5DK1A

S. erythraea trypsin mixed catalytic intermediate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
230
Chain Sequence
IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPNAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
molecule keywords Trypsin
total genus 59
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A01
5DJ7A 1LVOA 4Y76A 5E0GA 4K60A 1OX1A 4OS4A 1PYTC 3Q76A 3F1SB 1ZGVA 1Y59T 3HKIB 2QXHA 1P3EA 1GJ8B 2G52A 5FCRA 1HLTH 2A5KA 1C2IA 1D6RA 2BZ6H 2BLOA 2FXRA 1GHAG 1JRSA 2BXUH 3ZYDA 1KXAA 3D49H 1P01A 3RM2H 1SOTA 3V13A 3EAJA 2IPHA 1TNGA 1CT4E 1BJUA 3RMOH 1F5RA 3Q3YA 1W3CA 3BTFE 2VIOA 3RXGA 1NN6A 1DWEH 3ZZAA 2PKAA 1WSSH 2TPIZ 1NY22 3ZZCA 1DVAH 1AVGH 5TCAA 4Y6DA 4K3JA 1K1IA 2J34A 2V3OH 1GJ5H 1D3DB 4X6PA 3TNSA 2OQUA 3K6YA 5L6NH 5EODA 2ZU1A 1DSUA 4ISNA 1C1UH 2HPPH 1PPZA 3A7XA 2PFEA 2A45B 4LZ4B 3M3VA 3SGAE 4FVDA 1A46H 1YCPM 4HZHA 2J95A 4JYVH 3RMNH 2EC9H 4ZKRU 1TGNA 4XSKU 3SU2A 3VB6A 1GHZA 4IW4E 3U8TH 4RKJB 4BOHA 2ODPA 2C3SA 1KXEA 2W7UA 4BTUB 1FAXA 2GT7A 4K8YA 1DDJA 3TGIE 2BVXH 4JMYA 1BDAA 1AB9B 3Q3KA 3TGJE 2HLCA 1G3CA 1TX7A 1CA0B 2QYIA 2ZDKA 3LDXH 3MU0A 4RN6A 1C4Y2 1C5TA 1MCVA 4FVBA 1NESE 5F6MA 1TX8A 3NK8A 1A5HA 2KAIB 1HAIH 2JH6D 4YT7H 1W14U 2PR3A 1BTXA 1C5PA 2PSXA 1O2IA 2YOLA 3MU5A 4MNXA 4B75A 1NTPA 1HV7A 5A8XA 1W8BH 2C8WB 4CBOA 3W95A 1GJ7B 1PJPA 1SLWB 3UR6A 1MTWA 3NWUA 2ANMH 2AFQB 2B5TB 4X8SH 5EXNA 1LHDH 1WV7H 3DT0H 1DOJA 2ZU2A 3LONA 1TNHA 1Y3XA 2JH5D 4CBNA 2CHAC 2FI3E 2FOFA 1Y3UA 2ZP0H 1MTUA 1K28D 3VXFH 4JZFH 1GI4A 3T2NA 2G5VA 2VINA 5L2YH 1G3DA 1QL8A 3RMMH 3E91A 1ZSKA 2BQ6B 2VVCA 3RU4T 4A1VA 2R0KA 4A1XA 1GDNA 3RXHA 4Y8YA 3L6PA 5A0AE 1F7ZA 3BTHE 2V3HH 4FU7A 1GJAB 2W3KA 1BB0B 1ZPBA 1LVYA 2F3CE 3SOSA 8KME2 2XYAA 1O30A 1GHAF 3QDZB 4JYTA 1V2NT 1A4WH 1JMOH 3A82A 4J2YB 2BM2A 3TJNA 3QGNB 4I8JA 1E35B 4K8BA 2Q6DA 1EOJA 1XUKA 2BZAA 1TPPA 2GKVE 1HAXB 2BDHA 4GUXA 4XDEA 3SZNA 1Y8TA 1O2TA 3TVJB 1ZSJA 2D8WA 8GCHF 1MAYA 1ETTH 1DUEA 3C1KA 1GBMA 2D2DA 5HM2A 1GI9B 2THFB 2JKHA 4X2YA 1ESTA 2ZGXH 2BLWA 3OSYA 2VH0A 1ZR0A 1W7XH 1O2ZA 2QAAA 5HYOA 1GI2A 4D7GA 1RTLA 4AGJA 1ZOMA 1CO7E 4PROA 5ESTE 2BD5A 3EA9A 4AG2A 1CSOE 1C2DA 2Y82A 1ZGIA 2GZ8A 2D1JA 3U1IB 1SGEE 2R2MB 2ZI2H 4GSOA 1TLDA 4A5TS 3RDZA 2H9TH 3U98H 3U1JB 1NT1A 1W2KH 2ALVA 5EGMA 1IQLA 4FUEA 1S5SA 3RUOA 2TIOA 1UO6A 5EPNA 3HPTB 4XBDA 5A2MH 1QGFA 3KHVA 2XCNA 5LPFA 4K69A 4X1NU 2HALA 1MBQA 5T6FA 2BX3A 2XWBI 2XNIA 2B8OH 1HBTH 1W0YH 2ZTZA 2YNAA 2OQ5A 5DGJA 4YT6H 1FJSA 2FTLE 1TALA 1GJ4H 5FXLA 1KTTB 3ZZBA 5C5OA 2R0LA 4OS1A 2BQ7B 1SFQB 1EATA 1K1OA 3BIVH 3SU3A 5F8XA 1OOKB 1HIAB 1EZUC 4ZH8A 4X2WA 3TK6A 3A83A 3DFLA 4HGCA 1S6FA 1BMNH 3BN9A 4I33A 2G5NA 2O8MA 4E05H 2CV3A 4J1YA 3QZRA 1O3JA 1D3PB 4YM9A 4CRFA 1H9IE 2FOHA 2A5AA 1S84A 2ZHWH 2J4IA 1ELEE 2BD9A 3KQEA 1TA6A 1FY5A 3TITA 1XUFA 4ZKSU 2QA9E 1N6XA 4XBCA 1OP0A 1SL3A 6LPRA 3A7WA 1D6WA 3BEIB 1LVBA 3A81A 3V0XA 1ESBA 5PTPA 3SUEA 2V0BA 1SVPA 1DLEA 1MQ6A 1EX3A 1MKXH 3U8RH 2FTMA 1EJNA 1O31A 1TNLA 1TA2A 1O2OA 3UPEA 6CHAB 2PWXA 1QB6A 1JRTA 1HAZB 2Y5GA 2QV1A 1AY6H 2ZIQH 2I6SA 2P3FH 5GCHG 4BAQB 1O2MA 1WCZA 2BX4A 4CRAA 4B2BA 1K2I1 1JIRA 1B0FA 3HATH 3STJA 1MU8B 1THPB 4AN7A 3ITIA 2SFAA 1V2OT 1TWXB 1NFXA 3A8AA 1O2PA 1MU6B 5EU8A 3ODFA 1QRWA 2FOEA 1AHTH 3TJUA 2PUXB 2OLGA 1Z8JB 2BVRH 3OY5U 3UOPA 8LPRA 4DCDA 1LMWB 1FDPA 1PPCE 3TGKE 1C1NA 1ZYOA 1N1LA 1QURH 3SNCA 1QL9A 1ZPZA 2Z9IA 1Y3WA 1K1PA 1SGCA 3PYHA 1WQSA 1VJ9U 2EI8A 1FV9A 1HCGA 1IQHA 2XBYA 2CHAB 4Y79A 1W7GH 1O2VA 4BAMB 2QCYA 2JH0D 3CS7A 1DY8A 5T3HA 2GV7A 2UUYA 1O2XA 2HNTF 1Z1IA 1YPEH 4DIIH 2ZDNA 4A92A 1ABIH 3TJOA 1QY6A 3SQHE 2AMDA 1TBQH 4X1RU 4ZXXH 1P04A 4OGYA 3VFEA 2ZDLA 1WYKA 1HAVA 4CR9A 3LH3A 1SQOA 1F2SE 3SHAH 3F9FA 3GCOA 3ATLA 3P8OA 1AMHA 1ZHPA 3F9GA 1IQGA 3VGCB 2UUKB 2RA0A 4Y7AA 2Y80A 2Y6TA 1TMUH 2HPQH 1GJDB 1LTOA 1FZZA 4AZ2B 1PPFE 1HNEE 5FHTA 3M37A 2EI7A 5E0JA 5EQSA 1ANCA 4GLYA 2BXTH 1QHRB 2PLXA 2QF0A 4GHTA 1IQMA 1C9TA 1IQIA 4DW2U 2NWNA 1O5BB 3MNXA 4ABDA 3SU4A 1BTHH 5EW1H 1DWDH 3KQCA 1MH0A 1NC6A 1TRMA 1BMAA 3ELAH 5CE1A 5G4BA 1PQ7A 3I29A 2BY8X 3E8LA 4A1TA 2ZO3H 3DA9B 4U01A 3A87A 1UHBB 1IQNA 3WY8A 4ZUHA 5AVDA 3RXKA 4Z0KA 4AB8A 5A0CA 2QC2A 1YPLH 3B8JA 1P06A 1ZHMA 3SN8A 3GICB 1BBRK 1O2NA 3CS0A 1P10A 5DG6A 4AOQA 4TY7A 2ZCHP 3R0FA 4D9QA 3LJOA 3M7TA 2ZG0H 1W12U 1P02A 1Z8GA 1YBWA 1EUFA 3PM3A 2O8TA 3EYDA 3RXVA 1TNIA 3FZDA 5DP5A 1C5YB 5GJ4B 4IMZA 3SI4H 1NM6A 1UCYH 4Y8XA 2ZGBH 1CHGA 3SJKA 3D62A 4LK4A 4ZHAA 1GWAA 1FQ3A 1OWKA 1BBRH 1DPOA 1YLDA 2Y7ZA 1C2GA 1O2KA 2FX4A 1O39A 2PGQB 2DE8A 4TYDA 2XCFA 4Y0ZE 4WVPE 2ZGCA 4ASHA 2GZ7A 1V2UT 4GCHF 4MPVA 3GY6A 1HAYB 1O32A 3NZIA 4ISHH 3SJ9A 2ZU4A 1SGQE 1ID5H 1G2LA 1YF4A 2VIQA 1BRBE 1O37A 2ZFPH 1NPMA 1M9UA 1AIXH 2ODQA 4RSPA 4UFDH 2Y5HA 1SLXB 1BMLA 1UVSH 3P8NA 1V2WT 2OP9A 1ACBE 1T8MA 4OS5A 4O9VA 1RD3B 3SNAA 2PKSC 2DUCA 1AD8H 1XUIA 1GHBF 1EJMA 1TNKA 1UTMA 3FANA 3HKJB 4OS6A 3RXUA 2G81E 3RC4A 1G36A 1V2LT 5B6OA 1EASA 1AE5A 2WUBA 3G01A 4WWYA 4DIHH 1U6QA 1JXPA 1WTGH 1ZTKA 2FEQH 2ZQ1A 3UR9A 3A7TA 2B9LA 2BY5X 1BRAA 3DUXH 5L30H 4MNVA 4D7FA 1AFQC 1RXPA 1AU8A 1QQUA 