5DK0A

Fc heterodimer design 20.8.34 y349s/t366m/k370y/k409v + e356g/e357d/s364q/y407a
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
207
structure length
207
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVSTLPPSREEMTKNQVSLMCLVYGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSVLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 38
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dk0A01
2VAAB 2HRLA 1GAFH 3O6KL 1DQMH 4X80L 3MNWA 1B6UA 1AD9A 2HT3D 2X6MA 3PJSB 4EI5C 4WJ5B 4APQB 4W4OA 2A9MH 5C7XL 1ZHNB 1FO0B 4JHBA 2CIIB 3IYLW 3O8XB 4M4PA 2A6JB 2YRLA 3QUZD 5DC4B 3WL9B 5CCKL 1KB9K 3MOQA 1MHEA 1X5KA 5C0AA 3DX7B 1CLZL 2ED9A 5EOCJ 2ZPKH 3HMXH 5IF0B 4X0KB 5E6IA 3IAQA 1RY7B 1ZV5A 2Q6WA 4NYLA 3VWJC 2EDBA 5CD3A 3MLYH 3TVMC 3WFCL 1AGBA 4ODWA 5L2KB 1UKQA 1NUDA 2IANA 5CWSA 2P8LB 2PXYA 5I1LA 1LO3H 2C7UB 3PWNB 4QRTB 5DMIL 4DFHA 1XMWA 2L0DA 4OZHB 3S88H 3NCBB 1AGFB 4JZNB 3BN9D 4KQ4L 4M6ML 3IVKB 3BYTA 1CT8B 1BIIB 5EU4A 3UPAA 3VFPB 1YC7A 2Z8VC 5F9OL 4HXBH 4DN4H 3WYRA 3IDYC 1I3GH 4XXCC 1IBGH 3M8OL 5F71A 3ZKMC 1ZK9A 4LEXL 3OKMB 1E4WH 5FDYA 3ZYOA 1T1ZB 3TT1L 4OCYH 4TVSa 4BSWA 3WS6A 4L8SA 4DZBB 3K74B 3K1DA 5B22A 5EB9A 2IEPA 3N50A 3ZT7A 1AXIB 1MIEH 4N68A 4ODXB 2GYSA 4AH2B 3O6FA 3JWDH 4PRBB 4NBZB 2M2DA 5DFVD 3BZEB 4OUOA 5D70H 3QNZB 1LNUB 5AAMA 3ZKMD 3IT8D 5CJBA 1J5OL 5MENA 4JM4L 2WP3T 1OOAA 3S97C 3WFHB 2VXSL 1SM3H 1IC7H 4Q7DA 3OJDA 1H3TA 1QLRA 4PBXA 4U0RC 4XT1C 5J1TC 4XB7A 2P1YA 3STBA 1LE5B 3DV6B 1BVLA 3IU3B 5HDQL 4WHTA 3QEUB 5DJ8A 3ZZ1A 1CK0H 4UINL 3GSUB 3IDMA 1KIQB 1SBSH 4YXHL 1F97A 2DYPB 5AZEH 2CR3A 4WFFE 3U0PA 3SDYL 3GEWB 1XAUA 2NW3A 1FYTA 5DTFA 3ARDB 4O02L 4NO2A 4XPAL 4EUPG 2P5WD 2JTDA 1EFXB 2YMXL 3C2AL 1RK0A 5IEHA 5DJZB 3VFTB 2GITA 4TOYH 4NFDA 3WCYA 1N5AA 5DJCA 1X7QB 4MNHA 4YXKL 1YMHB 2H1PL 5I73B 4YBHA 3ARWA 5ADPL 1R0AH 1UWEL 4KHXH 3U7YL 4FQLL 3ARFC 3MBXL 4JHWH 5MENE 4KJYB 3S5LG 4EZMA 4I2XA 1SM3L 1BFSA 1TZHA 1U41A 3VRJA 1A2YA 4QHNB 5DI8A 3TGXA 5J56B 3MYJA 5E8NB 4NCC2 1O7VA 1IC5L 2GJ6A 4V1DB 1VGEH 3NCCB 4U1MB 3U2SB 5F7NC 1PG7L 1NGPH 3NZHH 3VD4A 2PETA 5EO1B 3QQ9C 4J1UA 2R0WH 1KJMB 2XTLA 2WQRA 2XZAL 1OSZB 3VXME 5CJ8A 2ZUVA 3MV8A 3UJIL 4LMQE 4XXDB 5FO7B 3MODH 4BH8B 3L3JA 1AGDB 2OL3H 4Q9BA 3LDBC 3LSOB 3HTLX 1GJIA 1N6QL 3QT2A 2J8UB 1QSVA 1NCDH 2FO4A 4IRJC 1NFDB 3SCMD 4JANB 1SEBB 5EIIB 5IW6B 2JCCF 3EOYG 5DJCB 5MP6L 3RTQD 3ZE0E 2HAZA 1CK0L 3ZL4H 5KS9F 4X6EB 2ED8A 3LKPA 2A6DA 2EXYC 3BXNA 3JV6B 4KQ4H 1JP5A 5IEKB 5J3HD 3EO9H 5CSGA 2D9CA 4EBQL 4XCFH 4J6RH 5FM4A 1F11A 4K3DL 3JTSB 1R3IL 5M94B 3KPSE 5D96C 5KVGL 3W9DB 4PYHA 1EERB 2ZUWA 5IVOA 3MRLB 2KKQA 1KCKA 2OBGA 1TZGL 3V5KA 2NY1C 3OAZH 4KRPC 1BREA 2AJZA 3VFRA 4KZEH 3AS3A 1ZHBB 5T3XH 2AQ2A 2QHRH 4JG1L 4ZSOA 2FRGP 1WFNA 2WBJC 3BWAB 2J4WH 4HIIA 2FEDD 4X7CC 1T89C 1P4IL 4P5TA 2ADJA 2Z93B 3KPLA 1LK2A 3HMXA 4MLIA 4OLXL 3TT1H 4XPTL 3NMEA 5BMFH 3E3QE 4ZTPL 4M8QB 4U1NA 4NQVB 5BVPH 4H25B 4RCAA 1U8KB 2CLVA 1KLUA 1MIMH 3EYOB 4PJXA 4TRPH 4OQTA 5KSAA 2WV3A 4LSPL 2P5EA 5EZIH 1YEGH 4FZ8L 5ISZA 5HI3D 4EUPB 1KT2B 1ZS8B 4HUXB 3HUJF 4IS6B 4JKPL 4U7SA 3MRMB 4QT5A 3QDJA 2YA2A 2BY0A 1DLHB 4NFCA 2WIIA 3TEUA 3GUTA 2XWJB 1CU4L 4UT6L 2F5AH 3MLTA 4JCLA 2DQJL 3UAJC 1I7RB 3EJJX 4RRPA 3MLYL 2FBJH 5FYJU 1BBJB 5F6IB 4HIEB 1H5BB 3V6ZB 2Q87A 1II4E 3MOBL 3KPRE 4Y4FB 2I9LB 4LSQL 2R9HD 4HQQH 3DTXA 3MTRA 3WHXB 4IRSA 1AGCA 3THML 1EAPA 4X8JB 5TDPB 2CH8A 1Z0MA 5CEZD 5C09A 1I9RL 1WF5A 4JY4A 3VGDA 5BQ7A 2W0LA 3DWTA 1QFUH 2PF6A 1HEZB 2IAMA 4L9DA 4GAJH 1FZKB 4XNYL 5FOBA 3D39E 5IUSA 4AG4L 5CBEA 4NBYB 2C4FU 5DT1L 3GJFK 4WEBL 3DROB 4EDXB 3LB6D 4HGMA 3S35X 1FH5L 1K4CB 3GJFA 4XAWL 2ZKHH 2P5WA 3NAAH 5K59E 5FECB 3H9HA 3MRMA 4OLXH 1G9NC 2PYEB 1NMCB 1XCTB 4JQVA 5E2WH 1FPTH 3FQRB 2DM7A 1W72A 4Z7WE 3G6JB 4GJTB 1AGEA 5FUOH 3B9EA 3U9UA 5JNYB 3ZT6A 2YWZA 4GQ9H 5F7WC 3LV3B 1HHJB 4K7FB 1A1MB 3WUWG 2X4SA 1V3LA 2Z35A 1BD2D 2OP4L 1DQQB 4QY8A 4ORGA 4QWWD 4I0PB 4CVXB 2D3VA 4MJIE 2ZSWB 3WN5A 4E42B 3MRJA 4TULL 4CUCA 1HH6A 1J1PL 1XIWD 1Q9OB 3WMSA 2YD6A 2JJUA 1CVRA 5M7QA 4EKXA 4PJIF 4XMPH 1M6OA 4D8PA 5EBLB 2AJSH 3TO2B 4I8DA 4CBPA 4EBQH 4LHUD 2LTQB 1PJ9A 3RY6A 4KVCH 3OKDA 1KG0A 1MCKA 1T4KB 2H8PB 4X6CB 2AABL 1YUHA 2JELL 3MUGA 5CAYB 4LSUL 4Y4FD 5F8RC 3SE4A 1HWHB 5EU5B 4C56D 5FO8A 1PBYA 3BEVB 2VQ1B 3EOBA 5I8EB 1VACB 5GRVL 1GOHA 1WCBB 1T0PB 2J12B 5K9QG 4JJ5B 4HZLB 1OL0A 2NY6C 1Q9LB 3FFCA 4N5EC 2XN9E 4Q2ZA 4QF1A 2NXZC 1L6XA 3HG1E 3PABA 3U46B 1FE8H 1RSFA 4G3YL 4ONFH 5DO2D 2PW2B 1TCRB 1IAMA 1KIRA 2FH6A 5H8DA 1EJ6A 1KJ2H 3TJHD 2NY7H 3BGFB 2BRRL 4DVBA 2AEPH 2ZSWA 3WN5B 1VFBB 5DF0A 3RWCB 5C0JB 5KS9E 4RAHA 5CUSL 1R3IH 5IBLC 4YHYB 4U1JA 5EC2A 4MMZC 4MA8H 4DVRL 3MLUL 4MA1C 1DVFB 3EDEA 1QBLL 3QG7H 1Z9LA 2UWEF 5FUCC 3DV6A 5A3IC 5C71A 4FQ1H 4ETYA 3RDTA 3HS0A 4JFPB 4K8RH 3U0TB 2BNQD 1FORL 1G7JB 3U48A 4FXGA 3D87B 4N1HB 4QLRA 3W81A 3VU2A 1JNNH 5E6ID 4BZ2H 5I1GH 4F9PA 4FXKA 4I5BB 2XWTA 1A1MA 3NAAL 4FNLH 2EDTA 4KK9C 3HG1A 3PABB 1O7SA 2ZWLT 4V2BA 5HHXL 1A3LH 1EAJA 2J8HA 4R3SA 5IESH 5IIEB 2ZUUA 3GSVA 4FQ1L 2XZZA 3UYOD 2KDGA 7CGTA 4RFOH 3GMNA 5C08E 4JDZB 3LKNA 