5DK0A

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLMCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A01
1I9IH 2MHAB 3DMMB 1E4KC 4OZHF 5HVFB 3IFNL 1DDHA 2HKHH 2ADJB 4G43B 2JE8A 1C08A 2VWEE 3HUJA 3QULA 1RIVL 3H9YA 3ILPB 1N8ZB 1PG7H 2Q76A 3WFDH 2VKXA 1IAIL 3LS5L 5AYQA 3FQNB 1ZA6A 5B39A 5JW4M 1BZQK 2CDEB 1X5HA 4I0KA 2EXYD 3MJ6A 1ITCA 1H5BC 5F8RC 5FK9A 2GJ6B 3WDIA 3BAEH 5D5ME 5GJTL 3T3PF 5GSRA 1YEKH 3MFFB 5E6IB 5J11C 4GQPH 3C5JA 3KPMA 2PXYA 4LOUC 4X80H 4M6ML 3WL9B 2OR7A 2JB6A 1J0ZA 2QADB 3W2DL 5IBTL 5E08H 4O58L 1I1FB 3O6MH 3V8OA 4EJ1C 1WAAE 4X9FA 2R8SH 5EOQL 4CN1A 3RHWK 1FNSH 1T5XB 4X99A 2PO6D 1BOYA 1MWAB 1ORQB 3STZB 5KAQF 4OGYH 3IDIA 3L3HA 4GRLB 4LRIA 2AJXL 4BZ2L 2J6EL 1P1ZA 1XGUB 4Q74A 3BE1L 4CVXA 5AD0B 4U6HA 1T1ZA 3T4YB 4F7MB 1S5IL 3C8HA 4M1DH 1X5XA 4ODXA 4YIQA 2DI9A 3FT2B 1RZ7H 3WXVL 4ALAL 1A1NA 4MA7L 1RU9L 1U8QA 3HFMH 1NCCL 2YA0A 3B2VH 5I6XB 4ZUVA 3RY4A 4P23A 2R9HD 3O81A 2YMXL 4Q58C 4WCYH 5DVKA 2FYYA 3QXUA 3U0TB 1ZTXL 2E8YA 3FN0H 4MJ2A 1MCNA 4PJFF 4OV6F 4F9LC 1BJ1J 1AGDA 3O3BB 3IDNA 1NLDL 4MA1C 1RHFA 1OP5K 1FE8H 3VMPA 5JW4N 3QUYC 2IAMB 3KPRB 3CFCH 2B2XL 3IDUA 5TQ2L 3S5LA 5TFSH 3VFPA 1I3GL 5DJYB 4N0RA 1S3KH 3CIQA 1G9NC 4JO1L 3CNKA 2XG4A 4KJQD 5AWNH 4XP9L 4A6YB 4Z7VA 4JPWL 5CP7B 3L3OB 4GG8B 1BWWA 4P59L 3T2PA 3HS0A 1Y6KR 3D39A 5HDQH 3V6BR 1R24A 3FT3A 1NCNA 1KYOJ 2E7MA 5DHXB 4KY1L 3VRIB 3WNNA 5CFHA 1FNHA 3VA2C 5A16A 2V5SA 3VXMB 4EQ2A 4HQQL 3WE6B 4XVJH 3KLHD 5E03A 5D8JH 3D85D 1CGUA 2ZSWA 5C7XL 3SDDC 1CK0H 1IM3A 4I3SL 3ZE0F 1CU4H 3ECBA 3GSWB 12E8L 4HGWA 2HRPH 4FXKB 4JFYB 4OLWH 4XGZB 4RGNC 3P2TA 2VAAB 5EULV 1PBYA 1JFQL 1QSEB 3T8XA 3VJ6B 5E2TL 5FCSH 5C08D 1S9VA 4KV5F 5CJBA 2DTML 3X3FL 4AIXA 1A02N 2J1KA 4GFTB 5CWSB 2K9UA 1K85A 1F4AA 2NY1C 3H3PL 2I60L 4IRZH 1Z2KA 4KVNL 4UDTA 4JAMB 1HZHH 4QRUA 1GL4B 4R96A 5CHNB 4PJ8B 1CE1H 1C5BL 3KJ4C 1U8JA 2FGWL 4MWFB 1DQDH 3X11A 3ZSTA 5E99L 3NFPB 5GPRA 3JWDH 5FECA 2BDNL 4LAQH 4QRPD 1KC5H 2PTUA 1ZXQA 5L8LB 4R2GC 5HYSB 1OCWL 3WFHB 1LP9A 3ARUA 3DVFA 1F4HA 4WFHE 3IETA 3W11D 3QUXD 4ZDHA 4FQXC 3LEVL 2JTDA 3FFCD 5F71A 1MCJA 1EAPB 3PE9A 5K9OB 5BVPL 1RUAH 3BZEA 1TVBB 3GM8A 3NA9H 4G6FD 3SO3B 2NY5H 5EOCH 1FORL 2W1NA 1P6AB 1H8NA 2CLZA 4XX1G 1IEBB 4AM0A 2IMNA 2BVOB 3MJ8A 2E7CA 3RJDA 2HT2C 1PJ9A 4JPKL 1EVTC 4K71C 4UQ3A 2D7TL 4NZTL 1E6OH 2NNAB 3N1QC 5HYFA 4CVWA 2PYEA 4UBDD 4XMLL 2MJWA 3G6DL 4YHNB 4G8GB 3W9DB 5IMKB 2O5XH 3F12B 1YPZB 1AE6L 4TUJB 3CUPA 1I7TA 1I9RH 4PJHE 1REIA 5ID1B 1AXSB 4Z0BL 2Z93A 4OFVA 3SDCA 4DZ8B 5CGTA 1XGQB 4LFHG 1PLGL 1BQHA 3EFDH 3S37L 4EUPB 1B3JA 1HNFA 3BYTA 1T80A 4YXLL 1PY4A 4KFZC 5MEQB 4NWTH 1GSMA 1ZT1A 3HZMA 3IS0X 3SE3C 1TQBC 3GMOB 4JN1H 3BD5A 5C09E 3UTOA 1C08B 2LFGA 3HUJB 3K7UA 3V6OE 3DNKA 1HHJA 2Q76B 3UC0H 5J13C 4LCWD 2D7MA 4P2QA 4L5FH 3WNOA 1XCQA 5DHYA 3CU1A 4DN3H 5CIPA 1ZA6B 5B39B 5I76A 5FA3A 3J7HA 5FK9B 4YHIA 2VXVL 5GSRB 1JPSH 4LEXH 4W70A 3KJ6H 3QEHB 4RRPG 2NW2B 3C5JB 4FQHA 4Y1AA 4RDQG 4N5EC 4I3RL 5T3ZH 3KPMB 5I1GH 5FM5O 2PXYB 3U6RB 4X7EC 3RIAF 1F4XL 5J56B 5JQ6H 1K6QL 2JB6B 1F4WL 3SJVD 1JYWA 5BVJA 1K8IB 2AJUL 1I4FA 3EYOA 2J88H 2WWMD 4LPYA 4DQOL 3N85H 4XI5D 4PJCE 4J3XA 1N3NA 1OHQA 2ARWA 3U79A 4WHYG 4M1GL 4X99B 4RGOH 3RVWC 4H5SA 4P9HC 3L5XH 3IDIB 3L3HB 4ZYKA 5EWIL 3IXAA 4OFIA 3O4LD 3MRPA 1QSVA 4PGJA 3K80A 4CVXB 4U6HB 5DXWA 1T1ZB 3HNSH 5DT1H 4ZXBD 1XF4A 4HWUA 4YIQB 5D1ZD 3BN9D 2VE6A 1A1NB 4DOHB 1II4E 4JB9H 4ZUVB 4P23B 1JF5A 3NGBC 2FYYB 4QGYA 4K23H 2YPLE 2IALA 2JCCF 3DUSA 4JO4H 1X5IA 2JJVA 3QQNA 1QPPA 2F9BT 3L3JA 2WM0A 1AGDB 3IDNB 2Y07H 5BMFL 4D0DA 3HNVL 2Y6SD 3BPCA 1MJJA 2WQ8A 1O7SA 1INEL 4EIZC 1T83C 3JBG7 4P4KA 3S5LB 3U4EA 3W5MA 3VFPB 4OCXL 3RDTA 1RD6A 1ZHKA 2WQRA 1AIFA 4V2CB 1U8IB 1PGRB 4KVCL 1W72H 5GS0L 4Z7VB 4EEEA 1EO8L 3V0WL 1X4YA 3G5ZA 4HKBA 4PY7A 4ZUUA 3HS0B 5EUOE 3D39B 1NMBH 1R24B 3ESVF 3FT3B 3KPOA 3QEGL 5ISZD 1E4KA 5A16B 4K7PX 4BJLA 4JFDE 5ENWB 4TSBL 2FB4H 5SV3A 4IMKC 4GO6B 3T2NL 3BUYA 2ZSWB 3UYRH 4XXDA 1KIQA 1IM3B 3H9ZA 4H1LG 5DD1H 4B50A 5T3XE 3ECBB 4UINH 3LZFH 1RVFH 4HGWB 4XPAL 5F96L 4TUKH 5JW4Q 5I1KH 1KENH 3GSNA 4GBXD 2ICWA 4QHKI 5DTFA 2QQNH 3WEXA 1SY6H 1T2XA 1YC7A 1YEIH 4QXUL 5E70A 5F72S 5CD5D 4JFXA 1NFDA 3T8XB 2LABA 1S9VB 3MOBL 1D5BA 1RK0A 2GW5A 5SWQA 3NFSL 2JB5L 4B53A 3O3EA 2CGRL 2MPAL 3GK8H 3E1F1 4UDTB 1U0QA 4QRUB 4R96B 2YSSA 1L0YA 1U8JB 3DVNA 3X11B 3P4OA 2DQGH 3BD3A 5FECB 4QWWC 4Y88A 4YDJA 2XG5A 5JHDE 3S4SA 3BKJL 4R0LC 3BHBA 3MV7A 3S9DB 5JTWA 3DYPA 4G9FB 1LP9B 3L5JA 5SWSA 5GS1A 2HFEA 4PRPA 3IETB 1QSFA 4ZDHB 1OAKH 3LMJL 5DEFA 1DBAL 1YEHH 2DOCA 3PWNA 4G7YL 2YS4A 3T3MF 3B5TA 3LS4H 1L4IA 4PB0H 4EIGB 4JPIA 2R4SH 5B3NA 1DUZA 1SYVA 3MGTB 1L7IL 3QZWG 4BELD 3EFFA 1AI1H 4HUMB 5KVGH 4P2CG 4MA8L 2CLZB 2IADA 5DJ6A 4OZIE 3MJ8B 1U8HA 4QNPE 4X8XA 1CFVH 4KI5F 5DA0B 1NCTA 1OB1A 1R5IA 2VABA 4UQ3B 1QRND 5D7LA 3IAQA 5INDA 5MP6H 4QOKE 3VFNA 4OIIL 2PYEB 2VDLL 5DJCA 3MUY1 3MJ9A 5I1EH 1IFHL 1A6WH 1JGVL 3QUYA 4U1SA 5FV2A 3CUPB 1BIIA 1I7TB 4WGWB 4ODHL 4MNQD 2WLZA 1TCRA 2W91A 2Z93B 4WI7A 3Q1SL 3SDCB 5HPOA 4HS8H 5B8CC 2FD6L 4HUWA 