5DK0A

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLMCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A01
2OQJB 4E41E 3CVHB 1ACYL 2ARWA 1WC7B 2X4SB 3NABL 1L0QA 1QRNE 2B0SL 1C08B 2C1PA 2DF3A 1D5ZB 2NY3D 5C2BL 2JB5L 3GSNH 2B20A 3ET9F 2FBJL 4WI9A 4Y89A 3RI5K 3UAJD 2QSVA 2RCSH 3DETC 1UEMA 3DO7A 3DMMD 1X4XA 3EO9L 4HKZA 3MV11 5HYQA 2DM7A 2P46B 4G8EB 2HH0L 2G9HB 1JI1A 5F8QC 3KPOA 4N0CC 1OT2A 4KUZL 4NUGL 1YY8B 4MD5A 3K2MC 3CXHK 3UJIH 3IXAA 1S9WA 1J8HA 2VKXA 4NO3B 2BHYA 5C0IA 2FGWL 1XT5A 2CR6A 1PEWA 4O9HL 2BOCA 1YNTA 4G6AD 2O93L 4GAFB 5D6DC 1KCVH 1UM6H 4HHAA 3QDJE 2A9ML 1D7FA 4AIXA 2XZQL 4HGMA 1W0WA 3GMMB 4N68A 5DK0B 3DSFH 4XNXH 1MAKA 1T7VA 5F1IA 1WZ1H 1IC5L 3KJ6H 1I1YB 2K7QA 5HHPB 4WW1B 1O7VA 2COQA 3CVHA 5E8DH 2X4SA 3UCRA 3G9AB 1E4KA 4HIXL 2GKIA 2IPUG 4P99A 2V6HA 4M3JA 5F3HB 3OKEA 1E4WL 3FL7A 1Q9OB 2DL2A 3OR6B 3RWJB 4Y5YA 2DQIL 4OCYH 4GT7A 3SGDI 5FYKE 2YBRB 4M43L 3VXSB 3FQTA 4J6RL 4HULB 4PJHF 4PLJC 2G9HA 2M8XA 2OXHA 4LEXH 1P69B 4ZUTA 3QEUB 4FOMA 4I48A 1RFDH 3HI1B 1FZJA 2CLVB 3U36A 4JQVA 4I4WB 4YHYC 5IKCB 5JR1L 4U1SB 3AVEA 3FFCD 4OLZL 3ES6A 4RX4D 3T0BA 4XVUC 4AZ8A 2ZOKA 2ICWI 3WLWD 4OBRA 4AL8L 1YEKL 4DOHB 2WINB 1FDLL 3FMGL 3BPCB 4L8DA 4KKCD 3O8XB 1EHLH 3QBTB 3S8WA 1B9ZA 4HW6A 4ONFH 3VFWA 4EOWL 3MREB 1E28A 3N1QC 1WISA 2WMPA 1EMTH 4FG6D 1OTSD 4MXVE 4JHWH 4GRWE 1MJUH 4J8RB 5EBWB 3VD5A 3MCLH 4Z7WE 2G60H 1DBML 5FUOL 1SHMA 4IRJC 5EO9B 5HHMD 1RZIA 3KR3H 3NZHH 1Q9OA 4Z7VF 4XPTH 4KZEH 1XGTB 2IF7A 4U1HA 3HNSH 4GBXD 2WLYA 5DQDL 3RZWA 3SDYH 5SV4A 3T3ME 2ZUXA 4N0FB 3MRQB 1EH9A 4CRPA 4L3AA 2PKDA 4LOUD 4OZFA 2CO6B 3PWNB 4MCYA 2XFXB 3HI1A 2OBGA 5IG7A 1JNJA 2W59A 5I66B 1P4LA 2VR9A 1S7QB 2MQ3A 3PWJB 5HVHB 4G8GA 4WWKC 4HUVB 4KJQD 4Z5RA 2WWMC 4NT6A 2A9NL 3IXTA 3IFLH 3MOBH 3CNKA 5B38B 4D9RD 2E9JA 4XMKH 1G9NH 1YUHA 2HYMA 4QRRB 3UJTL 1HH6B 4RGNE 5BRZA 5FHAH 3MBEA 3MREA 2XN9A 4RGOL 4YNYA 3I75A 3V4PL 3VWJA 4LLUA 1QSEE 1MRFH 3MV7B 3H9YA 4J8RA 3T0AA 1FNSL 3C5ZA 3W11C 1XFPA 1UKTA 5DK2A 3BP6A 5C6PB 5JXAH 2MQCA 5D7KE 4Y2DC 3RZCD 1WGOA 4M6OL 4QOKB 4TNWF 5EO9A 2Q8AL 3VXMA 5GZND 4L8SC 5FOBB 1FH5L 3STZB 2VDOL 3D39D 4K8RH 2P47B 3MLXH 2E6QA 1URLA 4PYGA 4AT6B 4Y1AB 4HEME 5ICXA 3C6LA 5EH1A 1BZ7A 5D7LA 2L4OA 1UQSB 4EI5A 3F7VB 3WLBB 1ODAA 2BVOA 4M93C 3CFCH 5BVJA 4M03A 3MRRA 3U0TB 4X6BB 1VGEL 3QQ9C 1MIEL 3VXNA 3KPLB 3U83A 5KAQG 3BQUC 1YYMH 1IM9B 4GFTB 4ODXB 4QKXB 5GGUB 1Q8MA 4UAOB 2VZSA 4LHUG 4MVBC 4MJ5A 4UI2A 2CGRL 3F58L 4XCFL 1ZLWK 1MCCA 5TDOB 4EEEA 5KSBA 1U93B 5DS8B 3CVHH 4QTHA 1A6VH 5CJOH 3MGTB 3OX8A 4RA0C 3FZUC 1RZKC 3QIBD 2B0SH 2B5IB 3VFNB 4L3EB 4YDIH 2JB5H 5K9KB 2FIKA 2H2SC 1J1PL 4DEPC 5L0QC 3LY6A 12E8H 4PP1D 5C8JB 5FA3A 4NNYA 1RMFH 2DI8A 1CGTA 3QXVA 2FHBA 3WLBA 4LLWA 1MLBA 5DJXA 4JFYA 2ATPA 4KUZH 4JM4L 4FXLA 5T3ZE 4X7TB 1ZVYA 4DKDC 2EYRB 1IVLA 4ODXA 1II4E 2ZCHL 4O5LL 1T0NB 1KCUL 4O9HH 2DI9A 4DZ8B 4QT5A 5T3XL 5SWZE 5IMLB 3ARDC 4P57A 3AMKA 1LDSA 4ZS6D 4Z77B 2A9MH 3BP4A 1K3IA 2XZQH 5BCAA 3HE6B 5H2BB 2NTSP 4HFWB 5HDLA 5I8OH 1TVBA 1RZJC 2P1YA 3I6KB 2DJ4A 1EIBA 2UZIH 1FZMA 1RK1B 2QL1A 5F7KC 2ZUQC 3QZWG 1CXIA 2BSSB 5DD1L 1CXFA 1OARL 5B39G 3BEWB 5I30H 3HN3A 3V52H 4OZFH 1JHLL 3WO4B 1ZGLP 2F9BT 3QO1A 4IRSA 2B1HL 3AU1B 4LGPB 3QXAB 3O45A 3LRHA 3DHJA 3TNNA 3FT3B 1FG2B 5HHVL 1XF5A 3EYVB 3PGCB 5IK3B 5JR1H 3MRHA 5D4QA 2IFFL 5F9JB 1T2XA 1I8IA 5C0CE 1MCDA 4TQEL 1Q9KA 1YEKH 5ALCL 5BJTB 4BH7A 4RRPA 3FMGH 4JM2D 2YD8A 1C5DA 2AQ1A 4Y19D 5DXWA 4ZUUB 2DQCL 2R39A 4NO0D 5JPNB 3QUZA 4Y16D 3RWEA 2OCFD 1FV1B 1FL3A 1EZVX 5GS0D 4OIBA 5E00A 1DBMH 2WBWB 4QHMB 5FUOH 3OAZK 4JDTL 1WZMA 1TENA 2ADFH 1R3JB 4JFEB 4FTVD 3EOBA 1D6EA 5HYSB 1MHCB 4NQVB 4M6AA 5CBEA 5C08A 5DQDH 2FATH 3VU2A 1EGJL 3N9GL 3PQYB 3ZDYF 5D1XD 1BVKB 1IZJA 1Z3GH 3T2QA 1FYTD 3RPKA 1BIIB 1X44A 2I60L 1YDPA 1LO4L 1M4KA 4X4ZA 4PJBA 5I1DB 1GH7A 4HH9A 3OV6A 4HWEL 3AXLB 1UA6L 5E1AA 3H3KA 1OB1A 3VD3A 5IFJA 1KXVC 4E41B 2WNGA 2JJSC 2QTEA 3PDGA 2AK4A 1QRNB 1IC4L 3WKML 3AY4A 4W68A 2NXZD 4M61B 2W38A 5LAXB 1VEMA 3SJVA 3UJTH 1IARB 1I3UA 4KKLC 4RAHA 4PJXF 2G5BA 3V4PH 2R9HD 1QA9B 4TTDD 5FM5O 2PN5A 1ZKAA 1HHGB 1FNSH 5H94B 4XAKE 3O4LA 2F74A 3C9NB 4K07A 3VMNA 4H88L 1VKXA 4M6OH 1VEOA 4PLNC 3P77B 2KH2B 4QNPF 2VDOH 4HXBH 4A2MA 3OKLB 4NQVA 5IHZB 2X4TB 5I1JL 4MXWL 1T7YA 2PYEA 2OTWB 3ROLA 4GKNB 3B43A 3DIFB 4GS7B 1X4ZA 3B5TA 3TA3D 1K9TA 3QULB 3QDJB 1BZQK 1Z0NA 3L3DA 4ZO6A 4OZIA 3MYZA 4E41A 2OR9L 1N26A 4IIQA 3W39A 1J05B 4WI4A 1D5BA 3MUGA 1J0JA 5KVGL 2NY2D 3GSRB 4CJ1A 1SMOA 3ULUD 5C09A 2BSED 5F6IB 1WCBA 1IGYB 5SV3A 4NBXB 5FYKL 1AD9A 5F7FA 1KIQB 1CTNA 2JF1A 1CIDA 1MI5A 4LSDA 4I9WD 4Q58C 4MQTB 3MBXL 1U42A 5B8CB 3MLRH 5FOJA 4YBLC 2KQMA 3GMLB 1BGXL 4JFXA 4U1JB 4UINL 1T03L 3A6CL 3WUWG 2BNRD 1R0AL 2R8SL 4ZUVA 3OKLA 4MXQD 2Z35B 1ETZB 5IOPB 3QDGE 5FAAA 2ZOLB 4POUB 5J1SC 4NQDB 2XKNB 3X13B 2HKFH 1YEIL 3QFDB 1UH4A 4QRUA 2ED7A 1JF1A 3QJFB 5C0FB 4JM4H 2BCKA 4X6DF 1EAJA 3QUYD 3OXRB 5AD0A 1I7UB 2H45A 5I8KL 4GRWB 4DVRL 4WVRA 1WJ3A 3DV6A 4Z7WB 4MSWA 3STLB 1JGUH 1CK0H 1GZPA 3VXOA 5T3XH 4RAVB 2Z9TA 4MCZA 4H25B 1DBJH 