1FNIA 1GCTB 4WF8A 5E8EH 1GI6A 2ZFRH 2ZEBA 4IN1A 2OUAA 1YPJH 1BMMH 1FUJA 1AN1E 2OTVA 2ZHFH 3CP7A 3GDVA 1O2RA 2UWPA 2D26C 4AFUA 2ZU3A 3SI3H 1N8OC 1RTFB 1BTZA 1OXGA 5I25A 1VCPA 5EXMA 4AFQA 3LGIA 2JETB 4B73A 2A2XH 1MKWK 2ZFFH 2F9VA 3RU4E 1FPHH 3O8BA 1GVKB 4I8HA 1SGNE 1GBIA 1HAGE 4YTAA 4GVUA 1KY9A 4CRCA 1GBKA 3P8GA 1PPGE 1SGFG 3VB7A 3SV2H 1KTSB 2BY6X 3A7ZA 3FZZA 2FYRA 4ZXYH 4BXSA 1SQAA 1FLEE 2HGTH 1V6DA 4AFSA 4ZAEA 3SV9A 4ZMAH 2ZPQA 2F9UA 2G55A 1P3CA 7LPRA 2JETC 1QJ1B 1ZRKA 2P94A 1MD7A 3M5NA 1PPHE 2SGPE 4ZHLU 1P2JA 1P11E 1YPHC 1GGDC 4DY7B 2ZDMA 5FX5A 3TJVA 3SU0A 3A84A 4UFEH 1ELCA 1J17T 1O2UA 3IWMA 4JYUH 3SW2B 2PTCE 1K1NA 3S7HB 2I6QA 3BTQE 1GCTC 1P12E 1SB1H 3K9XB 4U32A 2FS8A 1BTPA 1GMDF 1Z8RA 3SGBE 1GDQA 4E06H 6GCHF 1OYTH 1NZQH 2FOCA 4AORA 4DG4A 3RXIA 1OWHA 5DP4A 2R3UA 1SHHB 3MWIU 3BTEE 1H9HE 1P2MA 3SU1A 3TH4H 3R3GB 4ABAA 1A1RA 1HGTH 5C20A 5IYTA 1C2KA 5DPAA 1SOZA 2VIWA 1O2GH 3JZ2B 2VGCC 5TJXA 1P2NA 3SJIA 2V35A 3U69H 3UNRA 1L4DA 2Y5FA 2CGAA 2FM2A 3B9FH 4CRDA 1GBLA 1TBZH 3T25A 1DANH 2GT8A 4D8NA 3RXCA 1UJ1A 2WINI 1XVOA 2PTNA 1ELVA 4BAHB 1C9PA 3BG4C 4CHAC 3QN7A 4KP0A 4Q80A 3S9BA 2FP7B 3SORA 1O36A 4ZKNU 3KN2A 1AB9C 2A7CA 1V2PT 4Y7BA 3ZVGA 1J15A 1DWCH 4WMFA 4FUFA 1PPBH 1CGHA 4GPGA 3PMAB 4H6SB 5DK1A 1EAUA 5ETXA 2R3YA 3ATWA 1MTVA 1Z7KA 1ETRH 2ZECA 1HIAA 1ANBA 1MTNC 3F6UH 1EP5A 1P9SA 2TGDA 2OC8A 2ZDAH 1GMDG 2DE9A 9ESTA 3DD2H 1V2RT 2ZKSA 3MI4A 1IHTH 2C93B 1G3EA 1NFWA 4I8GA 5C2ZA 1TONA 2ZFTA 3TH3H 3RXDA 1V2KT 1VGCC 1FONA 2AGEX 4INLA 3VEQB 3UY9A 1RIWB 1O3KA 4ISLA 5A09A 4MVNA 2FPZA 1QQ4A 5LPEA 1Y5BT 1XXFA 3QTOH 1FI8A 4KTCA 3TU7H 2G00A 5ABWA 5JB8S 1P03A 1EAWA 1YPHE 1TQ0B 4CH2B 5AFYH 3S69A 1SGYE 3LC3A 2FIRH 1O2HA 1SGFA 3RXQA 2GMTC 3FP7E 1NFUA 4B1TA 1FN8A 1GJCB 1V2QT 1O3CA 2A7JA 2J92A 1TPOA 2UWLA 1UTOA 4WMEA 1LVMA 3E90B 7GCHF 3MH7A 1ARBA 1AUTC 3RLWH 1O5AB 3SGQE 3KEEA 2GP9B 5DKMA 1K1LA 2VVUA 1AQ7A 3ZZ8A 3OU0A 1HRTH 5EQRA 1O3EA 1TAWA 3H5CB 1QBVH 4AYVB 5BPEA 1NROH 5L2ZH 1C1OA 1H8DH 1N8OB 1ZPCA 4RKOB 1A0JA 1YKTA 3MNBA 4X2VA 3E0NB 3KQDA 1BTYA 2BD3A 2C8XB 4NSYA 2A4GA 2G4TA 2Z3CA 3MNCA 1SMFE 1QRZA 2QXGA 1BRUP 5LH8A 1THRH 1W10U 1CBWB 3VXEH 2ZU5A 3HK6B 3V3MA 3T29A 4YOGA 3RXPA 1NRRH 1NU7B 1D9IA 2GCHF 1BTUA 4H4FA 4DT7B 4UD9H 1EPTB 1TFXA 1QA0A 2Q6GA 5F8ZA 2NU4E 7GCHG 2PKSB 1HAVB 2ANKH 1UCYE 4BAKB 1TOMH 2ZTYA 3H7OA 1E0FD 1O3LA 3E1XB 1WUNH 1C1RA 1G37A 1E38B 1QR3E 2ZPSA 4VGCC 1O5EH 1T31A 1LHFH 2R9PA 1KLJH 2Z3EA 3T28A 5GIBA 4TPYA 3LPRA 3MNSA 1DT2A 1HAPH 1GBHA 1ELGA 1AZZA 2B7DH 4MLFB 2H9HA 4DVAU 2ZFQH 1KYNA 2BLVA 2A32A 2SGQE 1RIWC 5C3NA 1OP8A 1EJAA 2WPIS 2FI4E 2GCHG 2P3TB 2AIPA 3L3TA 4NCYA 3P92A 1O2YA 1SLUB 3SNDA 5C1YA 2GCTC 3MH4A 2A4QA 3GY3A 4DGJA 1UTKA 5C1UA 1PYTD 3BTKE 1AO5A 2G4UA 4YO9A 1P2OA 1EKBB 1WBGB 1ZZZA 2BDYA 3TNTA 2FYQA 4UONA 1UK3A 3GCTF 3T62A 1C2HA 4B74A 2O8UA 3KQBA 4NG9H 4FUBA 1K1JA 1NS3A 3M7QA 3PTNA 3GCHC 2FLRH 1HJ9A 2WYJA 3D23A 5J4SA 1EP6A 3BEFB 2EA3A 2ZF0H 9LPRA 1ANEA 1Z6JH 4B2CA 1NFYA 4K5ZA 3ESTA 1NO9H 2VWLA 1HAHH 1V3XA 3AVZA 2F83A 2UWOA 3PO1C 5K0HA 1TB6H 1WTHD 1SLVB 2ANYA 3A7YA 3O8DA 3UOUA 1KLIH 1L1NA 4WY3A 1LPZB 4F49A 3UWJH 2GDEH 4NWLA 1S0RA 1LHCH 3PLPA 2ZZUH 2AH4X 1C5XB 1P09A 1GVLA 3F68H 4CH8B 3ATKA 5JB9S 3LOXA 1F0SA 4CREA 1XM1A 3LGTA 1F0TA 1UVTH 1QB1A 2C4FH 1B5GH 1MCTA 4A6LA 1UTPA 2Z7FE 5K7RA 5A8YA 1C2LA 1QA7A 1XMNB 3P6ZB 2HOBA 2GD4B 2M5TA 4WMDA 1P57B 1SG8B 1C1VH 2ESTE 2HWLB 1C5WB 5CHAC 3BEUA 1NRNH 1ZHRA 3VGCC 1KLTA 1QBNA 1QIXB 3DHKH 1UTLM 4SGAE 1YYY1 3KIDU 5HMAA 1EAIA 1O2JA 4WJG2 1YGCH 1YPGH 1C2EA 2G51A 2VGCB 2ZGJA 1LCYA 2ZGHA 3ZZ4A 3P8FA 3QLPH 1Q2WA 1EB2A 3RP2A 1UK4A 2BMGB 1GJ9B 2ULLA 2ZHDA 1C1WH 4XBBA 1UVPA 1L0ZA 1QBOA 3T27A 4U2WA 4AB9A 1AFEH 3KL6A 1Z1JA 3TK5A 3H7TA 1QTFA 5DO4H 3SUFA 1GCDA 1BJVA 5GXPA 1GJ6A 1TGTA 1FN6A 4MNWA 5DP7A 3RC5A 3KCGH 4YLQH 1KXDA 3NKKA 1HXFH 3S9AA 2P8OC 1KDQA 4TY6A 3Q00A 4ABIA 2AIQA 1QL7A 2A5IA 4X0WU 3MH6A 4IS5A 4JZIA 1KXCA 2GDDA 2SNWA 3PWCA 2BD2A 3NPSA 2CF8H 1TGCA 2W7SA 2Z9LA 1CGJE 3RXMA 4KKDA 2ILNA 2P93A 4IBLH 1AE8H 4FUIA 2ZFSA 1Y5AT 5EQQA 3U8OH 1V2ST 5C67A 3RXLA 1FY3A 3BF6H 5JBCS 5J4QA 3OX7U 3GY5A 1OKXA 1ORFA 4NFEA 1SGTA 1CA0C 4X8TH 3LGVA 4ZHMU 1XX9A 2BDBA 4MPWA 5JDUB 4AFZA 1LKBA 1QCPA 1RFNA 3JZ1B 3OYPA 1QRXA 1VZQH 4E7RG 2VWNA 1TGBA 1PPEE 1O3AA 1OSSA 1OS8A 2RDLA 4X8UH 5F8TA 1HB0B 2RA3A 4YESB 1P2QA 1BZXE 1HAOH 5C5NA 2R2WU 1DM4B 4I8LA 2FLBH 1JIMA 1IAUA 1CHOF 3MOCA 2QN5T 3GDSA 1LQEA 5EPYA 2WPMS 2STAE 1G30B 1LHGH 1IQKA 3A8DA 3RXAA 2F9BH 3BSQA 2VU8E 1BBRE 3SV7A 1GMCF 3BIUH 1Q31A 4NIXA 1C5RA 2W26A 3PMBB 4IC6A 1Y3VA 2BB4A 2BY9X 2GMTB 3GY7A 1TPAE 2BLQA 4MG3A 2QXIA 4ABJA 4THNH 4X6NA 2BQWB 5HGGA 3ATMA 1DE7H 2A1DB 1AVWA 1O34A 1AKSB 5JBAS 1NRSH 1C2JA 4MTBA 5GCHF 3ZZ9A 1HPGA 2LNCA 5FPSA 1TOCB 2VIPA 1O3GA 4B2AA 5AHGH 1T4UH 1WAYB 2P3UB 5CHAB 2A0QB 2F9PA 2FOGA 1O5CB 5AFZH 3UTUH 3RM0H 1ZJKA 2OBQA 5FCKA 1YLCA 5H4IB 2GGVB 5E0HA 1MZAA 1CGIE 2PW8H 2FOAA 3BTME 3QUMP 4H6TA 4KGAA 1ZTJA 3CENA 1ELFA 1ELDE 2C8ZB 4NA9H 2XBVA 1P0SH 4CRGA 5GWZA 5CMXH 4NIYA 3V7TA 1EZQA 4O3UA 5I46H 1BHXF 1EZSC 1NRPH 2IN2A 3TK9A 1G2MA 3ENSB 1K1MA 