5DK5A

Crystal structure of crn-4-mes complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
294
structure length
294
Chain Sequence
b'HCPFDTLLILDFETTSDAANQDYPCEVIQFAIVAYDVPNDKIREDISFNKYVKPVLNRTLTKNCVDFTGIPQRSIDTADTFDVVYEQFQQWLITLGLEEGKFAFVCDSRQDLWRIAQYQMKLSNIQMPAFFRQYINLYKIFTNEMDRMGPKELSATTNIGKMNEYYDLPTIGRAHDAMDDCLNIATILQRMINMGAKVTVNELLTCCASWRRQPLVYNKEWRSSFMDAGKIFERVLPLVVTTIRAGDFRLEMYGVCRYCRKGMDVCGTSHQQTPHDLYKNEEDPIHFAKIAGYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell death-related nuclease 4
publication title Identification of Inhibitors for the DEDDh Family of Exonucleases and a Unique Inhibition Mechanism by Crystal Structure Analysis of CRN-4 Bound with 2-Morpholin-4-ylethanesulfonate (MES)
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase
total genus 90
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5dk5A01
3NF6A 2XY8A 2E4LA 4KI4A 1ZBHA 2B6AA 3HL8A 2VG7A 3K5NA 1NK4A 1EKEA 4FCYA 1S1XA 1VSFA 3NHGA 3KKRA 2KFNA 1RBUA 3VQDA 4CJKA 3ULDA 4DTNA 5C24A 3O4NA 4CHQA 4K8ZA 4CFCA 2KQ2A 1IH7A 4BDZA 1JLQA 4XIUA 3MXJA 1JXEA 1TKTA 3AO2A 4E7KA 4F4KA 1JLFA 3DI6A 4CJQA 4DFJA 4FXDA 1LV5A 3TABA 4RW9A 5JS1A 4EZ6A 1EXQA 1N5YA 4FK4A 5CZ1A 3ZSRA 3AVHA 4CESA 3QNNA 2DTUA 1VRUA 1RDDA 4DTOA 1S1VA 3OJSA 4M42A 3DYAA 3NCIA 1RDBA 1S5JA 3F73A 3LWLA 4JRPA 4HTUA 1WSFA 3VQBA 4JLHA 3AO1A 3ITHA 1TVRA 4E1MA 3TAQA 1RTHA 1IKWA 2PZSA 4DLEA 3PX6A 4FJGA 2FBYA 1SV5A 4B9TA 4PQUA 2Q3SA 5I3UA 4IKFA 2YNHA 1S1UA 3HPHA 2RN2A 3LANA 3H08A 4I7FA 4B8AB 2FBXA 4HUFA 3AVAA 2G8UA 3AVBA 4KHQA 4CERA 3QETA 3OYMA 1BGXT 1MU2A 3DOKA 2G8IA 3MECA 4OKJA 4DTUA 3EZ5A 1D8YA 1TKDA 1GOCA 4B9VA 4J2DA 3KK1A 1Q8IA 4E3SA 4KRFA 3AO4A 3SCXA 3T19A 3SUPA 3SZ2A 3OYBA 4CFBA 4CF8A 4J2EA 1KVCA 1A5VA 1RTIA 1TKZA 2RPIA 5CYQA 3WNFA 2OPSA 2HHWA 2Z1JA 4B08A 2YNIA 4ICLA 2IS3A 2F96A 1WN7A 1T8EA 5DK5A 1NK6A 1QQCA 4O44A 2WOMA 1R0AA 4FZYA 2HW3A 4N41A 1JLCA 1NKCA 2YNGA 3SUQA 3ZSXA 1L5UA 2OPQA 2XRIA 5FRMA 3NDKA 1VSKA 3PX4A 1X9SA 4MFBA 3O3HA 2HHQA 1UA0A 4PUOA 2VG6A 1TGOA 3MXMA 1Z26A 4BE2A 4B9UA 3L2WA 1IKVA 2DFHA 3AA4A 3CM6A 1T03A 3LP1A 4FZZA 3VQ4A 4KFBA 4OPJA 1VRTA 4K8XA 1S9GA 4CGDA 3L2UA 1ITGA 4M3YA 3HPOA 3SJJA 3WNGA 3I8DA 1K6YA 4CK1A 4ZTFA 4OLAA 1KTQA 4DTPA 3A2FA 3VQ8A 1NOYA 3VN5A 1GOBA 4CHYA 3L3UA 4L8RB 3MAQA 3RRGA 1NK9A 5CY4A 3CFPA 4Z4IA 4KO0A 4OGEA 3V9WA 4I9LA 4O0JA 2HHUA 4HHTA 4HUGA 2DY4A 1HQUA 2OYQA 4FM0A 2Y1IA 3QEPA 3OS0A 1UWBA 4W5RA 3OYDA 4ELUA 4DU1A 1J54A 4NCBA 1T7PA 3D0PA 4DG1A 4CJVA 1HMVA 1BISA 3DRPA 3O4QA 5HRRA 3WNHA 1VSMA 5J2MA 4CECA 4DTXA 3G10A 1ZBIA 4ID5A 1LWEA 3HP9A 4DTJA 4FJHA 4E19A 4KHUA 4CF1A 3VQ6A 4DSIA 2HB5A 1I39A 4CEDA 3V4IA 1RT3A 2RKIA 2XHBA 1ASWA 3D45A 4DF4A 1BQNA 1HPZA 2HVIA 5FROA 3QIOA 3CYMA 3DLRA 4DFPA 3TI0A 3QEWA 2HHVA 3PO4A 1TAUA 4LH5A 4CEBA 1VSLA 1RT6A 2VWKA 4ID1A 4FYDA 4LD0A 5KTQA 2F8SA 4DS4A 1WAFA 4ZTJA 3RMBA 5J2NA 4OGCA 3DRSA 3S9HA 3AVCA 3DLEA 1BIZA 2YNFA 3JSMA 4HCBA 3OYJA 2F8TA 1BI4A 3S3MA 4LSLA 1ZBLA 1J5OA 3C94A 4B9SA 2EX3A 3HYFA 1VSHA 4WE1A 4PWDA 3OYEA 4BWMA 5HLFA 4CGHA 3TAFA 4HVJA 3BGRA 1TAQA 4CJLA 1QTMA 3LPTA 1Y97A 3VQEA 3V9UA 3TAEA 4NCGA 1C0MA 3U3YA 1X9WA 4DFMA 4BDYA 2HMIA 1LWCA 4M3RA 1RNHA 3ASMA 3AA2A 3AO3A 3C6UA 2OA8A 2QK9A 3NGIA 3VA0A 3QNOA 2PY5A 1FKOA 4GMJB 1CZBA 3OVNA 3V1OA 3VQAA 2FBVA 4FJ9A 3P83D 3SQ4A 4F2RA 3M8SA 3LAKA 4CIEA 4M3UA 2BANA 3SQ2A 1SL1A 3AVIA 4Z4HA 3RR7A 1REVA 4CEFA 3K59A 5SWMA 4CK2A 4N5SA 1RILA 4CHPA 3KD1E 1NK7A 1SKWA 1LW0A 3OYKA 3PV8A 3LAMA 1U4BA 3O3FA 4C8OA 5HROA 4FJNA 1TV6A 4KV8A 1N6QA 4CJPA 5J1EA 2FBTA 1NJYA 1Q9YA 4DS5A 4FJIA 1QE1A 1TKXA 2Z1GA 3NF9A 4AILC 3M8QA 4CEEA 3OYCA 2E6LA 4IFVA 1SKRA 4I2QA 3IAYA 3HXMA 3MEEA 1X9MA 1HNVA 1D9FA 1FXXA 3DM2A 3U3GA 4DQRA 1U49A 3TAMA 1L3TA 4AHTA 5FRNA 3SV4A 1VSJA 5FDLA 4IDKA 4H8KA 4B8CA 3UIQA 3AA5X 1LW2A 4ELVA 1RBRA 3NBPA 4EP5A 1W0HA 3DLGA 1WAJA 4F8RA 4AH9A 4KPYA 4M3WA 1S1WA 4CIFA 3ZT0A 3OYNA 1NK0A 3SQ1A 4FK2A 4E7LA 3SV3A 2LSNA 4DLGA 4GVMA 3SUNA 3KIOA 3MEDA 1RT7A 2VG5A 2HHSA 1JL1A 2OPPA 2HNZA 4RW6A 1BCMA 3AVNA 3ZSWA 3QEIA 3AO5A 4RW7A 1KFDA 4CJRA 1KLMA 4UQGA 1JLBA 4CE9A 2VWJA 4DSFA 3VQ5A 1WSEA 1SL0A 3KJVA 1NJXA 1XHZA 4CJTA 1YT3A 3RMCA 4EZ9A 2IOCA 1LAVA 4CEQA 1T05A 3NAEA 1SUQA 4I9QA 1KVAA 4MQ3A 3QESA 4LH4A 3S3OA 4BACA 5KRSA 3KTQA 3ZT1A 3V9XA 3LWMA 1D9DA 5T7BA 2Z1HA 3IS9A 3OY9A 1WLJA 1G15A 4M41A 4F2SA 1IG9A 3KD5E 2PYLA 4CCHA 3TAGA 3RTVA 1CLQA 4FLYA 3PY8A 2DFEA 4Q0BA 4DWIA 4E1NA 3QEXA 1BIUA 2O4GA 2P1JA 3V1RA 3SPZA 4B9NA 1BI4B 3OYGA 3RMDA 1WSGA 4OLBA 3HP6A 1VSDA 1XWLA 1TL1A 4CEZA 1CXUA 2A1SA 4FW2A 1RTDA 2QKBA 3L2RA 4FJMA 4NYFA 1S1TA 1VSEA 4DQPA 2A1RA 4M3ZA 4NYNA 4PA1A 4E7IA 3OYHA 3NH2A 3T3FA 2BE2A 3V6DA 1JL2A 3L2VA 4JRQA 3DMJA 3I0SA 3TARA 1XC9A 4N47A 3VA3A 4CJ4A 4CF0A 3SI6A 4DU3A 4DSJA 3P5JA 3KLIA 5EU7A 3RRHA 1U45A 4NCAA 4RW8A 4W5QA 2DFFA 2RF2A 4QAGA 3NGZA 2O4IA 2OPRA 2X78A 4JS5A 4BDPA 5HRPA 3KLHA 2G8HA 1KVBA 4CJ3A 2W42A 1IKYA 4IFYA 1QSLA 1EP4A 3CFOA 3L8BA 3AVMA 3T1AA 4B3OA 3LZJA 1NK5A 4CFDA 4B9LA 4C8MA 1RDAA 3LZIA 3NF7A 4PY5A 2B5JA 2P51A 4CK3A 3ZCMA 3MXIA 4E0DA 4QOZB 3K2PA 1BCOA 1X1PA 3LP3A 1KCFA 1RT1A 1UA1A 3THVA 1RT4A 4CJUA 3EY1A 4E7JA 1BQMA 1S9EA 3TAPA 4AHRA 4KHWA 5HRSA 1KFSA 3DRRA 3AVKA 3CG7A 3ZT2A 2ATQA 5HP1A 1ZYQA 5HBMA 3NGYA 1HNIA 2GV9A 2D0CA 3K5LA 2G8KA 1QSSA 4OKKA 3VQ9A 1RBSA 1RBTA 4DU4A 5KGWA 3KK3A 1UOCA 3S3NA 3BDPA 4B9MA 3HPGA 4KHNA 4BE1A 4E89A 1QHTA 3EYZA 3FFIA 1NK8A 2ZD1A 1GOAA 5C25A 2ETJA 3LPUA 1B92A 3NE6A 2IC3A 4I2PA 2XY5A 3TWHA 4FJJA 2KFZA 3E01A 4AHUA 3QIPA 4DQIA 1BL3A 4FM2A 2Z1IA 4IG3A 3HM9A 1U47A 1NJWA 4OVLA 1L3UA 4CHZA 3ZSYA 4ZHRA 1F21A 1NKEA 4W5NA 3P1GA 4FLVA 4CHOA 1NKBA 4DSLA 4KB1A 2HNDA 1HJRA 2E6MA 3V1QA 2G8VA 5SZTA 4CJ5A 3K5MA 1IO2A 1D5AA 1WSJA 4CEOA 3NH0A 1RT5A 3CFRA 1J53A 3K5OA 4LSNA 2Y1JA 4FLUA 4CJEA 1DTTA 3IG1A 4Z4EA 5J2QA 4QCLA 4TSXA 4KREA 4YNQA 3SNNA 3CM5A 1ZBUA 4FLZA 4CEAA 3ZT3A 4O4GA 2EHGA 1TL3A 2G8FA 2YHAA 2X6SA 5C42A 1U48A 3DLHA 1WSIA 3RWUA 3SPYA 4FLWA 3M8PA 1RBVA 1CZ9A 2B4JA 3MEGA 4AHCA 1KRPA 3OS2A 1FK9A 3HVRA 1TK8A 3ISNC 1LWFA 4HCCA 2KZZA 4AHVA 2OZMA 2I5JA 3K57A 3I0RA 1C1CA 4DTRA 3HVTA 3QO9A 4KTZA 1C6VA 4N56A 3AVLA 4Z4CA 3DLKA 2WONA 3QLHA 3QERA 4FJ8A 3PO5A 2YV0X 3AVGA 4DTMA 3LP0A 4KKOA 1HYVA 1DTQA 2YKNA 4DMNA 3ZSOA 2NUBA 3JYTA 3PX0A 5CZ2A 3AV9A 1L3SA 4CJFA 3DLBA 1FKPA 4CF2A 3C6TA 2G8WA 1EX4A 1ZBFA 3C95A 4JS4A 2GUIA 3OS1A 4FJ7A 1CXQA 3NH1A 4C8LA 4Z0UA 4C8KA 1VK0A 4FJXA 4F3TA 2IGIA 1ASUA 4CF9A 5K14A 2HHTA 3VQPA 3QINA 4FVMA 1B9FA 2KW4A 1BHLA 4DQSA 3OYLA 4GW6A 3RR8A 3L3VA 4FK0A 3VQCA 4CGGA 1TK0A 4O5BA 4EP4A 3ZT4A 3KLGA 4DSEA 3V81A 2P5OA 4KHYA 4BE0A 4DSKA 4H4OA 3NFAA 1DLOA 1JLEA 4CJWA 4Y1DA 2R7YA 3SUOA 2IAJA 3ZSQA 1QS4A 5D3GA 1IKXA 4M3TA 4DTSA 2HHXA 1S6PA 3KKSA 5CYMA 5DMRA 4H4MA 3VQ7A 3B6OA 4FLTA 3LP2A 4M45A 1U04A 5E41A 4W5TA 3G0ZA 4OPKA 2D0BA 4KB0A 2JGUA 4R5PA 1WSHA 4F3OA 1XI1A 1S6QA 2HVHA 1VSIA 4RG8A 4BWJA 1C1BA 1I3AA 5JS2A 3V9ZA 3SYZA 3V9SA 2PYJA 4CGIA 3AVFA 3LALA 4CGFA 4CHNA 4HUEA 4Z4FA 1YTUA 4CFAA 3HSTB 1RTJA 1YVUA 4KHSA 4FM1A 1RT2A 4O0IA 5I42A 3IRXA 1JLAA 3HT3A 1HYZA 2XO7A 2OZSA 1B9DA 5HRNA 3LDSA 4DFKA 4DQQA 1W9HA 2IDOA 2ZQBA 1XHXA 4Z4GA 4O55A 4M3XA 3HK2A 4OJRA 2D0AA 5KRTA 4Y1CA 3AA3A 3ZSZA 4AHSA 3KK2A 1Q9XA 2AJQA 2JLEA 4KTQA 4N76A 1KLNA 4J2BA 3DOLA 1O1WA 1EETA 3OYFA 4FLXA 4C8NA 4FJKA 1J9AA 4W5OA 4CGJA 3O3GA 1SL2A 1ASVA 1HRHA 3KLEA 2KTQA 1A5XA 2D5RA 3TR8A 2ITGA 3B6PA 2BDPA 1NOZA 5J2PA 3RMAA 1YTAA 1C0UA 4CIGA 2YKMA 3NF8A 1C1AA 1L3VA 4ELTA 2BGGA 4IBNA 4RW4A 4FJ5A 2XY7A 1TK5A 4FZXC 1WNSA 1HYSA 2XY6A 2GBZA 1HQEA 5KGXA 4G1QA 5KI6A 1Z25A 3CQ8A 2QKKA 2FC0A 4KTWA 3OYIA 4Q5VA 4J2AA 1RCHA 2P5GA 2X6NA 4LY7A 3M8RA 1A5WA 3ALYA 1QSYA 1JLGA 3KLFA 4KAZA 3HJFA 1NJZA 3U6FA 1SKSA 2QXFA 4KI6A 1JKHA 4FW1A 4IG0A 4FJLA 4CJSA 3HO1A 3QEVA 2YHBA 1KSPA 2KZMA 3PUFA 4YFUA 3AVJA 3K58A 2X74A 4E7HA 4DF8A 3TANA 3WNEA 3OYAA 1JXBA 4OKEA 3VQQA 3L2QA 3SQ0A 2HNYA 1UAXA 3OJUA 1LAWA 1RDCA 3F9KA 3ZSVA 1C0TA 2ZE2A
chains in the Genus database with same CATH superfamily