1BQHB 3RVXD 1BD2D 4M9OA 1S7SA 5C0AD 3HZMB 1ZT1B 2R0LH 5GHWL 4ZTPH 4HXAH 3C5ZC 3LDBC 4RDQF 3MV11 2CKNA 5GGVY 3T0VA 4K9EL 1TETH 5C8JB 4HPOL 1HHJB 3I84A 3BKYL 1UFUA 4ZAKD 1FV1B 4P2QB 2H2PC 4S11A 1XCQB 5DHYB 3SDDA 5CIPB 5I76B 3KR3H 1A6TA 5FA3B 1B0RA 2VO5A 4YHIB 5IJKA 1FFOA 4Y4FD 2QHRH 3RUGF 2AXGA 4Y1AB 3DYOA 2CPCA 2IC2A 3HG1E 2W65A 4R4NC 1RUQL 2SEBA 3KXFD 4R90L 3EYOB 5KSVA 1JPFA 3O6KH 4DKEL 4YDIH 3RVUC 3HI6L 1N3NB 4MX7A 2JKXA 5L2KB 1I9JH 1WAAF 1ZEAL 3L7FA 4Z7UE 4H5SB 4KQ3L 4Q9QL 4CAGA 4QO1A 2DL9A 4ZYKB 5BW7C 2Q1EA 5JR1L 1WBXB 3IXAB 4LF3A 1NGWB 3MRPB 4XCCL 1XIWD 3P4LA 3KLAA 4OZGA 5FCUH 2EYTA 1XR9B 3M17A 2DMBA 1QKZL 1JGUL 1XF4B 3RHWF 1CG9A 4G42A 4ZFOA 1EGJH 2VE6B 5E4IA 3TPKA 5EPMA 1INQB 2NXYC 4FQCH 5JW5A 1KLUA 1DBJH 5I74C 4WI4A 1IC7L 2R0KL 2IALB 2QSTA 3DUSB 4KK5C 3TZVC 4MAYA 3L3JB 5CBEB 5ILTH 4D0DB 1D9KD 3FKUS 1E4WH 3BPCB 1N0XL 3QFJD 4OM1L 4Q9RH 1LEIA 1HOCA 4NQED 4PJBA 1CLYL 1M1SA 1MY7A 2FX8L 3RDTB 4LCIH 5JNYA 3G5XA 1KLFA 1AIFB 2EO9A 1LO5B 3S6CA 3C9NA 3MRRA 1F3RB 5MERA 1YC8A 1UKQA 5KZCB 1SVCP 4NRYA 3G5ZB 1N26A 4HKBB 4PY7B 3QWOA 4V1DD 3EYUL 4WI3A 3H3BC 4S0TD 1BFVL 3QG6A 3SE3A 2QQLH 5DO2D 5DJ8A 3HE7D 5IVZA 1YJDL 2UY6A 3BUYB 1U42A 2A6JB 3LEYH 4XXDB 1KIQB 4OLZL 3QFDA 1FIGL 5D7SH 5EBWA 3O11A 3ULVD 2OR9L 3R1GH 3TV3L 1IKNC 4K9EC 5DTFB 3WEXB 1MH5B 4JFXB 1UA6L 1NFDB 3BJLA 5I1CH 2GSGA 4RCAA 3O2DH 1Z0MA 5E8NA 3MRQA 1D5BB 2DF3A 4NM4L 4JG0L 5SWQB 2XWTA 2K7PA 3O3EB 5C2UB 3GJFA 2NMSA 3B5HA 1KN4H 1C7SA 1TZGL 5L6YL 4QRPE 3T1FA 1JNNL 3P4OB 2ZOLA 2X2YA 2VAJA 4YDJB 4NHCL 3S4SB 2X4UB 3BHBB 2VH5H 2DM2A 3MV7B 4OI9A 1TTGA 5I9QB 5SWSB 5GS1B 5KN5A 1UWEL 4PRPB 3NH7H 1QSFB 2VL4A 5DEFB 4C59B 3PWNB 4KZDL 2QQKH 3KLDA 1G0YR 1DEDA 1HI6A 5J89A 1DUZB 4OQTL 1SYVB 3VW3H 5IW1A 3EFFB 2P42B 1NUGA 4PTUA 4KKCC 4WWKD 2IADB 1V7MH 1NAML 1D5IH 2AJVH 4WO4D 5DJ6B 1CLZL 4BM7A 4E5XB 1U8HB 5D2NE 1OB1B 4ZG1A 1R5IB 3U30C 1OAUH 1GAFL 2VABB 3AUVA 1FFNA 4XMPH 5INDB 1O7VA 5GRWA 3SQOL 1DFBL 1ZHBA 2ARJA 4LPTA 4PJGE 5HHXL 4QRRD 2F5BL 1A9EB 3MR9B 5DJCB 5IIEA 3V4UH 2I07A 4W6XB 4U1SB 1C16A 4M43L 1T83A 4ELME 1BIIB 2OR8A 1TCRB 3G5VA 3MNVA 1LO4L 3U7WH 1WBZA 3O0RH 4JHAH 4HUWB 3BQUC 4EDWH 4I77H 1QFWM 2DQHH 1I1AA 5D1XC 3CPLB 1S7SB 3GGWA 1S9YA 4FQIH 3LRGA 3Q48A 2HRLA 4UT9H 4FFVD 3MRIA 1A2YA 4Z76A 1XZ0A 2YN3A 5IB1A 3VD4A 4LSSL 2B1AL 3MRJA 1RZGA 4IMKA 4KTDL 2QEJA 5JIIA 3MLUL 1ERNA 2QL1A 4QXTA 3WYRA 3ZTNH 4PJDB 1FIEA 5GS3A 1A6TB 2HLFC 3B8YA 5CJXC 4KUZH 4FQLH 1FFOB 1YJDC 4L9LC 1F11A 2AXGB 3SJVE 5IT2H 1JNHB 4RGNB 1EV2E 5HI3C 4ONOA 2FEDD 1OGTA 4DKFL 2GK0B 5L7XH 1R0AH 2GYSA 2W65B 1IQWL 4NCC1 3U7AA 1NLBL 2QSVA 1WSST 2ZUVA 1PSKH 1JPFB 1T5WA 5KSVB 4MCYA 4N1EA 5EU6D 4HFUH 4MX7B 3KVQA 5T3XH 1J1XL 3INUL 1XGRA 2P4AB 1LE5B 3L7FB 2VR4A 4C54A 3O4LE 2F54E 4JDTH 5FO7A 4CKVX 2BXYA 4OCWL 3S7GA 1R6VA 2NY7L 3P0YH 2C1PA 4PRHD 4LF3B 3VU2A 4R0LA 1D5MA 2AEPL 3KLAB 3I50H 4OZGB 4N8VG 2EYTB 3QUZC 4KROC 3M17B 1WISA 1G0DA 1CG9B 3CLFH 4G42B 4ZFOB 5IFJA 1CQKA 3QI9D 4HX1A 1FO0H 4F9PA 5EPMB 3QIWD 2PKDA 5D9SB 3VGDA 5DD6A 3VD3A 1MCLA 5JW5B 4YXHL 1KYOK 3L5IA 1KLUB 1S5HB 4X9BA 4DUXA 2P47B 1T1XA 4HF5L 4MAYB 4NC1E 2CIKA 3GSRA 3MLTA 1HH9A 4CMMA 2IFFL 3F7PC 4E42A 3F65A 1RULH 3P3YA 5EIIA 1LEIB 1HOCB 4AEFA 4JM2D 4OGAD 2WBWB 3PWPA 2NX5D 4PJBB 4O2EA 5DVOA 4WWID 5JNYB 3C8KA 1ZT4A 3G5XB 4JO2L 4Y4HC 2OCFD 3C60C 4M7KH 4F80A 4JREC 1CDHA 3DV6A 3C9NB 4JE4B 2BOBB 3MRRB 5MERB 1IAIM 4AMKL 3TWCH 5B8CA 4XPBH 3EJZC 4NRYB 3QWOB 5T33H 3QG6B 2ZOKA 4Z95L 3CFDB 5DJ8B 4ZODA 5IVZB 2Y72A 4F58L 5E7FA 3N06B 3TVMC 4OI8A 5ALCL 1QVOA 3WNLA 3QFDB 4X4XA 3Q5TA 1P4BH 1NKRA 5EBWB 3JZ7A 5GGSA 1LO0L 3GZKA 4CGTA 4GAYA 3T0XA 3MNZA 3RAJH 5IBUB 1L9NA 1RZJL 3IU3A 3QQ4A 1IQDA 2GSGB 35C8L 3EO0A 4X6CF 5E8NB 5EZIL 3MRQB 1MUJA 2E6JA 2IF7A 1AP2A 2I5YH 2XWTB 3SY0A 3GJFB 1UYWL 2D3VA 1QNZL 2A77L 1OPGL 1UCBH 1GC1C 5AUMA 2GCYB 4HJ0C 5DUPH 2WBJC 3T1FB 1CDJA 3LKQB 3RY6C 5HHPA 4PREB 2ZOLB 5C0ND 4Z7NE 4U6XB 2GJZA 3L6FA 5JXEA 1MVFA 3E3QE 4YZFF 4P5TC 2F8XC 5KN5B 3BPOC 5IBLC 1YN6A 2CUIA 4OT1L 3TA3C 4K94C 1AO7D 4X6FA 4XNZC 2AW2A 2AK4B 2E6PA 4JZJC 1GIGL 1JN6A 1ZGLA 1DLFL 3QDAA 1XGPA 1F6LL 2Q86A 1Q72H 2I25N 2QSCH 1D5ZA 2FEEL 3U48A 1KTRL 5TDPA 3HR6A 4E41B 1E28A 5A3ID 1QRNE 5CP3A 3LV3A 5HGDA 2DL2A 4N9OB 5HI5C 1G7MA 2XZAL 4OZIF 5C0RL 1FFNB 4GRWB 1A6PA 4GAJL 1ZHBB 4Y2OA 5FFLA 5IIEB 1RIHL 2PETA 4PJ9A 2FRGP 2VQTA 1C16B 5DMYA 1MCPL 3HB3C 3BGAA 1H3GA 4J3UA 4K7PL 3AREA 4NQVA 2M2DA 4Y2DD 3G5VB 3V7MA 3MJGX 1WBZB 3MXWH 2O61A 5IESL 1SMOA 1KCKA 3TO2A 1I1AB 1MI5E 4M7ZC 4YBLB 1EEYA 1HK6A 1S9YB 1X4ZA 3BDYH 2A9NH 3HC3H 4L3CB 5FIEA 1CZ8H 1YMMD 2GY5A 4APQC 3MRIB 4M7LT 1A2YB 5ACLA 4MXWL 1XZ0B 5IB1B 5HHMD 1MRFH 5D6CA 5GGRA 1XGYH 2DKUA 3MRJB 1RZGB 2DQDH 3GSUA 1QLEH 4QXTB 3HNTL 4OB5H 4NO0A 2AGJL 3F7QA 1MHCA 2ZUWA 3SE4C 3UJIH 1OSPL 2YXFA 4OZFG 3QDMD 4Y19D 2WBKA 5C9KA 1IKNA 3MLRL 1AR1C 1MFCL 1UWGH 3KXFE 3WIHL 1OGTB 3ZDXF 5F7MC 2D7PA 3HI1A 3QCUH 4MCZA 2B4CH 2VLJA 3NVQA 2PR4L 1U6AH 3B9VA 3MBEC 4C56A 1DQJA 3AGVA 4R8WL 1MIEH 1T5WB 5C0IA 4MCYB 1DVFC 3MSPA 1MFEL 4RFNB 4H0GA 4HIIB 