4KTUA 3FFGA 5JYIA 1T8OA 2ZNKH 3U9AH 3UUZA 3C27B 2WPJS 3ZVEA 1O5GH 1MTSA 1OWIA 1Z6EA 4NA8A 1AWHB 1B0EA 4DJZB 2J38A 3T26A 2CXVA 1FIZA 1UMAH 2OC7A 1DUAA 1CQQA 1JWTA 1RS0A 1ZLRA 2FZZA 4WXVA 1O5DH 3ZZ7A 3M3TA 3QGJA 3E6PH 3I78A 2Z9GA 1BCUH 4FUGA 3F9EA 1F92A 6ESTA 1LDTT 1H9LB 3BV9B 4TWYA 1O3MA 1C5MD 3LGWA 4MQAA 3S0NA 4M7GA 1J16A 3MTYA 1J9CH 1OWEA 4O3TA 1GDUA 1GL1A 3SJ8A 1BQYA 1O35A 2BOKA 3MO3A 1C1MA 1IQEA 2GCTB 1KSNA 1LPKB 3EE0B 1T8LA 2EI6A 3PO1B 1GMHF 7KMEH 1VCWA 3QTVH 4IGDA 1YPKH 4JCNA 1O3NA 2QGRA 1C5QA 1GMCG 4IC5A 1CT2E 2ALPA 2F9NA 3HGPA 5GPIB 2SGFE 1V2TT 2ZTXA 2A31A 2VIVA 1EXFA 3M5LA 1L4ZA 1P2KA 1MMJN 2HVXA 2FODA 2TGTA 5TCCA 1DSTA 2W3IA 1MQ5A 5T6GA 1OWJA 2P59A 1DY9A 2ZCKP 1F5KU 1EZXC 4INKA 1NRQH 3M7UA 1KXFA 3PV4A 4OS2A 4UFFH 4AGKA 5E2PA 2VJ1A 2IOTA 1CVWH 4O97A 1TRNA 1T8NA 3GISB 1GHWH 5EOKA 2HNTC 3AASA 2VWOA 2BOHB 2VB0A 5C1XA 2FI5E 3MO6A 3RXJA 3MU1A 4ZKOU 1O3HA 1HFDA 1SGPE 1GHBG 4DOQA 2BD4A 4BNRA 2XC5A 1L2EA 3GYLB 2QIQA 1E34B 1Z71A 1LKAA 1TMBH 2AS9A 2PGBB 2AMPA 2Z9JA 4B76A 2VH6A 1WU1A 1EPTA 2WUCA 5DP6A 3UWIA 4YZUA 4HTCH 3FP8E 1A5GH 1VJAU 4XOJA 3RXEA 3M5MA 1C1TA 1GBBA 2H6MA 1AI8H 3S9CA 1RTKA 1YM0A 2NU1E 1S81A 4NFFA 3P17H 5E2OA 2WYGA 1UTQA 1TMTH 3GCTG 4BANB 1C1SA 2STBE 1C2FA 1HXEH 6GCHG 1GPZA 5F03A 5FBIA 1SGDE 3TLOA 3MFJA 1PFXC 1O5FH 1SC8U 1J8AA 2ZQ2A 3SQEE 4LZ1H 1SBWA 1ZMJA 3NXPA 1DXWA 1WQVH 1YCPH 6CHAC 4AG1A 1AKSA 2W5EA 3QWCH 3UNSA 3K6ZA 1GI8B 3UFAA 1D3TB 4H42U 4YOIA 3LJJA 3QO6A 4MPUA 1BOQA 1QJ6B 1N6YA 2YNBA 4OGXA 4NIWA 4A7IB 2VWMA 4NWKA 2GVFA 3URDA 4K1SA 4K2YA 2C90B 5EW2H 2ZA5A 1QFKH 1O0DH 4INHA 1XKAC 4UDWH 4NIVA 1QJ7B 4GHQA 2VIDA 2WV4A 1ARCA 4LOYH 1NU9A 3VB4A 3ZZDA 4ABFA 2Y7XA 4LXBH 2VNTA 5JBTA 1GI0A 1RRKA 4QT8C 5HM9A 1TX6A 2BDAA 3SNEA 1C5ZB 1GI7B 2CJIA 4YOJA 1SFIA 2H5DA 3A7VA 3SU5A 5ESBA 3SUDA 4NSVA 1THSH 2AEIH 3F9HA 1C5VA 1RGQA 4JZEH 3LIWA 3T5FH 4X1SU 3SHCH 3RC6A 3N7OA 1IOEA 2WPLS 2ASUB 3PLKA 3ATIA 1DX5M 1HJAC 4ABHA 3P95A 1OP2A 1DITH 2CMYA 2EEKA 3FAOA 1O3FA 1H1BA 3STIA 1ELBA 2Y81A 1MAXA 4R8TB 1ESAA 4HI3A 1PQAA 1O3IA 1S0QA 2QXJA 5JBBS 3M61U 1GG6B 2OINA 4SGBE 3HK3B 4MDSA 2OBOA 3A80A 1BRCE 3RXBA 3PB1E 4Y10E 1O3DA 4ABBA 4OS7A 2TGAA 1INCA 3ZVFA 3EA8A 3K65B 5GDSH 1MZDA 1YP9A 1T4VH 1SSXA 4WH8A 1O3PB 3SJOA 1O33A 1GBEA 2TGPZ 4ISOA 1W11U 3EGKH 2FOMB 3PWBA 3O8RA 3BG8A 2G8TA 4BXWA 3PLBA 2UUJB 1GJBB 2CF9H 4FUJA 2XTTB 1CE5A 5JPMH 1K9OE 1ANDA 3MYWA 1TABE 4X6OA 1Y5UT 1UVUH 3ODDA 3ZVBA 3E16B 1XUJA 3A85A 2ZWLH 1C5UA 5A0BA 1UCYK 1GBJA 3EDXB 3SO3A 3GCHB 1AWFH 1C2MA 2GZ9A 4K1TA 1A61H 2BD7A 2OC0A 1GBFA 2C8YB 4MNYA 2O8WA 1EQ9A 4FUCA 4GCHG 1MD8A 5DP3A 2SGEE 1GL0E 1SGIB 2Z9KA 4NZQA 1CU1A 3EA7A 1GHXH 1GBTA 3AW1A 4XFQA 3RXTA 3UQOA 2ODYB 1GGDB 4X1PU 5LPRA 2Z6BD 3AAUA 2AYWA 1A3BH 1KXBA 1ZJDA 4FUHA 3DFJA 1V2VT 1XXDA 1O2SA 4KELA 1AVXA 2GV6A 3A89A 1MKWH 4R0IA 1L1GA 1TNJA 1XKBC 2WV5A 1CT0E 4B71A 1XVMA 1DICA 2HRVA 3SU6A 2ZPRA 1YPMH 2TRMA 2XBXA 2A4OA 2P95A 3SV8A 2Z94A 2ZCLP 1C4V2 3URCA 3ZVDA 1F0RA 1S6HA 3W94A 2FS9A 1WOFA 2F9OA 1VITG 5A8ZA 1JOUB 1IHSH 1O2LA 4WH6A 1V2JT 3PMHB 3PMJA 4ABGA 4FUDA 3ZZ5A 4X6MA 4TPIZ 2FX6A 5DP8A 3UREA 1L1JA 1UK2A 1PQ5A 3BTGE 1SI5H 1ABJH 4WXIA 1VCQA 2BD8A 2AMQA 3SUGA 1AFQB 2ZHEH 1C5OH 1FMGA 1T32A 3V12A 1DXPA 1XUHA 4D76A 3IG6B 1SGRE 1BA8B 3LT3A 1UTJA 4F4OC 1CBWC 1EAXA 1HJ8A 3RMLH 1BUIA 1AZ8A 4ZROA 5DP9A 3BTDE 4UFGH 1O2QA 4Y71A 3IITA 1O3OA 2FOBA 1ELTA 3PROA 1DLKB 4Y11E 1HJAB 2BDCA 4JK5A 1HYLA 2SGDE 1MTNB 3RLYH 2J9NA 3LU9B 1GI1A 1W0ZU 3ZYEA 3I77A 1VITF 2P16A 5FX6A 1LO6A 1UHBA 3A8CA 1X7AC 1ZMNA 4Y8ZA 1A0HB 3BTTE 3TIUA 1TPSA 2ZHQH 4O03A 1GG6C 1K22H 2P8OB 1W13U 1H8IH 2WPKS 3MHWU 3LGYA 3GY4A 1V2MT 5EG4A 1G3BA 3OTJE 3ZZ6A 3E3TA 2TBSA 3RXFA 1DFPA 1GBCA 3LKWA 3Q77A 2NU0E 1ZRBA 2H9EH 5FPTA 1BTWA 4UEHH 1FXYA 2ANWA 2BY7X 1VGCB 4YLUA 1KDQB 1A2CH 4D9RA 3ZZ3A 3O8CA 2FMJA 4I32A 1D4PB 4E7NA 4BAOB 3MU8A 1LPGB 1SPJA 1EB1H 3SBKA 1YCPK 1IQJA 1T7CA 3MO9A 2PKAB 1BT7A 1YC0A 3E0PB 1AUJA 3GYMA 1SHYA 4JK6A 3SV6A 1TBRH 3GCNA 3BTWE 1IQFA 3KF2A 1O2WA 2BVSH 3ZV9A 2F91A 2H5CA 2J94A 1ELAA 3A8BA 3AW0A 1XUGA 1HDTH 1OWDA 3GY2A 1P8VC 2AGGX 1AGJA 3BG4B 4CHAB 2O8LA 4BTIB 1RJXB 4Q7YA 1OPHB 3ZV8A 1VR1H 5FBEA 2VVVA 4JZDH 2XBWA 3B23B 1UVOA 1BHXB 3QX5H 1OYQA 2PSYA 3L33A 3RXOA 1J14A 5AF9H 2H2ZA 2QY0B 3FP6E 1QNJA 3A88A 3GY8A 2BHGA 4X2XA 5BRRE 2UUFB 1JBUH 1TIOA 1CHOG 1DWBH 1A0LA 3PTBA 5EXLA 1Q3XA 4CRBA 2BTCE 4Q7ZA 1TGSZ 2B0FA 4KTSA 3UNQA 4UE7H 2ZDVH 2A7HA 1MBMA 8GCHG 4ISIH 3RU4D 3S7KB 1A5IA 1SQTA 3QZQA 3GOVB 1C5LH 3MH5A 3KGPA 5T6DA 2QF3A 4TWWA 1FAKH 4BTTB 1C5SA 2SGAA 1GMHG 2PV9B 4NZLA 2HNTE 1D3QB 4FU8A 1HUTH 1GI5A 2FDAA 2NU3E 1GVZA 4HFPB 4NGAH 3ZVAA 4Q7XA 4XE4A 1GHYH 2A2QH 1LHEH 1F5LA 1P9UA 2FO9A 3LH1A 5SGAE 3VPKA 3M36A 1S85A 4I31A 4VGCB 4MPXA 2OXSA 4FU9A 1TQ7B 1LQDB 3SNBA 1TYNA 3EQ0H 2OC1A 1ZSLA 2OD3B 1P2IA 1MUEB 2IJOB 2Z3DA 4Q2KA 3P70B 1UTNA 2V6NA 4X1QU 4I8KA 3VB5A 2XC4A 1TE0A 1C1PA 3Q3XA 4JZ1A 2XWAA 4K1EA 1A3EH 1C4U2 2J2UA 1EPTC 1O38A 2Q6FA 1BIOA 1FY4A 3TH2H 3M5OA 1SR5C 1E37B 1G9IE 3D65E 2PHBA 1ETSH 1DS2E 3GDUA 4ABEA 3AAVA 4DURA 3VB3A 1A7SA 2H1UA 4IMQA 3MU4A 3KNXA 1FPCH 4I7YH 2K1QA 5IDKA 1ZMLA 2GTBA 3NCLA 1FY1A 3HGNA 3TPIZ 4ESTE 3M35A 4Z6AH 1BITA 2NU2E 1GHVH 2XRCA 2ZC9H 4Y0YE 2O9QA 1Z8IB 2GX4A 1G32B 2BDGA 2BYAX 2XXLA 3MMGA 2AERH 2AGIX 1ZTLA 2RG3A 2CN0H 2SNVA 1C5NH 5FPYA 1TRYA 2WPHS 2XC0A 1C1QA 5HXFA 2A4RA 1O3BA 4GAWA 1QB9A 1Y3YA 1MKXK 8ESTE 1FY8E 2XW9A 3UQVA 1VITH 3LGUA 2OCVB 2LPRA 2BDIA 4U30A 1B7XB 3OY6U 3UIRA 4FXGH 1PQ8A 2RCEA 3LC5A 1S82A 3RXSA 1KIGH 1P05A 1S83A 3A86A 7ESTE 2FWWA 1GI3A 4CR5A 3M3SA 2FESH 3NUMA 2KAIA 1GBDA 1EOLA 1GBAA 1CA8B 4AX9H 3ZVCA 5LGOA 1K21H 1F0UA 3RXRA 1E36B 1H4WA 4AYYB 4NA7A 5FAHA 1FIWA 3FVFB 2Q1JA 4X8VH 3QK1A 4IN2A 2PUQH 3K2UA
