5DK1A

S. erythraea trypsin mixed catalytic intermediate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
230
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPNAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 59
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A01
3TH2H 1UVUH 1AZZA 3Q76A 4ABGA 2IPHA 1TALA 1PFXC 1WBGB 1GHYH 3TLOA 5C20A 1HJAC 4Q2KA 2AMPA 2AYWA 1NFWA 2HOBA 4ISIH 4ISOA 6LPRA 3NXPA 4TWYA 1MU8B 1GI3A 3U98H 4MNWA 1NRPH 1P57B 2ZU4A 1IQEA 2G51A 3LC3A 1HLTH 2J9NA 2NU0E 1HAVA 4GPGA 1H4WA 4DJZB 1BT7A 2ASUB 1TBRH 3QK1A 5DG6A 1P06A 1AFEH 4J2YB 1MCTA 1QJ6B 1GBEA 3RXDA 1MD7A 2XC0A 1GBKA 1O3NA 2G00A 3STJA 1M9UA 2ZG0H 2CF8H 5EXNA 3RXFA 1P12E 2OLGA 1EAUA 1K22H 1YYY1 2GV6A 4Z6AH 3KQBA 2EI8A 3GY8A 1MTUA 1SGCA 3LDXH 2EC9H 1VCQA 1FZZA 3TPIZ 1TGCA 1ELVA 3JZ1B 2BLWA 5EOKA 1P8VC 3M5OA 5JPMH 1YKTA 4MNVA 1O38A 4IN2A 1GI4A 1D9IA 3BTDE 1G32B 4AX9H 3CENA 5HGGA 3GICB 1X7AC 1TOMH 1S6FA 4ZKNU 3PMJA 3PM3A 1GJ4H 2UWPA 1QY6A 4ZXYH 1W7GH 1C1SA 1ANEA 5LPRA 3EA7A 2ZHDA 1FXYA 2HVXA 3O8DA 3VGCC 4CH8B 1KLTA 4K60A 1TGTA 3Q3KA 2OTVA 1ZHRA 1TPAE 2BD3A 1A3EH 3SV2H 3MO3A 2J94A 1W7XH 2W5EA 1GDQA 1EASA 1LHFH 4CBNA 1E35B 4B2BA 3ELAH 2P3UB 3TJVA 3BEIB 4ZKOU 4JYTA 2ZQ1A 4BTIB 2FIRH 5LH8A 2ZPQA 1GHZA 4AYVB 2Z6BD 1K9OE 2FLRH 1G3CA 1EJAA 2A32A 1A0JA 1UK2A 1IQMA 2BQ6B 1DXPA 1YPHE 1GBBA 2HWLB 2ZEBA 1Z1IA 1AUJA 1TNGA 3STIA 2OQUA 1P9UA 1BTXA 1C9PA 1KDQA 2PUXB 1V2OT 1SLWB 4XBDA 2ILNA 1XVOA 4YLUA 1GVZA 4RN6A 1YCPM 1ZZZA 1C1TA 1G3BA 3KEEA 3M3TA 1OP0A 1DLEA 4NWLA 3P8OA 1AVXA 1K1JA 1VJ9U 3LT3A 2WPLS 4AOQA 2FPZA 4CHAC 3TK5A 1ESTA 4BAHB 1BTPA 2ZZUH 2QF3A 5AF9H 1CHOF 1XUKA 3G01A 1RD3B 1JXPA 4ABFA 4JMYA 1LPZB 3UWJH 2FEQH 4RKJB 1QBNA 1Y8TA 2A5AA 4KELA 1W3CA 2Y81A 3LONA 1O2OA 1O2PA 4B74A 2J95A 2FOHA 1GGDB 3T27A 4B73A 1GBFA 3ZVAA 1PPGE 1O37A 2CGAA 2VGCC 3A85A 4B2CA 1PPCE 1QURH 4U2WA 4MLFB 3SGQE 4K8YA 4Y6DA 1THPB 5GPIB 2PLXA 1MKXK 2Z9GA 3URDA 1FIZA 2QXHA 4NFFA 3RU4D 2AFQB 1YLCA 4ZMAH 3A86A 5T6DA 5E0HA 1BTZA 3SN8A 1HJ8A 1TMBH 3LIWA 4ZKSU 2YOLA 4INKA 4GVUA 3A7ZA 1P3EA 3ZZ7A 1IQLA 1H9LB 2GKVE 1HAOH 1GCTC 1GI6A 1ZOMA 1GJAB 2BD7A 3HK6B 3BTKE 1O2YA 1P2NA 2PKAB 2FTMA 1WAYB 2IN2A 2G52A 2VIVA 3S7HB 3GCHC 1GG6B 1XXDA 1V2VT 4A5TS 4YOJA 1Z8RA 3SU3A 2BOKA 5LPFA 1YPLH 1L4DA 1QHRB 1W12U 1V2LT 1BBRK 4Q7XA 1AE8H 3E0PB 4KGAA 3ZZDA 1N8OC 4IN1A 2A0QB 2G55A 3RUOA 3U8OH 1O2QA 1GHWH 8GCHF 1D6RA 1XUFA 2QF0A 3SUEA 3ZZBA 4FUDA 1A5IA 1HAXB 4LZ4B 2NU2E 5JDUB 1VGCC 4Y7BA 1SGYE 1WU1A 3A8CA 5E0GA 1O35A 1A5HA 2HGTH 4TYDA 1AFQB 1GI5A 3ODFA 2C90B 3UOUA 1L2EA 5I46H 5ESBA 3PLPA 1ELFA 2RCEA 5A09A 1ETTH 3A8BA 3PLBA 1RTKA 3GY2A 1AWFH 3IG6B 1PPEE 1C5PA 2F9UA 1VJAU 1JBUH 1AUTC 1O5GH 2H1UA 3BG4B 4U30A 1AWHB 1KIGH 2GMTC 2Z3CA 5JBTA 1FJSA 2FOEA 3LGWA 5EPNA 1EATA 1RS0A 2SNWA 4FVDA 3MH7A 5L2ZH 1ABIH 4MPXA 1V2TT 3PO1C 3RC4A 3SGAE 1UHBB 1ZSJA 1MKXH 3EA8A 5GJ4B 1Z8GA 1NN6A 4AFSA 2Y80A 4BOHA 1KXEA 3DHKH 4GLYA 4WH8A 1W0ZU 2QXJA 1O5BB 1P2OA 1PPHE 1QA7A 5DP5A 3ZV8A 5EXLA 1C1MA 4DOQA 1XX9A 4SGAE 2TGAA 5TCAA 3EGKH 1CA0B 1EAWA 4FU9A 5T6GA 2WPMS 2H9EH 4H6TA 1T8LA 3LGVA 3BTQE 2BD4A 3M36A 1TGNA 5FHTA 3W94A 2XC5A 2WPJS 1ELEE 3EE0B 3MU0A 2PFEA 3KN2A 2HNTC 1GHAG 4UDWH 3F9FA 1BBRH 1C4U2 1QR3E 3SHCH 1HAPH 2BVXH 3SJIA 1DT2A 3K9XB 1G36A 2G81E 5B6OA 2BDIA 4XBCA 2ODQA 3TK9A 2H5CA 2C93B 1AY6H 3LJJA 2FLBH 1V2ST 1SGFA 2Z9KA 3FZDA 3S69A 3A87A 3OYPA 5EU8A 1BRUP 2J38A 3HKIB 1GHAF 1ZGIA 4E7RG 3OSYA 1GI7B 5L6NH 2AS9A 3A7TA 3EYDA 3JZ2B 2ZNKH 3SNAA 2PTNA 1P01A 1UTQA 3RXLA 2F9VA 2P8OB 1AIXH 1C2DA 4ESTE 1C5ZB 1DWBH 3MH5A 1P9SA 1C5MD 2H5DA 3UNRA 2BX4A 3RU4T 3SBKA 3N7OA 3FVFB 1AHTH 1YPKH 3A7VA 4GHTA 3SV6A 2A7CA 3PV4A 5HM9A 1FAKH 4PROA 1TPOA 1WTGH 3V3MA 4IW4E 1HYLA 4ZHLU 2EI6A 2QXIA 1AE5A 4Y71A 3VB7A 1GBLA 2QCYA 3P6ZB 4D8NA 1RIWB 4I7YH 3VXEH 1CVWH 1Y3UA 3M35A 2A2QH 1O2GH 4OGXA 3PWBA 2W3IA 1DS2E 3WY8A 2TBSA 1LCYA 1SOZA 1C1PA 1SQTA 3DT0H 3VFEA 2ZF0H 5CHAB 2BD2A 4ZH8A 2VNTA 1F92A 1NFXA 2HALA 5K7RA 2AMDA 1S85A 1AVGH 1C5VA 1QB9A 2Y6TA 3S7KB 3MO6A 3QWCH 4NG9H 3CP7A 1J9CH 3V13A 1KTTB 3GY4A 4K1SA 1YBWA 3T5FH 3PMHB 2FOAA 2BD8A 3S9BA 1SLVB 2OBQA 4X1PU 4FUCA 3RC6A 2JKHA 2P95A 5A8ZA 3DFJA 2O8MA 5GIBA 5FCKA 4Y10E 3UOPA 3UR9A 1EZSC 2FM2A 2SGPE 2ZDNA 2OINA 1AB9B 1CBWC 2CMYA 4X1QU 5T3HA 1C1RA 1LVOA 1ZMNA 1U6QA 1EAIA 5C5OA 3MI4A 1SPJA 3RMMH 2Y7XA 1TA6A 4UFFH 3A88A 3M7TA 4YOIA 1C5OH 1JIRA 3RXHA 2BY9X 1ZHPA 1YPGH 1IQNA 5FPYA 3UY9A 1GBJA 4I8LA 1THSH 2C3SA 4KP0A 1OWDA 4IGDA 5L2YH 3GY6A 4IMZA 9LPRA 1QRWA 3MU5A 2AGIX 3W95A 1UHBA 1DWEH 1NY22 4YLQH 4YTAA 1FUJA 3D49H 4B1TA 1GL0E 2G4UA 1IHTH 3LJOA 4ZHAA 2W26A 1YGCH 2SNVA 1QBOA 3P92A 1ELGA 8KME2 4R8TB 3PMBB 2PKSC 4E7NA 3T29A 2NWNA 2ZDAH 2FODA 3SI4H 3LPRA 3T2NA 5A0AE 1O3KA 5JB9S 4AFZA 1O2TA 3TU7H 1GJ5H 1O3MA 1RRKA 3MNBA 1PYTD 1T8OA 2GP9B 3SJ8A 2V35A 1C5TA 2F83A 1GHBF 4FVBA 1E0FD 1L4ZA 2VIPA 1WYKA 3BEFB 1VCPA 3MU4A 5SGAE 4BTUB 1O39A 1S82A 1W8BH 1WCZA 2OQ5A 2GCHF 1AGJA 1SI5H 1CU1A 3QZRA 1HXEH 4GSOA 1A5GH 5BPEA 4WMEA 5E2PA 1V2PT 4JZIA 1O2WA 1ZJDA 4ABJA 3SJ9A 2ZGXH 2B9LA 3PMAB 1LHEH 1EB1H 1O34A 1QJ1B 