3SKOA 5ABDE 3PWUA 4WI9A 3FQUB 1OAUL 4LRIA 5FK9B 2QQLL 4RRPG 4PRDB 4HGWB 3QDAA 1CGSL 1IM9A 1KFAH 4P2QE 5HI4D 4F58H 3E2HB 5C6WH 4XPHL 2CJUL 3QI9C 4JHAL 3ULUD 4H1LA 4WFED 3OTTA 2YSSA 1KLFA 4I3SL 4MNGB 5INDA 1KGCD 1A6AB 1PG7W 3R8QA 3SGDH 3KPQA 3D18A 4PTUB 5HYIA 3MUHL 3OB0K 4FQXA 3OMZA 4G42A 1LILA 1I8KA 4Y19B 1R3HB 1R3LA 1Y0LB 1FLTX 5FO7A 4IRJB 4JFXB 3MLRL 2D7PA 1EGJL 2WNGA 4Z7NF 1ZWIB 2JJVA 5MENB 1CR9H 4IIQC 2EH7L 1YEKH 3QA3B 1K3ZA 1F4AA 4KDWA 1BZ9B 4OCLC 1XF4A 4HFWA 4R0LB 4OD1H 3O6FD 4Y2DA 4UQ2B 3RHWF 5KVEH 3AU1A 2DB8A 4JKWA 4R4BA 1EA9C 4XC3L 4DKAA 5CEXB 5IMKB 4NO5B 5FUOL 5HYSB 1YEGL 4FZ8H 1F3DH 4ZD3H 4OZGA 5I18L 1KTRL 1YNKH 5ILTL 3NGBC 5F9OH 4JFYB 2IGFL 5CIPA 3I02A 4MZ3A 1KYOJ 3BKML 1UCBH 2LFGA 5LWYH 2EZ0C 4R8WH 4P2QA 5I1HH 4HJ0D 1T2XA 4X4YA 1VKXA 3PIQB 2VH5H 4Y2OA 1R5VA 5SX5K 3VRIB 5D1XC 3WJLA 1EHLH 4PJBF 1Q8MA 2YSSB 4LSSL 3W9DA 1M7DA 2HJFB 1IM3B 3KYAA 5DFWH 3HI6H 1OARL 4P2YA 3BIKB 1YMHA 3O11B 1PFCA 4FQXB 3P30L 4G7YH 4ACPA 1JNJA 2ICCA 4J12A 4XNMA 2R8SL 4PJDF 3K1KC 4QEGA 4YAQB 2V2TB 1RMFL 1TQBB 3PNWA 5ADOL 4LSVH 4XCEA 5DYOA 4Z0XB 1IEBB 4FQIH 4W6WB 3O4LB 5KG9B 1NFDF 1D5MB 4NN7C 4F2MA 3HPJB 2Q7YA 3FB6B 1AHWA 1NBVL 4XX1E 5E5MA 4M1DH 5GGRA 5DMKA 4ERSH 4HG4K 1ZT1A 4KRPB 1U8OA 3NPSB 3L3JB 1FZOB 3X17A 4WEUD 2HTKD 5BS0A 4QTHA 3AFLA 1KTLB 1A9BB 1T2JA 1WVZA 2J1KA 3ARDD 5ICXA 4LLDB 5IMLA 4AEEA 3PIQA 3QXVA 3VFWB 4JKMA 5GGQH 5BZWB 3DRTB 2CK2A 1NLBL 3QIUD 3RJQB 2G60L 1JCKA 1CYGA 5F9DC 1Y18B 4JO1H 1CD1A 5DJAA 3EFDH 1EV2E 3MX0A 1D5IH 4PJ5E 1G9NL 3PQYD 4HUVB 2XRAL 3ARGB 2DTMH 1QLEL 3HMXL 2NCMA 3TNMA 5IGXH 1C1EL 3IFOB 2IF7A 12E8L 5DEFB 4IIQB 1T5WA 3AY4C 2R2BB 3BVNA 3HNSL 2Q76B 4EIZC 3JWOL 4M5YH 4LK4A 2DLFL 2P47B 5J11B 1IGYB 2Z8RA 3EO0A 3O8XA 3BAEH 2VRAA 1CWVA 3B2UD 3I84A 1S7WB 1EVTC 2CDGB 1LEIB 4RA0C 5FYKE 1DQML 4X80H 5HI3C 1F3RB 1NC4D 3BWAA 1MAKA 4QWWC 3UMTA 4XMLL 1QKZL 3L7FA 3QCUL 3AXLA 3KPOA 3GMPB 5IB3A 5FYKU 3GM8A 3TIDA 2W38A 4NKOA 3QEQD 1Q1JL 3W0WA 5BZWA 3JTTB 3MQIA 5TQ2H 3HAEA 3ARFA 5D9SB 3CK0H 3HZKB 3P73B 3M17A 5D7IB 1W0WA 1BLNA 1SYSB 4PGCA 1F3JA 1SBSL 1H3PH 3FAWA 5KSAB 4LNRA 1P84J 3IDGA 4K7PL 4ODSL 3NZ8A 1F6FB 2BSSA 1I8IB 1OGTB 2XT1B 3WHE0 2FGWH 1A6UL 4FQJL 3QNYA 2R0ZH 4LFHG 5CD5D 1EO8L 3CFCL 3ARUA 1P7KB 2EH8L 1CFVH 1DBJL 1TXKA 3T0EA 1BECA 3LS5L 5E99H 3F58H 1MLCB 3LZFL 5JW5B 5D2LA 1KJVA 1VFUA 2ICWI 5AD0B 2NXYC 2DDQH 1CGTA 5B39A 1SJEB 2UZIL 3DMMB 4JRXB 4KVNH 4DZBA 1CG9B 4QYOA 1S9YA 1A6VL 5JZ7C 1J0JA 5IHZB 3OKDB 4QRRD 3P77B 2GFBA 2IFFL 1EHLL 3T1WA 2CGRL 2ZG2A 1T21A 3I6KA 1UADC 4YHZL 4N0CD 2J8UA 3QH3A 2BSTA 4ZAKD 1RZGA 5F7UA 4IDJL 1KTKE 4L4VE 2APWA 5F93C 3LKRB 3HRZA 1WV7T 4RFEB 43CAB 1LO0H 2HFFA 3DURA 3KWWA 3DI3B 1BJ8A 4D9RE 4ZUUB 4YDVB 3U46A 1FV1A 3LEVH 4XPAH 5IVXA 4PJGE 2UWEB 4PLKD 5L0QC 3W2DL 1EX0A 1IAKA 1NGPL 5C8JB 1JV5B 1L9NA 3TBVA 3VFUA 4PJ7F 2DQEL 1GXEA 2VLLB 1BQLH 3GDBA 3MLWL 3W82A 4GRWE 4RMTA 2DYPA 3UC0L 5DK2B 4JR9L 3UPCA 5C92A 3ILQD 1M1SA 3DUSA 1U92B 1SJXA 2VMFA 3PQYE 4QXTA 5CZXC 2GT9A 1HI6B 2R1WA 1OM3L 5TGBB 1WFTA 5HHOA 2GFBB 2BJML 5FA4A 3W0WB 1S9XA 1QYGL 3PWVB 4O5LH 4KWUA 3CSGA 4HBQA 4BK4A 1S8DA 1UVQA 3B9AA 1KPVA 3MRIA 1RUAL 5CZVH 5C0CE 1DDHA 4BSVB 3GI9L 4NN6B 4N1EA 4PLOB 3LVEA 5CGMA 4JQXA 1TLKA 3VFNA 4YDKL 1T04B 1GC1L 5LXGL 4L3ED 5EDXA 2H9GA 2P8PA 4HGWA 5E7FA 4A6YL 3AREA 2AXGA 1CE1H 1RUQL 2X40A 1MWAA 2DI8A 4NN7B 1A7OL 1J1OH 3DYPA 1FL6B 2FZ3A 4LCYB 5INDB 3QUMB 3HNTH 1BF8A 3B6SB 3TYFB 3KPPB 5IFJB 5TH2A 3MA9L 1PGRB 5L2KA 3MV9B 4Z77B 1NEUA 1RZKC 2DM3A 5HBBA 1AD9B 1OAZH 3HC3H 3CZJA 1RFDH 2HFFB 2DLHA 2NY5H 2Q86A 2AEPL 2C7UA 2D7TH 3DX9A 1F45A 3D48R 5FUCE 1WSST 2LV4A 4YHPA 4A6YA 1JBJA 2E6JA 3AAZB 1AQDB 2AK1L 2GCYB 3V95A 1S5HA 4UOW1 3VG0L 1HK6A 1MHEB 4U3CA 4X6CE 4LEXH 5CJ5A 1T66D 1XR9A 4C4KT 4ODVH 3F6LA 1T0NB 5I8CA 1I9EA 3BEWA 2OR8A 1FJ1A 3W0WD 3HE7B 1BVZA 3MRLA 5I1DB 3ARFD 1CLYL 1GIGL 1X6LA 3SKUD 3WNLA 2VZUA 4YQXL 2IPUK 3CLEH 3LKQA 4Y5XA 1P7QA 1WBXB 5DT1H 3RX7A 3V6OC 2D03H 3B6SA 3TYFA 4NKQB 2R2EB 1KELL 5EUOE 2JCCA 4QRSB 35C8L 3L5WA 1OB1A 3FQTB 5I8OH 3G6JE 4Y4HC 3IAGC 2VLMD 5EZLB 3QYCA 1Z2KA 1H15A 2VYRE 1SMOA 3VXPA 3QXUA 3V52L 1DN0B 3WFEL 1JNLL 4JN2A 6CGTA 1KIPB 4DGIH 1ZANL 1CDYA 4TTDD 4GFTB 2MCG1 1FDLH 1MPAH 3BPCB 4M00A 2BERA 3ZDXE 3FB6A 2Q7YB 3Q5YA 5GQBA 2VITA 4X7SL 1CU4H 4IOFC 5JHDA 5KN5B 4M7LT 2HKFL 4OM0L 3CUPA 5E2WL 3O11A 3MBEA 1U9KA 1EEZB 2AXHA 5LJYH 5ERWB 3WNNA 2HKHH 3ARDA 2PYED 3KR3H 3KS0H 4WWID 4N0YL 5E8PA 3LIZL 4U1KB 4ZO9A 1XCQB 4ODHL 5D7LE 5DHVA 2EDKA 2EC9T 4PRPD 4WHYH 5EUOA 2E9BA 1XF2A 1A4JB 3BO8A 2R2EA 2Q1EA 2AW2A 3K80A 2XG4A 5GPRA 2ENSA 1LE5A 1A6TB 3X13B 1VFOA 2DD8L 1SY6A 5FOBB 1KEGL 1HHIB 1YY8A 3MXWH 1CD8A 4MQ7A 1FZOA 4JVUA 1OSPL 1S7SA 4BJLA 1QLFA 3TJEH 2NX5A 4LHUB 3A6CH 4YDIL 3QEQB 3S34H 2V5RA 2YEZA 2FX8L 3RNKB 2ED7A 1CFQA 3L3OA 3QO1A 4I77H 3MCLL 5JXED 5HDLA 3A6BH 4M62H 1QFPA 3BX7C 4S1DC 1CN4A 3UJTL 2DBLH 3F62A 1YEJL 4G8IA 4ETQB 4JG0H 1P1ZB 3JWDC 5I1EL 3IETA 4NQCA 2CDFA 4Y4KC 3U9PH 1DSFH 2F9BT 4MCZB 5D7LA 1CZ8L 1P9MA 5BV7B 1T22B 4NUJA 1WC7B 4AIOA 1TZHB 1QHOA 3D0VB 3PWPB 5LCVL 2YA0A 1Y6NR 5T1KD 4AEIL 