3MGOA 2W65B 2EE2A 4EI6B 5I1AA 3FONA 3TJEL 2VABA 2J8UA 2BY3A 4KI5D 3BGFB 4GQ9L 1NC4A 5EFIB 5B22A 5DQJB 1NCWL 1JYVA 3QEGL 1KF9B 1QKZL 3WBDA 1OARH 2OP4H 2HFGH 4JDZA 3BPLB 4LLQA 1LHZA 1BBJB 4PJIA 4AIOA 5J9PA 3VWKD 1I7ZA 3QRFM 2EECA 3VH8B 4BQBA 3TC9A 1PQZA 1JHLH 3TBWB 3FT2B 1ZT1A 2GJ6E 4OFKA 1YEJL 4TUOA 1OAYH 4IHOA 4KK5D 1U2CA 1N2RB 2AJUL 3LVEA 4D94A 5CBAA 5MHSD 5HHVH 3IRPX 4QRTB 1QSEB 1JPTL 3N06B 2CUMA 5GRJL 5D96C 5DUBA 3FJTA 4UIMB 2DWEA 2H2PD 5I74B 2WSKA 2AJYH 1JUFB 1X7QA 4KFZC 1U8MB 5CEXB 1SVCP 1KGCE 5ALCH 3VFTA 5E8OB 3VG9B 2HRLA 5E2TL 2AJ3A 1HSAA 4XBGB 5GS2D 5JOPE 5JW4N 3S36X 3U48A 4FFZL 5FUCC 4FQPA 1CBVH 2ZJSH 4YGVB 4RFOL 2Q8BL 1TZIB 4NZTL 1GGIL 1EHXA 5KVFL 4HIEB 4BH8B 3J8F7 3RAJH 6CGTA 4JCMA 1B0RA 3T8XB 1AP2A 2W07A 4HS6B 4CN4A 4QYOB 4U6YA 4AG4H 2DBJA 5IQ7L 3B2UC 4PB9L 1ZVSA 2FLBT 3I3BA 5A2JH 5LJYH 2LVEA 2Z31D 1A2YA 4J4PA 5L6YH 3CSYA 1UJ3C 3FQRB 2MSPA 4QF1A 4LSTL 3Q2CA 1Q9LA 1UYWL 4MZ3A 4MA7L 3N9GH 1N0LA 1S7UB 5GPRA 1Z5LB 4PRBA 2I60H 2Y06L 3H0TB 3K74B 3LPFA 1LO4H 4FQHA 4JZOB 4PP1C 4Z18A 1J1XL 3QFJE 1M71A 2BC4B 4EIZC 1UB5B 4XP9L 1UA6H 3B8SA 4JY5H 2B1AL 4PGEA 1IT9L 2DAVA 4ODBD 3RX8A 3WKMH 1IC4H 4LFHG 1X6NA 1DVFB 5C9JA 5I1KL 5ID0B 1T89C 3RY6A 5EZOH 1IGIL 4K7FB 2FGZA 1CD1A 1JYXA 3SGJA 1S8DB 3R0MA 1WAAF 3UTTD 3VGBA 1MCEA 3KPRD 4LLMA 4PJ7F 4PUBL 4X7CC 5KVDH 3VD9A 4YX2L 3NZ8B 1CFBA 1M7XA 3MA9L 1ZSDA 4HIEA 4Q9CA 2ED9A 3RVVD 1F00I 4HJJL 4K3HA 3T8XA 4XGZB 3C60D 4H88H 3SE4C 5T3ZL 1INEL 1CGWA 4JQXC 1CI5A 4EN3C 2IAND 2UV3A 4G9FE 3TO4B 3WIFA 5K9JH 1G84A 3IDJB 3GHBL 2OI9C 4D0BA 4N8PA 4X80L 1DE4A 4MXWH 3OXSA 2EE9A 4KZDL 2VLRE 4OM0L 5LGHH 4NM4L 5SWZB 1BQSA 4D3CL 4HWUA 3D1MC 4R2GD 2YPLE 3IKCA 4KMTL 3OKNB 5D7SL 5K9OB 3MCKB 1G7HB 2OR9H 5I9QB 4PRHA 3L3HB 5J06A 1JGDA 3MROB 3VXQB 1HSBA 5KVGH 1I3GL 5GS1B 4M5ZL 2HVKA 4LDLB 3ZTJG 3MYJA 1ZLVK 3DX7A 5SWSE 3WFEL 2XTJE 5FYKH 3C09C 3DVFA 1YEGL 3ALWA 3IDYC 5E99L 1KPUB 1OD9A 1GZQA 3ESUF 5DJ2B 1H3WM 5DEGA 3TN0A 3C6SB 5DA4A 5HJ3B 3PV7A 4OGAD 1B0WA 4UINH 4YAQB 1T03H 2R8SH 1NAMA 3WSQL 3PV6B 3CH1B 5C0CB 3X12A 1DQJA 5KSAA 3P4OA 3W5MA 1HN1A 1K4DA 2ZSWA 2C5DC 3P4NB 3M07A 2I9TA 1FE8L 3E8UL 3D18B 1YEIH 4HQQL 2GW5A 3KLAB 4I1NB 5JDJA 1AO7B 2XOTA 4NKOA 5EN2B 2I07B 4DFIA 2YS4A 4FQXC 5I8KH 4DVRH 2AGJH 5JOFA 1ZT4B 2D4FA 3MROA 3LZFL 1CDJA 4Y5VB 5EO0A 3IF1A 1OP5K 2XWTA 4IMKC 4WV1B 2BMKB 1GRWA 4PTUB 3I6LD 4TTGA 1UXSB 1TXKA 1NGYB 5FYJD 2GYSA 2Y7QA 4PJ9D 2VUYA 1NCWH 4JQIL 3BN3B 1QFUH 4YHNA 3QEGH 4H26A 2MKWA 1QKZH 2HAZA 1XH3A 1W8NA 4YHKL 4GJTB 1HHKB 1XCTA 3TNMA 1TMCB 3CH1A 3T65A 3VXRD 3LQAL 3BPOB 3SDAD 2IPKB 2QQNH 4PRPD 2H1PL 3EJYD 4LDOB 2DMKA 1CLOL 1C1EL 1YEJH 3C2SA 2FR4A 3IDXH 5J12C 4C55A 3KXFD 4LPWA 4NUJB 5E8PA 2AJUH 4Y4HD 2H32B 4OF3A 1QR4A 4GAJL 1FNAA 3MFFB 1JPTH 1UFUA 5GRJH 3ARBB 3WIIL 2WANA 3TA3C 2DOCA 5DLML 4P5MA 3TJHD 4L3CB 1L4IA 2ITCA 4NWUL 3DPBA 5E2TH 1WQVT 3B9KB 5E2WL 4OLUL 4MA8L 4JFFB 3GSQB 5JDSB 1NGYA 1MY7A 4GMSH 4ZFOA 1G7MA 4YJZL 2EYSA 4FFZH 1YN7A 3FFDB 3REVB 1A7BA 2Y36L 4L8BB 4RFOH 5DWUL 4NZTH 1GGIH 2CDEA 1TTFA 2VDPL 3K3QA 4P5TB 2LVCA 4F7MA 1I9IH 5IWLA 2V2TA 5L2KE 3EGSA 4KGJA 1HILA 2VDQL 2C4XA 1FNEB 2QSCL 3QEQD 3F7YA 5IQ7H 4LASH 3ARFD 1HHKA 4PB9H 2RQ8A 2NXYB 5JLZA 1I1RA 4EUPG 1JFQH 3TWCL 3G5ZA 2VDRL 2HKHL 2IPKA 5GRZA 4HUWB 2FX7L 4UBDC 3T08A 3HPJB 1YEDB 1UM4L 2WWKO 3L7FB 5ALBH 2YA2A 2Y06H 3PDOB 4WI5A 5FDWB 5HGAB 3CD4A 4JO3L 4YIQB 3B9VA 5F72S 2PO6A 2AV1B 1J1XH 3IJYA 3NIFF 4P48A 4X6CA 4JFDD 4EDXB 1GVIA 5F88A 4X5WB 5CSBA 3WEXB 3PP4L 2B1AH 1UM5L 3W5NA 4TSBL 4QRSB 2DBLL 3QUYC 2KL6A 2YD4A 1ZGLB 2IQ9L 3N0PB 4KPHL 2VZVA 4JGMA 4Z6AT 4J12A 1INDH 1IGIH 3KPPB 3LB6D 3SKUD 3QDGB 2PUQT 1A1OB 5E2JA 5HHNA 4PUBH 4P4KB 2HT4D 4YX2H 1TQBC 2J1KA 3MA9H 3PWPD 3P3YA 1I4FB 3P4MB 5L2JA 5L9DL 5L8JB 4JB9L 1INEH 3TBVB 5LXGH 1EEYA 1VACA 4NN5B 5KN5A 1NAMH 5I8EA 3X11B 2ARJQ 1MQKL 2E9WA 3GHBH 3O6FD 4JM2F 1AI1H 4X80H 4RGMC 3AGVA 3SY0A 3HC3H 4KZDH 4OM0H 1TCMA 3F7PC 3V0VB 2OR8A 3QCVH 4NM4H 2AEQL 2XXCB 3RWGB 2HJLB 1T21A 2AV1A 3QWQB 2Q3ZA 4O51A 4MD0B 3BPNC 1WBXA 2YN5A 4EDXA 1IC7L 4KMTH 4ODSL 1MIML 5D7SH 3MLYL 1EBPA 2H3NA 1G7PA 3QUXA 5A16B 1NFDF 1DBKH 1I3GH 2C3WA 4M5ZH 2P4AB 4WGVB 3Q3GB 2MPAL 2NY5H 3U9UB 4QGYA 3T77B 1KIPB 1JPFA 2Y6SD 3Q5TA 2H2PC 3WFEH 1HK6A 1PDKA 2A6DA 3GJEA 2DM2A 3V4UL 1DN0A 1BM3L 3BWAB 1FGVL 1A3LH 4WFEE 3RWIB 2GJ6B 2YC1B 1OF2B 3WS6A 1W0YT 2Q87A 3U6RA 5TGBB 1K5NA 1J88A 4RNRA 5BQ7B 2Y23A 4XHQA 4BFIB 4G42B 4XNMB 3LKSB 3TH2T 5FXCH 3V8CA 3WSQH 4F9PA 1KB9J 1CICA 3BZ4B 2ADGA 3RWDB 1S7SB 1Y6KR 3E8UH 1H5BB 2WIMA 3ZDXF 4HQQH 4E5XB 3FB8A 1A1NB 1F4XH 2Q76B 3IAPA 1WBYA 4GLRH 4HWZA 5D71L 3AC0A 3SDXE 1PYWB 3ARWA 3ECBB 1OGAD 3LZFH 2HWZL 4LLDA 4YDJA 4FQ2H 3HKFA 1YY9D 3DYMA 1EBAA 4RAUB 3HI6L 3MOAL 4AJ0A 3MLZL 1U8NB 4JREC 1MFCL 3L5WA 1OQXA 2BP3A 4P2QA 1Q94B 2ZG3A 4NP4H 3ZDYE 3TZVD 5GGQL 2LU7A 3PHOA 4LNRA 4ENEC 3AB0C 4KC3B 3JZ7A 4LVOB 4TVPE 2XYCA 1A14L 5L7XH 2VAJA 3EZ8A 3QXDA 3O11A 1SJVA 4NSKA 1NBYB 3P30L 3QFJB 3ULUF 4YHKH 3LKSA 2FHFA 5IB1A 5GRYA 1JNLL 5JHDD 2Z91A 3LQAH 3N1PC 2RAMA 3MJ9L 3D0VB 4YZFE 