3NF6A 5M1PA 1ZBHA 3AGRA 2QWMA 1RBUA 4ISGA 2A3ZA 4CHQA 4BDZA 1IH7A 1BA1A 2VCPA 4X64K 3MXJA 4CJQA 3DI6A 3WT0A 2YHYA 4B1ZA 1RDDA 3H3OB 3L0QA 1S1VA 3D2FA 3D2EB 4JLHA 1S3XA 4FJGA 4DLEA 2VQFK 3PX6A 2P9SA 3DJCA 4PL7A 5I3UA 2O8CA 1IG8A 3EZWA 4I7FA 3LANA 1OH5A 4HUFA 4LF4K 1MWKA 2O8EA 4KHQA 3OTOK 3QETA 1DT9A 4YOUA 4DTUA 3EZ5A 3O1BA 1D8YA 4BRFA 3FZFA 1Q8IA 3Q7BA 3ZLJA 3UKUB 4DV7K 4BG9A 1R59O 3SZ2A 4OPHA 1VHXA 4J2EA 3ZX0A 2OPSA 2YNIA 2IS3A 4CBXA 2V7YA 1QQCA 1YAGA 4O44A 5C10A 1N34K 2HW3A 4N41A 2CH6A 3ZSXA 3I55N 2XRIA 4MFBA 4H5NA 5GIOA 4PUOA 3MXMA 1Z26A 4BE2A 4IEIA 5AQWA 3CM6A 3M5RA 5FPEA 4OPJA 1VRTA 3SK3A 1VQ7N 3DXKA 4YDUA 2UXDK 4M3YA 3HPOA 3WNGA 3I8DA 3VQ8A 3GE1A 3P38A 4XH4A 2P9NA 4LFCK 1D4XA 3O8MA 4Z4IA 2P9LB 2DY4A 3IKMA 1OH6A 3UKRB 3CJ7A 4DU1A 2QW9A 4E19A 5BRHA 1X3NA 5C2FA 1RT3A 2RKIA 1ASWA 4DF4A 3T1HK 2HVIA 4B1WB 5E84A 3I56N 3QEWA 2HHVA 3PO4A 1VSLA 3CHWA 3D2FB 4LD0A 3THYA 1WAFA 3R9PA 1YXQA 3RMBA 3ATUA 3DRSA 1TYQB 5AQQA 5M1QA 4LSLA 1YJ9N 3C94A 1JCGA 2Q36A 4B9SA 3HYFA 1E3MA 1VSHA 2O8EB 3A8YA 4WE1A 2YHWA 4O5FA 4DR7K 4CGHA 3TAFA 3BGRA 1TAQA 4CJLA 1EWQA 4GY2B 1X9WA 3ZX3A 5BREA 2ZM6K 4JKEA 2YHXA 1XC3A 4GMJB 3V1OA 4FJ9A 3VQAA 2FBVA 4F2RA 4A5BA 4CIEA 2BANA 4FWQA 3CCJN 3SQ2A 4B1VA 4CEFA 3HTVA 1HJOA 3KD1E 1NK7A 1LW0A 3PV8A 3LAMA 5F2RA 3R3LA 3O9QA 4E1JA 5A2QO 1N36K 3KVGA 1N6QA 4JKGB 5J1EA 1Q9YA 4DS5A 4IDHA 1QE1A 4XEIA 3NF9A 4CEEA 1M90O 4LF8K 3J7AP 1FXXA 4DQRA 3TAMA 5GINA 4AHTA 3SV4A 1XMOK 1VQKN 1GLFO 1LW2A 2P9NB 1RBRA 3NBPA 4F8RA 1WAJA 4ILHA 3C65A 4E7LA 3MEDA 1JL1A 2HBMA 2BUPA 1NGAA 4RWTA 3AVNA 3QEIA 2D1KA 4UQGA 2VWJA 2UYTA 3CMEN 4CJTA 1YT3A 3OBWA 4BR7A 1OVYA 1NBWA 1SUQA 4MQ3A 3ID8A 2P9KA 3FZLA 1G15A 4CCHA 4JI0K 2FF6A 1CLQA 1YVNA 4H0TB 3WUHA 2DFEA 2VGMA 5LMNK 1WBDA 3LL3A 1T3VA 1WSGA 4OLBA 4CEZA 1TL1A 2QKBA 4FJMA 5IWAK 4AQYK 1W7AA 4A5AA 1IBMK 4BRCA 4E7IA 3T3FA 3MWPA 5JVHL 1FW6A 1NGEA 2P9IA 3TARA 5C0YA 2AA4A 1TUYA 2QA4N 3VA3A 4CZFA 4FOEA 3P5JA 5M1KA 3CQYA 4W5QA 2RF2A 4CD1A 2E1YA 1KAXA 1LCUA 4WFBL 3H1VX 3VF6A 4IFYA 1T6CA 1EP4A 2DPNA 3L8BA 3T1AA 5KQ8A 1NK5A 4CFDA 4B9LA 4H5VA 4C8MA 3LZIA 3NF7A 3CIPA 4CZGA 1QQMA 3CCMN 3BP8A 3THVA 1UA1A 1RT4A 1BQMA 1KFSA 3CG7A 3ZT2A 1IV0A 1ZYQA 5HBMA 5HOOA 1HNIA 3K5LA 2G8KA 1QSSA 4OKKA 1Q18A 5TKYA 4CZKA 3S3NA 4B9MA 4MO5A 3OW2M 4E89A 3EYZA 3L6QA 3DXMB 3THXA 4MDAA 5AQOA 3I33A 3C6HA 5AQHA 1NU0A 4ILJA 4FJJA 1NGBA 2Z1IA 5AZIA 2F4VK 3HM9A 3GOIA 1NKEA 1GLCG 4FLVA 3ZYYX 3CERA 4CHOA 1NKBA 4DSLA 4CEOA 2Y1JA 1RT5A 3SBTA 1J53A 3BEXA 3WQTA 4YNQA 1ZBUA 3Q7CA 4O4GA 1NGIA 3CETA 2X6SA 5C42A 2UUAK 3RWUA 3MEGA 2B4JA 2NZTA 2ASMA 4KBOA 4B1YB 3HVRA 5BPMA 3ISNC 3VPZA 4K43A 3K57A 4B3MK 3HVTA 3QO9A 4KTZA 4Z4CA 3DLKA 2WONA 4FJ8A 2YKNA 4DMNA 3JYTA 5JVGL 3DLBA 1FKPA 3C6TA 1ZBFA 4WQ5C 1CXQA 2IGIA 1ASUA 5F1XA 2NNWA 3C0BA 5AZJB 4BC5A 2HBKA 2FSKA 1BHLA 4GW6A 3L3VA 4FK0A 3VQCA 5AFUA 4CGGA 4EP4A 3KLGA 4DSKA 3SLCA 3NFAA 4JD2A 2R7YA 1QS4A 5D3GA 3HRGA 1GLEG 4CZIA 1VQLN 1SQKA 4W5TA 4IWVA 1WSHA 4F3OA 1S6QA 1VSIA 2O8BA 4RG8A 3V9ZA 5JS2A 1VQ4N 3LALA 1EQYA 4CFAA 3HSTB 1YVUA 4KHSA 3THXB 1RT2A 2YJFA 4U67L 2BTFA 2FSNA 5AQMA 3HT3A 1HYZA 1B9DA 4MLEA 4JI3K 4DQQA 3I8BA 3VTHA 2IDOA 3QFPA 3AA3A 3H6EA 4PHTX 4PKGA 4KTQA 3GG4A 4DV4K 4N76A 1J9AA 4W5OA 4CGJA 3EE8A 1ASVA 4DHYA 1QVFM 3CJCA 2BDPA 5GAEP 4FWOA 2YKMA 4R79A 1TK5A 4FZXC 1WNSA 4DR3K 5ADXA 5KGXA 4G1QA 5KI6A 4AM7A 2QKKA 4BR9A 4DB3A 4CW7B 1RCHA 2X6NA 3ALYA 3DLLL 1KQSM 1SKSA 5FPMA 1WUAA 1NG9A 3VERA 4IG0A 4JK7A 3U8XA 3VETA 1KSPA 1OH8A 3K58A 4E7HA 3IMXA 1GLJO 4BREA 4DR4K 1C0TA 3NMUA 4CJKA 4KH6A 2A6AA 4KI4A 2B6AA 3CC7N 1EKEA 3LDLA 2PAVA 2I7PA 2KFNA 3VQDA 3QBWA 2KQ2A 1JLQA 4JD2B 2F8TA 1JLFA 4DFJA 1Q81O 1Z05A 4H0PA 4EZ6A 2E5LK 3U9ZA 3O9UA 4FK4A 3O80A 3VESA 5FLXO 5BN9A 3CPEA 3NVMA 4G9ZA 3LM2A 3WXMB 3LWLA 1NNEA 3AO1A 4BR0A 1YUWA 1RTHA 2ZF5O 2PZSA 2O8BB 3R6MA 2FBYA 4PQUA 1W2BM 2YNHA 3DWLA 3HPHA 2RN2A 3H08A 4B8AB 2FBXA 1KAZA 2I7NA 4BGBA 3MMVA 3AVBA 2E8AA 3OYMA 3M1FA 4IJNA 1TKDA 1GOCA 4B9VA 3KWIA 2GWKA 5LL6Z 4CF8A 1TKZA 5CYQA 2RPIA 1YHQN 2HHWA 3MX2A 3CI5A 2Z1JA 4DKWA 1NK6A 2WOMA 1R0AA 5AQZA 2NLXA 2YNGA 4FXDA 1L5UA 1XMQK 3NDKA 1VSKA 2HHQA 1X9SA 4BRIA 2WC9A 3ZETA 2VYPA 4KFBA 4M7XA 1S9GA 4CGDA 1ITGA 2E2OA 4OLAA 4BC2A 3VN5A 3MAQA 1BO5O 1NK9A 5CY4A 3ID6A 1YI2N 4O0JA 4HUGA 1HQUA 4YORA 3KHYA 4FM0A 2Y1IA 4NCBA 1J54A 4CJVA 5HRRA 3DRPA 3H1QA 2OANA 1VSMA 3T7ZA 5J2MA 4DTXA 4FJHA 3A5OC 3CCLN 2E20A 4KHUA 4DSIA 1I39A 4ISFA 3D45A 1HPZA 2VGNA 5LMUK 3TI0A 2J4RA 1TAUA 4CEBA 1RT6A 1DKGD 2VWKA 4FYDA 5KTQA 4DS4A 2O8DA 2QWNA 3S9HA 3AVCA 2YNFA 2OTJN 3JSMA 4HCBA 5CE3A 4WQ4C 4GNIA 5B8HA 1ZBLA 3OYEA 4HVJA 2GWJA 1QTMA 3VQEA 5E26A 1C0MA 2PFUA 4DFMA 4BDYA 2HMIA 1ZC6A 1RNHA 3ASMA 2OA8A 2QK9A 3NGIA 2PY5A 5LJWA 2YI1A 2NRZA 3OVNA 4FPBA 3M8SA 3LAKA 4B3TK 4YOWA 3AVIA 5AQIA 3L4IA 3K59A 5SWMA 4CK2A 3RSEB 3BF3A 4CHPA 1NGCA 4C8OA 4BR2A 1IBKK 2GUPA 3OBYA 4KV8A 2PBDA 2Z1GA 3IAYA 1SKRA 4I2QA 1D9FA 4OPAA 3U3GA 1L3TA 5FRNA 1WOQA 5KPRA 2ZGYA 4ELVA 4DV1K 1W0HA 4AH9A 4M3WA 4CIFA 1YF5L 3AY9A 2LSNA 1KC8O 4GVMA 4RW6A 4A2AA 4EAHD 1KFDA 1VQON 1KLMA 4DV5K 1JLBA 3J80O 3VQ5A 4NLCA 3VEZA 1XHZA 5AR0A 4IJAA 3LDQA 2IOCA 3JXUA 1IBLK 1K8AO 1U2VA 3NAEA 3QESA 2CGLA 2WBNA 4BRPA 1BA0A 3S3OA 4BACA 2CGKA 4LF7K 3KTQA 3ZT1A 3MN5A 2Z1HA 4F2SA 1IG9A 2F7TA 4BVPA 2PYLA 3KD5E 4JI7K 4Q0BA 5AQLA 5LJVA 4K42A 3OYGA 3RMDA 3HP6A 2A1SA 3ENOA 2YCHA 1BWFO 4PA1A 3OYHA 1T6DA 2BE2A 1JL2A 4O8KA 1XC9A 1Q86O 4LC9B 5EU7A 1U45A 4RW8A 4QS8A 3NGZA 1M1KO 2O4IA 2OPRA 1K8KA 1WBBA 4BDPA 3C7NA 2G8HA 3GBTA 2HHHK 3WXKA 2IIRA 3AVMA 3FZKA 4BG8A 1V4SA 1N33K 2B5JA 3WXLA 1BCOA 1X1PA 3LP3A 5M1FA 2P9SB 3LDPA 3TTDA 4JV5K 3BZCA 1EWRA 2O8CB 1BG3A 2ZGZA 1HR0K 4IOXA 3NGYA 2GV9A 2D0CA 3VQ9A 4J8FA 4JI4K 4DU4A 4BRGA 2WFBA 3KK3A 3FR0A 3HPGA 4BE1A 1QHTA 1SAZA 1GOAA 2ETJA 3LPUA 1OH7A 5GAHP 1YJWN 3TWHA 3QIPA 1BL3A 3PIOL 2QWLA 1U47A 4OVLA 5BR9A 1NJWA 4CHZA 1L3UA 1F21A 1U2VB 4KB1A 2HNDA 3FFKB 1GLDG 4CJ5A 4LF5K 3CFRA 1BUPA 3QICA 4FWPA 1GLAG 4FLUA 4QCLA 3DXKB 3O4WA 4FLZA 4YOVA 2EHGA 3ULEA 3SPYA 1CZ9A 4YY3K 1CZAN 1TK8A 1LWFA 3L4QA 5I9EB 5AQUA 1C6VA 3QLHA 1RGIA 4C23A 1X9JA 5AQNA 1J6ZA 3ZSOA 4PL8A 1L3SA 5BPNA 4CF2A 1EX4A 3NH1A 3NVKA 1QQOA 3UE5A 5K14A 3QINA 3C7NB 4FVMA 4WF9L 4Y0WA 2KW4A 3RR8A 4DV6K 1TK0A 3J7ZO 3ZT4A 2QI2A 3V81A 3M6GA 3THYB 4H4OA 1JLEA 2VWBA 4Y1DA 3HSCA 4WFNL 3WQUA 3KKSA 5CYMA 4H4MA 3VQ7A 2QTDA 4JEPA 1YITN 1U04A 3G0ZA 4OPKA 2D0BA 3W0LA 4R5PA 3JAMO 1XI1A 2HVHA 5KQDA 3O9RA 1C1BA 4ISEA 2ITMA 3TPQA 3SYZA 2PYJA 4CGIA 4C1NI 2RHKA 1QHAA 4Z4FA 4YDUC 2QM1A 1VAZA 5EY4A 1JLAA 2Q31A 2OZSA 4DFKA 5AQKA 3N4PA 4UY8O 4Z4GA 5EXWA 1NGGA 2D0AA 4BRDA 5KRTA 3KK2A 3TSQA 5BN8A 5LY3A 1KLNA 3DOLA 3EEQA 1EETA 4FLXA 4NXNK 1T44A 4C8NA 1SL2A 2KTQA 3TR8A 2ITGA 3B6PA 5AQFA 2BGGA 4YOXA 4RW4A 3J8AA 2XY7A 3ULEB 3WEEA 2XY6A 2GBZA 4EHUA 4Z94A 1QZ6A 1N8RO 4CD3A 3EN9A 2P5GA 4LY7A 1A5WA 3KWGA 1QSYA 3KLFA 1NJZA 1JCEA 4KI6A 3A5LC 4FWNA 2X74A 4CZEA 4B3SK 3WNEA 3IDHA 4OKEA 1I94K 1NGDA 1ILYA 3MN9A 1UAXA 4I6MA 4IZ9A 3ZSVA 2E4LA 2A5XA 1QZ5A 2VG7A 5ELZA 1NK4A 4FCYA 1S1XA 1EO1A 1VSFA 2P9KB 4LFBK 4AM6A 5C24A 3BF1A 2ASOA 4K8ZA 4CFCA 1Y64A 1HNWK 1JXEA 1TKTA 4E7KA 5JS1A 1LV5A 4BC3A 1EXQA 2AP1A 2IVOA 3R8EA 5MLCQ 5EX5A 5BRFA 4DTOA 2NRVA 4M42A 4JI2K 3SAFA 4JRPA 3ITHA 1TVRA 4E1MA 5JICA 2P9IB 1RFQA 3SMPA 5HL7L 1S1UA 3CJ1A 4A62A 2Q97A 4JHDA 1HKCA 3CCSN 4CERA 5ADXH 1BGXT 1MU2A 2G8IA 3MECA 4OKJA 3EKSA 4J2DA 4H5RA 3KK1A 4E3SA 4KRFA 3AO4A 5GIPA 3T19A 1NGHA 3SUPA 1VQPN 1A5VA 1RTIA 3WNFA 5BPLA 4ICLA 2F96A 3SJHA 1T8EA 5DK5A 2NRRA 3BZKA 4X66K 3SUQA 4JKAA 5FRMA 2OPQA 3HBTA 3WEEB 1QVGM 3QBXA 4MDBA 2P9PA 1IKVA 2DFHA 3AA4A 4FZZA 3LP1A 3VQ4A 3CMAN 3A5NC 3L2UA 3SJJA 4ZTFA 1K6YA 2IVNA 1KTQA 1NMNA 4DTPA 4DUZK 1GOBA 4CHYA 4JK8A 3CFPA 4KO0A 5AZIB 4CVNE 1HPMA 2KLAA 2OYQA 3OS0A 1UWBA 2Q1NA 3D0PA 1ATSA 1HMVA 1BISA 3WNHA 4KHPK 3G71N 4CECA 4WCEL 3G10A 4ID5A 1LWEA 4DTJA 4BRMA 2ASPA 4KH4A 3VQ6A 2HB5A 2NRTA 1RDUA 1ESVA 4NB4A 4A59A 5FROA 3QIOA 3CYMA 4DFPA 3E66A 5KPZA 4LH5A 2QWRA 3M3ZA 2F8SA 1X3MA 4OGCA 2A41A 3F5TA 3C6AA 3DLEA 1BIZA 3QDKA 3B8AX 3G4SN 2GEMA 1BI4A 3S3MA 1DGKN 1HLUA 1J5OA 1V4TA 4JHDB 2EX3A 5HLFA 4U7BA 3LPTA 2CGJA 2GTDA 3U3YA 3AGKA 5GAGP 3AA2A 3AO3A 3C6UA 1E4FT 3VA0A 4FOIA 3SQ4A 3A5MC 2OCEA 1SL1A 4Z4HA 5AQPA 4OO1J 5FPDA 4N5SA 1SKWA 4HWIA 3OYKA 5H1SQ 4LF9K 1TV6A 4CJPA 2P9PB 1NJYA 4GV6A 4FJIA 1TKXA 4AILC 3M8QA 3OYCA 2E6LA 4IFVA 4M7YA 1HNVA 3DM2A 3TU5A 2UXBK 4H8KA 1XQSC 2ZJRL 2RE2A 1NGFA 4KPYA 1S1WA 3MX5A 3ZT0A 2D4WA 3OYNA 1NK0A 4FK2A 1NWKA 4IO8A 3SUNA 3H3NO 2VG5A 4JN4A 2OPPA 2HNZA 3ZSWA 3AO5A 4WFAL 3K9KA 4CJRA 2VQEK 4A2BA 4DSFA 1SL0A 1WSEA 1NJXA 3RMCA 4EZ9A 3S41A 4CEQA 3P4IA 4I9QA 4DV2K 1KVAA 2QXLA 4LH4A 3ZX2A 1WLJA 3TAGA 3RTVA 1FJGK 4FLYA 3PY8A 4DWIA 2F9WA 4E1NA 3QEXA 1VQ9N 1BI4B 1ZBSA 5EVZA 1VSDA 1XWLA 4FW2A 4NYFA 1VSEA 4DQPA 2A1RA 4M3ZA 3V6DA 3NH2A 3DMJA 5M1NA 3SI6A 4DSJA 2ZJQL 1YJNN 3KLIA 4BC4A 4NCAA 2DFFA 4H5WA 4QAGA 2X78A 5DM6L 4JS5A 1IKYA 4V19S 4GV9A 4BRKA 3CFOA 4DR1K 3LZJA 2HF4A 3T69A 4CZMA 1RDAA 3VEYA 4PY5A 2P51A 3CC4N 3CJ9A 3ZCMA 3MXIA 4E0DA 3K2PA 2HBLA 3MN6A 2E2QA 4H03B 4E7JA 3TAPA 4KHWA 4JNEA 4AHRA 2UXCK 5HRSA 1NM1A 3WXJA 2CH5A 3DRRA 3VEOA 2Q0RA 3MDQA 2WUSA 3GL1A 1BOTO 3TTCA 1RBSA 5KGWA 2KKZA 3O9TA 3OA9A 3FFIA 1VQMN 5C25A 1B92A 4BVOA 4K41A 3NE6A 2XY5A 4I2PA 1XNRK 4BRQA 3FLCO 2KFZA 4KH5A 1ATRA 1C0GA 4DQIA 4FM2A 3FZHA 4CJ7A 3ZSYA 4K0KK 3UKRA 5JLHA 1XUPO 1HJRA 2E6MA 5M1OA 5SZTA 1IO2A 1D5AA 1WSJA 3ZETB 3KZBA 3K5OA 4LSNA 1S72N 4Z4EA 5J2QA 3U4LA 3E9PA 3UB5A 2O8FA 3ZT3A 3DLHA 1U48A 1WSIA 1NLVA 3M8PA 3OS2A 1FK9A 4BR5A 4HCCA 3I0RA 4FVUA 1C1CA 2W6KA 4QS7A 3O9SA 4FPAA 3VEWA 3G25A 5C12A 1TYQA 3QERA 3A0IX 2FLOA 3AVGA 5FPNA 3LP0A 3AAPA 2NUBA 5CZ2A 3AV9A 4CJFA 3C95A 4JS4A 2GUIA 3OS1A 4C8LA 4C8KA 1VK0A 4F3TA 4CF9A 2HHTA 4GV3A 3VQPA 4HTLA 4DQSA 4O5BA 2P9UA 4DSEA 4BE0A 3WXIA 3SUOA 2O8DB 2IAJA 2IVPA 4M3TA 4DTSA 2HHXA 1S6PA 5DMRA 1NGJA 3F9MA 3B6OA 3LP2A 4M45A 1IJJA 4NXMK 5E41A 3E1YA 1BU6O 1VQNN 