5DK5A

Crystal structure of crn-4-mes complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
294
structure length
294
Chain Sequence
HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Identification of Inhibitors for the DEDDh Family of Exonucleases and a Unique Inhibition Mechanism by Crystal Structure Analysis of CRN-4 Bound with 2-Morpholin-4-ylethanesulfonate (MES)
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 90
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5dk5A01
5FDLA 3QNOA 3MXJA 5JS2A 1QS4A 2B5JA 4DTOA 4ID5A 4QCLA 2IS3A 5FRNA 3U3YA 4FM2A 1BIUA 2Y1IA 3DLBA 4N5SA 4FJLA 4RW8A 1Y97A 2P51A 4FJIA 4KB1A 3ITHA 5KRSA 4CFAA 4LSLA 3V9XA 4HCBA 4KHWA 2HVIA 1NK0A 3NBPA 3IAYA 3LZIA 4DFKA 1RNHA 1U4BA 1QSYA 1SKRA 2OZSA 3DRRA 3CFRA 4O44A 1NOZA 1RBUA 2ETJA 1GOCA 3AVGA 1D9DA 3VQEA 4FJXA 1BI4A 4DF8A 1GOBA 3CM6A 1J9AA 3DYAA 3K5OA 4BE2A 4DLGA 5J2MA 4M3UA 4J2DA 5C24A 1BL3A 3WNHA 4Y1CA 3HT3A 3FFIA 1B92A 4CEFA 1KVAA 2IOCA 3ZSQA 1JLAA 5JS1A 3S3OA 4B9LA 2ITGA 4JRQA 3RMCA 1S1WA 1VSJA 2ZQBA 4IG3A 3VQ4A 3OJSA 2FC0A 2IC3A 1S5JA 1J5OA 2XY5A 3PUFA 1KVCA 1RILA 3NGYA 4CHNA 1ZBFA 1EX4A 4JLHA 4OLAA 1SL1A 4I2PA 4Z0UA 4CECA 1JLFA 3ZCMA 1IKXA 1DTTA 3NFAA 3VQ8A 4CFBA 3NCIA 3KLIA 1RTDA 2HHQA 3AVFA 1JLCA 1UA0A 4CJLA 4DSKA 3OYCA 3OYMA 4DSIA 1ZYQA 1S1TA 3LALA 2AJQA 3HYFA 2OYQA 1WSHA 2PZSA 3U3GA 1RBTA 2YNHA 2KTQA 3MECA 3ZSRA 2HNYA 3KD1E 4DTPA 4C8LA 1XHXA 4DTNA 1BQMA 2X6NA 3QIOA 4O55A 4FZYA 1YTUA 4AHSA 1KFSA 1WSJA 3NGIA 1O1WA 1TAUA 4K8XA 3O3GA 3M8QA 3NHGA 4F3OA 3CYMA 1ITGA 4DF4A 3AO2A 3LWMA 3BGRA 3VQ9A 3NE6A 4FJNA 2X74A 2I5JA 3SUNA 4YFUA 2G8HA 2NUBA 1C1AA 2OPPA 2VG7A 4BWMA 2F8SA 3HPHA 3VA3A 1T03A 1NK9A 3AVKA 3NF9A 3L2QA 3T3FA 4O0IA 5J2PA 3HK2A 4M3RA 3AVNA 4CHYA 1IKVA 4OJRA 3K58A 4Z4EA 3I0SA 2HHWA 1CXUA 1C0UA 4TSXA 3UIQA 4O5BA 1U04A 4CEAA 4E1NA 1WAFA 1KLMA 5DK5A 4M45A 1UOCA 4K8ZA 4C8OA 3HP6A 3SNNA 4I9QA 4FVMA 2D0BA 4CEEA 4FJGA 5CYQA 4RW6A 4BDZA 4KV8A 3AV9A 3ZSXA 5E41A 4RW9A 3VQPA 2D5RA 2G8KA 1TAQA 1UAXA 3O4NA 3U6FA 1Q9XA 2G8FA 1LAWA 3DI6A 1HYZA 3VQ5A 5SWMA 1SL0A 1NK6A 1YT3A 2PYLA 3PY8A 5KGXA 3DLHA 2DFEA 2HNZA 2RN2A 1TL1A 3QINA 4CE9A 1T05A 3QEXA 3L8BA 4KI6A 2JGUA 1RDCA 4N56A 1HRHA 4AHTA 1C6VA 4CGHA 2QK9A 5HROA 1C0TA 1RT2A 4R5PA 3KLGA 1XHZA 3AVBA 1XI1A 1YVUA 3SUOA 4CEBA 1SKSA 4F3TA 4PUOA 5HRSA 4B3OA 1WSIA 1FKPA 4KTZA 3B6OA 4FLZA 3NF7A 3V9UA 4E19A 2Q3SA 1RTIA 3ZT4A 3MXIA 4Q5VA 1WN7A 3AO3A 1IKWA 1BCMA 4N41A 2FBXA 1W9HA 4LY7A 4CF1A 2DTUA 4DMNA 3ALYA 3B6PA 4HUFA 3L3UA 3VQQA 1LW2A 3MEEA 2PY5A 4FJ8A 1VSEA 2DFFA 3F73A 4FJJA 3ZSWA 4CFDA 3HJFA 4DTJA 4DLEA 2P5GA 2JLEA 3SPYA 1N6QA 1REVA 4YNQA 5HRRA 4CJFA 3F9KA 3ZT2A 4CIEA 4CK1A 4IBNA 2GBZA 4CF2A 1N5YA 4J2AA 1QHTA 2D0AA 4FZZA 3NGZA 4GVMA 3AVMA 1J53A 2XY7A 3NDKA 3OS1A 1NK4A 5DMRA 3DLEA 4CJ4A 3SCXA 1EXQA 4MFBA 4NCGA 5HBMA 3V9SA 1VRTA 3HPGA 4DQSA 1NK5A 2GUIA 4JS4A 4FLXA 3LWLA 3OYHA 1B9DA 4CCHA 4OKEA 3SPZA 3O4QA 4KHNA 2OPSA 3AA2A 3ISNC 4CJUA 1WAJA 2YV0X 4CJPA 2D0CA 1R0AA 4B9NA 1BQNA 2KW4A 3QO9A 3CG7A 3V9ZA 4CF8A 4AH9A 5HP1A 1RDAA 4F4KA 4ICLA 3HVTA 5KGWA 4AHRA 3LZJA 3SV3A 1X9MA 4DQIA 3P83D 3MXMA 5FRMA 3PX4A 1BCOA 1WNSA 3LP2A 4CERA 2XO7A 3HVRA 3RMBA 3S9HA 5I42A 4ZHRA 1TGOA 3AVLA 5HRNA 3RWUA 3LAMA 1RCHA 3KLEA 1SL2A 4E0DA 1TL3A 3K57A 3KK2A 1QSLA 3VA0A 5D3GA 3VQDA 1RT6A 4CJTA 1NJWA 3TI0A 1LV5A 5KTQA 3TAMA 2HB5A 4DU1A 4CJQA 4CJSA 1JLGA 2RPIA 1ZBIA 4OGCA 1ASWA 3LP0A 4RW4A 1NK8A 3LAKA 4KB0A 4FM1A 4IKFA 1VSIA 3RR8A 1SV5A 4PQUA 1I3AA 1S6QA 3OYFA 3TAQA 4I9LA 1J54A 4M41A 4E7IA 1NKEA 4FJ7A 4FLUA 3TR8A 1LWCA 1ZBUA 4CESA 2YKMA 2HNDA 3C95A 3SUPA 1TK8A 3ASMA 1VRUA 3AA3A 4OKKA 1WSFA 4DTUA 1FK9A 4I2QA 1TKDA 2X6SA 4J2BA 3OY9A 3QERA 3V4IA 2HHSA 5I3UA 2E6MA 2A1SA 3NAEA 2KZMA 1T8EA 4DWIA 4M3TA 2QKBA 3AVHA 3TWHA 1JLBA 1D8YA 4BE0A 3VQAA 2G8IA 4Z4IA 4FLWA 1NJZA 1IG9A 4CHZA 1VK0A 2BANA 3V1QA 3DOLA 3V6DA 3D0PA 3AVCA 3T19A 1D9FA 4FJHA 3KJVA 4OLBA 3E01A 3TANA 4J2EA 1D5AA 1U48A 3ZSOA 5CY4A 2WOMA 4CGIA 4DG1A 2Z1IA 4M42A 4DFPA 3PO5A 1BHLA 1HNIA 5T7BA 2F96A 5SZTA 4KHUA 4Z4CA 1L5UA 4FLYA 3TAPA 4DSLA 4IFVA 1LAVA 1XC9A 1GOAA 4W5QA 3OYAA 4DTRA 3ZSZA 3LP3A 3AVJA 3V9WA 1C1BA 4H4MA 4CJEA 1SKWA 1KSPA 4KRFA 1FXXA 3DMJA 1HPZA 2ATQA 4EP4A 1CLQA 1QQCA 3OYDA 2BGGA 4W5NA 3AVIA 4Z4FA 2YKNA 1EETA 4FLTA 2G8VA 4IDKA 3QEPA 3K59A 3QIPA 1VSKA 1HYSA 1BGXT 4FZXC 1JL2A 4CIFA 3CM5A 1ASUA 1L3SA 1QSSA 4M3YA 2EX3A 3D45A 3LPUA 1RBVA 2IGIA 4E7HA 3TABA 4KPYA 4FK4A 1KRPA 2ZD1A 2FBVA 4B9VA 2HVHA 4HHTA 1C0MA 1U49A 3EZ5A 4EP5A 4BDYA 4FK0A 2XHBA 3HPOA 1RT4A 3SQ2A 1FKOA 3CQ8A 2QKKA 3TARA 2BE2A 4HCCA 4N76A 3WNEA 4KREA 3IG1A 3OYKA 3PX6A 2YNFA 2OPRA 3KIOA 4KKOA 3L2RA 1C1CA 4FXDA 1RTHA 1L3UA 3RRHA 1RDBA 4B9MA 2HMIA 4L8RB 4MQ3A 4B08A 4ELUA 4OVLA 4DU3A 4C8KA 3NF6A 2FBTA 3QEIA 1W0HA 3M8PA 4FM0A 2HHXA 4NCBA 3KKRA 4ZTJA 3KK1A 4PA1A 3ZT3A 4ELVA 3AVAA 4EZ9A 3NH0A 4QAGA 2R7YA 4B8AB 1RT5A 2VG5A 3KLFA 1X9SA 1EKEA 1WLJA 4M3WA 3RRGA 2Z1JA 1ZBHA 1F21A 4CGDA 5J2NA 1YTAA 3SUQA 2HW3A 2XY8A 3V1RA 3M8SA 3QETA 3IS9A 1L3TA 4DFJA 1CXQA 4N47A 2W42A 4CGFA 1L3VA 2Z1HA 3RTVA 3ZT1A 1KCFA 4DSJA 2P1JA 4CEOA 4HTUA 3LPTA 2LSNA 1TK5A 1NKCA 2KFZA 3IRXA 3LDSA 1Q9YA 4KHYA 3SQ1A 1EP4A 3NH1A 4PWDA 5C25A 4Q0BA 5C42A 3OYEA 4OPJA 3WNGA 4KHQA 4B8CA 4CJVA 1T7PA 3DLRA 4E3SA 1TV6A 4RW7A 5J1EA 4GW6A 4Y1DA 3QNNA 1WSEA 3THVA 1RT7A 4I7FA 3QEWA 4CEDA 4E7JA 3BDPA 1RTJA 3DLKA 3VQ7A 3DOKA 4KTQA 4C8MA 2IDOA 3G0ZA 4AHCA 1A5XA 3QESA 1CZ9A 4O0JA 2KQ2A 2OPQA 1RBRA 4AHVA 3RMDA 3K5LA 1RT1A 4JRPA 4EZ6A 1S9EA 4OKJA 3K2PA 1A5VA 1JL1A 4FW1A 5HRPA 1U47A 3I0RA 2HHTA 3P5JA 4OPKA 2O4GA 1TVRA 3P1GA 3RMAA 3KKSA 1BISA 4E7KA 1HMVA 1G15A 1SUQA 4DS4A 1KVBA 2HHVA 3C6UA 1RT3A 1BI4B 4KFBA 3AA4A 1HQEA 2X78A 1NKBA 1S1UA 3ULDA 4M3ZA 4FLVA 1CZBA 2KZZA 3HO1A 4CHPA 3RR7A 2E4LA 2OZMA 1A5WA 4O4GA 3ZSVA 3OS0A 4CF9A 1JLEA 1TKTA 4CHQA 4XIUA 3SQ0A 4PY5A 3OVNA 4FW2A 2WONA 1NOYA 4CK3A 4DQRA 1X1PA 2YHBA 4KO0A 3OYIA 4LSNA 3VQCA 2KFNA 3WNFA 1VSLA 3V81A 3L2WA 3EYZA 3TAGA 4F2SA 3DRSA 3OYGA 1TK0A 4DU4A 3O3FA 3JYTA 3DRPA 3TAFA 4DTMA 1KTQA 1RDDA 4CGGA 4BACA 4DQPA 5FROA 1DLOA 1TKZA 4W5TA 4FJMA 5CZ2A 1K6YA 2QXFA 3G10A 1X9WA 2XRIA 4NYFA 3LANA 4CF0A 5KRTA 3OS2A 1QE1A 1VSMA 2VWKA 2Y1JA 1JLQA 2RKIA 3K5NA 4C8NA 4CJ3A 3O3HA 1B9FA 4BE1A 4KI4A 3OJUA 3T1AA 3M8RA 3HSTB 2EHGA 4WE1A 1UA1A 4FJKA 4HUEA 4IFYA 2OA8A 3QLHA 1KFDA 5J2QA 1NK7A 1S9GA 3MAQA 1VSHA 3HP9A 4HUGA 2PYJA 1UWBA 4CEQA 1HNVA 1VSDA 1HYVA 3H08A 4LH4A 3SV4A 4ZTFA 2A1RA 4BDPA 4DFMA 1JXBA 3SZ2A 4LH5A 4Z4GA 1KLNA 1U45A 1XWLA 3A2FA 3S3MA 2B4JA 4FJ5A 3HM9A 1IH7A 4H4OA 3NF8A 3VQBA 1HJRA 4FK2A 1DTQA 2VG6A 2VWJA 3AO1A 4IG0A 3I8DA 1LWFA 1Q8IA 4DSFA 4B9TA 2IAJA 1IO2A 5EU7A 1RBSA 3VQ6A 4E1MA 4UQGA 3K5MA 1NJXA 4NYNA 3TAEA 3L3VA 3PO4A 1IKYA 4CGJA 2P5OA 4M3XA 4HVJA 4RG8A 3HL8A 2G8UA 1BIZA 3CFOA 3OYJA 1S1VA 1JKHA 3JSMA 4Z4HA 4E7LA 2O4IA 3OYLA 5CZ1A 3V1OA 4DSEA 3SI6A 4JS5A 2YHAA 2G8WA 1I39A 4G1QA 3MEDA 5KI6A 4CFCA 3CFPA 4DTXA 3KD5E 1Z26A 3KLHA 4CK2A 3L2UA 2F8TA 3L2VA 5HLFA 3AO4A 3AO5A 4DTSA 3EY1A 1QTMA 4ID1A 4CJRA 1ASVA 4FYDA 1HQUA 4DQQA 2RF2A 4CHOA 4QOZB 3C6TA 4AILC 1WSGA 1MU2A 1NJYA 2FBYA 1Z25A 3S3NA 3QEVA 3SYZA 4BWJA 2XY6A 3SJJA 2Z1GA 4KAZA 3DLGA 4GMJB 1VSFA 4LD0A 4AHUA 2DFHA 4KTWA 4CEZA 1ZBLA 3ZSYA 4B9SA 3SQ4A 1TKXA 4F2RA 5K14A 3PV8A 4CIGA 5CYMA 3KTQA 2DY4A 4W5RA 1LWEA 4KHSA 3MEGA 4H8KA 4DS5A 2B6AA 3HXMA 2GV9A 3VN5A 1S1XA 4NCAA 4CJKA 4FCYA 2YNIA 4CJWA 4ELTA 3DM2A 2HHUA 4E89A 4FJ9A 1LW0A 4CJ5A 3PX0A 2BDPA 3C94A 3ZT0A 3OYNA 4OGEA 3KK3A 3LP1A 1S6PA 3NH2A 2E6LA 3AA5X 3OYBA 4B9UA 1JXEA 4F8RA 4W5OA 2YNGA 2ZE2A
chains in the Genus database with same CATH superfamily