1CLOH 1HQ4B 3MRNB 4NQSB 4E5XA 2I9LB 4TUKL 1XF3B 4IBLT 5GZOD 5IMKA 2D2OA 1A3RL 1DQTA 1PYWA 4XNQB 1N59A 3W0WA 5DLMH 1JZ2A 1LE5B 4R2GC 4LHUA 4G9FB 3V95A 2ZUSA 1Q94A 3U0PB 4YHPB 1HXYA 5C9KA 1N5AB 3MRDA 4XWGL 1BJ1J 3MRGB 4NDMA 1IKNC 1BOGA 4LHJB 1BHGA 3KYKL 1UCTA 2VLRB 2ZPKH 5C0RL 1G6VK 3Q0HA 1CT8A 2IAMB 5DWUH 1BQHG 1BZ9B 5EC1B 2K7PA 1G1YA 5ICYA 5FO7B 1NBYA 3OGOE 2Q86A 1QSFD 1MVUA 4GKSA 2QSCH 3ILPA 1CGXA 2JJVA 1X9QA 2YPLB 3NBNA 5HVWA 2G75B 1MCSA 5F93C 5JQ6H 1I1AB 3RL1A 2VDRH 4OAWA 3F7RA 4JEGB 2EXYD 4PY8J 4OGAC 5DGQA 2FX7H 3LDBC 4F33A 1EDQA 1HINL 1UM4H 4U1NB 3BE1L 1QYGL 1P7HL 3ARSA 4IOIA 4WIQA 3ZKXC 4KRMB 4KI5F 1ADQL 3AROA 3QPXH 3EYQC 4QHLA 4AENB 5DQ9B 2VDKL 3GI9L 4QXGL 1YQ2A 3KLSA 1UM5H 4HD9A 4TSBH 2FEEL 4FFYH 3WXVL 2Z92B 3JBG7 1QQDA 2X10A 3DX8B 2IQ9H 4KPHH 1OLLA 3M8OH 4G9DA 2AJVH 3U0PA 1R3HA 1FO0L 1N5AA 1OCWL 3IFNL 1FO0B 3S3SA 2NTFA 5IBUG 5E6IB 1ZS8A 3BP5B 1LK2A 1MCKA 1MCIA 1VFBB 5CJQL 4G6ML 3MRBA 4M1CD 4NHCH 3QZWA 3TO2B 2IJ0C 3O6ML 4PJCA 4M7LL 4RBPH 4JB9H 3IFOB 3RGVB 5DSCA 3ZKNC 5DJ6B 1LE9A 3VDBA 1A7PL 5B39A 1ZLSL 3BN9C 5D7IF 1MQKH 3ZDZF 4PJ9C 5ADPL 3WDHA 3LS5H 5LCVL 4XXCC 1NDMB 4N8CL 3VRIB 3VXSD 4LPTA 1V05A 3NCYS 4PJGF 5DRNA 2AEQH 5EB9A 5SWSA 1IL1B 4PJHA 3H42L 3S5LG 1T2QL 3GSWA 2X4RB 1T4KB 3VI3E 1IC7H 3BJLA 1MIMH 4JPKH 3MLYH 5LGJB 3CDGB 2R1WB 1B2WL 3O8XD 3S35L 1F5WA 1DLHA 1PSKL 3OAUL 5E94B 5ENWB 3ULSB 1BX2A 3I02B 5EU6D 4JZJA 5I1HL 3IS0X 3V4UH 1JIBA 1BM3H 3TVMC 4F15C 4Z7OF 1U8OB 5TQ0L 1AJ7L 1TQCC 1FGVH 5FGRA 3CDFA 2WBJA 4GUPA 5MI0B 2QKIA 4JN2B 2C3VB 5BZDB 1CXEA 1MJJB 2H26A 1H3VA 5GRUL 3O9WA 4Z7VA 4OCRH 4I0PA 1W0VB 3ARFC 1KJ2L 4FP8L 4HIIB 1QO3A 5T33H 4F80A 5A2LH 1NGZB 5CSGA 2D31A 3PABB 5GGSY 4PS4L 5C07A 1RJZA 3WJJA 4ZSOE 3FO1B 3HLAB 3WO3B 1S7XB 3NFPB 3TCXA 3FQXB 1BEYL 3MOQA 3QNZA 3BHBA 1AKJB 2HWZH 3QUKB 2IPTL 5L2KB 3M17A 3O41A 3RWCA 1B4RA 5CFHA 3MLZH 4QRRD 2UVEA 2BJML 1MFCH 3KLDA 5BV7L 1MAJA 3ZKMD 4U2YA 3QIUA 5ENWA 3ULSA 1DUZB 2LV4A 5DUPH 5GGVY 1I3RB 3KWWA 2QV2A 4R3SB 3QQ4A 2DQEL 3MV7D 5GGQH 5FB8B 1GOHA 2VXSL 5DJCA 2WV3A 5IW1B 1ZLUH 2MCG1 1T0MB 4OLYL 1A14H 2ED8A 2MOVA 4QOKD 1SJHA 4OD2A 3SPVA 3P30H 5DRZB 1GC1C 1KT2A 2YD7A 1G7LA 4XCYB 3CC5A 5E5RB 3MJ8A 2MHAA 4D8PB 1JNLH 3QO0B 4Y1AD 2EH7L 2V2XB 1T04B 5IBTL 3RUGF 2V2WA 3U2SB 4ZFZA 2GITA 5K9QG 3BH9B 1KJ2A 4DKEL 1TTGA 1L7TH 3L6FA 5E5MA 5CAYB 4TUKH 3DUUA 1BJ1H 1A3RH 4CADB 4NZJA 1IM9D 5CGMA 3T0EB 4BQ6A 2ZCLL 4X0KA 1KPVB 4Y5XC 4AM0A 3QUKA 5DJ8A 3D2UB 3IETB 1KSRA 2X4QB 1OP3K 2OMBA 3O3EB 4BFGA 2FNBA 3ZL4L 3LKPA 4LSQL 4CNIB 3O4OC 4OZ4B 1NLDL 4XWGH 3TYGL 2EDBA 3KYKH 5C0RH 4YHYB 4AIZA 4KKAD 2V7NA 43C9A 2OSLB 1IM3B 2UWEF 4HUUB 2BNQA 2E7LC 3QWRA 5T1KA 4L3ED 1FL6A 5LWYH 4OKVB 3RL2A 2FZ3A 3IU3B 4JY6A 1CD8A 1U8LB 1KIUA 3BKML 3VFPB 2RR3A 4JRWA 4WNQB 3ILQD 2XZAH 5HHOA 2RB8A 3DTXA 5SX5H 1RUQH 4GRLA 3BE1H 1QYGH 2APFA 3BH9A 3UEZA 5HXMA 4MZ2A 5FGCE 2P5EE 1ADQH 1AR1C 1G7JB 4JAMA 4UT9L 4CVZB 4XBEL 7FABH 3BIBX 3K4AA 8FABA 4U49A 3BW9A 2M1KA 3GI9H 4QXGH 5BS0E 5INDB 2AJXL 5FO9B 3CU7A 1KJMA 4XMLL 1SJEB 3TBTB 3MV8E 3WXVH 4OLEA 2GTZB 4AYFA 3S34L 3WL9A 4CNIA 3HE6D 1OCWH 3F5WB 3IFNH 4AEIL 2CKNA 4OGYL 3LN4B 1G0YR 3PE9A 3UTSE 3FCTA 4WWKB 4XI5C 1LILA 2FWOA 1RZGA 3VFUB 5CJQH 4C59B 5EU3B 3JSSA 2Y9RT 5FUZH 2PYFA 5DMKB 4M7LH 3TZVC 2BRRH 4N8VA 3EYOB 1A7PH 2EDNA 2IH3B 3DNKA 1ZLSH 3SDXB 5ADPH 2L7JA 3H7LA 4UIKL 2VLMD 4X9GA 5LCVH 2P24B 3VFPA 3RKPA 4OIIL 1IMHC 4KRPD 5E03A 5AZ2H 3SQOL 4JRXB 4XCCH 5A1AA 1X5HA 2C1OA 5ESVB 1KEML 4NQCA 2RHEA 5HPMA 1DSFL 4K7PY 3H42H 4IRJA 3MV9B 5FO8A 4MDIB 3HMXL 4UMGA 4L8SB 5INDA 1E27A 2YK1L 2DQJH 2AV7B 3VRLF 1MUJB 4PRNA 3TBTA 1R5WB 2A6JA 1YEEL 4ZUWB 1BP3B 5FUCE 1B2WH 1V7NL 2X4UB 3GB7B 3S35H 3IDGA 2ADJA 4R97C 3B3IA 1UZ6F 1YPZE 3HMWH 3OAUH 2XNAA 3DVGA 2PTTB 4M93B 4O02L 3H9HB 1RIHH 4HJGA 4KRLB 5TQ0H 1AJ7H 4ZFFA 4LCIH 1EJOL 3BQUB 1JHTA 1HH9B 1CDGA 1ES0A 3F65A 5DVLA 4MDJA 5E6ZA 4DN3L 4JFED 4QO1A 3UMTA 1ZHKB 4ZAKC 3KYMA 5GGTA 2GHWB 2HFEA 2XIDA 2FECI 2X09A 2YPKB 3VW3L 1EPFA 5J57B 2GJJA 5GRUH 4NGHH 2OR7A 4O2FB 2R69H 3PQYD 2YPVL 1XZ0A 4HV8A 1KJ2H 4FP8H 4R26L 5ESVA 2DQTH 4XP1L 3PWLB 1RZKL 3UTZA 3CIQA 2YWZA 4Y2DA 1CFVL 2ENYA 4ORZC 4PS4H 3VCLB 2Q7YB 4X98B 5AG9A 3TBYB 1RZ8A 2EYTB 4LCUA 1BEYH 4DEPB 1IGJB 2F15A 1QRND 2FX9L 3DRTB 2VDLL 3C5JB 1W8OA 5L0QB 1K6QL 1NBZB 2FJGB 1O7SA 1FFPB 1P4IL 4QHUB 5IM7B 4U1GC 1NFIA 1KJVA 5BV7H 5HI4C 2Y5TA 3GO1H 4LCYA 2EKJA 3AREC 1KB5L 2DQEH 2EDTA 1CCZA 1GAFL 2F53A 2OXGA 3H3PH 5HGHA 4PJXA 3TYFA 2J7LA 1MH5B 2D7TL 4OLYH 3NIFE 3VJ6B 3IDNB 4WHTA 1F42A 3ARDB 2J88H 4KUCF 3SKMA 2A74A 3RVUC 1LEGB 1TVDA 4M1CC 3IJSA 1WF5A 2EH7H 2XQBL 4U1KB 3OJDA 1K4CB 3VFSA 1RZJL 4KHTL 5DJZB 3MO1A 1KN2H 3QDJD 1UWEH 3QCUL 4DKEH 4JFQB 2VC2L 5IW6A 5GJTL 2A83B 1HHHA 1F58L 1WTGT 2Q7YA 4XTRC 4X98A 2DRUA 3LEXA 1RZ7H 1YZZA 1KTDB 2ZCLH 2AXFA 3C87A 3HZVB 1OAKL 3DBXB 4WHCA 2BOBB 3MJ7B 3M45A 4QRPA 2NW3A 3RNQB 4WI2A 3MRMB 4PJ5E 5B3JE 4DGYL 4LSQH 1IILE 1O5DT 2VLLB 4FRWA 4FZEH 5FYKD 3TYGH 5GSVB 2JJTA 1XGPB 3S3PA 1ZHNB 1KB5A 2APTA 4LKCB 4J3XA 3D69A 2W60B 4K9EC 4XP6H 4Z7NF 