chains in the Genus database with same CATH superfamily
5DJ7A 1LVOA 4Y76A 5E0GA 4K60A 1OX1A 4OS4A 1PYTC 3Q76A 3F1SB 1ZGVA 1Y59T 3HKIB 2QXHA 1P3EA 1GJ8B 2G52A 5FCRA 1HLTH 2A5KA 2QF4A 1C2IA 1D6RA 2BZ6H 2BLOA 2FXRA 2RDEA 1GHAG 1JRSA 2BXUH 3ZYDA 1KXAA 3D49H 1P01A 3RM2H 1SOTA 3V13A 3EAJA 2IPHA 1TNGA 1CT4E 3DSPA 1BJUA 3RMOH 1F5RA 3Q3YA 1W3CA 3BTFE 2VIOA 3RXGA 1NN6A 1DWEH 3ZZAA 2PKAA 1WSSH 2TPIZ 1NY22 3ZZCA 1DVAH 1AVGH 5TCAA 4Y6DA 4K3JA 1K1IA 2J34A 2V3OH 1GJ5H 1D3DB 4X6PA 3TNSA 2OQUA 3K6YA 5L6NH 3PV5A 5EODA 2ZU1A 1DSUA 4ISNA 1C1UH 2KCOA 2HPPH 1PPZA 3A7XA 2PFEA 2A45B 4LZ4B 3M3VA 3SGAE 4FVDA 1A46H 1YCPM 4HZHA 2J95A 4JYVH 3RMNH 2EC9H 4ZKRU 1TGNA 4XSKU 3SU2A 3VB6A 1GHZA 4IW4E 3U8TH 4RKJB 4BOHA 2ODPA 2C3SA 1KXEA 2XNDD 2W7UA 4BTUB 1FAXA 2GT7A 4K8YA 1DDJA 3TGIE 2BVXH 4JMYA 1BDAA 1AB9B 3Q3KA 3TGJE 2HLCA 1G3CA 1TX7A 1CA0B 2QYIA 2ZDKA 3LDXH 3MU0A 4RN6A 1C4Y2 1C5TA 1MCVA 4FVBA 1NESE 5F6MA 3N7EA 1TX8A 3NK8A 1A5HA 2KAIB 1HAIH 2JH6D 4YT7H 1W14U 2PR3A 1BTXA 1C5PA 2PSXA 1O2IA 2YOLA 3MU5A 4MNXA 4B75A 1NTPA 1HV7A 5A8XA 1W8BH 2C8WB 4CBOA 3W95A 1GJ7B 1PJPA 1SLWB 3UR6A 1MTWA 3NWUA 2ANMH 2AFQB 2B5TB 4X8SH 5EXNA 1LHDH 1WV7H 3DT0H 1DOJA 2ZU2A 3LONA 1TNHA 1Y3XA 2JH5D 4CBNA 2CHAC 2FI3E 2FOFA 1Y3UA 2ZP0H 1MTUA 1K28D 3VXFH 4JZFH 1GI4A 3T2NA 2G5VA 2VINA 5L2YH 1G3DA 1QL8A 3RMMH 3E91A 1ZSKA 2BQ6B 2VVCA 3RU4T 4A1VA 2R0KA 3DSOA 4A1XA 1GDNA 3RXHA 4Y8YA 3L6PA 5A0AE 1F7ZA 3BTHE 2V3HH 2YMSC 4FU7A 4Q63A 1GJAB 2W3KA 1BB0B 1ZPBA 2PP6A 3N7DA 1LVYA 2F3CE 3SOSA 8KME2 2XYAA 1O30A 1GHAF 3QDZB 4JYTA 1V2NT 1A4WH 1S6LA 4RT0A 1JMOH 3A82A 4J2YB 2BM2A 3TJNA 3QGNB 4I8JA 1E35B 2KCPA 4K8BA 2Q6DA 1EOJA 1XUKA 2BZAA 1TPPA 2GKVE 1HAXB 2BDHA 4GUXA 4XDEA 3SZNA 1Y8TA 1O2TA 5C0TA 3TVJB 2XOKD 1ZSJA 2D8WA 4P02A 8GCHF 1MAYA 1ETTH 1DUEA 3C1KA 1GBMA 2D2DA 5HM2A 1GI9B 2THFB 2JKHA 4X2YA 1ESTA 2ZGXH 2BLWA 3OSYA 3OAAD 2VH0A 1ZR0A 1W7XH 1O2ZA 2QAAA 5HYOA 1GI2A 4D7GA 1YWUA 1RTLA 4AGJA 1ZOMA 2QF5A 1H8HD 1CO7E 4PROA 5ESTE 5EJLA 2BD5A 5DN6D 3EA9A 4AG2A 1CSOE 1C2DA 2Y82A 1ZGIA 2GZ8A 2D1JA 3U1IB 1SGEE 2R2MB 2ZI2H 4GSOA 4XD7D 1TLDA 4A5TS 3RDZA 2H9TH 3U98H 3U1JB 1NT1A 1W2KH 2ALVA 5EGMA 1IQLA 4FUEA 1S5SA 3RUOA 2TIOA 1UO6A 5EPNA 5CHBA 3HPTB 4XBDA 3DSGA 5A2MH 1QGFA 3KHVA 1NBME 2XCNA 5LPFA 3F2HA 4K69A 4X1NU 2HALA 1MBQA 5T6FA 2BX3A 2XWBI 2XNIA 2B8OH 1HBTH 1W0YH 2ZTZA 2YNAA 2EQNA 2OQ5A 5DGJA 4YT6H 1FJSA 2FTLE 1TALA 1GJ4H 5FXLA 1KTTB 3ZZBA 5C5OA 2R0LA 4OS1A 2BQ7B 1SFQB 1EATA 1K1OA 2JIZD 3BIVH 3SU3A 1SQRA 5F8XA 1OOKB 1HIAB 1EZUC 3GS9A 4ZH8A 4X2WA 3TK6A 3A83A 3DFLA 4HGCA 1S6FA 1BMNH 3BN9A 4I33A 2G5NA 2O8MA 4E05H 2CV3A 4J1YA 3QZRA 1O3JA 1D3PB 4YM9A 4CRFA 1H9IE 2FOHA 2A5AA 1S84A 2J98A 2ZHWH 2J4IA 1MABB 1ELEE 2BD9A 3KQEA 1TA6A 2L6OA 1FY5A 3TITA 1XUFA 4ZKSU 2QA9E 1N6XA 4XBCA 1OP0A 1SL3A 6LPRA 3A7WA 1D6WA 3BEIB 1LVBA 3A81A 3V0XA 1ESBA 5PTPA 3SUEA 2V0BA 1SVPA 1DLEA 1MQ6A 1EX3A 1KMHB 2WPDD 1MKXH 3U8RH 2FTMA 1EJNA 1O31A 1TNLA 1TA2A 1O2OA 3UPEA 6CHAB 2PWXA 1QB6A 1JRTA 1HAZB 2Y5GA 2QV1A 1AY6H 5GNDA 2ZIQH 2I6SA 2P3FH 5GCHG 4BAQB 5KGOA 1O2MA 1WCZA 2BX4A 4CRAA 4B2BA 5HIZA 3ZIAD 1K2I1 1JIRA 1B0FA 3HATH 3STJA 1MU8B 1THPB 4AN7A 3ITIA 2SFAA 1V2OT 3PRBA 1TWXB 1NFXA 3A8AA 1O2PA 1MU6B 3WWBA 5EU8A 3ODFA 1QRWA 2FOEA 1AHTH 3TJUA 2PUXB 2OLGA 1Z8JB 2BVRH 3OY5U 3UOPA 8LPRA 5EIYA 4DCDA 1LMWB 1FDPA 1PPCE 3TGKE 1C1NA 1ZYOA 1N1LA 1QURH 3MQKC 3SNCA 1QL9A 1ZPZA 2Z9IA 1Y3WA 1K1PA 1SGCA 3PYHA 1WQSA 1VJ9U 2EI8A 1FV9A 1HCGA 1IQHA 2XBYA 2CHAB 4Y79A 1W7GH 1O2VA 4BAMB 2QCYA 2JH0D 3CS7A 1DY8A 5T3HA 2GV7A 2UUYA 1O2XA 2HNTF 1Z1IA 1YPEH 2HLDD 4DIIH 2ZDNA 4A92A 1ABIH 3TJOA 1QY6A 3SQHE 2AMDA 1TBQH 4X1RU 4ZXXH 1P04A 4OGYA 3VFEA 2JJ2D 2ZDLA 1WYKA 3FN8A 1HAVA 4CR9A 3LH3A 1SQOA 2JDID 1F2SE 3SHAH 3F9FA 3GCOA 3ATLA 3P8OA 1AMHA 1ZHPA 2QE7D 3F9GA 1IQGA 3VGCB 2UUKB 2RA0A 4Y7AA 2Y80A 2Y6TA 1TMUH 2HPQH 1GJDB 1LTOA 1FZZA 4AZ2B 1PPFE 1HNEE 5FHTA 3M37A 1W0JD 2EI7A 3EE7A 5E0JA 5EQSA 1ANCA 4GLYA 2BXTH 1QHRB 2PLXA 2QF0A 4GHTA 1IQMA 1C9TA 1IQIA 4DW2U 2NWNA 1O5BB 3MNXA 4ABDA 3SU4A 1BTHH 5EW1H 1DWDH 3KQCA 1MH0A 1NC6A 1TRMA 1BMAA 3ELAH 5CE1A 5G4BA 1PQ7A 3I29A 2BY8X 3E8LA 4A1TA 2ZO3H 3DA9B 4U01A 3A87A 1UHBB 1IQNA 3WY8A 4ZUHA 5AVDA 3RXKA 4Z0KA 4AB8A 5A0CA 2QC2A 1YPLH 3B8JA 1P06A 1ZHMA 3SN8A 3GICB 1BBRK 1O2NA 2W6ID 3CS0A 1P10A 5DG6A 4AOQA 4TY7A 2ZCHP 3R0FA 4D9QA 3LJOA 3M7TA 2ZG0H 1W12U 1P02A 1Z8GA 1YBWA 1EUFA 3PM3A 2O8TA 4TT3D 3EYDA 3RXVA 1TNIA 3SYJA 3FZDA 5DP5A 1C5YB 5GJ4B 4IMZA 