2CGKA 5FDLA 1LOTB 4A2BA 5BRFA 3QMLA 4ID5A 1IBLK 4JKDA 4FM2A 4G9ZA 2RHKA 2P51A 3ITHA 4CFAA 4LSLA 2HVIA 1NK0A 4DHYA 3LZIA 1SKRA 1OVQA 3FZMA 4FWNA 3ZX0A 3HI0A 4H5VA 4ISEA 3E1YA 3K5OA 4BE2A 5J2MA 5ADXH 4J2DA 3DJCA 3WNHA 4Y1CA 2FSKA 2IOCA 1JLAA 4B9LA 3EO3A 3CJ1A 4H03B 3PIPL 4CZEA 1S5JA 4IOCL 1KVCA 3GDQA 1SL1A 4CECA 4KH4A 1NGAA 4YOWA 1DTTA 4CFBA 1RTDA 3CCSN 1NJIO 4FPAA 1JLCA 2A5XA 4CJLA 4DSKA 4BGAA 5EY4A 2HOEA 1S1TA 4EFHA 4OX9K 2OYQA 3U3GA 3FR0A 2IVOA 3MECA 4C8LA 5E84A 1GLBG 4DTNA 3CD6N 1BQMA 3LDLA 3QIOA 4JI4K 4QS9A 2ZM6K 1KFSA 3M5RA 4IEEA 2ZJRL 3NHGA 1YI2N 4F3OA 4YDUC 1XNRK 3VQ9A 1DEJA 2X74A 5M1NA 4WQ4C 4YFUA 4WCEL 3D2FB 2VG7A 1WOQA 4YOVA 2P9SA 2F8SA 5M1OA 1E4GT 3FGUA 4OJRA 3K58A 2QWMA 1ATSA 1KLMA 3D2EB 4M45A 1UOCA 4K8ZA 3HP6A 4RW6A 4BDZA 3VQPA 3O4NA 4KPYA 5SWMA 3PY8A 3MK6A 5KGXA 4CZLA 2PBDA 2QW9A 4CE9A 1IBKK 4Z94A 3L8BA 3QEXA 4H5NA 4N56A 3ATVA 3CQYA 3H45C 3TSQA 3KLGA 1Q81O 3AVBA 4F3TA 1YVUA 3DXMB 4IZ9A 1WSIA 4B3OA 1FKPA 1BG3A 3ZT4A 3J80O 2F9TA 1GLEG 4CF1A 4B9QA 3ALYA 3L3UA 3VQQA 3MEEA 4FJ8A 1VSEA 2DFFA 3GE1A 1M90O 4DTJA 4DLEA 3SPYA 1N6QA 3LM9A 5GIPA 3F9KA 4IBNA 5KPTA 5GAHP 3EEQA 2E88A 3UB5A 3MN9A 5JLHA 4GVMA 2QWLA 3OS1A 1Q82O 1EXQA 4DQSA 4MO5A 1VRTA 3U9ZA 5AQUA 2GUIA 4JS4A 1VQ8N 4BQLA 4CCHA 4OKEA 3O4QA 4JKGB 4KHNA 1J5EK 2YV0X 4CJPA 1BQNA 5CHIA 3ATUA 4AH9A 4MLHA 4F4KA 4BQZA 3LZJA 5FRMA 1BCOA 4RCHA 3LP2A 3S9HA 4ZHRA 4EHUA 3DAWA 3RWUA 1RCHA 3WQTA 4LF9K 3KK2A 3VA0A 3VQDA 4JKFA 1RT6A 4CJTA 1LV5A 3KVGA 3QB0A 5KTQA 2RPIA 1TUUA 4X65K 1ZBIA 4OGCA 4RW4A 1NK8A 3LAKA 4IKFA 2VYPA 4PQUA 4MDAA 3OYFA 3R3LA 4FJ7A 1J54A 4FJXA 5C10A 4AM7A 4KBOA 2QWNA 3C95A 3SUPA 3ASMA 1VRUA 1WSFA 3A0IX 2I7PA 4I2QA 1TKDA 3ZX2A 4BRCA 5I3UA 3NAEA 4M3TA 2QKBA 3GOIA 2V52B 3TWHA 1JLBA 3V1QA 4OLBA 2YI1A 3DOLA 1D9FA 2D1KA 3KJVA 3E01A 4J2EA 5FPEA 3LL3A 2WOMA 4WYBA 4CGIA 2Z1IA 4DFPA 2QA4N 2P9LB 2A42A 1YHQN 4KHUA 4DSLA 1NU0A 1OH8A 3C6AA 3LP3A 3DMJA 2ATQA 5AQRA 4DR4K 2BGGA 4AF1A 3CJCA 4WQ5A 3K59A 1YIJN 1VSKA 1BGXT 3VEZA 2FSNA 4FVUA 4FZXC 1YVNA 1ASUA 1YJ9N 4GV9A 1RBVA 3TABA 5BN9A 3CMAN 4HHTA 1U49A 5HOOA 4FK0A 4FWRA 2V51B 1RT4A 1FKOA 3P31A 3TARA 3OYKA 4C1NI 4QS8A 2OPRA 4EHTA 3CI5A 2YX6A 4LF4K 3BF3A 4BGBA 4B08A 1K73O 2E1ZA 3BY5A 4ILJA 5KQ8A 3QEIA 2BH1A 3M8PA 4ZTJA 3EL2A 3KK1A 2VCPA 3HOSA 4EZ9A 3NH0A 4QAGA 1RT5A 3RRGA 3ZEUB 5J2NA 2E2QA 3V1RA 4MLEA 4NO7A 1DKGD 4DFJA 2W42A 3RTVA 4BG8A 4DV2K 4HTUA 3LPTA 1TK5A 2KFZA 3IRXA 1Q9YA 3SMSA 3SQ1A 4KHYA 1EP4A 3OYEA 4FSVA 1YF5L 4BRKA 3SK3A 1E3MA 4YORA 3THVA 4IEIA 1MA9B 2WBNA 1D4XA 4DR3K 2OPQA 1NGCA 4AHVA 3K5LA 1RT1A 4JRPA 1S9EA 3FLCO 3K2PA 1GLCG 2A40A 3BEXA 2O4GA 1HMVA 2NZTA 5AQLA 1SUQA 4DS4A 1Q18A 2HHVA 3QFPA 4KFBA 2PFUA 3L0QA 2X78A 1S1UA 3O5BA 3VERA 1ZC6A 4BR9A 3BUZB 1NGIA 1HKBA 2NRXA 4H0YB 1KAXA 4CF9A 1EWRA 4CHQA 3OVNA 5HL7L 3J81O 3O08A 4FW2A 2WONA 3R9PA 5MLCQ 2WTUA 4IJNA 1SAZA 3E66A 3JS6A 3JYTA 3TAFA 4DTMA 1RDDA 3A5LC 4EIAA 5BR9A 3OA9A 4BRHA 4DQPA 1TKZA 2Q0UA 5CZ2A 1N8RO 2QXFA 1X9WA 4NYFA 2GWKA 5KRTA 2IVNA 1GLAG 5GIOA 1VSMA 4DR7K 3HSCA 4E1JA 2RKIA 4DV7K 3O3HA 1B9FA 3C6HA 3THYA 3OJUA 1VQ5N 3HSTB 2EHGA 4WE1A 3L4IA 4FJKA 4FWLA 4HUEA 3ENHA 2E2PA 3O80A 3N4QA 1V4TA 1VSHA 4I6MA 1HNVA 4Y0WA 3H08A 1ATNA 4BDPA 3IFRA 2PAVA 3SZ2A 4LH5A 1TYQB 3SJHA 4FJ5A 1IH7A 5TKWA 5M1QA 3A5OC 3NF8A 4H4OA 4B3MK 1Q8IA 5AQFA 5EU7A 3VQ6A 4E1MA 4JKCA 3T7ZA 4JK8A 2G8UA 1BIZA 1NGJA 2P9PA 3V1OA 3SAFA 4DSEA 4JS5A 3VF2A 4M7XA 3MEDA 3WXIA 4JYAK 1Z26A 3L2UA 3CPEA 2F8TA 3L2VA 2CH5A 1QTMA 4DTSA 4FYDA 3RSEB 3L6QA 1MU2A 3ZETA 2FBYA 1QHAA 3SYZA 4BWJA 1KC8O 2Z1GA 4GMJB 3SQ4A 4CIGA 4W5RA 4X66K 3MEGA 4YDUA 3SAGA 2B6AA 5EX5A 5JICA 2YNIA 2E1YA 4BVOA 3FE1A 3ENOA 1R59O 2O8CA 4CJ5A 3ZT0A 4B9UA 5AQYA 4F8RA 3QNOA 5AQSA 4X62K 5JS2A 2B5JA 2QI2A 4DTOA 5FRNA 1N36K 3VOVA 3DLBA 2GX9A 4KH6A 3O9QA 4KB1A 5KPRA 3V9XA 4HCBA 3QICA 1YJWN 2YJFA 1VQON 4B3SK 3HBTA 3DYAA 4M3UA 4K41A 1NNEA 3ZSQA 5JS1A 2O8FA 4EAHD 4JRQA 3F2KA 3BP8A 3CIPA 5E26A 1S1WA 1VSJA 4IG3A 3MN5A 2YJEA 4CHNA 3WXLA 4I2PA 4BRPA 3VMFB 1IKXA 3NFAA 3AVFA 2HBMA 5M1FA 4DV0K 3WXKA 3AAPA 1OH6A 3HYFA 4BRMA 1WSHA 2PZSA 3CCMN 1RBTA 4X64K 2KTQA 3ZSRA 3U8XA 4DTPA 4JEPA 1HUXA 4O55A 4AHSA 1VAZA 3NGIA 3SAHA 3WUHA 1P8ZA 1HX1A 2NLXA 1V4SA 3IKMA 3BGRA 2FF3B 3NE6A 3ULEA 3TSPA 3SLCA 4PHTX 2G8HA 3NVKA 3WXJA 5LL6Z 3SBTA 1NG9A 4DB3A 3HPHA 5A2QO 4JK7A 4H0TB 4O0IA 3L2QA 5J2PA 1NGBA 3P4IA 4CHYA 3I0SA 4K42A 4B1YB 4CEAA 4E1NA 4LFAK 5DK5A 4C8OA 2E8AA 4JD2A 1WUAA 5E41A 3WXMB 3ZSXA 2WC9A 4RW9A 5BREA 1HNWK 1TAQA 1UAXA 3CC2N 3IUCA 3VQ5A 1YT3A 5AQVA 4JI2K 3DLHA 3QINA 3OW2M 3CJBA 1EO1A 1JCFA 3UKRA 1ATRA 3G25A 4H0VB 3A8YA 1C6VA 2HBLA 3LDQA 3R6MA 1XHZA 4PUOA 5AQOA 4B1UB 2IVPA 4KTZA 3PIOL 3B6OA 4CD1A 4FLZA 3ZLJA 3CC7N 2Q3SA 1RTIA 4Q5VA 1WN7A 2VWBA 1IKWA 1BCMA 1EWQA 3FFKB 4XH4A 2PY5A 3F73A 3VEVA 3HOTA 2UUAK 4A2AA 4CFDA 4CD3A 2ZGZA 5HRRA 1S3XA 4WFBL 1QHTA 2D0AA 5BPLA 4RWTA 4C23A 3SCXA 4NCGA 4MFBA 5HBMA 5DM7L 3OYHA 3VEYA 2OPSA 4CJUA 5C12A 1K8KA 3QO9A 4CF8A 4L3QA 4CBUA 3HVTA 3SV3A 1VQ4N 4H5RA 1E4FT 3K9JA 1QVFM 4CZHA 4CZJA 3PX4A 4CERA 1NWKA 2XO7A 1RGIA 1TGOA 5HRNA 4YHHK 3KLEA 4E0DA 4DQ8A 2YCHA 4NXNK 1TL3A 3K57A 1QSLA 2F9WA 1NJWA 4DU1A 3OTOK 4B3RK 3LP0A 4FM1A 1VSIA 4E7IA 4FLUA 3TR8A 4CESA 2HNDA 5TKYA 1JCEA 3AA3A 1FK9A 3CCLN 3MDQA 4J2BA 4H0XB 3QERA 4BY9C 2A1SA 1TUYA 1T8EA 4DWIA 4IOAL 3AVHA 4BE0A 3VQAA 2G8IA 1LCUA 3H6EA 4Z4IA 3A5NC 4CJ7A 2BANA 4FJHA 3D0PA 1NGGA 1U48A 2GELA 1GLJO 4DG1A 1VQKN 3PO5A 1HNIA 2F96A 3L4QA 1L5UA 3G6EN 4FLYA 4IFVA 1LAVA 1XC9A 1GOAA 3CCVN 4DTRA 4ILGB 3AVJA 4H4MA 2O8DA 5F0XA 1SKWA 1KSPA 1QQCA 3ID6A 4BVPA 3C7NA 4AQYK 3THYB 1BWFO 3QEPA 4ISGA 3QIPA 5C2DA 1HYSA 4JHDA 3VF4A 2O8EA 3EZWA 1JL2A 4CIFA 4CZKA 3O9SA 3CHWA 4M3YA 2W41A 2FBVA 2ZD1A 5JVGL 3PLAA 2XHBA 4BRIA 4KREA 4CZIA 3PX6A 2JWKA 3G4SN 4NB4A 3QFUA 4GY2B 1RDBA 2HMIA 4BRGA 1BA0A 4C8KA 1W0HA 4NCBA 3ZT3A 4LC9B 3AVAA 4F9OA 4B8AB 2R7YA 4GV3A 1EKEA 1WLJA 3THXB 2Z1JA 2OTLN 4YOYA 4LF8K 1IV0A 1F21A 3KK7A 3WEEB 3SUQA 3M8SA 3QETA 3IS9A 1L3VA 2Z1HA 3CJ7A 1KCFA 5DM6L 4DSJA 5GINA 4BR7A 4JV5K 2P9IA 1NKCA 2A41A 3CJAA 3LDSA 5FPDA 4B1ZA 3NH1A 4PWDA 1NMDA 2HBKA 3WNGA 4E3SA 1TV6A 3EE9A 4RW7A 4GW6A 4Y1DA 3QNNA 2O8CB 1RT7A 3QEWA 3BDPA 4LF6K 1RTJA 5EXWA 3DOKA 4ILHA 3G0ZA 4KH5A 1A5XA 3VEXA 1Q7YO 3S41A 4O0JA 3RMDA 2P9KA 3HM8A 1A5VA 3CETA 3U9DA 3RMAA 1YJNN 3PSIA 1KVBA 5F2RA 3C6UA 1RT3A 3AA4A 2KZZA 3HO1A 3RR7A 4BC4A 2E4LA 5AFUA 2OZMA 3OS0A 1P90A 2O8FB 1TKTA 1SZ2A 4XIUA 3R1XA 4CK3A 4DQRA 2NRWA 2YHBA 2KFNA 4F2SA 3EYZA 3MCPA 3TAGA 2E5LK 1KTQA 4CGGA 4BACA 5AQQA 5FROA 4FJMA 1U2VA 3OS2A 3GG4A 2VWKA 4GVEA 5AQPA 5IWAK 4LF7K 4KI4A 3M8RA 2OA8A 1KFDA 5J2QA 2A6AA 1S9GA 4IXCA 3MAQA 5FPNA 1U6ZA 3JAMO 3EE8A 4FWQA 3TU5A 1JXBA 3A2FA 3ULEB 1N33K 1BDGA 1HJRA 4FK2A 1WBBA 3I8DA 4B9TA 3GL1A 3TTDA 2Q2RA 1VQ6N 1IO2A 3CC4N 4XH5A 1S72N 2WFBA 3PO4A 4M3XA 3L3VA 1IKYA 4DUZK 3HL8A 4XEIA 3I33A 4FL9A 3JSMA 3OYLA 3I56N 3FZFA 4DCHA 2YHAA 4JD2B 4CK2A 3RVCA 1SQKA 5HLFA 1VQ9N 3AO5A 4H0PA 4ID1A 4K25A 1HQUA 2GTDA 3M1FA 4AILC 2HBJA 3LDOA 2AA4A 1NJYA 3QEVA 2XY6A 4AHUA 2DFHA 4KTWA 3UKRB 1J6ZA 2QEXN 4F2RA 5BPNA 5K14A 3PV8A 2UUBK 4CBXA 3VN5A 4NCAA 4QS7A 2HHUA 5C0YA 5AQHA 1LW0A 2GEMA 3C94A 4OGEA 3LP1A 3CF5L 3OYBA 4W5OA 5KPZA 1VQNN 3MXJA 1QS4A 4QCLA 2IS3A 3LM2A 2Y1IA 1BIUA 4FJLA 4RW8A 3HRGA 2A3ZA 3TSUA 3IDHA 3C0BA 4C1NK 4KHWA 3IAYA 1RNHA 3DRRA 3CFRA 4B1XB 1NOZA 1GOCA 3AVGA 3EKUA 3VQEA 1BI4A 2BUPA 3A5MC 4DF8A 3CM6A 4DLGA 1J9AA 1QQNA 5C24A 4DV6K 5AQNA 3FFIA 4CEFA 1KVAA 2KKZA 1K8KB 4A61A 4H5WA 3RMCA 1QVGM 4FWPA 2OANA 4BC2A 2IC3A 3B8AX 1J5OA 2XY5A 1XNQK 3NGYA 1RILA 1EX4A 3EKSA 4OLAA 1JLFA 1W2BM 3ZCMA 3VEOA 3MX5A 2HHQA 4BC3A 5ADXA 4JAXA 3MN7A 3OYMA 5JMVA 4DSIA 5EOYA 5AQWA 5AQGA 4DV1K 2YNHA 2NRVA 2HNYA 4BROA 3KD1E 2O8BA 4V19S 2X6NA 4FZYA 1YTUA 3AGRA 1O1WA 2W6LA 5AQXA 2ITMA 3O3GA 4K8XA 4M63C 3CYMA 1ITGA 3LWMA 2H3GX 4FJNA 3SUNA 4PL8A 2V7YA 5AQIA 1C1AA 2Q36A 2OPPA 2IIRA 1QZ5A 4BWMA 3VEWA 1T03A 4CZFA 2W40A 3AVKA 3MX2A 1ESVA 3NF9A 5LJVA 2HMPA 4M3RA 1XQSC 2P9SB 1IKVA 4BR2A 1CXUA 1C0UA 4TSXA 3UIQA 1Z05A 1U04A 1WAFA 4CBWA 4FVMA 4PKIA 5AJ3K 3AV9A 4JI1K 4DR6K 2D5RA 3C7NB 2G8KA 1Q9XA 2G8FA 3DI6A 1HYZA 2PYLA 2DFEA 2HNZA 2RN2A 4JHDB 2QTDA 1IBMK 2O8EB 3DXMA 1T05A 5GAGP 3PSFA 1RDCA 2QK9A 5HROA 4PL7A 5FLXO 3SUOA 4CEBA 3CERA 3E9LA 1DGKN 3V9UA 4E19A 3MN6A 2FBXA 4LY7A 3B6PA 4HUFA 1KD1O 4GKJK 5H1SQ 4FJJA 2P5GA 2JLEA 1REVA 4YNQA 5C2FA 3SBGA 3ZT2A 4CIEA 4CK1A 2GBZA 1Q86O 1I94K 4OO1J 3VF6A 2YHXA 2E2OA 1J53A 2CH6A 4BRQA 5DMRA 4CJ4A 1SKSA 1IJJA 4J8FA 1GLDG 3O1BA 4FLXA 3ID8A 2D0OA 3LWLA 1B9DA 2KLAA 3SPZA 1YUWA 1OKJA 1OVYA 1R0AA 4DR2K 2P9IB 2KW4A 3V9ZA 1T6DA 4AHRA 1X9MA 3P83D 1ILYA 2ZF5O 5I42A 3HVRA 3RMBA 2VGNA 3AVLA 4RTFD 2V7ZA 3LAMA 4IDHA 4LFCK 3TI0A 1T3VA 2P9KB 1ASWA 2FF6A 3RR8A 1S6QA 3TAQA 1NKEA 4M41A 2CGLA 3VTIA 1LWCA 1TK8A 3WQUA 4O8UA 5LMNK 5M1KA 3H3NO 4U67L 1FW6A 4DTUA 3MMVA 2X6SA 4WFNL 3OY9A 3V4IA 2E6MA 2KZMA 4FWSA 4JI0K 1MWKA 3T1YK 4FLWA 1NJZA 1IG9A 4CHZA 1VK0A 3D7EO 4KB0A 3G71N 4PKHA 4JI6K 5AQZA 5AQMA 3DLLL 1D5AA 3ZSOA 2Q97A 2ZJQL 4M42A 2D0PA 2NRHA 4LF5K 1YAGA 1BHLA 3H1QA 5B8HA 1OH5A 4Z4CA 3THWA 3P38A 1U2VB 4W5QA 5AZIA 3ZSZA 1GLFO 1C1BA 4CJEA 4KRFA 1FXXA 2KHOA 1CLQA 2UXDK 3NMUA 5I9EB 1EETA 4FLTA 5IT9O 3J7AP 3TPQA 1L3SA 1N34K 1QSSA 2EX3A 3LPUA 2YHYA 4E7HA 1KAZA 1KRPA 4B9VA 3EZ5A 4EP5A 4BDYA 3HPOA 3SQ2A 3CQ8A 4N76A 4HCCA 3IG1A 3MWPA 4FOIA 3JXUA 3KIOA 1IG8A 4CVNE 4FXDA 3RRHA 2FSJA 4BRFA 4CZMA 4B9MA 2FLOA 4L8RB 3QBWA 4ELUA 3H46O 4OVLA 3NF6A 2FBTA 2HHXA 3KKRA 3DXKA 4PA1A 4ELVA 3KLFA 1X9SA 4M3WA 4BR0A 3K0SA 3J7YP 1ZBHA 1NGEA 4CGDA 2J4RA 4BRDA 1YTAA 2CGJA 2HW3A 4HWIA 2E2NA 2XY8A 2Q1NA 3VESA 4O8KA 3CJ9A 4N47A 5C15A 1YXQA 4CGFA 4BG9A 4JKAA 4BRLA 3KZBA 3U4LA 1NGFA 2P1JA 4CEOA 2LSNA 1MDUB 5ELZA 2GUPA 5C25A 4Q0BA 4WF9L 4OPJA 4KHQA 4CJVA 1T7PA 3DLRA 3WT0A 5J1EA 1OH7A 1NGDA 1KAYA 4E7JA 4C8MA 2IDOA 4AHCA 1CZ9A 4JKBA 2KQ2A 1RBRA 3VPZA 4A57A 4EZ6A 1JL1A 1U47A 2HHTA 3P5JA 1TVRA 3CCEN 1BISA 1G15A 1C0GA 3D6RA 3MCAB 2F7TA 1BI4B 4H0OA 3ULDA 3O9UA 1Y64A 4M3ZA 4CHPA 2HSTA 3BF1A 4BRAA 3ZSVA 3M3ZA 2I7NA 2OCEA 1JLEA 3SQ0A 4LFBK 1NOYA 4PKGA 4IFEA 4KO0A 1Z6RA 4LSNA 3OYIA 3V81A 1VSLA 3VGMA 2P9UA 3OYGA 4DU4A 3UE5A 4NLCA 2ZWHA 3HTVA 1DLOA 2FXUA 1K6YA 3G10A 2XRIA 3H3OB 5EVZA 2UUCK 