5DKFA

Reaction of phosphorylated chey with imidazole 3 of 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
molecule keywords Chemotaxis protein CheY
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dkfA00
3FDFA 3I42A 5GQSA 1QMPA 3KCNA 3OQMA 3DLBA 4ETIA 2JBAA 5KQPA 1XHEA 5ED4A 4MS1A 1JDNA 4IMIB 4XXHA 2E4WA 3S99A 2PL9A 4RXMA 1KGSA 3A3KA 3C3MA 3N0XA 3D02A 5TE9A 1NXPA 1T34A 4FE7A 3N53A 4MR7B 5HM6A 1XHFA 2TMYA 4G0PA 4DADA 2MSKA 3KTOA 1PEAA 2QSJA 3H5OA 1MB0A 2IPNA 3QX9A 3KS9A 5HKOA 3HV2A 4MRMA 7ABPA 1MIHA 4M88A 1AB6A 5ABPA 3CHYA 3CU5A 1QP0A 3CZCA 2PAFA 4KV7A 3IP7A 3GYBA 4N03A 1QQBA 3HDGA 3OLWA 4PZ0A 5TQJA 3CNBA 2MYPA 3T8YA 1J56A 5IULC 4YO7A 1GCAA 4D6YA 1PHRA 3JTEA 1DCKA 2GI4A 4N76A 2FXIA 4RK5A 3QLVA 3JS5A 4YS6A 1A2OA 3Q9SA 1NXSA 4GPAA 1ABEA 4NCAA 3OMXA 4RKQA 5KC9A 5DTEA 4OLBA 3CS3A 3T6KA 1D2AA 2HJ9A 5JS1A 2FMFA 2FMKA 1MVOA 2VK2A 2MSLA 3BBLA 1UDRA 2MSWA 4H60A 3HVRA 5IEBA 1U2QA 3IP9A 2M98A 2HSGA 4E7OA 3OLXA 4HNSA 1RXEA 2CWDA 2FN8A 3NNDA 3ILYA 4RY8A 3NHZA 4ZMRA 2LIVA 2WRZA 3HDVA 4JOQA 4MS4B 1P2FA 1B00A 3EULA 4RV5A 4EYKA 1CEYA 3CZ5A 3MM4A 3SM9A 4G0ZA 3KHTA 1USGA 3BRSA 4S04A 3GL9A 4QPJC 2FTKE 3OO1A 3H1FA 1SXIA 1Z12A 2LBPA 4Q6WA 2LPMA 3HXMA 3L49A 1JLKA 1GUBA 1D1PA 4NCBA 2BGGA 3FMVA 4UHKA 3KYJB 4RK7A 2B4AA 3KJXA 1OXKB 1E6LA 2IPAB 4W5TA 4L4UA 2WB4A 1LJUA 1PNTA 4ML3A 3SG0A 2FN9A 2W42A 5IC5A 1H9CA 4ZPJA 2PMCA 4RZSA 2PUCA 1M2FA 1C4WA 1Y1LA 1CYEA 3LKBA 2NZUG 3L6UA 4MS3B 3SY8A 1U04A 4ZYLA 2WWVD 1OXBB 2PJUA 5B3JA 2YHBA 3F7NA 5IBQA 2FVYA 4G0QA 4WUTA 3RVOA 3QEMB 3SAJA 1NXOA 4WXEA 2F8SA 3QEMA 4MR8A 2P4UA 3NNSA 1DBQA 2QVCA 4G0YA 4MLDA 4MYRA 1SRRA 1QP4A 3H5VA 6ABPA 1DC8A 2PE5A 5HSGA 5FWXB 2A9QA 4RWEA 4IGAA 1JYFA 1QNLA 3M6MD 4E7PA 4XASA 3CG4A 3KYIB 2L18A 1LBHA 3F6PA 2PUAA 3TD9A 2QU7A 4LX8A 2LP4Y 1KRWA 1EHCA 4YR7A 1Z15A 5C5CA 3LTEA 4MQFB 4TLMB 4L85A 1DJMA 2RGYA 3O2JA 2JVKA 1F4VA 2IDMA 4YWHA 3H1EA 4EVRA 2E4ZA 4TN5A 5TPWB 3O1IC 5FWYA 4LE1A 4H3HB 2L17A 4CBVA 1QO0D 3GBPA 1BDHA 2ZWMA 5C5EA 1JWLA 8ABPA 4LE0A 2FLWA 4DQDA 4IRXA 3NNNA 1GLGA 2CD7A 3I45A 3A0RB 3FGZA 5B3JC 5KQGA 2B1JA 1ZAYA 3QX8A 2FEWB 1PEYA 4KK4A 5BQ3A 3O2QB 4QYMA 1EAYA 2FEPA 1TMYA 5TPZD 1TM2A 1SXGA 1YMUA 3UUGA 5JNSA 5JNVA 4EY3A 1BVHA 3HO1A 3SQNA 4MQEB 3KSMA 3LUAA 3T38A 2DRIA 2CHFA 2R25B 2JVIA 2RJOA 2PUGA 3G1WA 3HUUA 5EWMA 1W25A 4IF4A 4Z0NA 3OQNA 1Z17A 2XDYA 1JX6A 3RQIA 3Q7RA 5TQ0A 4NICA 3GBVA 4WZZA 3IPCA 4JASB 2Q5CA 2QVGA 1JYEA 1JF8A 1ZH4A 2IKSA 1Z18A 2NUBA 3NHMA 3P9YA 4LDZA 4H3KB 3GV0A 3RVLA 4MAAA 2R47A 4OTZA 1FFSA 2IYNA 1NXWA 4XAQA 4MRMB 1NXTA 