2V51B 4JKGA 2ZJPL 1E4GT 2E2PA 2D0OA 3MCPA 4JKCA 3V9SA 5CHIA 2QWPA 3AVFA 4CHNA 4HUEA 1RTJA 3VENA 4FM1A 4DR6K 4O0IA 2E88A 3IRXA 4XH5A 3RVCA 3LDSA 1W9HA 2ZQBA 1XHXA 1VQ5N 1HNXK 4O55A 4M3XA 2HOEA 4OJRA 4Y1CA 2AJQA 4AHSA 3IUCA 2JLEA 4J2BA 1O1WA 4H0XB 5IT9O 2NRXA 4FJKA 3O3GA 1HRHA 2KHOA 1A5XA 3CC2N 2D5RA 3TSUA 5BR8K 3RMAA 1YTAA 1C0UA 2FSJA 3QB0A 1L3VA 4IBNA 4RCHA 2O8FB 4RTFD 3E9LA 3FGUA 4JK9A 1HYSA 3CQ8A 4NO7A 2FC0A 4KTWA 4Q5VA 4MLHA 3F2KA 4A61A 4QS9A 3AARA 1JLGA 1K9MO 4KAZA 3HJFA 5C15A 3U6FA 1VQ6N 2QXFA 4BRLA 4FW1A 4C1NK 4FJLA 4CJSA 2KZMA 5AQXA 2ZWHA 4DF8A 3TANA 3OYAA 3VQQA 4BROA 3SQ0A 2HNYA 5AQRA 1RDCA 4TSXA 1JCFA 2XY8A 1KAYA 1HKGA 3HL8A 3MK6A 3K5NA 1U6ZA 3CJBA 3NHGA 3KKRA 2P9UB 3ULDA 4DTNA 3O4NA 1DEJA 4XIUA 4F4KA 2A42A 3AO2A 3TABA 4RW9A 2FF3B 1N5YA 1ZXOA 4IO9L 5CZ1A 3ZSRA 3AVHA 4CESA 3QNNA 2DTUA 1VRUA 3CXCM 3OJSA 3DYAA 3NCIA 1RDBA 1S5JA 3F73A 2YJEA 4HTUA 1WSFA 3VQBA 4EHTA 3TAQA 1IKWA 4PKHA 4B9TA 1SV5A 4EFHA 2Q3SA 4IKFA 3ZEUA 4WQ5A 1NJIO 3AVAA 2G8UA 5AQTA 3DOKA 4FSVA 1K8KB 2NRWA 3OHRA 1S22A 3SCXA 3OYBA 4CFBA 3DXMA 5C2DA 1KVCA 4B08A 3CD6N 1WN7A 4FZYA 4BRNA 4O8UA 1K73O 1JLCA 1NKCA 3PX4A 4M63C 3O3HA 3FZMA 4EIAA 1UA0A 4NLBA 2VG6A 1TGOA 4B9UA 3HI0A 3L2WA 1T03A 5AQSA 4CZJA 4K8XA 3ENHA 1JJ2M 2D0PA 2YX6A 4CK1A 3K0SA 3SAGA 3A2FA 4B1XB 4PKIA 2V52B 3BUZB 1NOYA 4YOTA 3L3UA 4L8RB 3RRGA 4IFEA 4OGEA 3V9WA 4I9LA 2HHUA 1MWMA 4HHTA 4DQ8A 5AQYA 3QEPA 4W5RA 3OYDA 4BQZA 4ELUA 1T7PA 4DG1A 4LF6K 3QMLA 1NMDA 3O4QA 4IXCA 4BR4A 2QEXN 4JYAK 1ZBIA 3CQXA 3HP9A 4CF1A 3T1YK 4CEDA 3EE9A 3V4IA 5KPTA 5AZJA 2XHBA 1BQNA 3DLRA 5GADP 5AFUH 5JLFA 4ID1A 3CCQN 4ZTJA 5J2NA 3VEVA 5JMVA 3OYJA 4XH1A 3ZEUB 4FO0A 4BQLA 2OTLN 3EKUA 3K9JA 4PWDA 4BWMA 4JKBA 3DAWA 3FE1A 3J81O 1Y97A 3V9UA 3TAEA 4NCGA 4M3RA 1LWCA 3EO3A 2EWSA 3LM9A 2HSTA 3VGLA 3QNOA 1GLBG 1FKOA 1CZBA 3VF2A 2QWOA 3E9OA 3P83D 1C0FA 3O5BA 4M3UA 4DV3K 3PLAA 4OX9K 3RR7A 1REVA 1HUXA 3THWA 3R1XA 1RILA 4K25A 3VMFB 1U4BA 3O3FA 4BGAA 3ENBA 4B1UB 5HROA 4FJNA 1RDWX 2FBTA 3PIPL 4GVEA 4WYBA 3HXMA 3MEEA 4ILGB 5BRDA 1X9MA 1U49A 1VSJA 5FDLA 4IDKA 4B8CA 3UIQA 3AA5X 5AQVA 3QFUA 4EP5A 3VGKA 2UUBK 3DLGA 4CBWA 3SQ1A 4JKHA 3SV3A 1OKJA 4DLGA 5F0XA 3KIOA 1RT7A 2HHSA 3W3DA 3D7EO 1BCMA 4CI6A 4RW7A 4CE9A 3KJVA 5AJ3K 3HOSA 1OVQA 3MCAB 1LAVA 3HOTA 1T05A 2GX9A 4DR5K 5KRSA 3V9XA 3LWMA 1D9DA 5T7BA 3IS9A 3OY9A 4M41A 3IFRA 1LOTB 3SMSA 4B9QA 4CZHA 1BIUA 2O4GA 2P1JA 3V1RA 3SPZA 1KD1O 2UUCK 4B9NA 1O13A 1N32K 4DUYK 4H0VB 1CXUA 4I6MB 2WTUA 1RTDA 3L2RA 1S1TA 3H45C 4IEEA 2E1ZA 4JAXA 4NYNA 3O08A 4IOAL 3L2VA 4JRQA 3I0SA 4YOYA 3G6EN 4N47A 3CCVN 4CJ4A 4CF0A 4DU3A 3AAQA 3RRHA 4FWSA 1Q7YO 1P90A 4H0OA 5HRPA 3KLHA 1KVBA 3VTIA 4JI1K 4CJ3A 2W42A 1QSLA 4AF1A 4B3OA 3THWB 3TTFA 1XNQK 4LFAK 4JI6K 4CK3A 4QOZB 1H1VA 2JWKA 1KCFA 1RT1A 1TUUA 4CJUA 2W40A 3EY1A 1S9EA 4JKFA 4WQ4A 4JI5K 3VOVA 3AVKA 1WB9A 2ATQA 1SZ2A 4FWRA 5HP1A 3ATVA 4DCHA 2UU9K 4FWMA 1RBTA 4MO4A 1UOCA 1MDUB 3BDPA 4KHNA 3TSPA 1NK8A 2ZD1A 2HMPA 2JWLA 2IC3A 3E01A 4AHUA 4IG3A 4ZHRA 4X65K 4W5NA 3P1GA 1KXPA 3P31A 2HF3A 3V1QA 2G8VA 2W6LA 3K5MA 3NH0A 5DM7L 1HX1A 4CJEA 1DTTA 3IG1A 4KREA 3HZ6A 3SNNA 3CM5A 3GDQA 4CEAA 4CBUA 1MA9B 2G8FA 1TL3A 4B3RK 2YHAA 3N4QA 4FLWA 1Q82O 1RBVA 4AHCA 1KRPA 2KZZA 4AHVA 2OZMA 4X62K 2I5JA 4DTRA 4L3QA 5TKWA 4N56A 4BRAA 2QWQA 1HKBA 3AVLA 3H46O 1QQNA 3SAHA 3PO5A 2YV0X 3O1WA 4DTMA 4KKOA 2HBJA 1HYVA 1DTQA 4BRHA 3PX0A 4BY9C 2G8WA 3MWTA 4FJ7A 1YIJN 1Z6RA 4Z0UA 4FJXA 1SS6A 3VF4A 4F9OA 1B9FA 5AQGA 3OYLA 3BY5A 5CR4A 2NRHA 3D6RA 1GLLO 4JKDA 2P5OA 4FWLA 4KHYA 1DLOA 4CJWA 4FL9A 3ZSQA 3P39A 1IKXA 4GKKK 3CCRN 3SBGA 2V7ZA 3VEXA 4FLTA 3RSEA 3D2EA 3LDNA 3CCEN 2E2NA 4GKJK 4KB0A 2JGUA 3CF5L 4CZLA 1P8ZA 3CJAA 4BWJA 1I3AA 2Q0UA 1YTUA 2F9TA 4CGFA 4YHHK 4IOCL 3CCUN 3EL2A 5I42A 3PSFA 4H0YB 2XO7A 2BH1A 3O6WA 3VGMA 3LDOA 5HRNA 3UKUA 3HK2A 1Q9XA 3ZSZA 1HNZK 3PSIA 2A40A 2Q2RA 3OYFA 3KLEA 3CPWM 1ATNA 1NOZA 5J2PA 4CIGA 4ELTA 3NF8A 1C1AA 1BDGA 4FJ5A 2FXUA 4JI8K 1HQEA 3JS6A 1W97L 4H5TA 1Z25A 5EOYA 3OYIA 4J2AA 3M8RA 3KK7A 1JKHA 3HM8A 5AQJA 3J7YP 4DR2K 1J5EK 3HO1A 3QEVA 2YHBA 3MN7A 1VQ8N 3PUFA 4YFUA 3AVJA 4A57A 2W41A 2H3GX 1JXBA 3U9DA 1G99A 3L2QA 2P9LA 4FWKA 3OJUA 1LAWA 3F9KA 4DV0K 2ZE2A 2GELA
chains in the Genus database with same CATH topology
3NF6A 2XY8A 2E4LA 4KI4A 1ZBHA 2B6AA 3HL8A 2VG7A 3K5NA 1NK4A 1EKEA 4FCYA 1S1XA 1VSFA 3NHGA 3KKRA 2KFNA 1RBUA 3VQDA 4CJKA 3ULDA 4DTNA 5C24A 3O4NA 4CHQA 4K8ZA 4CFCA 2KQ2A 1IH7A 4BDZA 1JLQA 4XIUA 3MXJA 1JXEA 1TKTA 3AO2A 4E7KA 4F4KA 1JLFA 3DI6A 4CJQA 4DFJA 4FXDA 1LV5A 3TABA 4RW9A 5JS1A 4EZ6A 1EXQA 1N5YA 4FK4A 5CZ1A 3ZSRA 3AVHA 4CESA 3QNNA 2DTUA 1VRUA 1RDDA 4DTOA 1S1VA 3OJSA 4M42A 3DYAA 3NCIA 1RDBA 1S5JA 3F73A 3LWLA 4JRPA 4HTUA 1WSFA 3VQBA 4JLHA 3AO1A 3ITHA 1TVRA 4E1MA 3TAQA 1RTHA 1IKWA 2PZSA 4DLEA 3PX6A 4FJGA 2FBYA 1SV5A 4B9TA 4PQUA 2Q3SA 5I3UA 4IKFA 2YNHA 1S1UA 3HPHA 2RN2A 3LANA 3H08A 4I7FA 4B8AB 2FBXA 4HUFA 3AVAA 2G8UA 3AVBA 4KHQA 4CERA 3QETA 3OYMA 1BGXT 1MU2A 3DOKA 2G8IA 3MECA 4OKJA 4DTUA 3EZ5A 1D8YA 1TKDA 1GOCA 4B9VA 4J2DA 3KK1A 1Q8IA 4E3SA 4KRFA 3AO4A 3SCXA 3T19A 3SUPA 3SZ2A 3OYBA 4CFBA 4CF8A 4J2EA 1KVCA 1A5VA 1RTIA 1TKZA 2RPIA 5CYQA 3WNFA 2OPSA 2HHWA 2Z1JA 4B08A 2YNIA 4ICLA 2IS3A 2F96A 1WN7A 1T8EA 5DK5A 1NK6A 1QQCA 4O44A 2WOMA 1R0AA 4FZYA 2HW3A 4N41A 1JLCA 1NKCA 2YNGA 3SUQA 3ZSXA 1L5UA 2OPQA 2XRIA 5FRMA 3NDKA 1VSKA 3PX4A 1X9SA 4MFBA 3O3HA 2HHQA 1UA0A 4PUOA 2VG6A 1TGOA 3MXMA 1Z26A 4BE2A 4B9UA 3L2WA 1IKVA 2DFHA 3AA4A 3CM6A 1T03A 3LP1A 4FZZA 3VQ4A 4KFBA 4OPJA 1VRTA 4K8XA 1S9GA 4CGDA 3L2UA 1ITGA 4M3YA 3HPOA 3SJJA 3WNGA 3I8DA 1K6YA 4CK1A 4ZTFA 4OLAA 1KTQA 4DTPA 3A2FA 3VQ8A 1NOYA 3VN5A 1GOBA 4CHYA 3L3UA 4L8RB 3MAQA 3RRGA 1NK9A 5CY4A 3CFPA 4Z4IA 4KO0A 4OGEA 3V9WA 4I9LA 4O0JA 2HHUA 4HHTA 4HUGA 2DY4A 1HQUA 2OYQA 4FM0A 2Y1IA 3QEPA 3OS0A 1UWBA 4W5RA 3OYDA 4ELUA 4DU1A 1J54A 4NCBA 1T7PA 3D0PA 4DG1A 4CJVA 1HMVA 1BISA 3DRPA 3O4QA 5HRRA 3WNHA 1VSMA 5J2MA 4CECA 4DTXA 3G10A 1ZBIA 4ID5A 1LWEA 3HP9A 4DTJA 4FJHA 4E19A 4KHUA 4CF1A 3VQ6A 4DSIA 2HB5A 1I39A 4CEDA 3V4IA 1RT3A 2RKIA 2XHBA 1ASWA 3D45A 4DF4A 1BQNA 1HPZA 2HVIA 5FROA 3QIOA 3CYMA 3DLRA 4DFPA 3TI0A 3QEWA 2HHVA 3PO4A 1TAUA 4LH5A 4CEBA 1VSLA 1RT6A 2VWKA 4ID1A 4FYDA 4LD0A 5KTQA 2F8SA 4DS4A 1WAFA 4ZTJA 3RMBA 5J2NA 4OGCA 3DRSA 3S9HA 3AVCA 3DLEA 1BIZA 2YNFA 3JSMA 4HCBA 3OYJA 2F8TA 1BI4A 3S3MA 4LSLA 1ZBLA 1J5OA 3C94A 4B9SA 2EX3A 3HYFA 1VSHA 4WE1A 4PWDA 3OYEA 4BWMA 5HLFA 4CGHA 3TAFA 4HVJA 3BGRA 1TAQA 4CJLA 1QTMA 3LPTA 1Y97A 3VQEA 3V9UA 3TAEA 4NCGA 1C0MA 3U3YA 1X9WA 4DFMA 4BDYA 2HMIA 1LWCA 4M3RA 1RNHA 3ASMA 3AA2A 3AO3A 3C6UA 2OA8A 2QK9A 3NGIA 3VA0A 3QNOA 2PY5A 1FKOA 4GMJB 1CZBA 3OVNA 3V1OA 3VQAA 2FBVA 4FJ9A 3P83D 3SQ4A 4F2RA 3M8SA 3LAKA 4CIEA 4M3UA 2BANA 3SQ2A 1SL1A 3AVIA 4Z4HA 3RR7A 1REVA 4CEFA 3K59A 5SWMA 4CK2A 4N5SA 1RILA 4CHPA 3KD1E 1NK7A 1SKWA 1LW0A 3OYKA 3PV8A 3LAMA 1U4BA 3O3FA 4C8OA 5HROA 4FJNA 1TV6A 4KV8A 1N6QA 4CJPA 5J1EA 2FBTA 1NJYA 1Q9YA 4DS5A 4FJIA 1QE1A 1TKXA 2Z1GA 3NF9A 4AILC 3M8QA 4CEEA 3OYCA 2E6LA 4IFVA 1SKRA 4I2QA 3IAYA 3HXMA 3MEEA 1X9MA 1HNVA 1D9FA 1FXXA 3DM2A 3U3GA 4DQRA 1U49A 3TAMA 1L3TA 4AHTA 5FRNA 3SV4A 1VSJA 5FDLA 4IDKA 4H8KA 4B8CA 3UIQA 3AA5X 1LW2A 4ELVA 1RBRA 3NBPA 4EP5A 1W0HA 3DLGA 1WAJA 4F8RA 4AH9A 4KPYA 4M3WA 1S1WA 4CIFA 3ZT0A 3OYNA 1NK0A 3SQ1A 4FK2A 4E7LA 3SV3A 2LSNA 4DLGA 4GVMA 3SUNA 3KIOA 3MEDA 1RT7A 2VG5A 2HHSA 1JL1A 2OPPA 2HNZA 4RW6A 1BCMA 3AVNA 3ZSWA 3QEIA 3AO5A 4RW7A 1KFDA 4CJRA 1KLMA 4UQGA 1JLBA 4CE9A 2VWJA 4DSFA 3VQ5A 1WSEA 1SL0A 3KJVA 1NJXA 1XHZA 4CJTA 1YT3A 3RMCA 4EZ9A 2IOCA 1LAVA 4CEQA 1T05A 3NAEA 1SUQA 4I9QA 1KVAA 4MQ3A 3QESA 4LH4A 3S3OA 4BACA 5KRSA 3KTQA 3ZT1A 3V9XA 3LWMA 1D9DA 5T7BA 2Z1HA 3IS9A 3OY9A 1WLJA 1G15A 4M41A 4F2SA 1IG9A 3KD5E 2PYLA 4CCHA 3TAGA 3RTVA 1CLQA 4FLYA 3PY8A 2DFEA 4Q0BA 4DWIA 4E1NA 3QEXA 1BIUA 2O4GA 2P1JA 3V1RA 3SPZA 4B9NA 1BI4B 3OYGA 3RMDA 1WSGA 4OLBA 3HP6A 1VSDA 1XWLA 1TL1A 4CEZA 1CXUA 2A1SA 4FW2A 1RTDA 2QKBA 3L2RA 4FJMA 4NYFA 1S1TA 1VSEA 4DQPA 2A1RA 4M3ZA 4NYNA 4PA1A 4E7IA 3OYHA 3NH2A 3T3FA 2BE2A 3V6DA 1JL2A 3L2VA 4JRQA 3DMJA 3I0SA 3TARA 1XC9A 4N47A 3VA3A 4CJ4A 4CF0A 3SI6A 4DU3A 4DSJA 3P5JA 3KLIA 5EU7A 3RRHA 1U45A 4NCAA 4RW8A 4W5QA 2DFFA 2RF2A 4QAGA 3NGZA 2O4IA 2OPRA 2X78A 4JS5A 4BDPA 5HRPA 3KLHA 2G8HA 1KVBA 4CJ3A 2W42A 1IKYA 4IFYA 1QSLA 1EP4A 3CFOA 3L8BA 3AVMA 3T1AA 4B3OA 3LZJA 1NK5A 4CFDA 4B9LA 4C8MA 1RDAA 3LZIA 3NF7A 4PY5A 2B5JA 2P51A 4CK3A 3ZCMA 3MXIA 4E0DA 4QOZB 3K2PA 1BCOA 1X1PA 3LP3A 1KCFA 1RT1A 1UA1A 3THVA 1RT4A 4CJUA 3EY1A 4E7JA 1BQMA 1S9EA 3TAPA 4AHRA 4KHWA 5HRSA 1KFSA 3DRRA 3AVKA 3CG7A 3ZT2A 2ATQA 5HP1A 1ZYQA 5HBMA 3NGYA 1HNIA 2GV9A 2D0CA 3K5LA 2G8KA 1QSSA 4OKKA 3VQ9A 1RBSA 1RBTA 4DU4A 5KGWA 3KK3A 1UOCA 3S3NA 3BDPA 4B9MA 3HPGA 4KHNA 4BE1A 4E89A 1QHTA 3EYZA 3FFIA 1NK8A 2ZD1A 1GOAA 5C25A 2ETJA 3LPUA 1B92A 3NE6A 2IC3A 4I2PA 2XY5A 3TWHA 4FJJA 2KFZA 3E01A 4AHUA 3QIPA 4DQIA 1BL3A 4FM2A 2Z1IA 4IG3A 3HM9A 1U47A 1NJWA 4OVLA 1L3UA 4CHZA 3ZSYA 4ZHRA 1F21A 1NKEA 4W5NA 