2QXLA 4DUYK 4K43A 1HKGA 3T69A 1JLQA 1VQLN 4C8NA 2W6KA 3T1AA 2O8BB 4IFYA 2BTFA 3HP9A 4JI3K 1TYQA 2A1RA 3FZLA 3S3MA 3M6GA 2B4JA 3LDPA 4I6MB 3HM9A 1DTQA 2VG6A 3AO1A 4IG0A 4DKWA 3K5MA 4UQGA 3EN9A 4CGJA 2P5OA 2Q31A 1RFQA 2ZJPL 3OYJA 5AQJA 2NNWA 4A62A 1HKCA 1I39A 1NM1A 4DV4K 4DTXA 3RSEA 3CFPA 3KD5E 2P9PB 3AAQA 1HLUA 3EY1A 4CJRA 1ASVA 1CZAN 4DQQA 2RF2A 4CHOA 1WSGA 1Z25A 3SJJA 3OHRA 4B1VA 4CW7B 4KAZA 3DLGA 1VSFA 4LD0A 4B9SA 4CEZA 4JKHA 5AQTA 3ZETB 5CYMA 3KTQA 1LWEA 4H8KA 4DS5A 1VQPN 2GV9A 2HF3A 4FCYA 1X3MA 3KHYA 4E89A 1NMNA 3PX0A 2BDPA 2JWLA 3NVMA 4IWVA 3KK3A 1HJOA 2E6LA 1JXEA 4KTQA 4Z4EA 2YNGA 2ZE2A 1BOTO 1GLLO 4CZGA 3E9PA 3U3YA 4MO4A 4N5SA 3QBXA 3QDKA 1Y97A 4FJIA 5KRSA 4YY3K 3CCRN 3NBPA 4DFKA 1U4BA 1QSYA 2OZSA 4O44A 1RBUA 2ETJA 1K9MO 1D9DA 1HNXK 1GOBA 1BL3A 3HT3A 1B92A 3ZYYX 3FZHA 4BR4A 3S3OA 1RDUA 2ITGA 3W0LA 3K9KA 2ZQBA 3VQ4A 3OJSA 2FC0A 1H1VA 3PUFA 4FWKA 1ZBFA 4JLHA 4JNEA 4GNIA 4Z0UA 3VQ8A 3NCIA 3KLIA 1T6CA 5CE3A 1UA0A 3OYCA 1RDWX 3AGKA 1ZYQA 3LALA 3KWGA 1HPMA 2AJQA 2P9NA 4B3TK 1N32K 3VGKA 5GAEP 2ASMA 1XHXA 3E9OA 1T44A 1VQMN 1WSJA 4BR5A 5AZJA 1TAUA 3M8QA 4DF4A 3AO2A 5AQKA 4BRNA 2I5JA 2NUBA 1VQ7N 4XH1A 5FPMA 4NXMK 1W7AA 4A59A 3VA3A 1NK9A 5JLFA 4CI6A 3CMEN 3AY9A 5JVHL 3T3FA 3HK2A 3AVNA 3O9TA 1O13A 2HHWA 4ISFA 1ZXOA 4O5BA 3THWB 5AZIB 3SNNA 4I9QA 2D0BA 4CEEA 4DR5K 4FJGA 5CYQA 4O5FA 4KV8A 3CXCM 3U6FA 1LAWA 3F5TA 1SL0A 1NK6A 1K8AO 4JI8K 1DT9A 1TL1A 3W3DA 1BO5O 4IO9L 4KI6A 2JGUA 1HRHA 3UKUA 4AHTA 3VENA 4M7YA 2GWJA 4CGHA 1C0TA 1RT2A 4R5PA 1VHXA 1XI1A 5HRSA 5AR0A 3NF7A 4OPAA 4FPBA 3AO3A 4N41A 3BZCA 1W9HA 2DTUA 4DMNA 2UU9K 1LW2A 4JN4A 3ZSWA 3HJFA 2DPNA 3DXKB 4FO0A 1YITN 4CJFA 3VTHA 3Q7CA 4CF2A 1N5YA 4J2AA 4FZZA 3NGZA 3AVMA 2OTJN 2XY7A 3NDKA 1NK4A 3DLEA 3V9SA 1NK5A 3HPGA 1W97L 2UXCK 3GBTA 3ISNC 3AA2A 1WAJA 2D0CA 4B9NA 5M1PA 3CG7A 5HP1A 1RDAA 2VQEK 4ICLA 5KGWA 4DQIA 4AM6A 4JKEA 3MXMA 3H1VX 1NGHA 3Q7BA 1WNSA 3CPWM 3MXIA 1BUPA 3IMXA 1WB9A 1SL2A 2HHHK 3VETA 5D3GA 1JCGA 4KHPK 4WFAL 1WBDA 3TAMA 2HB5A 4CJQA 4CJSA 1JLGA 2E20A 3TTCA 1SV5A 1I3AA 4IJAA 3O6WA 4I9LA 1ZBUA 2YKMA 4YOUA 4OKKA 1M1KO 2HHSA 1BA1A 2VGMA 1D8YA 3N4PA 4JI5K 3V6DA 3FZKA 3AVCA 3D2FA 3T19A 3I55N 3VGLA 3TANA 5CY4A 1QQMA 3O1WA 2P9UB 4NLBA 3ENBA 1G99A 3C65A 1X3NA 5T7BA 5SZTA 4OPHA 3TAPA 2NRTA 3OYAA 3D2EA 3V9WA 1X9JA 1HPZA 2QWOA 2AP1A 4EP4A 3OYDA 3F9MA 4W5NA 3AVIA 1BU6O 4Z4FA 4DR1K 2YKNA 2O8DB 2G8VA 4IDKA 4DV5K 4B1WB 5KQDA 3CM5A 4IO8A 3D45A 4JK9A 2IGIA 4H5TA 4FK4A 2HVHA 1C0MA 4GKKK 1S22A 3T1HK 2QWRA 3O8MA 2QKKA 2BE2A 3WNEA 1EQYA 2YNFA 4KKOA 3L2RA 1C1CA 1RTHA 2RE2A 1L3UA 3CCUN 4MQ3A 4DU3A 2NRZA 3J7ZO 4HTLA 4FM0A 3THXA 1XMOK 3WEEA 2VG5A 3CCJN 4UY8O 2EWSA 1SS6A 1L3TA 1CXQA 2Q0RA 4JKGA 3ZT1A 5BRDA 1KQSM 4WQ4A 5C42A 1QQOA 4B8CA 2NRRA 1WSEA 2UXBK 4I7FA 4CEDA 3DLKA 3VQ7A 5LMUK 3J8AA 3QESA 5AFUH 4JI7K 2YHWA 4OKJA 4FWMA 4R79A 3SMPA 4WQ5C 4FW1A 5HRPA 3I0RA 4OPKA 4YOTA 4YOXA 3P1GA 3KKSA 4E7KA 4GV6A 1HQEA 1NKBA 3CQXA 4FLVA 1CZBA 1MWMA 5LY3A 1A5WA 4O4GA 1XC3A 4PY5A 3ZX3A 4BC5A 1X1PA 1NLVA 1HNZK 3VQCA 3WNFA 5BR8K 3L2WA 3DWLA 3DRSA 1TK0A 3R8EA 3O3FA 3DRPA 4IOXA 2P9LA 4A5BA 4A5AA 1NBWA 4W5TA 2VQFK 3KWIA 3LANA 4CF0A 1QE1A 2P9NB 2Y1JA 3K5NA 4CJ3A 4BE1A 1KXPA 1ZBSA 4BREA 3TTFA 1UA1A 3CCQN 5F1XA 2HF4A 5BPMA 3QLHA 1HR0K 1NK7A 2D4WA 5GADP 5AZJB 2F4VK 2QWPA 2ASPA 4HUGA 2PYJA 1UWBA 4CEQA 1VSDA 1HYVA 1XUPO 4LH4A 3SV4A 4ZTFA 4DFMA 2UYTA 4Z4GA 1KLNA 1U45A 1XMQK 1XWLA 4FWOA 3LDNA 5BRHA 3VQBA 3O9RA 2VWJA 4DSFA 1LWFA 4MDBA 2IAJA 3MWTA 1RBSA 1NJXA 4NYNA 4DV3K 3TAEA 4HVJA 4RG8A 2QWQA 3CFOA 1S1VA 1JKHA 1C0FA 2WUSA 4Z4HA 4E7LA 2O4IA 5CZ1A 3SI6A 5LJWA 3OBWA 2G8WA 4G1QA 5KI6A 4CFCA 2ASOA 3KLHA 1QZ6A 3I8BA 3AARA 3BZKA 3AO4A 4FOEA 3ZEUA 4QOZB 3C6TA 2ZGYA 3S3NA 3P39A 1ZBLA 3O4WA 3ZSYA 1TKXA 3OBYA 3UKUB 2QM1A 2DY4A 1FJGK 4KHSA 4K0KK 3HXMA 1S1XA 4CJKA 4CJWA 4ELTA 3DM2A 5CR4A 4FJ9A 3HZ6A 4U7BA 3OYNA 5BN8A 1S6PA 3NH2A 3AA5X 1JJ2M
chains in the Genus database with same CATH topology
5FDLA 3QNOA 3MXJA 5JS2A 1QS4A 2B5JA 4DTOA 4ID5A 4QCLA 2IS3A 5FRNA 3U3YA 4FM2A 1BIUA 2Y1IA 3DLBA 4N5SA 4FJLA 4RW8A 1Y97A 2P51A 4FJIA 4KB1A 3ITHA 5KRSA 4CFAA 4LSLA 3V9XA 4HCBA 4KHWA 2HVIA 1NK0A 3NBPA 3IAYA 3LZIA 4DFKA 1RNHA 1U4BA 1QSYA 1SKRA 2OZSA 3DRRA 3CFRA 4O44A 1NOZA 1RBUA 2ETJA 1GOCA 3AVGA 1D9DA 3VQEA 4FJXA 1BI4A 4DF8A 1GOBA 3CM6A 1J9AA 3DYAA 3K5OA 4BE2A 4DLGA 5J2MA 4M3UA 4J2DA 5C24A 1BL3A 3WNHA 4Y1CA 3HT3A 3FFIA 1B92A 4CEFA 1KVAA 2IOCA 3ZSQA 1JLAA 5JS1A 3S3OA 4B9LA 2ITGA 4JRQA 3RMCA 1S1WA 1VSJA 2ZQBA 4IG3A 3VQ4A 3OJSA 2FC0A 2IC3A 1S5JA 1J5OA 2XY5A 3PUFA 1KVCA 1RILA 3NGYA 4CHNA 1ZBFA 1EX4A 4JLHA 4OLAA 1SL1A 4I2PA 4Z0UA 4CECA 1JLFA 3ZCMA 1IKXA 1DTTA 3NFAA 3VQ8A 4CFBA 3NCIA 3KLIA 1RTDA 2HHQA 3AVFA 1JLCA 1UA0A 4CJLA 4DSKA 3OYCA 3OYMA 4DSIA 1ZYQA 1S1TA 3LALA 2AJQA 3HYFA 2OYQA 1WSHA 2PZSA 3U3GA 1RBTA 2YNHA 2KTQA 3MECA 3ZSRA 2HNYA 3KD1E 4DTPA 4C8LA 1XHXA 4DTNA 1BQMA 2X6NA 3QIOA 4O55A 4FZYA 1YTUA 4AHSA 1KFSA 1WSJA 3NGIA 1O1WA 1TAUA 4K8XA 3O3GA 3M8QA 3NHGA 4F3OA 3CYMA 1ITGA 4DF4A 3AO2A 3LWMA 3BGRA 3VQ9A 3NE6A 4FJNA 2X74A 2I5JA 3SUNA 4YFUA 2G8HA 2NUBA 1C1AA 2OPPA 2VG7A 4BWMA 2F8SA 3HPHA 3VA3A 1T03A 1NK9A 3AVKA 3NF9A 3L2QA 3T3FA 4O0IA 5J2PA 3HK2A 4M3RA 3AVNA 4CHYA 1IKVA 4OJRA 3K58A 4Z4EA 3I0SA 2HHWA 1CXUA 1C0UA 4TSXA 3UIQA 4O5BA 1U04A 4CEAA 4E1NA 1WAFA 1KLMA 5DK5A 4M45A 1UOCA 4K8ZA 4C8OA 3HP6A 3SNNA 4I9QA 4FVMA 2D0BA 4CEEA 4FJGA 5CYQA 4RW6A 4BDZA 4KV8A 3AV9A 3ZSXA 5E41A 4RW9A 3VQPA 2D5RA 2G8KA 1TAQA 1UAXA 3O4NA 3U6FA 1Q9XA 2G8FA 1LAWA 3DI6A 1HYZA 3VQ5A 5SWMA 1SL0A 1NK6A 1YT3A 2PYLA 3PY8A 5KGXA 3DLHA 2DFEA 2HNZA 2RN2A 1TL1A 3QINA 4CE9A 1T05A 3QEXA 3L8BA 4KI6A 2JGUA 1RDCA 4N56A 1HRHA 4AHTA 1C6VA 4CGHA 2QK9A 5HROA 1C0TA 1RT2A 4R5PA 3KLGA 1XHZA 3AVBA 1XI1A 1YVUA 3SUOA 4CEBA 1SKSA 4F3TA 4PUOA 5HRSA 4B3OA 1WSIA 1FKPA 4KTZA 3B6OA 4FLZA 3NF7A 3V9UA 4E19A 2Q3SA 1RTIA 3ZT4A 3MXIA 4Q5VA 1WN7A 3AO3A 1IKWA 1BCMA 4N41A 2FBXA 1W9HA 4LY7A 4CF1A 2DTUA 4DMNA 3ALYA 3B6PA 4HUFA 3L3UA 3VQQA 1LW2A 3MEEA 2PY5A 4FJ8A 1VSEA 2DFFA 3F73A 4FJJA 3ZSWA 4CFDA 3HJFA 4DTJA 4DLEA 2P5GA 2JLEA 3SPYA 1N6QA 1REVA 4YNQA 5HRRA 4CJFA 3F9KA 3ZT2A 4CIEA 4CK1A 4IBNA 2GBZA 4CF2A 1N5YA 4J2AA 1QHTA 2D0AA 4FZZA 3NGZA 4GVMA 3AVMA 1J53A 2XY7A 3NDKA 3OS1A 1NK4A 5DMRA 3DLEA 4CJ4A 3SCXA 1EXQA 4MFBA 4NCGA 5HBMA 3V9SA 1VRTA 3HPGA 4DQSA 1NK5A 2GUIA 4JS4A 4FLXA 3LWLA 3OYHA 1B9DA 4CCHA 4OKEA 3SPZA 3O4QA 4KHNA 2OPSA 3AA2A 3ISNC 4CJUA 1WAJA 2YV0X 4CJPA 2D0CA 1R0AA 4B9NA 1BQNA 2KW4A 3QO9A 3CG7A 3V9ZA 4CF8A 4AH9A 5HP1A 1RDAA 4F4KA 4ICLA 3HVTA 5KGWA 4AHRA 3LZJA 3SV3A 1X9MA 4DQIA 3P83D 3MXMA 5FRMA 3PX4A 1BCOA 1WNSA 3LP2A 4CERA 2XO7A 3HVRA 3RMBA 3S9HA 5I42A 4ZHRA 1TGOA 3AVLA 5HRNA 3RWUA 3LAMA 1RCHA 3KLEA 1SL2A 4E0DA 1TL3A 3K57A 3KK2A 1QSLA 3VA0A 5D3GA 3VQDA 1RT6A 4CJTA 1NJWA 3TI0A 1LV5A 5KTQA 3TAMA 2HB5A 4DU1A 4CJQA 4CJSA 1JLGA 2RPIA 1ZBIA 4OGCA 1ASWA 3LP0A 4RW4A 1NK8A 3LAKA 4KB0A 4FM1A 4IKFA 1VSIA 3RR8A 1SV5A 4PQUA 1I3AA 1S6QA 3OYFA 3TAQA 4I9LA 1J54A 4M41A 4E7IA 1NKEA 4FJ7A 4FLUA 3TR8A 1LWCA 1ZBUA 4CESA 2YKMA 2HNDA 3C95A 3SUPA 1TK8A 3ASMA 1VRUA 3AA3A 4OKKA 1WSFA 4DTUA 1FK9A 4I2QA 1TKDA 2X6SA 4J2BA 3OY9A 3QERA 3V4IA 2HHSA 5I3UA 2E6MA 2A1SA 3NAEA 2KZMA 1T8EA 4DWIA 4M3TA 2QKBA 3AVHA 3TWHA 1JLBA 1D8YA 4BE0A 3VQAA 2G8IA 4Z4IA 4FLWA 1NJZA 1IG9A 4CHZA 1VK0A 2BANA 3V1QA 3DOLA 3V6DA 3D0PA 3AVCA 3T19A 1D9FA 4FJHA 3KJVA 4OLBA 3E01A 3TANA 4J2EA 1D5AA 1U48A 3ZSOA 5CY4A 2WOMA 4CGIA 4DG1A 2Z1IA 4M42A 4DFPA 3PO5A 1BHLA 1HNIA 5T7BA 2F96A 5SZTA 4KHUA 4Z4CA 1L5UA 4FLYA 3TAPA 4DSLA 4IFVA 1LAVA 1XC9A 1GOAA 4W5QA 3OYAA 4DTRA 3ZSZA 3LP3A 3AVJA 3V9WA 1C1BA 4H4MA 4CJEA 1SKWA 1KSPA 4KRFA 1FXXA 3DMJA 1HPZA 2ATQA 4EP4A 1CLQA 1QQCA 3OYDA 2BGGA 4W5NA 3AVIA 4Z4FA 2YKNA 1EETA 4FLTA 2G8VA 4IDKA 3QEPA 3K59A 3QIPA 1VSKA 1HYSA 1BGXT 4FZXC 1JL2A 4CIFA 3CM5A 1ASUA 1L3SA 1QSSA 4M3YA 2EX3A 3D45A 3LPUA 1RBVA 2IGIA 4E7HA 3TABA 4KPYA 4FK4A 1KRPA 2ZD1A 2FBVA 4B9VA 2HVHA 4HHTA 1C0MA 1U49A 3EZ5A 4EP5A 4BDYA 4FK0A 2XHBA 3HPOA 1RT4A 3SQ2A 1FKOA 3CQ8A 2QKKA 3TARA 2BE2A 4HCCA 4N76A 3WNEA 4KREA 3IG1A 3OYKA 3PX6A 2YNFA 2OPRA 3KIOA 4KKOA 3L2RA 1C1CA 4FXDA 1RTHA 1L3UA 3RRHA 1RDBA 4B9MA 2HMIA 4L8RB 4MQ3A 4B08A 4ELUA 4OVLA 4DU3A 4C8KA 3NF6A 2FBTA 3QEIA 1W0HA 3M8PA 4FM0A 2HHXA 4NCBA 3KKRA 4ZTJA 3KK1A 4PA1A 3ZT3A 4ELVA 3AVAA 4EZ9A 3NH0A 4QAGA 2R7YA 4B8AB 1RT5A 2VG5A 3KLFA 1X9SA 1EKEA 1WLJA 4M3WA 3RRGA 2Z1JA 1ZBHA 1F21A 4CGDA 5J2NA 1YTAA 3SUQA 2HW3A 2XY8A 3V1RA 3M8SA 3QETA 3IS9A 1L3TA 4DFJA 1CXQA 4N47A 2W42A 4CGFA 1L3VA 2Z1HA 3RTVA 3ZT1A 1KCFA 4DSJA 2P1JA 4CEOA 4HTUA 3LPTA 2LSNA 1TK5A 1NKCA 2KFZA 3IRXA 3LDSA 1Q9YA 4KHYA 3SQ1A 1EP4A 3NH1A 4PWDA 5C25A 4Q0BA 5C42A 3OYEA 4OPJA 3WNGA 4KHQA 4B8CA 4CJVA 1T7PA 3DLRA 4E3SA 1TV6A 4RW7A 5J1EA 4GW6A 4Y1DA 3QNNA 1WSEA 3THVA 1RT7A 4I7FA 3QEWA 4CEDA 4E7JA 3BDPA 1RTJA 3DLKA 3VQ7A 3DOKA 4KTQA 4C8MA 2IDOA 3G0ZA 4AHCA 1A5XA 3QESA 1CZ9A 4O0JA 2KQ2A 2OPQA 1RBRA 4AHVA 3RMDA 