4RXTA 3LUKA 5IEJA 4RS3A 4HYEA 4Y9TA 4S05A 5DLEA 5T7BA 2F8TA 1M5UA 4N0PA 2H3HA 1KMIY 3MA0A 4KREA 3JVDA 4KK3A 5DKFA 1U2PA 3N6VA 4F3TA 2MYNA 4YV7A 5KC8A 1HEYA 4HNRA 1RZRD 3VNAA 3RVPA 1EWVA 1ISSA 3N0WA 3BREA 3T95A 3H6HA 2PLNA 4YLEA 2E4YA 2FQXA 3QLUA 1NATA 3RVQA 4D6XA 5CNIA 3KKEA 3MF4A 2HQOA 2IPMA 3OMWA 4ZMSA 4W5OA 3H75A 3CG0A 2WY2D 1AB5A 3HSYA 3RVSA 3EODA 4KMRA 4G0MA 3R0JA 6CHYA 5KWSA 2AYZA 3C3WA 2E4VA 2JB9A 1DRJA 2IOYA 4MQEA 4Q7EA 3URMA 4Q6BA 4ETNA 4F06A 3H5TA 1P6UA 1U8TA 1Z26A 4RKRA 3ROFA 1KRXA 2JRLA 4FE4A 2MYTA 4F11A 3E3MA 2ID9A 4Z99A 3HK2A 1DBWA 4RU1A 2AYXA 3FFWA 3HM9A 4EVSA 3H5IA 2RDMA 1DG9A 3DGEC 1W9HA 2M1ZA 3FFTA 4G97A 2CHEA 4N0QA 1TVMA 3CRNA 2JK1A 3LUDA 5IUKC 3H6GA 1DCMA 2JBAB 3QELA 4QYWA 1YK1A 3HZHA 5BRJA 2GBPA 5FBHA 5TPWA 1U0SY 2O20A 3VNBA 1GUDA 4KNYA 5TQ0B 1ZDMA 2GKGA 3EGCA 1E6KA 3Q41A 1K66A 4OATA 5EWMB 4XARA 4EYQA 2NT3A 1FFGA 5PNTA 5IX8A 1PUXA 3O21A 1QPZA 1YS7A 1EWKA 1I3CA 3OLZA 4Z9BA 1E6MA 4TMYA 3A10A 1MAVA 4JP1A 4KVFA 3RVRA 2I6FA 2MYUA 1VRVA 1NXVA 4P98A 2PL1A 5CNJA 3DLHA 2FKAA 1QQAA 5JS2A 3EAFA 3IPAA 4QICA 4RDCA 3LUJA 5FBKA 5JNUA 3O74A 4MR8B 4MR9B 4MPTA 4B09A 4N41A 4Z4FA 3SNKA 1TJYA 4Z4HA 4Z4GA 3B2NA 1VKRA 3JPWA 1NXXA 4NQRA 4OG2A 5F64A 3GA5A 5HQJA 4JAVC 5TQ2A 2OQRA 3ILHA 5BRAA 1DC7A 4MS3A 1APBA 2WJWA 3HJFA 5T3YA 1VPWA 3QLUC 4EYOA 1WETA 4LZLA 5FWYB 3EQZA 1D5WA 4G86A 4YGXB 1RPJA 4Z4CA 1PNRA 3GRCA 3K4HA 3MYYA 3O1JC 1BAPA 2PUDA 2KYRA 3MIZA 1L5YA 3D8UA 4PEVA 4MQFA 3I09A 4RXUA 4WT7A 4KQCA 3TX6A 4ZJPA 3BRQA 4KQ9A 4MLCA 5JNWA 4EGSA 3QLVC 3CLKA 4O1HA 4RY0A 3LMKA 2ZAYA 4W5QA 1Z2EA 2NZVG 3HEBA 4JB0A 2GWRA 5FWXA 1TLFA 2P9HA 4JB2A 4F12A 2OENG 3O2SB 5CHYA 5EWJB 4UHJA 1JL3A 1YMVA 4N47A 3TB6A 2QZJA 1RNLA 4EVQA 3A0UA 1JFTA 1C0EA 3G85A 5E3JA 1USIA 2YHAA 3W9SA 1ZY2A 1GCGA 3LOPA 3Q7TA 4XFKA 5DCLA 4PYRA 4TLLB 1SD5A 1DP4A 2HQBA 2L2QA 4Z9AA 4EUKA 2JVJA 3KLOA 3C6QA 1JH9A 2N9UA 1DZ3A 1QO0A 3OLYA 3OLVA 3DZDA 4KZKA 2IPLA 3KG2A 3OQOA 1ZH2A 2X7XA 3CTPA 1LK0A 2FLKA 5GOTA 2RJNA 4Z4IA 1YTUA 3N8IA 4MGEA 1DRKA 4GNRA 9ABPA 2E4XA 3H1GA 3M9XA 1K68A 2JCGA 1Z2DA 1ZHHA 5BR1A 5EWLB 3NBMA 3EJWA 1Z25A 1NY5A 2A9RA 1BA2A 1ZITA 3RH0A 4F8JA 4MS4A 3ROTA 1E2BA 1IIBA 3LFTA 3LUFA 5EWJA 4YCSA 2PUFA 4W5NA 5IUNC 1EWTA 2LUOA 4G0XA 4MR7A 4DN6A 1ZVVA 3LKVA 4W5RA 1ZGGA 2WMYA 3MQ4A 5EWLA 3DGFC 3C97A 3DBIA 3H5WA 1M5TA 1BDJA 2FMHA 1Z13A 3F6CA 5DGCA 4MS1B 2QXYA 3EQ2A 2PKXA 3O1HB 5D2CA 3KLNA 3LUCA 4P1ZA 2VYCA 2QV0A 2HPHA 5KI6A 3QLTA 2A9PA 5KQLA 3HS3A 3OM0A 1EFAA 3JVIA 1QKKA 4HNQA 1JDPA 1Z16A 3MMNA 3K9CA 4ETMA 3HCWA 4WWHA 2L19A 3IP6A 3QK7A 