3P1GA 4FLVA 4CHOA 1NKBA 4DSLA 4KB1A 2HNDA 1HJRA 2E6MA 3V1QA 2G8VA 5SZTA 4CJ5A 3K5MA 1IO2A 1D5AA 1WSJA 4CEOA 3NH0A 1RT5A 3CFRA 1J53A 3K5OA 4LSNA 2Y1JA 4FLUA 4CJEA 1DTTA 3IG1A 4Z4EA 5J2QA 4QCLA 4TSXA 4KREA 4YNQA 3SNNA 3CM5A 1ZBUA 4FLZA 4CEAA 3ZT3A 4O4GA 2EHGA 1TL3A 2G8FA 2YHAA 2X6SA 5C42A 1U48A 3DLHA 1WSIA 3RWUA 3SPYA 4FLWA 3M8PA 1RBVA 1CZ9A 2B4JA 3MEGA 4AHCA 1KRPA 3OS2A 1FK9A 3HVRA 1TK8A 3ISNC 1LWFA 4HCCA 2KZZA 4AHVA 2OZMA 2I5JA 3K57A 3I0RA 1C1CA 4DTRA 3HVTA 3QO9A 4KTZA 1C6VA 4N56A 3AVLA 4Z4CA 3DLKA 2WONA 3QLHA 3QERA 4FJ8A 3PO5A 2YV0X 3AVGA 4DTMA 3LP0A 4KKOA 1HYVA 1DTQA 2YKNA 4DMNA 3ZSOA 2NUBA 3JYTA 3PX0A 5CZ2A 3AV9A 1L3SA 4CJFA 3DLBA 1FKPA 4CF2A 3C6TA 2G8WA 1EX4A 1ZBFA 3C95A 4JS4A 2GUIA 3OS1A 4FJ7A 1CXQA 3NH1A 4C8LA 4Z0UA 4C8KA 1VK0A 4FJXA 4F3TA 2IGIA 1ASUA 4CF9A 5K14A 2HHTA 3VQPA 3QINA 4FVMA 1B9FA 2KW4A 1BHLA 4DQSA 3OYLA 4GW6A 3RR8A 3L3VA 4FK0A 3VQCA 4CGGA 1TK0A 4O5BA 4EP4A 3ZT4A 3KLGA 4DSEA 3V81A 2P5OA 4KHYA 4BE0A 4DSKA 4H4OA 3NFAA 1DLOA 1JLEA 4CJWA 4Y1DA 2R7YA 3SUOA 2IAJA 3ZSQA 1QS4A 5D3GA 1IKXA 4M3TA 4DTSA 2HHXA 1S6PA 3KKSA 5CYMA 5DMRA 4H4MA 3VQ7A 3B6OA 4FLTA 3LP2A 4M45A 1U04A 5E41A 4W5TA 3G0ZA 4OPKA 2D0BA 4KB0A 2JGUA 4R5PA 1WSHA 4F3OA 1XI1A 1S6QA 2HVHA 1VSIA 4RG8A 4BWJA 1C1BA 1I3AA 5JS2A 3V9ZA 3SYZA 3V9SA 2PYJA 4CGIA 3AVFA 3LALA 4CGFA 4CHNA 4HUEA 4Z4FA 1YTUA 4CFAA 3HSTB 1RTJA 1YVUA 4KHSA 4FM1A 1RT2A 4O0IA 5I42A 3IRXA 1JLAA 3HT3A 1HYZA 2XO7A 2OZSA 1B9DA 5HRNA 3LDSA 4DFKA 4DQQA 1W9HA 2IDOA 2ZQBA 1XHXA 4Z4GA 4O55A 4M3XA 3HK2A 4OJRA 2D0AA 5KRTA 4Y1CA 3AA3A 3ZSZA 4AHSA 3KK2A 1Q9XA 2AJQA 2JLEA 4KTQA 4N76A 1KLNA 4J2BA 3DOLA 1O1WA 1EETA 3OYFA 4FLXA 4C8NA 4FJKA 1J9AA 4W5OA 4CGJA 3O3GA 1SL2A 1ASVA 1HRHA 3KLEA 2KTQA 1A5XA 2D5RA 3TR8A 2ITGA 3B6PA 2BDPA 1NOZA 5J2PA 3RMAA 1YTAA 1C0UA 4CIGA 2YKMA 3NF8A 1C1AA 1L3VA 4ELTA 2BGGA 4IBNA 4RW4A 4FJ5A 2XY7A 1TK5A 4FZXC 1WNSA 1HYSA 2XY6A 2GBZA 1HQEA 5KGXA 4G1QA 5KI6A 1Z25A 3CQ8A 2QKKA 2FC0A 4KTWA 3OYIA 4Q5VA 4J2AA 1RCHA 2P5GA 2X6NA 4LY7A 3M8RA 1A5WA 3ALYA 1QSYA 1JLGA 3KLFA 4KAZA 3HJFA 1NJZA 3U6FA 1SKSA 2QXFA 4KI6A 1JKHA 4FW1A 4IG0A 4FJLA 4CJSA 3HO1A 3QEVA 2YHBA 1KSPA 2KZMA 3PUFA 4YFUA 3AVJA 3K58A 2X74A 4E7HA 4DF8A 3TANA 3WNEA 3OYAA 1JXBA 4OKEA 3VQQA 3L2QA 3SQ0A 2HNYA 1UAXA 3OJUA 1LAWA 1RDCA 3F9KA 3ZSVA 1C0TA 2ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF6 A;  2XY8 A;  2E4L A;  4KI4 A;  1ZBH A;  2B6A A;  3HL8 A;  2VG7 A;  3K5N A;  1NK4 A;  1EKE A;  4FCY A;  1S1X A;  1VSF A;  3NHG A;  3KKR A;  2KFN A;  1RBU A;  3VQD A;  4CJK A;  3ULD A;  4DTN A;  5C24 A;  3O4N A;  4CHQ A;  4K8Z A;  4CFC A;  2KQ2 A;  1IH7 A;  4BDZ A;  1JLQ A;  4XIU A;  3MXJ A;  1JXE A;  1TKT A;  3AO2 A;  4E7K A;  4F4K A;  1JLF A;  3DI6 A;  4CJQ A;  4DFJ A;  4FXD A;  1LV5 A;  3TAB A;  4RW9 A;  5JS1 A;  4EZ6 A;  1EXQ A;  1N5Y A;  4FK4 A;  5CZ1 A;  3ZSR A;  3AVH A;  4CES A;  3QNN A;  2DTU A;  1VRU A;  1RDD A;  4DTO A;  1S1V A;  3OJS A;  4M42 A;  3DYA A;  3NCI A;  1RDB A;  1S5J A;  3F73 A;  3LWL A;  4JRP A;  4HTU A;  1WSF A;  3VQB A;  4JLH A;  3AO1 A;  3ITH A;  1TVR A;  4E1M A;  3TAQ A;  1RTH A;  1IKW A;  2PZS A;  4DLE A;  3PX6 A;  4FJG A;  2FBY A;  1SV5 A;  4B9T A;  4PQU A;  2Q3S A;  5I3U A;  4IKF A;  2YNH A;  1S1U A;  3HPH A;  2RN2 A;  3LAN A;  3H08 A;  4I7F A;  4B8A B;  2FBX A;  4HUF A;  3AVA A;  2G8U A;  3AVB A;  4KHQ A;  4CER A;  3QET A;  3OYM A;  1BGX T;  1MU2 A;  3DOK A;  2G8I A;  3MEC A;  4OKJ A;  4DTU A;  3EZ5 A;  1D8Y A;  1TKD A;  1GOC A;  4B9V A;  4J2D A;  3KK1 A;  1Q8I A;  4E3S A;  4KRF A;  3AO4 A;  3SCX A;  3T19 A;  3SUP A;  3SZ2 A;  3OYB A;  4CFB A;  4CF8 A;  4J2E A;  1KVC A;  1A5V A;  1RTI A;  1TKZ A;  2RPI A;  5CYQ A;  3WNF A;  2OPS A;  2HHW A;  2Z1J A;  4B08 A;  2YNI A;  4ICL A;  2IS3 A;  2F96 A;  1WN7 A;  1T8E A;  5DK5 A;  1NK6 A;  1QQC A;  4O44 A;  2WOM A;  1R0A A;  4FZY A;  2HW3 A;  4N41 A;  1JLC A;  1NKC A;  2YNG A;  3SUQ A;  3ZSX A;  1L5U A;  2OPQ A;  2XRI A;  5FRM A;  3NDK A;  1VSK A;  3PX4 A;  1X9S A;  4MFB A;  3O3H A;  2HHQ A;  1UA0 A;  4PUO A;  2VG6 A;  1TGO A;  3MXM A;  1Z26 A;  4BE2 A;  4B9U A;  3L2W A;  1IKV A;  2DFH A;  3AA4 A;  3CM6 A;  1T03 A;  3LP1 A;  4FZZ A;  3VQ4 A;  4KFB A;  4OPJ A;  1VRT A;  4K8X A;  1S9G A;  4CGD A;  3L2U A;  1ITG A;  4M3Y A;  3HPO A;  3SJJ A;  3WNG A;  3I8D A;  1K6Y A;  4CK1 A;  4ZTF A;  4OLA A;  1KTQ A;  4DTP A;  3A2F A;  3VQ8 A;  1NOY A;  3VN5 A;  1GOB A;  4CHY A;  3L3U A;  4L8R B;  3MAQ A;  3RRG A;  1NK9 A;  5CY4 A;  3CFP A;  4Z4I A;  4KO0 A;  4OGE A;  3V9W A;  4I9L A;  4O0J A;  2HHU A;  4HHT A;  4HUG A;  2DY4 A;  1HQU A;  2OYQ A;  4FM0 A;  2Y1I A;  3QEP A;  3OS0 A;  1UWB A;  4W5R A;  3OYD A;  4ELU A;  4DU1 A;  1J54 A;  4NCB A;  1T7P A;  3D0P A;  4DG1 A;  4CJV A;  1HMV A;  1BIS A;  3DRP A;  3O4Q A;  5HRR A;  3WNH A;  1VSM A;  5J2M A;  4CEC A;  4DTX A;  3G10 A;  1ZBI A;  4ID5 A;  1LWE A;  3HP9 A;  4DTJ A;  4FJH A;  4E19 A;  4KHU A;  4CF1 A;  3VQ6 A;  4DSI A;  2HB5 A;  1I39 A;  4CED A;  3V4I A;  1RT3 A;  2RKI A;  2XHB A;  1ASW A;  3D45 A;  4DF4 A;  1BQN A;  1HPZ A;  2HVI A;  5FRO A;  3QIO A;  3CYM A;  3DLR A;  4DFP A;  3TI0 A;  3QEW A;  2HHV A;  3PO4 A;  1TAU A;  4LH5 A;  4CEB A;  1VSL A;  1RT6 A;  2VWK A;  4ID1 A;  4FYD A;  4LD0 A;  5KTQ A;  2F8S A;  4DS4 A;  1WAF A;  4ZTJ A;  3RMB A;  5J2N A;  4OGC A;  3DRS A;  3S9H A;  3AVC A;  3DLE A;  1BIZ A;  2YNF A;  3JSM A;  4HCB A;  3OYJ A;  2F8T A;  1BI4 A;  3S3M A;  4LSL A;  1ZBL A;  1J5O A;  3C94 A;  4B9S A;  2EX3 A;  3HYF A;  1VSH A;  4WE1 A;  4PWD A;  3OYE A;  4BWM A;  5HLF A;  4CGH A;  3TAF A;  4HVJ A;  3BGR A;  1TAQ A;  4CJL A;  1QTM A;  3LPT A;  1Y97 A;  3VQE A;  3V9U A;  3TAE A;  4NCG A;  1C0M A;  3U3Y A;  1X9W A;  4DFM A;  4BDY A;  2HMI A;  1LWC A;  4M3R A;  1RNH A;  3ASM A;  3AA2 A;  3AO3 A;  3C6U A;  2OA8 A;  2QK9 A;  3NGI A;  3VA0 A;  3QNO A;  2PY5 A;  1FKO A;  4GMJ B;  1CZB A;  3OVN A;  3V1O A;  3VQA A;  2FBV A;  4FJ9 A;  3P83 D;  3SQ4 A;  4F2R A;  3M8S A;  3LAK A;  4CIE A;  4M3U A;  2BAN A;  3SQ2 A;  1SL1 A;  3AVI A;  4Z4H A;  3RR7 A;  1REV A;  4CEF A;  3K59 A;  5SWM A;  4CK2 A;  4N5S A;  1RIL A;  4CHP A;  3KD1 E;  1NK7 A;  1SKW A;  1LW0 A;  3OYK A;  3PV8 A;  3LAM A;  1U4B A;  3O3F A;  4C8O A;  5HRO A;  4FJN A;  1TV6 A;  4KV8 A;  1N6Q A;  4CJP A;  5J1E A;  2FBT A;  1NJY A;  1Q9Y A;  4DS5 A;  4FJI A;  1QE1 A;  1TKX A;  2Z1G A;  3NF9 A;  4AIL C;  3M8Q A;  4CEE A;  3OYC A;  2E6L A;  4IFV A;  1SKR A;  4I2Q A;  3IAY A;  3HXM A;  3MEE A;  1X9M A;  1HNV A;  1D9F A;  1FXX A;  3DM2 A;  3U3G A;  4DQR A;  1U49 A;  3TAM A;  1L3T A;  4AHT A;  5FRN A;  3SV4 A;  1VSJ A;  5FDL A;  4IDK A;  4H8K A;  4B8C A;  3UIQ A;  3AA5 X;  1LW2 A;  4ELV A;  1RBR A;  3NBP A;  4EP5 A;  1W0H A;  3DLG A;  1WAJ A;  4F8R A;  4AH9 A;  4KPY A;  4M3W A;  1S1W A;  4CIF A;  3ZT0 A;  3OYN A;  1NK0 A;  3SQ1 A;  4FK2 A;  4E7L A;  3SV3 A;  2LSN A;  4DLG A;  4GVM A;  3SUN A;  3KIO A;  3MED A;  1RT7 A;  2VG5 A;  2HHS A;  1JL1 A;  2OPP A;  2HNZ A;  4RW6 A;  1BCM A;  3AVN A;  3ZSW A;  3QEI A;  3AO5 A;  4RW7 A;  1KFD A;  4CJR A;  1KLM A;  4UQG A;  1JLB A;  4CE9 A;  2VWJ A;  4DSF A;  3VQ5 A;  1WSE A;  1SL0 A;  3KJV A;  1NJX A;  1XHZ A;  4CJT A;  1YT3 A;  3RMC A;  4EZ9 A;  2IOC A;  1LAV A;  4CEQ A;  1T05 A;  3NAE A;  1SUQ A;  4I9Q A;  1KVA A;  4MQ3 A;  3QES A;  4LH4 A;  3S3O A;  4BAC A;  5KRS A;  3KTQ A;  3ZT1 A;  3V9X A;  3LWM A;  1D9D A;  5T7B A;  2Z1H A;  3IS9 A;  3OY9 A;  1WLJ A;  1G15 A;  4M41 A;  4F2S A;  1IG9 A;  3KD5 E;  2PYL A;  4CCH A;  3TAG A;  3RTV A;  1CLQ A;  4FLY A;  3PY8 A;  2DFE A;  4Q0B A;  4DWI A;  4E1N A;  3QEX A;  1BIU A;  2O4G A;  2P1J A;  3V1R A;  3SPZ A;  4B9N A;  1BI4 B;  3OYG A;  3RMD A;  1WSG A;  4OLB A;  3HP6 A;  1VSD A;  1XWL A;  1TL1 A;  4CEZ A;  1CXU A;  2A1S A;  4FW2 A;  1RTD A;  2QKB A;  3L2R A;  4FJM A;  4NYF A;  1S1T A;  1VSE A;  4DQP A;  2A1R A;  4M3Z A;  4NYN A;  4PA1 A;  4E7I A;  3OYH A;  3NH2 A;  3T3F A;  2BE2 A;  3V6D A;  1JL2 A;  3L2V A;  4JRQ A;  3DMJ A;  3I0S A;  3TAR A;  1XC9 A;  4N47 A;  3VA3 A;  4CJ4 A;  4CF0 A;  3SI6 A;  4DU3 A;  4DSJ A;  3P5J A;  3KLI A;  5EU7 A;  3RRH A;  1U45 A;  4NCA A;  4RW8 A;  4W5Q A;  2DFF A;  2RF2 A;  4QAG A;  3NGZ A;  2O4I A;  2OPR A;  2X78 A;  4JS5 A;  4BDP A;  5HRP A;  3KLH A;  2G8H A;  1KVB A;  4CJ3 A;  2W42 A;  1IKY A;  4IFY A;  1QSL A;  1EP4 A;  3CFO A;  3L8B A;  3AVM A;  3T1A A;  4B3O A;  3LZJ A;  1NK5 A;  4CFD A;  4B9L A;  4C8M A;  1RDA A;  3LZI A;  3NF7 A;  4PY5 A;  2B5J A;  2P51 A;  4CK3 A;  3ZCM A;  3MXI A;  4E0D A;  4QOZ B;  3K2P A;  1BCO A;  1X1P A;  3LP3 A;  1KCF A;  1RT1 A;  1UA1 A;  3THV A;  1RT4 A;  4CJU A;  3EY1 A;  4E7J A;  1BQM A;  1S9E A;  3TAP A;  4AHR A;  4KHW A;  5HRS A;  1KFS A;  3DRR A;  3AVK A;  3CG7 A;  3ZT2 A;  2ATQ A;  5HP1 A;  1ZYQ A;  5HBM A;  3NGY A;  1HNI A;  2GV9 A;  2D0C A;  3K5L A;  2G8K A;  1QSS A;  4OKK A;  3VQ9 A;  1RBS