3GJEA 4X6CF 5F9JB 4M7KL 32C2A 2VXQL 4UIMB 5EO1A 1QSFE 3EYFA 4P3CH 4OGZA 4MZ2A 4RGNB 2X7LB 5C08B 3FQUA 3D39B 1N3NA 1YN7A 4C58B 2IMNA 1YZZA 1YEKL 3O3DA 1WJ3A 2OLDA 3BMVA 1K8DB 5SWZB 2QSCH 3O3EA 3P9LA 3W5MA 3JUYA 3MOAH 2X9XA 4QCIA 2YD3A 1QQDB 4RMUA 3SE3C 4P3DB 1MQ8A 4L5FL 3EHBC 5CD3B 1A7PL 1AC0A 4XI5D 2D0HA 2VIRA 2O5ZH 3RWIA 5H35B 4Q9QH 3ULVC 2XKSA 2YXMA 3ARBA 3S96A 2YOCA 5JPMB 3NABL 1P5UA 5ESAA 3O9WC 1JK8A 3HAEG 2GSIA 1J11A 2CXKA 2IADB 4L9LA 4U6XA 3LQAC 4OM1H 1HSAB 3X3GL 1L0YA 4GW4A 3V5DA 2C3XA 3Q6FB 5T1LA 1IQWL 3V0VA 1KPRA 4GRLD 3QIBB 3WIFB 3LN9A 5GRXG 2YD2A 1GC1H 4V1DE 4F7CA 3MV7A 5ESVA 5L8KB 3CXDL 3HA0A 1PEWA 3GMOA 3NIDF 4QRPA 1NCCH 1T3FA 4PRPE 4PY7B 3SCMC 4GKZB 1T21B 3TIEA 1QA9A 4HKJB 4OI8A 3GJFH 1UH3A 4MD0B 2BMKA 1U91A 3MGTA 1F3JB 4LQFL 2WWMD 1BPVA 1A1OA 3T4AA 2DQUL 3IF1A 3VXOA 2RJMA 3OZ9L 1DCLA 4NO0D 3QXWA 4JHAH 5DYOB 1MAML 3KPSD 3FQXB 4LPVA 4QXUL 1AXSB 3MJ9H 4F15C 5I66A 2ZOLB 3OF6D 1CQKA 5JOFA 3RAJL 4YBQC 1MJ7L 3X11A 4ZUWA 4D3CH 2W65A 3HI6L 1BVLB 3L3HB 1BVKB 1UZ8A 4EN3D 2YA1A 4J4PC 1ZHKB 1FZKA 3D3VE 2CRYA 2V7HA 3PGFL 1S9YB 3QAZB 3V5DB 4LLVA 4I18C 4P46C 1NBZB 4ISVB 1ONQB 2Y6SD 4JFZL 2DQFB 1OAXH 2YBRB 4Q6IB 5KSBA 5TJWK 1RVFL 2EDEA 2VUYA 3ALPA 4XVSH 2EDLA 3TCXA 1MJ8H 3WV0A 3MRQB 1XCTA 2VDML 4MAUH 4F7MA 5CMAB 1EDQA 4KHTH 2E7CA 3UTZB 4I48B 4JJHA 4OM1L 1Z3GH 1LO0L 4PV8B 1SYVA 3WSQL 2V9QA 3LD8C 3TFKD 4HWZA 1F5WA 4UNTA 3FL7A 4HUVA 2VDNH 4OF8A 1U3HB 1BIIA 5F3BB 4ZAKB 5C8JA 3PV6B 1PAMA 1HNFA 4P2RD 5A43C 4NZRH 4AM0A 2DQEH 3HN3A 4NQSB 4CVWA 4L4VB 2C3VA 5HY9A 3JV5A 2EDHA 2HT4D 5KVMC 1YPZA 3PGCB 3QWRA 5HD8C 2OXGA 2NZ9C 1JPFB 2A74A 3VI3E 3ARVA 3TIEB 3NIFF 1N59A 5JW4M 5GRVK 2GEEA 4CW1B 1DE4B 4LBEB 2HFGH 1Q0XL 5D9SA 3MRJB 5A3ID 3CK0L 3VMPA 3FB5B 2EKSB 2X4TB 4L8CB 1IEBA 4KGLA 5B4MD 4LNRB 4P2RA 4V2CB 1JWSA 4NKMA 1AD0A 3VXMD 1AXSA 2JJTA 3TPUB 4OV5A 1NAKH 5F1IB 5FKPA 2X4UB 1G6VK 1GVIA 3RVUD 4S2SB 4NIKB 4AMKL 5I1EH 4FG6C 4OI9A 4CVZA 4PRAA 3MRNB 4AQOA 2FATL 1UXWB 1A7BA 4OSUH 5D7KE 5AD0A 3LKSA 2BNRA 3P0YL 2ADIA 4GUPB 2NXZD 3AUVA 1IKNC 4P4RB 3SDCB 1KLGA 1FIGH 3MV8E 1AR1D 1NCBL 4NN6C 1I7UA 2E8YA 3B5TA 4CMHB 4ZSOB 3KPNA 1TVHB 4WIQA 4RMRA 4XNXL 2O5ZL 4MJ4A 3T65A 5HHQA 4JZJB 5E6IB 4ZFZA 5CCKH 2H26A 3O3BB 5C0DB 5HDBE 4R90H 3UDWC 1MCQA 3K4ZA 4UT9H 1G9NH 1A7QH 2X89D 3OKLA 2PXYB 5HYQB 1RZFH 1CF8H 3FT3A 1IEHA 3RKDC 2Y4SA 1ZVYA 5E4EB 1EMTL 1GGTA 2BSRB 2H2PC 4Q0XL 1MCCA 5JDSB 2Q76A 3WJLC 4YQXH 5C6PB 2XWBA 3X13A 1WZ1H 1EEUA 4L4VA 3JVGC 4K3HA 2AJ3B 5JHLH 3HB3C 3F5WB 5D7JC 1P7QB 3BQUD 2W9EH 3GM0A 1LO5B 2NXZB 3O2WH 1B3JA 5GHWL 1S9WB 3I50H 2R1WB 1D6EB 1NFDE 1OHQA 4YBQD 1U8HA 1OCWH 4CAGA 1CGYA 1FFNA 5SWSE 1Z6JT 2Y23A 3EFDL 5D7SH 1EO7A 2X1XR 5DZOA 1M4KA 3O4LD 3QG6A 3NCEB 3MRPA 1D5ZA 3S9DB 4K3EL 2VC2L 1C7SA 4KJWD 1ACYL 3VXUB 3ULVH 2GK0A 1ZHLB 4WI3A 4XHJD 2W91A 3CPLA 2HRPL 4R0LA 1DDHB 2RGSA 3O4LE 2OZ4L 1G7MB 5T3ZE 5IB2A 2L7UA 1LK3L 3RGVD 4FABL 1XIWA 2DWDA 4JPKL 1V3MA 4MNGA 4HG4J 1MI5D 2QSTA 3MO1A 2ZKHL 4DKEH 4E5XA 4JY6B 1MCDA 4R2GC 1K5NB 4M9OA 2VQUA 4BFEA 5GISL 5DUPH 3F5WA 1SJHA 1CF8L 4PGZA 4XP9H 3C60A 3BSZL 1S9WA 2VZTA 1WWWX 3MV11 1G0XA 3ZKND 1JTPA 3MA7A 1PX3A 1X5AA 3DYOA 4KK8C 3IDJA 5FKAA 2OTPA 4NT6B 4PGBB 3CFKA 4G6MH 3S6CA 4Z0BH 1FQ9C 2EYTA 3BP6A 4MQ7B 3W5NA 1TZIA 3ULUE 1G6RA 4WFEE 5KVFH 5GGVY 5B38G 1FVEA 3MV8D 3TJHC 4P46D 3O2WL 3D39A 4OGYH 5KOVC 1VGKA 3V52H 3L95A 4U1IB 1ZLWK 1WIOA 2DQCH 3IU3A 4KK5C 4OCSL 3KNBA 4DEPB 4HS6A 1S5IL 3FFDB 4NSKA 3GIZH 3QHZL 4G9FB 4ZFOB 2VL5B 5LBSH 1A22B 1NSNH 5KJRH 1P5VA 4RFNB 5J7CC 1L4IA 4HIXL 2FGZA 5KVEL 2CIKA 1EHAA 3PP4H 4WGWB 1J1XL 1F58H 3DVNA 4XBEH 4CMHC 3HE6D 1T83C 2BNQA 4XMKL 3W39B 3HPLA 5F1NB 2ZOKA 2NZIA 1N5AB 3EZ8A 4XNQB 3MODL 4K9EL 5HYJB 1NC2A 5C6TH 1MRDH 2NYYD 4HMEA 4MS8D 5JW4Q 3ZDXF 1A4KA 1X3DA 3AMKA 1B0RA 3FN0L 3CMOH 2VTFA 3TCLA 3QQ4A 4NZUH 1KPUB 4MA3B 4Y16C 4K8RL 3WLBA 5ALBL 5GS2H 3RGHA 2NR6C 5GS1C 5I66B 1P53A 5BS0B 4U1GC 1BJ1H 4MJ6A 1A6VH 3P0YH 4N0UE 1X6NA 4UMGA 1YDPA 25C8H 3T4YB 4E5XB 5HYJD 3RUGB 3ULVL 4CADA 2LU7A 4NNYB 4P59L 3G6JA 4JEGB 5SV3A 3C9NA 4IRJD 4MD0A 3LY6A 2NY0C 3KYMA 1EEZA 4MD4B 2EE2A 5TDNB 2H45A 5E8OA 3WUZA 3HCVB 5DD0H 5B38A 4MB5A 5I1AB 1B0WA 5AUMB 1OVZA 3RRQA 1REIA 3VFGL 5CLWA 3S4SB 4Y7MA 5DD5H 1OT2A 1NC2B 1A7NH 3HE7C 3N06B 4ZUWB 3LPFA 5T1LB 5D1XB 4HS3A 4JM2F 5DUMH 2ZUXA 1TJIH 3ROLA 3SCMB 1MRFH 2Z92A 2IANE 4LSTH 4HK0A 1YEIL 3QDJE 4HAFA 2H8PA 4OBRA 3SGJA 1TQCB 3P4NB 4TPRL 4EXPX 5IW3A 3G5YA 2EDXA 2B7DT 3KYOB 4R26L 1G0YR 3W11D 1SJVA 5KJRL 3T4YA 3F12B 3V9FA 4R4FH 4ELMF 1NAMH 4L5FH 2P45B 1R5IA 3EYVA 4HULB 5LVEA 5JIIA 4X6EA 4WI6A 5TE4L 1GCFA 3CLFL 3CVIH 1CTNA 1EZVY 3N1MC 1BZ9A 2ZOKB 4XNQA 2EC9U 4NRZA 1C12B 3O0RH 1OLLA 4JR9H 3HE6C 2KPNA 1VENA 1KCUL 3BDXA 5EH1A 3TYGL 2EDWA 3OXRB 2HP4A 4LVOC 3JWNC 1HYSC 1S7UB 4HC1H 1SVCP 4M5ZH 4ZQKB 2V7HB 1KLUB 4XVJL 1TMCB 2BSED 1J05A 3O45B 4LVHB 4AEIH 1RUPH 1INDL 5KAQG 3BIBX 2OQJA 3MJ7B 1U93A 2FEEI 4J7RA 1Q9WB 3RGVC 1ZHBA 4F37F 4E9LA 4HUUA 4KI5E 4GRWB 3C2SA 1Q72L 1K4CA 2BDNL 3DVGB 4G8FB 4OLUH 3GUTB 1WIPA 1JPTH 3J8F7 2F58L 4FA8A 5KSAC 5JLZA 1SYVB 3SDCA 5SX4I 