1WOFA 1TRMA 4Q7ZA 2VH0A 2ZTXA 4VGCC 2ZCHP 2TIOA 3K6YA 2TGDA 1IHSH 4FUGA 1S0QA 3AW0A 3QUMP 2HNTE 1NU9A 2FS9A 5FPTA 4BXWA 2I6SA 1UK4A 1ELAA 3E91A 2ZDLA 1BCUH 1ARBA 1QL9A 1OWIA 2BMGB 1KLJH 2FS8A 4X1NU 2B7DH 3URCA 1WSSH 4ABBA 4XFQA 1NC6A 3RXJA 2VIDA 2VH6A 1P0SH 4Y11E 3TIUA 1A1RA 2P16A 2ZFQH 3M3VA 5C3NA 1FY4A 1BTHH 1UCYK 3HGPA 3SU1A 2AIQA 1TIOA 2FOBA 3QN7A 3Q77A 1TPPA 1TFXA 3V7TA 1O36A 2BY6X 1ZSKA 2BDHA 1GBCA 2ODPA 3IITA 1BUIA 2WPIS 1PQ8A 2W7UA 2BLVA 1VITG 3KQEA 4FU7A 3RXMA 1NM6A 2P3TB 3ATLA 3HKJB 2VU8E 1D4PB 1GMCG 4ABIA 2UWOA 3SJOA 3SUDA 1BRAA 5FX6A 4I8HA 1O2SA 4XBBA 3GY7A 3TH4H 2XYAA 1PQ5A 3RXTA 1KXCA 1C1UH 1CT0E 1SFIA 1K2I1 5EODA 3SNEA 1K1PA 3BTHE 3TVJB 1ZJKA 1C4Y2 2YNAA 1MCVA 1SGQE 1Z8IB 1O3JA 3A83A 1IQJA 3O8BA 3VB3A 4MDSA 2FOCA 2OUAA 2FI3E 1DICA 3TGIE 4NIWA 3MNCA 3RXQA 1CA8B 1N1LA 1NZQH 1XUGA 2BVSH 1GBMA 2PGBB 4ASHA 1FN6A 4MQAA 2UUYA 2VVCA 3BEUA 3NK8A 1Z1JA 3NWUA 3RXPA 1TYNA 3L33A 3SO3A 1F0UA 5FX5A 3AVZA 4AZ2B 1P2IA 2BZAA 5LPEA 1ZYOA 4A7IB 4D7GA 1TNKA 3GY5A 1CQQA 3NZIA 1GDNA 1KTSB 1O3OA 4K1TA 1GMDG 5E2OA 3T25A 1O2JA 3A7WA 4CRFA 2WUCA 2H9TH 3UNSA 3LH3A 4CRCA 5DP7A 1O3IA 2STBE 4KTCA 1IQHA 2GZ7A 2PHBA 4INHA 4H6SB 1TQ7B 1F5LA 3SU2A 1WQVH 1FQ3A 2BDGA 4K3JA 5DKMA 3QDZB 4WXVA 1FAXA 1H8IH 1O31A 2ZA5A 3FP8E 3V12A 3PLKA 1UCYH 3A84A 1ZRKA 3QX5H 1GI2A 1OPHB 1BMNH 1ZPBA 1IAUA 4OS1A 4YT6H 5HXFA 4LOYH 2OC8A 1FY5A 1MU6B 1O33A 4NGAH 5F6MA 2Y5HA 3OY6U 3MH4A 1A7SA 1IQFA 2F9BH 3RXGA 1GJ8B 4I8GA 1O3BA 1O3PB 1B7XB 4A1XA 2BM2A 3GYMA 1C5RA 3A89A 1TOCB 3RXKA 4CRDA 2HPPH 3BF6H 2B0FA 2BX3A 3FAOA 2ZHFH 1OWHA 2Q1JA 3MU1A 1EPTC 1MTNC 4A6LA 4B71A 2BXUH 4U01A 3ATMA 1J16A 6CHAB 3UQVA 3RMNH 3RXSA 2BVRH 4DVAU 5LGOA 4JZDH 2ZHWH 4AYYB 1L1JA 2OD3B 1G37A 1QCPA 2Y5FA 1EZUC 3U69H 4DT7B 3Q3YA 2JETC 3SU4A 2FI5E 3AASA 1GI1A 1BHXB 3GY3A 2ZP0H 1GJ7B 2C8WB 3UNQA 1DE7H 3RMOH 2SGEE 2XCFA 2ZTZA 1O0DH 2JH5D 4D7FA 2R9PA 4AG1A 1FI8A 1GI0A 4X2YA 3DA9B 1OYQA 1THRH 2BDAA 2ALVA 1LPKB 2CHAB 5DP4A 1SL3A 2ZCLP 2GCTB 1FV9A 1JRSA 2DUCA 2LPRA 1C2MA 4O03A 3PTNA 1BJVA 2ESTE 5I25A 2ZECA 3RDZA 3TNSA 2UUKB 2O8UA 3S9CA 1GMHG 1YF4A 3PB1E 1LO6A 1DFPA 1YPMH 4Z0KA 4JK5A 1SMFE 4YT7H 2V3OH 5EQSA 4FUIA 2V6NA 2JH0D 2A4GA 2D2DA 8LPRA 1Z7KA 3E90B 1LTOA 4OS6A 3FFGA 3ZYDA 1B5GH 4Y8YA 1AKSA 1LHGH 2C8XB 2PSYA 5EPYA 2W3KA 2ZKSA 1QL7A 5C5NA 1MZDA 5HYOA 1UTKA 2PWXA 1UVSH 4MG3A 4X6OA 5C1UA 1UJ1A 1J15A 4HFPB 1H9HE 3T62A 4WWYA 1C5WB 2O8LA 1P09A 1EQ9A 2AIPA 4D9RA 3QGNB 1GBDA 4MTBA 2A2XH 1NO9H 3U1JB 3A81A 3BN9A 4ZKRU 3VPKA 1V2KT 2PV9B 1GJBB 3RLYH 1AN1E 4FUHA 4K69A 5EQQA 4X2WA 2BD9A 3SNDA 4FUFA 5HM2A 2ZPRA 2ZHEH 3SORA 1GHVH 3L3TA 3HGNA 4X2XA 5EXMA 4BXSA 1DANH 2FOFA 2FESH 5H4IB 1V2NT 1C5UA 1GVKB 1WQSA 3F9EA 3MNXA 2ZDVH 2BHGA 4YM9A 3FP6E 1O2VA 1AVWA 3RXUA 1SC8U 1NRQH 3P8NA 4AG2A 2F9OA 1Z8JB 1K1NA 4X6NA 4AB8A 1DDJA 2R2MB 2VIWA 1MTWA 1O2MA 4NSYA 1TPSA 3UFAA 2R2WU 1A4WH 4K8BA 1TNJA 4JCNA 3RMLH 1BTYA 3K2UA 5DJ7A 1J14A 2J34A 3O8RA 4XDEA 1ARCA 1CGJE 2FYQA 2Z9LA 1C2IA 4CRAA 1HXFH 2BZ6H 5A8XA 2FX6A 4I8JA 4CR9A 1LVBA 1A2CH 1BB0B 2A4RA 1ZTJA 3ZVDA 1QGFA 1XUJA 4O97A 4IC5A 3F9HA 2WYGA 3A80A 3OX7U 3RXIA 3TGKE 2RDLA 2QY0B 1NTPA 1XXFA 4IBLH 4UFDH 3ZZ6A 3NUMA 2WINI 1PQAA 2AH4X 2STAE 1DLKB 2OCVB 1O2ZA 2VJ1A 2VINA 1TNIA 4I32A 1KXDA 1CSOE 3KCGH 3VB4A 4DW2U 1ZHMA 1UCYE 1ELDE 2GT8A 4XOJA 1Q3XA 1TGSZ 2ZFPH 1Y5UT 1DUAA 1V2MT 4FUEA 4YOGA 4BNRA 2LNCA 4AGKA 3MH6A 4ZXXH 1QRXA 5TCCA 1SVPA 3SOSA 1HUTH 3HK3B 5ETXA 3ATIA 1D3QB 7LPRA 4GCHG 5C1XA 1EJNA 4CBOA 5E8EH 3RXRA 4UE7H 1MMJN 3S9AA 1O2UA 1HJ9A 1G3EA 2R0KA 1XVMA 1AZ8A 5EGMA 2QN5T 3GCTG 1W14U 2BY8X 1ORFA 1SBWA 3P8FA 1HIAB 1WTHD 3KL6A 1YM0A 3RP2A 4GCHF 1EOLA 2ZI2H 1N6XA 4JYVH 3IWMA 1L1GA 3TNTA 2NU1E 1Y3XA 2WV4A 1GGDC 4ZHMU 2GVFA 2ZU2A 4X8TH 5DK1A 3E16B 2TGTA 1DY8A 1DPOA 2PUQH 2QC2A 1LHDH 4VGCB 3LGYA 1V2JT 1SGDE 5EQRA 3B9FH 1KYNA 3E6PH 1ETSH 1FY8E 2PR3A 1C1WH 1C5XB 1SSXA 1IQGA 5HMAA 4WMFA 4MNXA 4CRGA 4NIVA 1NFUA 2Y7ZA 2C4FH 3M7QA 5C1YA 4CR5A 2GGVB 3UTUH 1J17T 1TBQH 3KQCA 4ABDA 3PTBA 1UVPA 1MAYA 1O3EA 4AGJA 2ZPSA 3LOXA 2F9NA 2XBXA 4TWWA 1ESAA 1O2KA 1MTSA 1C5SA 4HTCH 4A92A 1MUEB 2OC1A 2H9HA 1P2JA 1T32A 1AQ7A 1TGBA 3SW2B 1C2EA 2D1JA 4X8UH 3B23B 3ENSB 1DVAH 1Y5BT 3SV8A 1HJAB 2C8ZB 1P2KA 3RLWH 2VB0A 2ZFRH 3LH1A 4TPIZ 3NPSA 3SQEE 5FPSA 2THFB 1GBIA 2PSXA 1W10U 2GT7A 1AFQC 3A8AA 2BDYA 2FZZA 2TGPZ 5JBCS 4X1RU 3QLPH 4TPYA 3RXBA 5FCRA 5J4QA 1EB2A 2AERH 3GDUA 1GBTA 3U9AH 1TE0A 1S0RA 1TWXB 4ZROA 1UTPA 2BB4A 3BG4C 1AI8H 3F1SB 2Z9IA 3EA9A 1OX1A 1S84A 1KXFA 1JIMA 3NKKA 1B0EA 4H4FA 1GWAA 4O9VA 3KF2A 2D26C 3AAVA 1ZSLA 1ANDA 1Q2WA 2XC4A 1HB0B 1MTVA 5IDKA 5DP9A 2OC7A 2P94A 2QYIA 2VWLA 2PGQB 1TNLA 1AO5A 3UQOA 1LVYA 3MTYA 4OS7A 5F8TA 2R3UA 3DUXH 2ZIQH 1K1MA 1T31A 3D62A 3I29A 4BAOB 3HPTB 2VIQA 5DP3A 2XW9A 3SQHE 2BXTH 3GDVA 1FY1A 1T8NA 1QL8A 1CA0C 1O2XA 1TONA 5ABWA 1C2KA 4F4OC 4HGCA 2QGRA 3VGCB 3UPEA 2VVVA 2ALPA 1GCDA 1HAIH 3AW1A 1KY9A 1RTLA 1ZTLA 2M5TA 3M3SA 1L0ZA 1O2RA 3LGTA 4TY7A 1P05A 1PYTC 4ZUHA 4UFEH 6GCHG 1K28D 2GD4B 3RM0H 1SQAA 1NRSH 4NA8A 4X2VA 1EOJA 2FWWA 2SGQE 1QA0A 5DP6A 4MVNA 1O32A 3ESTA 