4YX2L 1VHPA 2CXKA 3OZ9L 1ETZB 4PUBH 3LQAL 1XGRB 3VD5A 2NQCA 1FJ1A 3RU8L 3X3GL 5FO7B 4M7LL 4X6DF 3C08L 4LHUA 2C1PB 2XA8L 4N8CH 4R0LB 1D5MB 3VMOA 4A2MA 2DJ4A 1LDPL 3V52L 3T0ED 3PQYE 5AG9A 1B0WA 1JWSA 1A1OA 4P5KA 2MCPH 3AS0A 5F6IB 1X5JA 2R0ZL 4KAQH 2AAVA 2BNUA 5IFJB 3L3IB 4HX1B 1P84J 4JQVC 2BSSB 3JWOC 4KKAD 5I17A 3HRZA 5FUOH 3QDJD 3VG9C 3R4DA 5HI4C 1T1XB 2VZOA 1NGXA 3MCLL 5IHLB 2CIKB 4NZRH 3GSRB 3QFJE 3MLTB 5HGGS 4CMMB 4PBXA 5ITBL 3EYQC 4HBCL 4YHKH 4E42B 2BZDA 2VXTH 1Y18A 4HMEA 4ODSL 2P43B 3O9WA 5EIIB 2J8HA 5I8OH 5ALBL 4LIQH 4FQ2H 3EGSA 3PWPB 2CUHA 1HYSD 4O2EB 4GSDL 2FIRT 4JJHA 2E7BA 1S7UA 4HG4J 1AY1L 4MJ5A 5TE4L 1YYLL 1ZT4B 3C8KB 5FHAL 3RKDC 1TPXC 3DV6B 3R0NA 4PG2C 3OPZH 1N7ML 4V1DE 1TZIA 2VN4A 5B8CB 1HXMA 1P9MA 2KUTA 3TESA 1TZHB 3BMVA 5B4MC 2FLBT 1CI5A 1OL0A 3VDCA 2ZOKB 5DK0A 5DMKA 1FVCA 3VXRD 5KVDH 4R26H 3ULVE 1F5WA 2AEWA 3QUKA 4OLUL 2YHGA 4K8RC 2DLEA 5GGSB 4NRXA 3FT4A 2HFFA 3DGCR 4GAYB 3MNZB 1M4KA 2BVPA 4S1DC 4H1LB 5CJXA 1A5FH 3IU3B 3GM0A 3QQ4B 1WFUA 1R5VA 4ZSOE 1IQDB 1T2QH 1MFAL 5BRZE 3EO0B 2OSLA 4KMTL 2DQEL 1KNOA 4XBGA 5J4MA 2JF1A 1MUJB 2VTFA 3IJHA 5BS0A 1D3CA 1P5VA 1AP2B 3SY0B 2EZ0C 3DSFL 1R5WA 4UNUA 5AAWA 2CR3A 2X89A 2UVFA 3FAWA 5HGHA 5AUMB 1RUPH 2VIRB 3PHQA 2LU4A 2WNGA 4KXZH 5F93C 5HHPB 5I1HH 3UPAA 1G6VK 5DHVA 3B3IA 3WV0A 3BKML 2YOCA 2GJZB 1INDL 3L6FB 4NQCE 1ULVA 3FRUA 3QUMA 4IJ3C 4XCNB 3LQAC 1YN6B 4RX4D 3QPQC 2ATKA 4ZO9A 4LLWA 2UY7A 3RP1A 3U1SL 4X6FB 3P4NB 2J8UA 2EIDA 1OQOA 4YEFA 3RWFA 1NC4D 4NJ9H 1JN6B 1ZGLB 1XGPB 2Q86B 4PB9H 1J0KA 1LDSA 1LK3L 2IQAA 4XBPA 3NCJL 1UWXH 1IGYA 1UKSA 3I3DA 3HN3A 4HC1L 4L8CA 1E28B 1JZ6A 3LV3B 5HGDB 3UZEA 2EDRA 5JOFA 1AD0A 5FYJL 4XWOC 4JKWA 1G7MB 4WJ5A 2V9RA 4KJWD 2IBGA 5D7JA 3WDJA 3MXVL 3ARFC 4OCSH 3ARGB 4LP5A 3QIBD 4CW1A 4Z5RA 1YEJL 1EEZA 2VC2L 5EA0L 2H3NA 1R3HA 4PJ9B 5FYKD 4XP5L 4GOSA 4M4RA 1I8LA 3AREB 4D0CA 4NQVB 2UZXB 4N0YL 4J1UA 1K8DA 2GJ6D 2VZSA 2XPGA 4UTBH 3DLQR 3TO2B 5E6ID 3X13A 3STLA 1EJOH 4GLRH 2ICCA 4NQTA 1AGCA 1QBLL 4JJ5A 1OAQH 3I9GH 4EI5A 1J86A 2QADD 3WKMH 3EO9L 5D6CB 1WZ1L 3VXNA 1NUDA 5GGRB 4NZUH 4PG9A 4R97C 1OP3H 5CD3A 3GSUB 4KRPC 5ICZB 1NCAL 4NO0B 3VXOA 4F15C 1ZVSB 1MHCB 3DRQA 3NIGE 5GS0D 4JY4A 5LCVL 4G6KL 1ZLWK 3OJDA 4EUPH 5DEGA 4GRLD 2D03L 1NMCC 1LGVA 1G6RH 2DYPD 2UVEA 5FUCC 2P5WE 3ARBC 3HI1B 3TJHC 1LILA 4MCZB 3RVTD 2HTLD 2VLJB 4C56B 1DQJB 3RGVA 3SGEI 3EDEA 5C0IB 1H9VA 4LVOC 3MO1A 2H8PA 4HCRL 2ZKHH 2D2OA 4PRHE 1FJ1B 4L1HA 1N0LA 2JJSC 4IOSD 2UWEA 3OKMA 3QEUA 4TOYH 4Z7OF 2IGFH 4IOFD 3OAYH 5AZ2H 1IILE 1A1OB 4P5KB 4YAQA 1MPAH 1K4DA 2O5ZL 5I8CB 4M3KB 3GBNH 2ILLA 4RMTA 5IHBA 2BNUB 3CVHA 3UPCA 1H3VA 1OTTC 4JZJA 2OJZL 4H20L 4AEIH 1VFOA 4YLQT 5I17B 3PV6A 3V0AC 4OTXH 3HRZB 2FO1A 3PV7A 4L3EE 3U36A 5I15L 4GMSH 1NGXB 2EIBA 2ITDA 1Z6JT 3IU4L 2NX5E 4FHBD 4M8QA 1Y18B 3O9WB 2ORBH 2X9WA 4F8QA 3EGSB 4BSVA 1S7UB 5TE6L 3GMRA 4MJ5B 4DW2H 1WTGT 5DLML 1U3HC 2WK2A 5CUSL 1TZIB 3GHEL 4J6RL 1HXMB 4GJTB 4JG1H 2FJFA 1HIML 3B9KC 1B2WL 4YXKL 1EUTA 1FLTX 4P9MH 4ZTOH 5J3HC 1BGXH 1QSED 2VDNL 4ETQA 4NNXA 2CIIA 5K9JH 4WGVB 2BVYA 5L2JA 5DK0B 5DMKB 2B1HH 1A47A 1FVCB 2B0SH 2R69H 2CLRA 3QUKB 1W8OA 2GIYA 3DVGA 5EO0A 1WLHA 2DQJL 2VDRH 1Z9LA 4NRXB 3FT4B 2BVPB 1S7XA 2ZCKL 1VPOH 1R5VB 5KANI 2XN9D 1G9MH 5SV4A 3TGXA 1DQLL 1MFNA 2OSLB 1KNOB 4XBGB 4NWUH 5BS0B 3SE9H 1K4CA 2V17H 2DRUA 4LLMA 3SE8L 1GZQA 4QF1A 4XB8A 3VRLE 3MUJA 4Z7WE 1DVFA 4O9HL 2VZ3A 2AQ3A 3I75A 5DHVB 3OB0H 3NAAH 4KGLA 3VFOB 2JLLA 4M9PA 3QBTB 1YNKH 3FRUB 2FX9H 2AABL 3QUMB 5IKCA 2VXQL 1PG7X 3LKSA 3LIZH 2W9LA 4NM8H 4TSAH 2J3SA 4ZS6D 5GISL 2BY2A 2OL3A 2ATKB 4PLJC 1J5OL 4LLWB 2CDFA 4G8GD 5MEPA 2J8UB 5GS2H 3RWFB 4KI5C 2RFXA 4X6BA 4XPFH 2YD2A 1V5JA 5GGTL 4C4KT 5IHUH 4JO3L 4XBPB 3C6LC 1IGYB 4L8CB 1OAYL 3V4PH 4NUGH 1GGBL 2DTSA 5JOFB 2VLMD 1AD0B 1YMHA 3MA9L 4WJ5B 2YD7A 8FABA 3W81A 3BPLB 4FQJL 4XWGL 1OAZL 5D7JB 3KYKL 3QQ9C 4HKZB 1AH1A 4MDJA 4CW1B 1OTSC 5GZND 1M6OA 4Z5RB 5HHOE 1RZKH 1CL7H 1EEZB 2H3NB 1R3HB 3PUCA 1BBDL 3SKNA 1JHLL 3U4BL 3NTCL 1IC4L 2YKLH 4J1UB 4JREB 1K8DB 2XPGB 4P2RA 3ZE1F 3NBNA 15C8H 3STLB 1YMME 1FFQA 2VWEC 2Y23A 1MCSA 5F7YC 2ZCHH 1N2RA 2PXYD 1AGCB 4JJ5B 5HHME 2V7HA 4EI5B 1MRDL 4J4PC 5DJ0A 2AV7A 4U49A 4UQ2B 2D9QB 3E8UL 5DSCA 2VDML 5MI0B 4PG9B 1QYGH 4HUUA 5CD3B 5HVWA 4LLYA 3QDME 1PAMA 3QPXH 4Y19E 1S8DA 5C0GA 3VXOB 2XA3A 1E6JL 4JY4B 1BHGA 2XZQH 3OJDB 4HUVA 1PFCA 3STBA 2ZP0T 5MHSD 3GBMH 2MQ0A 1MHHA 3ZDYE 4U3HA 1U8OA 4IRJC 4LCUA 1JI1A 4OFPA 4CDGC 3RGVB 4YGVA 2DI8A 3TH3T 2JELH 1AHWC 4NN6B 4OLXL 4MQ7A 2H8PB 3IFPA 4PD4J 1FBIH 2EDEA 1T21A 2ADIB 1HHHA 5D7IE 3QXAA 3DIFA 5L0QB 1KCUL 1JRHH 2N7AA 3T0EE 5I73C 2UWEB 3UO1H 3OKMB 4RA0C 5EZJA 3QEUB 3TNMB 4D8PA 1AGBA 1Q38A 1CXKA 2G60H 1A7PH 4ONGL 3MLVH 1K4DB 1IM9A 1JYXA 4O51A 3E0GA 2KQMA 1HXYB 3CVHB 3RBGA 2VQ1A 3MOAH 4XVUC 1CDUA 3ARDC 5BO1L 3LEXA 3QDJE 4X4ZA 4WTZA 5LJYH 2YK1L 3GIZL 4OZ4A 5F7FA 2EE3A 1JUFA 5SX4H 1CBVH 3U36B 5IMLA 2W0PA 2BSTA 4HXBH 2B5IB 5H94A 3D39D 3RKPA 4K3JL 3H7BB 1ACYL 4M8QB 5DMGD 3VFUA 3CSPA 5DK2A 4YQXH 3NPSB 4MQXD 2IH1A 4BSVB 4UV4L 1CIUA 2Z92B 