A;  1RBT A;  4DU4 A;  5KGW A;  3KK3 A;  1UOC A;  3S3N A;  3BDP A;  4B9M A;  3HPG A;  4KHN A;  4BE1 A;  4E89 A;  1QHT A;  3EYZ A;  3FFI A;  1NK8 A;  2ZD1 A;  1GOA A;  5C25 A;  2ETJ A;  3LPU A;  1B92 A;  3NE6 A;  2IC3 A;  4I2P A;  2XY5 A;  3TWH A;  4FJJ A;  2KFZ A;  3E01 A;  4AHU A;  3QIP A;  4DQI A;  1BL3 A;  4FM2 A;  2Z1I A;  4IG3 A;  3HM9 A;  1U47 A;  1NJW A;  4OVL A;  1L3U A;  4CHZ A;  3ZSY A;  4ZHR A;  1F21 A;  1NKE A;  4W5N A;  3P1G A;  4FLV A;  4CHO A;  1NKB A;  4DSL A;  4KB1 A;  2HND A;  1HJR A;  2E6M A;  3V1Q A;  2G8V A;  5SZT A;  4CJ5 A;  3K5M A;  1IO2 A;  1D5A A;  1WSJ A;  4CEO A;  3NH0 A;  1RT5 A;  3CFR A;  1J53 A;  3K5O A;  4LSN A;  2Y1J A;  4FLU A;  4CJE A;  1DTT A;  3IG1 A;  4Z4E A;  5J2Q A;  4QCL A;  4TSX A;  4KRE A;  4YNQ A;  3SNN A;  3CM5 A;  1ZBU A;  4FLZ A;  4CEA A;  3ZT3 A;  4O4G A;  2EHG A;  1TL3 A;  2G8F A;  2YHA A;  2X6S A;  5C42 A;  1U48 A;  3DLH A;  1WSI A;  3RWU A;  3SPY A;  4FLW A;  3M8P A;  1RBV A;  1CZ9 A;  2B4J A;  3MEG A;  4AHC A;  1KRP A;  3OS2 A;  1FK9 A;  3HVR A;  1TK8 A;  3ISN C;  1LWF A;  4HCC A;  2KZZ A;  4AHV A;  2OZM A;  2I5J A;  3K57 A;  3I0R A;  1C1C A;  4DTR A;  3HVT A;  3QO9 A;  4KTZ A;  1C6V A;  4N56 A;  3AVL A;  4Z4C A;  3DLK A;  2WON A;  3QLH A;  3QER A;  4FJ8 A;  3PO5 A;  2YV0 X;  3AVG A;  4DTM A;  3LP0 A;  4KKO A;  1HYV A;  1DTQ A;  2YKN A;  4DMN A;  3ZSO A;  2NUB A;  3JYT A;  3PX0 A;  5CZ2 A;  3AV9 A;  1L3S A;  4CJF A;  3DLB A;  1FKP A;  4CF2 A;  3C6T A;  2G8W A;  1EX4 A;  1ZBF A;  3C95 A;  4JS4 A;  2GUI A;  3OS1 A;  4FJ7 A;  1CXQ A;  3NH1 A;  4C8L A;  4Z0U A;  4C8K A;  1VK0 A;  4FJX A;  4F3T A;  2IGI A;  1ASU A;  4CF9 A;  5K14 A;  2HHT A;  3VQP A;  3QIN A;  4FVM A;  1B9F A;  2KW4 A;  1BHL A;  4DQS A;  3OYL A;  4GW6 A;  3RR8 A;  3L3V A;  4FK0 A;  3VQC A;  4CGG A;  1TK0 A;  4O5B A;  4EP4 A;  3ZT4 A;  3KLG A;  4DSE A;  3V81 A;  2P5O A;  4KHY A;  4BE0 A;  4DSK A;  4H4O A;  3NFA A;  1DLO A;  1JLE A;  4CJW A;  4Y1D A;  2R7Y A;  3SUO A;  2IAJ A;  3ZSQ A;  1QS4 A;  5D3G A;  1IKX A;  4M3T A;  4DTS A;  2HHX A;  1S6P A;  3KKS A;  5CYM A;  5DMR A;  4H4M A;  3VQ7 A;  3B6O A;  4FLT A;  3LP2 A;  4M45 A;  1U04 A;  5E41 A;  4W5T A;  3G0Z A;  4OPK A;  2D0B A;  4KB0 A;  2JGU A;  4R5P A;  1WSH A;  4F3O A;  1XI1 A;  1S6Q A;  2HVH A;  1VSI A;  4RG8 A;  4BWJ A;  1C1B A;  1I3A A;  5JS2 A;  3V9Z A;  3SYZ A;  3V9S A;  2PYJ A;  4CGI A;  3AVF A;  3LAL A;  4CGF A;  4CHN A;  4HUE A;  4Z4F A;  1YTU A;  4CFA A;  3HST B;  1RTJ A;  1YVU A;  4KHS A;  4FM1 A;  1RT2 A;  4O0I A;  5I42 A;  3IRX A;  1JLA A;  3HT3 A;  1HYZ A;  2XO7 A;  2OZS A;  1B9D A;  5HRN A;  3LDS A;  4DFK A;  4DQQ A;  1W9H A;  2IDO A;  2ZQB A;  1XHX A;  4Z4G A;  4O55 A;  4M3X A;  3HK2 A;  4OJR A;  2D0A A;  5KRT A;  4Y1C A;  3AA3 A;  3ZSZ A;  4AHS A;  3KK2 A;  1Q9X A;  2AJQ A;  2JLE A;  4KTQ A;  4N76 A;  1KLN A;  4J2B A;  3DOL A;  1O1W A;  1EET A;  3OYF A;  4FLX A;  4C8N A;  4FJK A;  1J9A A;  4W5O A;  4CGJ A;  3O3G A;  1SL2 A;  1ASV A;  1HRH A;  3KLE A;  2KTQ A;  1A5X A;  2D5R A;  3TR8 A;  2ITG A;  3B6P A;  2BDP A;  1NOZ A;  5J2P A;  3RMA A;  1YTA A;  1C0U A;  4CIG A;  2YKM A;  3NF8 A;  1C1A A;  1L3V A;  4ELT A;  2BGG A;  4IBN A;  4RW4 A;  4FJ5 A;  2XY7 A;  1TK5 A;  4FZX C;  1WNS A;  1HYS A;  2XY6 A;  2GBZ A;  1HQE A;  5KGX A;  4G1Q A;  5KI6 A;  1Z25 A;  3CQ8 A;  2QKK A;  2FC0 A;  4KTW A;  3OYI A;  4Q5V A;  4J2A A;  1RCH A;  2P5G A;  2X6N A;  4LY7 A;  3M8R A;  1A5W A;  3ALY A;  1QSY A;  1JLG A;  3KLF A;  4KAZ A;  3HJF A;  1NJZ A;  3U6F A;  1SKS A;  2QXF A;  4KI6 A;  1JKH A;  4FW1 A;  4IG0 A;  4FJL A;  4CJS A;  3HO1 A;  3QEV A;  2YHB A;  1KSP A;  2KZM A;  3PUF A;  4YFU A;  3AVJ A;  3K58 A;  2X74 A;  4E7H A;  4DF8 A;  3TAN A;  3WNE A;  3OYA A;  1JXB A;  4OKE A;  3VQQ A;  3L2Q A;  3SQ0 A;  2HNY A;  1UAX A;  3OJU A;  1LAW A;  1RDC A;  3F9K A;  3ZSV A;  1C0T A;  2ZE2 A; 
#chains in the Genus database with same CATH topology
 3NF6 A;  5M1P A;  1ZBH A;  3AGR A;  2QWM A;  1RBU A;  4ISG A;  2A3Z A;  4CHQ A;  4BDZ A;  1IH7 A;  1BA1 A;  2VCP A;  4X64 K;  3MXJ A;  4CJQ A;  3DI6 A;  3WT0 A;  2YHY A;  4B1Z A;  1RDD A;  3H3O B;  3L0Q A;  1S1V A;  3D2F A;  3D2E B;  4JLH A;  1S3X A;  4FJG A;  4DLE A;  2VQF K;  3PX6 A;  2P9S A;  3DJC A;  4PL7 A;  5I3U A;  2O8C A;  1IG8 A;  3EZW A;  4I7F A;  3LAN A;  1OH5 A;  4HUF A;  4LF4 K;  1MWK A;  2O8E A;  4KHQ A;  3OTO K;  3QET A;  1DT9 A;  4YOU A;  4DTU A;  3EZ5 A;  3O1B A;  1D8Y A;  4BRF A;  3FZF A;  1Q8I A;  3Q7B A;  3ZLJ A;  3UKU B;  4DV7 K;  4BG9 A;  1R59 O;  3SZ2 A;  4OPH A;  1VHX A;  4J2E A;  3ZX0 A;  2OPS A;  2YNI A;  2IS3 A;  4CBX A;  2V7Y A;  1QQC A;  1YAG A;  4O44 A;  5C10 A;  1N34 K;  2HW3 A;  4N41 A;  2CH6 A;  3ZSX A;  3I55 N;  2XRI A;  4MFB A;  4H5N A;  5GIO A;  4PUO A;  3MXM A;  1Z26 A;  4BE2 A;  4IEI A;  5AQW A;  3CM6 A;  3M5R A;  5FPE A;  4OPJ A;  1VRT A;  3SK3 A;  1VQ7 N;  3DXK A;  4YDU A;  2UXD K;  4M3Y A;  3HPO A;  3WNG A;  3I8D A;  3VQ8 A;  3GE1 A;  3P38 A;  4XH4 A;  2P9N A;  4LFC K;  1D4X A;  3O8M A;  4Z4I A;  2P9L B;  2DY4 A;  3IKM A;  1OH6 A;  3UKR B;  3CJ7 A;  4DU1 A;  2QW9 A;  4E19 A;  5BRH A;  1X3N A;  5C2F A;  1RT3 A;  2RKI A;  1ASW A;  4DF4 A;  3T1H K;  2HVI A;  4B1W B;  5E84 A;  3I56 N;  3QEW A;  2HHV A;  3PO4 A;  1VSL A;  3CHW A;  3D2F B;  4LD0 A;  3THY A;  1WAF A;  3R9P A;  1YXQ A;  3RMB A;  3ATU A;  3DRS A;  1TYQ B;  5AQQ A;  5M1Q A;  4LSL A;  1YJ9 N;  3C94 A;  1JCG A;  2Q36 A;  4B9S A;  3HYF A;  1E3M A;  1VSH A;  2O8E B;  3A8Y A;  4WE1 A;  2YHW A;  4O5F A;  4DR7 K;  4CGH A;  3TAF A;  3BGR A;  1TAQ A;  4CJL A;  1EWQ A;  4GY2 B;  1X9W A;  3ZX3 A;  5BRE A;  2ZM6 K;  4JKE A;  2YHX A;  1XC3 A;  4GMJ B;  3V1O A;  4FJ9 A;  3VQA A;  2FBV A;  4F2R A;  4A5B A;  4CIE A;  2BAN A;  4FWQ A;  3CCJ N;  3SQ2 A;  4B1V A;  4CEF A;  3HTV A;  1HJO A;  3KD1 E;  1NK7 A;  1LW0 A;  3PV8 A;  3LAM A;  5F2R A;  3R3L A;  3O9Q A;  4E1J A;  5A2Q O;  1N36 K;  3KVG A;  1N6Q A;  4JKG B;  5J1E A;  1Q9Y A;  4DS5 A;  4IDH A;  1QE1 A;  4XEI A;  3NF9 A;  4CEE A;  1M90 O;  4LF8 K;  3J7A P;  1FXX A;  4DQR A;  3TAM A;  5GIN A;  4AHT A;  3SV4 A;  1XMO K;  1VQK N;  1GLF O;  1LW2 A;  2P9N B;  1RBR A;  3NBP A;  4F8R A;  1WAJ A;  4ILH A;  3C65 A;  4E7L A;  3MED A;  1JL1 A;  2HBM A;  2BUP A;  1NGA A;  4RWT A;  3AVN A;  3QEI A;  2D1K A;  4UQG A;  2VWJ A;  2UYT A;  3CME N;  4CJT A;  1YT3 A;  3OBW A;  4BR7 A;  1OVY A;  1NBW A;  1SUQ A;  4MQ3 A;  3ID8 A;  2P9K A;  3FZL A;  1G15 A;  4CCH A;  4JI0 K;  2FF6 A;  1CLQ A;  1YVN A;  4H0T B;  3WUH A;  2DFE A;  2VGM A;  5LMN K;  1WBD A;  3LL3 A;  1T3V A;  1WSG A;  4OLB A;  4CEZ A;  1TL1 A;  2QKB A;  4FJM A;  5IWA K;  4AQY K;  1W7A A;  4A5A A;  1IBM K;  4BRC A;  4E7I A;  3T3F A;  3MWP A;  5JVH L;  1FW6 A;  1NGE A;  2P9I A;  3TAR A;  5C0Y A;  2AA4 A;  1TUY A;  2QA4 N;  3VA3 A;  4CZF A;  4FOE A;  3P5J A;  5M1K A;  3CQY A;  4W5Q A;  2RF2 A;  4CD1 A;  2E1Y A;  1KAX A;  1LCU A;  4WFB L;  3H1V X;  3VF6 A;  4IFY A;  1T6C A;  1EP4 A;  2DPN A;  3L8B A;  3T1A A;  5KQ8 A;  1NK5 A;  4CFD A;  4B9L A;  4H5V A;  4C8M A;  3LZI A;  3NF7 A;  3CIP A;  4CZG A;  1QQM A;  3CCM N;  3BP8 A;  3THV A;  1UA1 A;  1RT4 A;  1BQM A;  1KFS A;  3CG7 A;  3ZT2 A;  1IV0 A;  1ZYQ A;  5HBM A;  5HOO A;  1HNI A;  3K5L A;  2G8K A;  1QSS A;  4OKK A;  1Q18 A;  5TKY A;  4CZK A;  3S3N A;  4B9M A;  4MO5 A;  3OW2 M;  4E89 A;  3EYZ A;  3L6Q A;  3DXM B;  3THX A;  4MDA A;  5AQO A;  3I33 A;  3C6H A;  5AQH A;  1NU0 A;  4ILJ A;  4FJJ A;  1NGB A;  2Z1I A;  5AZI A;  2F4V K;  3HM9 A;  3GOI A;  1NKE A;  1GLC G;  4FLV A;  3ZYY X;  3CER A;  4CHO A;  1NKB A;  4DSL A;  4CEO A;  2Y1J A;  1RT5 A;  3SBT A;  1J53 A;  3BEX A;  3WQT A;  4YNQ A;  1ZBU A;  3Q7C A;  4O4G A;  1NGI A;  3CET A;  2X6S A;  5C42 A;  2UUA K;  3RWU A;  3MEG A;  2B4J A;  2NZT A;  2ASM A;  4KBO A;  4B1Y B;  3HVR A;  5BPM A;  3ISN C;  3VPZ A;  4K43 A;  3K57 A;  4B3M K;  3HVT A;  3QO9 A;  4KTZ A;  4Z4C A;  3DLK A;  2WON A;  4FJ8 A;  2YKN A;  4DMN A;  3JYT A;  5JVG L;  3DLB A;  1FKP A;  3C6T A;  1ZBF A;  4WQ5 C;  1CXQ A;  2IGI A;  1ASU A;  5F1X A;  2NNW A;  3C0B A;  5AZJ B;  4BC5 A;  2HBK A;  2FSK A;  1BHL A;  4GW6 A;  3L3V A;  4FK0 A;  3VQC A;  5AFU A;  4CGG A;  4EP4 A;  3KLG A;  4DSK A;  3SLC A;  3NFA A;  4JD2 A;  2R7Y A;  1QS4 A;  5D3G A;  3HRG A;  1GLE G;  4CZI A;  1VQL N;  1SQK A;  4W5T A;  4IWV A;  1WSH A;  4F3O A;  1S6Q A;  1VSI A;  2O8B A;  4RG8 A;  3V9Z A;  5JS2 A;  1VQ4 N;  3LAL A;  1EQY A;  4CFA A;  3HST B;  1YVU A;  4KHS A;  3THX B;  1RT2 A;  2YJF A;  4U67 L;  2BTF A;  2FSN A;  5AQM A;  3HT3 A;  1HYZ A;  1B9D A;  4MLE A;  4JI3 K;  4DQQ A;  3I8B A;  3VTH A;  2IDO A;  3QFP A;  3AA3 A;  3H6E A;  4PHT X;  4PKG A;  4KTQ A;  3GG4 A;  4DV4 K;  4N76 A;  1J9A A;  4W5O A;  4CGJ A;  3EE8 A;  1ASV A;  4DHY A;  1QVF M;  3CJC A;  2BDP A;  5GAE P;  4FWO A;  2YKM A;  4R79 A;  