1S6HA 2ANMH 1BIOA 4AFQA 1NESE 7ESTE 4OS5A 1BQYA 1EXFA 3CS7A 5G4BA 3FZZA 1C5NH 4GHQA 3LU9B 4DG4A 2QIQA 1MTNB 1EP5A 1BBRE 2R0LA 3DFLA 1Y59T 3U8TH 1V2QT 2OBOA 4JK6A 1DUEA 1HIAA 1VZQH 1UTJA 1G9IE 3M5LA 2P8OC 2Y82A 1N6YA 5IYTA 2FOMB 1P11E 1S81A 2A1DB 1ZRBA 3LGUA 5JBBS 2QV1A 1K1LA 3ZZ4A 5GCHG 4OS2A 3NCLA 4CHAB 1HV7A 4I31A 4K2YA 4ISHH 4DY7B 1ZLRA 1H8DH 3UIRA 1ZPZA 1BHXF 3ODDA 1SGEE 5AVDA 1RIWC 1AKSB 3C1KA 1O5DH 1PQ7A 2K1QA 3H5CB 2XBWA 2VGCB 1V6DA 3EQ0H 2P3FH 1G2LA 2SGAA 1UTNA 1FN8A 4Y8XA 5FBIA 5AFYH 3LC5A 3U1IB 1P03A 5CHAC 3RXEA 2GX4A 1LHCH 4Y0YE 3D65E 3ZZ5A 1VR1H 1OP2A 1OOKB 1T4UH 4OGYA 1GCTB 1HNEE 1BMLA 2SGFE 1E37B 1VITF 1EZXC 1PPZA 1V2WT 2AEIH 5CE1A 1O3HA 4F49A 1GMCF 4J1YA 2WUBA 1SGTA 3GCHB 3QZQA 1K1OA 4MPUA 1MBQA 1TLDA 2FTLE 2HPQH 1V2UT 1DY9A 1AB9C 1F7ZA 3K6ZA 4GAWA 5ESTE 3PWCA 1Z6JH 1MH0A 1YLDA 3RXCA 1F2SE 1O3CA 4NIYA 3ZVFA 4JYUH 4BANB 1QIXB 3BTME 4GUXA 1T4VH 2A4OA 2XRCA 1N8OB 2A7JA 3GYLB 1BMAA 1NRNH 1SGRE 4Y0ZE 2WPHS 1YC0A 2VIOA 2PTCE 4LK4A 1XM1A 1LPGB 1D6WA 2I6QA 1ANCA 1SHHB 3VXFH 2NU4E 3BIUH 3I78A 1VGCB 2ZU3A 2O9QA 1TA2A 1BTUA 2YNBA 2TPIZ 3UR6A 1TNHA 2G4TA 4CRBA 4BAQB 7KMEH 4THNH 4RKOB 3I77A 1FONA 5C2ZA 1FY3A 2XCNA 3SJKA 3E8LA 1GJ6A 4X6MA 2OXSA 3K65B 2FYRA 1CE5A 1OKXA 4D76A 4A1VA 1BRBE 4E05H 2Z7FE 1DWDH 3OY5U 5CMXH 1BITA 1GMDF 1O2IA 4NSVA 3SU5A 2GMTB 5F8XA 1GJ9B 1GPZA 2ZCKP 1F0TA 2V3HH 4AB9A 2ZDMA 1TMUH 5EW2H 1C4V2 1FMGA 1O3GA 1P10A 3PO1B 1UTOA 3F9GA 1SLXB 2RA3A 1MKWK 2UUFB 1Z71A 5JBAS 2P93A 3ATKA 1ELCA 4DURA 3SNBA 1ANBA 1TX7A 2CXVA 4WJG2 4IC6A 3BSQA 1IQIA 1XUHA 1SGNE 1E34B 1O5FH 2CF9H 1HBTH 1QBVH 1HAHH 2A45B 4WVPE 4H42U 5DGJA 4E06H 3TH3H 1W13U 5BRRE 3TK6A 4LXBH 2BQWB 3A82A 1EPTA 4MPWA 3TJUA 2A7HA 1CHOG 2ZGHA 4Q7YA 1K1IA 3SU0A 2RA0A 1QJ7B 1TX6A 2ZGCA 4NA7A 4Y7AA 1ZGVA 1MQ5A 2FXRA 1IOEA 1EKBB 3SUFA 2QXGA 1CGIE 4JZ1A 1TX8A 1HGTH 2Z94A 3MO9A 1AD8H 3QTVH 1H9IE 2FI4E 1XUIA 1RFNA 3VEQB 1A46H 2EI7A 4FUJA 1RGQA 1SOTA 2GZ9A 1JWTA 1VCWA 1IQKA 2ODYB 1ETRH 2ANWA 2KAIA 1KLIH 4ZAEA 5AHGH 1ZTKA 3ZVBA 4Y79A 1O5CB 3HATH 2BDBA 2ZFSA 1GI8B 1UTLM 5A0BA 1W0YH 4MNYA 3UUZA 3KGPA 3U8RH 1LMWB 3M7UA 1P2QA 3QTOH 4KTUA 5JB8S 2H6MA 4AORA 2WYJA 1GMHF 1K21H 5GWZA 1C5YB 2C8YB 1EJMA 4I8KA 1BZXE 1TB6H 3M5NA 1WUNH 1MAXA 2A5IA 1GL1A 2AGGX 1KXAA 2D8WA 4INLA 5FXLA 4DGJA 1NS3A 1MKWH 3SGBE 1TAWA 1JRTA 1SB1H 4LZ1H 1EAXA 3MNSA 4CREA 1C2GA 1NPMA 1GBAA 1UVTH 4FXGH 4TY6A 1DSUA 2VWOA 1E38B 2XXLA 3SHAH 1LDTT 2O8TA 3ZVCA 1HRTH 1LKAA 1O5AB 2EA3A 2XNIA 8GCHG 5PTPA 2FDAA 1O3DA 2OC0A 4B76A 2BY7X 3KIDU 4NWKA 4KKDA 1D3TB 2VWMA 2Q6GA 1FDPA 1XMNB 3RXVA 1JMOH 2QAAA 2XBYA 3UREA 4JZEH 2F3CE 2WV5A 3C27B 4ABEA 4ABHA 3L6PA 1CGHA 5GDSH 3ZVEA 2ZTYA 4X6PA 1OWJA 1OWKA 2ULLA 2Z3DA 3KQDA 2FOGA 1F0SA 3BTGE 4YESB 1OWEA 4UONA 2NU3E 2RG3A 4U32A 1C5LH 1SG8B 1UVOA 1Y5AT 3RC5A 1BJUA 1CBWB 5FAHA 2HLCA 1D3PB 1CT4E 4CH2B 1P02A 1Q31A 1ACBE 1V3XA 1TQ0B 3D23A 4MPVA 1P3CA 3ZZ3A 3LKWA 4WXIA 4XE4A 3GCOA 1EZQA 1BRCE 2V0BA 1C9TA 2ZC9H 3BTTE 1O5EH 5EW1H 5A8YA 1B0FA 1QFKH 3B8JA 1S5SA 1XKBC 1XKAC 3BTEE 1TRYA 2CN0H 3PROA 1DWCH 2GV7A 3SV7A 3R3GB 5A2MH 2BYAX 4NZQA 1TRNA 1O30A 2JH6D 1DOJA 1DXWA 2DE8A 3M61U 4AFUA 2CV3A 3Q00A 5GXPA 1BOQA 1F0RA 4IS5A 3P17H 3AAUA 1C5QA 3MWIU 2ZU5A 4YO9A 3E0NB 1L1NA 2BTCE 2XTTB 1HCGA 2PKSB 2W7SA 6CHAC 4WF8A 1WV7H 1E36B 1CHGA 1DITH 1NU7B 1AU8A 3EAJA 1SGIB 4NFEA 2ZFTA 4HI3A 1INCA 1W2KH 1RXPA 2VVUA 3BG8A 3OTJE 3MOCA 2A4QA 3ZVGA 3BTFE 2G5NA 1YCPK 2BDCA 2O8WA 1C2LA 1A61H 1MD8A 2B8OH 4X0WU 3VB6A 3PYHA 4SGBE 1ELTA 1Y3VA 1YPEH 1UTMA 1MQ6A 1BDAA 2CHAC 3CS0A 1HPGA 3BIVH 1LQDB 2GCTC 5F8ZA 3M5MA 3O8CA 3RXAA 1HAGE 5J4SA 3DD2H 3E1XB 4ISLA 4NA9H 1ESBA 1QB6A 1C1NA 1A0LA 2ANYA 2BQ7B 1JOUB 5DO4H 3F68H 2ZHQH 1A3BH 1UMAH 3GCTF 4X1SU 3RM2H 1NRRH 1HFDA 3MFJA 1VITH 3P70B 5TJXA 2J4IA 4Q80A 1EUFA 2SFAA 1DM4B 4A1TA 2UUJB 2AMQA 2H2ZA 3ZZCA 2VWNA 3VB5A 1UO6A 1O3FA 3TITA 1O3LA 3SZNA 4NIXA 1F5RA 1QTFA 3A8DA 3SNCA 1GG6C 1TABE 2CJIA 3KNXA 4M7GA 8ESTE 5EG4A 2Q6DA 3A7YA 1P04A 1QNJA 5FBEA 3GISB 3RXOA 1GDUA 1C2FA 4K1EA 1LVMA 1DSTA 4UD9H 2ZGBH 4X8SH 2Q6FA 2BLOA 3SV9A 5AFZH 5F03A 1PPFE 2HRVA 3BV9B 5DP8A 4ABAA 2A5KA 3H7OA 1O3AA 2XBVA 4FU8A 1G2MA 2BOHB 4WMDA 2IOTA 2XWBI 2PKAA 3RU4E 1LQEA 1OSSA 3ITIA 1O2NA 1O2HA 3ZZ9A 1ELBA 1SLUB 2QA9E 3GDSA 2FMJA 4AN7A 1RTFB 3R0FA 2TRMA 3MHWU 3M37A 1MBMA 1C1VH 1ID5H 1DX5M 5E0JA 1YCPH 1PPBH 1AMHA 2J92A 1HAVB 1C1QA 1ZMJA 1HAYB 3F6UH 3FP7E 1CT2E 1SHYA 1KSNA 2F9PA 1P2MA 1BMMH 1FIWA 2ZFFH 2R3YA 3A7XA 1SGPE 3FANA 1GJCB 1RJXB 1FLEE 1SQOA 5T6FA 1T8MA 2IJOB 2P59A 2BLQA 2G5VA 3ZZ8A 2B5TB 1Y3YA 1LKBA 1CO7E 1Y3WA 2PW8H 4UEHH 1OP8A 1ZMLA 2ZQ2A 3TJNA 3T26A 4BAKB 4WY3A 7GCHG 2ZDKA 2A31A 1C1OA 3QGJA 4Y8ZA 3MYWA 4R0IA 3E3TA 4I33A 1BA8B 1GHXH 1TMTH 4WH6A 4RSPA 3SU6A 3OU0A 3MMGA 4DIHH 6ESTA 1C2HA 1FPCH 2ANKH 1C2JA 1EP6A 1O2LA 4IMQA 3T28A 1QQ4A 4OS4A 1V2RT 2WPKS 7GCHF 1HAZB 1H1BA 3H7TA 4NCYA 5DPAA 2OP9A 1YPHC 2Y5GA 1OS8A 1OXGA 4B2AA 2FP7B 1S83A 1GHBG 1HDTH 4X8VH 1FNIA 4NZLA 4DIIH 1NFYA 2Z9JA 4K5ZA 1F5KU 1Z6EA 2J2UA 2GTBA 3SUGA 2GCHG 4QT8C 1W11U 2EEKA 2BD5A 2GZ8A 1YP9A 4KTSA 2GDDA 5JYIA 3MU8A 3ZV9A 1OYTH 4D9QA 3Q3XA 1NROH 4UFGH 1GJDB 1ZR0A 3KHVA 1GVLA 1UK3A 1ZPCA 1SFQB 5A0CA 3P95A 3GOVB 3EDXB 1EPTB 2SGDE 9ESTA 1KDQB 1J8AA 1FPHH 2FX4A 3SI3H 6GCHF 1SR5C 2ZGJA 3TGJE 2ZWLH 5C67A 4Y76A 3ATWA 2UWLA 4BTTB 5L30H 3LGIA 2ZU1A 3ZZAA 2JETB 4HZHA 2BY5X 3BTWE 2FO9A 1BTWA 2G8TA 4B75A 1GI9B 1G30B 3P8GA 1QB1A 2AGEX 2ZO3H 4YZUA 2Z3EA 1PJPA 4FUBA 1ABJH 3S0NA 4BAMB 4DCDA 1YPJH 1SGFG 3TJOA 2KAIB 1GBHA 2GDEH 1EX3A 1T7CA 4JZFH 5K0HA 2HNTF 3ZYEA 1KXBA 5GCHF 2DE9A 1G3DA 3QO6A 2XWAA 4XSKU 1TBZH 3UWIA 1NT1A 3GCNA 4O3UA 3V0XA 1MZAA 1D3DB 1QQUA 1A0HB 2F91A 4O3TA 1QRZA 4ISNA