2PN5A 3GMRB 4RZCA 3ZYZA 4DGVL 3QAZB 4JFZH 3TLRA 4RBPK 5C6WH 3PGFL 1A6UH 2IEPA 4TNWK 2VZ1A 3LKNA 1QFUL 1N6QL 2AK1L 4UT6H 3TF7C 2FJFB 5I19L 1JPTH 4MXVE 2P5EA 5HHQA 2JK5B 5IEKA 3VXRE 3RL1A 4ETQB 4NNXB 4ETYA 1MRCL 3PGCA 2CIIB 2X4TA 5HGAA 3L5WA 4LSPL 3BSZL 2GHWB 5L2JB 3SCMB 5I1AA 2CLRB 5LGHH 1J0IA 4HUNB 2VLRE 4K7FA 3TN0C 3DVGB 4PJEE 5EO0B 3AXLB 3NABH 4L8SC 5KVMC 4HIHB 2BRRH 3WO3B 3IDXH 3AMLA 4YHYB 4AL8H 3GO1L 1S7XB 4U1HA 5CEZH 3UTZA 3FOLA 4G9FD 1B88A 4G8EA 4P2OA 1BEYH 1WUNT 2J4WH 2C3HA 5CJQL 1FPTL 1E0OB 3VXTA 5KSUA 5KTEH 4GLRI 4GKNA 3TFKC 1CGVA 1ZSDA 2BK8A 5C71A 3MV9E 3Q2CA 1K4CB 4XRCA 3CDGA 2NZ9D 2DJUA 4LLMB 5E2UH 1GZQB 4QF1B 4TN9A 5C0DA 3FZUD 43C9A 1DVFB 5DEZA 4LDOB 1A3LH 4D94A 1HDMA 2QKIA 3I75B 4UT7L 5EZOH 2YR3A 3UDWA 4QGTA 2GITA 3GSNH 3QCVL 5HVHC 2EDXA 2EXWC 3FO2A 5IKCB 3V6FA 2EH7L 2Z31C 1RAMA 1CLOH 1SJXA 3LKSB 3RWHA 4JHWH 2EDKA 2MSPA 3MV8A 2VJXA 4GKZA 3HMXL 5C0JA 4G6JH 2CDFB 2PYED 1UZ8A 5IB2A 5MEPB 2EICA 4P46C 4X6BB 2RFXB 2YRLA 4L4JA 3WIFB 1UEMA 5LXGH 4TULL 4W6WB 2CO6B 1KTDA 4MDIB 1OTUC 1A14H 4WVRA 5FXCH 3SDCD 4LSVL 5KSBE 1QFHA 4NNYA 1J87A 2XQBL 5T5FH 2CK0H 3SGJA 3PXJA 1ZLUK 1KJ2L 1YMHB 2OZ4L 1RIUL 8FABB 4CJ1A 4KHXH 3MLZL 4HIJA 1YECH 2HT3D 4PJXE 4MDJB 3SOBH 5IW6A 1DBKH 2D7NA 4PV9A 5ADPH 1NGQH 3SKNB 1G0XA 5FM4A 2Q6WA 4K3EL 2GJ6E 3WDHA 4P2QD 5KJRH 3I6KB 3S8WA 5E94A 2MTPA 1H3TA 1U3HA 4P2RB 2YPKA 2CQVA 4WEBL 3OKKA 2E8ZA 3CXDH 1FVEA 4IDJH 5E5RB 4Y1AD 3O8XA 5HDOA 2HWZH 3V6OC 1N2RB 4LRNL 4OBSA 3U83A 3CLEL 4L3AA 2V7HB 4U2YA 4X8JB 5DD5L 5DJ0B 2AV7B 4U1GB 2X9YA 4NFDA 3MJ9H 4M02A 4BFGA 5DSCB 1J0YA 5JDSA 4NBYB 5E9DE 3V4VH 1RJYA 4HUUB 5L2KD 5SWZE 4LLYB 3ZDZF 1S8DB 5C0GB 5L9DL 5JOEA 1ZLVK 5EORL 4HIXL 4I0PC 2MCG1 2I27N 4DJMA 4DVRH 4HUVB 3NIGF 5D71L 4BZYA 3KAAA 4Q6YA 1E4XH 2APFA 2FO4A 3QG7L 1U8OB 4YPJA 1UC6A 3HR5A 5FM8A 1P84K 4LCUB 1UZ6F 1T2JA 4QCIA 4LVHC 4XBEL 1TQCB 4YGVB 3H9HA 1LO3H 4PGBA 4U3CA 2IBZY 4JFEE 1YY9C 4E0RA 3HE6A 4MQ7B 3IFPB 3IAPA 1T21B 4UOW0 3IDYC 2Q8BL 1HHHB 3QXAB 3DIFB 1IC5L 1RMFL 2CLVA 4J3VA 2HFGL 2NPLX 4PJAB 1J10A 4NUJA 3D18A 4D8PB 1AGBB 1MVUA 5E5UB 4HG4K 2CXGA 1IAIH 3UCRA 3LS5H 3D3VA 3P9LA 5ID0A 1IM9B 1IAMA 4O51B 3IRZA 1KPRA 3KLSA 2R2BA 5LBSL 5DA4A 2W9DL 3BW9A 3LVEA 5GJTH 2VQ1B 2OM5A 3I2CL 2HH0L 3LEXB 1Y6MR 4MQTB 4OZ4B 3GSQA 4NJAL 2WV3A 5K9QI 4YFLI 2G9HB 1MAKA 1FSKC 3C6LA 1JUFB 5KZCD 1JNLL 4M6MH 3W2DH 1WGOA 5CEZD 5IMLB 4O58H 2BSTB 2IQ9L 5H94B 4KKBC 5EOQH 5C07B 1OGAA 2C1OA 2OYPA 4XTRC 4ZD3L 3BH9A 3VFUB 4JM2F 3GUTA 5C6TL 3V6ZA 1KN2L 2JJWA 2V5YA 1WCQA 5DK2B 2IH1B 3QNZB 4RZCB 3HHRB 3H42L 2AJXH 2R1WA 2J6EH 5C3TA 4BZ2H 4L4TD 4EOWL 3MC0A 5DFTA 2UUDH 3HLAA 4FFYL 3BE1H 1QEWA 5D72L 3DETC 3LKNB 4RQQA 1QSEE 3CU7A 2Y36L 1QACA 2HKFL 5DQ9A 5HHQB 4RWYL 3EW3B 5IEKB 1SMAA 3BIAX 1RUML 3RL1B 2X44D 4MA7H 4ALAH 4ZOAA 1VEMA 2EDJA 3S98A 5KS9F 1F3JA 1NCCH 3PGCB 1H0DA 2X4TB 5HGAB 3L5WB 4TRPH 4YWGH 2Q20A 4N0UE 1A7NH 5I71B 5I1AB 3DECA 4K7FB 4QXGL 4X5LA 3VGAC 4R97B 2N7BA 6FABH 1NLDH 5D5MA 5LKNA 1F8TH 2XN9E 5DS8B 4F15B 3ZE2E 4R7DA 1WWBX 4U1HB 3MV7D 3UTZB 4EN3C 3FOLB 2XRAL 2B2XH 4G8EB 4P2OB 5TQ2H 3VXTB 4PRPD 5KSUB 4ENED 2XT1B 1I3GH 4GKNB 1DLHA 3NMEA 4JO1H 4JGMA 4M5ZL 1WAAA 2OTWA 4XRCB 3CDGB 4P4RA 4PTTA 3RX5A 4JPWH 5C0DB 4N90E 3U0PA 1MCKA 3U2SA 3REVB 5HJ3A 4MMZC 1HDMB 2E9JA 2QKIB 3FQRA 1CDBA 4Z7WF 1H3UA 1J7VR 2GITB 3VWJC 2MQCA 2FSEA 1L7TL 3FO2B 3V6FB 4G8GE 5DVMA 3RWHB 5C7XH 3MV8B 4GXVH 4IEFB 4GKZB 5E0QA 3QDHA 4LMQI 4LHQB 1UQSA 5C0JB 1ED3A 3DX6A 1IGJA 2DJSA 4IRSB 5IB2B 4JFOA 3GJFH 3D9AL 5F3HA 3CCHA 1G7HA 3GSVA 5KANG 3G04A 2NW3A 1MOEA 2GKIA 1BBJA 4JANA 2Q8AH 1HQRA 4XT1C 2R56H 5E2TH 5LGJA 2DTMH 4EZMA 4LNRB 3R06A 5ESQA 1JRHI 4TNVK 4P9HH 3EO1A 2FJGA 2I60H 1I7ZA 3EOTL 2J7LA 4H26B 5F7DA 4KVNH 4U05A 2DWEB 4OCMC 3TT1L 2NY2B 2FGWH 2XIDA 2R2HA 5IW6B 1EBPA 1CD0A 5FV1L 5GRYA 3BP5A 2Q6WB 3BESR 5IFAL 2LU7A 4WUKL 3NZ8A 1EZVX 5E94B 1BZ9A 4PJIE 5FKPB 1JWMA 2EH8L 2NXZB 4RGMB 4GG6F 2PCPA 3LEVH 4M93B 4DUWA 3GMNB 5M7QA 2YPKB 5HPMA 3OKKB 1FVEB 5SX4I 1CD8A 3O8XB 3V0VA 5LWYL 1C12A 4F37K 4KKLD 2BNQE 2EXYC 1PG7W 2ESVE 1KCVH 2ZPKL 3A67L 2GSIA 5JDSB 3CK0H 2XFXA 4JPKH 1RJYB 3QSKB 2D7TH 5JQHC 3TN0A 3NIDF 5MHSE 4UTAL 1T03L 3M45A 3IFLL 2EDWA 2CO7B 3RWDA 3G6DH 1IE5A 3EOYG 5E2WL 3KPLA 1CS6A 1AE6H 1RJZA 2HKHL 4L4VE 4U31A 3CSYA 1GOGA 2MNUA 2PO6C 1M7XA 4QCIB 3ZDYF 3P11L 4DOHE 2X1PA 1AGFB 4WW2A 4OGZA 3K8MA 4ZFZA 1LE9B 4PGBB 3N50A 3S37H 3WFDL 1PG7L 5D6DC 4YXLH 4E0RB 3HE6B 2D31A 4NOFA 5FB8A 1A7RL 1T22A 2WIIA 4J3TA 4UI2A 2AJYL 3BAEL 2CLVB 4LP4A 4MAYD 4YE4L 4M48H 3VFGH 4NUJB 4LQ1A 3D18B 1MVUB 2OP4L 3OKDA 3D3VB 3P9LB 3D25A 1F3DH 4PRAA 3MGAA 3TP4A 5ID0B 5HYJE 4CU8A 1O5DT 3FB8A 1S7WA 3WSQH 4LBEA 1F2XK 1LEKA 1KPRB 5IVXF 5EU5A 2R2BB 4QHMA 3BW9B 4FMKA 2R8SL 1GPOL 3VI4F 1C7TA 4P46A 3WIIH 2NTFA 3K81A 2NY6B 2X4SA 3GSQB 5FKAA 1UADC 4AIOA 1KIUA 1F4XH 4XHQA 3C6LB 3O6LL 1K6QH 3ILQD 4OGYL 3PP4H 2AJUH 1V3LA 4Q0XL 1QO3A 3RZCA 32C2A 4Y5VA 2ICWI 3G6AA 2QHLA 1OGAB 2C1OB 3TBVA 3B9EA 3MTRA 3BH9B 3RIFF 3GUTB 4M1DL 4YC2C 3I3EA 1C5CL 1T89C 4PJHA 3TC9A 1OLZA 5B38A 