4WXMA 2ID7A 2J48A 2QW1A 1S8NA 2FW0A 4RK6A 4O1IA 3N0RA 4MR9A 4YP9A 3CFYA 2HQRA 1L5ZA 1MB3A 3HUTA 3RVMA 3E61A 4LE2A 1ABFA 1FQWA 3OM1A 3F73A 1YS6A 3UKJA 1URPA 3JPYA 2FEKA 1LBIA 4RSMA 4IMJB 1ZN2A 5JNTA 1YK0A 2R4QA 5CNKA 1DBPA 2H0AA 2WJAA 3C3KA 1D4ZA 1YIOA 4LRQA 1SXHA 4EYGA 1R8JA 2FSPA 2V0NA 3EDCA 4OLAA 1YVUA 2GX6A 4G0OA 3H5LA 3IP5A 3N75A 5TPZA 2R48A 1P8AA 2FMIA 1RXIA 2A9OA 3M9WA 4PICA 1CHNA 2E4UA 3BILA 3RVJA 4D74A 3QELB 4RK4A 3Q15C 4RK0A 3UK0A 1FFWA 1JHZA 1F51E 4KPYA 1FSPA 3RVKA 4JA2A 5TQ2B 4FB4A 4IILA 3FFXA 3TMYA 3I5AA 5I4CA 3QEKA 2FQWA 3IDOA 4YRZA 1LJLA 1BDIA 2PUEA 1P6QA 4O5AA 1ZESA 2NT4A 3LUGA 2VUHB 4LDAA 3CKMA 3RVNA 1JFVA 1D1QA 1A0OA 3GT7A 4KRFA 1NTRA 3JY6A 1JBEA 3LUHA 5CNMA 5KQMA 4NV3A 1XWWA 4XLTA 5IUJC 4Z4EA 3TO5A 1VLZA 3Q7SA 4PE5B 2VUIB 3O75A 5JNRA 1QP7A 1RZRA 1ZGZA 4OBBA 1DCFA 1JFSA 1A04A 4RK1A 2PUBA 4RY9A 4KFCA 1ISRA 3OO0A 1USKA 1M2EA 2QR3A 2FQYA 3GWGA
chains in the Genus database with same CATH superfamily
3A1UA 2HTFA 4UM8B 4PZEA 5DPMA 3ANXA 3LGXA 4E2ZA 2WTNA 1QP8A 5ICSA 4MEBA 2PTGA 2F6RA 2CLCX 4R1MA 2ZIWB 4AWBA 1CXZA 1JTVA 1T6XA 1XROA 3L5OA 4MP8A 4WFIA 5LUBA 3NCHA 3KFVA 4HJXA 4IKEA 2WUGA 3WB0A 1MEOA 4N40A 4Y9SA 4LXXA 4GSYA 2WUEA 4MHOA 3WHIA 3GLIE 4TUYF 3KL4A 1QGZA 2A0XA 5GONB 2NUAB 1BWSA 4OYLA 2CMKA 5DLDA 4IHAA 2ZSKA 4I4IA 5CX4A 2G8NA 3IA7A 4BKOA 4RHUA 1EWRA 1YXMA 5DWQA 3QKIA 1I6MA 4M8LA 3LBNA 4L9RA 1H6CA 1O6BA 4D6PA 4D56A 4FEGA 2YXLA 4D8XA 6Q21A 5IYZA 1UJ2A 2B61A 2PZMA 3K2IA 2ONCA 1YUNA 3GA7A 1Q92A 2ET6A 2YH2A 4E15A 3MPUA 4EA6A 5IULC 1N0IA 4PPGA 2NTEA 5ES3A 1CSEE 3AG6A 3C3XA 2B98A 1HF3A 2YY6A 4ARSA 4AMZA 1V5IA 4BMPB 4RK5A 3F90A 2VT2A 4ALNA 2V4MA 2BFAA 2ZYSA 3V1TC 1MC8A 4CMBA 3EFOB 1G5IA 3M8KA 1SM4A 3IQHX 3SZRA 1ZGCA 4B73A 1CJTC 4CQMA 3ZS8A 2FPOA 3UJHA 5IT9A 3U44B 2FMFA 3JWIA 5EZYF 1H65A 1QV7A 3F46A 3L7BA 3OZSA 4DA8A 4QBTA 1P2TA 1PT8A 2POCA 2VJKA 3H16A 3CGGA 1FNBA 2V45A 4BEVA 3UPTA 1XLWA 1SC6A 4E5PA 2OBBA 2I2FA 3IBTA 4P0PB 1P1KA 1I01A 3IIEA 2GLUA 3IKVA 2Q4TA 4D26A 2FAXA 2QD4A 1Z5PA 4HXYA 1ULUA 1U28A 5C0OE 5KNBH 3DMYA 3HDVA 2F4NA 3QVSA 1MBZA 1KC3A 1L7OA 3L4BC 4AKSA 3GFPA 1MORA 3ENNA 1E7RA 1VJTA 5G0VA 4MHTA 1VECA 1OOEA 4QXPA 4AJOA 1I94B 3QX3A 2OZPA 3C6BA 5IH7A 4AQYB 3HKCB 1IQRA 3H4IA 5JFTA 4XCQA 2B8TA 5DGHA 2FRXA 4AY3A 3LDAA 1EE2A 2JFHA 2EBWA 4PLWA 3CUWA 3NPMA 3SS7X 5A5FA 3FOWA 5CX1B 4J7CA 1LX6A 1SVMA 2ZJZA 4XUEA 2VKTA 4CIBA 4WERA 2YMMA 3O91A 1O9GA 3H2IA 5JD3A 4TV9F 4WDRA 3LQYA 2BI8A 1U5BA 3ASYA 4RMNA 1U04A 3BD7A 5F77A 4ARZA 1JR2A 1RWQA 4JHXA 4TS4A 4XD2A 5FBVB 1KTIA 3F7NA 3RS9A 