chains in the Genus database with same CATH superfamily
3TH2H 1UVUH 1AZZA 3Q76A 4ABGA 2IPHA 2W6ID 1TALA 1PFXC 2K0QA 1WBGB 1GHYH 3TLOA 5C20A 1HJAC 4Q2KA 2AMPA 2KCOA 2AYWA 1NFWA 2HOBA 4ISIH 4ISOA 6LPRA 3MQKC 3NXPA 4TWYA 1MU8B 1GI3A 3U98H 4MNWA 1NRPH 1P57B 2ZU4A 1IQEA 2G51A 3LC3A 1HLTH 2J9NA 2NU0E 1HAVA 4GPGA 1H4WA 4DJZB 1BT7A 2ASUB 1YLNA 1TBRH 3QK1A 5DG6A 1P06A 1AFEH 4J2YB 1MCTA 1QJ6B 1GBEA 3RXDA 1MD7A 2XC0A 1GBKA 1O3NA 2G00A 3STJA 1M9UA 2ZG0H 2CF8H 5EXNA 3RXFA 1P12E 2OLGA 1EAUA 1K22H 1YYY1 2GV6A 4Z6AH 3KQBA 2EI8A 3GY8A 1MTUA 1SGCA 3LDXH 2EC9H 1VCQA 1FZZA 3TPIZ 1TGCA 1ELVA 3JZ1B 2BLWA 5EOKA 1P8VC 3M5OA 5JPMH 1YKTA 4MNVA 1O38A 4IN2A 4Q4LA 1GI4A 1D9IA 3BTDE 1G32B 4AX9H 3CENA 5HGGA 3GICB 2KX4A 1X7AC 1TOMH 1S6FA 4ZKNU 3PMJA 3PM3A 1GJ4H 2UWPA 1QY6A 4ZXYH 1W7GH 1C1SA 1ANEA 5LPRA 3EA7A 2ZHDA 1FXYA 2HVXA 3O8DA 3VGCC 4CH8B 1KLTA 4K60A 1TGTA 3Q3KA 2OTVA 1ZHRA 1TPAE 2BD3A 1A3EH 3SV2H 3MO3A 2J94A 1W7XH 2W5EA 1GDQA 1EASA 1LHFH 4CBNA 1E35B 4B2BA 3ELAH 2P3UB 3TJVA 3BEIB 4ZKOU 4JYTA 2ZQ1A 4BTIB 2FIRH 5LH8A 2ZPQA 1GHZA 4AYVB 2Z6BD 1K9OE 2FLRH 1G3CA 1EJAA 2A32A 1A0JA 1UK2A 1IQMA 2BQ6B 1DXPA 1YPHE 1GBBA 2HWLB 2ZEBA 1Z1IA 1AUJA 1QZ8A 1TNGA 3STIA 4ACBA 2OQUA 1P9UA 1BTXA 1C9PA 1KDQA 2PUXB 1V2OT 1SLWB 4XBDA 2ILNA 1XVOA 4YLUA 1GVZA 4RN6A 1YCPM 1ZZZA 1C1TA 1G3BA 3KEEA 3M3TA 1OP0A 1DLEA 4NWLA 3P8OA 1AVXA 1K1JA 1VJ9U 3LT3A 2WPLS 4AOQA 1FX0B 2FPZA 4CHAC 3TK5A 1ESTA 4BAHB 1BTPA 2ZZUH 2QF3A 5AF9H 1CHOF 1XUKA 3G01A 2KCPA 1RD3B 1JXPA 4ABFA 4JMYA 1LPZB 3UWJH 2FEQH 4RKJB 1QBNA 1Y8TA 2A5AA 4KELA 1W3CA 2Y81A 3LONA 1O2OA 1O2PA 4B74A 2J95A 2FOHA 1GGDB 3T27A 4B73A 1GBFA 3ZVAA 1PPGE 1O37A 2CGAA 2VGCC 3A85A 4B2CA 1PPCE 1QURH 4U2WA 4MLFB 3SGQE 4K8YA 4Y6DA 1THPB 5GPIB 2PLXA 1MKXK 2Z9GA 3URDA 1FIZA 2QXHA 4NFFA 3RU4D 2AFQB 1YLCA 4ZMAH 3A86A 5T6DA 5E0HA 1BTZA 3SN8A 1HJ8A 1TMBH 3LIWA 4ZKSU 2YOLA 4INKA 4GVUA 3A7ZA 1P3EA 3ZZ7A 1IQLA 1H9LB 2GKVE 1HAOH 1GCTC 1GI6A 1ZOMA 1GJAB 2BD7A 3HK6B 3BTKE 1O2YA 1P2NA 2PKAB 2FTMA 1WAYB 2IN2A 2G52A 2VIVA 3S7HB 3GCHC 1GG6B 1XXDA 1V2VT 4A5TS 4YOJA 1Z8RA 5HKKD 3SU3A 2BOKA 5LPFA 1YPLH 1L4DA 1QHRB 1W12U 1V2LT 1BBRK 4Q7XA 1AE8H 3E0PB 4KGAA 3ZZDA 1N8OC 4IN1A 2A0QB 2G55A 3RUOA 3U8OH 1O2QA 1GHWH 8GCHF 1D6RA 1XUFA 2QF0A 3SUEA 3ZZBA 4FUDA 1A5IA 1HAXB 4LZ4B 2NU2E 5JDUB 1VGCC 4Y7BA 5CHBA 1SGYE 1WU1A 3A8CA 5E0GA 1O35A 1A5HA 2HGTH 4TYDA 1AFQB 1GI5A 3ODFA 2C90B 3UOUA 1L2EA 5I46H 5ESBA 3PLPA 1ELFA 5FL7D 2RCEA 5A09A 1ETTH 3A8BA 3PLBA 1RTKA 3GY2A 1AWFH 3IG6B 1PPEE 3OE7D 1C5PA 2F9UA 1VJAU 1JBUH 1AUTC 1O5GH 2H1UA 3BG4B 4U30A 1AWHB 1KIGH 2GMTC 2Z3CA 5JBTA 1FJSA 2FOEA 3LGWA 5EPNA 1EATA 1RS0A 2SNWA 2KCYA 4FVDA 3MH7A 5L2ZH 1ABIH 4MPXA 1V2TT 3PO1C 3RC4A 3SGAE 1UHBB 1ZSJA 4AC9A 1MKXH 5HIZA 1NBME 3EA8A 5GJ4B 2RFKC 1Z8GA 1NN6A 5C94A 4AFSA 2Y80A 4BOHA 1KXEA 3DHKH 4GLYA 4WH8A 1W0ZU 2QXJA 1O5BB 1P2OA 1PPHE 1QA7A 4RI0A 5DP5A 3ZV8A 5EXLA 1C1MA 4DOQA 1XX9A 4SGAE 2TGAA 5TCAA 5DN6D 3EGKH 1CA0B 1EAWA 4FU9A 5T6GA 2WPMS 2H9EH 2RDEA 4H6TA 4Q63A 1T8LA 3LGVA 3BTQE 2BD4A 3M36A 1TGNA 5FHTA 3W94A 2XC5A 2WPJS 1ELEE 3EE0B 3MU0A 2PFEA 3KN2A 2HNTC 4M9FA 1GHAG 4UDWH 3F9FA 1BBRH 1C4U2 1QR3E 3SHCH 3OTPA 1HAPH 2BVXH 3SJIA 1DT2A 1MABB 3K9XB 1G36A 2G81E 5B6OA 2BDIA 4XBCA 2ODQA 3TK9A 2H5CA 2C93B 1AY6H 3LJJA 3GS9A 2FLBH 1V2ST 1SGFA 2Z9KA 3FZDA 3S69A 3A87A 3OYPA 5EU8A 1BRUP 2J38A 3HKIB 1GHAF 1ZGIA 4E7RG 3OSYA 1GI7B 5L6NH 2AS9A 3A7TA 3EYDA 3JZ2B 2ZNKH 3SNAA 2PTNA 1P01A 1UTQA 3RXLA 2F9VA 2P8OB 1AIXH 1C2DA 4ESTE 1C5ZB 1DWBH 2W6JD 3MH5A 1VKYA 1P9SA 1C5MD 2H5DA 3UNRA 2BX4A 3RU4T 3SBKA 3N7OA 3FVFB 1AHTH 1YPKH 3A7VA 4GHTA 3SV6A 2A7CA 3PV4A 5HM9A 1FAKH 4PROA 1TPOA 1WTGH 3V3MA 4FETA 4IW4E 1HYLA 4ZHLU 2EI6A 1K0HA 2QXIA 1AE5A 4Y71A 3VB7A 1GBLA 2QCYA 3P6ZB 4D8NA 1RIWB 5KGOA 3VXEH 4I7YH 1CVWH 1Y3UA 4XRNA 3M35A 2A2QH 1O2GH 4OGXA 3N7DA 2J97A 3PWBA 2W3IA 1DS2E 3WY8A 2TBSA 1LCYA 1SOZA 1C1PA 1SQTA 3DT0H 3VFEA 2ZF0H 5CHAB 2BD2A 4ZH8A 2VNTA 1F92A 1NFXA 2HALA 5K7RA 2AMDA 1S85A 1AVGH 1C5VA 1QB9A 2Y6TA 3S7KB 3MO6A 3QWCH 4NG9H 3CP7A 1J9CH 3V13A 1KTTB 3GY4A 4K1SA 1YBWA 3T5FH 3PMHB 2FOAA 2BD8A 3S9BA 1SLVB 2OBQA 4X1PU 4FUCA 3RC6A 2JKHA 2P95A 5A8ZA 3DFJA 2HLDD 2O8MA 5GIBA 5FCKA 4Y10E 3EE7A 3UOPA 3UR9A 1EZSC 2FM2A 2SGPE 2ZDNA 2OINA 1AB9B 1CBWC 1OHHD 2CMYA 4X1QU 1C1RA 1LVOA 1ZMNA 1U6QA 5T3HA 1EAIA 5C5OA 3MI4A 1SPJA 3RMMH 2Y7XA 1TA6A 4UFFH 3A88A 3M7TA 4YOIA 1C5OH 1JIRA 3RXHA 2BY9X 1ZHPA 1YPGH 1IQNA 5FPYA 3UY9A 1GBJA 4I8LA 1THSH 5HIYA 2GJGA 2C3SA 