1TK5 A;  4FZX C;  1WNS A;  4DR3 K;  5ADX A;  5KGX A;  4G1Q A;  5KI6 A;  4AM7 A;  2QKK A;  4BR9 A;  4DB3 A;  4CW7 B;  1RCH A;  2X6N A;  3ALY A;  3DLL L;  1KQS M;  1SKS A;  5FPM A;  1WUA A;  1NG9 A;  3VER A;  4IG0 A;  4JK7 A;  3U8X A;  3VET A;  1KSP A;  1OH8 A;  3K58 A;  4E7H A;  3IMX A;  1GLJ O;  4BRE A;  4DR4 K;  1C0T A;  3NMU A;  4CJK A;  4KH6 A;  2A6A A;  4KI4 A;  2B6A A;  3CC7 N;  1EKE A;  3LDL A;  2PAV A;  2I7P A;  2KFN A;  3VQD A;  3QBW A;  2KQ2 A;  1JLQ A;  4JD2 B;  2F8T A;  1JLF A;  4DFJ A;  1Q81 O;  1Z05 A;  4H0P A;  4EZ6 A;  2E5L K;  3U9Z A;  3O9U A;  4FK4 A;  3O80 A;  3VES A;  5FLX O;  5BN9 A;  3CPE A;  3NVM A;  4G9Z A;  3LM2 A;  3WXM B;  3LWL A;  1NNE A;  3AO1 A;  4BR0 A;  1YUW A;  1RTH A;  2ZF5 O;  2PZS A;  2O8B B;  3R6M A;  2FBY A;  4PQU A;  1W2B M;  2YNH A;  3DWL A;  3HPH A;  2RN2 A;  3H08 A;  4B8A B;  2FBX A;  1KAZ A;  2I7N A;  4BGB A;  3MMV A;  3AVB A;  2E8A A;  3OYM A;  3M1F A;  4IJN A;  1TKD A;  1GOC A;  4B9V A;  3KWI A;  2GWK A;  5LL6 Z;  4CF8 A;  1TKZ A;  5CYQ A;  2RPI A;  1YHQ N;  2HHW A;  3MX2 A;  3CI5 A;  2Z1J A;  4DKW A;  1NK6 A;  2WOM A;  1R0A A;  5AQZ A;  2NLX A;  2YNG A;  4FXD A;  1L5U A;  1XMQ K;  3NDK A;  1VSK A;  2HHQ A;  1X9S A;  4BRI A;  2WC9 A;  3ZET A;  2VYP A;  4KFB A;  4M7X A;  1S9G A;  4CGD A;  1ITG A;  2E2O A;  4OLA A;  4BC2 A;  3VN5 A;  3MAQ A;  1BO5 O;  1NK9 A;  5CY4 A;  3ID6 A;  1YI2 N;  4O0J A;  4HUG A;  1HQU A;  4YOR A;  3KHY A;  4FM0 A;  2Y1I A;  4NCB A;  1J54 A;  4CJV A;  5HRR A;  3DRP A;  3H1Q A;  2OAN A;  1VSM A;  3T7Z A;  5J2M A;  4DTX A;  4FJH A;  3A5O C;  3CCL N;  2E20 A;  4KHU A;  4DSI A;  1I39 A;  4ISF A;  3D45 A;  1HPZ A;  2VGN A;  5LMU K;  3TI0 A;  2J4R A;  1TAU A;  4CEB A;  1RT6 A;  1DKG D;  2VWK A;  4FYD A;  5KTQ A;  4DS4 A;  2O8D A;  2QWN A;  3S9H A;  3AVC A;  2YNF A;  2OTJ N;  3JSM A;  4HCB A;  5CE3 A;  4WQ4 C;  4GNI A;  5B8H A;  1ZBL A;  3OYE A;  4HVJ A;  2GWJ A;  1QTM A;  3VQE A;  5E26 A;  1C0M A;  2PFU A;  4DFM A;  4BDY A;  2HMI A;  1ZC6 A;  1RNH A;  3ASM A;  2OA8 A;  2QK9 A;  3NGI A;  2PY5 A;  5LJW A;  2YI1 A;  2NRZ A;  3OVN A;  4FPB A;  3M8S A;  3LAK A;  4B3T K;  4YOW A;  3AVI A;  5AQI A;  3L4I A;  3K59 A;  5SWM A;  4CK2 A;  3RSE B;  3BF3 A;  4CHP A;  1NGC A;  4C8O A;  4BR2 A;  1IBK K;  2GUP A;  3OBY A;  4KV8 A;  2PBD A;  2Z1G A;  3IAY A;  1SKR A;  4I2Q A;  1D9F A;  4OPA A;  3U3G A;  1L3T A;  5FRN A;  1WOQ A;  5KPR A;  2ZGY A;  4ELV A;  4DV1 K;  1W0H A;  4AH9 A;  4M3W A;  4CIF A;  1YF5 L;  3AY9 A;  2LSN A;  1KC8 O;  4GVM A;  4RW6 A;  4A2A A;  4EAH D;  1KFD A;  1VQO N;  1KLM A;  4DV5 K;  1JLB A;  3J80 O;  3VQ5 A;  4NLC A;  3VEZ A;  1XHZ A;  5AR0 A;  4IJA A;  3LDQ A;  2IOC A;  3JXU A;  1IBL K;  1K8A O;  1U2V A;  3NAE A;  3QES A;  2CGL A;  2WBN A;  4BRP A;  1BA0 A;  3S3O A;  4BAC A;  2CGK A;  4LF7 K;  3KTQ A;  3ZT1 A;  3MN5 A;  2Z1H A;  4F2S A;  1IG9 A;  2F7T A;  4BVP A;  2PYL A;  3KD5 E;  4JI7 K;  4Q0B A;  5AQL A;  5LJV A;  4K42 A;  3OYG A;  3RMD A;  3HP6 A;  2A1S A;  3ENO A;  2YCH A;  1BWF O;  4PA1 A;  3OYH A;  1T6D A;  2BE2 A;  1JL2 A;  4O8K A;  1XC9 A;  1Q86 O;  4LC9 B;  5EU7 A;  1U45 A;  4RW8 A;  4QS8 A;  3NGZ A;  1M1K O;  2O4I A;  2OPR A;  1K8K A;  1WBB A;  4BDP A;  3C7N A;  2G8H A;  3GBT A;  2HHH K;  3WXK A;  2IIR A;  3AVM A;  3FZK A;  4BG8 A;  1V4S A;  1N33 K;  2B5J A;  3WXL A;  1BCO A;  1X1P A;  3LP3 A;  5M1F A;  2P9S B;  3LDP A;  3TTD A;  4JV5 K;  3BZC A;  1EWR A;  2O8C B;  1BG3 A;  2ZGZ A;  1HR0 K;  4IOX A;  3NGY A;  2GV9 A;  2D0C A;  3VQ9 A;  4J8F A;  4JI4 K;  4DU4 A;  4BRG A;  2WFB A;  3KK3 A;  3FR0 A;  3HPG A;  4BE1 A;  1QHT A;  1SAZ A;  1GOA A;  2ETJ A;  3LPU A;  1OH7 A;  5GAH P;  1YJW N;  3TWH A;  3QIP A;  1BL3 A;  3PIO L;  2QWL A;  1U47 A;  4OVL A;  5BR9 A;  1NJW A;  4CHZ A;  1L3U A;  1F21 A;  1U2V B;  4KB1 A;  2HND A;  3FFK B;  1GLD G;  4CJ5 A;  4LF5 K;  3CFR A;  1BUP A;  3QIC A;  4FWP A;  1GLA G;  4FLU A;  4QCL A;  3DXK B;  3O4W A;  4FLZ A;  4YOV A;  2EHG A;  3ULE A;  3SPY A;  1CZ9 A;  4YY3 K;  1CZA N;  1TK8 A;  1LWF A;  3L4Q A;  5I9E B;  5AQU A;  1C6V A;  3QLH A;  1RGI A;  4C23 A;  1X9J A;  5AQN A;  1J6Z A;  3ZSO A;  4PL8 A;  1L3S A;  5BPN A;  4CF2 A;  1EX4 A;  3NH1 A;  3NVK A;  1QQO A;  3UE5 A;  5K14 A;  3QIN A;  3C7N B;  4FVM A;  4WF9 L;  4Y0W A;  2KW4 A;  3RR8 A;  4DV6 K;  1TK0 A;  3J7Z O;  3ZT4 A;  2QI2 A;  3V81 A;  3M6G A;  3THY B;  4H4O A;  1JLE A;  2VWB A;  4Y1D A;  3HSC A;  4WFN L;  3WQU A;  3KKS A;  5CYM A;  4H4M A;  3VQ7 A;  2QTD A;  4JEP A;  1YIT N;  1U04 A;  3G0Z A;  4OPK A;  2D0B A;  3W0L A;  4R5P A;  3JAM O;  1XI1 A;  2HVH A;  5KQD A;  3O9R A;  1C1B A;  4ISE A;  2ITM A;  3TPQ A;  3SYZ A;  2PYJ A;  4CGI A;  4C1N I;  2RHK A;  1QHA A;  4Z4F A;  4YDU C;  2QM1 A;  1VAZ A;  5EY4 A;  1JLA A;  2Q31 A;  2OZS A;  4DFK A;  5AQK A;  3N4P A;  4UY8 O;  4Z4G A;  5EXW A;  1NGG A;  2D0A A;  4BRD A;  5KRT A;  3KK2 A;  3TSQ A;  5BN8 A;  5LY3 A;  1KLN A;  3DOL A;  3EEQ A;  1EET A;  4FLX A;  4NXN K;  1T44 A;  4C8N A;  1SL2 A;  2KTQ A;  3TR8 A;  2ITG A;  3B6P A;  5AQF A;  2BGG A;  4YOX A;  4RW4 A;  3J8A A;  2XY7 A;  3ULE B;  3WEE A;  2XY6 A;  2GBZ A;  4EHU A;  4Z94 A;  1QZ6 A;  1N8R O;  4CD3 A;  3EN9 A;  2P5G A;  4LY7 A;  1A5W A;  3KWG A;  1QSY A;  3KLF A;  1NJZ A;  1JCE A;  4KI6 A;  3A5L C;  4FWN A;  2X74 A;  4CZE A;  4B3S K;  3WNE A;  3IDH A;  4OKE A;  1I94 K;  1NGD A;  1ILY A;  3MN9 A;  1UAX A;  4I6M A;  4IZ9 A;  3ZSV A;  2E4L A;  2A5X A;  1QZ5 A;  2VG7 A;  5ELZ A;  1NK4 A;  4FCY A;  1S1X A;  1EO1 A;  1VSF A;  2P9K B;  4LFB K;  4AM6 A;  5C24 A;  3BF1 A;  2ASO A;  4K8Z A;  4CFC A;  1Y64 A;  1HNW K;  1JXE A;  1TKT A;  4E7K A;  5JS1 A;  1LV5 A;  4BC3 A;  1EXQ A;  2AP1 A;  2IVO A;  3R8E A;  5MLC Q;  5EX5 A;  5BRF A;  4DTO A;  2NRV A;  4M42 A;  4JI2 K;  3SAF A;  4JRP A;  3ITH A;  1TVR A;  4E1M A;  5JIC A;  2P9I B;  1RFQ A;  3SMP A;  5HL7 L;  1S1U A;  3CJ1 A;  4A62 A;  2Q97 A;  4JHD A;  1HKC A;  3CCS N;  4CER A;  5ADX H;  1BGX T;  1MU2 A;  2G8I A;  3MEC A;  4OKJ A;  3EKS A;  4J2D A;  4H5R A;  3KK1 A;  4E3S A;  4KRF A;  3AO4 A;  5GIP A;  3T19 A;  1NGH A;  3SUP A;  1VQP N;  1A5V A;  1RTI A;  3WNF A;  5BPL A;  4ICL A;  2F96 A;  3SJH A;  1T8E A;  5DK5 A;  2NRR A;  3BZK A;  4X66 K;  3SUQ A;  4JKA A;  5FRM A;  2OPQ A;  3HBT A;  3WEE B;  1QVG M;  3QBX A;  4MDB A;  2P9P A;  1IKV A;  2DFH A;  3AA4 A;  4FZZ A;  3LP1 A;  3VQ4 A;  3CMA N;  3A5N C;  3L2U A;  3SJJ A;  4ZTF A;  1K6Y A;  2IVN A;  1KTQ A;  1NMN A;  4DTP A;  4DUZ K;  1GOB A;  4CHY A;  4JK8 A;  3CFP A;  4KO0 A;  5AZI B;  4CVN E;  1HPM A;  2KLA A;  2OYQ A;  3OS0 A;  1UWB A;  2Q1N A;  3D0P A;  1ATS A;  1HMV A;  1BIS A;  3WNH A;  4KHP K;  3G71 N;  4CEC A;  4WCE L;  3G10 A;  4ID5 A;  1LWE A;  4DTJ A;  4BRM A;  2ASP A;  4KH4 A;  3VQ6 A;  2HB5 A;  2NRT A;  1RDU A;  1ESV A;  4NB4 A;  4A59 A;  5FRO A;  3QIO A;  3CYM A;  4DFP A;  3E66 A;  5KPZ A;  4LH5 A;  2QWR A;  3M3Z A;  2F8S A;  1X3M A;  4OGC A;  2A41 A;  3F5T A;  3C6A A;  3DLE A;  1BIZ A;  3QDK A;  3B8A X;  3G4S N;  2GEM A;  1BI4 A;  3S3M A;  1DGK N;  1HLU A;  1J5O A;  1V4T A;  4JHD B;  2EX3 A;  5HLF A;  4U7B A;  3LPT A;  2CGJ A;  2GTD A;  3U3Y A;  3AGK A;  5GAG P;  3AA2 A;  3AO3 A;  3C6U A;  1E4F T;  3VA0 A;  4FOI A;  3SQ4 A;  3A5M C;  2OCE A;  1SL1 A;  4Z4H A;  5AQP A;  4OO1 J;  5FPD A;  4N5S A;  1SKW A;  4HWI A;  3OYK A;  5H1S Q;  4LF9 K;  1TV6 A;  4CJP A;  2P9P B;  1NJY A;  4GV6 A;  4FJI A;  1TKX A;  4AIL C;  3M8Q A;  3OYC A;  2E6L A;  4IFV A;  4M7Y A;  1HNV A;  3DM2 A;  3TU5 A;  2UXB K;  4H8K A;  1XQS C;  2ZJR L;  2RE2 A;  1NGF A;  4KPY A;  1S1W A;  3MX5 A;  3ZT0 A;  2D4W A;  3OYN A;  1NK0 A;  4FK2 A;  1NWK A;  4IO8 A;  3SUN A;  3H3N O;  2VG5 A;  4JN4 A;  2OPP A;  2HNZ A;  3ZSW A;  3AO5 A;  4WFA L;  3K9K A;  4CJR A;  2VQE K;  4A2B A;  4DSF A;  1SL0 A;  1WSE A;  1NJX A;  3RMC A;  4EZ9 A;  3S41 A;  4CEQ A;  3P4I A;  4I9Q A;  4DV2 K;  1KVA A;  2QXL A;  4LH4 A;  3ZX2 A;  1WLJ A;  3TAG A;  3RTV A;  1FJG K;  4FLY A;  3PY8 A;  4DWI A;  2F9W A;  4E1N A;  3QEX A;  1VQ9 N;  1BI4 B;  1ZBS A;  5EVZ A;  1VSD A;  1XWL A;  4FW2 A;  4NYF A;  1VSE A;  4DQP A;  2A1R A;  4M3Z A;  3V6D A;  3NH2 A;  3DMJ A;  5M1N A;  3SI6 A;  4DSJ A;  2ZJQ L;  1YJN N;  3KLI A;  4BC4 A;  4NCA A;  2DFF A;  4H5W A;  4QAG A;  2X78 A;  5DM6 L;  4JS5 A;  1IKY A;  4V19 S;  4GV9 A;  4BRK A;  3CFO A;  4DR1 K;  3LZJ A;  2HF4 A;  3T69 A;  4CZM A;  1RDA A;  3VEY A;  4PY5 A;  2P51 A;  3CC4 N;  3CJ9 A;  3ZCM A;  3MXI A;  4E0D A;  3K2P A;  2HBL A;  3MN6 A;  2E2Q A;  4H03 B;  4E7J A;  3TAP A;  4KHW A;  4JNE A;  4AHR A;  2UXC K;  5HRS A;  1NM1 A;  3WXJ A;  2CH5 A;  3DRR A;  3VEO A;  2Q0R A;  3MDQ A;  2WUS A;  3GL1 A;  1BOT O;  3TTC A;  1RBS A;  5KGW A;  2KKZ A;  3O9T A;  3OA9 A;  3FFI A;  1VQM N;  5C25 A;  1B92 A;  4BVO A;  4K41 A;  3NE6 A;  2XY5 A;  4I2P A;  1XNR K;  4BRQ A;  3FLC