3D3VA 1ZLVH 4C83B 4TQEH 5T1KB 1UJTA 3D85B 4MNQA 3RU8H 1MI5B 4OBSA 4PJFA 3RPKA 1JWSB 3UX9B 4X6DB 5I1CL 2DQUH 2R2CA 4P5TC 2F5BH 15C8L 4NRYA 5JW3L 3Q0HA 1T89A 4KKBC 2AAVA 3C5ZB 3TT3H 3K0WA 1HINL 1X5LA 3PXHA 2WBJA 2Y1VA 5IBUG 1A6ZA 4NQSA 4D9QD 3GMNB 5BZDA 3DBXB 1CD9B 2DQDH 4ZXBD 2G5BA 1ZGLB 3HR5A 1HXMB 5H94A 4BSVA 4U6XB 5D7SL 3VXUD 4NRXB 2GI7A 5BJTA 3KYKH 2W9DH 4H88L 2EECA 1T1YB 1JPFA 2M26A 1XF5B 1AKJB 1MVUA 4CDGC 2IH1A 3VDAA 1W72L 1WICA 2Z4QA 5L88L 4JPIA 4HPOH 4G9DA 4YHML 4QHKJ 5JTWA 4KI5C 5GGUA 2OTUB 5DJ0A 2GJ6E 2E5EA 5DSCA 5DDHA 4XVJH 3QWQB 5BQ7B 1U91B 1LD9B 5CBAB 3T3ME 1K4DA 4JM2B 4XWOC 1DSFL 4X5WA 3NTCL 3GMRB 2YUZA 4PJIA 5FDWA 3NIGE 4X4ZA 5IFJA 4GBXC 3V4UH 5HYQA 5IHUH 3UTSD 1JPSH 4M6NL 3WIHL 4OLWH 2R2BA 3BP7A 4TVPE 2W0PA 4FFVD 4OJFL 4OCWH 2W65B 4EI5D 5KTEH 4P9MH 2GJZA 1TVBB 2J6EA 3DLQR 3UCRA 2LABA 4NCDA 2GCYA 3VE0A 3Q1SL 2A6IB 4LLUA 5FYJH 1L9MA 4MAYB 1KG0B 1T4KA 4O58H 4NC0B 4H20L 2WIMA 5MERB 2DL9A 1A9EA 3V4UL 4G6KH 3DYMA 5A40E 2P24B 2ERJB 3GMPA 4KJPC 5IB3B 4ZNCD 4Q9RH 4ZPVB 3EO9L 2YPVL 1I1AD 1T5XB 3SJVE 4OLYH 5D2NE 3O41A 4TUOB 5GS0H 1MWAL 1MH5A 3LAFA 5GRUL 1MFBL 3ZLQC 4EIGB 5H35A 1LNUA 5IP4A 3E6FA 4JQIL 4MHHG 3MRDA 4GKNA 5EN2B 3MACH 5T1KA 5J13C 3VXUA 1XR8A 2HJKB 4PJIE 3QIUB 4LPXA 1CLCA 2IBZX 4G6FB 4D9LL 4K3JH 4QHLB 1J86A 4MJIB 1YN6B 1CDJA 3I9GH 3IDJB 3QUML 5BZDB 5DQJB 3NCYP 2KQNA 3F7YB 4HEME 5C0AD 1MHPL 2FIKA 3T0EB 1F3DJ 3BH8A 1LO2H 1GH7A 4UINH 1UB6B 1H3WM 2DMBA 4ZG1A 5D96B 1EGJA 2XNAA 4RGNE 3U7AA 5I19H 15C8H 3L1OL 4FG6D 2PKDA 5ISZD 5BOPA 4WO4B 4XC1L 4WHCA 4Y5XB 3KNBB 4U31A 3ZKSD 5IV2A 3G5XA 1RUQH 2FO4B 1NEZB 2R0LL 5E56A 5IQ9B 1MHHB 4NHUA 4UDTA 5K9KA 2OSLB 4DJMA 4NZRL 1D5ZB 1IZKA 1CLOH 4HIJB 5FYLH 3LKOA 2XYCA 3EDJA 5B3JE 1G7IB 4NT6A 5GJSL 3FO9A 5C6TL 2X9WA 4G3YH 5IW1B 4PJXF 2MJWA 4Z95L 3SBWA 4U1LB 4FTVD 3DO3A 2DLIA 4NP4L 2V7NB 4U1JB 5EC2B 1I7TB 2NY0B 1SY6L 4LKXA 4MSWB 4IRSD 1ZAGA 1TJIL 5IVXB 3IVKA 1T7YA 3BP5B 5K9JL 3BP7B 3IJHA 4NO3A 2Y6SC 4M7LH 4LCUA 2BVUA 4ZFOL 1IAKB 1TVBA 2KH2B 5MEOA 5ID1A 1PW3A 1CDIA 2FBOJ 1N4XL 3TH3T 4JGMA 3OR7B 4QHUA 4FFZH 3F7VA 4ZUTA 2JELH 3BZ4B 1QHPA 5T5FH 3V4VH 4P2RE 1NANH 4LU5L 4WWKB 4WI4A 2V17L 5FA4B 4Z5RB 3JTTA 5F7EH 5HYFA 5D5MB 1TJHL 4LEOA 3GMLB 5CINL 3QXTA 5TF0A 4QGTA 4YE4H 3QEGL 5MEND 4TVPD 2WWMC 1R5WA 3M17B 4ZUVA 1BQHB 3MRDB 3LCYA 1MSPA 4L1DA 3QPQD 3H7BA 4CJ0A 2EYTB 5C0FA 1CCZA 3BP6B 1K2DA 2OP4H 4K8RD 4L29A 3LKOB 4YLQT 5I1JL 2VJXA 3PWUB 4QXUH 4Y8DC 1AGFA 2EEAA 4JZNA 5DJ2B 2H3NB 3KHOA 4GRLB 5IR1A 5KBNC 5T1MA 1AI1H 4WW1B 3RVVD 2IJ0C 3ECBB 4R7DA 1T0MB 3OHXB 4RFNC 5IVZB 3BP5A 3EYUL 3V6FA 4CN4A 3TWCL 4S1SH 1K8IA 4NO0B 1YEEL 1CBVL 2BHZA 1AHWB 3Q48A 3X3FL 1G0DA 5DD6B 3FO2A 5I8KL 3H3PL 2PYEE 1JZ2A 4WV1A 4NWUH 5GZNC 2ZCKH 5SWSB 2C26A 4HIIB 3EO1A 4LGPB 3BPNC 4IJ3B 3VD5A 3CCHA 2GHWB 3CSPA 2X89A 5C0CD 3G5YB 4MDIB 4H0GA 3C6SB 1FL3B 5DWUL 3H0TB 3KPSB 5JPNB 2Z0BA 2FSEA 1JWUA 3VFTA 1FVDA 1KXQE 3FOMA 4NCC1 3QNZA 4X98A 4NO5A 3C8KB 1L0QA 4ZO6A 2NZ9D 1AIFA 4F57H 5JUEH 5CIPB 1C5BL 2OR9H 4G5ZH 3V8CA 4Q9RL 3T0WA 3VH8A 2B8OT 2VLKD 4JDTL 4OV5B 3EIFA 3G5VB 4GG8B 2AJVL 3FO1A 3KPRB 3RA7H 1I85A 1NC4A 1NDMB 3RY4A 1ZANH 5I71C 3NFSL 4PJ7A 3I75A 3RGVB 3SY0B 1MUJB 4BQ6A 4PJ9B 5T1DH 3R0NA 1FJ1B 4QCIB 1AXTL 1FZJB 2V6HA 1XGQA 1EEQA 3B2VH 1IC4H 3KYMB 4N9GA 3TLRA 4LVNB 1IRAY 3D1MC 4D9LH 3DX6A 3ARZA 3TFKC 1JGEB 2DRUA 1MCJA 2FJGA 4LDOB 4XZUB 5E2TL 1LP9F 3LQAL 4MDIA 3IJYB 1R5WB 4NQXA 4UTBL 2A73A 5CJQL 4YHKL 1G7HA 5BRZA 2R23B 2J8UF 5E24E 1KPVB 4L9LB 1JWUB 4MJ2A 3CC5B 3VW3H 1CICB 3LPGA 2XTJE 1N26A 4RGOH 4KK6D 2ADGA 3WUWA 3U0WH 1UWGH 1D6VL 2A6DB 1DQDH 3JV6A 4TNWF 2DOCA 4QHNA 1VFMA 3B5GA 3P4NA 4UU9A 4JY5L 5EG6C 3MV7B 5ESVB 4P4KC 5KVFL 3V6FB 2W9DL 3IXAB 3L3IA 3B2UC 1KUMA 3HR5B 1D9KD 4F8TA 3SDDA 3FT4B 2AJ3A 1X5HA 3KDMA 1ORQA 3S5LA 5I75B 2X2YA 3V5KB 2YBRA 3LSOA 4OZ4A 5HHMD 3FB8B 3LN4B 3KPPA 2JK5B 4P3WA 3QSKB 1C12A 4U6YA 2MTPA 4TSAH 3DVFA 2P7TB 1YY9C 5JHLL 4YFDB 2ZOLA 4Y4KD 4YHNA 4YK4C 5DA4A 5DJ6A 4DTGH 2E7LC 3HZVB 3N0PB 2FHCA 2V2XA 5KVDL 3HMWL 1U58A 1EMTH 3KLAB 3QZWB 1I3RB 4LKCB 1PLGL 3BJLA 1JUFB 1NJ9A 3LIZH 1GOFA 4GSDL 5DRWA 1T1YA 1FC2D 1BEYL 5FYKL 3STLA 1JGLL 4RWHA 1ACYH 1JV5A 3HNVH 3B2VL 4OFDA 1XGPB 3V2AR 3VXMB 4P23D 7FABH 1DL7L 3MZGB 5JW3H 1WCBA 3BGFC 4C83A 1PX4A 1GPOH 5GJTL 1QRNA 2NY2B 4RZCB 3C5ZC 3C60B 4K3DH 1ETZB 3BQUC 4YPGB 4L4TE 1UG9A 1KGCE 4JY5H 3HCVA 2EE3A 5I1HL 5D8JL 2ATPB 1OAQL 5FV2A 1R0AL 1RIVH 3PWVA 3JV4A 3OAUH 1BWMA 1FFPB 3PHSA 1JIBA 1IAIM 3GZKA 1D5XA 4ZD3L 1RZJC 1AH1A 4L3EA 3NACH 2E27H 4YHMH 4YGVA 1J0KA 2H32B 1XGTB 3U4EA 2NX5D 3E3QC 3T0BA 3LQAH 1AP2A 1FN4A 4HIHA 3REVB 3V4PH 2AP2A 1A9EB 4NFBA 4PGDA 1IE5A 3MRNA 3IKKA 2MQCA 2IH3B 2ESVB 3NGBB 4M48L 5F7FA 1I7RA 1RIUL 2ADIB 4XP5H 1F6AA 2HVKA 1P2CA 3M1BB 3DGGA 2QQQA 4HDIA 3O6LL 2J4WL 1CFSA 1KN2H 3C5JA 3CFDA 3NFSH 4OF0A 5HGGS 3OPZL 2BNQB 1QO3B 2APVA 5ESAB 4GOSA 3C6LC 4JRWA 1TZGH 5EU7C 3WNOA 4YHNB 3QB7C 5SX4H 4R26H 3MRIB 4KAQL 4HKBA 4DCQB 2FIKB 3RWDB 1FVCB 3CDGB 4JZOB 1G7LA 2XKNB 3MNZA 4XP6H 1MF2H 1DBJH 2PN5A 4PJDB 5E5UB 4Y19D 3CJJA 3HZMB 5CGYD 4WW2B 2WM0A 4LLAA 4X9GA 