1MH5A 5DT1L 2M2DA 1RJYB 2APVA 3QIWC 4X4XB 4LPCA 1NGQH 3D5OF 3SE8L 1X6LA 4LIQH 4M7ZC 3VFVA 1NFDE 2Y1VA 2W9LA 3IFPA 2R23A 3BKMH 4BZ2H 4R7NA 2X7LB 3HE7A 4NQDD 4G8IB 4PJFF 2V5TA 4UQ2B 1JWUB 3QP3A 4TYUA 3AM8C 1B6DA 1CG9B 1J12A 5I0DA 2F8VA 4UT9H 5D1QC 4XBEH 1AGDB 5JNYB 4DK3A 5D9SA 1TETL 3QHZL 1IAII 4LLYB 3UO1L 2AJXH 4X6DA 4ZNEA 3ARGC 3HZVA 4XMLH 5F7LB 4MJIE 2BOBA 3MJ7A 4LAJH 1H8SA 4GQPH 3R06B 1BIHA 1QACA 4F8QA 3FB6B 4W81A 3MODL 4OQTL 3S34H 1JWMA 2FO4A 3K7UA 4OD1L 2F5BL 5HHXL 4JZNB 4XHJC 3DX9A 3W82A 1A4KA 5DEFA 2G2RB 4NZUH 3ARYA 5DMIL 2I24N 1P1ZB 2GSIB 4H1LB 4MB4A 2R56L 4LSVH 5EZJB 1LNUB 1S7VB 3BZDA 3V6OC 1J0YA 4PV9A 1DQQA 4GRMB 5J7CC 4ZSOB 5GGTH 1KPRB 1NMAL 2AXGA 4QHKJ 3CX5J 3QHTC 1UADC 4UIKH 4ZXBA 3QWOB 2V5YA 2HMID 5DFWH 3ZHDA 1YNLL 5HY9A 4UQ2A 4OIIH 2XV6B 4EVNB 1A5FL 3FRPG 3SQOH 4NC2B 4AEEA 2X70B 4PJDE 2OJZL 5GRWA 4FXGB 3W9DB 3G6JF 1DSFH 1QSED 1F8TH 4HX1B 4XCNB 5IB3A 5C0BB 5DHVA 1T83C 4PG2C 4K3DH 5TFSL 1ZA6B 3SGKA 4NNXA 2E7MA 2ITDB 5D7KD 5DJAB 4I5BA 1YEEH 1OSPL 2AEIT 1V7NH 3S7GA 4DQOL 4ZG1A 4GOSA 4NCC1 1JWSA 2F5AL 1JI2A 4PY7B 4OQTA 3DMMA 2WZPD 3UYPA 3NIGF 5I0ZA 5EO1B 4MX7B 5T1LB 3RJDA 1FVCB 1EJOH 4HIHA 35C8L 1OLZA 2A6IA 3MZTA 1S7VA 2GK0B 2FEDD 4DN3H 1U3HC 3D9AL 5K59E 4MYWB 4ZYKA 4EUPA 3G5VA 1MCOL 3MRIB 3EBAA 5FA4B 4BUHA 2YPVH 4YDKL 3FT4B 3U0WL 3KJ4C 1MJ7L 4H8WH 4J7RA 3QG7L 5EIIB 4R26H 1KFAL 5C3TA 3CXHJ 4MB5A 4XP1H 1VPOL 1CFVH 4YBLB 4FXKA 1YQVL 1IEBA 3GIVB 1QOKA 2SEBB 5D7JC 4LKXB 2VLJE 4KK6D 1S5IH 4UNVA 3WHXB 2FX9H 2IADB 3R4DA 1Y0LA 2VO5A 4XPGL 3ZTJH 1DVFD 5TJWK 1MNUL 5D1ZC 2VR4A 43CAB 2WBKA 3FOLA 1N6UA 4GLRI 4IMLB 2XQYG 2YSSB 5DO2D 3VRJA 4ERSL 5I8CA 5A40E 3GMOA 4MAYC 1INQA 4KK8C 3MRFB 4OLWL 1KB5H 4O2EA 4YHML 1GAFH 5CD5D 3PF2A 1QBAA 1N8ZB 2DLHA 1FGNH 1WAAA 4HSQA 1JN6B 3L3GA 4PJ7A 4JPIA 4R8WL 5FGCB 5IB5B 2P5EB 4GG6E 2VAAB 4JVWA 4X7SL 1BFVL 3TO4D 5T3ZD 4PG9A 5CKGA 3FFCA 3RFZC 4RX4A 1D5MB 1FZKA 4PJAE 1DBBH 1D6VL 2B4CC 4TUJA 5F44A 5BS0B 5IJVB 3KPNB 4EIGB 2ERJC 2J4WL 4G43A 1JF6A 1AY1L 3MV8B 3LMJL 5DDHA 5IMMA 1I1FB 1JPSL 1RZJH 4KHTH 5SWZD 5HYIA 5FFLA 3GBNH 2Z4QA 2R1YA 2AS5M 4Q7DA 2IWGA 1F90L 1S9YA 2VC2H 4JO2L 5HVGB 5GJTH 5MHSE 2Z8VC 1F58H 1CFTA 4KRPC 1SJXA 4NKMB 2CDGA 3P9LA 3UTSB 2CDFA 3QRGH 1AXTH 2G5RA 3MNVB 3HC0A 1ND0A 3G6AA 5CJXA 1HCFX 2F54B 2CD0A 5C0ND 1AXSB 1UKSA 4NM8L 4GBXA 1EAPA 3MRLA 2ESVA 3ZLQC 1CGUA 3FOMB 3HZMB 5D96B 1S78D 5DT1H 4OFVA 4PGDA 1AIFB 3GGWB 3OKOB 2VAAA 4NO2B 1MFNA 3EW3B 5ESQA 4U1MB 1KULA 2Q3AA 4HS3A 4WJ5B 4UV7L 3P73A 4JPWL 5C0CD 4WUUE 3L7EA 5TE4L 2VQUA 4Y2OA 1AFVL 5CINH 5EU7C 3IS1X 4GW4B 4HBCL 4ESKA 1U8KA 1KENH 2V5MA 2DLFL 1AO7D 4KDTC 4PJ8C 3V5DA 1ZA3B 2BY1A 2VZUA 5TH2A 3RX7A 1YPZB 4Z7OE 3TIDB 3VMPA 5DHVH 1F3JB 1SBBA 1TETH 3DYPA 2V5SA 3UO1H 4YHIB 1UJ3B 3RZCA 3EDEA 4DUVA 2KBGA 3ZKQD 2R2HB 3SCMA 4GKZB 1A9BB 4QCIA 4KAQL 4GMTL 3D39A 3LPWA 3MODH 4OQTH 5ANME 1CE6A 4OD1H 3UTTE 1YEHL 5I71C 4GXVL 3ABZA 3KPRE 5KG9B 4RDQF 4LQFL 4H1LH 5DD5L 2XZCL 4F7CB 2NX5E 1DEEA 2F19L 2R56H 3OR7B 3D87B 3SE3A 3I85A 1V5JA 2OMNA 1LO3L 2EICA 3L3OB 2AW2A 2IANE 1RU9L 4EUPH 4MQXD 2IPUK 3PL6A 1NMAH 2XWJB 1PLGH 3HUJE 5ACZB 4OLXH 3SEPA 1YNLH 1T22B 3FO2B 2EIZA 2YRZA 3T4YB 3DROA 4G7YL 4JG1L 4RFEB 4Y88A 4BSWB 1OTUD 1YC7A 3CVIL 2OJZH 2AKRB 4K2UH 4AMKL 4S10A 3RIAK 5I1LB 1FFNB 3BMVA 1Z2KA 2H8PB 3ARBD 4JKMA 4EN3B 4UQ3A 1FC1A 2VQ1A 1IAKA 1TCRB 2H6PA 4X6FB 2OI9B 4XAKD 2GTWA 2BVPB 3DGCR 3QIBA 2KKQA 2UUDH 1QLFA 1OW0C 1HIML 2JELL 3BAEL 1OSPH 2EKSB 3B9KD 1HEZA 3TH4T 4JFFD 4YFEA 4FMKA 4LARL 4JANB 3TM6A 1ZHLA 3RUGE 2F5AH 3AUVA 1NCDL 1TNMA 3TBSA 4F7CA 4R4ND 1N6QH 1PKQE 4P5TD 1I8LC 1BQHA 4YC2C 3OR7A 5DA0B 4HDIA 5F7DB 4JE4B 4ZD3L 3DRQA 4C56E 3LSOB 5FYLE 4X4ME 3V5HB 4A6YL 1M6OB 2NXYD 4NPYB 3SDCC 3KG5A 1T89A 2GIYA 4A6YB 3LAFA 3LHPL 1J5OL 4RBPK 4Z76A 1P53A 2YZ8A 4IS6A 4FQLL 3C09B 4JFPB 3EOTL 2PXYC 1DR9A 3IDYB 4YDKH 3U0WH 1DL7L 4ODUB 1G7IA 1MJ7H 3VGHA 5HYJE 3QG7H 5IQ9B 1KFAH 3QI9C 4YXKH 1HQRA 1XGQA 4Z7QE 4PJ5B 4H5SB 3PUCA 1U36A 1K8IB 2R0LL 2UWEE 2CIIA 4NHUB 1YQVH 3M1BA 4Y4KC 4UDUB 4YBQD 3NCMA 4HKXB 3WYRA 2DQGL 2P45B 4PIRF 1FCGA 4XPGH 1NEZB 3NA9H 4MNGA 4OI7A 3I6LE 4YFLF 4L9LC 4ERSH 3IRZA 3QDGD 4R9HA 3NN8B 3D48R 3RKDC 4JPVH 4P4KD 4OLWH 3K8KA 1T1ZA 1IQDA 3ARQA 3MX0A 4OZFG 4FQXB 5FK9B 3I6GB 1KB9K 1NC2B 4P2OC 1ROWA 3BD3A 4QRQB 3G04B 2GSGA 3O3UN 1M05A 4LMQI 4R8WH 5FGBA 1P7KB 5JUEL 2OZ4A 4NPYA 2DQFA 1HDMA 3PGDB 2OS7A 4AEHL 1JRHH 5I16B 1D6VH 1LDPL 5L88L 1VADB 2HLFD 4JFPA 3KHQA 3RNKB 3U1SH 2J4WH 4MJIB 3BUYB 3Q6GL 1AY1H 3VD7A 2BSRB 3LMJH 4JM2A 5IQ9A 2MMXA 4Y19A 1FQ9C 4QHNA 2OL3A 4IEFB 1D9KC 4JO2H 1MCBA 1QNZL 1U8QA 4NO0A 3ETBF 1N0XL 1YJDC 3D0LB 2HMIC 3S5LA 4Y16A 4Z78A 4PR5B 3L3JB 4DGVL 4FFVD 4PGCB 4ONOA 4RMVA 1FVEA 3VXTA 1KTLA 3WNOA 5FIEA 2BY0A 1ONQB 4FTVA 5DMYA 3IDIB 2EDWA 3PIQB 1NFDA 1UH2A 5E8NA 3VGFA 2P7TA 4NM8H 2VE6B 5J12B 4ELKA 1OGTA 1P4BL 4HCRA 4MLSA 3HR6A 5D1XA 2GJ6D 1MHHA 1FYTA 1TLKA 3OKDB 2GJZA 4PJDB 4RMSA 1IGFL 3CDYA 1MLCB 4OT1L 1ZLUK 5AUMA 3VRLE 3T1FB 4NCDA 2FBOJ 4UV7H 5B38G 1DTUA 5KSVA 1AFVH 1KGCD 3V79C 4PD4J 1UZ6E 