3SI4H 1NM6A 1UCYH 4Y8XA 2ZGBH 1CHGA 3SJKA 2J98B 3D62A 4LK4A 4ZHAA 1GWAA 1FQ3A 1OWKA 1BBRH 1DPOA 1YLDA 2Y7ZA 1C2GA 1O2KA 3PV2A 2FX4A 1O39A 2PGQB 2DE8A 4TYDA 2XCFA 4Y0ZE 4WVPE 2ZGCA 4ASHA 2KFWA 2GZ7A 1V2UT 4GCHF 4MPVA 3GY6A 1HAYB 1O32A 3NZIA 4ISHH 3SJ9A 2ZU4A 3OE7D 1SGQE 3OTPA 5C17A 1ID5H 1G2LA 1YF4A 3OFND 2VIQA 1BRBE 1O37A 2ZFPH 1NPMA 1M9UA 1AIXH 2ODQA 4RSPA 4UFDH 2Y5HA 1SLXB 1BMLA 1UVSH 3P8NA 1YLNA 1V2WT 2OP9A 1ACBE 1T8MA 4OS5A 4O9VA 1RD3B 3SNAA 2PKSC 2DUCA 1AD8H 1XUIA 1GHBF 1EJMA 1TNKA 1UTMA 3FANA 3HKJB 4OS6A 3RXUA 2G81E 3RC4A 1G36A 1V2LT 2IPQX 5B6OA 1EASA 3H09A 1AE5A 2WUBA 3G01A 4WWYA 4DIHH 3FKSD 1U6QA 1JXPA 1WTGH 1ZTKA 2FEQH 2ZQ1A 3UR9A 3A7TA 2B9LA 2BY5X 3KQ5A 1BRAA 3DUXH 5L30H 4MNVA 4D7FA 1AFQC 1RXPA 1AU8A 1QQUA 1FNIA 1GCTB 4WF8A 5E8EH 1GI6A 2ZFRH 2ZEBA 2K0QA 4IN1A 2OUAA 1YPJH 1BMMH 1FUJA 1AN1E 2OTVA 2ZHFH 3CP7A 3GDVA 1O2RA 4YXWD 2UWPA 2D26C 4AFUA 2ZU3A 3SI3H 1N8OC 1RTFB 1BTZA 1OXGA 5I25A 1VCPA 5EXMA 4AFQA 3LGIA 2JETB 4B73A 5F53A 2A2XH 1MKWK 2ZFFH 2F9VA 3RU4E 1FPHH 3O8BA 1GVKB 4I8HA 1SGNE 1GBIA 2YMSD 1HAGE 4YTAA 4GVUA 1KY9A 4CRCA 1GBKA 3P8GA 1PPGE 1SGFG 3VB7A 3SV2H 1KTSB 2BY6X 3A7ZA 3FZZA 2FYRA 4ZXYH 4BXSA 1SQAA 1FLEE 2HGTH 2GJGA 1V6DA 4AFSA 4ZAEA 3SV9A 4ZMAH 2ZPQA 2F9UA 2G55A 1P3CA 7LPRA 2JETC 1QJ1B 1ZRKA 2P94A 1MD7A 3M5NA 1PPHE 2SGPE 4ZHLU 1P2JA 1P11E 1YPHC 1GGDC 4DY7B 2ZDMA 2W6JD 5FX5A 3TJVA 3SU0A 3A84A 4P00A 4UFEH 1ELCA 1J17T 2V3MA 1O2UA 3IWMA 4JYUH 3SW2B 1VKYA 2PTCE 1K1NA 3S7HB 2I6QA 3BTQE 1GCTC 1P12E 1SB1H 3K9XB 4U32A 2FS8A 1BTPA 3F0PA 1GMDF 1Z8RA 3SGBE 1GDQA 4E06H 6GCHF 1OYTH 1NZQH 2FOCA 4AORA 4DG4A 3RXIA 1OWHA 5DP4A 2R3UA 1SHHB 3MWIU 3BTEE 1H9HE 1P2MA 3SU1A 3TH4H 3R3GB 4ABAA 1A1RA 1HGTH 5C20A 5IYTA 1C2KA 2F43B 4RT1A 5DPAA 1SOZA 2VIWA 1O2GH 3JZ2B 2VGCC 5TJXA 1P2NA 3SJIA 2V35A 3U69H 3UNRA 1L4DA 2Y5FA 2CGAA 2FM2A 3B9FH 4CRDA 1GBLA 1TBZH 3T25A 1DANH 2GT8A 4D8NA 3RXCA 1UJ1A 2WINI 1XVOA 4I86A 2PTNA 1ELVA 4BAHB 1C9PA 3BG4C 4CHAC 3QN7A 4KP0A 4Q80A 3S9BA 2FP7B 3SORA 1O36A 4ZKNU 2LP6A 3KN2A 1AB9C 2A7CA 1V2PT 4Y7BA 3ZVGA 1J15A 1DWCH 4WMFA 4FUFA 1PPBH 1CGHA 4GPGA 3PMAB 4H6SB 5DK1A 1EAUA 5ETXA 5KEDA 2R3YA 3ATWA 1MTVA 1Z7KA 1ETRH 2ZECA 1HIAA 1ANBA 1MTNC 3F6UH 1EP5A 1P9SA 2TGDA 2OC8A 2ZDAH 1GMDG 2DE9A 9ESTA 3DD2H 1V2RT 2ZKSA 3MI4A 1IHTH 2C93B 1G3EA 1NFWA 4I8GA 5C2ZA 1TONA 5FL7D 2ZFTA 1WDIA 3RXDA 3TH3H 1V2KT 1VGCC 4ASUD 1FONA 5IK2D 2AGEX 4INLA 3VEQB 3UY9A 2WZQA 1RIWB 1O3KA 4ISLA 5A09A 4MVNA 1BMFD 2FPZA 1QQ4A 5LPEA 1Y5BT 1XXFA 2KCYA 1YY3A 3QTOH 1FI8A 4KTCA 3AK5A 3TU7H 2G00A 4FOUC 4F55A 5ABWA 5JB8S 1P03A 1EAWA 1YPHE 1TQ0B 4CH2B 5AFYH 3S69A 1SGYE 3LC3A 2FIRH 5B6LA 1O2HA 1SGFA 3RXQA 2GMTC 3FP7E 1NFUA 4B1TA 1FN8A 1GJCB 1V2QT 1O3CA 2A7JA 1E1RD 2J92A 5HIYA 1TPOA 2UWLA 1UTOA 4WMEA 1LVMA 3E90B 7GCHF 3MH7A 1ARBA 1AUTC 3RLWH 1O5AB 3SGQE 3KEEA 2GP9B 5DKMA 1K1LA 2VVUA 1AQ7A 3ZZ8A 3OU0A 4RI0A 1HRTH 5EQRA 3OEED 1O3EA 1TAWA 3H5CB 1QBVH 4AYVB 5BPEA 1NROH 5L2ZH 1C1OA 1H8DH 1N8OB 1ZPCA 4RKOB 1A0JA 1YKTA 3MNBA 4X2VA 3E0NB 3KQDA 1BTYA 2BD3A 2C8XB 4NSYA 2A4GA 2G4TA 2Z3CA 3MNCA 1SMFE 1QRZA 2QXGA 1BRUP 5LH8A 1THRH 1W10U 1CBWB 3VXEH 2ZU5A 3HK6B 3V3MA 3U28C 3T29A 4YOGA 3RXPA 1NRRH 1NU7B 1D9IA 2GCHF 1BTUA 4H4FA 4DT7B 4UD9H 1EPTB 1TFXA 1QA0A 2Q6GA 5F8ZA 2NU4E 7GCHG 2PKSB 1HAVB 2ANKH 1UCYE 4BAKB 1TOMH 2ZTYA 3H7OA 1E0FD 1O3LA 3E1XB 1WUNH 1C1RA 1G37A 1E38B 1QR3E 2ZPSA 4VGCC 1O5EH 1T31A 1LHFH 2KZ4A 1KLJH 2R9PA 2Z3EA 3T28A 5GIBA 4TPYA 3LPRA 3MNSA 1DT2A 1HAPH 1GBHA 1ELGA 1AZZA 2B7DH 4MLFB 2H9HA 4DVAU 2ZFQH 1H8ED 1KYNA 2K8IA 2BLVA 2A32A 2SGQE 1RIWC 5C3NA 1OP8A 1EJAA 2WPIS 2FI4E 2GCHG 2P3TB 2AIPA 3L3TA 4NCYA 3P92A 1O2YA 1SLUB 4TSFD 1SKYE 3SNDA 5C1YA 2GCTC 3MH4A 4XRNA 2A4QA 3GY3A 5C0UA 1K0HA 4DGJA 1UTKA 5C1UA 1PYTD 3BTKE 1AO5A 2G4UA 4YO9A 4Z1MD 1P2OA 1EKBB 1WBGB 1ZZZA 2BDYA 3TNTA 2FYQA 4UONA 1UK3A 3GCTF 3T62A 1C2HA 4B74A 2O8UA 3KQBA 4NG9H 4FUBA 1K1JA 1NS3A 3M7QA 3PTNA 3GCHC 2FLRH 1HJ9A 2WYJA 2RFKC 3D23A 5J4SA 1EP6A 3BEFB 2EA3A 2ZF0H 9LPRA 1ANEA 1Z6JH 4B2CA 1NFYA 4K5ZA 3ESTA 1NO9H 2VWLA 1HAHH 1V3XA 3AVZA 2F83A 2UWOA 3PO1C 5K0HA 1TB6H 1WTHD 1SLVB 2ANYA 1E79D 3A7YA 3O8DA 3UOUA 1KLIH 1L1NA 4WY3A 1LPZB 4F49A 3UWJH 2GDEH 4NWLA 1S0RA 1LHCH 3PLPA 2ZZUH 3FO8D 2AH4X 1C5XB 1P09A 1GVLA 3F68H 4CH8B 3ATKA 5JB9S 3LOXA 1F0SA 4CREA 1XM1A 2KR7A 3LGTA 1F0TA 1UVTH 1QB1A 2C4FH 1B5GH 1MCTA 4A6LA 4HG6A 1UTPA 2Z7FE 5K7RA 5A8YA 1C2LA 1QA7A 1XMNB 3P6ZB 2HOBA 4B6FA 2GD4B 2M5TA 4WMDA 1P57B 1SG8B 1C1VH 2ESTE 2HWLB 1C5WB 5CHAC 3BEUA 1NRNH 1ZHRA 3VGCC 1KLTA 1QBNA 1QIXB 2WV9A 3DHKH 1UTLM 3SZEA 4SGAE 1YYY1 3KIDU 5HMAA 1EAIA 1O2JA 4WJG2 1YGCH 2WSSD 1YPGH 1C2EA 2G51A 2VGCB 2KCAA 2ZGJA 1LCYA 2ZGHA 4FETA 3ZZ4A 3P8FA 3QLPH 1Q2WA 1EB2A 3RP2A 1UK4A 2BMGB 1GJ9B 2ULLA 2ZHDA 2AHME 1C1WH 4XBBA 1UVPA 1L0ZA 1QBOA 3T27A 4U2WA 4AB9A 1AFEH 3KL6A 1Z1JA 3TK5A 3H7TA 1QTFA 4F48B 5DO4H 3SUFA 1GCDA 1BJVA 5GXPA 1GJ6A 1TGTA 1FN6A 4MNWA 5DP7A 3RC5A 3KCGH 4YLQH 1KXDA 3NKKA 1HXFH 3S9AA 2J5UA 2P8OC 1KDQA 4TY6A 3Q00A 4ABIA 2AIQA 1QL7A 2A5IA 4X0WU 3MH6A 4IS5A 4JZIA 1KXCA 2GDDA 2SNWA 3PWCA 2BD2A 3NPSA 2CF8H 1TGCA 