3K5LA 1RT1A 4JRPA 4EZ6A 1S9EA 4OKJA 3K2PA 1A5VA 1JL1A 4FW1A 5HRPA 1U47A 3I0RA 2HHTA 3P5JA 4OPKA 2O4GA 1TVRA 3P1GA 3RMAA 3KKSA 1BISA 4E7KA 1HMVA 1G15A 1SUQA 4DS4A 1KVBA 2HHVA 3C6UA 1RT3A 1BI4B 4KFBA 3AA4A 1HQEA 2X78A 1NKBA 1S1UA 3ULDA 4M3ZA 4FLVA 1CZBA 2KZZA 3HO1A 4CHPA 3RR7A 2E4LA 2OZMA 1A5WA 4O4GA 3ZSVA 3OS0A 4CF9A 1JLEA 1TKTA 4CHQA 4XIUA 3SQ0A 4PY5A 3OVNA 4FW2A 2WONA 1NOYA 4CK3A 4DQRA 1X1PA 2YHBA 4KO0A 3OYIA 4LSNA 3VQCA 2KFNA 3WNFA 1VSLA 3V81A 3L2WA 3EYZA 3TAGA 4F2SA 3DRSA 3OYGA 1TK0A 4DU4A 3O3FA 3JYTA 3DRPA 3TAFA 4DTMA 1KTQA 1RDDA 4CGGA 4BACA 4DQPA 5FROA 1DLOA 1TKZA 4W5TA 4FJMA 5CZ2A 1K6YA 2QXFA 3G10A 1X9WA 2XRIA 4NYFA 3LANA 4CF0A 5KRTA 3OS2A 1QE1A 1VSMA 2VWKA 2Y1JA 1JLQA 2RKIA 3K5NA 4C8NA 4CJ3A 3O3HA 1B9FA 4BE1A 4KI4A 3OJUA 3T1AA 3M8RA 3HSTB 2EHGA 4WE1A 1UA1A 4FJKA 4HUEA 4IFYA 2OA8A 3QLHA 1KFDA 5J2QA 1NK7A 1S9GA 3MAQA 1VSHA 3HP9A 4HUGA 2PYJA 1UWBA 4CEQA 1HNVA 1VSDA 1HYVA 3H08A 4LH4A 3SV4A 4ZTFA 2A1RA 4BDPA 4DFMA 1JXBA 3SZ2A 4LH5A 4Z4GA 1KLNA 1U45A 1XWLA 3A2FA 3S3MA 2B4JA 4FJ5A 3HM9A 1IH7A 4H4OA 3NF8A 3VQBA 1HJRA 4FK2A 1DTQA 2VG6A 2VWJA 3AO1A 4IG0A 3I8DA 1LWFA 1Q8IA 4DSFA 4B9TA 2IAJA 1IO2A 5EU7A 1RBSA 3VQ6A 4E1MA 4UQGA 3K5MA 1NJXA 4NYNA 3TAEA 3L3VA 3PO4A 1IKYA 4CGJA 2P5OA 4M3XA 4HVJA 4RG8A 3HL8A 2G8UA 1BIZA 3CFOA 3OYJA 1S1VA 1JKHA 3JSMA 4Z4HA 4E7LA 2O4IA 3OYLA 5CZ1A 3V1OA 4DSEA 3SI6A 4JS5A 2YHAA 2G8WA 1I39A 4G1QA 3MEDA 5KI6A 4CFCA 3CFPA 4DTXA 3KD5E 1Z26A 3KLHA 4CK2A 3L2UA 2F8TA 3L2VA 5HLFA 3AO4A 3AO5A 4DTSA 3EY1A 1QTMA 4ID1A 4CJRA 1ASVA 4FYDA 1HQUA 4DQQA 2RF2A 4CHOA 4QOZB 3C6TA 4AILC 1WSGA 1MU2A 1NJYA 2FBYA 1Z25A 3S3NA 3QEVA 3SYZA 4BWJA 2XY6A 3SJJA 2Z1GA 4KAZA 3DLGA 4GMJB 1VSFA 4LD0A 4AHUA 2DFHA 4KTWA 4CEZA 1ZBLA 3ZSYA 4B9SA 3SQ4A 1TKXA 4F2RA 5K14A 3PV8A 4CIGA 5CYMA 3KTQA 2DY4A 4W5RA 1LWEA 4KHSA 3MEGA 4H8KA 4DS5A 2B6AA 3HXMA 2GV9A 3VN5A 1S1XA 4NCAA 4CJKA 4FCYA 2YNIA 4CJWA 4ELTA 3DM2A 2HHUA 4E89A 4FJ9A 1LW0A 4CJ5A 3PX0A 2BDPA 3C94A 3ZT0A 3OYNA 4OGEA 3KK3A 3LP1A 1S6PA 3NH2A 2E6LA 3AA5X 3OYBA 4B9UA 1JXEA 4F8RA 4W5OA 2YNGA 2ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FDL A;  3QNO A;  3MXJ A;  5JS2 A;  1QS4 A;  2B5J A;  4DTO A;  4ID5 A;  4QCL A;  2IS3 A;  5FRN A;  3U3Y A;  4FM2 A;  1BIU A;  2Y1I A;  3DLB A;  4N5S A;  4FJL A;  4RW8 A;  1Y97 A;  2P51 A;  4FJI A;  4KB1 A;  3ITH A;  5KRS A;  4CFA A;  4LSL A;  3V9X A;  4HCB A;  4KHW A;  2HVI A;  1NK0 A;  3NBP A;  3IAY A;  3LZI A;  4DFK A;  1RNH A;  1U4B A;  1QSY A;  1SKR A;  2OZS A;  3DRR A;  3CFR A;  4O44 A;  1NOZ A;  1RBU A;  2ETJ A;  1GOC A;  3AVG A;  1D9D A;  3VQE A;  4FJX A;  1BI4 A;  4DF8 A;  1GOB A;  3CM6 A;  1J9A A;  3DYA A;  3K5O A;  4BE2 A;  4DLG A;  5J2M A;  4M3U A;  4J2D A;  5C24 A;  1BL3 A;  3WNH A;  4Y1C A;  3HT3 A;  3FFI A;  1B92 A;  4CEF A;  1KVA A;  2IOC A;  3ZSQ A;  1JLA A;  5JS1 A;  3S3O A;  4B9L A;  2ITG A;  4JRQ A;  3RMC A;  1S1W A;  1VSJ A;  2ZQB A;  4IG3 A;  3VQ4 A;  3OJS A;  2FC0 A;  2IC3 A;  1S5J A;  1J5O A;  2XY5 A;  3PUF A;  1KVC A;  1RIL A;  3NGY A;  4CHN A;  1ZBF A;  1EX4 A;  4JLH A;  4OLA A;  1SL1 A;  4I2P A;  4Z0U A;  4CEC A;  1JLF A;  3ZCM A;  1IKX A;  1DTT A;  3NFA A;  3VQ8 A;  4CFB A;  3NCI A;  3KLI A;  1RTD A;  2HHQ A;  3AVF A;  1JLC A;  1UA0 A;  4CJL A;  4DSK A;  3OYC A;  3OYM A;  4DSI A;  1ZYQ A;  1S1T A;  3LAL A;  2AJQ A;  3HYF A;  2OYQ A;  1WSH A;  2PZS A;  3U3G A;  1RBT A;  2YNH A;  2KTQ A;  3MEC A;  3ZSR A;  2HNY A;  3KD1 E;  4DTP A;  4C8L A;  1XHX A;  4DTN A;  1BQM A;  2X6N A;  3QIO A;  4O55 A;  4FZY A;  1YTU A;  4AHS A;  1KFS A;  1WSJ A;  3NGI A;  1O1W A;  1TAU A;  4K8X A;  3O3G A;  3M8Q A;  3NHG A;  4F3O A;  3CYM A;  1ITG A;  4DF4 A;  3AO2 A;  3LWM A;  3BGR A;  3VQ9 A;  3NE6 A;  4FJN A;  2X74 A;  2I5J A;  3SUN A;  4YFU A;  2G8H A;  2NUB A;  1C1A A;  2OPP A;  2VG7 A;  4BWM A;  2F8S A;  3HPH A;  3VA3 A;  1T03 A;  1NK9 A;  3AVK A;  3NF9 A;  3L2Q A;  3T3F A;  4O0I A;  5J2P A;  3HK2 A;  4M3R A;  3AVN A;  4CHY A;  1IKV A;  4OJR A;  3K58 A;  4Z4E A;  3I0S A;  2HHW A;  1CXU A;  1C0U A;  4TSX A;  3UIQ A;  4O5B A;  1U04 A;  4CEA A;  4E1N A;  1WAF A;  1KLM A;  5DK5 A;  4M45 A;  1UOC A;  4K8Z A;  4C8O A;  3HP6 A;  3SNN A;  4I9Q A;  4FVM A;  2D0B A;  4CEE A;  4FJG A;  5CYQ A;  4RW6 A;  4BDZ A;  4KV8 A;  3AV9 A;  3ZSX A;  5E41 A;  4RW9 A;  3VQP A;  2D5R A;  2G8K A;  1TAQ A;  1UAX A;  3O4N A;  3U6F A;  1Q9X A;  2G8F A;  1LAW A;  3DI6 A;  1HYZ A;  3VQ5 A;  5SWM A;  1SL0 A;  1NK6 A;  1YT3 A;  2PYL A;  3PY8 A;  5KGX A;  3DLH A;  2DFE A;  2HNZ A;  2RN2 A;  1TL1 A;  3QIN A;  4CE9 A;  1T05 A;  3QEX A;  3L8B A;  4KI6 A;  2JGU A;  1RDC A;  4N56 A;  1HRH A;  4AHT A;  1C6V A;  4CGH A;  2QK9 A;  5HRO A;  1C0T A;  1RT2 A;  4R5P A;  3KLG A;  1XHZ A;  3AVB A;  1XI1 A;  1YVU A;  3SUO A;  4CEB A;  1SKS A;  4F3T A;  4PUO A;  5HRS A;  4B3O A;  1WSI A;  1FKP A;  4KTZ A;  3B6O A;  4FLZ A;  3NF7 A;  3V9U A;  4E19 A;  2Q3S A;  1RTI A;  3ZT4 A;  3MXI A;  4Q5V A;  1WN7 A;  3AO3 A;  1IKW A;  1BCM A;  4N41 A;  2FBX A;  1W9H A;  4LY7 A;  4CF1 A;  2DTU A;  4DMN A;  3ALY A;  3B6P A;  4HUF A;  3L3U A;  3VQQ A;  1LW2 A;  3MEE A;  2PY5 A;  4FJ8 A;  1VSE A;  2DFF A;  3F73 A;  4FJJ A;  3ZSW A;  4CFD A;  3HJF A;  4DTJ A;  4DLE A;  2P5G A;  2JLE A;  3SPY A;  1N6Q A;  1REV A;  4YNQ A;  5HRR A;  4CJF A;  3F9K A;  3ZT2 A;  4CIE A;  4CK1 A;  4IBN A;  2GBZ A;  4CF2 A;  1N5Y A;  4J2A A;  1QHT A;  2D0A A;  4FZZ A;  3NGZ A;  4GVM A;  3AVM A;  1J53 A;  2XY7 A;  3NDK A;  3OS1 A;  1NK4 A;  5DMR A;  3DLE A;  4CJ4 A;  3SCX A;  1EXQ A;  4MFB A;  4NCG A;  5HBM A;  3V9S A;  1VRT A;  3HPG A;  4DQS A;  1NK5 A;  2GUI A;  4JS4 A;  4FLX A;  3LWL A;  3OYH A;  1B9D A;  4CCH A;  4OKE A;  3SPZ A;  3O4Q A;  4KHN A;  2OPS A;  3AA2 A;  3ISN C;  4CJU A;  1WAJ A;  2YV0 X;  4CJP A;  2D0C A;  1R0A A;  4B9N A;  1BQN A;  2KW4 A;  3QO9 A;  3CG7 A;  3V9Z A;  4CF8 A;  4AH9 A;  5HP1 A;  1RDA A;  4F4K A;  4ICL A;  3HVT A;  5KGW A;  4AHR A;  3LZJ A;  3SV3 A;  1X9M A;  4DQI A;  3P83 D;  3MXM A;  5FRM A;  3PX4 A;  1BCO A;  1WNS A;  3LP2 A;  4CER A;  2XO7 A;  3HVR A;  3RMB A;  3S9H A;  5I42 A;  4ZHR A;  1TGO A;  3AVL A;  5HRN A;  3RWU A;  3LAM A;  1RCH A;  3KLE A;  1SL2 A;  4E0D A;  1TL3 A;  3K57 A;  3KK2 A;  1QSL A;  3VA0 A;  5D3G A;  3VQD A;  1RT6 A;  4CJT A;  1NJW A;  3TI0 A;  1LV5 A;  5KTQ A;  3TAM A;  2HB5 A;  4DU1 A;  4CJQ A;  4CJS A;  1JLG A;  2RPI A;  1ZBI A;  4OGC A;  1ASW A;  3LP0 A;  4RW4 A;  1NK8 A;  3LAK A;  4KB0 A;  4FM1 A;  4IKF A;  1VSI A;  3RR8 A;  1SV5 A;  4PQU A;  1I3A A;  1S6Q A;  3OYF A;  3TAQ A;  4I9L A;  1J54 A;  4M41 A;  4E7I A;  1NKE A;  4FJ7 A;  4FLU A;  3TR8 A;  1LWC A;  1ZBU A;  4CES A;  2YKM A;  2HND A;  3C95 A;  3SUP A;  1TK8 A;  3ASM A;  1VRU A;  3AA3 A;  4OKK A;  1WSF A;  4DTU A;  1FK9 A;  4I2Q A;  1TKD A;  2X6S A;  4J2B A;  3OY9 A;  3QER A;  3V4I A;  2HHS A;  5I3U A;  2E6M A;  2A1S A;  3NAE A;  2KZM A;  1T8E A;  4DWI A;  4M3T A;  2QKB A;  3AVH A;  3TWH A;  1JLB A;  1D8Y A;  4BE0 A;  3VQA A;  2G8I A;  4Z4I A;  4FLW A;  1NJZ A;  1IG9 A;  4CHZ A;  1VK0 A;  2BAN A;  3V1Q A;  3DOL A;  3V6D A;  3D0P A;  3AVC A;  3T19 A;  1D9F A;  4FJH A;  3KJV A;  4OLB A;  3E01 A;  3TAN A;  4J2E A;  1D5A A;  1U48 A;  3ZSO A;  5CY4 A;  2WOM A;  4CGI A;  4DG1 A;  2Z1I A;  4M42 A;  4DFP A;  3PO5 A;  1BHL A;  1HNI A;  5T7B A;  2F96 A;  5SZT A;  4KHU A;  4Z4C A;  1L5U A;  4FLY A;  3TAP A;  4DSL A;  4IFV A;  1LAV A;  1XC9 A;  1GOA A;  4W5Q A;  3OYA A;  4DTR A;  3ZSZ A;  3LP3 A;  3AVJ A;  3V9W A;  1C1B A;  4H4M A;  4CJE A;  1SKW A;  1KSP A;  4KRF A;  1FXX A;  3DMJ A;  1HPZ A;  2ATQ A;  4EP4 A;  1CLQ A;  1QQC A;  3OYD A;  2BGG A;  4W5N A;  3AVI A;  4Z4F A;  2YKN A;  1EET A;  4FLT A;  2G8V A;  4IDK A;  3QEP A;  3K59 A;  3QIP A;  1VSK A;  1HYS A;  1BGX T;  4FZX C;  1JL2 A;  4CIF A;  3CM5 A;  1ASU A;  1L3S A;  1QSS A;  4M3Y A;  2EX3 A;  3D45 A;  3LPU A;  1RBV A;  2IGI A;  4E7H A;  3TAB A;  4KPY A;  4FK4 A;  1KRP A;  2ZD1 A;  2FBV A;  4B9V A;  2HVH A;  4HHT A;  1C0M A;  1U49 A;  3EZ5 A;  4EP5 A;  4BDY A;  4FK0 A;  2XHB A;  3HPO A;  1RT4 A;  3SQ2 A;  1FKO A;  3CQ8 A;  2QKK A;  3TAR A;  2BE2 A;  4HCC A;  4N76 A;  3WNE A;  4KRE A;  3IG1 A;  3OYK A;  3PX6 A;  2YNF A;  2OPR A;  3KIO A;  4KKO A;  3L2R A;  1C1C A;  4FXD A;  1RTH A;  1L3U A;  3RRH A;  1RDB A;  4B9M A;  2HMI A;  4L8R B;  4MQ3 A;  4B08 A;  4ELU A;  4OVL A;  4DU3 A;  4C8K A;  3NF6 A;  2FBT A;  3QEI A;  1W0H A;  3M8P A;  4FM0 A;  2HHX A;  4NCB A;  3KKR A;  4ZTJ A;  3KK1 A;  4PA1 A;  3ZT3 A;  4ELV A;  3AVA A;  4EZ9 A;  3NH0 A;  4QAG A;  2R7Y A;  4B8A B;  1RT5 A;  2VG5 A;  3KLF A;  1X9S A;  1EKE A;  1WLJ A;  4M3W A;  3RRG A;  2Z1J A;  1ZBH A;  1F21 A;  4CGD A;  5J2N A;  1YTA A;  3SUQ A;  2HW3 A;  2XY8 A;  3V1R A;  3M8S A;  3QET A;  3IS9 A;  1L3T A;  4DFJ A;  1CXQ A;  4N47 A;  2W42 A;  4CGF A;  