4KP0A 1OWDA 4IGDA 1S6LA 5L2YH 3GY6A 2JIZD 4IMZA 9LPRA 1QRWA 3MU5A 2AGIX 3OAAD 3W95A 1BMFD 1UHBA 1DWEH 1NY22 4YLQH 2YMSC 1FUJA 4YTAA 5EJ1A 3D49H 4B1TA 1GL0E 2G4UA 1IHTH 3LJOA 4ZHAA 2W26A 1YGCH 2SNVA 1QBOA 3P92A 1ELGA 8KME2 4R8TB 3PMBB 2PKSC 4E7NA 3T29A 2NWNA 2ZDAH 2FODA 3SI4H 3LPRA 3T2NA 5A0AE 1O3KA 5JB9S 4AFZA 1O2TA 3TU7H 1GJ5H 4Z1MD 1O3MA 1RRKA 3MNBA 1PYTD 1T8OA 2GP9B 3SJ8A 2V35A 1C5TA 2F83A 1GHBF 4FVBA 1E0FD 1L4ZA 2VIPA 1WYKA 3BEFB 1VCPA 3MU4A 5SGAE 4BTUB 1O39A 1S82A 1W8BH 1WCZA 2OQ5A 2GCHF 1AGJA 1SI5H 1CU1A 3QZRA 1HXEH 4GSOA 1A5GH 5BPEA 4WMEA 5E2PA 1V2PT 4JZIA 4B6FA 1O2WA 1ZJDA 4ABJA 3SJ9A 2ZGXH 2B9LA 3PMAB 1LHEH 1EB1H 1O34A 1QJ1B 1WOFA 1TRMA 4Q7ZA 2VH0A 2ZTXA 4VGCC 2ZCHP 2TIOA 3K6YA 2TGDA 1IHSH 4FUGA 1S0QA 3AW0A 3QUMP 2HNTE 1NU9A 2FS9A 5FPTA 4BXWA 2I6SA 1WXRA 4F55A 1UK4A 1ELAA 3E91A 2ZDLA 1BCUH 1ARBA 1QL9A 1OWIA 2BMGB 1KLJH 2FS8A 4X1NU 2B7DH 3URCA 1WSSH 4ABBA 4XFQA 1NC6A 3RXJA 2VIDA 2VH6A 1P0SH 3KQ5A 4Y11E 3TIUA 1A1RA 2P16A 2ZFQH 3M3VA 5C3NA 1FY4A 3FO8D 1BTHH 1UCYK 3HGPA 3SU1A 2AIQA 1TIOA 2FOBA 3QN7A 3Q77A 1TPPA 1TFXA 3V7TA 1O36A 2BY6X 1ZSKA 2BDHA 1GBCA 2ODPA 3IITA 1BUIA 2F4LA 2WPIS 1PQ8A 2W7UA 2BLVA 1VITG 3KQEA 4FU7A 3RXMA 3N99A 1NM6A 2P3TB 3ATLA 3HKJB 2VU8E 1D4PB 1GMCG 4ABIA 2UWOA 3SJOA 3SUDA 1BRAA 5FX6A 4I8HA 1O2SA 4XBBA 3GY7A 3OEED 3TH4H 2XYAA 1PQ5A 3RXTA 1KXCA 1C1UH 1CT0E 1SFIA 1K2I1 5EODA 3SNEA 1K1PA 3BTHE 3TVJB 1ZJKA 1C4Y2 2YNAA 1MCVA 1SGQE 1Z8IB 1O3JA 3A83A 1IQJA 3O8BA 3VB3A 4MDSA 2FOCA 2FI3E 2OUAA 1UW7A 1DICA 3TGIE 4NIWA 3MNCA 3RXQA 1CA8B 1N1LA 1NZQH 1XUGA 2BVSH 1GBMA 2PGBB 4ASHA 1FN6A 4MQAA 2UUYA 2VVCA 3BEUA 3NK8A 1Z1JA 3NWUA 3RXPA 1TYNA 3L33A 3SO3A 1F0UA 5FX5A 3AVZA 4AZ2B 1P2IA 2BZAA 5LPEA 1ZYOA 3VG8A 4A7IB 4D7GA 1TNKA 1H8HD 3GY5A 3F2FA 3AK5A 1CQQA 3NZIA 1GDNA 1KTSB 1O3OA 4K1TA 1GMDG 5E2OA 3T25A 1O2JA 3A7WA 2AHME 4CRFA 2WUCA 2H9TH 3UNSA 3LH3A 4CRCA 5DP7A 1O3IA 2STBE 4KTCA 1IQHA 2GZ7A 2PHBA 4INHA 4H6SB 1TQ7B 1F5LA 3SU2A 1WQVH 1FQ3A 2BDGA 4K3JA 5DKMA 3QDZB 4WXVA 1FAXA 1H8IH 1O31A 2ZA5A 3FP8E 3V12A 3PLKA 1UCYH 3A84A 1ZRKA 3QX5H 1GI2A 1OPHB 1BMNH 1ZPBA 1IAUA 4OS1A 4YT6H 5HXFA 4LOYH 2OC8A 1FY5A 1MU6B 1O33A 4NGAH 5F6MA 2Y5HA 3OY6U 3MH4A 1A7SA 1IQFA 2F9BH 3RXGA 1GJ8B 4I8GA 1O3BA 1O3PB 1B7XB 4A1XA 2BM2A 3GYMA 1C5RA 3A89A 1TOCB 3RXKA 4CRDA 2HPPH 3BF6H 2B0FA 2BX3A 3FAOA 2ZHFH 1OWHA 2Q1JA 1W0KD 1EPTC 3MU1A 1MTNC 4A6LA 4B71A 2BXUH 4U01A 3ATMA 1J16A 6CHAB 3UQVA 3RMNH 3RXSA 2BVRH 4DVAU 5LGOA 4JZDH 2WZQA 2ZHWH 4AYYB 1L1JA 2OD3B 3NRLA 1G37A 1QCPA 2Y5FA 1EZUC 3U69H 4DT7B 3Q3YA 2JETC 3SU4A 2FI5E 3AASA 1GI1A 1BHXB 3GY3A 2ZP0H 1GJ7B 2C8WB 3UNQA 1DE7H 3RMOH 4F48B 2SGEE 2XCFA 2ZTZA 1O0DH 2JH5D 4D7FA 2R9PA 4AG1A 1FI8A 1GI0A 4X2YA 3DA9B 1OYQA 1THRH 2BDAA 2ALVA 1LPKB 2CHAB 5DP4A 1SL3A 2ZCLP 2GCTB 1FV9A 1JRSA 2DUCA 2LPRA 1C2MA 4O03A 3PTNA 1BJVA 2ESTE 5I25A 2ZECA 3RDZA 3TNSA 2UUKB 2O8UA 1E1QD 3S9CA 1GMHG 1YF4A 3PB1E 1LO6A 1DFPA 1YPMH 4Z0KA 4JK5A 1SMFE 2EY4C 4YT7H 2V3OH 5EQSA 4FUIA 2V6NA 2JH0D 2A4GA 2D2DA 8LPRA 1Z7KA 3E90B 1LTOA 4OS6A 3FFGA 3ZYDA 1B5GH 4Y8YA 1AKSA 1LHGH 2C8XB 2PSYA 5EPYA 2W3KA 2ZKSA 1QL7A 5C5NA 1MZDA 5HYOA 1UTKA 2PWXA 1UVSH 4MG3A 4X6OA 5C1UA 1UJ1A 1J15A 4HFPB 1H9HE 3T62A 4WWYA 1C5WB 2O8LA 1P09A 1EQ9A 2AIPA 4D9RA 3QGNB 5EIYA 1GBDA 4MTBA 2A2XH 1NO9H 3U1JB 3A81A 3BN9A 4ZKRU 3VPKA 1V2KT 2PV9B 1GJBB 3RLYH 1AN1E 4FUHA 4K69A 5EQQA 3F3BA 4X2WA 2BD9A 3SNDA 4FUFA 5HM2A 1COWD 2ZHEH 2ZPRA 3SORA 1GHVH 3L3TA 3HGNA 4X2XA 5EXMA 4BXSA 1DANH 2FOFA 2FESH 5H4IB 1V2NT 1C5UA 1GVKB 1WQSA 3F9EA 3MNXA 2WSSD 2ZDVH 2BHGA 5B6LA 4YM9A 3FP6E 1O2VA 1AVWA 3RXUA 3UB0A 1SC8U 1NRQH 3P8NA 4AG2A 2F9OA 1Z8JB 1K1NA 2EQNA 4X6NA 4AB8A 1DDJA 2R2MB 2VIWA 1MTWA 1O2MA 4NSYA 1TPSA 3UFAA 2R2WU 1A4WH 3FKSD 4K8BA 1TNJA 4JCNA 3RMLH 1BTYA 3K2UA 5DJ7A 1J14A 2J34A 3O8RA 4XDEA 1ARCA 3KYGA 1CGJE 2FYQA 2Z9LA 1C2IA 4CRAA 1HXFH 2BZ6H 5A8XA 2FX6A 4I8JA 4CR9A 1LVBA 1A2CH 1BB0B 2A4RA 1ZTJA 2IPQX 3ZVDA 1QGFA 1XUJA 4O97A 4IC5A 3F9HA 2WYGA 3A80A 3OX7U 3RXIA 3TGKE 2RDLA 2QY0B 1NTPA 1XXFA 4IBLH 4UFDH 1H8ED 3ZZ6A 3NUMA 2WINI 1PQAA 2AH4X 2STAE 1DLKB 2OCVB 1O2ZA 2VJ1A 2VINA 1TNIA 4I32A 1KXDA 1CSOE 3KCGH 2F43B 3VB4A 4DW2U 1ZHMA 1UCYE 1ELDE 2GT8A 3PRBA 4XOJA 1Q3XA 1TGSZ 2ZFPH 1Y5UT 3DCLA 1DUAA 1V2MT 4FUEA 4YOGA 4BNRA 2LNCA 4AGKA 3MH6A 2KM0A 4ZXXH 1QRXA 5TCCA 1SVPA 3SOSA 1HUTH 3HK3B 5ETXA 3ATIA 2LP6A 1D3QB 7LPRA 4GCHG 5C1XA 1EJNA 4CBOA 5E8EH 3RXRA 4UE7H 1MMJN 3S9AA 1O2UA 3PV5A 1HJ9A 1G3EA 2R0KA 1XVMA 1AZ8A 5EGMA 2QN5T 3GCTG 1W14U 2BY8X 5EJZA 1ORFA 1SBWA 3P8FA 1HIAB 1WTHD 3KL6A 1YM0A 3RP2A 4GCHF 1EOLA 2ZI2H 1N6XA 4JYVH 3IWMA 1L1GA 3TNTA 2NU1E 1Y3XA 2WV4A 1GGDC 4ZHMU 2GVFA 2ZU2A 4X8TH 5DK1A 3E16B 2TGTA 1DY8A 1DPOA 2PUQH 2QC2A 1LHDH 4VGCB 3LGYA 1V2JT 1SGDE 5EQRA 3B9FH 5F53A 1KYNA 3E6PH 1ETSH 1FY8E 2PR3A 1C1WH 1C5XB 1SSXA 1IQGA 3F0PA 5HMAA 4WMFA 4MNXA 4CRGA 4NIVA 1NFUA 2Y7ZA 2C4FH 3M7QA 5C1YA 2XOKD 2GGVB 4CR5A 3UTUH 1J17T 1TBQH 3KQCA 4ABDA 3PTBA 3N7EA 1UVPA 1MAYA 1O3EA 4AGJA 2ZPSA 3LOXA 2F9NA 2XBXA 4TWWA 1ESAA 1O2KA 1MTSA 1C5SA 4HTCH 4A92A 1MUEB 2OC1A 2H9HA 1P2JA 1T32A 1AQ7A 