2W7SA 2Z9LA 1CGJE 3RXMA 4KKDA 2ILNA 2P93A 4IBLH 1AE8H 4FUIA 2ZFSA 1Y5AT 5EQQA 3U8OH 1V2ST 5C67A 4OM9A 3RXLA 1FY3A 3BF6H 5JBCS 5J4QA 3OX7U 3GY5A 1OKXA 1ORFA 4NFEA 1SGTA 1CA0C 4X8TH 3LGVA 4ZHMU 1XX9A 2BDBA 4MPWA 5JDUB 4AFZA 1LKBA 1QCPA 1RFNA 3JZ1B 3OYPA 1QRXA 1VZQH 4E7RG 2VWNA 1TGBA 1PPEE 1O3AA 1OSSA 1OS8A 2RDLA 3F2GA 4X8UH 5F8TA 1HB0B 2RA3A 4YESB 1P2QA 1BZXE 1HAOH 5C5NA 2R2WU 1DM4B 4I8LA 2FLBH 1JIMA 1IAUA 1CHOF 3MOCA 2QN5T 3GDSA 1LQEA 5EPYA 2WPMS 2STAE 3UB0A 2CK3D 1G30B 1LHGH 2JJ1D 1IQKA 3A8DA 3RXAA 2F9BH 3KYFA 3BSQA 2VU8E 1BBRE 1UW7A 3SV7A 1GMCF 3BIUH 1Q31A 4NIXA 1C5RA 2W26A 3PMBB 4IC6A 1Y3VA 2BB4A 2BY9X 2GMTB 3GY7A 1TPAE 2BLQA 4MG3A 2QXIA 4Q4LA 4ABJA 4THNH 4X6NA 2BQWB 5HGGA 3NRLA 3ATMA 1DE7H 2A1DB 1AVWA 1O34A 1AKSB 5JBAS 1NRSH 1C2JA 4MTBA 5GCHF 3ZZ9A 1HPGA 2LNCA 5FPSA 4AC9A 1TOCB 2VIPA 1O3GA 4B2AA 5AHGH 1T4UH 1WAYB 1WXRA 2P3UB 5CHAB 2A0QB 2F9PA 2FOGA 1O5CB 5AFZH 3UTUH 5CDFE 3RM0H 1ZJKA 2OBQA 3UAIC 5FCKA 1YLCA 5H4IB 2GGVB 5E0HA 1MZAA 1CGIE 2PW8H 2FOAA 3BTME 3QUMP 4H6TA 4KGAA 1ZTJA 3CENA 1ELFA 1ELDE 3WW7A 4DT4A 2C8ZB 4NA9H 2XBVA 1P0SH 4CRGA 5GWZA 5CMXH 4NIYA 3V7TA 1EZQA 4O3UA 5I46H 1BHXF 1EZSC 1NRPH 2IN2A 3TK9A 1G2MA 3ENSB 1K1MA 4KTUA 3FFGA 5JYIA 1T8OA 2ZNKH 3U9AH 3UUZA 3C27B 2WPJS 3ZVEA 1O5GH 1MTSA 1OWIA 1Z6EA 2J97A 4NA8A 2WHXA 1AWHB 1B0EA 4DJZB 2J38A 3T26A 2CXVA 1FIZA 1UMAH 2OC7A 1DUAA 1CQQA 1FX0B 1JWTA 1RS0A 1ZLRA 2FZZA 4WXVA 1O5DH 3ZZ7A 3M3TA 3QGJA 3E6PH 3I78A 2Z9GA 1BCUH 4FUGA 3F9EA 1F92A 6ESTA 1LDTT 1H9LB 2KM0A 3BV9B 4TWYA 1O3MA 1C5MD 3LGWA 4MQAA 3S0NA 4M7GA 1J16A 3MTYA 1J9CH 1OWEA 4O3TA 1GDUA 1GL1A 3SJ8A 1BQYA 1O35A 2BOKA 3MO3A 1C1MA 1IQEA 2GCTB 1KSNA 1LPKB 3EE0B 1T8LA 2EI6A 3PO1B 1GMHF 7KMEH 1VCWA 4ZCNA 3QTVH 4IGDA 1YPKH 4JCNA 1O3NA 2QGRA 1C5QA 1GMCG 4IC5A 5EJZA 1CT2E 2ALPA 2F9NA 3HGPA 5GPIB 2SGFE 1V2TT 2ZTXA 2A31A 2VIVA 1EXFA 3M5LA 1L4ZA 1P2KA 1MMJN 2HVXA 2FODA 2TGTA 5TCCA 1DSTA 2W3IA 1MQ5A 5T6GA 1OWJA 2P59A 1DY9A 2ZCKP 1F5KU 1EZXC 4INKA 1NRQH 2V7QD 3M7UA 1KXFA 3OEHD 3PV4A 4OS2A 4UFFH 4AGKA 5E2PA 2VJ1A 2IOTA 1CVWH 4O97A 1TRNA 1T8NA 3GISB 1E1QD 1GHWH 5EOKA 2HNTC 3AASA 2VWOA 2BOHB 2VB0A 5C1XA 2FI5E 3CNRA 3KYGA 3MO6A 3VG8A 3RXJA 3MU1A 4ZKOU 1O3HA 4ACBA 1HFDA 1SGPE 1GHBG 4DOQA 2BD4A 4BNRA 2XC5A 1L2EA 3GYLB 2QIQA 1E34B 1Z71A 1LKAA 1TMBH 2AS9A 2PGBB 2AMPA 2Z9JA 4B76A 2VH6A 1WU1A 1EPTA 2WUCA 5DP6A 3UWIA 4YZUA 4HTCH 3FP8E 1A5GH 1VJAU 4XOJA 3RXEA 3M5MA 1C1TA 1GBBA 2KX4A 2H6MA 1AI8H 3S9CA 1RTKA 1YM0A 2NU1E 1S81A 4NFFA 3P17H 5E2OA 2OK5A 2WYGA 1UTQA 1TMTH 3GCTG 4BANB 2EY4C 1C1SA 2STBE 1C2FA 1HXEH 6GCHG 1GPZA 5F03A 5FBIA 1SGDE 3TLOA 3MFJA 1PFXC 1O5FH 1SC8U 1J8AA 2ZQ2A 3SQEE 4LZ1H 1SBWA 1ZMJA 3NXPA 1DXWA 1WQVH 1YCPH 6CHAC 4AG1A 1AKSA 2W5EA 3QWCH 3UNSA 3K6ZA 1GI8B 1NBMD 1D3TB 3UFAA 4H42U 4YOIA 3LJJA 3QO6A 4MPUA 1BOQA 1QJ6B 1N6YA 2YNBA 4OGXA 4NIWA 4A7IB 2VWMA 4NWKA 2GVFA 3URDA 4K1SA 4K2YA 2C90B 5EW2H 2ZA5A 1QFKH 1O0DH 4INHA 1XKAC 4UDWH 4NIVA 1QJ7B 4GHQA 2VIDA 2WV4A 1ARCA 4LOYH 1NU9A 3VB4A 3ZZDA 4ABFA 2Y7XA 4LXBH 2VNTA 2HVYB 5JBTA 1GI0A 1RRKA 4QT8C 5HM9A 1TX6A 2BDAA 3SNEA 1C5ZB 1GI7B 2CJIA 4YOJA 1SFIA 2H5DA 3A7VA 3SU5A 5ESBA 3SUDA 4NSVA 1W0KD 1THSH 2AEIH 3F9HA 1C5VA 1RGQA 4JZEH 3LIWA 3T5FH 4X1SU 3SHCH 5KECA 3RC6A 3N7OA 1IOEA 2WPLS 2ASUB 3PLKA 3ATIA 1DX5M 1HJAC 4ABHA 3P95A 1OP2A 1DITH 2CMYA 2EEKA 3FAOA 1QZ8A 1O3FA 1H1BA 3STIA 3WWFA 1ELBA 2Y81A 1MAXA 4R8TB 1ESAA 3FOAA 4HI3A 1PQAA 1O3IA 1S0QA 2QXJA 5JBBS 3W1EA 3M61U 1GG6B 2OINA 4SGBE 3HK3B 4MDSA 2OBOA 3A80A 1BRCE 3RXBA 3PB1E 4Y10E 1O3DA 4ABBA 4OS7A 2TGAA 1INCA 3ZVFA 3EA8A 3K65B 5GDSH 1MZDA 1YP9A 1T4VH 1SSXA 4WH8A 1O3PB 3SJOA 1O33A 1GBEA 2F4LA 2TGPZ 4ISOA 1W11U 3EGKH 2FOMB 3PWBA 1COWD 3O8RA 3BG8A 2G8TA 3F2FA 4BXWA 3PLBA 2UUJB 1GJBB 5T1VA 2CF9H 4FUJA 2XTTB 1CE5A 5JPMH 1K9OE 1ANDA 3MYWA 1TABE 4X6OA 1Y5UT 1UVUH 3ODDA 3ZVBA 3E16B 1XUJA 3A85A 2ZWLH 1C5UA 5A0BA 1UCYK 1GBJA 3EDXB 3SO3A 3GCHB 1AWFH 1C2MA 2GZ9A 4K1TA 1A61H 2BD7A 2OC0A 1GBFA 2C8YB 4MNYA 2O8WA 1EQ9A 4FUCA 4GCHG 1MD8A 5DP3A 2SGEE 1GL0E 1SGIB 2Z9KA 4NZQA 1CU1A 3EA7A 4B6EA 1GHXH 1GBTA 3AW1A 4XFQA 3RXTA 3UQOA 2ODYB 1GGDB 4X1PU 5LPRA 2Z6BD 3AAUA 2AYWA 1A3BH 1KXBA 1ZJDA 4FUHA 3DFJA 1V2VT 1XXDA 1O2SA 4KELA 1OHHD 1AVXA 2GV6A 3A89A 1MKWH 4R0IA 1L1GA 1TNJA 1XKBC 2WV5A 1CT0E 4B71A 1XVMA 1DICA 2HRVA 3SU6A 2ZPRA 1YPMH 2TRMA 2XBXA 2A4OA 2P95A 3PRDA 3SV8A 2Z94A 2ZCLP 1C4V2 3URCA 3ZVDA 1F0RA 1S6HA 3W94A 2FS9A 1WOFA 4M9FA 2F9OA 5C94A 1VITG 5A8ZA 1JOUB 1IHSH 1O2LA 4WH6A 1V2JT 3PMHB 3PMJA 4ABGA 4FUDA 3ZZ5A 4X6MA 4TPIZ 2FX6A 5DP8A 3UREA 1L1JA 1UK2A 1PQ5A 3BTGE 1SI5H 1ABJH 4WXIA 1VCQA 2BD8A 2AMQA 3SUGA 1AFQB 2ZHEH 1C5OH 1FMGA 1T32A 2IJD1 3V12A 1DXPA 1XUHA 4D76A 3IG6B 1SGRE 1BA8B 3LT3A 1UTJA 4F4OC 1CBWC 1EAXA 1HJ8A 3RMLH 1BUIA 1AZ8A 4ZROA 5DP9A 3BTDE 4UFGH 1O2QA 4Y71A 3IITA 1O3OA 2FOBA 1ELTA 3PROA 2M2AA 1DLKB 4Y11E 1HJAB 2BDCA 4JK5A 1HYLA 1EFRD 2SGDE 1MTNB 3RLYH 2J9NA 3LU9B 1GI1A 1W0ZU 3ZYEA 3I77A 1VITF 2P16A 5FX6A 1LO6A 1UHBA 3A8CA 1X7AC 1ZMNA 4Y8ZA 1A0HB 3BTTE 3TIUA 1TPSA 2ZHQH 4O03A 1GG6C 1K22H 2P8OB 1W13U 1H8IH 2WPKS 3MHWU 3LGYA 3GY4A 