1L3V A;  2Z1H A;  3RTV A;  3ZT1 A;  1KCF A;  4DSJ A;  2P1J A;  4CEO A;  4HTU A;  3LPT A;  2LSN A;  1TK5 A;  1NKC A;  2KFZ A;  3IRX A;  3LDS A;  1Q9Y A;  4KHY A;  3SQ1 A;  1EP4 A;  3NH1 A;  4PWD A;  5C25 A;  4Q0B A;  5C42 A;  3OYE A;  4OPJ A;  3WNG A;  4KHQ A;  4B8C A;  4CJV A;  1T7P A;  3DLR A;  4E3S A;  1TV6 A;  4RW7 A;  5J1E A;  4GW6 A;  4Y1D A;  3QNN A;  1WSE A;  3THV A;  1RT7 A;  4I7F A;  3QEW A;  4CED A;  4E7J A;  3BDP A;  1RTJ A;  3DLK A;  3VQ7 A;  3DOK A;  4KTQ A;  4C8M A;  2IDO A;  3G0Z A;  4AHC A;  1A5X A;  3QES A;  1CZ9 A;  4O0J A;  2KQ2 A;  2OPQ A;  1RBR A;  4AHV A;  3RMD A;  3K5L A;  1RT1 A;  4JRP A;  4EZ6 A;  1S9E A;  4OKJ A;  3K2P A;  1A5V A;  1JL1 A;  4FW1 A;  5HRP A;  1U47 A;  3I0R A;  2HHT A;  3P5J A;  4OPK A;  2O4G A;  1TVR A;  3P1G A;  3RMA A;  3KKS A;  1BIS A;  4E7K A;  1HMV A;  1G15 A;  1SUQ A;  4DS4 A;  1KVB A;  2HHV A;  3C6U A;  1RT3 A;  1BI4 B;  4KFB A;  3AA4 A;  1HQE A;  2X78 A;  1NKB A;  1S1U A;  3ULD A;  4M3Z A;  4FLV A;  1CZB A;  2KZZ A;  3HO1 A;  4CHP A;  3RR7 A;  2E4L A;  2OZM A;  1A5W A;  4O4G A;  3ZSV A;  3OS0 A;  4CF9 A;  1JLE A;  1TKT A;  4CHQ A;  4XIU A;  3SQ0 A;  4PY5 A;  3OVN A;  4FW2 A;  2WON A;  1NOY A;  4CK3 A;  4DQR A;  1X1P A;  2YHB A;  4KO0 A;  3OYI A;  4LSN A;  3VQC A;  2KFN A;  3WNF A;  1VSL A;  3V81 A;  3L2W A;  3EYZ A;  3TAG A;  4F2S A;  3DRS A;  3OYG A;  1TK0 A;  4DU4 A;  3O3F A;  3JYT A;  3DRP A;  3TAF A;  4DTM A;  1KTQ A;  1RDD A;  4CGG A;  4BAC A;  4DQP A;  5FRO A;  1DLO A;  1TKZ A;  4W5T A;  4FJM A;  5CZ2 A;  1K6Y A;  2QXF A;  3G10 A;  1X9W A;  2XRI A;  4NYF A;  3LAN A;  4CF0 A;  5KRT A;  3OS2 A;  1QE1 A;  1VSM A;  2VWK A;  2Y1J A;  1JLQ A;  2RKI A;  3K5N A;  4C8N A;  4CJ3 A;  3O3H A;  1B9F A;  4BE1 A;  4KI4 A;  3OJU A;  3T1A A;  3M8R A;  3HST B;  2EHG A;  4WE1 A;  1UA1 A;  4FJK A;  4HUE A;  4IFY A;  2OA8 A;  3QLH A;  1KFD A;  5J2Q A;  1NK7 A;  1S9G A;  3MAQ A;  1VSH A;  3HP9 A;  4HUG A;  2PYJ A;  1UWB A;  4CEQ A;  1HNV A;  1VSD A;  1HYV A;  3H08 A;  4LH4 A;  3SV4 A;  4ZTF A;  2A1R A;  4BDP A;  4DFM A;  1JXB A;  3SZ2 A;  4LH5 A;  4Z4G A;  1KLN A;  1U45 A;  1XWL A;  3A2F A;  3S3M A;  2B4J A;  4FJ5 A;  3HM9 A;  1IH7 A;  4H4O A;  3NF8 A;  3VQB A;  1HJR A;  4FK2 A;  1DTQ A;  2VG6 A;  2VWJ A;  3AO1 A;  4IG0 A;  3I8D A;  1LWF A;  1Q8I A;  4DSF A;  4B9T A;  2IAJ A;  1IO2 A;  5EU7 A;  1RBS A;  3VQ6 A;  4E1M A;  4UQG A;  3K5M A;  1NJX A;  4NYN A;  3TAE A;  3L3V A;  3PO4 A;  1IKY A;  4CGJ A;  2P5O A;  4M3X A;  4HVJ A;  4RG8 A;  3HL8 A;  2G8U A;  1BIZ A;  3CFO A;  3OYJ A;  1S1V A;  1JKH A;  3JSM A;  4Z4H A;  4E7L A;  2O4I A;  3OYL A;  5CZ1 A;  3V1O A;  4DSE A;  3SI6 A;  4JS5 A;  2YHA A;  2G8W A;  1I39 A;  4G1Q A;  3MED A;  5KI6 A;  4CFC A;  3CFP A;  4DTX A;  3KD5 E;  1Z26 A;  3KLH A;  4CK2 A;  3L2U A;  2F8T A;  3L2V A;  5HLF A;  3AO4 A;  3AO5 A;  4DTS A;  3EY1 A;  1QTM A;  4ID1 A;  4CJR A;  1ASV A;  4FYD A;  1HQU A;  4DQQ A;  2RF2 A;  4CHO A;  4QOZ B;  3C6T A;  4AIL C;  1WSG A;  1MU2 A;  1NJY A;  2FBY A;  1Z25 A;  3S3N A;  3QEV A;  3SYZ A;  4BWJ A;  2XY6 A;  3SJJ A;  2Z1G A;  4KAZ A;  3DLG A;  4GMJ B;  1VSF A;  4LD0 A;  4AHU A;  2DFH A;  4KTW A;  4CEZ A;  1ZBL A;  3ZSY A;  4B9S A;  3SQ4 A;  1TKX A;  4F2R A;  5K14 A;  3PV8 A;  4CIG A;  5CYM A;  3KTQ A;  2DY4 A;  4W5R A;  1LWE A;  4KHS A;  3MEG A;  4H8K A;  4DS5 A;  2B6A A;  3HXM A;  2GV9 A;  3VN5 A;  1S1X A;  4NCA A;  4CJK A;  4FCY A;  2YNI A;  4CJW A;  4ELT A;  3DM2 A;  2HHU A;  4E89 A;  4FJ9 A;  1LW0 A;  4CJ5 A;  3PX0 A;  2BDP A;  3C94 A;  3ZT0 A;  3OYN A;  4OGE A;  3KK3 A;  3LP1 A;  1S6P A;  3NH2 A;  2E6L A;  3AA5 X;  3OYB A;  4B9U A;  1JXE A;  4F8R A;  4W5O A;  2YNG A;  2ZE2 A; 
#chains in the Genus database with same CATH topology
 2CGK A;  5FDL A;  1LOT B;  4A2B A;  5BRF A;  3QML A;  4ID5 A;  1IBL K;  4JKD A;  4FM2 A;  4G9Z A;  2RHK A;  2P51 A;  3ITH A;  4CFA A;  4LSL A;  2HVI A;  1NK0 A;  4DHY A;  3LZI A;  1SKR A;  1OVQ A;  3FZM A;  4FWN A;  3ZX0 A;  3HI0 A;  4H5V A;  4ISE A;  3E1Y A;  3K5O A;  4BE2 A;  5J2M A;  5ADX H;  4J2D A;  3DJC A;  3WNH A;  4Y1C A;  2FSK A;  2IOC A;  1JLA A;  4B9L A;  3EO3 A;  3CJ1 A;  4H03 B;  3PIP L;  4CZE A;  1S5J A;  4IOC L;  1KVC A;  3GDQ A;  1SL1 A;  4CEC A;  4KH4 A;  1NGA A;  4YOW A;  1DTT A;  4CFB A;  1RTD A;  3CCS N;  1NJI O;  4FPA A;  1JLC A;  2A5X A;  4CJL A;  4DSK A;  4BGA A;  5EY4 A;  2HOE A;  1S1T A;  4EFH A;  4OX9 K;  2OYQ A;  3U3G A;  3FR0 A;  2IVO A;  3MEC A;  4C8L A;  5E84 A;  1GLB G;  4DTN A;  3CD6 N;  1BQM A;  3LDL A;  3QIO A;  4JI4 K;  4QS9 A;  2ZM6 K;  1KFS A;  3M5R A;  4IEE A;  2ZJR L;  3NHG A;  1YI2 N;  4F3O A;  4YDU C;  1XNR K;  3VQ9 A;  1DEJ A;  2X74 A;  5M1N A;  4WQ4 C;  4YFU A;  4WCE L;  3D2F B;  2VG7 A;  1WOQ A;  4YOV A;  2P9S A;  2F8S A;  5M1O A;  1E4G T;  3FGU A;  4OJR A;  3K58 A;  2QWM A;  1ATS A;  1KLM A;  3D2E B;  4M45 A;  1UOC A;  4K8Z A;  3HP6 A;  4RW6 A;  4BDZ A;  3VQP A;  3O4N A;  4KPY A;  5SWM A;  3PY8 A;  3MK6 A;  5KGX A;  4CZL A;  2PBD A;  2QW9 A;  4CE9 A;  1IBK K;  4Z94 A;  3L8B A;  3QEX A;  4H5N A;  4N56 A;  3ATV A;  3CQY A;  3H45 C;  3TSQ A;  3KLG A;  1Q81 O;  3AVB A;  4F3T A;  1YVU A;  3DXM B;  4IZ9 A;  1WSI A;  4B3O A;  1FKP A;  1BG3 A;  3ZT4 A;  3J80 O;  2F9T A;  1GLE G;  4CF1 A;  4B9Q A;  3ALY A;  3L3U A;  3VQQ A;  3MEE A;  4FJ8 A;  1VSE A;  2DFF A;  3GE1 A;  1M90 O;  4DTJ A;  4DLE A;  3SPY A;  1N6Q A;  3LM9 A;  5GIP A;  3F9K A;  4IBN A;  5KPT A;  5GAH P;  3EEQ A;  2E88 A;  3UB5 A;  3MN9 A;  5JLH A;  4GVM A;  2QWL A;  3OS1 A;  1Q82 O;  1EXQ A;  4DQS A;  4MO5 A;  1VRT A;  3U9Z A;  5AQU A;  2GUI A;  4JS4 A;  1VQ8 N;  4BQL A;  4CCH A;  4OKE A;  3O4Q A;  4JKG B;  4KHN A;  1J5E K;  2YV0 X;  4CJP A;  1BQN A;  5CHI A;  3ATU A;  4AH9 A;  4MLH A;  4F4K A;  4BQZ A;  3LZJ A;  5FRM A;  1BCO A;  4RCH A;  3LP2 A;  3S9H A;  4ZHR A;  4EHU A;  3DAW A;  3RWU A;  1RCH A;  3WQT A;  4LF9 K;  3KK2 A;  3VA0 A;  3VQD A;  4JKF A;  1RT6 A;  4CJT A;  1LV5 A;  3KVG A;  3QB0 A;  5KTQ A;  2RPI A;  1TUU A;  4X65 K;  1ZBI A;  4OGC A;  4RW4 A;  1NK8 A;  3LAK A;  4IKF A;  2VYP A;  4PQU A;  4MDA A;  3OYF A;  3R3L A;  4FJ7 A;  1J54 A;  4FJX A;  5C10 A;  4AM7 A;  4KBO A;  2QWN A;  3C95 A;  3SUP A;  3ASM A;  1VRU A;  1WSF A;  3A0I X;  2I7P A;  4I2Q A;  1TKD A;  3ZX2 A;  4BRC A;  5I3U A;  3NAE A;  4M3T A;  2QKB A;  3GOI A;  2V52 B;  3TWH A;  1JLB A;  3V1Q A;  4OLB A;  2YI1 A;  3DOL A;  1D9F A;  2D1K A;  3KJV A;  3E01 A;  4J2E A;  5FPE A;  3LL3 A;  2WOM A;  4WYB A;  4CGI A;  2Z1I A;  4DFP A;  2QA4 N;  2P9L B;  2A42 A;  1YHQ N;  4KHU A;  4DSL A;  1NU0 A;  1OH8 A;  3C6A A;  3LP3 A;  3DMJ A;  2ATQ A;  5AQR A;  4DR4 K;  2BGG A;  4AF1 A;  3CJC A;  4WQ5 A;  3K59 A;  1YIJ N;  1VSK A;  1BGX T;  3VEZ A;  2FSN A;  4FVU A;  4FZX C;  1YVN A;  1ASU A;  1YJ9 N;  4GV9 A;  1RBV A;  3TAB A;  5BN9 A;  3CMA N;  4HHT A;  1U49 A;  5HOO A;  4FK0 A;  4FWR A;  2V51 B;  1RT4 A;  1FKO A;  3P31 A;  3TAR A;  3OYK A;  4C1N I;  4QS8 A;  2OPR A;  4EHT A;  3CI5 A;  2YX6 A;  4LF4 K;  3BF3 A;  4BGB A;  4B08 A;  1K73 O;  2E1Z A;  3BY5 A;  4ILJ A;  5KQ8 A;  3QEI A;  2BH1 A;  3M8P A;  4ZTJ A;  3EL2 A;  3KK1 A;  2VCP A;  3HOS A;  4EZ9 A;  3NH0 A;  4QAG A;  1RT5 A;  3RRG A;  3ZEU B;  5J2N A;  2E2Q A;  3V1R A;  4MLE A;  4NO7 A;  1DKG D;  4DFJ A;  2W42 A;  3RTV A;  4BG8 A;  4DV2 K;  4HTU A;  3LPT A;  1TK5 A;  2KFZ A;  3IRX A;  1Q9Y A;  3SMS A;  3SQ1 A;  4KHY A;  1EP4 A;  3OYE A;  4FSV A;  1YF5 L;  4BRK A;  3SK3 A;  1E3M A;  4YOR A;  3THV A;  4IEI A;  1MA9 B;  2WBN A;  1D4X A;  4DR3 K;  2OPQ A;  1NGC A;  4AHV A;  3K5L A;  1RT1 A;  4JRP A;  1S9E A;  3FLC O;  3K2P A;  1GLC G;  2A40 A;  3BEX A;  2O4G A;  1HMV A;  2NZT A;  5AQL A;  1SUQ A;  4DS4 A;  1Q18 A;  2HHV A;  3QFP A;  4KFB A;  2PFU A;  3L0Q A;  2X78 A;  1S1U A;  3O5B A;  3VER A;  1ZC6 A;  4BR9 A;  3BUZ B;  1NGI A;  1HKB A;  2NRX A;  4H0Y B;  1KAX A;  4CF9 A;  1EWR A;  4CHQ A;  3OVN A;  5HL7 L;  3J81 O;  3O08 A;  4FW2 A;  2WON A;  3R9P A;  5MLC Q;  2WTU A;  4IJN A;  1SAZ A;  3E66 A;  3JS6 A;  3JYT A;  3TAF A;  4DTM A;  1RDD A;  3A5L C;  4EIA A;  5BR9 A;  3OA9 A;  4BRH A;  4DQP A;  1TKZ A;  2Q0U A;  5CZ2 A;  1N8R O;  2QXF A;  1X9W A;  4NYF A;  2GWK A;  5KRT A;  2IVN A;  1GLA G;  5GIO A;  1VSM A;  4DR7 K;  3HSC A;  4E1J A;  2RKI A;  4DV7 K;  3O3H A;  1B9F A;  3C6H A;  3THY A;  3OJU A;  1VQ5 N;  3HST B;  2EHG A;  4WE1 A;  3L4I A;  4FJK A;  4FWL A;  4HUE A;  3ENH A;  2E2P A;  3O80 A;  3N4Q A;  1V4T A;  1VSH A;  4I6M A;  1HNV A;  4Y0W A;  3H08 A;  1ATN A;  4BDP A;  3IFR A;  2PAV A;  3SZ2 A;  4LH5 A;  1TYQ B;  3SJH A;  4FJ5 A;  1IH7 A;  5TKW A;  5M1Q A;  3A5O C;  3NF8 A;  4H4O A;  4B3M K;  1Q8I A;  5AQF A;  5EU7 A;  3VQ6 A;  4E1M A;  4JKC A;  3T7Z A;  4JK8 A;  2G8U A;  1BIZ A;  1NGJ A;  2P9P A;  3V1O A;  3SAF A;  4DSE