2R1WB 5EWIH 5CJOH 1MHPH 3HLAB 3LRSA 4RQQB 4K55A 3WFEL 3KLHC 3E2HC 3QXDA 4M1CD 2XTJB 4NKIL 3FN0L 1XMWA 1LVEA 5DQ9B 5C09A 4MD5A 3G6JE 3FRPG 3V6OA 1CXHA 1H0DB 4CU7A 2X9XA 4PR5A 5AZEL 1A3QA 5EBLB 3K74B 3MGOA 3WJJC 2WUBL 3T77A 5TFSL 5TDNA 3CSGA 3MUGA 1S3KL 5AWNL 4FXGA 1P7QA 5D5MB 4G9FE 5BMFH 4YNYA 3OAZH 4ODVH 3HNVH 1ZANH 4F2MA 4OIAA 4R7DB 4Y89A 4I0PA 2A6KB 3GIVB 1ZK9A 1EERB 5I2IA 1J8HD 5IMOA 2YUVA 5CEYA 4POYA 3UJTH 4LLVA 2HN7A 1TMCB 4Z78A 3A0OA 1DQQA 2VB5A 4WDIA 5L88H 2Z8SA 2BNRA 4MS8D 4O2CA 4XVJL 3R8QA 4C58B 2OTWB 2AK4D 4P4RB 2O5YH 4PJCA 4NP4H 4PTTB 5D8JL 5GRZA 4FP8L 2HVKA 3U0PB 4D9LH 3U2SB 3V0WH 4ONFH 3W11C 3QUXC 5HJ3B 5HYSG 2C3XA 4E41D 1J05A 1MJ8L 3FQRB 4OLWL 1GOFA 4M4PA 3SKUD 1FFPA 3TBYB 2NR6D 1H8OA 4TSBH 5J1SC 4MXQD 4DCQA 4S1SL 2PYEE 2FSEB 4GUPA 1KEML 5I73B 3MYJA 3T2NH 1E4XI 2AJSL 5DFVD 2P8MA 1UQSB 3DJ9A 1ED3B 3DX6B 3O4OC 3Q6GH 4LVNB 1IGJB 3EYFA 2ED7A 4JFOB 4XH2A 4KTYA 3C09C 4OFYA 43CAA 3CCHB 3GSVB 2NW3B 3G04B 1QG3A 1CE1L 4QXUH 2CKBA 3QNYA 2LV4A 3QP3A 1DQDL 2VZVA 3WS6A 1HQRB 4LCCC 1OF2A 3JWDL 4UBDC 2YPLA 5D96C 5LGJB 3MOBH 4LAQL 3R06B 4HFWA 5F70A 4I9WD 1I1AD 1U92A 4XVTL 5ESQB 3EO1B 1XT5A 4KPHL 2MPAH 2FJGB 1I7ZB 1NH6A 1AKJD 2AXFA 2R2HB 4P2QE 3T08A 5EC1A 2LTQC 1RUAL 4EUPG 3BP5B 3NA9L 4KK9D 2ENYA 1MEXL 4OGXH 4OF0A 5ANMA 1BZ9B 3BPNC 4KTEL 1JWMB 3ZHLA 2PCPB 1DBAH 1P7KA 4OZHE 1XEDA 4TYUA 4G7YH 5EUOA 3P4MA 3W5NA 4G6AD 1WWAX 1CWVA 1C12B 4PD4K 3RTQA 5E1HB 1WT5C 4HS6A 4MA8H 4FQ1H 5L2KE 2O5XL 2EIEA 5D2LA 5B39G 2Z35B 2W0KA 3JV0A 2GSIB 5F9WC 1I9RL 2XFXB 5I66A 2Y25A 3TN0B 3T3PE 1KGCE 3VFRA 1JHKH 3BRFA 3EFDL 4TTDD 2X4QB 1VADA 3ALXA 3WNMA 4OIIH 5KVEH 4IIQA 2WWMC 2VDLH 3L9RA 4TPRL 4QWWD 3RWDB 4XI5C 1JGVH 3KPLB 1DQTA 1RJZB 3VMNA 4EN3A 5HXMA 4FN0A 3CSYB 4ELKA 3THMH 1U91A 3L7EA 4CVUA 4PJ7B 4WW2B 2FD6H 4NKDB 4XC3H 1EEUA 3MA7A 2YRZA 4QEGA 2D31B 5FB8B 3CH1A 4DN3L 4OUOA 1T22B 4LSTH 1QBBA 2WIIB 4ZXBC 3IXTB 5GHWH 5JHDA 3T4AA 5F6HI 4OLEA 2YD3A 1L0QA 1SJHA 1JPSL 4LEXL 5D1ZC 4NO3A 3BN9C 3KJ6L 1ZLSH 1K3ZA 1T7WA 3CAFA 4K9EH 4NQDA 4KHTL 4HPOH 4I5BA 2XV6B 3BKYH 5JQ6L 1UT9A 4PRAB 4TVPD 1KULA 3T0DA 3FB8B 1S7WB 1LEKB 4LBEB 2J88L 4XXCA 4J23A 5EU5B 3N85L 2YUWA 3QO1A 4P46B 4MD4A 3ROOA 2NTFB 4YDLC 2ICEB 2X4SB 3K4DA 4OZIA 1RJLA 1IMHC 2Y6SC 2X4NA 3PIQA 5C0BA 3MLPA 4PJFE 4ZOCA 2DLFH 3FCTB 3L5XL 1ITBB 4N68A 5JZ7D 1WIPA 2NCMA 3VDBA 4BFEA 4QOKA 3RZCB 32C2B 4Y5VB 3G6AB 3HI6H 3S5LG 4YDVA 1UM6L 4IM8A 3JWDC 3TBVB 1YQVH 2FBOJ 1BPVA 1JF6A 1MCWM 4L4TE 4X5XA 1FYTA 5FYLD 4HH8A 4KQ3H 4XNMA 4PJHB 1V7NH 3L3GA 4Q9QH 5IHZB 1MJ7H 2EEAA 2PTTA 4OI7A 4HAGA 5B38B 4JB9L 5JR1H 1CXIA 4GS7C 4DGYH 4CMHB 3NZHL 2JJUA 3LRSB 2XZCH 1Z9SA 1KXVC 4GRMA 2WW8A 1ZGLM 3QXDB 1EK3A 2W9EL 4YBHA 4K23L 5FGRA 2K7QA 3ARPA 3BGMB 1JGUH 1NBVL 1TNMA 1IGCL 1RHHA 1SM3H 2AXHA 1JE6A 2Y07L 4AEHL 1UG9A 1DUYA 1UCTA 5K9QG 4PR5B 4GBXC 4BQBA 3ZE0E 3MGOB 3T77B 5CD5C 5TDNB 2DIAA 3MUGB 4JLRA 3EYSL 4FXGB 4Q6IC 4OD1L 1W72L 4YNYB 1M05A 2YD5A 4PRPE 1FAIH 4F2MB 1N0XH 2FJHA 4OM1H 5I1IH 5JXED 4I0PB 3HG1A 2VMFA 5IMOB 2VL5A 3ESUF 4G9DA 4GW4A 2FX8H 3VGFA 1Z3GL 4LLVB 1QSZA 2HN7B 3I02A 4NN5B 4Z78B 3ZYJA 1DQQB 2BNRB 4O2CB 3WNKA 2XI9A 1WF5A 5EG6C 2FB4L 3QHFH 4LVHB 4PJCB 5HHVH 3KPSD 4LPCA 2VN7A 3UYRL 2BOCA 2HVKB 5D6DA 4QTHA 4R7NB 5DD1L 4Z7UA 4NC0B 4H0HB 4U1KA 4UINL 3EYUH 5EBMA 3E3QC 3IF1A 1J05B 4N1HB 4TUKL 5I1KL 1KENL 1FFPB 5C2BH 1SY6L 1YEIL 3NACL 4HWBL 4GUPB 1YJDH 3MYJB 1TVHA 4YK4B 3ARGD 4OLZH 3H8NA 3VD7A 2W07A 5CLTA 2OR9H 3EYFB 1YPZF 3AB0C 1EAJA 4XH2B 3TV3H 4PJ9D 4X7FC 3GK8L 4F3FA 4JZOB 3ARED 3QNYB 1UA6H 1V3MA 1OF2B 1A4KA 2Q7YA 4JGUA 4NDMA 4NM4H 3BGFB 4HFWB 1FSKB 1U92B 4XNQB 2EIZA 2EKSA 2F8VA 3QUMH 1HEZA 3EYVA 1OAKL 1TZGH 3HUJF 1MNUL 5C86A 1YEHL 3F58H 1JNNH 3BD4A 2AXFB 3NN8B 5EU3A 3RVXC 3VRJA 4PB0L 2FH8A 4PJDE 5EC1B 1CD9B 3SKJH 1BQHG 4L8DA 1DBML 1QFOA 1ADQA 1FVDA 2NY3B 4NO0D 4LLQA 1AI1L 3DWTA 3OAUL 1UWEH 5ANMB 3ARZA 2OBGA 4TNVF 1EO5A 1WK0A 3Q3GA 1P7KB 3ZKXC 5C0CE 3QXTA 3HAEH 3TM6A 1MJUH 5EUOB 1VFUA 3P4MB 2E27H 2PW1A 4ZAKC 1J0HA 3D85A 1F58L 5DYOB 3RTQB 3WS3A 5IF0A 1WZKA 2R4RH 4HS6B 4W4OA 4C56D 3TYFA 5D2LB 1VGKA 1A6WL 1CLZH 4Y4FC 5I66B 1H15A 2V5MA 2P24A 3VFRB 2RJMA 1DFBH 1A7OH 3TT3H 3MPCA 1MCHA 4IIQB 4JFFE 5FOBB 2R23A 3L9RB 4F37F 1CXLA 4LASL 2C3WA 1J1OL 4EN3B 4M43H 3FQXA 4ZTPL 4HXAL 4ELKB 1EH9A 1U91B 3L7EB 1YNTA 3EJYD 1FZOA 3MLWL 4LDEB 1EHAA 1U3JA 3MA7B 5J0BA 4QRPA 3U9UA 1XIWC 3CH1B 2C7UA 3QJFA 4WU7B 3O6FA 1HILA 1JTTA 4M6OH 1DL7L 3HMWL 3T4AB 4DUVA 4NO3B 1NFKA 4NQDB 5ELIA 4LSSH 4I5BB 3MLUH 5IJVA 5D1QC 3O9WD 4J3SA 2XQYG 1CICA 3T2OA 4YDIL 3QO1B 4YBQD 4MD4B 1T66D 4ZMAT 2AJZA 4JDVA 1D9KC 3SDAA 1RJLB 4MJIE 1GC1H 5D2NA 2X4NB 5IW3A 5C0BB 4KZEL 4Z7VF 3WUWA 1IQWH 1FZKA 3PP3H 1NLBH 4WV1A 2P44B 3UZQA 4QOKB 4PJGA 1YYML 2OXHA 5FCUL 1NMAH 5BV7L 4LSDA 4YDVB 4ZUTA 4XPGH 1NCBL 4X5XB 1D5XA 1FYTB 1OT1A 1K5NA 4UIKL 3WN5B 4K94H 4XNMB 4XVSH 3CJJA 1EGJL 3L3GB 4ELMA 3CVHH 2EDOA 5FA4A 4YFLF 2PTTB 3KDMA 2NY7H 2GY7B 5F9AC 5FYJE 2KDGA 4FQCL 4O2FA 5ACZA 1MF2H 1DBJL 2HT4D 2XXMB 3VXQA 4GRMB 3HE7C 3NPZB 5C6PB 1BVZA 2DB8A 1RHHB 