5JO5B 4F37K 3W9EB 1SQ2N 2DLFH 2FB4L 1VFOA 3PWVA 3SDDC 5EUOE 4LEOB 1V3LA 4BQCA 3KHOA 3WXWL 2F58L 4K71C 2VXTL 5EPMB 1QSVA 1XCQB 5DC0A 3NMEA 4B0MM 3CK0L 4NQEE 5C0EB 1SBSL 2NNAB 4HJ0D 2HFFB 4KAQH 2MQ0A 4GMTH 2VXUH 4G3YH 3WHE1 2GK2A 2J3SA 4WUKH 2GCYB 4CVWA 1YEHH 4YH6A 1UXWB 3LS4L 1MWAL 5DD5H 2R1XA 2XZCH 3KPSE 3LRSA 2RGSA 5JORA 5IROA 3GNML 3TA3A 5DO2C 3JWDC 3LN5A 4OV5B 1T5WA 4BSJA 2DMCA 2I26N 1NUNB 2XY2A 3OMZA 5CD5C 1RU9H 5DD3L 3RA7L 1J8HD 4KWUA 1GGYA 5GSRA 1QEWA 5TQ2L 2VLJB 1EEQA 1YN6B 4ETYA 1CLZL 3LOWA 5J3HD 4D2NA 5TPWL 3C08H 4JG1H 4G7YH 1TQBB 1N64L 4PGJA 3AMLA 1DJSA 3CVIH 3ARZA 1NBQA 3CFDB 4AMKH 2JK5A 5SX5K 3VFRB 4UUJA 2XACC 5HI3D 4OCSL 2YD3A 2V9RA 3MA7A 1NANH 3MLWL 2JJUA 3BH8A 5I1CH 1HIMH 3O6LL 4GG6B 3BAEH 4C83A 1LK3L 4G9FD 4DAGL 4MA1C 4P59L 5C0EA 2BNRA 3QJHB 3TIEB 4LARH 2CK0H 1QR1A 3QQ3A 4PJAB 3ARRA 4LBEA 2IAMD 1EO5A 3BPNB 3O3BA 4MXVF 4EJ1C 1MWAA 4GRWF 4ZQKB 2EZ0D 4DJMA 1SYSB 4UB0H 5F21B 2OZ4H 4ZD3H 3LEYL 2DIBA 4Z7WF 3QUYA 1ZVHA 4G6FB 2YPLD 1U91A 4P49A 1I1AD 1B3JA 5F3BA 5F7UA 2NZ9D 3LHPH 5GRXG 5AYQA 1FL5B 5A3ID 2KUTA 4NKQB 4ZDHA 1KN4H 3EOTH 4HC1L 1R24A 2OL3H 2Z93B 4X7DC 1DL7H 4JKLA 1R3LB 4CVXA 3HNVL 5CGTA 1MQ8A 3DX6A 4LLVA 5BZWB 4ZPTB 2VIRB 5DVMA 2A0LC 2Z0BA 1TNNA 4OZGE 4YE4L 3HC4L 4Z7NE 4HKBB 5GS0H 4ONHB 3U30C 3RPIB 4MA3B 4PTTB 2P8LA 3MRJA 2EE6A 1G9MC 1OGAE 2DQGH 1VA9A 3GSOA 5IIEB 2V7HA 4X8JA 4ZUSB 3VGGA 3VWKA 1GYAA 1P9MA 2O26U 4I0KA 2VYRE 2MTPA 4WUUB 3Q1SH 1QVOB 4HCRH 5E6ID 2DLIA 4ZQKA 1RHHA 1U58B 2O5ZL 1QFOA 3RGVD 1AGCB 3OGCB 2DQDH 5JUEH 4PLKD 4LF3B 1ZWIB 4JREB 4M7LT 2XPGB 5E4IA 1BECA 5JHDE 3BP7A 4WU7A 4ODVL 2MFNA 3DVNA 4NO5A 5J1TC 3BYYA 4N5ED 3WN5A 5D7IA 4TNWK 3BYTA 2XN9D 1FRGH 4UU9A 1CFNB 1BJMA 4MD4B 5INCB 4NRZB 2VDML 1DANT 1QNZH 5ANMB 2YEZB 4PJGA 3UTTB 3S35X 3OAZH 2BVEA 2CUHA 2X4OB 3D25B 5J6HB 4DGVH 1XGRB 4Y4FC 2BVQA 2NX5B 5EDXA 5DRXA 4XWOD 3ZYIA 4NQXB 3WNNA 4HXAL 1LD9A 2IANB 3B2VH 5HYSG 1G0DA 3CFJA 2Z31A 3V0AC 2Y25A 5I1IL 1XF4A 4NN6C 1RVFL 1PX3A 2ZNXA 3HUJB 4KH2A 3JTTA 1LO2H 1P4BH 5CKAA 4F7TA 4BUGA 3BOVA 3E6HA 3G6JE 4WI6A 3SGEH 1IBGL 4L5FL 5DK3A 5IVZB 3LQZA 1QSFE 4JHAL 1OQOA 4P46C 3MGAA 1T7ZA 3ZHKA 1NGXB 5H37G 4UTAH 4EZMA 4M8QB 1DUYB 4WI3A 3MV01 1GCFA 3D3VE 5E08L 1WIPA 4KKBC 1GGUA 1AC0A 4D0CA 5CD3A 4I3RH 3T3PE 5FECB 2FB4H 5INCA 4NRZA 4A2LA 1JK8A 1V7MH 2EIBA 5CWSB 3V7AE 5JW5B 2HN7A 3UTTA 3H3BC 4I18A 3OTTA 3KPRA 3WXWH 5D5ME 5E95B 4H0HB 4XB7A 5CIPB 2F58H 1XIWC 4P23C 5DHYB 1AKJD 1PKQB 3CCHA 2VXTH 3GIZL 3H7BA 1IEHA 3C60A 5FYLL 2R2BB 5L2KD 4GW5B 1J86A 4C56B 3LDBB 2IANA 3CK0H 4K55A 4POZC 1SBSH 4N0CD 3HHRB 1ORQB 2VL4A 4YBQC 3NTCH 3CFEB 5E2UH 1R5VB 1YNKL 5KTEL 4BKLB 2X1WL 3BIKB 3EJZC 1TZHB 4R7DA 3LS4H 3S37L 1MWAH 4OB5L 1JNHA 4OFDA 3GMQB 4QY8A 5HYJB 3GMPA 2WIIB 3GMRB 1P7QB 3UTOA 4PRAA 5DD3H 3RA7H 4RQQA 4ETQA 3O3DA 4GH7B 4OUUA 5HSFA 5TQ2H 5EZLA 2NY1C 1UH3A 5F89B 3NPSB 3BX7C 4ZOBA 4NN5C 4GAYA 3U4EA 3L3KB 5TPWH 2IMMA 5T1MA 3RUGA 5B21A 1A4JB 1S3KL 5IBLD 4OCSH 4WTZG 1I85A 3T0ED 3V5KB 3JV4A 5EC2B 4S0SD 1AD0A 4PJ9B 1BD2E 3D2UD 3F12A 1C7SA 2ADIB 3O6LH 4PLJD 1TPXC 4KVCH 1LK3H 3ZYJA 1KLUB 4P59H 4JG0L 5C0GB 4ODHL 4JFOB 5EU6E 3OJVC 4U33A 4MQ7A 5E70A 4HAGA 2BVTA 4UT7L 1AGFA 2VWEC 4LCCA 5HGDA 1K8DA 4XVUD 1F45A 3RP1A 3HZYB 4CKVX 2W9DL 4ELME 2FJFA 1FJ1A 3GMRA 4WO4C 3LEYH 3SKNA 4APQB 2UWEA 5SX4H 3GSUA 5F1OB 2ZG1A 3MR9A 5EWIL 1JGEB 1WVZA 1KLFA 5F89A 2EDKA 3GMNB 1RULL 4KXZI 3TVMB 1Q0YL 4F15B 3JVGA 4YWGL 5D8JL 5IP4A 1TQCB 5GS2H 3HNVH 3UBXB 3I2CL 5DMGD 1EXUA 1CE1L 1A4JA 1FIEA 1C16B 1G9NC 1I7TB 3QHFL 4PJ9A 1J9CT 4LSRL 1PJ9A 5MENE 1UVQA 4JGJA 2GEEA 2GUOA 3ARFB 4PRID 3SKJL 4AK1A 3VH8G 4XBPB 3VXRA 3HI5L 1FN4A 3V6OE 3SDAA 4WWKD 3QH3B 4PRPA 5ITBL 2WWMD 1H0DB 1LO0L 3O3AA 5IEKB 1FSKC 1GGCH 4NZRL 1FNGB 4YDVA 5EUOB 3KXFA 4Y4HA 1IAIM 1NQBA 1KBGL 4X7FC 4KI1A 2DIAA 1CGYA 2A73B 4LVOC 1XEDA 4L8CB 3HNTL 1QFWI 2W9EL 2GT9B 5E7BA 1BLNA 4HIJB 3SKOA 1GSMA 4Y1AE 4YHLL 4ODVH 3NIDE 4LRNH 3RWFA 4M4RA 4Q2ZB 2ARJA 4JRXD 4LU5L 3FRPA 3W11D 4HUKB 3LKOA 4NQEB 4FQCL 1KIRB 1Z6JT 1I1CA 2VL5B 4R90L 1GC1L 3GSVA 4S1RL 3MV9D 1FAIL 3HRPA 4X5XA 2XWBB 1VFAA 5GGVL 3JV6A 3KPSB 4KJYB 4TVPD 5F7MC 2QR0B 3KYAA 2O61A 1AXIB 5IR1B 3IVKA 1GGBL 3WDJA 3NCJH 2B2XL 3QEQA 4ODWA 4HXAH 3S4SB 1UENA 4MNHA 3ARFA 4V1DE 4HWBA 1E4KC 3U7WH 5F1NA 1FVDA 2WQ8A 4XCEB 1UB6B 4EBQL 2OM5A 5KS9E 4M6MH 1RVFH 5E8EB 4R0LA 5B4MC 1T5XA 1LGVA 4O2CB 4Y5YC 3BQUD 5ISZE 1RK0B 4L4VE 3EYFA 3Q6FA 4Y5XB 1YECH 4NBYB 4CMMB 3VE0A 4JFDA 4MVBD 1CLCA 3FO9A 2EZ0C 1X5LA 2GT9A 5GGSA 4WCYL 1SEBA 5CEZD 5IV2B 3C5SA 3O4OB 2VSDA 3FQNA 5E08H 3BDYL 2WM0A 2HVJA 1I1AC 1S7RB 5DTFB 5EBMA 5CEYA 4HWNA 4OFIA 2Q20A 5CILL 1OAZH 4J23A 5CIPH 1EFXB 3KPMA 4Z8FH 3ZT6A 2E27L 4K3GA 1TJIL 5FM5M 3PWPA 2H2SD 2AABL 3MRKA 4E0RB 1MRDL 5DR5L 3GIZH 4JHZA 1UZ8A 2ZNWA 3QAZC 2FH6A 4ORGA 2Y72A 3F62A 1T1XA 3O6FA 4M3KB 1CXLA 2IALB 1YNKH 3WIHL 5KTEH 3FN3A 5C7XL 5F7EL 3PWUA 4F7PA 2H9GA 4OB5H 3PGFL 3BI9X 4FZ8H 1S9XA 4JJ5A 3KYOA 4Y5XA 4NZDA 1N4XH 5HHQB 1F6AA 1OTTC 4OFYA 1WIOA 1NCNA 1S9VA 4HUXB 4QHKI 1BFOA 4LVNB 3ARDD 4N1HB 4OZGB 5I17A 