A;  4JS5 A;  3VF2 A;  4M7X A;  3MED A;  3WXI A;  4JYA K;  1Z26 A;  3L2U A;  3CPE A;  2F8T A;  3L2V A;  2CH5 A;  1QTM A;  4DTS A;  4FYD A;  3RSE B;  3L6Q A;  1MU2 A;  3ZET A;  2FBY A;  1QHA A;  3SYZ A;  4BWJ A;  1KC8 O;  2Z1G A;  4GMJ B;  3SQ4 A;  4CIG A;  4W5R A;  4X66 K;  3MEG A;  4YDU A;  3SAG A;  2B6A A;  5EX5 A;  5JIC A;  2YNI A;  2E1Y A;  4BVO A;  3FE1 A;  3ENO A;  1R59 O;  2O8C A;  4CJ5 A;  3ZT0 A;  4B9U A;  5AQY A;  4F8R A;  3QNO A;  5AQS A;  4X62 K;  5JS2 A;  2B5J A;  2QI2 A;  4DTO A;  5FRN A;  1N36 K;  3VOV A;  3DLB A;  2GX9 A;  4KH6 A;  3O9Q A;  4KB1 A;  5KPR A;  3V9X A;  4HCB A;  3QIC A;  1YJW N;  2YJF A;  1VQO N;  4B3S K;  3HBT A;  3DYA A;  4M3U A;  4K41 A;  1NNE A;  3ZSQ A;  5JS1 A;  2O8F A;  4EAH D;  4JRQ A;  3F2K A;  3BP8 A;  3CIP A;  5E26 A;  1S1W A;  1VSJ A;  4IG3 A;  3MN5 A;  2YJE A;  4CHN A;  3WXL A;  4I2P A;  4BRP A;  3VMF B;  1IKX A;  3NFA A;  3AVF A;  2HBM A;  5M1F A;  4DV0 K;  3WXK A;  3AAP A;  1OH6 A;  3HYF A;  4BRM A;  1WSH A;  2PZS A;  3CCM N;  1RBT A;  4X64 K;  2KTQ A;  3ZSR A;  3U8X A;  4DTP A;  4JEP A;  1HUX A;  4O55 A;  4AHS A;  1VAZ A;  3NGI A;  3SAH A;  3WUH A;  1P8Z A;  1HX1 A;  2NLX A;  1V4S A;  3IKM A;  3BGR A;  2FF3 B;  3NE6 A;  3ULE A;  3TSP A;  3SLC A;  4PHT X;  2G8H A;  3NVK A;  3WXJ A;  5LL6 Z;  3SBT A;  1NG9 A;  4DB3 A;  3HPH A;  5A2Q O;  4JK7 A;  4H0T B;  4O0I A;  3L2Q A;  5J2P A;  1NGB A;  3P4I A;  4CHY A;  3I0S A;  4K42 A;  4B1Y B;  4CEA A;  4E1N A;  4LFA K;  5DK5 A;  4C8O A;  2E8A A;  4JD2 A;  1WUA A;  5E41 A;  3WXM B;  3ZSX A;  2WC9 A;  4RW9 A;  5BRE A;  1HNW K;  1TAQ A;  1UAX A;  3CC2 N;  3IUC A;  3VQ5 A;  1YT3 A;  5AQV A;  4JI2 K;  3DLH A;  3QIN A;  3OW2 M;  3CJB A;  1EO1 A;  1JCF A;  3UKR A;  1ATR A;  3G25 A;  4H0V B;  3A8Y A;  1C6V A;  2HBL A;  3LDQ A;  3R6M A;  1XHZ A;  4PUO A;  5AQO A;  4B1U B;  2IVP A;  4KTZ A;  3PIO L;  3B6O A;  4CD1 A;  4FLZ A;  3ZLJ A;  3CC7 N;  2Q3S A;  1RTI A;  4Q5V A;  1WN7 A;  2VWB A;  1IKW A;  1BCM A;  1EWQ A;  3FFK B;  4XH4 A;  2PY5 A;  3F73 A;  3VEV A;  3HOT A;  2UUA K;  4A2A A;  4CFD A;  4CD3 A;  2ZGZ A;  5HRR A;  1S3X A;  4WFB L;  1QHT A;  2D0A A;  5BPL A;  4RWT A;  4C23 A;  3SCX A;  4NCG A;  4MFB A;  5HBM A;  5DM7 L;  3OYH A;  3VEY A;  2OPS A;  4CJU A;  5C12 A;  1K8K A;  3QO9 A;  4CF8 A;  4L3Q A;  4CBU A;  3HVT A;  3SV3 A;  1VQ4 N;  4H5R A;  1E4F T;  3K9J A;  1QVF M;  4CZH A;  4CZJ A;  3PX4 A;  4CER A;  1NWK A;  2XO7 A;  1RGI A;  1TGO A;  5HRN A;  4YHH K;  3KLE A;  4E0D A;  4DQ8 A;  2YCH A;  4NXN K;  1TL3 A;  3K57 A;  1QSL A;  2F9W A;  1NJW A;  4DU1 A;  3OTO K;  4B3R K;  3LP0 A;  4FM1 A;  1VSI A;  4E7I A;  4FLU A;  3TR8 A;  4CES A;  2HND A;  5TKY A;  1JCE A;  3AA3 A;  1FK9 A;  3CCL N;  3MDQ A;  4J2B A;  4H0X B;  3QER A;  4BY9 C;  2A1S A;  1TUY A;  1T8E A;  4DWI A;  4IOA L;  3AVH A;  4BE0 A;  3VQA A;  2G8I A;  1LCU A;  3H6E A;  4Z4I A;  3A5N C;  4CJ7 A;  2BAN A;  4FJH A;  3D0P A;  1NGG A;  1U48 A;  2GEL A;  1GLJ O;  4DG1 A;  1VQK N;  3PO5 A;  1HNI A;  2F96 A;  3L4Q A;  1L5U A;  3G6E N;  4FLY A;  4IFV A;  1LAV A;  1XC9 A;  1GOA A;  3CCV N;  4DTR A;  4ILG B;  3AVJ A;  4H4M A;  2O8D A;  5F0X A;  1SKW A;  1KSP A;  1QQC A;  3ID6 A;  4BVP A;  3C7N A;  4AQY K;  3THY B;  1BWF O;  3QEP A;  4ISG A;  3QIP A;  5C2D A;  1HYS A;  4JHD A;  3VF4 A;  2O8E A;  3EZW A;  1JL2 A;  4CIF A;  4CZK A;  3O9S A;  3CHW A;  4M3Y A;  2W41 A;  2FBV A;  2ZD1 A;  5JVG L;  3PLA A;  2XHB A;  4BRI A;  4KRE A;  4CZI A;  3PX6 A;  2JWK A;  3G4S N;  4NB4 A;  3QFU A;  4GY2 B;  1RDB A;  2HMI A;  4BRG A;  1BA0 A;  4C8K A;  1W0H A;  4NCB A;  3ZT3 A;  4LC9 B;  3AVA A;  4F9O A;  4B8A B;  2R7Y A;  4GV3 A;  1EKE A;  1WLJ A;  3THX B;  2Z1J A;  2OTL N;  4YOY A;  4LF8 K;  1IV0 A;  1F21 A;  3KK7 A;  3WEE B;  3SUQ A;  3M8S A;  3QET A;  3IS9 A;  1L3V A;  2Z1H A;  3CJ7 A;  1KCF A;  5DM6 L;  4DSJ A;  5GIN A;  4BR7 A;  4JV5 K;  2P9I A;  1NKC A;  2A41 A;  3CJA A;  3LDS A;  5FPD A;  4B1Z A;  3NH1 A;  4PWD A;  1NMD A;  2HBK A;  3WNG A;  4E3S A;  1TV6 A;  3EE9 A;  4RW7 A;  4GW6 A;  4Y1D A;  3QNN A;  2O8C B;  1RT7 A;  3QEW A;  3BDP A;  4LF6 K;  1RTJ A;  5EXW A;  3DOK A;  4ILH A;  3G0Z A;  4KH5 A;  1A5X A;  3VEX A;  1Q7Y O;  3S41 A;  4O0J A;  3RMD A;  2P9K A;  3HM8 A;  1A5V A;  3CET A;  3U9D A;  3RMA A;  1YJN N;  3PSI A;  1KVB A;  5F2R A;  3C6U A;  1RT3 A;  3AA4 A;  2KZZ A;  3HO1 A;  3RR7 A;  4BC4 A;  2E4L A;  5AFU A;  2OZM A;  3OS0 A;  1P90 A;  2O8F B;  1TKT A;  1SZ2 A;  4XIU A;  3R1X A;  4CK3 A;  4DQR A;  2NRW A;  2YHB A;  2KFN A;  4F2S A;  3EYZ A;  3MCP A;  3TAG A;  2E5L K;  1KTQ A;  4CGG A;  4BAC A;  5AQQ A;  5FRO A;  4FJM A;  1U2V A;  3OS2 A;  3GG4 A;  2VWK A;  4GVE A;  5AQP A;  5IWA K;  4LF7 K;  4KI4 A;  3M8R A;  2OA8 A;  1KFD A;  5J2Q A;  2A6A A;  1S9G A;  4IXC A;  3MAQ A;  5FPN A;  1U6Z A;  3JAM O;  3EE8 A;  4FWQ A;  3TU5 A;  1JXB A;  3A2F A;  3ULE B;  1N33 K;  1BDG A;  1HJR A;  4FK2 A;  1WBB A;  3I8D A;  4B9T A;  3GL1 A;  3TTD A;  2Q2R A;  1VQ6 N;  1IO2 A;  3CC4 N;  4XH5 A;  1S72 N;  2WFB A;  3PO4 A;  4M3X A;  3L3V A;  1IKY A;  4DUZ K;  3HL8 A;  4XEI A;  3I33 A;  4FL9 A;  3JSM A;  3OYL A;  3I56 N;  3FZF A;  4DCH A;  2YHA A;  4JD2 B;  4CK2 A;  3RVC A;  1SQK A;  5HLF A;  1VQ9 N;  3AO5 A;  4H0P A;  4ID1 A;  4K25 A;  1HQU A;  2GTD A;  3M1F A;  4AIL C;  2HBJ A;  3LDO A;  2AA4 A;  1NJY A;  3QEV A;  2XY6 A;  4AHU A;  2DFH A;  4KTW A;  3UKR B;  1J6Z A;  2QEX N;  4F2R A;  5BPN A;  5K14 A;  3PV8 A;  2UUB K;  4CBX A;  3VN5 A;  4NCA A;  4QS7 A;  2HHU A;  5C0Y A;  5AQH A;  1LW0 A;  2GEM A;  3C94 A;  4OGE A;  3LP1 A;  3CF5 L;  3OYB A;  4W5O A;  5KPZ A;  1VQN N;  3MXJ A;  1QS4 A;  4QCL A;  2IS3 A;  3LM2 A;  2Y1I A;  1BIU A;  4FJL A;  4RW8 A;  3HRG A;  2A3Z A;  3TSU A;  3IDH A;  3C0B A;  4C1N K;  4KHW A;  3IAY A;  1RNH A;  3DRR A;  3CFR A;  4B1X B;  1NOZ A;  1GOC A;  3AVG A;  3EKU A;  3VQE A;  1BI4 A;  2BUP A;  3A5M C;  4DF8 A;  3CM6 A;  4DLG A;  1J9A A;  1QQN A;  5C24 A;  4DV6 K;  5AQN A;  3FFI A;  4CEF A;  1KVA A;  2KKZ A;  1K8K B;  4A61 A;  4H5W A;  3RMC A;  1QVG M;  4FWP A;  2OAN A;  4BC2 A;  2IC3 A;  3B8A X;  1J5O A;  2XY5 A;  1XNQ K;  3NGY A;  1RIL A;  1EX4 A;  3EKS A;  4OLA A;  1JLF A;  1W2B M;  3ZCM A;  3VEO A;  3MX5 A;  2HHQ A;  4BC3 A;  5ADX A;  4JAX A;  3MN7 A;  3OYM A;  5JMV A;  4DSI A;  5EOY A;  5AQW A;  5AQG A;  4DV1 K;  2YNH A;  2NRV A;  2HNY A;  4BRO A;  3KD1 E;  2O8B A;  4V19 S;  2X6N A;  4FZY A;  1YTU A;  3AGR A;  1O1W A;  2W6L A;  5AQX A;  2ITM A;  3O3G A;  4K8X A;  4M63 C;  3CYM A;  1ITG A;  3LWM A;  2H3G X;  4FJN A;  3SUN A;  4PL8 A;  2V7Y A;  5AQI A;  1C1A A;  2Q36 A;  2OPP A;  2IIR A;  1QZ5 A;  4BWM A;  3VEW A;  1T03 A;  4CZF A;  2W40 A;  3AVK A;  3MX2 A;  1ESV A;  3NF9 A;  5LJV A;  2HMP A;  4M3R A;  1XQS C;  2P9S B;  1IKV A;  4BR2 A;  1CXU A;  1C0U A;  4TSX A;  3UIQ A;  1Z05 A;  1U04 A;  1WAF A;  4CBW A;  4FVM A;  4PKI A;  5AJ3 K;  3AV9 A;  4JI1 K;  4DR6 K;  2D5R A;  3C7N B;  2G8K A;  1Q9X A;  2G8F A;  3DI6 A;  1HYZ A;  2PYL A;  2DFE A;  2HNZ A;  2RN2 A;  4JHD B;  2QTD A;  1IBM K;  2O8E B;  3DXM A;  1T05 A;  5GAG P;  3PSF A;  1RDC A;  2QK9 A;  5HRO A;  4PL7 A;  5FLX O;  3SUO A;  4CEB A;  3CER A;  3E9L A;  1DGK N;  3V9U A;  4E19 A;  3MN6 A;  2FBX A;  4LY7 A;  3B6P A;  4HUF A;  1KD1 O;  4GKJ K;  5H1S Q;  4FJJ A;  2P5G A;  2JLE A;  1REV A;  4YNQ A;  5C2F A;  3SBG A;  3ZT2 A;  4CIE A;  4CK1 A;  2GBZ A;  1Q86 O;  1I94 K;  4OO1 J;  3VF6 A;  2YHX A;  2E2O A;  1J53 A;  2CH6 A;  4BRQ A;  5DMR A;  4CJ4 A;  1SKS A;  1IJJ A;  4J8F A;  1GLD G;  3O1B A;  4FLX A;  3ID8 A;  2D0O A;  3LWL A;  1B9D A;  2KLA A;  3SPZ A;  1YUW A;  1OKJ A;  1OVY A;  1R0A A;  4DR2 K;  2P9I B;  2KW4 A;  3V9Z A;  1T6D A;  4AHR A;  1X9M A;  3P83 D;  1ILY A;  2ZF5 O;  5I42 A;  3HVR A;  3RMB A;  2VGN A;  3AVL A;  4RTF D;  2V7Z A;  3LAM A;  4IDH A;  4LFC K;  3TI0 A;  1T3V A;  2P9K B;  1ASW A;  2FF6 A;  3RR8 A;  1S6Q A;  3TAQ A;  1NKE A;  4M41 A;  2CGL A;  3VTI A;  1LWC A;  1TK8 A;  3WQU A;  4O8U A;  5LMN K;  5M1K A;  3H3N O;  4U67 L;  1FW6 A;  4DTU A;  3MMV A;  2X6S A;  4WFN L;  3OY9 A;  3V4I A;  2E6M A;  2KZM A;  4FWS A;  4JI0 K;  1MWK A;  3T1Y K;  4FLW A;  1NJZ A;  1IG9 A;  4CHZ A;  1VK0 A;  3D7E O;  4KB0 A;  3G71 N;  4PKH A;  4JI6 K;  5AQZ A;  5AQM A;  3DLL L;  1D5A A;  3ZSO A;  2Q97 A;  2ZJQ L;  4M42 A;  2D0P A;  2NRH A;  4LF5 K;  1YAG A;  1BHL A;  3H1Q A;  5B8H A;  1OH5 A;  4Z4C A;  3THW A;  3P38 A;  1U2V B;  4W5Q A;  5AZI A;  3ZSZ A;  1GLF O;  1C1B A;  4CJE A;  4KRF A;  1FXX A;  2KHO A;  1CLQ A;  2UXD K;  3NMU A;  5I9E B;  1EET A;  4FLT A;  5IT9 O;  3J7A P;  3TPQ A;  1L3S A;  1N34 K;  1QSS A;  2EX3 A;  3LPU A;  2YHY A;  4E7H A;  1KAZ A;  1KRP A;  4B9V A;  3EZ5 A;  4EP5 A;  4BDY A;  3HPO A;  3SQ2 A;  3CQ8 A;  4N76 A;  4HCC A;  3IG1 A;  3MWP A;  4FOI A;  