3BT2H 2NX5B 5TGBA 1CVSC 1UT9A 1X5GA 3ZL4L 2CXGA 4GKZA 1IKFL 2HJFA 4EUPH 3DVGA 4G8EA 3P11L 1RJZA 2X9YA 2YXFA 2W9LA 1QZ1A 5DK3A 4F33A 3EOTL 1XR8B 1QEWB 4Y2DD 5TQ2L 3RQ3A 4D94A 1CL7L 2HJLA 1X5YA 5DHYB 3D0VA 3VFPA 1MCOH 2FX7H 1PVHA 2ICWB 1IGMH 3DECA 4NWTH 3ES6B 4HH8A 5ALCL 4D0CB 1RUAH 1RZKL 4XTRD 3RUGF 2NNAA 3BOVA 3UTTA 4LCUB 3DARA 3I02B 2V2WB 3RAJH 5TE6L 3OKMA 1WT5A 3IDNA 1QRKA 4OCRH 1ZT1B 4C56A 2Z92B 2MCPL 5I16B 2NPLX 2DQGH 1YPZE 3VWJB 4BKLA 4JFDE 1IFHL 4ISVA 3WO4B 5BO1L 1PG7X 3U83A 1XIWB 2DWDB 1MJJB 1F4YL 3U4BL 2DTSA 3IJSB 1G6RH 1KXVC 3O3UN 3SE8L 4KUCD 4B50A 5JQHC 1YNKL 1A3LL 4Y5YB 2X4NA 2IPTH 3MV8B 4JFPA 4ODBD 2VDMH 4MAUL 4XMKH 1OTSC 1G7IA 4G9FE 1TJGL 4HT1L 1YEDA 3BPNB 4IJ3C 3DXAB 4HK3N 4CDHA 1J0ZA 3VXRB 3MR9B 1VEOA 3QDME 3E1F1 2J3SA 2Q3ZA 4GRLA 5IR1B 4TNVK 2ICWA 4BUGA 1FSKB 3HC4H 1ZEAH 1LP9A 3QXAB 4IOIB 5CZXD 3T1FB 5HDQH 1H15B 2NXYD 1D9KB 1E4JA 1ZA6B 3BXNB 5T33L 5GS0C 2AXJA 4XB8A 3BAEL 3BZ4A 5DK0B 3SOBL 1G7PA 4U3XA 4ZDHB 2EKJA 2RR3A 3ESVF 2I27N 2NW2A 5GIRB 1VEPA 1OW0C 2DBJA 5GSVB 4GAFB 3RFZC 3ZDZE 1N0XL 2H32H 4ZODA 5L8JB 5J4MA 3O6ML 3NPSC 4AIZB 4TUOA 3H7BB 2DYPD 4OJFH 5EBGA 5LGJA 3TZVD 2AKRA 1LEKA 4QNPF 3BSZH 3HI1B 3P0VL 2FJHB 3V4PL 3CDCA 5HYEA 3G6JF 1WCQA 4KV5F 1A6UH 4BSJA 3BH9B 3VXSD 1Z0NA 5KVDH 3PWJB 4LIQH 5I74C 4GAGL 1FORH 1FCGA 1UZ8B 5CLTA 1FP5A 4KQ3H 1HZHL 4R2GB 4RQQA 1HKLH 4HUKB 4XPGH 1U8KA 2CLVB 3RNQB 5HYSA 1M7IB 2APFA 5KSAD 1H0DB 2FL5A 1MCEA 5FM5M 3KLSA 2E7HA 4LLYB 4E0RA 3MRCB 3EZJB 5FXCH 1I9JH 4M61B 3QULA 4Z7UB 1S7SB 2HMIC 3ELAT 1OQXA 4OB5L 1QKZH 3QCUH 5FO9B 1EBPA 2EIEA 4N0RA 2BY1A 1NFDA 1S9VA 1EBAA 2R1XB 1IGIL 1QVOA 3CLFH 4XHQA 5DVOA 1CQYA 3EHBD 3BE1H 4I48A 5HYJA 4LAJH 4M6OL 4KUCF 1ED3A 3NPZB 1ZGLP 2QSQA 1FBIH 5ITFA 3T3MF 4KK6C 4Y1AA 2XV6B 2YR3A 1VPOL 3MROA 2B39A 2P7TA 1KB9J 4KRPD 3O4LA 2NY1D 5DJYB 3GK8L 3AS1A 3VXQA 1QSFB 5JOEA 1FAKT 2DD8H 3SY0A 3PHQB 5EU6E 5HGAA 4HMCA 3I85A 1P6AB 2MMXA 3L3GB 2GTZB 4WCYL 5B8CA 1KBGL 4I3RL 1UCBL 5E9DD 1CFNB 1KTDA 4P48A 1KULA 4HC1A 2A6IA 1BAFL 1V3KA 4R0LC 5DRWB 4UDUB 1P1ZA 3FB8A 4XNYH 2O5XH 2ILLA 4LASL 1EVUA 5JXEC 4PJ9D 1YEJH 1S9VB 3ARGC 5B38B 5E95B 2JF1A 5TF1H 3OX8B 5JXEA 5MEQB 3HC3L 3WJJC 2X4TA 1SEQH 4MJ5A 2FEDC 2Y06H 3SE8H 5D7JA 3RVTC 1A64A 3QZWA 1JHLH 3BKYL 4BH7B 4GG6F 4KH2A 3B3IA 1H8OA 3FOLA 4GW4B 2PTUA 1M6OB 1HHHA 1M05A 5CEYB 1ZHKA 1A7RL 1HCFX 2HLAB 3FRPA 2P8PB 3MRFA 2CDGA 2HLFC 3SKNA 5ICXB 3BFOA 4NQEA 5H37H 3VCLB 4QXWA 3U36B 1JVKA 3A67H 4YDJB 2ZCKL 4G8GE 2WUBH 3WFDL 4GAJL 3VXSE 1GGBL 1ZLUH 3UDWA 4NRZB 3BKMH 3VXTA 3CU7A 5FO8B 1I7ZA 5DJAB 1RK1B 3MBED 1CE6A 1TFHA 1A1OB 1ZT4A 3CXHJ 4MA7L 4JFFE 3FTGA 3C8KA 1MI5E 5C0GB 5FGRA 5CGTA 4Z7WB 5DD0L 4F7PB 1IKNA 1AY1L 4TTDC 2F74A 1UM5L 2WQ8A 4AT6B 2QJDA 2H6PA 3Q6GL 1HILA 5F70A 5HGAB 3GIVB 2VUOA 5DJXB 1IFHH 4JFOA 1U6AH 3ET9F 2PW1A 4K94H 5D6DA 3ZSSA 3S3JA 1QP1A 3QUZC 1ONQA 3FKUS 4TSCL 4JCMA 1F6AB 4GS7B 3P4MA 5SWQA 3WD5H 3BESR 3NN8A 1FNLA 3S7GA 3HNTL 4O4YL 5EO0B 4RMWA 1CGSH 1KFAL 4I9WD 3U7WL 4PJFB 4XPGL 5D2LE 1E27A 2AV7A 4G8GB 5L6YH 1AE6L 4TTGA 3QIUC 5EU6D 4MQSB 1MCNA 4E42A 5A1AA 3RVXC 4CJ1A 1GIGH 4MA7H 3RZWA 4EQ2A 5C0FB 1K4DB 1Q38A 4WUUE 5TFSL 1QSZA 5HHXH 5EO9A 3CDGA 1OW0A 1FG9C 4YIQB 4P2RB 4MB3A 4JG1H 1WIUA 1KIPA 4KI5D 2QEJA 3D6GA 2DQFA 3TM6A 2FDBP 2VN7A 3ZDYF 1NCUA 5C2UB 4PJAA 1G1YA 2AABH 5L2JA 4U6VL 2NNAB 3QI9D 2NY3C 5E94A 3ULUC 3NZHL 4LLQA 1E28A 1KCRH 3J7HA 1PKQA 3FO0L 3G08B 1K6QL 4JFOB 1DEDA 2VN4A 1N0XH 5JHDB 5KN5A 4AEFA 2IWGA 1WWBX 2P44B 3KDMB 3BN9C 2DQTL 3CVHB 4P59H 5IVXE 3OSKA 4JKKA 4NUGL 3VFVA 4W70A 4GG6A 2EH8H 3ALXA 5AG8A 4N5ED 5IT2H 1BZ7A 1KB5A 4Z76A 1G9MC 4GQ9L 1AGBB 4IRSB 4F9LC 3GO1H 2NY4C 1F4WH 1CE6B 3OB0H 5EU3B 4PRID 5CS7A 4KJWC 2BRRH 1JI2A 2VDQH 1FLRL 4UT6H 4P99A 2ZSVB 2CRZA 5HHOE 1BFTA 1DN0A 1WAAA 2IAMB 4PJDA 4Y8AA 3LEVL 1YJDH 3RI5F 1Q1JH 3RX5A 4QTIL 3FO1B 4JLRA 1MOEA 4YXHH 5DLML 5DJXA 2BCKB 4NQUA 1WT5C 1BAFH 2R0WL 4WO4D 1D9KC 1V8HA 4KMTL 3DOSA 4OFIA 1PZ5B 5D1ZD 4ZTPH 4DK3A 1QSFD 3SEPA 3ZE1F 4LAQL 1QFUL 2YD5A 5F88A 3MLSL 1HI6A 1JGEA 2WK2A 2QADD 3FQNA 4ZO7A 3CSYA 2FZ3B 5SWZE 4MXWL 5HGHB 4QRUB 4ZUSB 1D6EA 2ADJB 3QQNA 3KVQA 4JFEB 4IEFB 4XBPA 3AU1B 4F80A 2ICWJ 4LARL 5INCB 4UIKL 5CILH 2NMSA 3TN0C 1DJSA 2AJUH 4M6NH 3WIHH 1FFQA 4U05A 1A5FH 3N1QC 3QUMH 4LKXB 4MSWA 1RZ7L 4GUPA 2P43B 4OAWA 4LF3B 4PP2B 1QR4A 2Q3AA 5E4EC 4OKVA 3TV3H 1LMKA 4HV8B 1J9CT 3PL6B 3HUJA 5A2JH 2Q8AH 4LHJB 4LDEB 3GBLA 5AZEL 1LVEA 3UTTD 4HXAL 3RUGA 1NCAL 2A83A 2NY1B 5FM8A 3ROOB 3DV4B 1EEYB 4OIIL 3IDMB 4PFEA 5EU5A 3O9WA 3MREA 3VFMA 3D9AL 1DQLL 1L7TL 2ICEB 5IHLB 1P2CB 4M1DL 1KBGH 3BKCH 2OL3B 4YHOH 1U8PB 4Q0XH 4P57A 5IBUB 4KZDH 4OCXL 1P4IH 3WDJA 5A2KH 4I0PD 5I1AA 3GKWH 1X5FA 5T3XD 5CJOH 4JY4B 5ITBL 2BOBA 1A7PH 3MYZA 1OTTC 3ARQA 3K7UA 5F7DA 3HZVA 1MNUH 4GT7A 5C0CB 2G2RA 1MIEL 2BZDA 5T3XE 3GRWL 4YO0B 1M7IA 1N3NB 1OARH 1D5BB 4YR6B 1I9IH 1P6FA 5KSVB 5IMOB 5DJYA 2DKUA 3AM8C 3WIFA 4Q97A 3QJFB 2AERT 4S1QL 1IM3A 3LB6C 3M07A 2JJSC 1UEYA 1IGYA 4JREC 4NM8L 3OJ2C 2DQJH 2ZUQB 1H8SA 1LEIA 2GITB 1MFDH 3K3QA 4EQ3A 1U8MA 1F90L 2VXTL 4P2CG 5HJ3A 5AZ2H 3CSYB 4FS0A 