4HKJB 1RIVL 3HZKB 1ZLVH 4LL9A 1LVEA 1A7QH 4UT6H 3HS0A 4WU5B 4PP2A 3U82B 1ZT7B 2PCPB 2E7LA 4URTB 2AEPL 1W72L 1NMCC 3K8LA 1LEIB 1DDHB 3OJ2C 1OPGL 3H2WA 1W72B 1T6WA 4J1UA 3TZVB 3G08B 3P11L 1HNGA 5ITFA 1T20A 4X6EA 3FN9A 4JN1L 3RWHB 3VWJC 1JL8A 5D2NA 2P42B 3C5ZC 1MFDL 2CKBL 2R0WL 5JW3H 2NY7L 4JG0H 1R3KB 4ODHH 4XNZC 1F11A 5IB2A 3RVXC 1E6OL 3VFOB 4GG8A 1S5HA 5JHDB 4D9QD 5HDBE 1WT5A 3CX5K 4W4NA 3UZEA 1F97A 2PW2B 3MLTB 2HG5A 4S1DC 3CLFL 2K9UA 4N0UE 2NPLX 3C6LC 5EU7E 3BKYL 4RCAA 3QT2A 1WEJL 1K2DB 4EI5C 3VXUE 3CLEH 1EHNA 1X5JA 4K7PL 3WKNA 1JV5A 4R97B 2C7UB 2JKXA 3VXPA 1OGAA 4F2MB 5FKAB 4XRCB 1A0QL 1RULH 1CWVA 4FFWC 1Q0YH 4MGXA 4YWGH 5IEHB 4XAWL 1T66D 3WE6A 1KYOJ 2CLRA 4D0DB 3BZFA 5EBLA 2GFBA 3GZKA 1CFSB 3I2CH 4PJFA 1CE1H 1NGWB 5CJBA 3TZVA 3FQWA 2YD5A 4ZAKB 3G6JB 4LSRH 1U8HA 3FTGA 4F37F 3R8BB 1IEAB 1QSFB 4HWBH 1S7WB 1FZOB 1FBIH 3SKJH 1YMMB 5DC4B 2UUDK 4MNQE 2CKBA 4WEBL 4KKNA 3BFOA 5JHDA 4NKDB 3HI5H 1JYWA 1NLBL 3D3VB 1HHJB 1MELA 4Q9BA 4IOFC 3UPRA 3DURB 5ECJE 4Z95H 3K2UL 1QBLL 1MEXH 2FYYA 2Q6WA 3HTLX 3X17A 5I2IB 5CCKL 1G6RL 1MREL 1KBGH 5D5MB 4U1GB 1G6RB 4Z0XA 5JW4M 2W9EH 4KKLD 1YMHB 4P4RA 4P3DB 4YHLH 2NW2A 3ARVA 3AREB 2XT1B 5FCSH 4HG4J 4YO0A 1U41A 5DJ0B 4MLIA 4PREA 4FQCH 1T3FB 2MJWA 4OBSA 5E4EC 1NGWA 2NMSA 1B0GB 2XA8L 3E6FA 1FAIH 3FO0L 3WFHA 5C0BD 1JRHI 1GXEA 1GJIA 4HK0B 2OQJA 5GGVH 5BXFB 1WC7A 5CHNB 4YR6B 3G6JA 3WFCL 1A6ZB 1M7DB 1NUDA 3FB5B 1C08A 4MWFB 4G80B 3QR2A 1D5ZA 5IF0B 5EUKB 1NSNH 1GGBH 4YEEA 4OCNC 5IBLC 1I8MB 1Q1JL 3T0EC 1RJLB 3MRCB 4NRXB 3DV4B 4QXTB 2MNUA 1EJ6A 3K0WA 5T1LD 2VISB 2X89D 4G8EA 3AFLA 4NWTL 4K23L 4RFNB 2PF6A 4PV8B 5CS7A 2XRAL 4U3HA 1RUPL 2Z8SA 2ZWLT 5J13C 1YY8A 2PNDA 4S11A 1AGEB 4NO3A 1YMHA 1BD2B 3AAZB 4NQDE 2OLDA 3GBLA 1CS6A 1QBML 5AAMA 4K9EL 2I5YH 1F13A 3GMMA 5CILH 2OJEB 3H9SB 5DK0A 1B0GA 5EU6B 1S9KC 1I1YA 2IH1B 3LD8C 3QIWB 1E0OB 2E27H 4J2XA 5HHPA 1IGML 1TJIH 3A0OA 4WW1A 5C6TL 4M6NL 4M7ZB 2AABH 3T4AB 1MRDH 5DD6B 5DR5H 3QUZC 4QXWA 4U31A 1WSST 4S2SB 5DMGC 3TF7C 3MNZB 4KTEL 4ELMB 2CMRL 5F3HA 3S96B 1H15B 3OR6A 1SM3H 3RWJA 3GHEH 1A47A 2YBRA 3VXSA 1ZTXH 2K3TA 5D1QB 3TFKD 3BO8B 4HS8L 4Q0XH 4YQXL 1BVLB 3NACL 4YPGB 3PGFH 3RIFF 1WWCA 4BQ9A 3QEUA 1U92B 2CLVA 2P5ED 3ARGB 2FSEB 4I4WA 5J56B 5IKCA 1WWAX 1T1YB 4U1SA 1NAKH 5H35B 3KDMB 5BS0D 1KEGH 3UC0L 4BZ1L 1XF2B 3REWB 1EVUA 3ZYOA 2WINA 3MV8D 4R4FL 4UDTB 4JFZL 3BPCA 5MENB 3O8XA 3IU4L 1IAMA 4U1IB 1A6UH 1H3TA 1HI6B 2AEPH 1FFOB 1BREA 5EU6A 1DN2A 2ICWB 2EH8L 3UTSD 5EBWA 2LFGA 4JN1H 4OGZA 2V5RA 4TOYL 3BXNB 2UYLB 3HCVB 3MNZA 3QNXB 1Y18B 2F54D 3G6DL 1MFDH 1X5GA 3BKCL 2CKBH 5MERB 1XGTA 2R0WH 1OM3L 4Y7MA 3OJMB 2ICWJ 2LAGB 3DO3A 1E6OH 4N0FA 3K1DA 3MRQA 4RZCB 3PHQB 4CAGA 5JIIA 3BUTA 2VQTA 3PWNA 3IKKA 1HKFA 2XFXA 5I66A 1OAXH 3PWJA 1S7QA 1JTPA 3FRUB 1JE6A 4HUVA 3BKYH 1WEJH 5FM4A 2D7NA 4X4YB 4K7PH 2NQCA 1XF2A 2H41A 3PJSB 1RAMA 5IB4B 4B5EA 5B38A 4FQJL 1CLYH 3DJ9A 1A0QH 4J3OC 4QRRA 4XAWH 4IIQC 1HH6A 4NYLB 4V1DB 4MQSB 1FFOA 1HHIB 2ZKHH 3P0YL 4LCWE 4PFEA 5KS9B 5E56A 5EU5B 3MV7A 3V6OA 3B2UD 3O2VH 1U3HB 2WK2A 5ISZB 5E9DE 1ACYH 3NABH 4L4VB 5CUSL 2EXWC 4QOKA 4XH2B 5C2BH 3ZKSD 2YRLA 4XPHL 5FOBA 3STZA 2FBJH 3KJ4B 4NOFA 5CZVL 1WBZB 5DRWB 4JDVB 4WEBH 3TH3T 1ULVA 4JRYE 4AT6A 4Y1AA 2BSTB 3EO9H 4CBPA 5D2LE 2IFGA 3OKKB 4H20L 2HH0H 4PG2A 3E3QC 1UQSA 4TRPL 3F7VA 5D7JB 2EDFA 3K2UH 1QBLH 1OHQA 1FNHA 4P2RE 2OYPA 4X6BA 2DWDB 3U0TA 1LP9E 3KPLA 4NUGH 5CCKH 3CZFB 1MREH 5IFHL 5D1ZB 1Z0MA 5MEQB 1IM9A 3CGTA 3X14B 5KZCB 5GGUA 1G9EA 2FGWH 3QDME 4MAYB 3WFDL 3R8QA 1NGPL 5JZ7C 2X42A 3FQUB 4G8FB 3NFNB 2W0FB 1JPGB 4Z7UE 3L95B 5TDOA 2QBWA 2XA8H 1MSPA 1U93A 3ELAT 5DS8A 1IC5H 3AS0A 4EN3D 3VFMB 2R4SL 1PZ5B 3MGTA 3WFCH 4HIXH 5E7FA 3VFNA 4L3EA 2ERJB 5K9KA 2JB6B 4JY4B 4U7SA 2CRMA 1E4WH 1NJ9B 1Q1JH 4N0RA 1G7QB 5DJDB 1DCLA 3QEHB 1EEZB 2DQIH 3QA3B 5C8JA 2KDGA 4KK9C 4HGKC 2QEJA 4M43H 4J6RH 3DXAE 5KANG 1XR9B 3HPLB 4K23H 4KRPB 2EIDA 5IMOB 3ZE2E 4OCXL 1QUNA 3CFBB 3ZE0E 5C0DB 1FG9C 4X7TA 4X9FA 2EC8A 4X8XA 3SO3C 3IYLW 2EYRA 5HYFA 4OLZH 2RIKA 4U6HB 2Y07L 3QNYB 2DD8L 2R4RL 2JLLA 1T0NA 2EDXA 3LPGA 1FYHB 4AL8H 4DZ8A 1FDLH 5IMLA 4OM1L 4K9EH 4LSSL 4G8FA 3NFNA 4Z77A 4PJ5D 1AO7E 1A1MB 4M1GL 4EOWH 2CSPA 3IGAB 3HE6A 5H2BA 1WFTA 4HFWA 1IAOB 1ORSB 2A6KB 5LBSL 1ED3B 4TNVF 3CUPB 5C0AE 1IGMH 5C6TH 3I6KA 1T66C 4M6NH 3BVNB 3IJHB 4W6XB 1I8KB 1RK1A 2WUCL 5D70L 4DUXA 1BAFL 2E7BA 3SDXF 3PNWB 2BSSA 5K9QI 1FLRL 4KTEH 5J11C 2XY1A 4N0UB 1OSZB 4DTGL 4O58L 3BEWA 3VXUB 3U7YL 1RSFA 4PJ8B 1I7RB 4X5LA 4HS8H 3HPLA 4FQXD 4YQXH 4J4PC 4GXUN 3NACH 1NC2D 3AU1A 2FD6L 4OZHB 1D3CA 1VFMA 5AYUL 1PW3A 3QXAA 2O5XL 3FT3A 1FG2A 4PD4K 5D72L 3FKUS 3PGCA 3EYVA 5IK3A 3LV3B 2A9NH 3BKJL 5FF6B 5F9JA 4MJ6B 3BMWA 4KV5F 4OTXL 3BD5A 5BJTA 4MJID 4YEFA 5I71B 4JFZH 2YUVA 2F8XC 1XAUA 5GIRB 4AH2B 5JW4Q 4ZUUA 32C2B 3IU4H 2ZUWA 4Q9QL 4YZFF 4RGOH 5F7HA 4MNQB 5JPNA 3CPLB 3FB7B 1FV1A 3RY6C 1P6AB 2EH8H 3B4NA 5IHLB 3SGJC 1RJCA 4QHMA 1KG0B 4XX1E 1D5XB 1H8NA 1KACB 2P5WE 2Q8AH 3G6DH 1R3JA 2J2ZA 4JFEA 4BSVB 3BKCH 1FH5H 4JFFE 5HYSA 3V6FB 1OM3H 1MHCA 5SWQB 3MXVL 