5KECA 1TGBA 3SW2B 1C2EA 2D1JA 4X8UH 3B23B 3DSPA 3ENSB 1DVAH 1Y5BT 3SV8A 1HJAB 2C8ZB 1P2KA 3RLWH 2VB0A 2ZFRH 3LH1A 4TPIZ 3NPSA 3SQEE 5FPSA 2THFB 1GBIA 2PSXA 1W10U 2GT7A 1AFQC 3A8AA 2BDYA 2FZZA 2TGPZ 5JBCS 4X1RU 3QLPH 4TPYA 3RXBA 1YWUA 5FCRA 5J4QA 1EB2A 2AERH 3GDUA 1GBTA 3U9AH 1TE0A 1S0RA 1TWXB 4ZROA 1UTPA 2BB4A 3BG4C 1AI8H 3F1SB 2Z9IA 3EA9A 1OX1A 1S84A 1KXFA 1JIMA 3NKKA 1B0EA 4H4FA 1GWAA 4O9VA 4ACAA 3KF2A 2D26C 3AAVA 1ZSLA 1ANDA 1Q2WA 2XC4A 1HB0B 1MTVA 5IDKA 2QE7D 5DP9A 2OC7A 2P94A 2QYIA 2VWLA 2PGQB 1TNLA 1AO5A 3UQOA 1LVYA 3MTYA 4OS7A 5F8TA 2R3UA 3DUXH 2ZIQH 1K1MA 1T31A 1E79D 3D62A 3I29A 4BAOB 3HPTB 2YMSD 2VIQA 5DP3A 2XW9A 3SQHE 2BXTH 3GDVA 1FY1A 1T8NA 1QL8A 1CA0C 1O2XA 1TONA 5ABWA 1C2KA 4F4OC 4HGCA 2QGRA 3VGCB 3F0OA 3UPEA 2VVVA 2KR7A 2ALPA 1GCDA 1HAIH 3AW1A 1KY9A 1RTLA 1ZTLA 2M5TA 3M3SA 1L0ZA 1O2RA 3LGTA 4TY7A 1P05A 1PYTC 4ZUHA 4UFEH 6GCHG 1K28D 2GD4B 3RM0H 1SQAA 1NRSH 4NA8A 5GNDA 4X2VA 1EOJA 2FWWA 2SGQE 1QA0A 5DP6A 4MVNA 1O32A 3ESTA 1S6HA 2ANMH 1BIOA 4AFQA 1NESE 7ESTE 4OS5A 1BQYA 1EXFA 3CS7A 5G4BA 3FZZA 1C5NH 4GHQA 3LU9B 4DG4A 2QIQA 1MTNB 1EP5A 2WHXA 1BBRE 2R0LA 2WV9A 3DFLA 1Y59T 3U8TH 2KFWA 1V2QT 2OBOA 4JK6A 1DUEA 4ZCNA 1HIAA 1VZQH 1UTJA 1G9IE 3M5LA 2P8OC 2Y82A 1N6YA 2M2AA 5IYTA 2FOMB 1P11E 1S81A 2A1DB 1ZRBA 3LGUA 5JBBS 2QV1A 1K1LA 3ZZ4A 5GCHG 4OS2A 5C17A 3NCLA 3U28C 4CHAB 1HV7A 4I31A 4K2YA 4ISHH 4DY7B 2KCAA 1ZLRA 1H8DH 3UIRA 1ZPZA 1BHXF 3ODDA 1SGEE 5AVDA 1RIWC 1AKSB 3C1KA 1O5DH 1PQ7A 2K1QA 3H5CB 2XBWA 2VGCB 1V6DA 3EQ0H 2P3FH 3CNRA 1G2LA 2SGAA 1UTNA 1FN8A 4Y8XA 5FBIA 5AFYH 3LC5A 3U1IB 1P03A 5CHAC 3RXEA 2XNDD 2GX4A 1LHCH 4Y0YE 3D65E 3ZZ5A 1VR1H 5T1VA 1OP2A 1OOKB 1T4UH 4OGYA 1GCTB 1HNEE 1BMLA 2SGFE 1E37B 1VITF 1EZXC 1PPZA 1V2WT 1SKYE 2AEIH 5CE1A 1O3HA 4F49A 1GMCF 4J1YA 2WUBA 1SGTA 3GCHB 3QZQA 1K1OA 4MPUA 1MBQA 1TLDA 2FTLE 3OEHD 2HPQH 1V2UT 1DY9A 1AB9C 1F7ZA 3K6ZA 4GAWA 5ESTE 3PWCA 1Z6JH 1MH0A 1YLDA 4TSFD 3RXCA 1F2SE 1O3CA 2L6OA 4NIYA 3ZVFA 4JYUH 4BANB 1QIXB 2QF4A 3BTME 4GUXA 1T4VH 1W0JD 2A4OA 2XRCA 4YXWD 1N8OB 2A7JA 3GYLB 1BMAA 1NRNH 1KMHB 1SGRE 4Y0ZE 2WPHS 1YC0A 2VIOA 2PTCE 4LK4A 1XM1A 1LPGB 1D6WA 2I6QA 1ANCA 1SHHB 3VXFH 2NU4E 3BIUH 3I78A 1VGCB 2ZU3A 2O9QA 1NBMD 2L74A 1TA2A 1BTUA 2YNBA 2TPIZ 3UR6A 1TNHA 2G4TA 4CRBA 4BAQB 7KMEH 4THNH 4RKOB 3I77A 1FONA 5C2ZA 1FY3A 2XCNA 3SJKA 3E8LA 1GJ6A 4X6MA 2OXSA 3K65B 2FYRA 1CE5A 1OKXA 4D76A 4A1VA 1BRBE 4E05H 2Z7FE 1DWDH 3OY5U 5CMXH 1BITA 1GMDF 1O2IA 4NSVA 3SU5A 2GMTB 5F8XA 1GJ9B 1GPZA 2ZCKP 1F0TA 2V3HH 4AB9A 2ZDMA 1TMUH 5EW2H 1C4V2 1FMGA 1O3GA 1P10A 3PO1B 1UTOA 3F9GA 1SLXB 2RA3A 1MKWK 2UUFB 1Z71A 5JBAS 2P93A 3ATKA 1ELCA 4DURA 3SNBA 1ANBA 1TX7A 2CXVA 4WJG2 3OFND 4IC6A 3BSQA 1IQIA 1XUHA 1SGNE 3UAIC 1E34B 1O5FH 2CF9H 1HBTH 1QBVH 1HAHH 2A45B 4WVPE 2JDID 4H42U 5DGJA 4E06H 3TH3H 1W13U 5BRRE 2V3MA 3TK6A 4LXBH 2BQWB 4I86A 3A82A 1EPTA 4MPWA 3TJUA 2A7HA 1CHOG 2ZGHA 4Q7YA 1K1IA 5C0TA 3SU0A 2RA0A 1QJ7B 1TX6A 2ZGCA 4NA7A 4Y7AA 1ZGVA 3W1EA 1MQ5A 2FXRA 1YY3A 1IOEA 2QF5A 1EKBB 3SUFA 5KEDA 2QXGA 1CGIE 4JZ1A 1TX8A 1HGTH 2Z94A 3MO9A 1AD8H 3QTVH 1H9IE 2FI4E 1XUIA 1RFNA 3VEQB 1A46H 2EI7A 4FUJA 1RGQA 1SOTA 2GZ9A 1JWTA 1VCWA 1IQKA 2ODYB 4OM9A 1E1RD 1ETRH 2ANWA 2KAIA 1KLIH 4ZAEA 5AHGH 1ZTKA 3ZVBA 4Y79A 1O5CB 3HATH 2BDBA 2ZFSA 1GI8B 1UTLM 5A0BA 1W0YH 4MNYA 3UUZA 3KGPA 3U8RH 1LMWB 3M7UA 1P2QA 3QTOH 4KTUA 5JB8S 2H6MA 4AORA 2WYJA 1GMHF 1K21H 5GWZA 1C5YB 2C8YB 4HG6A 2J98B 1EJMA 4I8KA 3WWBA 1BZXE 1TB6H 3M5NA 1WUNH 1MAXA 2JJ1D 2A5IA 1GL1A 2AGGX 1KXAA 2D8WA 4INLA 5FXLA 4DGJA 1NS3A 1MKWH 3SGBE 1TAWA 1JRTA 1SB1H 4LZ1H 1EAXA 3MNSA 4CREA 3SYJA 1C2GA 1NPMA 3SZEA 1GBAA 1UVTH 4FXGH 4TY6A 1DSUA 2VWOA 1E38B 2XXLA 3SHAH 1LDTT 2O8TA 3ZVCA 1HRTH 1LKAA 1O5AB 2JJ2D 2EA3A 2XNIA 8GCHG 5PTPA 2FDAA 1O3DA 2OC0A 4B76A 2BY7X 3KIDU 4NWKA 4KKDA 1D3TB 2VWMA 2Q6GA 1FDPA 1XMNB 3RXVA 1JMOH 2QAAA 2XBYA 3UREA 4JZEH 3DSGA 2F3CE 2WV5A 3C27B 3WWFA 4ABEA 4ABHA 3L6PA 1CGHA 5GDSH 3ZVEA 2ZTYA 4X6PA 1OWJA 1OWKA 2ULLA 2Z3DA 3KQDA 2FOGA 1F0SA 3BTGE 4YESB 1OWEA 4UONA 2NU3E 2RG3A 4U32A 1C5LH 1SG8B 1UVOA 1Y5AT 3RC5A 1BJUA 1CBWB 5FAHA 2HLCA 1D3PB 1CT4E 4CH2B 1P02A 1Q31A 1ACBE 1V3XA 1TQ0B 3D23A 4MPVA 1P3CA 3ZZ3A 3LKWA 4WXIA 4XE4A 3GCOA 1EZQA 1BRCE 2V0BA 1C9TA 2ZC9H 5DSFA 1WDIA 3BTTE 1O5EH 4P02A 5EW1H 5A8YA 3F2GA 1B0FA 1QFKH 3B8JA 1S5SA 1XKBC 1XKAC 3BTEE 1TRYA 2CN0H 3PROA 1DWCH 2GV7A 3SV7A 3R3GB 5A2MH 2BYAX 4NZQA 1TRNA 1O30A 2JH6D 1DOJA 1DXWA 2DE8A 3M61U 4AFUA 2CV3A 3Q00A 5GXPA 1BOQA 2YMSB 1F0RA 4IS5A 3P17H 3AAUA 1C5QA 3MWIU 2ZU5A 4YO9A 3E0NB 1L1NA 5EJLA 2BTCE 2XTTB 1HCGA 2PKSB 2W7SA 6CHAC 4WF8A 1WV7H 1E36B 1CHGA 2PP6A 1DITH 1NU7B 1AU8A 3EAJA 1SGIB 4NFEA 2ZFTA 4HI3A 1INCA 1W2KH 1RXPA 2VVUA 3BG8A 3OTJE 3MOCA 2A4QA 3ZVGA 5CDFE 3BTFE 2G5NA 2V7QD 1YCPK 2BDCA 2O8WA 1C2LA 1A61H 1MD8A 2B8OH 4X0WU 3VB6A 3DSOA 3PYHA 4SGBE 1ELTA 1Y3VA 1YPEH 1UTMA 1MQ6A 1BDAA 2CHAC 3CS0A 1HPGA 1SQRA 3BIVH 1LQDB 2GCTC 5F8ZA 3M5MA 3O8CA 3FN8A 3RXAA 1HAGE 5J4SA 3DD2H 3E1XB 4ISLA 4NA9H 1ESBA 4ASUD 1QB6A 1C1NA 1A0LA 2ANYA 2BQ7B 1JOUB 5DO4H 3F68H 2ZHQH 1A3BH 1UMAH 3GCTF 4X1SU 