1V2MT 5EG4A 1G3BA 3OTJE 3ZZ6A 3E3TA 2TBSA 3RXFA 5HKKD 1DFPA 1GBCA 3LKWA 3Q77A 2NU0E 3F0OA 1ZRBA 2H9EH 5FPTA 1BTWA 4UEHH 3DCLA 1FXYA 2ANWA 2BY7X 1VGCB 4YLUA 1KDQB 1A2CH 4D9RA 3ZZ3A 3O8CA 2FMJA 4I32A 1D4PB 4E7NA 4BAOB 3MU8A 1LPGB 1SPJA 1EB1H 3SBKA 1YCPK 1IQJA 1T7CA 3MO9A 2PKAB 1BT7A 1YC0A 3E0PB 1AUJA 3GYMA 1SHYA 4JK6A 3SV6A 1TBRH 3GCNA 3BTWE 2L74A 1IQFA 3KF2A 1O2WA 2BVSH 3ZV9A 2F91A 2H5CA 2J94A 1ELAA 3A8BA 3AW0A 1XUGA 1HDTH 1OWDA 3GY2A 1P8VC 2AGGX 1AGJA 3BG4B 4CHAB 2O8LA 4BTIB 1RJXB 4Q7YA 1OPHB 3ZV8A 1VR1H 5FBEA 2VVVA 4JZDH 2XBWA 3B23B 1UVOA 1BHXB 3QX5H 1OYQA 2PSYA 3L33A 3RXOA 1J14A 5AF9H 2H2ZA 2QY0B 3FP6E 1QNJA 3A88A 3GY8A 2BHGA 4X2XA 5BRRE 2UUFB 1JBUH 1TIOA 1CHOG 1DWBH 1A0LA 3PTBA 5EXLA 1Q3XA 4CRBA 2BTCE 4Q7ZA 1TGSZ 2B0FA 4KTSA 2YMSB 3UNQA 4UE7H 2ZDVH 2A7HA 1MBMA 8GCHG 4ISIH 3RU4D 3S7KB 1A5IA 1SQTA 3QZQA 3GOVB 1C5LH 3MH5A 3KGPA 5T6DA 2QF3A 4TWWA 5DSFA 1FAKH 4BTTB 1C5SA 2SGAA 1GMHG 2PV9B 4NZLA 2HNTE 1D3QB 4FU8A 1HUTH 1GI5A 2FDAA 2NU3E 1GVZA 4HFPB 4NGAH 3ZVAA 4ACAA 4Q7XA 4XE4A 1GHYH 2A2QH 1LHEH 1F5LA 1P9UA 2FO9A 3LH1A 5SGAE 3VPKA 3M36A 1S85A 4I31A 4VGCB 4MPXA 2OXSA 4FU9A 1TQ7B 1LQDB 3SNBA 1TYNA 3EQ0H 2OC1A 1ZSLA 2OD3B 1P2IA 3N99A 1MUEB 2IJOB 2Z3DA 4Q2KA 3P70B 1UTNA 2V6NA 4X1QU 4I8KA 3VB5A 2XC4A 1TE0A 1C1PA 3Q3XA 4JZ1A 2XWAA 4K1EA 1A3EH 1C4U2 2J2UA 1EPTC 1O38A 2Q6FA 2VBCA 1BIOA 1FY4A 3TH2H 3M5OA 1SR5C 1E37B 1G9IE 3D65E 2PHBA 1ETSH 1DS2E 3GDUA 4ABEA 3AAVA 4DURA 3VB3A 1A7SA 2H1UA 4IMQA 3MU4A 3KNXA 1FPCH 4I7YH 2K1QA 5IDKA 1ZMLA 2GTBA 3NCLA 1FY1A 3HGNA 3TPIZ 4ESTE 3M35A 4Z6AH 1BITA 5EJ1A 2NU2E 1GHVH 2XRCA 2ZC9H 4Y0YE 2O9QA 1Z8IB 2GX4A 1G32B 2BDGA 2BYAX 2XXLA 3MMGA 2AERH 2AGIX 1ZTLA 2RG3A 2CN0H 2SNVA 1C5NH 5FPYA 1TRYA 2WPHS 2XC0A 1C1QA 5HXFA 2A4RA 1O3BA 4GAWA 1QB9A 1Y3YA 1MKXK 8ESTE 1FY8E 2XW9A 3UQVA 1VITH 2LELA 3LGUA 2OCVB 2LPRA 2BDIA 4U30A 1B7XB 3OY6U 3UIRA 4FXGH 1PQ8A 2RCEA 3F3BA 1S82A 3LC5A 3RXSA 1KIGH 1P05A 1S83A 3A86A 7ESTE 2FWWA 1GI3A 4CR5A 3M3SA 2FESH 3NUMA 2KAIA 1GBDA 1EOLA 1GBAA 1CA8B 4AX9H 3ZVCA 5LGOA 1K21H 1F0UA 3RXRA 1E36B 1H4WA 4AYYB 4NA7A 5FAHA 1FIWA 3FVFB 2Q1JA 4X8VH 3QK1A 4IN2A 2PUQH 3K2UA
chains in the Genus database with same CATH topology
5DJ7A 1LVOA 4Y76A 5E0GA 4K60A 1OX1A 4OS4A 1PYTC 3Q76A 3F1SB 1ZGVA 1Y59T 3HKIB 2QXHA 1P3EA 1GJ8B 2G52A 5FCRA 1HLTH 2A5KA 1C2IA 1D6RA 2BZ6H 2BLOA 2FXRA 1GHAG 1JRSA 2BXUH 3ZYDA 1KXAA 3D49H 1P01A 3RM2H 1SOTA 3V13A 3EAJA 2IPHA 1TNGA 1CT4E 1BJUA 3RMOH 1F5RA 3Q3YA 1W3CA 3BTFE 2VIOA 3RXGA 1NN6A 1DWEH 3ZZAA 2PKAA 1WSSH 2TPIZ 1NY22 3ZZCA 1DVAH 1AVGH 5TCAA 4Y6DA 4K3JA 1K1IA 2J34A 2V3OH 1GJ5H 1D3DB 4X6PA 3TNSA 2OQUA 3K6YA 5L6NH 5EODA 2ZU1A 1DSUA 4ISNA 1C1UH 2HPPH 1PPZA 3A7XA 2PFEA 2A45B 4LZ4B 3M3VA 3SGAE 4FVDA 1A46H 1YCPM 4HZHA 2J95A 4JYVH 3RMNH 2EC9H 4ZKRU 1TGNA 4XSKU 3SU2A 3VB6A 1GHZA 4IW4E 3U8TH 4RKJB 4BOHA 2ODPA 2C3SA 1KXEA 2W7UA 4BTUB 1FAXA 2GT7A 4K8YA 1DDJA 3TGIE 2BVXH 4JMYA 1BDAA 1AB9B 3Q3KA 3TGJE 2HLCA 1G3CA 1TX7A 1CA0B 2QYIA 2ZDKA 3LDXH 3MU0A 4RN6A 1C4Y2 1C5TA 1MCVA 4FVBA 1NESE 5F6MA 1TX8A 3NK8A 1A5HA 2KAIB 1HAIH 2JH6D 4YT7H 1W14U 2PR3A 1BTXA 1C5PA 2PSXA 1O2IA 2YOLA 3MU5A 4MNXA 4B75A 1NTPA 1HV7A 5A8XA 1W8BH 2C8WB 4CBOA 3W95A 1GJ7B 1PJPA 1SLWB 3UR6A 1MTWA 3NWUA 2ANMH 2AFQB 2B5TB 4X8SH 5EXNA 1LHDH 1WV7H 3DT0H 1DOJA 2ZU2A 3LONA 1TNHA 1Y3XA 2JH5D 4CBNA 2CHAC 2FI3E 2FOFA 1Y3UA 2ZP0H 1MTUA 1K28D 3VXFH 4JZFH 1GI4A 3T2NA 2G5VA 2VINA 5L2YH 1G3DA 1QL8A 3RMMH 3E91A 1ZSKA 2BQ6B 2VVCA 3RU4T 4A1VA 2R0KA 4A1XA 1GDNA 3RXHA 4Y8YA 3L6PA 5A0AE 1F7ZA 3BTHE 2V3HH 4FU7A 1GJAB 2W3KA 1BB0B 1ZPBA 1LVYA 2F3CE 3SOSA 8KME2 2XYAA 1O30A 1GHAF 3QDZB 4JYTA 1V2NT 1A4WH 1JMOH 3A82A 4J2YB 2BM2A 3TJNA 3QGNB 4I8JA 1E35B 4K8BA 2Q6DA 1EOJA 1XUKA 2BZAA 1TPPA 2GKVE 1HAXB 2BDHA 4GUXA 4XDEA 3SZNA 1Y8TA 1O2TA 3TVJB 1ZSJA 2D8WA 8GCHF 1MAYA 1ETTH 1DUEA 3C1KA 1GBMA 2D2DA 5HM2A 1GI9B 2THFB 2JKHA 4X2YA 1ESTA 2ZGXH 2BLWA 3OSYA 2VH0A 1ZR0A 1W7XH 1O2ZA 2QAAA 5HYOA 1GI2A 4D7GA 1RTLA 4AGJA 1ZOMA 1CO7E 4PROA 5ESTE 2BD5A 3EA9A 4AG2A 1CSOE 1C2DA 2Y82A 1ZGIA 2GZ8A 2D1JA 3U1IB 1SGEE 2R2MB 2ZI2H 4GSOA 1TLDA 4A5TS 3RDZA 2H9TH 3U98H 3U1JB 1NT1A 1W2KH 2ALVA 5EGMA 1IQLA 4FUEA 1S5SA 3RUOA 2TIOA 1UO6A 5EPNA 3HPTB 4XBDA 5A2MH 1QGFA 3KHVA 2XCNA 5LPFA 4K69A 4X1NU 2HALA 1MBQA 5T6FA 2BX3A 2XWBI 2XNIA 2B8OH 1HBTH 1W0YH 2ZTZA 2YNAA 2OQ5A 5DGJA 4YT6H 1FJSA 2FTLE 1TALA 1GJ4H 5FXLA 1KTTB 3ZZBA 5C5OA 2R0LA 4OS1A 2BQ7B 1SFQB 1EATA 1K1OA 3BIVH 3SU3A 5F8XA 1OOKB 1HIAB 1EZUC 4ZH8A 4X2WA 3TK6A 3A83A 3DFLA 4HGCA 1S6FA 1BMNH 3BN9A 4I33A 2G5NA 2O8MA 4E05H 2CV3A 4J1YA 3QZRA 1O3JA 1D3PB 4YM9A 4CRFA 1H9IE 2FOHA 2A5AA 1S84A 2ZHWH 2J4IA 1ELEE 2BD9A 3KQEA 1TA6A 1FY5A 3TITA 1XUFA 4ZKSU 2QA9E 1N6XA 4XBCA 1OP0A 1SL3A 6LPRA 3A7WA 1D6WA 3BEIB 1LVBA 3A81A 3V0XA 1ESBA 5PTPA 3SUEA 2V0BA 1SVPA 1DLEA 1MQ6A 1EX3A 1MKXH 3U8RH 2FTMA 1EJNA 1O31A 1TNLA 1TA2A 1O2OA 3UPEA 6CHAB 2PWXA 1QB6A 1JRTA 1HAZB 2Y5GA 2QV1A 1AY6H 2ZIQH 2I6SA 2P3FH 5GCHG 4BAQB 1O2MA 1WCZA 2BX4A 4CRAA 4B2BA 1K2I1 1JIRA 1B0FA 3HATH 3STJA 1MU8B 1THPB 4AN7A 3ITIA 2SFAA 1V2OT 1TWXB 1NFXA 3A8AA 1O2PA 1MU6B 