2AK1L 3U46B 3PQYA 3EHBC 1BVKA 3MTRA 2IBZX 1BIIA 1EGJA 5D6CB 5GGRY 4HT1L 2VOTA 4C58B 4I2XE 1QHOA 5I1DA 1VGEH 2Z8WC 1MIEH 4DCQB 3AXLA 2AJSL 4XP5L 1QRNA 1D5IL 1XR8B 4WI7A 4M61A 4L4JA 5LAXA 4AH2A 1MCFA 6FABL 5B3NA 4L1HA 2CGRH 3MLPA 3F58H 1QA9A 2DQUL 4YC2B 4XCFH 4MB3A 5I15L 1JJUA 5SX4I 2OX5A 2ENSA 1EVTC 1B88A 1HHGA 3LH2L 5H94A 3OL2A 4PBWD 3SDCB 1I9JL 2IGFL 3C9NA 3HG1D 4J3VA 4TSAL 4OLVL 3O0RL 4UBDD 4F57L 4BELD 2PXYB 3P77A 4XPHH 3EOAB 3TN0C 3R0NA 1J1PH 1TVHB 5IHZA 3QI9B 5CZVH 2X4TA 3C8DA 4HMEA 1AHWC 1CD9B 2OTWA 3U46A 4GKNA 3DIFA 4H20H 4TRPH 3QULA 5KSAC 3QDJA 5AZEL 4Y4KB 1A7RL 3B9DA 2BNUB 3TFKC 1KV3A 3MLVL 2AEWA 3S97C 1MF2L 3BDBA 5F7YC 2D7OA 1OP3H 2VLJD 1J05A 4L9LB 2ZCHH 4O5LH 1QP1A 3GSRA 5JIKA 1KCUH 2RFXB 2APBA 3HAEB 4L4TE 1NGPH 1IGYA 4MS8D 1CN4A 1I8LA 4P2OB 3B83A 1W2KT 3LKNB 1O0VA 1KIQA 4EDWL 1U8IB 5CSZB 3S88L 1A22B 2NY5C 4WTZA 2ATKB 5B8CA 2HT3C 1EV2E 2EDHA 4TN9A 3VI3F 3GMLA 5DD1H 2R0ZL 3F7QA 4U1JA 4N8VG 2VWEE 2Z35A 1ETZA 5IOPA 2ZOLA 1YJDL 1D9KB 3EIFA 3WFBL 5IJKA 5DFVC 4NQDA 2XKNA 3X13A 4UV4L 4KQ3L 3QFDA 1T7XA 2B1HH 1OT1A 5FHBL 3QJFA 4OSUL 5C0FA 3OXRA 2BNUA 3EOYG 4G6FD 1I7UA 5DZOA 1QD0A 2ZUVA 4ZOEA 2C26A 2DTSA 1C12B 3DGGB 5BO1L 1KNOB 5JW4R 2IFFH 4Z7WA 2DD8H 2R4RH 4TQEH 3STLA 1PG7L 2VXQL 5I6XC 2BY2A 2HRPL 4F7EB 4OM1H 4RAVA 4X9HA 4LSSH 2YA0A 4HK3J 5K93A 1U8JB 2VLKE 4H25A 2FJHB 5C0JB 1GHFL 1VCAA 1H3UA 2DQCH 2W65A 2YMXL 4M1GH 3LKNA 4EI6A 3EUUA 3BGMB 3ZO0A 4FNLL 5LBSH 2YRPA 1H3GA 2WUCH 5EFIA 4WENB 1BAFH 1E4XL 5DQJA 4JDTH 1DQML 3CH8A 1FLRH 2RJMA 4DTGH 4O58H 2DICA 1BBJA 4P2CG 2X1XR 1Q72L 5IWLC 1KELL 2DYPB 3VH8A 3U7YH 4WUUD 3SDDB 3MC0A 3QG6B 1EGJH 4HZAA 3TBWA 3FT2A 3ZT5A 3UDWA 5AYUH 4C4KT 4K71B 2O5XH 1PVHA 1N2RA 4GO6B 5J6GB 4D9LL 4XVTL 4LCWB 5D72H 4QRTA 1QSEA 5H37H 3LEVL 4CW1B 4HWEH 1J8HE 3BKJH 4UIMA 5CZXC 4PYHA 4JLRB 1KCLA 2PO6C 1JUFA 4WI8A 5E9DB 1U8MA 5CEXA 4LRIA 1MCWM 4F7EA 5E8OA 4ENED 1EK3A 1C7TA 2AXHA 3KS0J 3JWDL 1NDGB 4LHQB 4XBGA 3W81A 4Q9QH 5ID1B 3L9RB 4ODTL 3OF6A 3OKMB 5IT2L 2YA1A 3TT3L 4JRYB 1TJHL 4YGVA 5D2LB 4DZBB 3T0XA 1TZIA 4BH8A 2NX5D 4P0DA 2APXA 4HS6A 5I76B 1IGTB 4QYOA 4P2RB 4KROD 2FIRT 3TGXA 1LP9B 1A9EB 1QFWM 2CJUL 4E42B 5MP6L 2EEAA 2DTML 4U4BA 3FQRA 5I1JH 3MXVH 2AK1H 3QDMB 1N3NB 1HZHL 5J1AB 3TCLB 1S7UA 3MACL 4XZUB 4JKPL 1RY7B 1Z5LA 3H0TA 4HT1H 5J0BA 4JZOA 4Z7UB 2CIKB 4XNYL 2BC4A 1QRKA 2C3XA 1UB5A 9CGTA 5C70A 4MA1B 3WNLA 1IZKA 4N1CA 1J18A 1VENA 2AJSH 3WJLA 4KY1L 4XP5H 3KLHC 1D5IH 3T0VA 1DVFA 2NR6C 5ID0A 3ZZ1A 3QUXC 4N5UA 4K7FA 5JHLL 3VG0L 1BQLL 1NKOA 2A2QT 2DQUH 4LLAA 1S8DA 5F9AC 4L29B 3CX2A 5DJYB 4DZBA 3NZ8A 3LH2H 3DXAB 5F1SA 3TPKA 1I9JH 2IGFH 3MBXH 1HXMB 3ARUA 1BFTA 4XGZA 1IQWL 3ROOB 4TSAH 3OHXB 1AR2A 4C56D 2XZZA 3O0RH 1X3DA 3KYNB 5FYLD 1BGXH 1CXHA 1IGCL 4FS0A 3TO4A 3IDJA 5F9OL 3A6CH 1R0AH 3WS6C 1P2CB 1GL4B 1MFEL 4OF5A 3QXTA 1IFHL 1IRAY 3EYQD 4YXHL 4TPRL 4UOW0 3WMSA 2R2EB 5SWZA 4IJ3C 5HYJD 4F9PC 3U30B 1A7RH 3RDTD 4XNUL 1L7IL 1P7QD 4GRWH 4JVUA 1HOCB 1MF2H 3OKNA 5DF0A 2A77L 5C0AB 5K9OA 3MCKA 1G7HA 4ZPVB 3O2DL 3L3HA 4WDIB 3UZVB 3VXQA 1SYVB 1TZGL 3ZTNL 5GS1A 3EO0B 3NGBC 5BRZE 1FFQA 3SBWA 2XN9E 3V6ZB 5JTWA 3LKRB 3MNWB 5IESL 4R4BB 4EDWH 3TJEH 1KPUA 3L5JA 3UTQB 2IG2L 3ZKND 4M1DL 5EIQA 1QLRB 3BN9D 2CPCA 5DJ2A 4GQ9H 4PRDB 1WFUA 1LEKB 2NZIA 3C6SA 1J8KA 2DJSA 5HJ3A 3VXME 1CDHA 2R0ZH 1S7TB 5HYEA 2ICEB 4YAQA 3BDXA 5ICZB 3BGAA 4HBQA 4DVBB 3PV6A 5C0CA 3WFBH 1YPZF 4P9HC 3P4NA 1ZEAL 5D7LE 2UY6A 3IT8D 4UV4H 3D18A 5HPOA 4NQCD 3KLAA 1A6AB 5FHBH 1GIGL 1AO7A 4NFBA 4OSUH 3EFFB 4Y4FB 3WS3B 4U6VL 4WW2B 1C8PA 4APQD 5EN2A 2I07A 1A6PA 1CL7L 4ALAL 1ZT4A 4U6XB 1I9RL 4Y5VA 3O2DA 1PG7H 3GSNL 2LAAA 4PGZA 4NN6B 2HRPH 1HYSC 3TVMD 4WV1A 1CFQB 2P5WB 5EU4B 3GSNB 2BMKA 2QADC 3B6SB 4PTUA 1UXSA 2RCSL 3LKRA 4JVPA 3EO1B 2NY0C 2YMXH 5IFAL 4FQQB 3EAKA 5DYOB 4FNLH 3UTQA 4NNPL 4P46B 2Q8BH 4H1LG 5ESAB 5DURB 5KVFH 3G5YB 3F6LA 1E4XH 2X40A 1F3RB 4I2XB 1S7TA 3RTQD 1NKRA 3UJIL 3T1WA 4PGBB 1MHEB 3UZQA 1Q72H 3K4DA 1KELH 4CJ0A 4RMQA 4LSTH 4K94C 2XQYK 1UYWH 3KPQB 4MA7H 3BZEB 1Q9WB 3P2TA 1BMGA 2D3VA 3KS0H 1XIWB 3DSFL 4P23B 2C3HA 4XNXL 3O81A 4NUJA 2H32A 4XVTH 1CXKA 2GAZB 3MFFA 4XP9H 3ARBA 4F3FB 5JXED 2DIJA 5MEPB 4U6XA 4OKDA 5F1KC 5HD8C 1IT9H 2P8PB 4L3CA 2HTKC 3L3IB 5I1KH 3B9KA 1MJ8L 4NQED 4JFFA 3GSQA 5JDSA 4OCYL 4FQQA 3TT3H 4N9GB 1TJHH 3FFDA 3REVA 3DECA 3LRGA 4L8BA 3KPSD 3T0EE 4LEXL 2FL5B 4P5TA 3O6KL 4MS8C 4ONGL 4HJJH 3LCYA 2BHUA 5E24E 3JWOL 2NY1B 1FNEA 5T3ZH 2OTPA 4NRYB 4PGBA 1GOGA 1A6TB 2CJUH 5FKPB 3UROR 2DTMH 2UZXB 4HUWA 5CMAB 2HTLC 5B3JF 3KNBB 3HPJA 3LKQB 1MCHA 1YEDA 3OKYA 4L4TB 3L7FA 5HGAA 5FDWA 3PDOA 1EMTL 8CGTA 3MSPA 4YIQA 3ARTA 4D3CH 4JHWL 4N1EA 4UOW1 4I13B 1JZ3A 1NMBL 3HR5B 1PEZA 1TPXB 5ETUB 4X5WA 3WEXA 4G6KL 2G60L 4QRSA 2LTQC 4M9PA 1AGBB 4KY1H 3MRPB 4KUCD 1ZGLA 1X5YA 1B4JL 4KZEL 3HNSL 3KPPA 4U05A 2ZSVB 1ACZA 1JBJA 3SDYL 4UOJA 3QDGA 3N1FC 1BQLH 1A1OA 1YEGH 1EFXD 1XGUB 2X4PB 4P4KA 4WO4B 5E99H 1IKFL 4NQTA 2PW1B 1I4FA 3P4MA 4KVNL 4JZJC 1IQWH 4HF5L 5DHXB 3TBVA 1T1WB 4OV6F 3IFLL 4UNUA 5F9OH 3X11A 3IDMB 4PRIE 2WBJC 5C08E 