2P7TA 3UP1A 1MAMH 5ILTL 2CK2A 1NDGA 5J9PA 1DUYB 3ULVC 2QJDA 4AQ1B 4K2UL 4YXHH 1VGEH 3LKPA 1WT5A 4WU5A 5JXAH 4LCIL 2R29L 4HF5H 3QEQE 3ULUH 4JLRB 1DQML 4DN4L 4FNLH 1J8HE 2IFFH 3QRGL 1M05B 2H32A 5EU4A 2FJHB 2JJTC 1W0VA 3HG1B 1LP9F 2VL5B 4G9DB 3EHBD 4M5YL 4GW4B 3HZYB 2AK4E 2F5AL 3I02B 3TJEL 4JO2H 1SEQH 2EE9A 4KDTC 1CFNB 4AMKH 5HDBF 2AEIT 4E41E 4JKLA 3LEYL 1TJIH 3QHTC 4QTHB 4W81A 5D7SL 3S4SG 4Z7UB 4U1KB 3RWIA 1DSFH 2F54A 5EBMB 5C0EB 3GB7A 3IF1B 4XX1E 1A8JH 4GRWE 2Q87A 2YWYA 1TLKA 4LLDA 4HS3A 4F58H 5CILL 1TVHB 4YPGA 5D7JD 3O2DL 4EBQL 1JV5A 1I1YA 1KCRH 3T3ME 4WWKC 4WO4C 2D9CA 3H9SB 4AG4L 4HT1H 4AH2A 4XP6H 2DDQL 5IV2A 4F3FB 2OQJA 3IB4A 4I9WE 4KI5E 1NFIA 1OQXA 1A4KB 5F1IA 2Q7YB 4NDMB 3SDXB 4I2XE 2EIZB 2EKSB 3ARTA 1HEZB 4UAOC 1TJHL 3EYVB 3PWLA 4S2SA 4N0CD 1OPGH 4EI5D 4LLAA 2DM4A 5J12B 4BK4A 2OL3H 2N4IA 3VRJB 4RNRA 3G08A 2QQKL 4HD9A 5IMMA 4L8DB 5J8OA 1IEAA 3SGKC 3VW3L 1FVDB 4LLQB 5BV7C 1PD6A 4FFVC 5E4EC 3PWJA 1V7ML 2D0HA 3JWOH 3F6IA 3Q3GB 3M8OH 4P5MA 4OT1H 4POZD 3GKWL 3C2AL 4WUUD 1OAUL 2VITB 1G6RA 2PW1B 2X4PA 4CVZA 1GIGH 4XMPL 4HLZG 5E1AA 3D85B 1DLFH 3WS3B 1RZFL 5IF0B 1XF2A 1UJ3C 5CS7A 3RGVD 3TYFB 2FHFA 1HWHB 3UX9B 1VGKB 3RVVD 3DX8A 1AQKH 4GBXA 4Q9BA 1Q94B 5ECJE 1Q9LA 2FEDC 5C0RH 3U7WL 1BQSA 3O0RL 5DRXB 5DWUH 2D4DA 4GAJH 1OAXH 3RUGE 4Y4KC 4QHUA 4EDWL 4Q6IA 4PS4L 2EC9U 2R23B 1E4JA 1I1CA 3OR6A 1RIHH 3EIFA 3HC4H 4OM0H 3T65A 4FQIL 3PF2A 1V8HA 3BP6A 1MCPH 3FQXB 4UT9L 4X4YA 4S1RL 5IBLD 3LN5B 1YNTB 1FZOB 4WFGD 4QRPB 1CTOA 3KYOA 3U9UB 3QHZH 1YEGL 1IARB 3SKOA 3QJFB 1RUKL 3O6FB 1HILB 1ROWA 3OGOE 3SKMA 4K8RH 3DYMA 1BFOA 4TVPE 3AC0A 3QQ3A 4MXWH 1MFBH 1KCSL 2VDQL 1SHMA 4OIBA 3QIWC 4UNVA 4WTXA 2GTWA 1R0AL 4IDLA 2X1QA 3S88L 4HJJH 1IC1A 1UH3A 5IJVB 3SGDH 1IGIL 2AGJH 1CICB 1NJ9A 4NN7B 4ZUSA 4UOW1 2CMRH 5D93B 3ULUD 2AJZB 4JDVB 3SDAB 4Z8FH 5D2NB 3P9MA 3WUWB 1FZKB 4JM2C 4OGAC 3ZKMC 4WV1B 3P0YL 5I1DA 2B7DT 4PJGB 5CBAA 1QA9A 5FYLE 4X5WA 2OK0L 2NY4D 3UTSE 4YX2H 1ZGLP 5ERWA 4ZUTB 3LQAH 2PUQT 4MLIA 1CF8L 3LD8B 4FFZL 3SCMD 4ELMB 2BERA 4HPYH 2P1YA 4M7LH 1FO0L 5FA4B 3KDMB 4UZGA 3WFCL 4LGRB 4O2FB 5ACZB 1VB9A 1LDPH 3MZTA 3VXQB 4WHDA 1MI5A 2ENSA 3BPNB 3BX7C 1NFDF 1EVUA 2P7TB 5EFIA 1NDGB 5J9PB 4FABL 3JXAA 1RULL 1IGFH 3KWWA 2BHYA 2BX5A 2NYYD 1KBGL 5BJTB 3LKPB 1XAUA 4RMUA 3VFSA 3DUUA 1KB5A 3BI9X 3WLWD 4QT5A 1ODAA 3MCLH 5IBUG 4F7TA 4M7KL 1ES0B 3UTTE 5ITBH 1G7IA 2H32B 5F9OH 4AIZA 1FL5A 5EU4B 4XPBL 3NA4A 5ALBH 3S3JA 4GSDH 4DGIL 5EOCJ 5TE4H 3KPSE 1FHGA 3EOAA 1IT9L 5C0NC 5ETUB 1AJ7L 4UB0H 2Z8RA 5MENB 3VDAA 1P4BL 2RCSH 3I85A 3BMWA 3RWIB 4MZ2A 2F54B 1XIWA 3GB7B 1BQLH 3RAJL 4LLDB 1U41A 2F53B 3PQYA 4YPGB 5KOMC 1MFDL 4JRXE 5FHBH 5DR5L 1BIHA 1QHPA 5A3IC 4EVNA 5LGKA 5D1QA 4AH2B 2VDPH 2C9AA 2EE2A 5IV2B 2F58L 2OQJB 5DC4B 4MLSA 1HNGA 1J0JA 4U0RC 1MFAH 1DTUA 4KMTH 2DQEH 1D9KA 2ERJC 4WEMB 5DJXA 5ITFA 5F1IB 3UXFA 1FDLH 3OKLA 4P2RD 3ZMRA 3QFJA 2LVEA 3GFUA 4X4MA 1KF9B 4MNGA 4GKOA 4XP1H 3DSFH 5I1LA 3PWLB 4S2SB 5K59F 4Y2DC 1IZKA 1VSCA 3WHE1 3VI3F 2C4FU 5FO8A 3O41B 4PRIE 4RNRB 3G08B 2EYSA 3BKMH 5IMMB 1INDH 4HEME 1Q72L 1KELH 2QSCL 4PJDF 2WWKO 3PWJB 3OKOA 5CAYB 4P5MB 5JPNA 1FNEA 2P49B 1G6RB 3ME0A 2X4PB 4CVZB 4OD2A 5E1AB 3K8LA 2E9IA 2VERN 1DDHB 1P69B 3QULB 1JZ2A 2MQ3A 2H41A 3HRPA 1QR1A 4HC1H 2HMID 3X12A 2Y5TA 4C4KO 3DX8B 1N64L 4M3JA 4GBXB 2EZ0D 1Q9LB 3C6SA 1I7RA 1U8LA 3MXVH 3HPJA 4HMDA 4QHUB 5FYJU 4XHJD 3EDFA 4ZSOA 5BRZA 2VC2H 5EA0H 3T65B 3X17A 4OZGF 4M6NH 4XP5H 2A9NL 3BP6B 4X4YB 1HKFA 2D4FA 2XACC 3QIUA 3MQIA 4N0YH 1MRFL 3BJ91 2UV3A 4J12A 5KSAD 5A43C 3U0WH 1XGYL 3KYOB 3T0WA 1QLEL 3SKOB 3T0EC 3VWKA 4KDWA 1YNLL 4FTVE 1QBLH 4NQCA 4ZO8A 3WO4C 4NQUA 4RIRA 3QJHA 5HD8D 1BFOB 5F3BA 3QQ3B 1P1ZB 3GI8L 4KQ4L 2W0LA 2GTWB 3QCUL 4KKAC 4NRZA 5C07D 1NCAH 1U6AL 3TO4A 4WWKA 4ODXB 1NAKH 4PJBF 1MIEL 4ZUSB 4G6KH 2EKJA 5GRXG 5FYKL 1U8QB 3AB0B 4L9DA 4G8FA 3UYPA 4PUBL 5ADOH 3QNXA 3P9MB 2UYLA 1BP3B 4GQ9H 1YEFH 5FGBA 2OJEA 5GJSH 5I1DB 3G5YA 5E95B 5D7KD 5CBAB 3C8DA 1QA9B 4X5WB 4HCRH 4U1JA 1MLBA 5ERWB 2KZ1B 1ZMYA 3WUZA 3K2UL 1AGEA 3DHJA 2A1WL 5TF0A 1F6AA 1GGIH 3WHXA 5GRJL 4GXUM 7CGTA 3VFTA 3FQWA 4LKCA 5FUOL 1HSBA 1KUMA 1P4IL 1MI5B 1MWAL 3GI9H 4LU5H 3JTSA 1VEPA 3IGAA 4YHOH 4NZRL 3UTPD 2RBLA 4P2OD 3LKRA 5EFIB 3LSOA 3ARRA 1CD1A 2VXTL 4H20H 3KWWB 2C5DC 4AYFA 4FQ2L 4KK8D 3VFSB 1W8NA 3DUUB 1P6FA 5E5MA 1T4KA 3DTXA 3IJSA 4BKLA 1WEJH 4F7TB 4U2ZA 3RY5A 3NCYP 1WWCA 1X5FA 3IU4H 3OPZL 2A74A 4ZO7A 1G7IB 5H8DA 4AIZB 5GRUH 5AEAA 4X6CE 1H5BA 1Q9WA 4Y4KA 2P5WA 1F6FB 5LVEA 1UEYA 4PGZA 1NCDH 2YD1A 3MV8D 4M03A 4I18C 4PGCA 1CE6A 3EOAB 3DVIA 3ZZ1A 4PP2A 4IRSD 3OXSA 3DI3B 1R3IH 5IUSA 2J5LC 4WHYH 1B2WH 4PRHA 2VDNH 1XIWB 4W6YB 3V5DA 4YZFE 1PDKA 4A6YL 4JQXC 1A5FL 2BHZA 4GMTL 4PJ5E 4GRWF 1SBSH 1T2QL 3CX2A 3PQYB 5CKGA 3UBXA 1DCLA 4GXUN 1T0NA 5JIPA 2VR5A 3QIWA 1S7QA 2EYRA 2NY2D 2BJMH 3MRBA 4EVNB 2E5EA 3A6CH 2VR9A 2DQJH 5D1QB 2YPVL 1H3PL 4ZNEE 3BZEB 4KJWC 4K3HA 2HTKD 2ZCKH 1VFAA 5E8PA 1RUPL 4HKXA 1DQLH 5FAAA 3QIBC 4AM0B 5DJXB 5ITFB 4L3EA 2NXZD 4O4YL 1A9BA 3OKLB 1A21A 1NBYA 3S36H 5CZXD 3I6GA 4MNGB 