3JXU A;  3KIO A;  1IG8 A;  4CVN E;  4FXD A;  3RRH A;  2FSJ A;  4BRF A;  4CZM A;  4B9M A;  2FLO A;  4L8R B;  3QBW A;  4ELU A;  3H46 O;  4OVL A;  3NF6 A;  2FBT A;  2HHX A;  3KKR A;  3DXK A;  4PA1 A;  4ELV A;  3KLF A;  1X9S A;  4M3W A;  4BR0 A;  3K0S A;  3J7Y P;  1ZBH A;  1NGE A;  4CGD A;  2J4R A;  4BRD A;  1YTA A;  2CGJ A;  2HW3 A;  4HWI A;  2E2N A;  2XY8 A;  2Q1N A;  3VES A;  4O8K A;  3CJ9 A;  4N47 A;  5C15 A;  1YXQ A;  4CGF A;  4BG9 A;  4JKA A;  4BRL A;  3KZB A;  3U4L A;  1NGF A;  2P1J A;  4CEO A;  2LSN A;  1MDU B;  5ELZ A;  2GUP A;  5C25 A;  4Q0B A;  4WF9 L;  4OPJ A;  4KHQ A;  4CJV A;  1T7P A;  3DLR A;  3WT0 A;  5J1E A;  1OH7 A;  1NGD A;  1KAY A;  4E7J A;  4C8M A;  2IDO A;  4AHC A;  1CZ9 A;  4JKB A;  2KQ2 A;  1RBR A;  3VPZ A;  4A57 A;  4EZ6 A;  1JL1 A;  1U47 A;  2HHT A;  3P5J A;  1TVR A;  3CCE N;  1BIS A;  1G15 A;  1C0G A;  3D6R A;  3MCA B;  2F7T A;  1BI4 B;  4H0O A;  3ULD A;  3O9U A;  1Y64 A;  4M3Z A;  4CHP A;  2HST A;  3BF1 A;  4BRA A;  3ZSV A;  3M3Z A;  2I7N A;  2OCE A;  1JLE A;  3SQ0 A;  4LFB K;  1NOY A;  4PKG A;  4IFE A;  4KO0 A;  1Z6R A;  4LSN A;  3OYI A;  3V81 A;  1VSL A;  3VGM A;  2P9U A;  3OYG A;  4DU4 A;  3UE5 A;  4NLC A;  2ZWH A;  3HTV A;  1DLO A;  2FXU A;  1K6Y A;  3G10 A;  2XRI A;  3H3O B;  5EVZ A;  2UUC K;  2QXL A;  4DUY K;  4K43 A;  1HKG A;  3T69 A;  1JLQ A;  1VQL N;  4C8N A;  2W6K A;  3T1A A;  2O8B B;  4IFY A;  2BTF A;  3HP9 A;  4JI3 K;  1TYQ A;  2A1R A;  3FZL A;  3S3M A;  3M6G A;  2B4J A;  3LDP A;  4I6M B;  3HM9 A;  1DTQ A;  2VG6 A;  3AO1 A;  4IG0 A;  4DKW A;  3K5M A;  4UQG A;  3EN9 A;  4CGJ A;  2P5O A;  2Q31 A;  1RFQ A;  2ZJP L;  3OYJ A;  5AQJ A;  2NNW A;  4A62 A;  1HKC A;  1I39 A;  1NM1 A;  4DV4 K;  4DTX A;  3RSE A;  3CFP A;  3KD5 E;  2P9P B;  3AAQ A;  1HLU A;  3EY1 A;  4CJR A;  1ASV A;  1CZA N;  4DQQ A;  2RF2 A;  4CHO A;  1WSG A;  1Z25 A;  3SJJ A;  3OHR A;  4B1V A;  4CW7 B;  4KAZ A;  3DLG A;  1VSF A;  4LD0 A;  4B9S A;  4CEZ A;  4JKH A;  5AQT A;  3ZET B;  5CYM A;  3KTQ A;  1LWE A;  4H8K A;  4DS5 A;  1VQP N;  2GV9 A;  2HF3 A;  4FCY A;  1X3M A;  3KHY A;  4E89 A;  1NMN A;  3PX0 A;  2BDP A;  2JWL A;  3NVM A;  4IWV A;  3KK3 A;  1HJO A;  2E6L A;  1JXE A;  4KTQ A;  4Z4E A;  2YNG A;  2ZE2 A;  1BOT O;  1GLL O;  4CZG A;  3E9P A;  3U3Y A;  4MO4 A;  4N5S A;  3QBX A;  3QDK A;  1Y97 A;  4FJI A;  5KRS A;  4YY3 K;  3CCR N;  3NBP A;  4DFK A;  1U4B A;  1QSY A;  2OZS A;  4O44 A;  1RBU A;  2ETJ A;  1K9M O;  1D9D A;  1HNX K;  1GOB A;  1BL3 A;  3HT3 A;  1B92 A;  3ZYY X;  3FZH A;  4BR4 A;  3S3O A;  1RDU A;  2ITG A;  3W0L A;  3K9K A;  2ZQB A;  3VQ4 A;  3OJS A;  2FC0 A;  1H1V A;  3PUF A;  4FWK A;  1ZBF A;  4JLH A;  4JNE A;  4GNI A;  4Z0U A;  3VQ8 A;  3NCI A;  3KLI A;  1T6C A;  5CE3 A;  1UA0 A;  3OYC A;  1RDW X;  3AGK A;  1ZYQ A;  3LAL A;  3KWG A;  1HPM A;  2AJQ A;  2P9N A;  4B3T K;  1N32 K;  3VGK A;  5GAE P;  2ASM A;  1XHX A;  3E9O A;  1T44 A;  1VQM N;  1WSJ A;  4BR5 A;  5AZJ A;  1TAU A;  3M8Q A;  4DF4 A;  3AO2 A;  5AQK A;  4BRN A;  2I5J A;  2NUB A;  1VQ7 N;  4XH1 A;  5FPM A;  4NXM K;  1W7A A;  4A59 A;  3VA3 A;  1NK9 A;  5JLF A;  4CI6 A;  3CME N;  3AY9 A;  5JVH L;  3T3F A;  3HK2 A;  3AVN A;  3O9T A;  1O13 A;  2HHW A;  4ISF A;  1ZXO A;  4O5B A;  3THW B;  5AZI B;  3SNN A;  4I9Q A;  2D0B A;  4CEE A;  4DR5 K;  4FJG A;  5CYQ A;  4O5F A;  4KV8 A;  3CXC M;  3U6F A;  1LAW A;  3F5T A;  1SL0 A;  1NK6 A;  1K8A O;  4JI8 K;  1DT9 A;  1TL1 A;  3W3D A;  1BO5 O;  4IO9 L;  4KI6 A;  2JGU A;  1HRH A;  3UKU A;  4AHT A;  3VEN A;  4M7Y A;  2GWJ A;  4CGH A;  1C0T A;  1RT2 A;  4R5P A;  1VHX A;  1XI1 A;  5HRS A;  5AR0 A;  3NF7 A;  4OPA A;  4FPB A;  3AO3 A;  4N41 A;  3BZC A;  1W9H A;  2DTU A;  4DMN A;  2UU9 K;  1LW2 A;  4JN4 A;  3ZSW A;  3HJF A;  2DPN A;  3DXK B;  4FO0 A;  1YIT N;  4CJF A;  3VTH A;  3Q7C A;  4CF2 A;  1N5Y A;  4J2A A;  4FZZ A;  3NGZ A;  3AVM A;  2OTJ N;  2XY7 A;  3NDK A;  1NK4 A;  3DLE A;  3V9S A;  1NK5 A;  3HPG A;  1W97 L;  2UXC K;  3GBT A;  3ISN C;  3AA2 A;  1WAJ A;  2D0C A;  4B9N A;  5M1P A;  3CG7 A;  5HP1 A;  1RDA A;  2VQE K;  4ICL A;  5KGW A;  4DQI A;  4AM6 A;  4JKE A;  3MXM A;  3H1V X;  1NGH A;  3Q7B A;  1WNS A;  3CPW M;  3MXI A;  1BUP A;  3IMX A;  1WB9 A;  1SL2 A;  2HHH K;  3VET A;  5D3G A;  1JCG A;  4KHP K;  4WFA L;  1WBD A;  3TAM A;  2HB5 A;  4CJQ A;  4CJS A;  1JLG A;  2E20 A;  3TTC A;  1SV5 A;  1I3A A;  4IJA A;  3O6W A;  4I9L A;  1ZBU A;  2YKM A;  4YOU A;  4OKK A;  1M1K O;  2HHS A;  1BA1 A;  2VGM A;  1D8Y A;  3N4P A;  4JI5 K;  3V6D A;  3FZK A;  3AVC A;  3D2F A;  3T19 A;  3I55 N;  3VGL A;  3TAN A;  5CY4 A;  1QQM A;  3O1W A;  2P9U B;  4NLB A;  3ENB A;  1G99 A;  3C65 A;  1X3N A;  5T7B A;  5SZT A;  4OPH A;  3TAP A;  2NRT A;  3OYA A;  3D2E A;  3V9W A;  1X9J A;  1HPZ A;  2QWO A;  2AP1 A;  4EP4 A;  3OYD A;  3F9M A;  4W5N A;  3AVI A;  1BU6 O;  4Z4F A;  4DR1 K;  2YKN A;  2O8D B;  2G8V A;  4IDK A;  4DV5 K;  4B1W B;  5KQD A;  3CM5 A;  4IO8 A;  3D45 A;  4JK9 A;  2IGI A;  4H5T A;  4FK4 A;  2HVH A;  1C0M A;  4GKK K;  1S22 A;  3T1H K;  2QWR A;  3O8M A;  2QKK A;  2BE2 A;  3WNE A;  1EQY A;  2YNF A;  4KKO A;  3L2R A;  1C1C A;  1RTH A;  2RE2 A;  1L3U A;  3CCU N;  4MQ3 A;  4DU3 A;  2NRZ A;  3J7Z O;  4HTL A;  4FM0 A;  3THX A;  1XMO K;  3WEE A;  2VG5 A;  3CCJ N;  4UY8 O;  2EWS A;  1SS6 A;  1L3T A;  1CXQ A;  2Q0R A;  4JKG A;  3ZT1 A;  5BRD A;  1KQS M;  4WQ4 A;  5C42 A;  1QQO A;  4B8C A;  2NRR A;  1WSE A;  2UXB K;  4I7F A;  4CED A;  3DLK A;  3VQ7 A;  5LMU K;  3J8A A;  3QES A;  5AFU H;  4JI7 K;  2YHW A;  4OKJ A;  4FWM A;  4R79 A;  3SMP A;  4WQ5 C;  4FW1 A;  5HRP A;  3I0R A;  4OPK A;  4YOT A;  4YOX A;  3P1G A;  3KKS A;  4E7K A;  4GV6 A;  1HQE A;  1NKB A;  3CQX A;  4FLV A;  1CZB A;  1MWM A;  5LY3 A;  1A5W A;  4O4G A;  1XC3 A;  4PY5 A;  3ZX3 A;  4BC5 A;  1X1P A;  1NLV A;  1HNZ K;  3VQC A;  3WNF A;  5BR8 K;  3L2W A;  3DWL A;  3DRS A;  1TK0 A;  3R8E A;  3O3F A;  3DRP A;  4IOX A;  2P9L A;  4A5B A;  4A5A A;  1NBW A;  4W5T A;  2VQF K;  3KWI A;  3LAN A;  4CF0 A;  1QE1 A;  2P9N B;  2Y1J A;  3K5N A;  4CJ3 A;  4BE1 A;  1KXP A;  1ZBS A;  4BRE A;  3TTF A;  1UA1 A;  3CCQ N;  5F1X A;  2HF4 A;  5BPM A;  3QLH A;  1HR0 K;  1NK7 A;  2D4W A;  5GAD P;  5AZJ B;  2F4V K;  2QWP A;  2ASP A;  4HUG A;  2PYJ A;  1UWB A;  4CEQ A;  1VSD A;  1HYV A;  1XUP O;  4LH4 A;  3SV4 A;  4ZTF A;  4DFM A;  2UYT A;  4Z4G A;  1KLN A;  1U45 A;  1XMQ K;  1XWL A;  4FWO A;  3LDN A;  5BRH A;  3VQB A;  3O9R A;  2VWJ A;  4DSF A;  1LWF A;  4MDB A;  2IAJ A;  3MWT A;  1RBS A;  1NJX A;  4NYN A;  4DV3 K;  3TAE A;  4HVJ A;  4RG8 A;  2QWQ A;  3CFO A;  1S1V A;  1JKH A;  1C0F A;  2WUS A;  4Z4H A;  4E7L A;  2O4I A;  5CZ1 A;  3SI6 A;  5LJW A;  3OBW A;  2G8W A;  4G1Q A;  5KI6 A;  4CFC A;  2ASO A;  3KLH A;  1QZ6 A;  3I8B A;  3AAR A;  3BZK A;  3AO4 A;  4FOE A;  3ZEU A;  4QOZ B;  3C6T A;  2ZGY A;  3S3N A;  3P39 A;  1ZBL A;  3O4W A;  3ZSY A;  1TKX A;  3OBY A;  3UKU B;  2QM1 A;  2DY4 A;  1FJG K;  4KHS A;  4K0K K;  3HXM A;  1S1X A;  4CJK A;  4CJW A;  4ELT A;  3DM2 A;  5CR4 A;  4FJ9 A;  3HZ6 A;  4U7B A;  3OYN A;  5BN8 A;  1S6P A;  3NH2 A;  3AA5 X;  1JJ2 M; 
#chains in the Genus database with same CATH homology
 5FDL A;  3QNO A;  3MXJ A;  5JS2 A;  1QS4 A;  2B5J A;  4DTO A;  4ID5 A;  4QCL A;  2IS3 A;  5FRN A;  3U3Y A;  4FM2 A;  1BIU A;  2Y1I A;  3DLB A;  4N5S A;  4FJL A;  4RW8 A;  1Y97 A;  2P51 A;  4FJI A;  4KB1 A;  3ITH A;  5KRS A;  4CFA A;  4LSL A;  3V9X A;  4HCB A;  4KHW A;  2HVI A;  1NK0 A;  3NBP A;  3IAY A;  3LZI A;  4DFK A;  1RNH A;  1U4B A;  1QSY A;  1SKR A;  2OZS A;  3DRR A;  3CFR A;  4O44 A;  1NOZ A;  1RBU A;  2ETJ A;  1GOC A;  3AVG A;  1D9D A;  3VQE A;  4FJX A;  1BI4 A;  4DF8 A;  1GOB A;  3CM6 A;  1J9A A;  3DYA A;  3K5O A;  4BE2 A;  4DLG A;  5J2M A;  4M3U A;  4J2D A;  5C24 A;  1BL3 A;  3WNH A;  4Y1C A;  3HT3 A;  3FFI A;  1B92 A;  4CEF A;  1KVA A;  2IOC A;  3ZSQ A;  1JLA A;  5JS1 A;  3S3O A;  4B9L A;  2ITG A;  4JRQ A;  3RMC A;  1S1W A;  1VSJ A;  2ZQB A;  4IG3 A;  3VQ4 A;  3OJS A;  2FC0 A;  2IC3 A;  1S5J A;  1J5O A;  2XY5 A;  3PUF A;  1KVC A;  1RIL A;  3NGY A;  4CHN A;  1ZBF A;  1EX4 A;  4JLH A;  4OLA A;  1SL1 A;  4I2P A;  4Z0U A;  4CEC A;  1JLF A;  3ZCM A;  1IKX A;  1DTT A;  3NFA A;  3VQ8 A;  4CFB A;  3NCI A;  3KLI A;  1RTD A;  2HHQ A;  3AVF A;  1JLC A;  1UA0 A;  4CJL A;  4DSK A;  3OYC A;  3OYM A;  4DSI A;  1ZYQ A;  1S1T A;  3LAL A;  2AJQ A;  3HYF A;  2OYQ A;  1WSH A;  2PZS A;  3U3G A;  1RBT A;  2YNH A;  2KTQ A;  3MEC A;  3ZSR A;  2HNY A;  3KD1 E;  4DTP A;  4C8L A;  1XHX A;  4DTN A;  1BQM A;  2X6N A;  3QIO A;  4O55 A;  4FZY A;  1YTU A;  4AHS A;  1KFS A;  1WSJ A;  3NGI A;  1O1W A;  1TAU A;  4K8X A;  3O3G A;  3M8Q A;  3NHG A;  4F3O A;  3CYM A;  1ITG A;  4DF4 A;  3AO2 A;  3LWM A;  3BGR A;  3VQ9 A;  3NE6 A;  4FJN A;  2X74 A;  2I5J A;  3SUN A;  4YFU