4ZOCA 1ETZA 4TSAL 4XPBH 1OPGH 3LV3A 5KG9A 3VXUE 2WBJD 5T5NF 3L5WB 4QY8B 4O9HL 2UWEE 5DFTA 5B3JF 1E0OB 2CO7B 3NCMA 3BGMA 2VDQL 5EA0H 4JFQB 4UTAH 4JFDB 4R3SB 4UIKH 3VGEA 1CS6A 5C07E 2C3WA 2XOTA 4JFEE 4QOKD 1BVKA 3VXPB 3QIBA 3I3BA 5DC9B 1WITA 4R90L 3QDGB 4L3AA 2OMBA 5HGBA 1IGFL 4P5MA 3MRKB 2J6EH 2YN5A 3V0WL 4N0UB 5T3XL 2BNUA 4PJ5B 1MQKH 2DQTH 5IJKC 3WLWD 1G9ML 3EYQD 3TIDB 4LRNL 5BS0E 2GQHA 3KPQB 1UEMA 1S7XA 2A6KB 3MBXH 5EFIA 3BEVA 5ANMB 1ED3B 3ZMRA 1JHTB 4GSDH 3GKZA 4MYWB 1TTUA 5ICYB 4Z9KB 3IF1B 1QPXA 3MROB 1C16B 4KZDL 2W07A 1DEEA 3PF2A 1XF3A 2LVEA 1YA5A 2HH0H 4NQCB 3IRZA 2YRZA 2HTKC 4DTGL 5F6HI 1VEMA 3TF7C 5IFAL 2CLRB 3RIFK 2DI9A 4QHLA 1WC7A 1E4XI 5JXAL 3L95B 3VGHA 2K3TA 3QAZC 3PP3H 2F53A 2IBGA 5AUMA 3UPRB 1INDH 5IVXF 4ZOBA 5DQJA 4KHTL 4RX4D 3PDGA 1ADQH 1Z9MA 43C9B 5CEZE 1FZJA 1I3GL 1U3YA 5HY9B 4YDKH 2YD7A 5DK0A 1JGVH 4NQCD 2B1AH 3BD5A 4LHUA 1RZIA 3EOAB 1RV6X 5EC1A 5FOJA 3REWB 4Z95H 4F3FB 4QKXB 4GMTH 3O2DA 4OZIA 5CMAA 5F1NA 2Z8WC 1ORQB 5EOCH 4OT1L 4GRWH 2V5SA 3P73A 5DSCB 4NQXB 5C70A 4KTEL 1DE4A 3MA9H 3SKMA 1RK1A 3IETB 4KPHH 4JZJC 4FQQB 5D1XD 4MJ5B 5FGBC 1FFOA 1DUYA 1EUTA 3CAFA 5J57B 1MREH 3QCVH 4NM4H 4ONGH 4XPHH 1JGUH 4UUJB 1JPST 3I6LD 1U8QA 4RGND 2XQBH 1YNTA 5AG9A 3CMOL 5DZNA 2ESVD 4LCCA 1FNAA 3EOTH 3LPWA 3CVHH 1BBDH 3VRLF 5C09D 1M05B 4M7LL 4Y5YC 1XGRA 1S7QB 4S1SL 1HSAA 2EDOA 4H5SA 3PWPD 3QDMD 4LPYA 4FNLL 1UACH 4NQEB 1I1YA 4P4KB 4PJCA 5D2NC 2LU3A 1WTGT 5TDOA 5IB4B 1O0VA 1A9BA 3G5ZA 5KZCB 4LLQB 1LWRA 4WWKA 4KMLB 3RVVC 1TQBC 4M1CC 3JXAA 4HIXH 5JA8B 2FHFA 5JMRA 4LEOB 4XP6L 3MLRH 1E4KA 2P4AB 4JQIH 1QA9B 4HKJA 1LO3L 5C0GA 5C07D 4FTVA 3EW3B 4LCYA 4YDLB 4KI5F 1N5YL 4NKMB 3RVWC 5IQ7H 2F74B 3L1OH 5IOPB 4S1RH 5F9AC 4XWOD 3NBNA 4NUGH 1J1OL 5BXFA 5CUSH 2FD6L 2X1PA 4KK8D 5HVFB 1NBYB 3QRGL 2BSRA 1YYMH 1RJYA 5E5RB 5F3HB 2GKIA 5DVKA 1A3RH 3HG1D 1U8JB 2DQHL 4PJ7E 3CX5J 4YGVB 1OT1A 3K81A 3G08A 4AL8L 4DAGH 4F7TA 1FYTD 4YFEA 3T09A 4DQOL 1S7QA 1QTYT 3HLAA 3K8LA 5I71B 1FIEA 3FHAA 3NA9L 1S5HB 4LLVB 1FNGB 5IFAH 5CJOL 2EC8A 4FQPA 4Q6IA 3RTQC 4F3FA 4FQJH 5E1AA 5FHAH 2KZWA 3FJTA 1NEZA 3VGBA 1NEZG 3ULVF 4XPBL 4DW2L 5F88B 2QR0A 3BKJL 3CDFA 5I76B 1S5IH 3BQUB 3DX8A 1P7QD 2CSPA 3IGAB 4J8RA 4PRNA 2HKFH 4OM0H 5LCVH 4X7FC 3CFBB 1PZUB 2GK0B 2FLBT 5I1JH 3OAUL 4S1RL 1P4BH 1HN1A 2YPKB 3RP1A 3C5ZA 4M7ZB 4ALAL 4OIBA 1JNHA 5SX5H 1RZ7H 5D1ZB 1E6JH 5TF1L 1UZ6E 3O4OC 2FX8H 5D4QA 3UBXI 5JLZB 1LO5A 1IEAA 2XN9B 4O2FA 5AEAA 3VXRD 1GL4B 3ILQC 5CEZH 2ZPKL 2RCSL 4O51B 4XP9L 2R56L 1JHKL 1WTLA 2VXTH 5C0EB 1CTOA 3L5XH 2OJZL 4KJQC 4LLMB 4XCNA 1HQ4A 4ZS7H 3R1GH 2BSTB 4NOFA 4WHYG 5FYKD 2H2SD 1MFBH 1D5IL 2AEIT 3OQ3B 4PREB 3WFBH 1OTUC 2HA1A 1MCSA 1FH5H 4FQHA 4XAWH 2X4PA 3TO4A 5BMFL 5FDWB 3L3KB 3EYOA 4J3SA 1JGUL 3QIWD 4PRPA 4B53A 2XZCH 4OZHA 3TA3C 2IFFH 1EJOL 2J8OA 5BW7C 3QRFM 1HHKA 2NLJB 3BPCA 5CKAA 3VFSB 3X14B 4EVNB 2BK8A 1BFOB 1A6TA 5FKPB 1A14L 5J6HA 4WNQB 5E8EA 3MUJA 2EXWC 3EO0B 3S37H 1F6LL 1HSBB 3V0WH 2X70A 1WWAX 5I16A 3KLHD 1G1CA 5F1KC 1IAII 3IFNH 5MEPB 2ZUSA 1I8LA 5CBAA 5I1IH 1NCBH 4QRUA 1P84K 4JDTH 3VXNB 2J8UE 4FN0A 1UYWH 4ZPVA 4BA8A 4ALAH 2ITCB 4MWFA 1W8NA 5D1ZA 1EHNA 3G6AA 2VDKL 3SJVB 3WNPA 4X8JA 4TQEL 2AJXH 3PJSA 3T77B 1U8MB 5EPMB 5JXAH 3LKPB 5B4MC 5KSBE 1TZIB 4ZSOE 1IT9H 4Y0GA 3N9GL 3VGAB 2IQ9H 4LSPH 4LLUB 4U1IA 3TV3L 2NY0D 3O2VL 1ZVHA 4ODTH 3BN3B 3T2QA 1NL0H 2DJUA 1VCAA 3DRQB 1TNMA 3QFJA 3P3YA 4M43L 5I75C 4X99B 5GGTL 3FQWA 1OAYL 1JN6A 3EYFB 5DRZA 4DQOH 2BNRB 4NKIH 1MH5B 1FRGH 3G6DH 3QPXH 2XFXB 3CVHA 1MEXL 1CXLA 1B4JH 4JRYE 3RWGA 3SGEH 5HHNB 3QA3A 2AK1H 2OZ4A 3LD8B 4O5LL 5FF6B 5FYJD 2M8XA 1RZGB 4MCZA 4OCWL 4ZFFA 2ITCA 2XTJC 2F54B 2Y5TA 1RUML 4YEEA 4D0BA 3L3DB 1AO7E 2DKMA 3S8WA 4IHOB 5H37G 4OLUL 3HI1A 2IQAA 1DQJA 1E4XL 4FRWA 1TETH 1TJHH 5BVJA 2D31A 4J6RL 5FGSA 4D8PB 4XI5C 1U8LA 5C3LD 3AAZA 1QLFB 1BM3L 5CHNB 4R7DB 1XR9B 2WWKO 4NHCL 4WUUD 3SDDB 4LVNC 2QQLH 1A7NL 1VADA 5E08H 4LLWB 5DURD 2NTFB 3O6FB 2AV1A 5E9DB 5I8KH 2XY2A 3EDKA 4MD4A 4DEPC 5C1MB 1BBDL 4JGJA 1VDGA 3FCTB 4X83A 3TWCH 1RURH 5F6HJ 1ORSB 4MNGE 3GSWA 3D5OF 1WBXA 3K2MC 1TTGA 1MF2L 4BZ2L 5IB1A 4ZUSA 2XA8H 3S4SA 1WBYA 3G04A 2AGJL 2Y5TB 2AEQL 2CUIA 4Z7UF 1B0GB 3VJ6B 4NPYA 2ICES 2C9AA 2VDOH 2D7TL 2F53B 5D1XA 3UPRA 4HHAB 4UOW0 1YYML 4PGBA 1KV3A 4X7TA 3EGSB 1QYGH 3X12A 4C56E 4PJ8C 1V7ML 1U8QB 1MFCH 2UY7A 1QSFA 3N85H 2CQVA 3EJZD 4LF3A 1HIMH 5IQ7L 4GG8A 5FB8B 4U0QB 1K8IB 4Y16B 1W8OA 1GYAA 3VA2C 4EDWH 2H1PH 5C9KA 1NMBL 4M3KB 4A6YH 2MPAL 1QSED 5BV7L 1R5IB 4B0MM 1WQVT 3MREB 3GSOB 3HE6A 4XC3H 5ICYA 5C0IA 1M71B 4HJ0C 4OLEA 4PD4J 4YEFA 3B9KD 1PY9A 1LE9A 4HW6A 4YX2H 4XVUD 2B2XH 2R1YA 5F7HA 3SBWC 1ORSA 4K07A 3MXVH 3TNNB 1OAXL 4XCYB 3HUJE 3EKCA 5IB1B 2YK1L 3TYGH 1UQSB 4QRQA 4RISL 3UTZA 5EZJA 3TP4A 3C09B 4BQ8A 5JW4R 2GTZA 3LOWA 1NFIB 1KIUA 5GS0L 4JFFD 4PR5B 4KKBD 4X4ME 3H3BC 1KPUA 2BNQE 4LRIC 4MA8L 2VE6B 2MCPH 2DAVA 2BRQA 4PY7A 4O58L 2IH1B 3CCHB 4XRCB 1CICD 1K6QH 5DC0A 4ZS6C 4N8CL 5JHDE 1H9VA 2NY7L 1XGQB 3CFJA 2AEQH 1SEBA 2HFEB 5FHBH 1RUKL 4KY1H 4G7VH 4EOWH 4WU7B 2GTWA 3OKNA 5F97E 5DLMH 3GFUA 3KYNA 5E6YA 5I30H 5DD1L 