5T3ZD 3O8XD 3SE8H 4F9LA 2HYMA 2BMKA 5KBNC 5FO8B 3PL6C 4O9HH 4YEEA 3RPIA 2CR6A 2EYSB 4RAHA 5E6IC 3KHQA 5I18L 5GXBB 1Z9MA 4PB9L 3KG5A 4JVPA 2GTZA 4P3CL 4WUUE 3ETBF 3Q0HA 3OKOB 4NPYA 4R4FH 2EDDA 5JPNB 1J5OH 5IB3A 3S35H 1FNEB 2PTVA 4OCNC 1G7PA 4OD2B 5GGTH 4F7PA 4OCSL 3P0VL 4JO3H 5GS0C 5C3LD 2DMCA 2DQTL 3D0VA 4YHPA 5I1JH 1QR1B 3DHMA 3MROA 3X12B 2Y5TB 4GRLC 4LKXA 4MSWA 1OAYH 4HKJA 3MRDA 3NFNA 1GGUA 4YUEL 3HE6D 3CDCA 4YHLH 4NQXA 5AYUH 1J8KA 3C6SB 1I7RB 4FQJH 1OP5H 4NO5A 3RRQA 5FGSA 3RVTC 2HTLC 3KYKH 3HPJB 4UTBL 5IK3A 4ZSOB 5JA8B 3ZDXE 1CR9H 1DANU 1HCVA 1EJOL 4FQHB 5BRZB 2W0FA 2VUOA 3B5GA 2EEDA 4M62H 1JHLH 3D3VD 3NCMA 4QHLA 2DLTA 3U4BH 3WKML 3QIUB 5BVJB 1I4FB 1MCQA 1LWRA 5H37H 3RJQB 2YD6A 4Z7WA 4NZUL 1FQ9C 1MHEA 3NCEB 4IOFC 2NY6D 3MBXL 3VWKB 4X6DE 4XPHH 3PGDA 5JOPD 4NQCB 2A38A 3C6LD 5DJ2A 1MRDH 4Y16D 3QJHB 5F3BB 1JGDA 3E8UH 5B22A 2VDMH 1OGAD 4NRZB 4Y5XC 4WW1A 3HCVA 3CVIL 3TO4B 2YD8A 4FQXA 5EB9A 4WWKB 1X5AA 2X1WL 4D3CH 3AU1A 1E6JH 4URTB 4ZUWA 2J6EA 5EIVA 3SDYL 1Q8MA 1S7RA 3EDKA 2XTJD 4FZ8H 1QHOA 2UYLB 3RGHA 1GH7A 2OJEB 2AEQH 5I8EA 4TOYL 5FUZH 3ZTJH 4IBLT 4U1JB 5HHOA 1MLBB 1MJJB 2OS7A 5IQ7L 4I4WA 1AGEB 4P4KB 1KCUH 5C1MB 3U4EB 1F6AB 2Z91A 3WHXB 2F19H 1ZHKB 3QCTH 3KGRA 2FECI 2FX7H 3VFTB 4RSVA 4LKCB 5A40E 2A73A 1YMMA 4LEOA 5GRVK 1S9WA 1NKOA 4ONGH 3JTSB 2BY1A 3ISWA 1HINL 4GMSL 3IGAB 2YWZA 5EOTA 1CTNA 2MFNA 4ZUUB 3LKRB 3KPOB 4LDLB 5BO1H 3LSOB 3OQ3B 1CD1B 5SX5H 1HE7A 1T3FA 2YK1H 3GIZH 1FGNL 2ORBL 5IB5A 4ODTL 1CGWA 4FG6D 1GGCL 4RISH 5E5MB 1T4KB 3QDMA 3DTXB 4Y19A 5T5NG 3IJSB 4BKLB 1VFMA 4QTIL 1AXIB 1T1YA 3DSNA 4KJPD 3OJMB 2A74B 3OF6A 3GSNB 3AFLA 2E3VA 2ICWB 5C08E 1H5BB 4Y4KB 1S9XA 4C83A 2P5WB 3MRGA 4UNTA 4P9ML 3S34L 3DX7A 5J11B 1IEHA 4UV4H 4AY0A 4DGVH 1J11A 1CE6B 3TIEA 1RK0B 4OCLC 5K9JL 3KPQA 4LCYA 5CEXA 2D0GA 4PP2B 4EDXA 25C8H 3OXSB 4XNYL 4G7VL 1N6QH 1JF1A 1U2CA 2YSSB 2BFVH 5D7IA 2OMBA 3DVNB 4ZS6C 3Q6FA 2E7LC 5E2VH 3V5DB 2DICA 1MRCH 3KYMA 1V3JA 4LSPH 3BSZH 3FFCE 1VPOL 5A2FA 2X42A 4Y5YC 2HFEB 3UBXB 1OD7A 1T0NB 1UM5H 3V5KA 2CRZA 5F97E 5KW9L 3QIWB 1S7QB 2EYRB 3MRBB 4HGMA 3SE9L 2V17L 4P57A 3QDJA 4JPIB 3GO1H 1UXWA 1VFAB 3K1KC 4KRMB 5E8PB 4HKXB 3ZKQD 3IKKA 4QHNA 5CJQH 5FM5M 4G6ML 2GK2A 4L3EB 1T04A 5GZNC 3GMQA 2A6DA 1A9BB 3LPFA 4AENA 1N5YL 3TBSA 1NBYB 1S78D 1X44A 5HBBA 2FX9L 3I6GB 2X4OA 4JDZA 5D7LB 3QWRA 5TF1H 3S37X 3TNNA 3LIZL 5F1OB 4BSJA 3RWCA 4TSAL 2AI0L 3VFNB 4MA1B 1QUNA 5FEBA 3ZKND 1NCUA 2LAAA 3CFBA 2DBLH 3RPIB 3QUYB 4XPFL 3ZYIA 1NDMA 3QCVH 5IHUL 2PXYC 1FNGA 3TN0D 2GTZB 2CKBH 2EH7H 1M7DA 4NPYB 4P3WA 3K0WA 3V4PL 4NUGL 3TH2T 5IEHA 5IB3B 5ACMA 2A0LD 3VXRA 4RMVA 1G7PB 3GEWB 4OUUA 4F7PB 1GHFL 2IANA 2Y7QA 1V05A 4QY8A 2DLHA 4IOIA 3D0VB 4LCWE 4YHPB 3ABZA 2IPUG 1RZKL 2VLRA 4LKXB 4LRIC 4PJEA 4U33A 3MRDB 3TBTA 1OM3L 3MODL 5I0DA 4LPXA 1KJ2H 1IBGL 2OZ4H 1RIUH 3SDDB 1BECA 1ZVHA 4NO5B 4PJAE 1MREH 4FMFA 4JFPA 1B0RB 1U95A 3L1OH 5IK3B 1U3YA 2W0FB 2ZCHL 4LGPB 1G1YA 5DRWA 1TFHA 4ONHA 3VXSD 3MV9A 3MRKA 4YDKL 4QHLB 1MCCA 2SEBB 1F4YH 4I18A 1UXSA 2PF6A 1I85C 4M7JL 2NY1B 1MHEB 4P46D 3PNWA 4U1MA 4ORGA 5JW3L 4DTGL 3PGDB 4LRNH 2F8OA 3KJ4B 3CLEH 4RX4A 1NSNL 5DJ2B 2XZQL 5EH1A 4Z7OE 5C07E 2I26N 1CDIA 4HIEA 3IDMA 3SQBA 4D9QD 3RZCD 4R2GB 3AS3A 4I8DA 2ED8A 5T1DH 3JV4A 4WW1B 3HCVB 2ZJSH 3LN9A 4FQXB 3BH8A 5EORH 3AU1B 4HIXH 1URLA 1I8MA 1I7UA 1Q1JH 5D71H 2MHAA 5KSBA 4OCYH 2IH3A 5DMGC 3BN3B 2V9TA 1JRHL 2QR0A 4U0RB 1S7RB 4PRDA 3QIBA 3OB8A 4XBEH 4JM4H 3RX8A 3UO1L 4MQXC 4X7CC 5EZLA 3LH2L 5I8EB 1N8ZA 4K71B 4DFIA 4PJXA 4ZS7H 4D2NA 2G60L 3IDJA 1A7PL 4N8PA 5TE7L 5HHOB 3MLVL 3FQNA 2Q8BH 4I4WB 2CRIA 3PL6A 5CINL 5IR1A 3A6BH 3NIFF 2Z91B 1RMFH 3MOAL 2IMMA 3B9DA 1GVIA 2HFGH 2WMPA 5I30H 1UH4A 3MMEA 4UV7H 4PYGA 5T5NF 3ZT6A 4UU9A 1L9MA 2A73B 3WL9A 1YMMB 4LEOB 1S9WB 2OTUA 5ISZE 1QRKA 4I0PD 2HJLA 4HXBL 3L95A 5LBSH 3I2CH 2KBGA 5IFHL 1A6VH 1TQBB 1WITA 1T3FB 4I0CC 4NJAH 1UB6A 2BNRD 3C5ZA 5IB5B 5E9DA 4OSUL 1UACL 5SWZA 3QDMB 4GRLA 3LAFA 3X14A 3O11B 1T1YB 2DYPA 5J13B 1IZJA 4F7MA 1RZKC 3RA7H 4ZD3H 3MV8E 4BFIA 2NZ9C 1S9XB 1JPTL 3VXPA 4C83B 3UJJH 1KN2H 3O2WL 3FZUC 3DX7B 3RI5F 3PXHA 3O45A 3TIEB 5T1MA 1PW3A 3KPQB 4LCYB 5CEXB 2J8UF 4JFEA 2ATPA 4GAGL 2EC9T 5D72H 3ORJA 5JA9A 4OFYD 4FOMA 1JF1B 3NOIA 3FB5A 4LSUL 4NT6A 4RWYH 3IDXL 3KYMB 4HZLA 5H2BA 3RWJA 5CEZL 3WO4B 5HDLA 4P99A 4TSCL 5BW7A 1BEYL 5KTEL 2VISA 3SDCC 4PLKD 3W0WD 4M00A 4Y5XA 3MRCA 1KT2A 4XB7A 1QFPA 2EDFA 4P57B 3QDJB 5E2UL 3SPVA 1HI6B 5IQ9A 3MRHA 3DBXA 5IW1B 5T1LA 2NY3D 2JIXA 4PTUB 1A3LL 5ABDE 4QHNB 2HT3C 3VRIA 1T04B 5EZOL 3GMQB 2A6DB 3NGBB 4AENB 4M5ZH 3DO7A 3TBSB 1PKOA 2X4OB 4JDZB 1OP9A 3TZVA 1CLOL 4ODWA 3TNNB 3RWCB 4JHWL 4U0QB 2ARJB 1XR8A 4GW5A 3RTQD 1AXTL 1HHGA 4WI5A 4MNQE 1KJMA 1AC0A 3CFBB 2I07B 1F42A 5LXGL 1NDMB 5T3XD 2FHCA 5E8OA 5EO1A 3MLXL 2J12B 1NGYA 1FNGB 1VACA 4KK6D 3T0BA 3MNVB 3ZE1E 5C70A 1BD2E 1QSEA 3FO1A 5C0AE 1M7DB 2XICA 5T5FL 2CK0L 1RURH 5IEHB 1A7QH 2NZIA 5DJDA 3VXRB 3GGWB 4KHXL 2WSKA 3KS0H 4EN3D 4OUUB 5DZOA 4P0DA 5CHNA 2IANB 2Y7QB 4N0UA 4QY8B 4IOIB 4RA3A 4Z76B 3SOBL 1N4XL 1XGTA 2VLRB 