2CJWB 1U90A 3IOMA 3ZE6A 3ZGVA 4IQFA 2FWNA 1EXWA 1BMQA 5LWQA 1OGYA 2DHCA 2J7PA 3SICE 1E2KA 5U9CA 1Z5NA 1MUUA 2XOKA 3W05A 3R3UA 3OCZA 1GL6A 5G0TA 2OCLA 2WWWA 3E9MA 2CZCA 1C3LA 3UVEA 3HVUA 3QVXA 3B2QA 3EGXA 1RTTA 3P9KA 3OTQA 4COKA 4H77A 3BX1A 1ZUNA 2ZI3A 2P2YA 3DDNA 2GPAA 4FFNA 3V32A 1FDTA 5CEJA 3WA6A 4RTNA 1LSSA 3SZGA 4YALA 2B83A 1DIGA 1DIRA 3FRHA 4KPFC 2COKA 4F5WA 3THWA 4KE6A 1AZTA 1NG9A 5K8LA 4NMWA 3SX0A 1U65A 2HF8A 3PV0A 2XVXA 2DHDA 4TVKA 1XL0A 1Y8CA 3LDFA 4HGYA 4I6JA 4M99A 4DJJA 1RR6A 4H3HB 4F7WA 3OEED 1ZSVA 3ZE0B 1LW6E 3N9IA 3H4TA 2J5XA 4C4PA 1RRMA 3KJNA 1RLTA 4G0UA 3KTDA 2Q7DA 4NAVA 5AKIA 1TT5B 2ZYAA 2Z08A 5FDFA 2DQKA 1ZH0A 4KJXA 4XLLA 3W1EA 4FOTA 1N5KA 3K5WA 1QRTA 2QD3A 5J2UB 4NWIA 2FW7A 1X1AA 2HRQA 1S2GA 1P2BA 2ST1A 5KVQA 4EO7A 1AN0A 3EXHB 4DWWA 3O83A 3PLAE 3CR3C 5AW3A 5H9WA 5JY6A 3UWDA 1EJBA 1L4MA 1U28C 3Q11A 1D4OA 4MVJP 1PEDA 3MT0A 3RDPA 1DXYA 4C4ZA 1G3IA 2VLIA 2WWYA 2NO7A 3BMQB 1Z6PA 1PT5A 2R97A 4BCBA 2A1TR 3MJRA 3ANMA 1HKUA 3E35A 3OIFA 1A50B 3FJYA 3QHAA 1P2VA 2PUGA 1Q1QA 2IF2A 3U0BA 5IBCA 2R86A 3THSA 3EIQA 2AKEA 2E4AA 4BMDA 1NDUA 2DQSA 3AY0A 2RSLA 2RMKA 1PYGA 4E2YA 1MQ8B 1X7ZA 2J6BA 3ZWAA 4BX2A 1S3IA 2ZXUA 1K75A 3EY9A 5LQAA 1WA5A 4D80A 2Q49A 4B6QA 5DEOA 3JRXA 4NARA 2CLFB 2DHRA 2I6SA 3HYRA 5JDIA 1N9GB 2VA9A 4OQFA 2R60A 2A6PA 1U8AA 4RS3A 3TS1A 3W5JA 4PYLA 3ZJYA 4BNDA 1E6UA 1QNFA 2YMPA 1AE1A 5F4ZA 3QOXA 2YZGA 5DKFA 5GINE 4GR5A 4HNTA 1PWYE 2IOHA 4RVOA 4MPPA 4YUYA 4YV7A 1HEYA 1ZUIA 3PFIA 1X0VA 2H0QA 2HLHA 4OOFA 3I37X 4HGZA 1BE0A 2C8LA 2XQIA 1XQVA 1P1FA 1BGXT 1G9SA 2H1WA 2J3DA 3OIVA 3QUQA 4RELA 4YHBA 2I65A 3IH5A 3EEOA 4O2RA 4NFSA 3U3XA 3DOEA 2AOXA 1QHFA 4RH0A 3C24A 3ESXA 5LJIA 3VR5D 1HDOA 2UZ0A 1FS5A 5DGXA 4ZVLA 3PSAA 3HSYA 4D4GA 1V4NA 1GAJA 2PIDA 2V55B 2I6UA 1OKKA 4S0ZA 4EAQA 2VSQA 3VPBA 2DM6A 4JVSB 4C06A 4XSGA 3ZHVA 5A6VA 2PWBA 5HJ5A 2AVNA 4Y2YA 4A8JA 5J5CA 2ZJ8A 2FWPA 2ODTX 5B1IA 5CA0B 2WG0A 3DOJA 1ZVMA 1Z8NA 2VK8A 3HRIA 2G76A 1OGIA 1KRHA 1CG6A 4P7JA 1JBQA 4S1OA 2F9FA 2AYXA 5A03A 4FFOA 5CVJA 4XUGB 3B89A 2JAUA 2CVFA 3MWKA 2APJA 4BYMA 1DXOA 1NI5A 5TB5A 1KZHA 1BCSB 2IYYA 2OT3B 2BFWA 4WXPA 3HVIA 1QXSA 1JG1A 1TVMA 3CRNA 2NM0A 1XQWA 1U1IA 3NS7A 2BR5A 5CYFA 4C0JA 5J2TA 1RWOA 1NJSA 2HAEA 4LOKA 2ZTHA 4K9MA 4EG6A 5HNKA 1J6UA 1EM8A 1CW2B 1VPEA 5FORA 4NBKA 2LE0A 4QOHA 1TMGE 1R8XA 1AGNA 4FKZA 4LZAA 2NG1A 5DN6D 5LM3A 1WBDA 2PX8A 1ZLXA 4M8SA 3PIRA 3IAM6 3HYSA 4CM7A 3BK7A 3FVRA 3DE5X 2G1AA 2PZKA 4K2AA 3ROGA 2OFOA 1NYTA 4EHFA 2HKIA 5IX8A 3NTXA 1TAUA 4IUYA 1E89A 3TNJA 2AFVA 2FV8A 4RL4A 4M9CA 3BMCA 