1OWRM 4WFHD 1IFHH 4XT1C 1AR1D 1G9NL 4ISVB 3V0VA 4TPRH 1U8PB 1PG7W 4KJPC 1FE8H 2DM4A 1J0KA 3RWGA 4PJBE 2HJLA 2VLKB 1UACL 3O9WC 2ICCA 5IVXF 4I0PC 3GEWB 4MD0A 1ZE3C 1KYOK 5ETUA 2WW8A 4HAFA 2X44D 5JXAL 1MRCL 4HGWB 3O2DH 2AK4E 5A16A 2D0GA 2C1PB 1AGBA 1TZGH 3ZTNH 3SJVE 3Q3GA 3NFSL 4JRXE 3U9UA 4XI5D 1IC1A 2Q7NA 3T77A 2D7QA 1KIPA 3F8UB 2YD9A 5HDOA 1FSKB 1MCQA 1EX0A 5IESH 4PJDF 4HKZB 5BW7A 3MV9E 5HYQB 3BWAA 7CGTA 3O4LE 3QIUC 3KPOB 3RWIA 2GJ6A 2YC1A 5FV1L 5KAQF 5M94B 1OF2A 4W70A 5TGBA 5BQ7A 4JQIH 5AWNL 4MD5B 4BFIA 1YYML 3IXAB 4KV5E 4G42A 4XNMA 1S9WB 1J8HB 2PYEE 5C0IB 2P48B 1GOFA 2EDRA 4KROC 2BOCB 1V3KA 1ZEAH 2H1PH 3BZ4A 3RWDA 1EA9C 1S7SA 1MCLA 4HHAB 1H5BA 4K7PX 1C1EH 2XKUA 1W0WB 5DVKA 1A1NA 1GIGH 2Q76A 2H32H 4U6VH 4HLJA 5F1IB 1T7WA 4FABL 3RU8L 2EDLA 4HG4K 4XP4L 4GAJH 5I73C 4OZIE 1CL7H 1A6VL 5CJOL 4IDJL 3WIIH 4HGWA 4ALAH 5K59F 3ECBA 5CEZE 1WUNT 2L0DA 1I9RH 4YDIL 5C09E 4S1SL 1DEDA 4RAUA 3OKEB 1U8NA 4NWUH 4Y5YB 5E2WH 4OLUH 4MA8H 1TIUA 12E8L 1U3ZA 2CH8A 1MI5E 3FQTB 1RMFL 5IFAH 4NNPH 2Y36H 5BV7C 5T1DL 4ZAKD 4ZUTB 2BXZA 2VDPH 4I48B 2NYYC 1FZJB 3EJJX 3MJ6A 3U36B 4JFHD 3TLRA 2VDQH 3NH7L 3WNKA 3MPCA 3QFJA 5AG8A 3ES6B 1YMMD 3E3QE 2ZZUT 5GQBA 2ZOKB 3JTSB 4ZOAA 3FAWA 3TWCH 2HKHH 4XC1L 3H9ZA 3INUL 3D3VD 3D0VA 4I3SL 4L8DB 1HQ4A 3MJ9A 3MRNA 4F9LC 4NQSA 3VFWB 2I9LA 1E28B 4JO3H 1XF3A 5E0QA 4PJCF 5KJRL 5I8OL 3NCCB 1X5XA 5BMFL 2W91A 2EDOA 1LWRA 3QAZB 4GRLC 5T5FL 4GG6F 2UZIL 4XNQA 3JXAA 5HI4D 1DANU 2VJXA 3PP4H 3RDTC 4NN7C 3K46A 1CD0A 4PJAF 2DBLH 3ARED 1LE5A 1RZIB 1HCVA 5I30L 4G9FA 3V52L 1MJ8H 2IMNA 4U1HB 4YHPA 1A7NL 3MRGA 3NPSC 2J8UE 1M1SA 2VLRA 2IAMA 4OZFB 3RHWF 2BDNL 4MCYB 4CL7A 1BZ9A 3O6KH 5EC1A 3RVUD 3BT2L 5CLWA 5IG7B 4ONGH 5FO7A 1P4LB 5HDQL 3JWOH 4G8GB 5L9DH 4Z5RB 4PJIE 4NT6B 1MCRA 2YPLA 3IXTB 1JYNA 3STBA 2G75A 1I1AA 3JTSA 5DD0L 3X3FL 1P84J 1NMCB 2NY4D 4M02A 4CN1A 4D9QE 4XTRD 1CVRA 1YUHB 4U1NA 3LN9A 2HA1A 5BRZB 3MBEB 4XMPL 2EDQA 2XN9B 4YNYB 3I75B 3VWJB 4LLUB 4AENA 4EXPX 5DQ9A 1ADQA 5ELIA 3K81A 1NMBH 3C5ZB 2Q1EA 3D6GA 4PLOB 4ODSH 5DK2B 3BP6B 4G6KH 1J0IA 5DGRA 4XVJL 4W4OA 1BD2D 4XNZB 2Z92A 4APQC 1NEZG 2ADFL 3VXMB 3DX8A 4Q97A 1B4JH 2MPAH 2FATL 3H9SD 4U0RC 2AERT 4NFDA 3ULVD 2ESVD 1FO0A 3QIWD 3HRZB 5ICXB 5E6IA 3C6LB 1Z3GL 3BP5A 1BZ7B 5D7LB 1IKFH 1VFBA 4EI5B 1C5CL 2BVOB 4KVNH 5BVJB 4HPYL 4HLZH 3MRRB 3TO2A 4HF5H 3GI8L 3IFOA 3RGVA 4WFFE 3VXNB 5DJ6A 2D0HA 3L5HA 4O00A 3VRIA 1NDMA 4NKIL 1LO5B 4LK4A 4DFHA 1CTOA 5D1QD 1BVZA 3RTQC 1J10A 3CZJA 4MJ5B 1IL1A 1MHPL 3ARGD 3NPZB 1UACH 5KSBB 3GDBA 4I0CC 2X4RA 5K33A 1T4KA 4QTHB 5I1GL 5D71H 4RA3A 1MRCH 3OX8B 5LGJA 3CDGA 2R1WA 3SCMD 3NAAL 2D7MA 2CXGA 5MEND 3HUJF 4XHJD 3HI6H 3MOAH 3NFSH 4HXBL 4X99B 1J1OL 2FIKB 5JXEC 5E94A 3WUZA 4K3JL 3I02A 3HRZA 5FA3B 4NNYB 1AE6L 1U8OA 5C0BE 4OUOA 1EO7A 4LLWB 1MLBB 2DKMA 5DJXB 4JFYB 2ATPB 5AWNH 4AY0A 4JN2A 2C3VA 3PL6D 5BZDA 5TE7L 1MJJA 5HGGS 1LO5A 4P2YA 3H8NA 3PP3H 5E4EB 3MJ9H 4QT5B 3QPQC 4OGXL 4BK5A 1W0VA 4P57B 4HIIA 3BP4B 5GJSL 2QHLA 1NGZA 3PABA 4G7VL 1KXQE 3MLSL 4FABH 3RU8H 1Z9SA 1RUML 3FO1A 3HLAA 4XP4H 1TVBB 3NVQA 1S7XA 5A2KH 4IDJH 4H8WC 3NFPA 4PRHE 3FQXA 1FZMB 3MLRL 4LVHC 1PX4A 1AKJA 2N4IA 4YFLI 4OI8A 4S1SH 5L2KA 4X99A 2HLAB 1TITA 4V1DD 5EG6C 1DUZA 4KJWC 1BOYA 5E2VL 1KTKE 4YHOL 1I3RA 4R3SA 4Z7QF 4KMLB 3DYOA 5J13B 1U3HD 5FB8A 2HKFL 3QO1B 4IRSB 5T1DH 5ISZD 5IW1A 3L1OL 1T0MA 4L4VD 3O45B 3QQNA 5F9WC 3TNNB 2JJTC 4JCLA 2F8OA 3B9AA 3NH7H 5DRZA 1XF5B 1Q38A 4KTDL 3MRHB 4XCYA 5J4MA 5D6DA 5C1MB 1I8IB 3ZE1E 1WTLA 5LVEA 4D8PA 1Q9KB 4XC1H 1JGUL 1CK0L 3D85D 3QO0A 3INUH 4BH7B 2V2XA 1T04A 1C5DB 1UCBL 3U2SA 4BJLA 3LIZL 4I3SH 3ME0A 3BWUC 3LD8B 1HINH 5D7JD 1DBJL 3CAFA 4NBZB 5HBBA 4M7KL 4N0YL 4NJ9L 3HE7C 3QUZB 4GW1B 3MUY1 5KJRH 3RWEB 5BMFH 1NH6A 1FL3B 5MEOB 2VDKH 5D1ZD 5T5FH 4CADA 2W0PA 5KZCD 3T0EA 4YDLC 2XI9A 5E00B 1KPVA 4MAYD 3D2UA 1JGVL 3IETA 4KK8D 2OP4L 2X4QA 2HFGL 4LVNC 2HLAA 3O3EA 3EOBB 1D6EB 5BOPA 5CBEB 5EIVA 4PRIB 5C08B 3N50A 1FO0H 4OZ4A 1A7NH 3V4VL 1QFHA 3MUZ1 1L9MA 3E2HC 2OSLA 1IM3A 4HUUA 2BDNH 1YDPB 1OAYL 2XKSA 3BT2H 4G6MH 1MCNA 2VERN 4PJBB 2EC9T 3O6MH 5HDQH 4OKVA 3NCEB 2N56A 2F54E 4HH9B 1I3VA 3IU3A 5E1AB 1OB1B 5IFJB 2AJYL 5DD0H 2X05A 3X3FH 1U8LA 4N8CH 2AK4B 3R1GL 4WNQA 3SJVB 1QFPA 4XMPH 4ZXBC 2G5BB 1G7JA 4CVZA 4GW1A 5CZKA 3VGAC 1CBVL 2ZJSL 1T2QH 5MEOA 3OBAA 3HFML 3O4LB 4TVPL 3RAJL 5FO9A 2F74B 1SJEA 4XVJH 1VKXB 4AG4L 2HT2C 2GTZA 4FA8A 2NY6C 3SGKC 1R6VA 5L6YL 3MQIA 4PRIA 4OCWL 1PSKH 2PYEB 4CDGC 3F5WA 2NY3C 3OWEA 5I1HH 3CFIC 3LN4A 3ROLB 5EUOF 4WWKA 5DMJB 3UAJC 3VFUA 1C5CH 4P3CL 5EU3A 4HPYH 3DMMC 4H0IA 5DMKA 3GI8H 3L3DB 1WFNA 3EYOA 4JY5L 3GKWL 4QGTA 4NCC2 3VXUD 2IH3A 4OZIB 3SDXA 4IIQB 3W39B 1E4JA 5CEZL 4PJ8D 1D5BB 2VRAA 3MUGB 4NKIH 2P24A 5C09B 1KCSL 4JRXA 1WCBB 5EZOL 4Y8AA 4O4YL 1MHPH 1AD9B 5KVDL 4X6CE 5TE6L 1X5ZA 1MI5B 3MV9A 4G6AC 4MDIA 4L8SA 1FORL 3WFZA 5I1GH 1WWWX 2AV7A 3HMXA 1MUJA 2PETA 1FP5A 3U4BL 1R5WA 4XPBL 3NAAH 2IPTH 4ZUWA 4JFXB 5K9JL 2X4UA 4OCLC 4C57C 3GB7A 1F4AA 4ZUVB 2BJMH 1J1OH 1PBYA 4HEPG 2YKLL 2QSQA 4MNQD 1EUTA 1T0PB 2X6MA 4K3JH