1L0XA 4PJEB 3TBTB 5ADPL 4GAFB 3ARVA 1JGLH 3U4AA 5KJRL 1ADQH 2XN9A 3EOTH 4JFPB 1U95B 2A2QT 3L3DA 3TT1H 2RIKA 2UWEF 1DEEA 3CXDL 1HN1A 1F11B 4IDJL 4NNPL 3RPKA 4NQDD 3VXUD 5AAMA 2HWZL 2IG2H 5DRWB 5F89A 3MV9B 3MRKB 3K2MC 2CUMA 5IFAH 1MIMH 3N9GL 4WUKH 1UXSB 1IEBA 1RZJC 3QDGD 3MJ9L 2EH8H 5JOPE 1J88A 1EJ6A 3V4VL 1QBML 4WTWA 3PNWB 1CXEA 2ADFH 2NNAA 2J5LB 4PIRF 2VQUA 5C0BD 3IS1X 4G5ZH 5DQDL 4NCC2 4DVRL 4HWEH 2E7LA 3M07A 4HIEB 2A9MH 3C2SA 3IDMB 4XC1L 1RFDH 4QOKD 1J1PH 2XY1A 4U6YA 5T1KA 4Y5YA 4X9IA 3CH8A 1AXSA 2M8XA 4WTZG 1T03H 3BH8B 1FYTD 1LO3L 2IPTL 1I7UB 5CZVH 3ULUF 2XTJE 5DD6B 5DMIH 5KSBB 5E2WH 2ZNXA 4MAUL 2IH3B 3GMOA 2EEBA 3IRPX 3QWQB 2QR0B 4PRDB 1A1MA 4XNXH 3QIBB 3P11H 2Y06H 4X7DC 5EZLB 2APTA 3D2UA 1HH9B 4NQEE 4PJXB 1IKFH 3IDJB 4HULB 2VYRE 1A7RH 1ONQA 3PL6B 5IR1B 1CVSC 5FDWA 4OJFL 1IGTA 2AJYH 3OGCA 3D87B 3QEHA 4HWNA 2NW2A 4YE4H 4PJIA 2C4FT 3MMEB 2OP4H 3BVNA 3U6RA 4FXLA 4UU9B 5C9JA 4P49A 3QT2A 2OTUB 3LB6D 3BQUA 1K8IA 2HJLB 1N5AA 3HG1D 5D1XA 3L95B 5E8EA 2BNQA 1GPOH 1X3DA 4J2XA 2ESVA 2V2TA 1PVHA 3OHXA 1UB6B 3GDBA 3LY6A 3C5ZB 3LDBB 5TDOA 1A3RL 5E9DB 4ZFOL 1A6ZA 3IFOA 3O6LH 3WLBA 2IBZX 5SWZB 3G9VA 1QVOB 5I9QC 5GS1C 4X4XB 3M1BA 3X14B 4ENEC 4Q0XH 2DYPB 1FFRA 3B9AA 2FIKA 4KI1A 4OZFH 4Z9KB 1AFVH 2J2ZA 3FONA 4BFIB 3VXPB 3EZ8A 2RQ8A 3FB6A 1C5CH 4L9LA 2V2WA 4L4VA 1DN2A 3O45B 5KVFL 2R2EA 4Y0GA 2L0DA 5EUKA 5T1MB 3H9SD 4Y8AA 3TYGL 3OMZA 4TRPL 4YWGL 4JFEB 2ATPB 3N1PC 4HBQA 1A7NL 5DC0A 3WFEH 3E6HA 1OLLA 4NKIH 3DO3A 3FB5B 2LE9A 1I85A 2YD9A 6FABL 4NT6B 4NC2B 1A0QH 4EI6A 3GNML 5GGVH 1F8TL 2H32H 3VG0L 4HZLB 4GKSA 5H2BB 3RWJB 5AZEH 3FO0L 2WUBH 5HYJA 1IGML 2VISB 4NIKB 1P53A 1U8IA 4J8RA 3VH8A 4Y5XB 3QUZA 3MRCB 1KT2B 2YEZA 3SPVB 5HYIA 5IQ9B 4JQIH 2WIMA 3MRHB 3DBXB 5T1LB 4AK1A 4XPTH 1D5ZB 2JIXB 5TDPB 5DMJB 3UPRA 2NXYB 4NO2A 2HVJA 5I74B 3HAEA 3DO7B 5ENWA 3BT2L 4QRRE 5I16A 3DMMD 3TZVB 1MAJA 4ODWB 1BJ1H 4FP8H 4OQTA 1XR8B 4GW5B 4GXVL 3F62A 5EDXA 1HHGB 1NAMA 1KJMB 5IJKC 1MJ8H 3AM8C 4ZOEA 5J1TC 5E8OB 5EO1B 3GHBL 1NGYB 1VACB 4S1SH 1C1EL 4KKLC 1KEMH 2Q8AL 2O61B 3FO1B 4Y4HA 2R56L 2WUCL 3C60A 3W82A 3WFBH 4OV5A 2AJSH 1BX2A 4Z7QE 4Z6AT 2VRAA 4F33A 3G6JA 4S1QL 1EEYB 4P9HL 5DJDB 3PHSA 1Q0YL 1UM4L 4PJ7E 1I8IA 4BZ1H 4N0UB 4RMRA 1XGTB 3ZDZE 2GT9A 3FMGH 4UILH 1P2CA 3TVMA 2FDBP 5JORA 4XVTH 3EJJX 1FL6A 4G9FA 2COQA 4KPHH 1NGPL 2XN9B 4YJZL 8CGTA 1CGTA 3O6FD 1CXFA 3L3DB 4PJAF 3VXSE 1DEEB 3T09A 1UZ6E 3DARA 1YDPA 3SHSA 5F89B 5IP4A 2H2SD 3MGTA 5EU6E 4OLVH 1CICD 1KCVL 1MEXH 5SX5K 4KTEH 4MAYC 3CFKA 1BJMA 3CK0L 3MACL 2YBRA 3RWGA 3SDAD 2DQIL 5F7KC 1BVLA 2WBJA 3V95A 4D9QE 3RY6A 2V5RA 1CDGA 4WI9A 4LHUB 3PG2A 2FBJL 4U6YB 4NFCA 4P5TA 5T1KB 4Y5YB 3B6SA 5CZKA 1JWSB 2IAMD 3TA3A 2H9GA 3ILQC 3KPRD 5E7BA 5TH2A 1A7BA 4LARL 1NCWL 4TPRH 4CJ0A 3MUHL 4MMXC 1EHLL 4X83A 4BQCA 4U6VL 4JPVL 2DWDA 1A6AA 1A1MB 4M48L 3VFGL 5C8JA 3QH3A 3D2UB 3U30B 2FZ3A 2VXUL 5GGQL 1FV1A 3VXMD 5A2LH 1PX3A 2GAZA 3WSQL 4M1CC 1ONQB 1EXUA 5FDWB 1IGTB 4KRNA 3OGCB 4JZNA 2VLKA 3WIIL 4IMLA 4PJIB 1RPQA 4KHTH 1K9TA 4OLYL 1VDGA 3BVNB 4OZHA 2MMXA 4MB3A 5C9JB 1LO2H 3BQUB 3PP4L 3BOVA 1N5AB 5KS9E 4TUOA 5D1XB 2BNRE 1MCFA 5E8EB 2BNQB 3U82B 1DN0A 5BZDA 2ESVB 3PHOA 2V2TB 1K2DA 5L2KA 4X9GA 3VGEA 3OHXB 5FO9A 5TDOB 4APQA 1A6ZB 1TJGL 3IFOB 3WLBB 3K46A 5IGXL 2EDQA 5MEND 4PJ8D 1WBXA 2VDKL 3M1BB 1DZBA 1NGWA 2NY0C 1MHPL 3LHPL 5CJOL 2F54D 2FIKB 4YFEA 2R15A 4XCFH 4MS8C 2HFFB 3SE4A 1UM6H 1PX4A 4U1IA 3RZWA 3FONB 1XR9A 3WD5L 3FB6B 4L9LB 2V2WB 2F53D 2EDHA 3DX9A 4L4VB 2XXCB 5FGCE 3BIKA 2R2EB 4TVPL 1GYAA 5EUKB 1INQA 3IJHB 4A2LA 5BXFA 4ESKA 3NZHH 3MBEA 1R5WB 1DANT 2NR6C 3V8CA 2W9EH 3E6HB 4MXQC 1KB5H 5HGHB 1NBVH 3PHQB 1IGCH 5CBEA 5DFVC 1YA5A 4EI6B 4CDHA 3B3IB 4AEHH 2WWKT 1MCOH 4ODVL 1ZANL 4QLRA 4GKSB 4NGHL 3W0WE 1AO7E 2O26U 1ORSA 1KXTB 3UJTL 5HYJB 4HAFA 1LO5A 4J8RB 4X0KA 5L88L 3EYSH 2IPKA 3VH8B 3MLYL 3QUZB 4JRYA 4LQFH 5HGBA 4OD1H 2YEZB 5FYLL 4KROB 2O5YL 1I1AC 3CZJA 4NP4L 4YBLC 1NEZA 5ANME 1FLRH 2BP3A 4PRNA 4D9LL 4ONFL 2IQAB 4PJFA 4JQVA 3UPRB 4NO2B 1T0MA 1Z3GH 1NBZA 2HVJB 3HAEB 3AAZA 1X4XA 5I16B 4OD3L 3JUZA 1CFTA 4KK9C 5D2LE 2A6JA 3O3AA 4L4TA 1CLCA 3ZL4H 1NAMB 3Q6GL 5IVOA 4TQEL 1KJ3H 4KKNA 5DRNA 4G6AC 2OLDA 4GG6E 1MH5A 3NACH 4HWBH 4D0CB 4PP1D 2Z0BA 3F6LA 4LPVA 4Y4HB 3C60B 4OV5B 5GZOD 1BX2B 4PG2A 5F7WC 1EBAA 4F33B 3G6JB 3X13B 5H37G 4RFNC 5CKAA 3CMOL 4H8WH 3CFEA 2ZCLL 1I8IB 1KEGL 4H88L 2UZIL 3NCFB 2LQRA 4TTDC 1JVKA 5IVNA 3VXNB 1T7VA 3NIDE 2GT9B 2APWA 1KIPA 1P2CB 3BUTA 2X4UA 3TVMB 5JORB 1FL6B 4P3DA 3DRQB 4OGXL 4EXPX 3B2UC 4NQDE 3VXUE 5F6IC 5DEGB 1BZ7A 4XP4H 1MNUH 1W2KT 2QSQA 2FATL 1LD9A 3MCG1 4F9PC 1YDPB 3QDGE 2YD4A 3DXAA 3V79C 1DBMH 3D1MC 5DUMH 4QRTA 2L7JA 2DQUH 4WY7L 1WTLA 3MCKA 3OAUH 4FQ1L 3ULVH 2PW2A 5EIQA 4E5XA 4LSRL 2CJUH 3MO1B 5C0BE 3CFKB 2GEEA 4YHZL 3WIHA 4P23D 4JN2A 2YBRB 3RWGB 1BVLB 1F58H 2WBJB 1JHKL 3BDBA 3ZTJG 4B0MM 2B20A 1A9EA 5KVEL 1HKLL 5BOPA 3MR9A 4XNUL 2Y1VA 3J8F7 1FYTE 4P5TB 3O2VH 3B6SB 5IVXE 3BPOB 5DVNA 4YAQB 5TQ0L 3THML 3VI4E 1JYVA 5F7EH 3TA3B 2H9GB 1ZT7A 5JZ7C 4XC3L 1T7YA 4Q2ZA 4DK3A 2DN7A