4KWCA 4IR7A 2K7ZA 5IFLA 3MRVA 3FJ1A 4DAEA 4HQKA 2Z2XA 1L5VA 2Q9CA 2OZKA 4INAA 4X8MA 2FSVA 2B1GA 3B1FA 4D8WA 4W9NC 3BH6A 3GUVA 3LUBA 4ICIA 2V97A 4C04A 4RD4A 2IUEA 4TQGA 5AHXA 4CL2A 1G4UR 1GPUA 3KB1A 4KKVA 1CV2A 1SCKA 3ZK8A 1EPUA 1QIKA 3ORRA 5ALTA 4R68A 5JYCA 4LWPA 3MYRA 5E0KB 4ZC8A 5LYJB 2H4XA 3K72B 3TIFA 5BRAA 3BWDD 2MINB 2BFMA 3RK0A 2WYUA 1SBCA 4GNKA 1CDOA 2FKNA 2JZCA 1VL5A 2EW1A 4R3WA 4L73A 1NNI1 2NQ8A 3HLKA 4E2FA 1O03A 1MXFA 2GZSA 2IYAA 2PX5A 3QOYA 5J5VA 3ZBUA 5L3SB 2J9GA 2XJ9A 4HVTA 4Q39A 5PGMA 2WM3A 1Z6GA 2O8BB 2YS7A 1EFTA 1V7ZA 2CJXA 3K31A 5EFZA 3IHWA 4PEVA 4E4RA 5I51A 2XNCA 4B40A 1UKYA 2VJNA 3M70A 4X61A 1KDVA 3IAUA 4M2LA 2VHWA 3MWJA 3QLVC 3T7TA 2J0SA 1KEWA 3D4OA 2J3LA 1N9KA 3DZBA 3RV3A 5LBIA 3OJ0A 4EJ2A 2ZUUA 3JWGA 4YXWD 4JB2A 4F12A 2IH2A 1R9NA 3D5EA 4TTIA 2F00A 4WLNA 3QF7A 1B3RA 4YH1A 1JFTA 2Q5HA 1X70A 4HYYA 1YKGA 1QLHA 5J59A 1TPYA 2QY6A 3CKLA 1FRFS 2X6RA 4GP6A 2AFHE 4M0UA 4Q7JB 5JQWA 5IASA 2HSEA 3QE0A 5KQSA 5NLLA 4Z9AA 1CE8A 1VYHA 4JSYA 3I8XA 5FPQA 1TAGA 2W90A 3G59A 2JVJA 4B3JA 4F8YA 1VHTA 5G53C 3JQ9A 3ETEA 3JD4A 3LHFA 5BWNA 3I23A 4KZKA 1U4NA 3KR1A 3BE8A 4UBNA 1YQEA 1Q7RA 2AOTB 2QRUA 4LYEA 1Y89A 3NQ41 2BM1A 2X4DA 3D1LA 3TNDA 4ZD6A 5LJLA 4KUHA 1A27A 2F9MA 4OB7A 1VI2A 4HAVA 5JHHB 3RFCA 3O8QA 5KTOA 1DRKA 3NHPA 1FFDA 2AWOA 3FPAA 4GU5A 4LRXA 4AO8A 3TFQA 4WZAE 3DC2A 5IKMA 2GAAA 2C57A 2G80A 2QX8A 3AW8A 3KAPA 4HBGA 4B9EA 5KU1A 1K6EA 2OHIA 1IIBA 3KSUA 1OIXA 2QTAA 3VJKA 3FTEA 1WJGA 3A1FA 3I2IA 3K5PA 5D1HA 4LFCB 2PKQP 3A6LA 3WYFA 4QXOA 1T6BY 1T5OA 3K1JA 3T5AA 4R83A 1KO5A 4XIFA 2VP0A 1NBHA 4KMSA 1JKMA 3NXKA 1A2QA 4LNAA 2A8YA 4RESA 721PA 3R3HA 2ODPA 1J9EA 1FJGB 4XDGA 4P1ZA 3L0YA 1D7OA 4LFBB 4Q34A 2DF8A 2WE8A 2G09A 4WKGA 4FNMA 3TNYA 4CG3A 5CT4A 2DULA 4BHTA 2C5EA 4DIEA 4EG0A 1Y6QA 1QS0A 4UNNA 3GVPA 1WU7A 3SMQA 1YR1A 3AERB 2VDWB 3IP1A 3WRYC 1UPXA 4R0MA 4QU9A 2ZJ0A 3JQDA 4M0KA 4BLUA 3E3AA 1Z5ZA 1LD3A 3MJFA 3TGLA 5JS7A 1VMIA 2P90A 2Z98A 3JZMA 5JCOC 1EIZA 3MS7A 2AH5A 3LZCA 5ALPA 3VTAA 1ABFA 2WG2A 2F1OA 2QORA 1L4GA 1M6VB 2WZDA 3BGOS 4KWTA 4CKYA 3FUVA 1S2NA 1ZN7A 3HCCA 2IIPA 3K4QA 3WOVA 3KT6A 3FCUB 1ZK4A 4CF5A 2BEUA 1UXGA 4WD3A 3WGJA 2PBFA 5DHFA 3OPVA 2P2NA 3W3AD 3VOTA 2FU5C 1D4ZA 1E2UA 2QRMA 3D6JA 3PPVA 2VUSA 3SC2A 1OFTA 3LWDA 2KB0A 1U0EA 1HTWA 1HFWA 3PUYA 3T06B 3CPEA 3KQLA 2DOKA 3D9QX 1NN0A 1AG9A 2IOQA 2GN2A 1W5AA 4GO1A 4JWKA 1G8YA 4B3DA 1VE3A 5K20A 1OBFO 4LI0A 1KH3A 1WV1A 1P4SA 1VC2A 1W4CA 3LM8A 3OZRA 4LTMA 4MQUA 2FWJA 3PSHA 4M4SA 4QNRA 5KPJA 3HB7A 5KJFA 3UK0A 1JR4A 2VZ0A 1MPTA 1YQGA 3CEAA 1OFUA 