O;  2KFZ A;  4KH5 A;  1ATR A;  1C0G A;  4DQI A;  4FM2 A;  3FZH A;  4CJ7 A;  3ZSY A;  4K0K K;  3UKR A;  5JLH A;  1XUP O;  1HJR A;  2E6M A;  5M1O A;  5SZT A;  1IO2 A;  1D5A A;  1WSJ A;  3ZET B;  3KZB A;  3K5O A;  4LSN A;  1S72 N;  4Z4E A;  5J2Q A;  3U4L A;  3E9P A;  3UB5 A;  2O8F A;  3ZT3 A;  3DLH A;  1U48 A;  1WSI A;  1NLV A;  3M8P A;  3OS2 A;  1FK9 A;  4BR5 A;  4HCC A;  3I0R A;  4FVU A;  1C1C A;  2W6K A;  4QS7 A;  3O9S A;  4FPA A;  3VEW A;  3G25 A;  5C12 A;  1TYQ A;  3QER A;  3A0I X;  2FLO A;  3AVG A;  5FPN A;  3LP0 A;  3AAP A;  2NUB A;  5CZ2 A;  3AV9 A;  4CJF A;  3C95 A;  4JS4 A;  2GUI A;  3OS1 A;  4C8L A;  4C8K A;  1VK0 A;  4F3T A;  4CF9 A;  2HHT A;  4GV3 A;  3VQP A;  4HTL A;  4DQS A;  4O5B A;  2P9U A;  4DSE A;  4BE0 A;  3WXI A;  3SUO A;  2O8D B;  2IAJ A;  2IVP A;  4M3T A;  4DTS A;  2HHX A;  1S6P A;  5DMR A;  1NGJ A;  3F9M A;  3B6O A;  3LP2 A;  4M45 A;  1IJJ A;  4NXM K;  5E41 A;  3E1Y A;  1BU6 O;  1VQN N;  2V51 B;  4JKG A;  2ZJP L;  1E4G T;  2E2P A;  2D0O A;  3MCP A;  4JKC A;  3V9S A;  5CHI A;  2QWP A;  3AVF A;  4CHN A;  4HUE A;  1RTJ A;  3VEN A;  4FM1 A;  4DR6 K;  4O0I A;  2E88 A;  3IRX A;  4XH5 A;  3RVC A;  3LDS A;  1W9H A;  2ZQB A;  1XHX A;  1VQ5 N;  1HNX K;  4O55 A;  4M3X A;  2HOE A;  4OJR A;  4Y1C A;  2AJQ A;  4AHS A;  3IUC A;  2JLE A;  4J2B A;  1O1W A;  4H0X B;  5IT9 O;  2NRX A;  4FJK A;  3O3G A;  1HRH A;  2KHO A;  1A5X A;  3CC2 N;  2D5R A;  3TSU A;  5BR8 K;  3RMA A;  1YTA A;  1C0U A;  2FSJ A;  3QB0 A;  1L3V A;  4IBN A;  4RCH A;  2O8F B;  4RTF D;  3E9L A;  3FGU A;  4JK9 A;  1HYS A;  3CQ8 A;  4NO7 A;  2FC0 A;  4KTW A;  4Q5V A;  4MLH A;  3F2K A;  4A61 A;  4QS9 A;  3AAR A;  1JLG A;  1K9M O;  4KAZ A;  3HJF A;  5C15 A;  3U6F A;  1VQ6 N;  2QXF A;  4BRL A;  4FW1 A;  4C1N K;  4FJL A;  4CJS A;  2KZM A;  5AQX A;  2ZWH A;  4DF8 A;  3TAN A;  3OYA A;  3VQQ A;  4BRO A;  3SQ0 A;  2HNY A;  5AQR A;  1RDC A;  4TSX A;  1JCF A;  2XY8 A;  1KAY A;  1HKG A;  3HL8 A;  3MK6 A;  3K5N A;  1U6Z A;  3CJB A;  3NHG A;  3KKR A;  2P9U B;  3ULD A;  4DTN A;  3O4N A;  1DEJ A;  4XIU A;  4F4K A;  2A42 A;  3AO2 A;  3TAB A;  4RW9 A;  2FF3 B;  1N5Y A;  1ZXO A;  4IO9 L;  5CZ1 A;  3ZSR A;  3AVH A;  4CES A;  3QNN A;  2DTU A;  1VRU A;  3CXC M;  3OJS A;  3DYA A;  3NCI A;  1RDB A;  1S5J A;  3F73 A;  2YJE A;  4HTU A;  1WSF A;  3VQB A;  4EHT A;  3TAQ A;  1IKW A;  4PKH A;  4B9T A;  1SV5 A;  4EFH A;  2Q3S A;  4IKF A;  3ZEU A;  4WQ5 A;  1NJI O;  3AVA A;  2G8U A;  5AQT A;  3DOK A;  4FSV A;  1K8K B;  2NRW A;  3OHR A;  1S22 A;  3SCX A;  3OYB A;  4CFB A;  3DXM A;  5C2D A;  1KVC A;  4B08 A;  3CD6 N;  1WN7 A;  4FZY A;  4BRN A;  4O8U A;  1K73 O;  1JLC A;  1NKC A;  3PX4 A;  4M63 C;  3O3H A;  3FZM A;  4EIA A;  1UA0 A;  4NLB A;  2VG6 A;  1TGO A;  4B9U A;  3HI0 A;  3L2W A;  1T03 A;  5AQS A;  4CZJ A;  4K8X A;  3ENH A;  1JJ2 M;  2D0P A;  2YX6 A;  4CK1 A;  3K0S A;  3SAG A;  3A2F A;  4B1X B;  4PKI A;  2V52 B;  3BUZ B;  1NOY A;  4YOT A;  3L3U A;  4L8R B;  3RRG A;  4IFE A;  4OGE A;  3V9W A;  4I9L A;  2HHU A;  1MWM A;  4HHT A;  4DQ8 A;  5AQY A;  3QEP A;  4W5R A;  3OYD A;  4BQZ A;  4ELU A;  1T7P A;  4DG1 A;  4LF6 K;  3QML A;  1NMD A;  3O4Q A;  4IXC A;  4BR4 A;  2QEX N;  4JYA K;  1ZBI A;  3CQX A;  3HP9 A;  4CF1 A;  3T1Y K;  4CED A;  3EE9 A;  3V4I A;  5KPT A;  5AZJ A;  2XHB A;  1BQN A;  3DLR A;  5GAD P;  5AFU H;  5JLF A;  4ID1 A;  3CCQ N;  4ZTJ A;  5J2N A;  3VEV A;  5JMV A;  3OYJ A;  4XH1 A;  3ZEU B;  4FO0 A;  4BQL A;  2OTL N;  3EKU A;  3K9J A;  4PWD A;  4BWM A;  4JKB A;  3DAW A;  3FE1 A;  3J81 O;  1Y97 A;  3V9U A;  3TAE A;  4NCG A;  4M3R A;  1LWC A;  3EO3 A;  2EWS A;  3LM9 A;  2HST A;  3VGL A;  3QNO A;  1GLB G;  1FKO A;  1CZB A;  3VF2 A;  2QWO A;  3E9O A;  3P83 D;  1C0F A;  3O5B A;  4M3U A;  4DV3 K;  3PLA A;  4OX9 K;  3RR7 A;  1REV A;  1HUX A;  3THW A;  3R1X A;  1RIL A;  4K25 A;  3VMF B;  1U4B A;  3O3F A;  4BGA A;  3ENB A;  4B1U B;  5HRO A;  4FJN A;  1RDW X;  2FBT A;  3PIP L;  4GVE A;  4WYB A;  3HXM A;  3MEE A;  4ILG B;  5BRD A;  1X9M A;  1U49 A;  1VSJ A;  5FDL A;  4IDK A;  4B8C A;  3UIQ A;  3AA5 X;  5AQV A;  3QFU A;  4EP5 A;  3VGK A;  2UUB K;  3DLG A;  4CBW A;  3SQ1 A;  4JKH A;  3SV3 A;  1OKJ A;  4DLG A;  5F0X A;  3KIO A;  1RT7 A;  2HHS A;  3W3D A;  3D7E O;  1BCM A;  4CI6 A;  4RW7 A;  4CE9 A;  3KJV A;  5AJ3 K;  3HOS A;  1OVQ A;  3MCA B;  1LAV A;  3HOT A;  1T05 A;  2GX9 A;  4DR5 K;  5KRS A;  3V9X A;  3LWM A;  1D9D A;  5T7B A;  3IS9 A;  3OY9 A;  4M41 A;  3IFR A;  1LOT B;  3SMS A;  4B9Q A;  4CZH A;  1BIU A;  2O4G A;  2P1J A;  3V1R A;  3SPZ A;  1KD1 O;  2UUC K;  4B9N A;  1O13 A;  1N32 K;  4DUY K;  4H0V B;  1CXU A;  4I6M B;  2WTU A;  1RTD A;  3L2R A;  1S1T A;  3H45 C;  4IEE A;  2E1Z A;  4JAX A;  4NYN A;  3O08 A;  4IOA L;  3L2V A;  4JRQ A;  3I0S A;  4YOY A;  3G6E N;  4N47 A;  3CCV N;  4CJ4 A;  4CF0 A;  4DU3 A;  3AAQ A;  3RRH A;  4FWS A;  1Q7Y O;  1P90 A;  4H0O A;  5HRP A;  3KLH A;  1KVB A;  3VTI A;  4JI1 K;  4CJ3 A;  2W42 A;  1QSL A;  4AF1 A;  4B3O A;  3THW B;  3TTF A;  1XNQ K;  4LFA K;  4JI6 K;  4CK3 A;  4QOZ B;  1H1V A;  2JWK A;  1KCF A;  1RT1 A;  1TUU A;  4CJU A;  2W40 A;  3EY1 A;  1S9E A;  4JKF A;  4WQ4 A;  4JI5 K;  3VOV A;  3AVK A;  1WB9 A;  2ATQ A;  1SZ2 A;  4FWR A;  5HP1 A;  3ATV A;  4DCH A;  2UU9 K;  4FWM A;  1RBT A;  4MO4 A;  1UOC A;  1MDU B;  3BDP A;  4KHN A;  3TSP A;  1NK8 A;  2ZD1 A;  2HMP A;  2JWL A;  2IC3 A;  3E01 A;  4AHU A;  4IG3 A;  4ZHR A;  4X65 K;  4W5N A;  3P1G A;  1KXP A;  3P31 A;  2HF3 A;  3V1Q A;  2G8V A;  2W6L A;  3K5M A;  3NH0 A;  5DM7 L;  1HX1 A;  4CJE A;  1DTT A;  3IG1 A;  4KRE A;  3HZ6 A;  3SNN A;  3CM5 A;  3GDQ A;  4CEA A;  4CBU A;  1MA9 B;  2G8F A;  1TL3 A;  4B3R K;  2YHA A;  3N4Q A;  4FLW A;  1Q82 O;  1RBV A;  4AHC A;  1KRP A;  2KZZ A;  4AHV A;  2OZM A;  4X62 K;  2I5J A;  4DTR A;  4L3Q A;  5TKW A;  4N56 A;  4BRA A;  2QWQ A;  1HKB A;  3AVL A;  3H46 O;  1QQN A;  3SAH A;  3PO5 A;  2YV0 X;  3O1W A;  4DTM A;  4KKO A;  2HBJ A;  1HYV A;  1DTQ A;  4BRH A;  3PX0 A;  4BY9 C;  2G8W A;  3MWT A;  4FJ7 A;  1YIJ N;  1Z6R A;  4Z0U A;  4FJX A;  1SS6 A;  3VF4 A;  4F9O A;  1B9F A;  5AQG A;  3OYL A;  3BY5 A;  5CR4 A;  2NRH A;  3D6R A;  1GLL O;  4JKD A;  2P5O A;  4FWL A;  4KHY A;  1DLO A;  4CJW A;  4FL9 A;  3ZSQ A;  3P39 A;  1IKX A;  4GKK K;  3CCR N;  3SBG A;  2V7Z A;  3VEX A;  4FLT A;  3RSE A;  3D2E A;  3LDN A;  3CCE N;  2E2N A;  4GKJ K;  4KB0 A;  2JGU A;  3CF5 L;  4CZL A;  1P8Z A;  3CJA A;  4BWJ A;  1I3A A;  2Q0U A;  1YTU A;  2F9T A;  4CGF A;  4YHH K;  4IOC L;  3CCU N;  3EL2 A;  5I42 A;  3PSF A;  4H0Y B;  2XO7 A;  2BH1 A;  3O6W A;  3VGM A;  3LDO A;  5HRN A;  3UKU A;  3HK2 A;  1Q9X A;  3ZSZ A;  1HNZ K;  3PSI A;  2A40 A;  2Q2R A;  3OYF A;  3KLE A;  3CPW M;  1ATN A;  1NOZ A;  5J2P A;  4CIG A;  4ELT A;  3NF8 A;  1C1A A;  1BDG A;  4FJ5 A;  2FXU A;  4JI8 K;  1HQE A;  3JS6 A;  1W97 L;  4H5T A;  1Z25 A;  5EOY A;  3OYI A;  4J2A A;  3M8R A;  3KK7 A;  1JKH A;  3HM8 A;  5AQJ A;  3J7Y P;  4DR2 K;  1J5E K;  3HO1 A;  3QEV A;  2YHB A;  3MN7 A;  1VQ8 N;  3PUF A;  4YFU A;  3AVJ A;  4A57 A;  2W41 A;  2H3G X;  1JXB A;  3U9D A;  1G99 A;  3L2Q A;  2P9L A;  4FWK A;  3OJU A;  1LAW A;  3F9K A;  4DV0 K;  2ZE2 A;  2GEL A; 
#chains in the Genus database with same CATH homology
 3NF6 A;  2XY8 A;  2E4L A;  4KI4 A;  1ZBH A;  2B6A A;  3HL8 A;  2VG7 A;  3K5N A;  1NK4 A;  1EKE A;  4FCY A;  1S1X A;  1VSF A;  3NHG A;  3KKR A;  2KFN A;  1RBU A;  3VQD A;  4CJK A;  3ULD A;  4DTN A;  5C24 A;  3O4N A;  4CHQ A;  4K8Z A;  4CFC A;  2KQ2 A;  1IH7 A;  4BDZ A;  1JLQ A;  4XIU A;  3MXJ A;  1JXE A;  1TKT A;  3AO2 A;  4E7K A;  4F4K A;  1JLF A;  3DI6 A;  4CJQ A;  4DFJ A;  4FXD A;  1LV5 A;  3TAB A;  4RW9 A;  5JS1 A;  4EZ6 A;  1EXQ A;  1N5Y A;  4FK4 A;  5CZ1 A;  3ZSR A;  3AVH A;  4CES A;  3QNN A;  2DTU A;  1VRU A;  1RDD A;  4DTO A;  1S1V A;  3OJS A;  4M42 A;  3DYA A;  3NCI A;  1RDB A;  1S5J A;  3F73 A;  3LWL A;  4JRP A;  4HTU A;  1WSF A;  3VQB A;  4JLH A;  3AO1 A;  3ITH A;  1TVR A;  4E1M A;  3TAQ A;  1RTH A;  1IKW A;  2PZS A;  4DLE A;  3PX6 A;  4FJG A;  2FBY A;  1SV5 A;  4B9T A;  4PQU A;  2Q3S A;  5I3U A;  4IKF A;  2YNH A;  1S1U A;  3HPH A;  2RN2 A;  3LAN A;  3H08 A;  4I7F A;  4B8A B;  2FBX A;  4HUF A;  3AVA A;  2G8U A;  3AVB A;  4KHQ A;  4CER A;  3QET A;  3OYM A;  1BGX T;  1MU2 A;  3DOK A;  2G8I A;  3MEC A;  4OKJ A;  4DTU A;  3EZ5 A;  1D8Y A;  1TKD A;  1GOC A;  4B9V A;  4J2D A;  3KK1 A;  1Q8I A;  4E3S A;  4KRF A;  3AO4 A;  3SCX A;  3T19 A;  3SUP A;  3SZ2 A;  3OYB A;  4CFB A;  4CF8 A;  4J2E A;  1KVC A;  1A5V A;  1RTI A;  1TKZ A;  2RPI A;  5CYQ A;  3WNF A;  2OPS A;  2HHW A;  2Z1J A;  4B08 A;  2YNI A;  4ICL A;  2IS3 A;  2F96 A;  1WN7 A;  1T8E A;  5DK5 A;  1NK6 A;  1QQC A;  4O44 A;  2WOM A;  1R0A A;  4FZY A;  2HW3 A;  4N41 A;  1JLC A;  1NKC A;  2YNG A;  3SUQ A;  3ZSX A;  1L5U A;  2OPQ A;  2XRI A;  5FRM A;  