3RM2H 1NRRH 4B6EA 1HFDA 3MFJA 1VITH 3P70B 5TJXA 2J4IA 4Q80A 1EUFA 2SFAA 1DM4B 4A1TA 2UUJB 2AMQA 2J5UA 2H2ZA 3ZZCA 2VWNA 3VB5A 1UO6A 1O3FA 3TITA 1O3LA 3SZNA 4NIXA 1F5RA 1QTFA 3A8DA 3SNCA 1GG6C 2J98A 1TABE 2CJIA 3KNXA 4M7GA 8ESTE 5EG4A 2Q6DA 3A7YA 1P04A 1QNJA 5FBEA 3GISB 3RXOA 1GDUA 1C2FA 4K1EA 4TT3D 1LVMA 1DSTA 4UD9H 3F2HA 2ZGBH 4P00A 2Q6FA 2BLOA 3PRDA 4X8SH 3SV9A 5AFZH 5F03A 1PPFE 2HRVA 3BV9B 5DP8A 4ABAA 2A5KA 3H7OA 1O3AA 2XBVA 4FU8A 1G2MA 2BOHB 4WMDA 2IOTA 2XWBI 2PKAA 3RU4E 1LQEA 1OSSA 2VBCA 3ITIA 1O2NA 1O2HA 3ZZ9A 1ELBA 1SLUB 2QA9E 3GDSA 2FMJA 4AN7A 4FOUC 1RTFB 3R0FA 4RT0A 2TRMA 3MHWU 3M37A 3WW7A 3PV2A 1MBMA 1C1VH 1ID5H 1DX5M 5E0JA 5IK2D 1YCPH 1PPBH 1AMHA 2J92A 1HAVB 1C1QA 1ZMJA 1HAYB 3F6UH 3FP7E 1CT2E 1SHYA 1KSNA 2F9PA 1P2MA 1BMMH 1FIWA 2ZFFH 2R3YA 3A7XA 1SGPE 3FANA 1GJCB 1RJXB 1FLEE 1SQOA 5T6FA 3H09A 1T8MA 2IJOB 2P59A 2BLQA 2G5VA 3ZZ8A 2B5TB 1Y3YA 2WPDD 1LKBA 1CO7E 1Y3WA 2PW8H 4UEHH 1OP8A 1ZMLA 2ZQ2A 3TJNA 3T26A 4BAKB 4WY3A 7GCHG 2ZDKA 2A31A 2LELA 1C1OA 3QGJA 4Y8ZA 3MYWA 4R0IA 3E3TA 4I33A 1BA8B 1GHXH 1TMTH 4WH6A 4RSPA 3SU6A 3OU0A 3MMGA 4DIHH 6ESTA 1C2HA 1FPCH 2ANKH 1C2JA 1EP6A 1O2LA 4IMQA 2HVYB 3T28A 1QQ4A 4OS4A 1V2RT 2WPKS 7GCHF 1HAZB 1H1BA 3H7TA 4NCYA 5DPAA 2OP9A 1YPHC 3FOAA 2Y5GA 1OS8A 1OXGA 4B2AA 4DT4A 2FP7B 1S83A 1GHBG 1HDTH 4X8VH 1FNIA 4NZLA 4DIIH 1NFYA 4RT1A 2Z9JA 4K5ZA 1F5KU 1Z6EA 2J2UA 2GTBA 3SUGA 2GCHG 4QT8C 3ZIAD 1W11U 2EEKA 2BD5A 2GZ8A 1YP9A 4KTSA 2GDDA 5JYIA 3MU8A 3ZV9A 1OYTH 4D9QA 3Q3XA 1NROH 4UFGH 1GJDB 1ZR0A 3KHVA 1GVLA 1UK3A 1ZPCA 1SFQB 5A0CA 3P95A 3GOVB 3EDXB 1EPTB 4XD7D 2IJD1 2SGDE 9ESTA 1KDQB 1J8AA 1FPHH 2FX4A 2OK5A 3SI3H 6GCHF 3KYFA 1SR5C 2ZGJA 3TGJE 2ZWLH 5C67A 4Y76A 3ATWA 2UWLA 4BTTB 5L30H 3LGIA 2ZU1A 3ZZAA 2JETB 4HZHA 2BY5X 3BTWE 2CK3D 2FO9A 1BTWA 2G8TA 4B75A 1GI9B 1G30B 3P8GA 5C0UA 1QB1A 2AGEX 2ZO3H 4YZUA 2Z3EA 1PJPA 4FUBA 1ABJH 1EFRD 3S0NA 4BAMB 4DCDA 1YPJH 1SGFG 3TJOA 2KAIB 2K8IA 1GBHA 2GDEH 2KZ4A 1EX3A 1T7CA 4JZFH 5K0HA 2HNTF 3ZYEA 1KXBA 5GCHF 2DE9A 1G3DA 3QO6A 2XWAA 4XSKU 1TBZH 3UWIA 1NT1A 3GCNA 4O3UA 3V0XA 1MZAA 1D3DB 1QQUA 1A0HB 2F91A 4O3TA 1QRZA 4ISNA
chains in the Genus database with same CATH topology
3TH2H 1UVUH 1AZZA 3Q76A 4ABGA 2IPHA 1TALA 1PFXC 1WBGB 1GHYH 3TLOA 5C20A 1HJAC 4Q2KA 2AMPA 2AYWA 1NFWA 2HOBA 4ISIH 4ISOA 6LPRA 3NXPA 4TWYA 1MU8B 1GI3A 3U98H 4MNWA 1NRPH 1P57B 2ZU4A 1IQEA 2G51A 3LC3A 1HLTH 2J9NA 2NU0E 1HAVA 4GPGA 1H4WA 4DJZB 1BT7A 2ASUB 1TBRH 3QK1A 5DG6A 1P06A 1AFEH 4J2YB 1MCTA 1QJ6B 1GBEA 3RXDA 1MD7A 2XC0A 1GBKA 1O3NA 2G00A 3STJA 1M9UA 2ZG0H 2CF8H 5EXNA 3RXFA 1P12E 2OLGA 1EAUA 1K22H 1YYY1 2GV6A 4Z6AH 3KQBA 2EI8A 3GY8A 1MTUA 1SGCA 3LDXH 2EC9H 1VCQA 1FZZA 3TPIZ 1TGCA 1ELVA 3JZ1B 2BLWA 5EOKA 1P8VC 3M5OA 5JPMH 1YKTA 4MNVA 1O38A 4IN2A 1GI4A 1D9IA 3BTDE 1G32B 4AX9H 3CENA 5HGGA 3GICB 1X7AC 1TOMH 1S6FA 4ZKNU 3PMJA 3PM3A 1GJ4H 2UWPA 1QY6A 4ZXYH 1W7GH 1C1SA 1ANEA 5LPRA 3EA7A 2ZHDA 1FXYA 2HVXA 3O8DA 3VGCC 4CH8B 1KLTA 4K60A 1TGTA 3Q3KA 2OTVA 1ZHRA 1TPAE 2BD3A 1A3EH 3SV2H 3MO3A 2J94A 1W7XH 2W5EA 1GDQA 1EASA 1LHFH 4CBNA 1E35B 4B2BA 3ELAH 2P3UB 3TJVA 3BEIB 4ZKOU 4JYTA 2ZQ1A 4BTIB 2FIRH 5LH8A 2ZPQA 1GHZA 4AYVB 2Z6BD 1K9OE 2FLRH 1G3CA 1EJAA 2A32A 1A0JA 1UK2A 1IQMA 2BQ6B 1DXPA 1YPHE 1GBBA 2HWLB 2ZEBA 1Z1IA 1AUJA 1TNGA 3STIA 2OQUA 1P9UA 1BTXA 1C9PA 1KDQA 2PUXB 1V2OT 1SLWB 4XBDA 2ILNA 1XVOA 4YLUA 1GVZA 4RN6A 1YCPM 1ZZZA 1C1TA 1G3BA 3KEEA 3M3TA 1OP0A 1DLEA 4NWLA 3P8OA 1AVXA 1K1JA 1VJ9U 3LT3A 2WPLS 4AOQA 2FPZA 4CHAC 3TK5A 1ESTA 4BAHB 1BTPA 2ZZUH 2QF3A 5AF9H 1CHOF 1XUKA 3G01A 1RD3B 1JXPA 4ABFA 4JMYA 1LPZB 3UWJH 2FEQH 4RKJB 1QBNA 1Y8TA 2A5AA 4KELA 1W3CA 2Y81A 3LONA 1O2OA 1O2PA 4B74A 2J95A 2FOHA 1GGDB 3T27A 4B73A 1GBFA 3ZVAA 1PPGE 1O37A 2CGAA 2VGCC 3A85A 4B2CA 1PPCE 1QURH 4U2WA 4MLFB 3SGQE 4K8YA 4Y6DA 1THPB 5GPIB 2PLXA 1MKXK 2Z9GA 3URDA 1FIZA 2QXHA 4NFFA 3RU4D 2AFQB 1YLCA 4ZMAH 3A86A 5T6DA 5E0HA 1BTZA 3SN8A 1HJ8A 1TMBH 3LIWA 4ZKSU 2YOLA 4INKA 4GVUA 3A7ZA 1P3EA 3ZZ7A 1IQLA 1H9LB 2GKVE 1HAOH 1GCTC 1GI6A 1ZOMA 1GJAB 2BD7A 3HK6B 3BTKE 1O2YA 1P2NA 2PKAB 2FTMA 1WAYB 2IN2A 2G52A 2VIVA 3S7HB 3GCHC 1GG6B 1XXDA 1V2VT 4A5TS 4YOJA 1Z8RA 3SU3A 2BOKA 5LPFA 1YPLH 1L4DA 1QHRB 1W12U 1V2LT 1BBRK 4Q7XA 1AE8H 3E0PB 4KGAA 3ZZDA 1N8OC 4IN1A 2A0QB 2G55A 3RUOA 3U8OH 1O2QA 1GHWH 8GCHF 1D6RA 1XUFA 2QF0A 3SUEA 3ZZBA 4FUDA 1A5IA 1HAXB 4LZ4B 2NU2E 5JDUB 1VGCC 4Y7BA 1SGYE 1WU1A 3A8CA 5E0GA 1O35A 1A5HA 2HGTH 4TYDA 1AFQB 1GI5A 3ODFA 2C90B 3UOUA 1L2EA 5I46H 5ESBA 3PLPA 1ELFA 2RCEA 5A09A 1ETTH 3A8BA 3PLBA 1RTKA 3GY2A 1AWFH 3IG6B 1PPEE 1C5PA 2F9UA 1VJAU 1JBUH 1AUTC 1O5GH 2H1UA 3BG4B 4U30A 1AWHB 1KIGH 2GMTC 2Z3CA 5JBTA 1FJSA 2FOEA 3LGWA 5EPNA 1EATA 1RS0A 2SNWA 4FVDA 3MH7A 5L2ZH 1ABIH 4MPXA 1V2TT 3PO1C 3RC4A 3SGAE 1UHBB 1ZSJA 1MKXH 3EA8A 5GJ4B 1Z8GA 1NN6A 4AFSA 2Y80A 4BOHA 1KXEA 3DHKH 4GLYA 4WH8A 1W0ZU 2QXJA 1O5BB 1P2OA 1PPHE 1QA7A 5DP5A 3ZV8A 5EXLA 1C1MA 4DOQA 1XX9A 4SGAE 2TGAA 5TCAA 3EGKH 1CA0B 1EAWA 4FU9A 5T6GA 2WPMS 2H9EH 4H6TA 1T8LA 3LGVA 3BTQE 2BD4A 3M36A 1TGNA 5FHTA 3W94A 2XC5A 2WPJS 1ELEE 3EE0B 3MU0A 