DTGL 4HXBH 2IAMD 3B2UD 5B3NA 4A6YH 2W60B 2W65B 4XB7A 3L5WB 3BZEB 3VXMD 4BFGA 1ZLUK 5JO5B 2ZUQC 4IS6A 1J88A 4JQIL 3HZKB 3E2HB 3GBML 1INDL 3QUXA 4RISH 1LP9A 2X4NB 5GGRB 4WRLA 1V7MH 3CPLA 4ELMB 2BFVL 4JN1L 4Q9CA 4KRPD 4FS0A 3IDMA 4CVXA 3AREB 5JORA 3EOAA 1FLRH 4H88H 5KG9A 2R39A 1OAQH 3QXAA 5SWZD 2VLJE 4M93C 2DQUH 25C8L 4X6CB 4KTEH 1I9IL 1TXKA 4YFEA 5EU3A 5KVGL 4R4NC 4OUUA 4F15B 1W72B 4HWUA 4NFDA 2FO4A 1OAXL 4PGBB 4D0BB 1FJ1B 1DJSA 3G6JF 4OD1H 4ZTPL 5L2JB 3SDAC 3QXWA 2DBLH 3O3DA 4Z0BH 1A1MB 4L9DA 5T1DH 1RU9L 4IRSC 2ZCKL 2GQHA 3SCMC 3KXFE 1A3RL 1BQLL 3VXPB 4D9RE 1J11A 5EG6C 3TPUB 1AY1L 2H9GB 2VL5B 2PW1B 1NCAL 3QA3A 3KAAA 5EPMA 2XRAL 2ITCA 3O2VH 5HPOA 1U3HD 4PJ9B 4YLQT 4G9DA 4LK4A 2W59A 4NQCD 3TA3C 5IJKA 3NFPB 5F7NC 2X4RA 3O4OB 4NUJA 2JB5L 3G5XB 3C6LB 4Z0XA 2IPUG 3GKWH 4YBQC 4XWOC 5LXGL 4RFEB 1OSPL 1VFBA 5I2IB 4QXTB 2BNRD 1F90L 4FOMA 4R7DB 2JCCB 4I2XE 3MV7B 5BMFH 1MRCL 2FH6A 2C3GA 4XPBH 3O6FA 4PRNB 4PYHA 5E8PA 1TVBB 5T1KA 4PJIE 1MCHA 3T77A 3F12A 1CE6B 1LP9F 3QI9A 4YHYB 4WUUE 2OX5A 2Z35B 4LCYB 5KSBB 4RGMC 2YD7A 3P9LB 3SY0A 4QTIH