5EU8A 3ODFA 1QRWA 2FOEA 1AHTH 3TJUA 2PUXB 2OLGA 1Z8JB 2BVRH 3OY5U 3UOPA 8LPRA 4DCDA 1LMWB 1FDPA 1PPCE 3TGKE 1C1NA 1ZYOA 1N1LA 1QURH 3SNCA 1QL9A 1ZPZA 2Z9IA 1Y3WA 1K1PA 1SGCA 3PYHA 1WQSA 1VJ9U 2EI8A 1FV9A 1HCGA 1IQHA 2XBYA 2CHAB 4Y79A 1W7GH 1O2VA 4BAMB 2QCYA 2JH0D 3CS7A 1DY8A 5T3HA 2GV7A 2UUYA 1O2XA 2HNTF 1Z1IA 1YPEH 4DIIH 2ZDNA 4A92A 1ABIH 3TJOA 1QY6A 3SQHE 2AMDA 1TBQH 4X1RU 4ZXXH 1P04A 4OGYA 3VFEA 2ZDLA 1WYKA 1HAVA 4CR9A 3LH3A 1SQOA 1F2SE 3SHAH 3F9FA 3GCOA 3ATLA 3P8OA 1AMHA 1ZHPA 3F9GA 1IQGA 3VGCB 2UUKB 2RA0A 4Y7AA 2Y80A 2Y6TA 1TMUH 2HPQH 1GJDB 1LTOA 1FZZA 4AZ2B 1PPFE 1HNEE 5FHTA 3M37A 2EI7A 5E0JA 5EQSA 1ANCA 4GLYA 2BXTH 1QHRB 2PLXA 2QF0A 4GHTA 1IQMA 1C9TA 1IQIA 4DW2U 2NWNA 1O5BB 3MNXA 4ABDA 3SU4A 1BTHH 5EW1H 1DWDH 3KQCA 1MH0A 1NC6A 1TRMA 1BMAA 3ELAH 5CE1A 5G4BA 1PQ7A 3I29A 2BY8X 3E8LA 4A1TA 2ZO3H 3DA9B 4U01A 3A87A 1UHBB 1IQNA 3WY8A 4ZUHA 5AVDA 3RXKA 4Z0KA 4AB8A 5A0CA 2QC2A 1YPLH 3B8JA 1P06A 1ZHMA 3SN8A 3GICB 1BBRK 1O2NA 3CS0A 1P10A 5DG6A 4AOQA 4TY7A 2ZCHP 3R0FA 4D9QA 3LJOA 3M7TA 2ZG0H 1W12U 1P02A 1Z8GA 1YBWA 1EUFA 3PM3A 2O8TA 3EYDA 3RXVA 1TNIA 3FZDA 5DP5A 1C5YB 5GJ4B 4IMZA 3SI4H 1NM6A 1UCYH 4Y8XA 2ZGBH 1CHGA 3SJKA 3D62A 4LK4A 4ZHAA 1GWAA 1FQ3A 1OWKA 1BBRH 1DPOA 1YLDA 2Y7ZA 1C2GA 1O2KA 2FX4A 1O39A 2PGQB 2DE8A 4TYDA 2XCFA 4Y0ZE 4WVPE 2ZGCA 4ASHA 2GZ7A 1V2UT 4GCHF 4MPVA 3GY6A 1HAYB 1O32A 3NZIA 4ISHH 3SJ9A 2ZU4A 1SGQE 1ID5H 1G2LA 1YF4A 2VIQA 1BRBE 1O37A 2ZFPH 1NPMA 1M9UA 1AIXH 2ODQA 4RSPA 4UFDH 2Y5HA 1SLXB 1BMLA 1UVSH 3P8NA 1V2WT 2OP9A 1ACBE 1T8MA 4OS5A 4O9VA 1RD3B 3SNAA 2PKSC 2DUCA 1AD8H 1XUIA 1GHBF 1EJMA 1TNKA 1UTMA 3FANA 3HKJB 4OS6A 3RXUA 2G81E 3RC4A 1G36A 1V2LT 5B6OA 1EASA 1AE5A 2WUBA 3G01A 4WWYA 4DIHH 1U6QA 1JXPA 1WTGH 1ZTKA 2FEQH 2ZQ1A 3UR9A 3A7TA 2B9LA 2BY5X 1BRAA 3DUXH 5L30H 4MNVA 4D7FA 1AFQC 1RXPA 1AU8A 1QQUA 1FNIA 1GCTB 4WF8A 5E8EH 1GI6A 2ZFRH 2ZEBA 4IN1A 2OUAA 1YPJH 1BMMH 1FUJA 1AN1E 2OTVA 2ZHFH 3CP7A 3GDVA 1O2RA 2UWPA 2D26C 4AFUA 2ZU3A 3SI3H 1N8OC 1RTFB 1BTZA 1OXGA 5I25A 1VCPA 5EXMA 4AFQA 3LGIA 2JETB 4B73A 2A2XH 1MKWK 2ZFFH 2F9VA 3RU4E 1FPHH 3O8BA 1GVKB 4I8HA 1SGNE 1GBIA 1HAGE 4YTAA 4GVUA 1KY9A 4CRCA 1GBKA 3P8GA 1PPGE 1SGFG 3VB7A 3SV2H 1KTSB 2BY6X 3A7ZA 3FZZA 2FYRA 4ZXYH 4BXSA 1SQAA 1FLEE 2HGTH 1V6DA 4AFSA 4ZAEA 3SV9A 4ZMAH 2ZPQA 2F9UA 2G55A 1P3CA 7LPRA 2JETC 1QJ1B 1ZRKA 2P94A 1MD7A 3M5NA 1PPHE 2SGPE 4ZHLU 1P2JA 1P11E 1YPHC 1GGDC 4DY7B 2ZDMA 5FX5A 3TJVA 3SU0A 3A84A 4UFEH 1ELCA 1J17T 1O2UA 3IWMA 4JYUH 3SW2B 2PTCE 1K1NA 3S7HB 2I6QA 3BTQE 1GCTC 1P12E 1SB1H 3K9XB 4U32A 2FS8A 1BTPA 1GMDF 1Z8RA 3SGBE 1GDQA 4E06H 6GCHF 1OYTH 1NZQH 2FOCA 4AORA 4DG4A 3RXIA 1OWHA 5DP4A 2R3UA 1SHHB 3MWIU 3BTEE 1H9HE 1P2MA 3SU1A 3TH4H 3R3GB 4ABAA 1A1RA 1HGTH 5C20A 5IYTA 1C2KA 5DPAA 1SOZA 2VIWA 1O2GH 3JZ2B 2VGCC 5TJXA 1P2NA 3SJIA 2V35A 3U69H 3UNRA 1L4DA 2Y5FA 2CGAA 2FM2A 3B9FH 4CRDA 1GBLA 1TBZH 3T25A 1DANH 2GT8A 4D8NA 3RXCA 1UJ1A 2WINI 1XVOA 2PTNA 1ELVA 4BAHB 1C9PA 3BG4C 4CHAC 3QN7A 4KP0A 4Q80A 3S9BA 2FP7B 3SORA 1O36A 4ZKNU 3KN2A 1AB9C 2A7CA 1V2PT 4Y7BA 3ZVGA 1J15A 1DWCH 4WMFA 4FUFA 1PPBH 1CGHA 4GPGA 3PMAB 4H6SB 5DK1A 1EAUA 5ETXA 2R3YA 3ATWA 1MTVA 1Z7KA 1ETRH 2ZECA 1HIAA 1ANBA 1MTNC 3F6UH 1EP5A 1P9SA 2TGDA 2OC8A 2ZDAH 1GMDG 2DE9A 9ESTA 3DD2H 1V2RT 2ZKSA 3MI4A 1IHTH 2C93B 1G3EA 1NFWA 4I8GA 5C2ZA 1TONA 2ZFTA 3TH3H 3RXDA 1V2KT 1VGCC 1FONA 2AGEX 4INLA 3VEQB 3UY9A 1RIWB 1O3KA 4ISLA 5A09A 4MVNA 2FPZA 1QQ4A 5LPEA 1Y5BT 1XXFA 3QTOH 1FI8A 4KTCA 3TU7H 2G00A 5ABWA 5JB8S 1P03A 1EAWA 1YPHE 1TQ0B 4CH2B 5AFYH 3S69A 1SGYE 3LC3A 2FIRH 1O2HA 1SGFA 3RXQA 2GMTC 3FP7E 1NFUA 4B1TA 1FN8A 1GJCB 1V2QT 1O3CA 2A7JA 2J92A 1TPOA 2UWLA 1UTOA 4WMEA 1LVMA 3E90B 7GCHF 3MH7A 1ARBA 1AUTC 3RLWH 1O5AB 3SGQE 3KEEA 2GP9B 5DKMA 1K1LA 2VVUA 1AQ7A 3ZZ8A 3OU0A 1HRTH 5EQRA 1O3EA 1TAWA 3H5CB 1QBVH 4AYVB 5BPEA 1NROH 5L2ZH 1C1OA 1H8DH 1N8OB 1ZPCA 4RKOB 1A0JA 1YKTA 3MNBA 4X2VA 3E0NB 3KQDA 1BTYA 2BD3A 2C8XB 4NSYA 2A4GA 2G4TA 2Z3CA 3MNCA 1SMFE 1QRZA 2QXGA 1BRUP 5LH8A 1THRH 1W10U 1CBWB 3VXEH 2ZU5A 3HK6B 3V3MA 3T29A 4YOGA 3RXPA 1NRRH 1NU7B 1D9IA 2GCHF 1BTUA 4H4FA 4DT7B 4UD9H 1EPTB 1TFXA 1QA0A 2Q6GA 5F8ZA 2NU4E 7GCHG 2PKSB 1HAVB 2ANKH 1UCYE 4BAKB 1TOMH 2ZTYA 3H7OA 1E0FD 1O3LA 3E1XB 1WUNH 1C1RA 1G37A 1E38B 1QR3E 2ZPSA 4VGCC 1O5EH 1T31A 1LHFH 2R9PA 1KLJH 2Z3EA 3T28A 5GIBA 4TPYA 3LPRA 3MNSA 1DT2A 1HAPH 1GBHA 1ELGA 1AZZA 2B7DH 4MLFB 2H9HA 4DVAU 2ZFQH 1KYNA 2BLVA 2A32A 2SGQE 1RIWC 5C3NA 1OP8A 1EJAA 2WPIS 2FI4E 2GCHG 2P3TB 2AIPA 3L3TA 4NCYA 3P92A 1O2YA 1SLUB 3SNDA 5C1YA 2GCTC 3MH4A 2A4QA 3GY3A 4DGJA 1UTKA 5C1UA 1PYTD 3BTKE 1AO5A 2G4UA 4YO9A 1P2OA 1EKBB 1WBGB 1ZZZA 2BDYA 3TNTA 2FYQA 4UONA 1UK3A 3GCTF 3T62A 1C2HA 4B74A 2O8UA 3KQBA 4NG9H 4FUBA 1K1JA 1NS3A 3M7QA 3PTNA 3GCHC 2FLRH 1HJ9A 2WYJA 3D23A 5J4SA 1EP6A 3BEFB 2EA3A 2ZF0H 9LPRA 1ANEA 1Z6JH 4B2CA 1NFYA 4K5ZA 3ESTA 1NO9H 2VWLA 1HAHH 1V3XA 3AVZA 2F83A 2UWOA 3PO1C 5K0HA 1TB6H 1WTHD 1SLVB 2ANYA 3A7YA 3O8DA 3UOUA 1KLIH 1L1NA 4WY3A 1LPZB 4F49A 3UWJH 2GDEH 4NWLA 1S0RA 1LHCH 3PLPA 2ZZUH 2AH4X 1C5XB 1P09A 1GVLA 3F68H 4CH8B 3ATKA 5JB9S 3LOXA 1F0S