3KKPA 2V7BA 4DV4B 2JLCA 3NHUA 3GK3A 1NP6A 5U4QA 3FYUC 1BW9A 4TZKA 3TFWA 2IY7A 2WHPB 3EZ7A 3TLEA 1DAOA 1IATA 1LJLA 4P38A 3I6MA 4D9NA 2J9YB 1A96A 1DIHA 3LV8A 3N1UA 4NEHB 2JGAA 3HP7A 3ADOA 2E5FA 5A3VA 3VTKA 3ZDDA 1OU0A 2BMWA 1KOJA 3B13B 4JLKA 1SCQA 2G83A 1SUCA 1RAFA 4B45A 4EX7A 1RXSA 2IXDA 1ZQ9A 5LLSA 5CAEA 1MMFB 2OP1A 3BPSA 2C7RA 1J21A 3GUZA 3AKYA 2C7VA 2UDPA 1MT0A 1QK4A 2QL5A 1GM5A 1S01A 4LXYA 2GHTA 1QYRA 3AT1A 4J3JA 2DBYA 5HF5A 3QJYA 2XUAA 3R7WA 4RK1A 4EB6A 2AMJA 3VI3B 1N77A 4P5PA 3EA0A 5F9MA 2V1XA 2VZ9A 3PC4A 5BR7A 3U7FB 1UMDB 4M1SA 1XRPA 1UKVY 3SSAA 4TRMA 1JKIA 4WY2A 1C4XA 2JJMA 4GMHA 1A9PA 1JXQA 3U4IA 4QNNA 2P1ZA 3IR7A 2L82A 1BVRA 1GR0A 5FUYA 1OX4A 3FWHA 2J32A 1X8LA 2I7VA 4YPFA 4FD3A 4OBWA 1U2ZA 2QUKA 1JJAA 3KM0A 4EOGA 3GJYA 2QSJA 2KJQA 1HK7A 5FFMA 1Z38A 4MYTA 4HPJB 2HUPA 5FFNA 1E4VA 4KYUA 1IZ9A 1CERA 3ABSB 2J5BA 3R3SA 2IUFA 3DZ8A 5A4MS 3RI3A 4PX2A 4GS5A 2R66A 2WYWA 4RIHA 3ZKWA 3V4OA 3HDGA 3IV6A 2XE8A 5BMOA 2ZZNA 3OY7A 2DSTA 3K70C 1V3QE 1Q0QA 4YO7A 4LAFA 4D0LB 1N5DA 2XTZA 1ZH8A 1SXJD 3CN9A 4EHBA 5JSHA 1EIWA 1UJ6A 4OCZA 1TLLA 5IKOA 4XDYA 5HBGA 1JG4A 2QXTA 5BSKA 4V38A 4O4IF 2POQX 1VJCA 5C4IA 1NW9B 1JV2B 1CRLA 1EP9A 2P78A 2VPZA 3AG5A 3PEEA 3TRJA 4EDHA 2JLYA 3ZY6A 1J20A 2MSLA 3QBTA 3MFYA 4EITA 3DAYA 5LOVF 2EFEB 1U2QA 2HN9A 2VJMA 2WAAA 2ENUA 1WCWA 3FHJA 4I8DA 1RI5A 5F33A 3SJ7A 3H83A 4OXNA 1BDMA 5IU6A 4DIKA 4ZYWA 2UV8A 5G4KA 4H16A 4C14A 1A9SA 4BQIA 3FUTA 4RY8A 2C7GA 2IUYA 4HWSA 3BWYA 3L7MA 2WRZA 4REQB 2Z30A 3IMFA 4DPLA 3C87A 2I55A 3ZUGA 4D9MA 4RTRA 3NEAA 1KVRA 1EFRA 2WJYA 3QVUA 4HDRA 4I2NA 3KOOA 4G5XA 4RM3A 4WKOA 5K0NA 3L46A 3RQSA 2RBKA 3U7JA 1DKMA 2P2DA 4YUWA 4B4OA 2O05A 3B6ZA 5T4EA 1QIJA 1U0NA 2P69A 4Q6WA 3DHWC 2WHXA 4XVHA 4Q3BA 421PA 4DEXA 5DJ5A 1W5BA 2OFPA 2WU1A 4KB5A 3WDSA 1W1WA 1CS4C 2B4AA 2GJ9A 3KKMA 1GU1A 2JATA 2C4NA 1YRLA 3D0OA 5HKKD 4IIJF 2GDZA 3VAAA 2XQFA 3WZ2A 4DXDA 1Y1LA 1R0RE 2NU6B 3E2PA 1OR8A 3AJ8A 3LJKA 1RQRA 4X6UA 3UV7A 5L4SA 1VL2A 2G07A 1JIJA 4R7TA 3M9LA 3ABRB 1OKKD 5FV7A 4EW2A 5B1YA 1GGHA 1D0IA 3C3JA 4R1SA 4C76A 3TVYA 1RQ7A 1WXHA 3NNSA 3QFRA 1DBQA 3IMEA 1ZMBA 4JKOA 5EERA 2LCQA 1WG8A 2HA2A 4D46A 4DLXA 2HSDA 2BFBB 3H1BA 4Y6GB 1RS0A 1SRRA 2GSDA 2JFOA 3RRYA 3TRKA 4J2TA 4BB0A 2EG9A 3OOEA 3U3RA 4C29A 2O2DA 3EN0A 3DE2X 3C1TA 4DPMA 2A9QA 3C7TA 2FWIA 3LYHA 4V1CB 5HIAA 5BV8A 4KGZA 3S1LA 3ZVNA 2ZUCA 1PJRA 3PD7A 4K88A 1J0BA 1UK9A 5ADVA 4KPEC 1AXRA 4MGHA 3AJAA 3AU8A 5H02A 3RIMA 5FT9A 2PO7A 3HR4A 4C22A 3O5AA 5AW4A 3NJ4A 1YL6A 4BMNA 1UPFA 1LDBA 1C80A 2Q28A 2AEJA 2QJOA 3L8DA 1XPRA 