2PFEA 3KN2A 2HNTC 1GHAG 4UDWH 3F9FA 1BBRH 1C4U2 1QR3E 3SHCH 1HAPH 2BVXH 3SJIA 1DT2A 3K9XB 1G36A 2G81E 5B6OA 2BDIA 4XBCA 2ODQA 3TK9A 2H5CA 2C93B 1AY6H 3LJJA 2FLBH 1V2ST 1SGFA 2Z9KA 3FZDA 3S69A 3A87A 3OYPA 5EU8A 1BRUP 2J38A 3HKIB 1GHAF 1ZGIA 4E7RG 3OSYA 1GI7B 5L6NH 2AS9A 3A7TA 3EYDA 3JZ2B 2ZNKH 3SNAA 2PTNA 1P01A 1UTQA 3RXLA 2F9VA 2P8OB 1AIXH 1C2DA 4ESTE 1C5ZB 1DWBH 3MH5A 1P9SA 1C5MD 2H5DA 3UNRA 2BX4A 3RU4T 3SBKA 3N7OA 3FVFB 1AHTH 1YPKH 3A7VA 4GHTA 3SV6A 2A7CA 3PV4A 5HM9A 1FAKH 4PROA 1TPOA 1WTGH 3V3MA 4IW4E 1HYLA 4ZHLU 2EI6A 2QXIA 1AE5A 4Y71A 3VB7A 1GBLA 2QCYA 3P6ZB 4D8NA 1RIWB 4I7YH 3VXEH 1CVWH 1Y3UA 3M35A 2A2QH 1O2GH 4OGXA 3PWBA 2W3IA 1DS2E 3WY8A 2TBSA 1LCYA 1SOZA 1C1PA 1SQTA 3DT0H 3VFEA 2ZF0H 5CHAB 2BD2A 4ZH8A 2VNTA 1F92A 1NFXA 2HALA 5K7RA 2AMDA 1S85A 1AVGH 1C5VA 1QB9A 2Y6TA 3S7KB 3MO6A 3QWCH 4NG9H 3CP7A 1J9CH 3V13A 1KTTB 3GY4A 4K1SA 1YBWA 3T5FH 3PMHB 2FOAA 2BD8A 3S9BA 1SLVB 2OBQA 4X1PU 4FUCA 3RC6A 2JKHA 2P95A 5A8ZA 3DFJA 2O8MA 5GIBA 5FCKA 4Y10E 3UOPA 3UR9A 1EZSC 2FM2A 2SGPE 2ZDNA 2OINA 1AB9B 1CBWC 2CMYA 4X1QU 5T3HA 1C1RA 1LVOA 1ZMNA 1U6QA 1EAIA 5C5OA 3MI4A 1SPJA 3RMMH 2Y7XA 1TA6A 4UFFH 3A88A 3M7TA 4YOIA 1C5OH 1JIRA 3RXHA 2BY9X 1ZHPA 1YPGH 1IQNA 5FPYA 3UY9A 1GBJA 4I8LA 1THSH 2C3SA 4KP0A 1OWDA 4IGDA 5L2YH 3GY6A 4IMZA 9LPRA 1QRWA 3MU5A 2AGIX 3W95A 1UHBA 1DWEH 1NY22 4YLQH 4YTAA 1FUJA 3D49H 4B1TA 1GL0E 2G4UA 1IHTH 3LJOA 4ZHAA 2W26A 1YGCH 2SNVA 1QBOA 3P92A 1ELGA 8KME2 4R8TB 3PMBB 2PKSC 4E7NA 3T29A 2NWNA 2ZDAH 2FODA 3SI4H 3LPRA 3T2NA 5A0AE 1O3KA 5JB9S 4AFZA 1O2TA 3TU7H 1GJ5H 1O3MA 1RRKA 3MNBA 1PYTD 1T8OA 2GP9B 3SJ8A 2V35A 1C5TA 2F83A 1GHBF 4FVBA 1E0FD 1L4ZA 2VIPA 1WYKA 3BEFB 1VCPA 3MU4A 5SGAE 4BTUB 1O39A 1S82A 1W8BH 1WCZA 2OQ5A 2GCHF 1AGJA 1SI5H 1CU1A 3QZRA 1HXEH 4GSOA 1A5GH 5BPEA 4WMEA 5E2PA 1V2PT 4JZIA 1O2WA 1ZJDA 4ABJA 3SJ9A 2ZGXH 2B9LA 3PMAB 1LHEH 1EB1H 1O34A 1QJ1B 1WOFA 1TRMA 4Q7ZA 2VH0A 2ZTXA 4VGCC 2ZCHP 2TIOA 3K6YA 2TGDA 1IHSH 4FUGA 1S0QA 3AW0A 3QUMP 2HNTE 1NU9A 2FS9A 5FPTA 4BXWA 2I6SA 1UK4A 1ELAA 3E91A 2ZDLA 1BCUH 1ARBA 1QL9A 1OWIA 2BMGB 1KLJH 2FS8A 4X1NU 2B7DH 3URCA 1WSSH 4ABBA 4XFQA 1NC6A 3RXJA 2VIDA 2VH6A 1P0SH 4Y11E 3TIUA 1A1RA 2P16A 2ZFQH 3M3VA 5C3NA 1FY4A 1BTHH 1UCYK 3HGPA 3SU1A 2AIQA 1TIOA 2FOBA 3QN7A 3Q77A 1TPPA 1TFXA 3V7TA 1O36A 2BY6X 1ZSKA 2BDHA 1GBCA 2ODPA 3IITA 1BUIA 2WPIS 1PQ8A 2W7UA 2BLVA 1VITG 3KQEA 4FU7A 3RXMA 1NM6A 2P3TB 3ATLA 3HKJB 2VU8E 1D4PB 1GMCG 4ABIA 2UWOA 3SJOA 3SUDA 1BRAA 5FX6A 4I8HA 1O2SA 4XBBA 3GY7A 3TH4H 2XYAA 1PQ5A 3RXTA 1KXCA 1C1UH 1CT0E 1SFIA 1K2I1 5EODA 3SNEA 1K1PA 3BTHE 3TVJB 1ZJKA 1C4Y2 2YNAA 1MCVA 1SGQE 1Z8IB 1O3JA 3A83A 1IQJA 3O8BA 3VB3A 4MDSA 2FOCA 2OUAA 2FI3E 1DICA 3TGIE 4NIWA 3MNCA 3RXQA 1CA8B 1N1LA 1NZQH 1XUGA 2BVSH 1GBMA 2PGBB 4ASHA 1FN6A 4MQAA 2UUYA 2VVCA 3BEUA 3NK8A 1Z1JA 3NWUA 3RXPA 1TYNA 3L33A 3SO3A 1F0UA 5FX5A 3AVZA 4AZ2B 1P2IA 2BZAA 5LPEA 1ZYOA 4A7IB 4D7GA 1TNKA 3GY5A 1CQQA 3NZIA 1GDNA 1KTSB 1O3OA 4K1TA 1GMDG 5E2OA 3T25A 1O2JA 3A7WA 4CRFA 2WUCA 2H9TH 3UNSA 3LH3A 4CRCA 5DP7A 1O3IA 2STBE 4KTCA 1IQHA 2GZ7A 2PHBA 4INHA 4H6SB 1TQ7B 1F5LA 3SU2A 1WQVH 1FQ3A 2BDGA 4K3JA 5DKMA 3QDZB 4WXVA 1FAXA 1H8IH 1O31A 2ZA5A 3FP8E 3V12A 3PLKA 1UCYH 3A84A 1ZRKA 3QX5H 1GI2A 1OPHB 1BMNH 1ZPBA 1IAUA 4OS1A 4YT6H 5HXFA 4LOYH 2OC8A 1FY5A 1MU6B 1O33A 4NGAH 5F6MA 2Y5HA 3OY6U 3MH4A 1A7SA 1IQFA 2F9BH 3RXGA 1GJ8B 4I8GA 1O3BA 1O3PB 1B7XB 4A1XA 2BM2A 3GYMA 1C5RA 3A89A 1TOCB 3RXKA 4CRDA 2HPPH 3BF6H 2B0FA 2BX3A 3FAOA 2ZHFH 1OWHA 2Q1JA 3MU1A 1EPTC 1MTNC 4A6LA 4B71A 2BXUH 4U01A 3ATMA 1J16A 6CHAB 3UQVA 3RMNH 3RXSA 2BVRH 4DVAU 5LGOA 4JZDH 2ZHWH 4AYYB 1L1JA 2OD3B 1G37A 1QCPA 2Y5FA 1EZUC 3U69H 4DT7B 3Q3YA 2JETC 3SU4A 2FI5E 3AASA 1GI1A 1BHXB 3GY3A 2ZP0H 1GJ7B 2C8WB 3UNQA 1DE7H 3RMOH 2SGEE 2XCFA 2ZTZA 1O0DH 2JH5D 4D7FA 2R9PA 4AG1A 1FI8A 1GI0A 4X2YA 3DA9B 1OYQA 1THRH 2BDAA 2ALVA 1LPKB 2CHAB 5DP4A 1SL3A 2ZCLP 2GCTB 1FV9A 1JRSA 2DUCA 2LPRA 1C2MA 4O03A 3PTNA 1BJVA 2ESTE 5I25A 2ZECA 3RDZA 3TNSA 2UUKB 2O8UA 3S9CA 1GMHG 1YF4A 3PB1E 1LO6A 1DFPA 1YPMH 4Z0KA 4JK5A 1SMFE 4YT7H 2V3OH 5EQSA 4FUIA 2V6NA 2JH0D 2A4GA 2D2DA 8LPRA 1Z7KA 3E90B 1LTOA 4OS6A 3FFGA 3ZYDA 1B5GH 4Y8YA 1AKSA 1LHGH 2C8XB 2PSYA 5EPYA 2W3KA 2ZKSA 1QL7A 5C5NA 1MZDA 5HYOA 1UTKA 2PWXA 1UVSH 4MG3A 4X6OA 5C1UA 1UJ1A 1J15A 4HFPB 1H9HE 3T62A 4WWYA 1C5WB 2O8LA 1P09A 1EQ9A 2AIPA 4D9RA 3QGNB 1GBDA 4MTBA 2A2XH 1NO9H 3U1JB 3A81A 3BN9A 4ZKRU 3VPKA 1V2KT 2PV9B 1GJBB 3RLYH 1AN1E 4FUHA 4K69A 5EQQA 4X2WA 2BD9A 3SNDA 4FUFA 5HM2A 2ZPRA 2ZHEH 3SORA 1GHVH 3L3TA 3HGNA 4X2XA 5EXMA 4BXSA 1DANH 2FOFA 2FESH 5H4IB 1V2NT 1C5UA 1GVKB 1WQSA 3F9EA 3MNXA 2ZDVH 2BHGA 4YM9A 3FP6E 1O2VA 1AVWA 3RXUA 1SC8U 1NRQH 3P8NA 4AG2A 2F9OA 1Z8JB 1K1NA 4X6NA 4AB8A 1DDJA 2R2MB 2VIWA 1MTWA 1O2MA 4NSYA 1TPSA 3UFAA 2R2WU 1A4WH 4K8BA 1TNJA 4JCNA 3RMLH 1BTYA 3K2UA 5DJ7A 1J14A 2J34A 3O8RA 4XDEA 1ARCA 1CGJE 2FYQA 2Z9LA 1C2IA 4CRAA 1HXFH 2BZ6H 5A8XA 2FX6A 4I8JA 4CR9A 1LVBA 1A2CH 1BB0B 2A4RA 1ZTJA 3ZVDA 1QGFA 1XUJA 4O97A 4IC5A 3F9HA 2WYGA 3A80A 3OX7U 3RXIA 3TGKE 2RDLA 2QY0B 1NTPA 1XXFA 4IBLH 4UFDH 3ZZ6A