3DIFB 5ETUB 3SKJH 2E8ZA 3S98A 3V7MA 1DLFH 3IJYA 2I9LA 4ZAKA 1F11B 2VKXA 4DZ8A 2AK4D 3CXHK 4QRQB 5DUPL 1KENL 3GHEH 4R2GD 1VFBA 5C0JA 2UVEA 2JKXA 3QQ4B 4Z7WA 1MFDL 2V5MA 5H2BA 2NY3B 1HZHH 3OAZK 5B3NA 1T1WA 1SJEA 3DMMA 4ERSL 5GS1A 4AT6A 1IAIL 3PQYB 1XF5A 5T3ZL 4RNRA 2Q8AL 1T2QH 2Y07H 3KLDA 3SKNB 2JE8A 2PR4L 4Y16A 4JM4H 5E70A 3O3AB 5DS8B 1GGIL 3BP4B 1BD2B 4FQIL 4WDIB 3QIBC 2DWEA 2KL6A 2XXMB 5FCUL 3DETD 3KG5A 1OCWL 4BQ9A 5ANMA 1U3JA 3TBSA 3OKOB 2JK5A 5IB5B 1IQDB 3DURB 3L5HA 1AR2A 5BV7C 1C16A 2IALA 5AAWA 2DQIL 1C08A 3RWFB 5E8DH 1FPTL 5TDPA 1JPGA 1MRDL 1U8JA 2YD9A 4J2XA 1HILB 4GKSA 2R4SH 3LQZB 3C6LD 1OP3K 3KPMA 5HPOA 2GJZB 2VXQH 2ZUQC 2JB6B 5ID0B 2EDFA 2X4OB 2WUBL 3GMMB 1DTUA 3OR6B 3FT3B 4Q74A 2IGFH 1WK0A 4OZFB 4LOUC 4Z7WF 2X1OA 2JJSA 5GS1B 3DUSB 1JYNA 2XN9A 3HZYB 4X0KA 5FO9A 1MFAH 1EXUA 2CUHA 4CGTA 2ZCLL 3REWA 3PP3K 1E4XH 3TO4C 5DQ9A 3BP4A 2FH8A 4X8XA 1A5FL 4M62L 1J12A 1ZLUK 3FQRA 4JFXA 4M5ZL 5C09B 1MWAB 3V7AE 5I76A 1GHFL 2APTA 4LSQH 5EORH 4WEMB 2HJKA 5DJ6B 4M7JH 5IK3A 5D7LB 5HVHB 3PGDB 3SDXF 2GJ6D 4OQTH 4G6ML 2EXWD 3WFHA 3QFDB 5T1LD 4JM2C 3RY5A 3DXAE 3U0WL 3DSFL 3L3GA 1BFVL 4C54A 3P30H 3LRSA 4G7YL 5H2BB 4WHTB 1ND0B 3QUKB 1GGBH 1MHCA 4DCQA 1BIHA 1AQDA 4U1HA 5CJQH 4PTTA 3MLXL 3VGAC 4PG2A 3OV6A 3PG2A 4BZ1L 3KXFE 5LGKA 4RISH 5M95B 5E00B 4TRPL 3QUMA 5DS8A 2O5YH 3LN5B 1BMGA 3PV7A 1JN6B 1KCVH 5DRZB 5IHBA 5DUML 3C5SA 3RKDD 4OFKA 3MJGX 1T66C 2B2XL 4Y4HB 3KJ4C 4KXZH 2G75A 5CJXA 4UT7L 3DGGB 2CUMA 4OTXL 4NQCE 1JZ4A 4HD9A 5C3TA 1HDMA 2BY3A 4F33B 3KJ6H 2A9NH 3NCJL 4Q2ZB 2HTLC 3L7EA 2Y06L 3O0RL 1HHKB 3EYSL 2WZPD 2F54A 3B4NA 3KPTA 1RVFH 3MA7B 1OLZA 4N0CC 3NA4A 4GKSB 3WFEH 2ITDB 5E2UL 3U79A 5FCSH 1I75A 1HOCA 4MLSA 4JKPH 5I0ZA 3I6LE 4PP2A 2VDOL 2B0SH 4NC1C 4AENB 2VLRB 5C0AE 5IMLB 4ONOA 3IAPA 4XH2A 4GBXB 4P2OC 4RGOL 1MJJA 3FN3A 5HGHA 3GMQA 3V5HA 2N56A 4G9FA 4ZFOA 2VOTA 4R7NB 1Z5LB 2I24N 4L8DB 3UYRL 1N59B 3VXTB 2GSGA 1YJDC 4LQFH 4OUUA 1X5JA 1I1AB 1NCWH 3O9WD 2XPGA 1ES0A 1PQZB 4JAMA 5IBTL 2D0GA 2HVJA 4WWKC 1U3ZA 5DD5L 4GKNB 2H3NA 3RWDA 3S3SA 2DQIH 3DX8B 2P46B 4J8RB 2XQBL 2VAAA 4MAYD 1AI1L 5K33A 1IGJA 2QHRL 2RB8A 2A77H 2J88L 1J1XH 5EOTA 5JOFB 1JZ8A 4KUZH 3IFLL 1INQA 1NGQL 2VR5A 3TN0B 4NKDB 1IQWH 1LP9B 2FEEL 3EYQC 4CN1A 5GGVH 2OCFD 4MA3A 3BH8B 1J10A 2HT4C 1J8HA 2JB5H 3VE0B 4YWGL 4JRXE 1NKOA 4FZEL 3RWJA 1SJHB 4JHZA 2XY1A 2Z8SA 3MFFA 4P57B 4RAUA 5DD3H 4H8WC 4QOKB 3GSWB 3ABZA 1B2WL 3C8DA 4R4NC 5HGDA 4DFIA 4XNZC 5EIIA 3L3OB 5IW6A 2ZG3A 3L3DA 3H8NA 3V5HB 4PJHE 4IRJA 1PDKA 2Z93A 3UZEA 5I1LB 4WVRA 2XG5A 1N6UA 4HHAA 3OKLB 2BOCA 1PEZA 2NY4B 4PGEB 2D2OA 4PRPB 5HHMB 3PWPA 1IGJB 1EJOH 2ENYA 1URLA 1I3UA 1N8ZB 3O2VH 3C09C 3CXDH 4B5EA 1Y6KR 2FYYA 2YD8A 3FB7A 4QHMB 4P46B 1NGWB 1DLHA 4TSBL 1FAIL 1EHXA 3ZDZF 2Y9RT 4L8SB 1I1RA 4URTB 4LSUH 2C4FT 4HKZB 4PJHF 1M71A 4LCIH 2BHYA 2GJJA 3GMQB 2OZ4H 1V3JA 3TO4D 2MWCA 4N90E 4NO2B 1J0YA 4AH2A 4P5TB 3P9WB 4NC1E 1C5CH 4RIRB 2DJ4A 4DVRH 1OWRM 2AGJH 4YE4L 5J8OA 5C0NC 4K94L 1HWGB 1SEQL 3FTGB 3K46A 3MLWH 5B39G 4YAQA 1JZ6A 3DPBA 1UJ3C 4L8CA 7FABL 1BX2A 4CVUA 5ICZA 4MDJB 3VGGA 3CFCH 4L29B 4O9HH 2YPKA 2A0LC 1WAAF 1OD7A 5GHWH 5ISZE 3ZYJA 3IKCA 3RL2A 2DLTA 1UACL 1VHPA 1R5VB 1QFHA 5AZ2L 4FXLA 3BVNB 1FGVH 2VLKE 4KKLD 4PS4L 1UXSB 1GGCL 4YGAB 1MIML 1XGPA 1U92A 1KJMA 4XNMB 1VERA 1AQKH 3CFEB 1KYOK 4KRLB 5HHOB 1NUGA 1WWCA 5EC1B 2XI9A 3TNNA 2IQ9L 1D3CA 2QQKH 4OI7A 4OZGF 5F89B 2R1XA 3I2CL 2F19H 2X44D 3H7LA 4DGVH 5BCAA 4RMSA 1T03L 1I9IL 5D7IE 2IAMD 2NY5C 4S1DD 1UB5A 1E6OH 5E5MB 2UYLB 4XVTL 5A16B 3ARGA 3BD4A 4Z18A 1I3RA 2DQHH 4JREB 5I17B 4WFFD 4XNXH 1MEXH 3WS6C 1C8PA 5J12C 1I8IA 3IDXL 4FQCL 5SWSD 1XGTA 4S11A 2C3GA 3HUJB 3NFNA 4PPTA 2P5WE 3S4SG 3SOBH 2B1HL 3DRTA 3AS2A 2VABB 1IKFH 1HCVA 1S7WA 3KHQA 5T3ZD 4GMSH 2OMNA 3HC4L 5L2KD 4F15B 2BVQB 1AKJA 1MVUB 4HPYL 5TDOB 2BNRD 3TBSB 4I4WA 3SDXE 1HHJA 4K7FA 3VGFA 3OKYA 1F90H 1UWXH 1NCDL 4WFGD 5E2TH 3FFCB 1XEDA 3FHQA 4BZ1H 5J3HC 1N64H 3OXRA 3TVMA 4XGZA 1KIRB 4FP8H 3T77A 5E6IC 3KPRD 3SE3A 3BUYA 3MJ9A 4POZD 5J6GB 3NZ8B 4MXQD 5DURB 1IL1A 1HHGA 3PQYA 2OJEA 2CMRH 1Q9WA 5ACZB 2HT2C 3MNZB 3EAKA 1FN4B 1JNLH 1KC5H 3GSXB 1FV1B 3O4OB 4BFGA 4W4OC 5KSBB 4N90D 4U6HA 4EUPA 3MO1B 2WP3O 1MREL 3D0LA 4CNIB 5I8OL 3CX5K 3PHOA 2YS4A 4N9GB 3I6GA 4OLWL 3TBTA 1S7TB 5IHZA 1HE7A 3GSOA 3HE6B 1NPUA 1Z9OA 4TOYL 2CDFB 5JQ6L 2J5LC 1NKRA 4LSTL 4N0YH 1RI8A 35C8H 1OPGL 4NYLB 4GLRH 4R8WL 3C5SB 1G84A 2HFTA 1AGCB 4ODWB 3EJZC 1JMZA 4I3GA 1E27B 4TUJB 4OIIH 1P7KA 2IG2L 5F3HA 2G5BB 4NNXA 2EEBA 1MCHA 5LAXB 3KWWB 1FVCA 1A6WL 3FOLB 1MLCA 3QWOA 5L88H 2MPAH 4OZFA 5BV7H 3B83A 2IPTL 1ZHNA 3SDXB 1CGWA 3HKFA 2V2XB 4H26A 1MHCB 5FK9A 5F44A 1OTSD 1YEEH 1CBVH 3WL9A 1DUZA 1HKFA 2O61A 3BT2L 1JUFA 3IXAA 4YHIB 3MJ8B 3ULVD 1F4YH 1DBBH 3QDHA 4HS6B 4EN3B 3CH1B 1R3KB 3D18B 2P5WB 3HNVL 1UJ3A 2A6KA 3ULUL 2W0FB 3UYPA 4EI6B 3ZDYE 3E8UH 5HI4C 3LN4A 5DQDH 3D69B 4KTEH 5CWSB 3MUY1 1QRNB 3QEGH 2C4XA 2CJUH 2QQKL 4X4MA 2EYSA 4XCCH 1UH4A 3WHXA 5CSZB 1QG3A 1WLHA 3MNWB 1JF1A 3T8XA 1HQ4B 4PRBA 3MBEC 1JGVL 1GZPA 2IADA 4Y19E 2BDNH 4FQHB 3TO4B 1QRNE 2BFVL 2NQCA 1MELA 1S7UA 5I18H 