3NDK A;  1VSK A;  3PX4 A;  1X9S A;  4MFB A;  3O3H A;  2HHQ A;  1UA0 A;  4PUO A;  2VG6 A;  1TGO A;  3MXM A;  1Z26 A;  4BE2 A;  4B9U A;  3L2W A;  1IKV A;  2DFH A;  3AA4 A;  3CM6 A;  1T03 A;  3LP1 A;  4FZZ A;  3VQ4 A;  4KFB A;  4OPJ A;  1VRT A;  4K8X A;  1S9G A;  4CGD A;  3L2U A;  1ITG A;  4M3Y A;  3HPO A;  3SJJ A;  3WNG A;  3I8D A;  1K6Y A;  4CK1 A;  4ZTF A;  4OLA A;  1KTQ A;  4DTP A;  3A2F A;  3VQ8 A;  1NOY A;  3VN5 A;  1GOB A;  4CHY A;  3L3U A;  4L8R B;  3MAQ A;  3RRG A;  1NK9 A;  5CY4 A;  3CFP A;  4Z4I A;  4KO0 A;  4OGE A;  3V9W A;  4I9L A;  4O0J A;  2HHU A;  4HHT A;  4HUG A;  2DY4 A;  1HQU A;  2OYQ A;  4FM0 A;  2Y1I A;  3QEP A;  3OS0 A;  1UWB A;  4W5R A;  3OYD A;  4ELU A;  4DU1 A;  1J54 A;  4NCB A;  1T7P A;  3D0P A;  4DG1 A;  4CJV A;  1HMV A;  1BIS A;  3DRP A;  3O4Q A;  5HRR A;  3WNH A;  1VSM A;  5J2M A;  4CEC A;  4DTX A;  3G10 A;  1ZBI A;  4ID5 A;  1LWE A;  3HP9 A;  4DTJ A;  4FJH A;  4E19 A;  4KHU A;  4CF1 A;  3VQ6 A;  4DSI A;  2HB5 A;  1I39 A;  4CED A;  3V4I A;  1RT3 A;  2RKI A;  2XHB A;  1ASW A;  3D45 A;  4DF4 A;  1BQN A;  1HPZ A;  2HVI A;  5FRO A;  3QIO A;  3CYM A;  3DLR A;  4DFP A;  3TI0 A;  3QEW A;  2HHV A;  3PO4 A;  1TAU A;  4LH5 A;  4CEB A;  1VSL A;  1RT6 A;  2VWK A;  4ID1 A;  4FYD A;  4LD0 A;  5KTQ A;  2F8S A;  4DS4 A;  1WAF A;  4ZTJ A;  3RMB A;  5J2N A;  4OGC A;  3DRS A;  3S9H A;  3AVC A;  3DLE A;  1BIZ A;  2YNF A;  3JSM A;  4HCB A;  3OYJ A;  2F8T A;  1BI4 A;  3S3M A;  4LSL A;  1ZBL A;  1J5O A;  3C94 A;  4B9S A;  2EX3 A;  3HYF A;  1VSH A;  4WE1 A;  4PWD A;  3OYE A;  4BWM A;  5HLF A;  4CGH A;  3TAF A;  4HVJ A;  3BGR A;  1TAQ A;  4CJL A;  1QTM A;  3LPT A;  1Y97 A;  3VQE A;  3V9U A;  3TAE A;  4NCG A;  1C0M A;  3U3Y A;  1X9W A;  4DFM A;  4BDY A;  2HMI A;  1LWC A;  4M3R A;  1RNH A;  3ASM A;  3AA2 A;  3AO3 A;  3C6U A;  2OA8 A;  2QK9 A;  3NGI A;  3VA0 A;  3QNO A;  2PY5 A;  1FKO A;  4GMJ B;  1CZB A;  3OVN A;  3V1O A;  3VQA A;  2FBV A;  4FJ9 A;  3P83 D;  3SQ4 A;  4F2R A;  3M8S A;  3LAK A;  4CIE A;  4M3U A;  2BAN A;  3SQ2 A;  1SL1 A;  3AVI A;  4Z4H A;  3RR7 A;  1REV A;  4CEF A;  3K59 A;  5SWM A;  4CK2 A;  4N5S A;  1RIL A;  4CHP A;  3KD1 E;  1NK7 A;  1SKW A;  1LW0 A;  3OYK A;  3PV8 A;  3LAM A;  1U4B A;  3O3F A;  4C8O A;  5HRO A;  4FJN A;  1TV6 A;  4KV8 A;  1N6Q A;  4CJP A;  5J1E A;  2FBT A;  1NJY A;  1Q9Y A;  4DS5 A;  4FJI A;  1QE1 A;  1TKX A;  2Z1G A;  3NF9 A;  4AIL C;  3M8Q A;  4CEE A;  3OYC A;  2E6L A;  4IFV A;  1SKR A;  4I2Q A;  3IAY A;  3HXM A;  3MEE A;  1X9M A;  1HNV A;  1D9F A;  1FXX A;  3DM2 A;  3U3G A;  4DQR A;  1U49 A;  3TAM A;  1L3T A;  4AHT A;  5FRN A;  3SV4 A;  1VSJ A;  5FDL A;  4IDK A;  4H8K A;  4B8C A;  3UIQ A;  3AA5 X;  1LW2 A;  4ELV A;  1RBR A;  3NBP A;  4EP5 A;  1W0H A;  3DLG A;  1WAJ A;  4F8R A;  4AH9 A;  4KPY A;  4M3W A;  1S1W A;  4CIF A;  3ZT0 A;  3OYN A;  1NK0 A;  3SQ1 A;  4FK2 A;  4E7L A;  3SV3 A;  2LSN A;  4DLG A;  4GVM A;  3SUN A;  3KIO A;  3MED A;  1RT7 A;  2VG5 A;  2HHS A;  1JL1 A;  2OPP A;  2HNZ A;  4RW6 A;  1BCM A;  3AVN A;  3ZSW A;  3QEI A;  3AO5 A;  4RW7 A;  1KFD A;  4CJR A;  1KLM A;  4UQG A;  1JLB A;  4CE9 A;  2VWJ A;  4DSF A;  3VQ5 A;  1WSE A;  1SL0 A;  3KJV A;  1NJX A;  1XHZ A;  4CJT A;  1YT3 A;  3RMC A;  4EZ9 A;  2IOC A;  1LAV A;  4CEQ A;  1T05 A;  3NAE A;  1SUQ A;  4I9Q A;  1KVA A;  4MQ3 A;  3QES A;  4LH4 A;  3S3O A;  4BAC A;  5KRS A;  3KTQ A;  3ZT1 A;  3V9X A;  3LWM A;  1D9D A;  5T7B A;  2Z1H A;  3IS9 A;  3OY9 A;  1WLJ A;  1G15 A;  4M41 A;  4F2S A;  1IG9 A;  3KD5 E;  2PYL A;  4CCH A;  3TAG A;  3RTV A;  1CLQ A;  4FLY A;  3PY8 A;  2DFE A;  4Q0B A;  4DWI A;  4E1N A;  3QEX A;  1BIU A;  2O4G A;  2P1J A;  3V1R A;  3SPZ A;  4B9N A;  1BI4 B;  3OYG A;  3RMD A;  1WSG A;  4OLB A;  3HP6 A;  1VSD A;  1XWL A;  1TL1 A;  4CEZ A;  1CXU A;  2A1S A;  4FW2 A;  1RTD A;  2QKB A;  3L2R A;  4FJM A;  4NYF A;  1S1T A;  1VSE A;  4DQP A;  2A1R A;  4M3Z A;  4NYN A;  4PA1 A;  4E7I A;  3OYH A;  3NH2 A;  3T3F A;  2BE2 A;  3V6D A;  1JL2 A;  3L2V A;  4JRQ A;  3DMJ A;  3I0S A;  3TAR A;  1XC9 A;  4N47 A;  3VA3 A;  4CJ4 A;  4CF0 A;  3SI6 A;  4DU3 A;  4DSJ A;  3P5J A;  3KLI A;  5EU7 A;  3RRH A;  1U45 A;  4NCA A;  4RW8 A;  4W5Q A;  2DFF A;  2RF2 A;  4QAG A;  3NGZ A;  2O4I A;  2OPR A;  2X78 A;  4JS5 A;  4BDP A;  5HRP A;  3KLH A;  2G8H A;  1KVB A;  4CJ3 A;  2W42 A;  1IKY A;  4IFY A;  1QSL A;  1EP4 A;  3CFO A;  3L8B A;  3AVM A;  3T1A A;  4B3O A;  3LZJ A;  1NK5 A;  4CFD A;  4B9L A;  4C8M A;  1RDA A;  3LZI A;  3NF7 A;  4PY5 A;  2B5J A;  2P51 A;  4CK3 A;  3ZCM A;  3MXI A;  4E0D A;  4QOZ B;  3K2P A;  1BCO A;  1X1P A;  3LP3 A;  1KCF A;  1RT1 A;  1UA1 A;  3THV A;  1RT4 A;  4CJU A;  3EY1 A;  4E7J A;  1BQM A;  1S9E A;  3TAP A;  4AHR A;  4KHW A;  5HRS A;  1KFS A;  3DRR A;  3AVK A;  3CG7 A;  3ZT2 A;  2ATQ A;  5HP1 A;  1ZYQ A;  5HBM A;  3NGY A;  1HNI A;  2GV9 A;  2D0C A;  3K5L A;  2G8K A;  1QSS A;  4OKK A;  3VQ9 A;  1RBS A;  1RBT A;  4DU4 A;  5KGW A;  3KK3 A;  1UOC A;  3S3N A;  3BDP A;  4B9M A;  3HPG A;  4KHN A;  4BE1 A;  4E89 A;  1QHT A;  3EYZ A;  3FFI A;  1NK8 A;  2ZD1 A;  1GOA A;  5C25 A;  2ETJ A;  3LPU A;  1B92 A;  3NE6 A;  2IC3 A;  4I2P A;  2XY5 A;  3TWH A;  4FJJ A;  2KFZ A;  3E01 A;  4AHU A;  3QIP A;  4DQI A;  1BL3 A;  4FM2 A;  2Z1I A;  4IG3 A;  3HM9 A;  1U47 A;  1NJW A;  4OVL A;  1L3U A;  4CHZ A;  3ZSY A;  4ZHR A;  1F21 A;  1NKE A;  4W5N A;  3P1G A;  4FLV A;  4CHO A;  1NKB A;  4DSL A;  4KB1 A;  2HND A;  1HJR A;  2E6M A;  3V1Q A;  2G8V A;  5SZT A;  4CJ5 A;  3K5M A;  1IO2 A;  1D5A A;  1WSJ A;  4CEO A;  3NH0 A;  1RT5 A;  3CFR A;  1J53 A;  3K5O A;  4LSN A;  2Y1J A;  4FLU A;  4CJE A;  1DTT A;  3IG1 A;  4Z4E A;  5J2Q A;  4QCL A;  4TSX A;  4KRE A;  4YNQ A;  3SNN A;  3CM5 A;  1ZBU A;  4FLZ A;  4CEA A;  3ZT3 A;  4O4G A;  2EHG A;  1TL3 A;  2G8F A;  2YHA A;  2X6S A;  5C42 A;  1U48 A;  3DLH A;  1WSI A;  3RWU A;  3SPY A;  4FLW A;  3M8P A;  1RBV A;  1CZ9 A;  2B4J A;  3MEG A;  4AHC A;  1KRP A;  3OS2 A;  1FK9 A;  3HVR A;  1TK8 A;  3ISN C;  1LWF A;  4HCC A;  2KZZ A;  4AHV A;  2OZM A;  2I5J A;  3K57 A;  3I0R A;  1C1C A;  4DTR A;  3HVT A;  3QO9 A;  4KTZ A;  1C6V A;  4N56 A;  3AVL A;  4Z4C A;  3DLK A;  2WON A;  3QLH A;  3QER A;  4FJ8 A;  3PO5 A;  2YV0 X;  3AVG A;  4DTM A;  3LP0 A;  4KKO A;  1HYV A;  1DTQ A;  2YKN A;  4DMN A;  3ZSO A;  2NUB A;  3JYT A;  3PX0 A;  5CZ2 A;  3AV9 A;  1L3S A;  4CJF A;  3DLB A;  1FKP A;  4CF2 A;  3C6T A;  2G8W A;  1EX4 A;  1ZBF A;  3C95 A;  4JS4 A;  2GUI A;  3OS1 A;  4FJ7 A;  1CXQ A;  3NH1 A;  4C8L A;  4Z0U A;  4C8K A;  1VK0 A;  4FJX A;  4F3T A;  2IGI A;  1ASU A;  4CF9 A;  5K14 A;  2HHT A;  3VQP A;  3QIN A;  4FVM A;  1B9F A;  2KW4 A;  1BHL A;  4DQS A;  3OYL A;  4GW6 A;  3RR8 A;  3L3V A;  4FK0 A;  3VQC A;  4CGG A;  1TK0 A;  4O5B A;  4EP4 A;  3ZT4 A;  3KLG A;  4DSE A;  3V81 A;  2P5O A;  4KHY A;  4BE0 A;  4DSK A;  4H4O A;  3NFA A;  1DLO A;  1JLE A;  4CJW A;  4Y1D A;  2R7Y A;  3SUO A;  2IAJ A;  3ZSQ A;  1QS4 A;  5D3G A;  1IKX A;  4M3T A;  4DTS A;  2HHX A;  1S6P A;  3KKS A;  5CYM A;  5DMR A;  4H4M A;  3VQ7 A;  3B6O A;  4FLT A;  3LP2 A;  4M45 A;  1U04 A;  5E41 A;  4W5T A;  3G0Z A;  4OPK A;  2D0B A;  4KB0 A;  2JGU A;  4R5P A;  1WSH A;  4F3O A;  1XI1 A;  1S6Q A;  2HVH A;  1VSI A;  4RG8 A;  4BWJ A;  1C1B A;  1I3A A;  5JS2 A;  3V9Z A;  3SYZ A;  3V9S A;  2PYJ A;  4CGI A;  3AVF A;  3LAL A;  4CGF A;  4CHN A;  4HUE A;  4Z4F A;  1YTU A;  4CFA A;  3HST B;  1RTJ A;  1YVU A;  4KHS A;  4FM1 A;  1RT2 A;  4O0I A;  5I42 A;  3IRX A;  1JLA A;  3HT3 A;  1HYZ A;  2XO7 A;  2OZS A;  1B9D A;  5HRN A;  3LDS A;  4DFK A;  4DQQ A;  1W9H A;  2IDO A;  2ZQB A;  1XHX A;  4Z4G A;  4O55 A;  4M3X A;  3HK2 A;  4OJR A;  2D0A A;  5KRT A;  4Y1C A;  3AA3 A;  3ZSZ A;  4AHS A;  3KK2 A;  1Q9X A;  2AJQ A;  2JLE A;  4KTQ A;  4N76 A;  1KLN A;  4J2B A;  3DOL A;  1O1W A;  1EET A;  3OYF A;  4FLX A;  4C8N A;  4FJK A;  1J9A A;  4W5O A;  4CGJ A;  3O3G A;  1SL2 A;  1ASV A;  1HRH A;  3KLE A;  2KTQ A;  1A5X A;  2D5R A;  3TR8 A;  2ITG A;  3B6P A;  2BDP A;  1NOZ A;  5J2P A;  3RMA A;  1YTA A;  1C0U A;  4CIG A;  2YKM A;  3NF8 A;  1C1A A;  1L3V A;  4ELT A;  2BGG A;  4IBN A;  4RW4 A;  4FJ5 A;  2XY7 A;  1TK5 A;  4FZX C;  1WNS A;  1HYS A;  2XY6 A;  2GBZ A;  1HQE A;  5KGX A;  4G1Q A;  5KI6 A;  1Z25 A;  3CQ8 A;  2QKK A;  2FC0 A;  4KTW A;  3OYI A;  4Q5V A;  4J2A A;  1RCH A;  2P5G A;  2X6N A;  4LY7 A;  3M8R A;  1A5W A;  3ALY A;  1QSY A;  1JLG A;  3KLF A;  4KAZ A;  3HJF A;  1NJZ A;  3U6F A;  1SKS A;  2QXF A;  4KI6 A;  1JKH A;  4FW1 A;  4IG0 A;  4FJL A;  4CJS A;  3HO1 A;  3QEV A;  2YHB A;  1KSP A;  2KZM A;  3PUF A;  4YFU A;  3AVJ A;  3K58 A;  2X74 A;  4E7H A;  4DF8 A;  3TAN A;  3WNE A;  3OYA A;  1JXB A;  4OKE A;  3VQQ A;  3L2Q A;  3SQ0 A;  2HNY A;  1UAX A;  3OJU A;  1LAW A;  1RDC A;  3F9K A;  3ZSV A;  1C0T A;  2ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...