5EHXA 1IWPB 1SUSA 1KVTA 4RF2A 2DE0X 1R3UA 1T8PA 3EGVA 4HB4A 3OX1A 3IEXA 3KVRA 4P81A 3KVVA 2G08A 1ZWLA 4KWEA 2QW0X 5JQGF 1PGJA 3EYWA 4LA4A 3SYTA 3I8SA 2I6XA 1A8UA 2VPYA 3DKVA 5KSZA 1OF1A 5KQGA 3RTGA 1WVMA 2VSOA 1U7XA 3NOOA 4G9GA 3RYHB 3S2YA 3WRVA 2XUKA 3ZZMA 2DT5A 2F43A 4MYDA 2QDKA 2NMVA 4PNEA 3F5FA 4U7WA 1N8SA 4WJKB 1HTTA 2G36A 2VDOB 1MJGM 2G06A 4EMSA 5B1DA 1BVHA 4UTOA 4HYQA 4BVGA 3BFJA 2I4OA 3NALA 5G1PA 4R69A 5KJ6A 5SY4A 4WXYB 1KEEB 5CG2A 3U37A 2VDUE 2WICA 2XTNA 3UPDA 1EFVA 3BAZA 3VPSA 2C5GA 4BNVA 2VDKB 4EKGA 2QTCA 2I4LA 1KS2A 1X1QA 1SUIA 2MIIA 4BIIA 5BSEA 1RJ9A 4M9SA 4G4IA 4GRIA 5CLIA 2I87A 3DUFA 4YRSA 4MVJM 1PFUA 3VR2D 2HPZA 2EWWA 5E6UA 1ZH4A 3AK4A 3AVVA 2JD2A 4H3KB 4B6FA 4XZ3A 2LTAA 1VG0B 2IYNA 2X5NA 1TXGA 4RVUA 4FOLA 4RCVA 3BSSA 4GH5A 3AEKA 5JISA 2X7JA 4Q1EA 4RHCA 4UCXA 1LQTA 3ND9A 4GBMA 3DAPA 4L0CA 4HNAB 1M2OA 2F8TA 1KMIY 3ECAA 3MJHA 4L8FA 3WZLA 1FRNA 3OE5A 3GG9A 4LVOA 1YUMA 1MABB 4TL7A 4UW9A 5FBWB 1YCDA 5EA2A 4DM3A 4HNRA 4YQFA 4AY2A 3BICA 4CEIB 2VRCD 3N0WA 4QGAA 5LZ7A 4JI3B 1G4AE 2PLNA 3GUUA 4YLEA 4WCFB 4EI8A 2PS0A 1Z5OA 2HDHA 1NATA 3LQ1A 5KYGA 5LD2C 1A5TA 2ZI6A 3KJIA 4MQMA 5CA0A 1G0OA 5EJ8A 1PZEA 1S0UA 1ATIA 1WWKA 3CG0A 4PAWA 2H5LA 4I55F 2CYCA 2QX6A 5F9FA 2I33A 3EODA 3CH5A 2Z4SA 3X1MA 1T2EA 2W6ID 3QPAA 4NBNA 1XD2B 4EPYA 3DBVO 1RYMA 4HDNA 4JJEA 1Z56C 1UXIA 1UOOA 1Z9BA 1ZD1A 2WM8A 3C48A 3QYPA 4M6WA 4NYIR 1Y7TA 4MDFA 5DHRA 1L7RA 2YY7A 1IY8A 4US1R 3URMA 4GL2A 1RAEA 1VRWA 2CZQA 3BG5A 1L5GB 2PHZA 4S1TA 1NVKA 2IIQA 4WPGA 1OBHA 5LLDA 1IQUA 3F6YA 3ZU4A 4S24A 4BY9E 4CM4B 4HX2A 4D0NA 4ECEA 3FX2A 2AR0A 5JSYA 3ADPA 1Q50A 1UDXA 1VB5A 3J81k 1ONBA 3BGDA 1NRJB 4WNCA 1WDWB 5H0IA 4IDHA 4XX1A 5EHGA 3OCWA 1O77A 4Z9YA 1ZVJA 2DPGA 3QPVA 2C2XA 5CFPA 1BJRE 1K8YB 1C0LA 1N4AA 2HHHB 3G49A 5DNUA 3RT9A 4BRSA 4ZHSA 4UE6A 1VJ1A 4K2HA 5CTJA 3WYDA 4DA7A 2X40A 3KUUA 4ZI2A 3LC2O 3CNQS 1JIVA 3V5NA 2P9BA 5BT8A 1CUJA 2QVYX 2HRBA 3P94A 4A2QA 1MW9X 2EIXA 2ZVPX 2CMGA 2B2NA 1V0JA 3AUAA 3AP1A 3MERA 4I50F 5F1PA 4HRVA 4DZTA 2EEPA 1VDMA 2PFGA 10MHA 1U2RA 3EXHC 4Z9BA 2OWEA 4WK2B 3BTSA 1JFLA 3LPLA 3VDMA 1NQAO 1U3VA 3RWMB 4AJJA 2VF8A 4TYNA 2JLXA 4NYIQ 4ALMA 4P98A 2PL1A 3C2QA 4S35A 3PR1A 4KHPB 2VUTA 4N3AA 3PVSA 2IYOA 2OD2A 5C5DA 3K0EA 3LUJA 2O8FB 1T1IA 4KN6A 4RLHA 4HDMA 3VU8A 3I04A 1WXXA 2PL5A 3B5EA 3FKJA 2BBWA 4KVZA 4QU8A 5CMLA 3SKXA 3ABQB 2PGAA 1QB8A 3GGSA 2Y9MB 3HXLA 1Y6GA 5CGZA 1KJ8A 4E1VA 2DFKB 2EWVA 3VPHA 3M6IA 2AXNA 2VQ3A 4DILA 5I9MA 4ESOA 2WJWA 3DMRA 1L7QA 3HUFA 5AVWA 4BJ3A 4CFYA 1NV9A 2R4UA 3K4PA 4FJ0A 4DR7B 4UM9D 1OFHA 