3RZCA 3QUYD 3PL6C 4LKCA 1ADQL 4OKDA 3D2UB 4WHDA 2H32A 3U4EB 5IF0A 1OWWA 4P2QB 5ELIA 2V5YA 3SKJL 1IC4L 4MXVE 2C1OB 3SDYH 3D0LB 4CNIA 3H9SE 1SY6H 3E6HA 1WEJH 3TBYB 2OL3L 1S9XB 4Y4HA 3S88L 2HWZL 3CH1A 5E2JA 1FGNL 3AREB 2PO6B 3PWLA 1GZQB 1MHHA 3QDJD 1S7RA 3UZQA 2DQCL 4HWEH 5LGJB 3T0DA 1ES0B 3O2DH 3L7EB 4GAYA 4HFWB 4PJEA 3NVQA 2EO1A 3MLUH 4YIQA 5J9PA 1MQKL 2X4RB 4DN3H 1MAMH 2QADB 4UB0H 4XP1H 1HYSD 1DN2A 4JHWL 4YDLC 4NNXB 4KTDH 3QUZA 1BQHA 3HPJA 4PJ9C 1CFBA 1GZPB 4APQD 2F53E 4OFPA 5MHSD 2D03L 4HJGB 4HBCH 1TDQA 2JB6A 4UBDC 4LPUA 4YXKH 4HGKC 5T1MB 1G7LB 1UC6A 4AJ0A 5EZOH 3MGOA 1DBMH 4PLKC 3L5IA 4XH2B 5HHPB 3TBWB 2E7MA 4NWUL 5IV2B 4N0UA 4WW2A 1ZVSB 1Q0YH 4JFHE 2FGWL 3WS3B 4OIAA 1GC1C 4XP4H 1ZOXA 3P11H 5DQ9B 5E9DE 4OGAD 1F02I 1JZ3A 5D71L 2VDPL 4L9LC 3WXVL 4MNHB 4NZTH 5DA0B 3LKQB 1RJLB 2EICA 1LD9A 5F96L 1YPZF 3C6LA 2V7NA 1A0QH 1N7MH 2EYRB 2B1HH 1QFWM 2NY6B 3IDIA 3QEQE 4NQEE 5JUEL 4F57L 3IJHB 4KC3B 2NY5L 4XMLH 1SVZA 4P2OB 3JSSA 5B21A 1F13A 1F2QA 4ZYKB 4KAQH 3RJDA 3AVEA 2HWZH 3BPLC 1CGVA 4JZOA 4LQ1A 3UTSB 4QHUB 3C5ZD 4JY6A 4RGMB 3V7AG 5KTEL 4PB0L 1F4HA 1V05A 1NUNB 1FNGA 4K7PH 1DBBL 3QJFA 1DQDL 4MQXC 3GMLA 4JRYB 1YYLH 3WJJA 2R0ZL 5IMMA 1RIHL 2W59A 1T5XA 3CVHL 2HN7A 3RWHA 1YEFH 4KROB 1KCVL 2WINB 1MWAH 2G75B 2KBGA 2LAGB 4WTWA 3VI4E 1J8HE 4YHKH 1LEGB 2IANB 3CFKB 3IDGB 3VFOB 2V9TA 3TNMB 2IBZY 3ECBA 4HXAH 4CMMB 1WFUA 3MR9A 3NCYS 3T2OA 3QNYB 1NDGA 2X5PA 4HJJL 3GBNL 1KCSH 2BOBB 4L4VD 1X4XA 3S35L 1BF2A 1KJ2B 3EDFA 4Z8FH 4NNPL 3MCKA 1MCFA 1BFVH 3QPQC 4M8QA 4U1NB 1HXMA 2AQ3A 4HS8L 5H94B 4PJHA 5B8CC 4WUKL 3PE9A 1CDGA 3F58L 4PLNC 1NFKA 1KJVB 3EGSA 4QNPE 3BUTA 4QHKI 1FHGA 3O9WB 5E7BA 2R2HA 4HUWA 2LQRA 1G7PB 2HLAA 3FAXA 2CIKB 2EDYA 2VLKB 2WBKA 1A1NA 4P5MB 5GZOC 2FBJL 4OV6F 1GPOL 3VRIA 4PJ5D 4IM8A 2LTQC 3ARFB 1SBBA 1I8KB 3QPXL 2BXYA 3HFMH 4NQDD 4XBGA 3RHWK 1JJUA 3B9VA 1BLNB 4NHUB 4UDTB 5F21B 2AXFA 2BVTA 3KXFD 4HWZB 1PKQE 2C1PA 4M43H 2R1YB 3VWKA 3DO7B 4HFUL 2VQTA 3VH8B 4MQTB 4ZMAT 4BH7A 4GO6B 6FABL 2VH5L 3ARDC 1RJYB 5DR5L 3CDYA 5EBWB 4O2CA 2KZ1B 1JWMA 2ZNXA 5JW5A 4PIRF 5GGSB 5J6GA 3ZTNH 1FO0A 2BVOB 4QXGH 2C3VB 2CLZB 4C59B 5HGBB 2X70B 3KXFB 3ULSB 5E8DL 3U36A 4K2UL 2Z31D 4LSVL 4XZUA 5CEZL 1QLEH 2YPLB 4JRYA 1TQCC 4QRPD 3V8OA 4OZFH 2GY7B 3PHOB 3LS5H 1I1FB 3BDBA 1IGCL 2HN7B 3RWHB 4CW1A 3RWEA 1EGJH 2HMID 2QV2A 4H25A 4WUKH 5BOZG 4JFDA 3KYNB 2FJHA 4YNYB 3GJEB 2JB5L 5BRZE 5I17A 4XCEB 4Z0XA 1JRHH 1AD0B 1A47A 3UTPE 1VFAA 3V6OA 2X1QA 4KDTC 1YQVL 4GXVL 1MCWW 1D5MA 4F2MB 4Y5XC 3NOIA 1BHGA 3UTOA 3JV4B 4PJGA 1KJ2A 5DVLA 4GMSL 3IFOA 1K8DA 5SWZA 3FT4A 5I6XC 2GJ6B 3DRQA 3QFJB 4RMVA 4HT1H 5F8QC 5E94B 4W81A 4PJCE 3BPLB 1JTOA 1OQOA 2CRMA 2E3VA 2FCBA 4P3DA 4KMTH 5GSRA 3UXFA 1CFNA 2YWYA 3X3FH 3QCTL 3P4MB 3MRCA 4S1QH 3TBTB 4ZAKC 2BY2A 5SWQB 2O93L 5CGYC 2GT9B 4XXDA 2P49B 1B9ZA 3REVA 1JHKH 5EU6A 3MCG1 5D93B 4ODXA 2M1KA 5HHNA 3U7WH 4HF5L 2EDNA 3FT2A 4I0KA 3D25B 3VG0H 2IH3A 3W0WE 3QWRD 3S3PA 2WWKT 1I1FA 3OJVC 4HH9B 4PREA 3AC0A 1CLOL 4L3CA 4Z77A 5T1DL 3AGVA 1PYWA 1U58B 2CKNA 4H0IA 4I3SH 3VXOB 2YUWA 2DTML 1RZKH 3UJJL 4BFBD 5GS0D 3P4LA 3Q5TA 1QLRB 5CD5C 2QKIB 1JPGB 4GW1A 3BKCL 3VFNB 4OGYL 5BXFB 1CL7H 4PJGB 4LCCB 4JRYD 5J6HB 2NY2D 4HUUB 5GGSA 5HYSG 5LWYL 3L3HA 4JPWL 5ID0A 4PGDB 2VR9A 3I6GB 2Y72A 2VLME 4P23B 4PRHA 1W72B 3CIQA 2FWOB 1WEJL 4JQXC 1QNZH 3OGCA 1PY4A 3PDDA 1YJDL 3I9GL 2B4CH 3GSNA 2VXUL 3BW9B 5EOQH 1YMMD 2OS7A 1JZ5A 5HGDB 2P48B 5D72L 1ZLWH 1QSEA 4Q58C 1QO3A 2AK4E 3GB7A 3D25A 3QG6B 4YUEL 5MEQA 4Z7QF 2N7AA 3K4AA 3WIHA 4K23L 1A4KB 1EPFA 3MSPA 5FM5O 3TC9A 1ZGLA 4R4ND 1A3QA 2F5BL 2P42B 2YPVH 4KKLC 2EKSA 3SGDI 1JMXA 5IB2B 4NRXA 4ORZC 1XGYL 4PRHD 2ERJC 3QUZB 1X44A 4HV8A 4PJ8A 3GSVB 5DQDL 4W6XB 2ESVA 5ADPH 2LE9A 3DETC 1FBIL 2A83B 2DDQL 2Y5EA 1FSKC 3TBVB 2VABA 4HLJA 5ALCH 4PRHE 3SPVA 5DRXA 1ZEAL 4Z0BL 2YK1H 3MOAL 5E2UH 5C0ND 5IKCB 4JM2A 3NN8B 4HWUA 1DANT 5EOQL 2I60H 2GUOB 2NY6D 2B4CC 3QH3B 1FL3A 4FXKB 4KK9D 3ETBF 3KPNB 4ZTOH 1X4ZA 4D0BB 1E4WL 4BYHA 4HH9A 1Y0LA 5LQBH 4KGJA 4BELD 1NSNL 5LBSL 3RWCA 4PLJD 4WJ5A 4FMFA 3UTTB 1S3KH 4GRMB 3QUXD 2D7MA 1NFIA 4JDZA 3PL6D 4HS3B 5EO9B 3QI9A 4RAVA 1VSCA 3ZYIA 4QRRE 2DKSA 4MGXA 2AJSL 4IOSD 1V7MH 5F1IA 5C86A 5J0BA 1CD0A 5JR1L 3DUUB 1QPPA 2P5ED 4J3OC 3VWJD 4JDVB 1U6AL 5JDSA 3JV0A 4U2YA 2DLEA 2VL5A 1ZLSH 4ZPTB 3Q1SH 1UXSA 3WS3A 3FO0H 1GZQA 2VAJA 2Z91B 3T0EC 3F12A 3GNML 3CFEA 3T0VA 3L5JA 3JWDL 3MUZ1 4GMTL 4MNQD 2GTWB 4PJAE 3DVNB 1LHZA 4F9PC 1CFVL 3BQUA 1KC5L 4NDMA 2GAZB 4IRZL 4CU7A 3GB7B 3MV01 2H26B 3O3BA 5C0DA 4LHQB 1YEHH 2AVGA 3VD7A 4Y2DB 5L2KE 1H3XA 3NTCH 1I1CA 9CGTA 1AJ7H 3OKKB 2FIRT 2ZP0T 4PJXB 3FZUD 4PRDA 4M1GL 1D5BA 4YR6A 5KSVA 1F58L 3R8BB 1T7VA 1MFEL 4J3XA 1HKLL 5EULV 1SMAA 3QI9B 4RAVB 3B8SA 1ZTXL 2O26U 1YMME 1BFOA 2RBLA 2HH0L 3OKEA 3MRKA 2PYFA 2DLGA 5GGRB 4U2ZA 1P69B 3O8XC 3DMMC 2MSPA 1JFQH 2XWJA 4QGYA 3C9NB 3MCLH 3RIAF 4ZUTB 3L6FA 4NJ9L 1BBJA 2R4SL 4YZFF 4RBPK 4M61A 3Q6GH 3OG6B 4J3VA 1H3UA 4V1DD 3MOBH 4I4WB 3IFPA 5D1ZC 4WGVB 4DGYH 1XF3B 1AO7A 3THMH 2XZQH 2D4DA 3MLZL 2F5AL 4OTXH 3QO0A 3E0GA 1NQBA 1V5JA 4KZEL 2C1PB 1HEZA 3SE4C