A;  2G8H A;  2NUB A;  1C1A A;  2OPP A;  2VG7 A;  4BWM A;  2F8S A;  3HPH A;  3VA3 A;  1T03 A;  1NK9 A;  3AVK A;  3NF9 A;  3L2Q A;  3T3F A;  4O0I A;  5J2P A;  3HK2 A;  4M3R A;  3AVN A;  4CHY A;  1IKV A;  4OJR A;  3K58 A;  4Z4E A;  3I0S A;  2HHW A;  1CXU A;  1C0U A;  4TSX A;  3UIQ A;  4O5B A;  1U04 A;  4CEA A;  4E1N A;  1WAF A;  1KLM A;  5DK5 A;  4M45 A;  1UOC A;  4K8Z A;  4C8O A;  3HP6 A;  3SNN A;  4I9Q A;  4FVM A;  2D0B A;  4CEE A;  4FJG A;  5CYQ A;  4RW6 A;  4BDZ A;  4KV8 A;  3AV9 A;  3ZSX A;  5E41 A;  4RW9 A;  3VQP A;  2D5R A;  2G8K A;  1TAQ A;  1UAX A;  3O4N A;  3U6F A;  1Q9X A;  2G8F A;  1LAW A;  3DI6 A;  1HYZ A;  3VQ5 A;  5SWM A;  1SL0 A;  1NK6 A;  1YT3 A;  2PYL A;  3PY8 A;  5KGX A;  3DLH A;  2DFE A;  2HNZ A;  2RN2 A;  1TL1 A;  3QIN A;  4CE9 A;  1T05 A;  3QEX A;  3L8B A;  4KI6 A;  2JGU A;  1RDC A;  4N56 A;  1HRH A;  4AHT A;  1C6V A;  4CGH A;  2QK9 A;  5HRO A;  1C0T A;  1RT2 A;  4R5P A;  3KLG A;  1XHZ A;  3AVB A;  1XI1 A;  1YVU A;  3SUO A;  4CEB A;  1SKS A;  4F3T A;  4PUO A;  5HRS A;  4B3O A;  1WSI A;  1FKP A;  4KTZ A;  3B6O A;  4FLZ A;  3NF7 A;  3V9U A;  4E19 A;  2Q3S A;  1RTI A;  3ZT4 A;  3MXI A;  4Q5V A;  1WN7 A;  3AO3 A;  1IKW A;  1BCM A;  4N41 A;  2FBX A;  1W9H A;  4LY7 A;  4CF1 A;  2DTU A;  4DMN A;  3ALY A;  3B6P A;  4HUF A;  3L3U A;  3VQQ A;  1LW2 A;  3MEE A;  2PY5 A;  4FJ8 A;  1VSE A;  2DFF A;  3F73 A;  4FJJ A;  3ZSW A;  4CFD A;  3HJF A;  4DTJ A;  4DLE A;  2P5G A;  2JLE A;  3SPY A;  1N6Q A;  1REV A;  4YNQ A;  5HRR A;  4CJF A;  3F9K A;  3ZT2 A;  4CIE A;  4CK1 A;  4IBN A;  2GBZ A;  4CF2 A;  1N5Y A;  4J2A A;  1QHT A;  2D0A A;  4FZZ A;  3NGZ A;  4GVM A;  3AVM A;  1J53 A;  2XY7 A;  3NDK A;  3OS1 A;  1NK4 A;  5DMR A;  3DLE A;  4CJ4 A;  3SCX A;  1EXQ A;  4MFB A;  4NCG A;  5HBM A;  3V9S A;  1VRT A;  3HPG A;  4DQS A;  1NK5 A;  2GUI A;  4JS4 A;  4FLX A;  3LWL A;  3OYH A;  1B9D A;  4CCH A;  4OKE A;  3SPZ A;  3O4Q A;  4KHN A;  2OPS A;  3AA2 A;  3ISN C;  4CJU A;  1WAJ A;  2YV0 X;  4CJP A;  2D0C A;  1R0A A;  4B9N A;  1BQN A;  2KW4 A;  3QO9 A;  3CG7 A;  3V9Z A;  4CF8 A;  4AH9 A;  5HP1 A;  1RDA A;  4F4K A;  4ICL A;  3HVT A;  5KGW A;  4AHR A;  3LZJ A;  3SV3 A;  1X9M A;  4DQI A;  3P83 D;  3MXM A;  5FRM A;  3PX4 A;  1BCO A;  1WNS A;  3LP2 A;  4CER A;  2XO7 A;  3HVR A;  3RMB A;  3S9H A;  5I42 A;  4ZHR A;  1TGO A;  3AVL A;  5HRN A;  3RWU A;  3LAM A;  1RCH A;  3KLE A;  1SL2 A;  4E0D A;  1TL3 A;  3K57 A;  3KK2 A;  1QSL A;  3VA0 A;  5D3G A;  3VQD A;  1RT6 A;  4CJT A;  1NJW A;  3TI0 A;  1LV5 A;  5KTQ A;  3TAM A;  2HB5 A;  4DU1 A;  4CJQ A;  4CJS A;  1JLG A;  2RPI A;  1ZBI A;  4OGC A;  1ASW A;  3LP0 A;  4RW4 A;  1NK8 A;  3LAK A;  4KB0 A;  4FM1 A;  4IKF A;  1VSI A;  3RR8 A;  1SV5 A;  4PQU A;  1I3A A;  1S6Q A;  3OYF A;  3TAQ A;  4I9L A;  1J54 A;  4M41 A;  4E7I A;  1NKE A;  4FJ7 A;  4FLU A;  3TR8 A;  1LWC A;  1ZBU A;  4CES A;  2YKM A;  2HND A;  3C95 A;  3SUP A;  1TK8 A;  3ASM A;  1VRU A;  3AA3 A;  4OKK A;  1WSF A;  4DTU A;  1FK9 A;  4I2Q A;  1TKD A;  2X6S A;  4J2B A;  3OY9 A;  3QER A;  3V4I A;  2HHS A;  5I3U A;  2E6M A;  2A1S A;  3NAE A;  2KZM A;  1T8E A;  4DWI A;  4M3T A;  2QKB A;  3AVH A;  3TWH A;  1JLB A;  1D8Y A;  4BE0 A;  3VQA A;  2G8I A;  4Z4I A;  4FLW A;  1NJZ A;  1IG9 A;  4CHZ A;  1VK0 A;  2BAN A;  3V1Q A;  3DOL A;  3V6D A;  3D0P A;  3AVC A;  3T19 A;  1D9F A;  4FJH A;  3KJV A;  4OLB A;  3E01 A;  3TAN A;  4J2E A;  1D5A A;  1U48 A;  3ZSO A;  5CY4 A;  2WOM A;  4CGI A;  4DG1 A;  2Z1I A;  4M42 A;  4DFP A;  3PO5 A;  1BHL A;  1HNI A;  5T7B A;  2F96 A;  5SZT A;  4KHU A;  4Z4C A;  1L5U A;  4FLY A;  3TAP A;  4DSL A;  4IFV A;  1LAV A;  1XC9 A;  1GOA A;  4W5Q A;  3OYA A;  4DTR A;  3ZSZ A;  3LP3 A;  3AVJ A;  3V9W A;  1C1B A;  4H4M A;  4CJE A;  1SKW A;  1KSP A;  4KRF A;  1FXX A;  3DMJ A;  1HPZ A;  2ATQ A;  4EP4 A;  1CLQ A;  1QQC A;  3OYD A;  2BGG A;  4W5N A;  3AVI A;  4Z4F A;  2YKN A;  1EET A;  4FLT A;  2G8V A;  4IDK A;  3QEP A;  3K59 A;  3QIP A;  1VSK A;  1HYS A;  1BGX T;  4FZX C;  1JL2 A;  4CIF A;  3CM5 A;  1ASU A;  1L3S A;  1QSS A;  4M3Y A;  2EX3 A;  3D45 A;  3LPU A;  1RBV A;  2IGI A;  4E7H A;  3TAB A;  4KPY A;  4FK4 A;  1KRP A;  2ZD1 A;  2FBV A;  4B9V A;  2HVH A;  4HHT A;  1C0M A;  1U49 A;  3EZ5 A;  4EP5 A;  4BDY A;  4FK0 A;  2XHB A;  3HPO A;  1RT4 A;  3SQ2 A;  1FKO A;  3CQ8 A;  2QKK A;  3TAR A;  2BE2 A;  4HCC A;  4N76 A;  3WNE A;  4KRE A;  3IG1 A;  3OYK A;  3PX6 A;  2YNF A;  2OPR A;  3KIO A;  4KKO A;  3L2R A;  1C1C A;  4FXD A;  1RTH A;  1L3U A;  3RRH A;  1RDB A;  4B9M A;  2HMI A;  4L8R B;  4MQ3 A;  4B08 A;  4ELU A;  4OVL A;  4DU3 A;  4C8K A;  3NF6 A;  2FBT A;  3QEI A;  1W0H A;  3M8P A;  4FM0 A;  2HHX A;  4NCB A;  3KKR A;  4ZTJ A;  3KK1 A;  4PA1 A;  3ZT3 A;  4ELV A;  3AVA A;  4EZ9 A;  3NH0 A;  4QAG A;  2R7Y A;  4B8A B;  1RT5 A;  2VG5 A;  3KLF A;  1X9S A;  1EKE A;  1WLJ A;  4M3W A;  3RRG A;  2Z1J A;  1ZBH A;  1F21 A;  4CGD A;  5J2N A;  1YTA A;  3SUQ A;  2HW3 A;  2XY8 A;  3V1R A;  3M8S A;  3QET A;  3IS9 A;  1L3T A;  4DFJ A;  1CXQ A;  4N47 A;  2W42 A;  4CGF A;  1L3V A;  2Z1H A;  3RTV A;  3ZT1 A;  1KCF A;  4DSJ A;  2P1J A;  4CEO A;  4HTU A;  3LPT A;  2LSN A;  1TK5 A;  1NKC A;  2KFZ A;  3IRX A;  3LDS A;  1Q9Y A;  4KHY A;  3SQ1 A;  1EP4 A;  3NH1 A;  4PWD A;  5C25 A;  4Q0B A;  5C42 A;  3OYE A;  4OPJ A;  3WNG A;  4KHQ A;  4B8C A;  4CJV A;  1T7P A;  3DLR A;  4E3S A;  1TV6 A;  4RW7 A;  5J1E A;  4GW6 A;  4Y1D A;  3QNN A;  1WSE A;  3THV A;  1RT7 A;  4I7F A;  3QEW A;  4CED A;  4E7J A;  3BDP A;  1RTJ A;  3DLK A;  3VQ7 A;  3DOK A;  4KTQ A;  4C8M A;  2IDO A;  3G0Z A;  4AHC A;  1A5X A;  3QES A;  1CZ9 A;  4O0J A;  2KQ2 A;  2OPQ A;  1RBR A;  4AHV A;  3RMD A;  3K5L A;  1RT1 A;  4JRP A;  4EZ6 A;  1S9E A;  4OKJ A;  3K2P A;  1A5V A;  1JL1 A;  4FW1 A;  5HRP A;  1U47 A;  3I0R A;  2HHT A;  3P5J A;  4OPK A;  2O4G A;  1TVR A;  3P1G A;  3RMA A;  3KKS A;  1BIS A;  4E7K A;  1HMV A;  1G15 A;  1SUQ A;  4DS4 A;  1KVB A;  2HHV A;  3C6U A;  1RT3 A;  1BI4 B;  4KFB A;  3AA4 A;  1HQE A;  2X78 A;  1NKB A;  1S1U A;  3ULD A;  4M3Z A;  4FLV A;  1CZB A;  2KZZ A;  3HO1 A;  4CHP A;  3RR7 A;  2E4L A;  2OZM A;  1A5W A;  4O4G A;  3ZSV A;  3OS0 A;  4CF9 A;  1JLE A;  1TKT A;  4CHQ A;  4XIU A;  3SQ0 A;  4PY5 A;  3OVN A;  4FW2 A;  2WON A;  1NOY A;  4CK3 A;  4DQR A;  1X1P A;  2YHB A;  4KO0 A;  3OYI A;  4LSN A;  3VQC A;  2KFN A;  3WNF A;  1VSL A;  3V81 A;  3L2W A;  3EYZ A;  3TAG A;  4F2S A;  3DRS A;  3OYG A;  1TK0 A;  4DU4 A;  3O3F A;  3JYT A;  3DRP A;  3TAF A;  4DTM A;  1KTQ A;  1RDD A;  4CGG A;  4BAC A;  4DQP A;  5FRO A;  1DLO A;  1TKZ A;  4W5T A;  4FJM A;  5CZ2 A;  1K6Y A;  2QXF A;  3G10 A;  1X9W A;  2XRI A;  4NYF A;  3LAN A;  4CF0 A;  5KRT A;  3OS2 A;  1QE1 A;  1VSM A;  2VWK A;  2Y1J A;  1JLQ A;  2RKI A;  3K5N A;  4C8N A;  4CJ3 A;  3O3H A;  1B9F A;  4BE1 A;  4KI4 A;  3OJU A;  3T1A A;  3M8R A;  3HST B;  2EHG A;  4WE1 A;  1UA1 A;  4FJK A;  4HUE A;  4IFY A;  2OA8 A;  3QLH A;  1KFD A;  5J2Q A;  1NK7 A;  1S9G A;  3MAQ A;  1VSH A;  3HP9 A;  4HUG A;  2PYJ A;  1UWB A;  4CEQ A;  1HNV A;  1VSD A;  1HYV A;  3H08 A;  4LH4 A;  3SV4 A;  4ZTF A;  2A1R A;  4BDP A;  4DFM A;  1JXB A;  3SZ2 A;  4LH5 A;  4Z4G A;  1KLN A;  1U45 A;  1XWL A;  3A2F A;  3S3M A;  2B4J A;  4FJ5 A;  3HM9 A;  1IH7 A;  4H4O A;  3NF8 A;  3VQB A;  1HJR A;  4FK2 A;  1DTQ A;  2VG6 A;  2VWJ A;  3AO1 A;  4IG0 A;  3I8D A;  1LWF A;  1Q8I A;  4DSF A;  4B9T A;  2IAJ A;  1IO2 A;  5EU7 A;  1RBS A;  3VQ6 A;  4E1M A;  4UQG A;  3K5M A;  1NJX A;  4NYN A;  3TAE A;  3L3V A;  3PO4 A;  1IKY A;  4CGJ A;  2P5O A;  4M3X A;  4HVJ A;  4RG8 A;  3HL8 A;  2G8U A;  1BIZ A;  3CFO A;  3OYJ A;  1S1V A;  1JKH A;  3JSM A;  4Z4H A;  4E7L A;  2O4I A;  3OYL A;  5CZ1 A;  3V1O A;  4DSE A;  3SI6 A;  4JS5 A;  2YHA A;  2G8W A;  1I39 A;  4G1Q A;  3MED A;  5KI6 A;  4CFC A;  3CFP A;  4DTX A;  3KD5 E;  1Z26 A;  3KLH A;  4CK2 A;  3L2U A;  2F8T A;  3L2V A;  5HLF A;  3AO4 A;  3AO5 A;  4DTS A;  3EY1 A;  1QTM A;  4ID1 A;  4CJR A;  1ASV A;  4FYD A;  1HQU A;  4DQQ A;  2RF2 A;  4CHO A;  4QOZ B;  3C6T A;  4AIL C;  1WSG A;  1MU2 A;  1NJY A;  2FBY A;  1Z25 A;  3S3N A;  3QEV A;  3SYZ A;  4BWJ A;  2XY6 A;  3SJJ A;  2Z1G A;  4KAZ A;  3DLG A;  4GMJ B;  1VSF A;  4LD0 A;  4AHU A;  2DFH A;  4KTW A;  4CEZ A;  1ZBL A;  3ZSY A;  4B9S A;  3SQ4 A;  1TKX A;  4F2R A;  5K14 A;  3PV8 A;  4CIG A;  5CYM A;  3KTQ A;  2DY4 A;  4W5R A;  1LWE A;  4KHS A;  3MEG A;  4H8K A;  4DS5 A;  2B6A A;  3HXM A;  2GV9 A;  3VN5 A;  1S1X A;  4NCA A;  4CJK A;  4FCY A;  2YNI A;  4CJW A;  4ELT A;  3DM2 A;  2HHU A;  4E89 A;  4FJ9 A;  1LW0 A;  4CJ5 A;  3PX0 A;  2BDP A;  3C94 A;  3ZT0 A;  3OYN A;  4OGE A;  3KK3 A;  3LP1 A;  1S6P A;  3NH2 A;  2E6L A;  3AA5 X;  3OYB A;  4B9U A;  1JXE A;  4F8R A;  4W5O A;  2YNG A;  2ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...