1IAQA 3I2GA 3KOMA 4HSGA 4M1WA 4EMBA 3OWXA 3UXYA 4YDSA 2BFPA 2YWRA 1L5YA 4ZCQA 3GGPA 4WMLA 1H1LA 2R6FA 4QYXA 4BPBA 1JN0A 1GA6A 1R6DA 4RXUA 5DBEX 5A0TA 4EMTA 4JJKA 3FCEA 2XYQA 3KV1A 3UAVA 3TKLA 4ALJA 4US0R 1TCAA 1E2PA 2XXBA 3WS7A 4BO4A 1NGSA 1Z4IA 4P53A 2MR6A 2EW8A 4M0CA 1Z3CA 3MN1A 4NOJA 3QUSA 4G0WA 5CDGA 2AX3A 5EWJB 4X9XA 3WRXC 4MV5A 4IIGA 2XIJA 1NQTA 1WZEA 2I7XA 1NMYA 1MEJA 1QHNA 3PHHA 3UW1A 3VHXA 2HZ7A 3R9XB 2J3QA 5TT1A 3TTUA 2YZ7A 4RQAA 1IY2A 1CEQA 5LB4A 4MPRA 5CEEA 1JH9A 3VR0A 2ZPTX 4WRRA 2XZLA 3A28A 4MA0A 2IEGA 4P32A 1FFXB 1V11A 2Z4RA 3QLJA 3RFFA 2PRYA 4A7PA 5DHUA 2Z5FA 3W5IA 1Y1RA 1F6WA 3GC6A 3I12A 5FOWA 2ZTUA 2MMCA 3TBKA 4J0KA 1SVNA 1PR0A 1RD4A 2GHRA 2VHEA 3C3BA 1N0HA 3DKRA 3M3DA 3ZD7A 1CIVA 4NE2A 1XA4A 3WR5A 4H15A 4Z4IA 5TC4A 4F3CA 1MO6A 2E4XA 2QQFA 4WY8A 1K68A 4EYEA 2VXBA 1SCUA 3KCQA 3L4JA 4AKHA 3GB9A 3K94A 4R98A 4MYCA 1BS9A 3FDZB 3SYKA 4MW0A 3H11A 2IYUA 4CQJA 3LFTA 1T0HB 1IBMB 3R6GA 2C0PA 3G6KA 4W5NA 4QM7A 2FFJA 4DLNA 2Y1DA 1XUOA 1RAHA 2EKQA 5IXJA 1UJ4A 1RRCA 3WISA 5DK6A 1EB9A 2JFYA 2A35A 2A1IA 3LKVA 2WMYA 4GWLA 4BQQA 5DSTA 1ZMOA 4CM3A 4D8UA 5ECYA 5DFAA 2H2WA 3MLBA 5DGDA 4IG9A 1JPNA 2ZIZA 4FYYA 1RXUA 2D1TA 2ZE6A 3I2KA 4M37A 4I6EA 1ODCA 5EINA 2JEOA 4A3SA 2JDIA 3ROZA 3WFZA 1FRZA 5F4BA 2YV1A 4LZOA 5HA5A 1G63A 4EBFA 3UWSA 3SQDA 5JFGA 3QU7A 4L6AA 4UNPA 3OKCA 5ES4B 4ER6A 3E22A 4Q03A 4F2GA 2BMDA 1ECJA 2NTJA 4M1KA 2OHJA 4ETMA 3CY6A 3BT7A 1JZQA 2GAIA 1JPUA 1QFJA 3IP6A 4U7GA 3PJEA 2RGAA 3Q6MA 4WXMA 3OE1A 2VTKA 3X1JA 3INYA 3MW8A 3EGEA 5IS2A 4G07A 4F4CA 1UBFA 1CUHA 1XN4A 2XUIA 2IE0A 1XZJA 3WADA 4XYLA 1TZCA 2Y05A 2YJ3A 2CDRA 1X7XB 1P60A 4KC0A 1AN9A 1EVLA 3UYLA 1EEHA 4ND8A 2P7HA 2I71A 3WLAA 1WZ2A 4ZHQA 3EIHA 1CDEA 2YBEA 1MTZA 3R5JA 1WR8A 1PV4A 2PRSA 4DDHA 2NGRA 3MB8A 3WG9A 3D0KA 1R74A 1KAMA 3WBFA 4KIJA 4I9HA 2K2QB 1N3LA 1MU0A 2PUVA 3OPXA 1DBPA 1EGHA 4D4MA 4JI2B 4AZVA 5M04A 1YIOA 3BGIA 1SXHA 4RE5A 1R8JA 3TJRA 4OLAA 2CNNA 3K9GA 1NA5A 2YHSA 4B84A 1GL3A 4OMCA 4WASA 3USES 4U8HA 5AI9A 1P1HA 3X1XA 1MNQA 4IWYA 3BCSA 1H8ED 1IUKA 4L0MA 5IN5A 3ZCQA 1XMVA 4D7AA 1G19A 2DR3A 1GILA 1KMQA 1ZVKA 3LU1A 1XR3A 2E7ZA 4KRXA 4ZVVA 1FFWA 2QU8A 1O7JA 2MINA 2NSJA 3T7KA 5EZ5A 4RMHA 1X9HA 4KO1S 5FPPA 5BYBA 2A1TS 1F17A 3NYRA 1K9SA 4MWDA 2GBFA 2QVLA 2XCSB 4JXXA 4WZAA 4YK7A 3TI9A 5F35A 5I4CA 1AKUA 1N7HA 3OIYA 4WI1A 3TCKA 2HWYA 3FSJX 4Y98A 5F1OA 4UVDA 2DB3A 4HC4A 2Q4DA 4LECA 4PRZA 4L5JA 3L1IA 4NULA 1PS0A 4LGYA 5BWCA 3INTA 3FZNA 4MUFA 1T4GA 2V7PA 2X1MA 3A7DA 3DDWA 1GPBA 3E3LA 3LUGA 2KLBA 4H27A 4JQYA 4P84A 4UBMA 4JKYA 3RE1A 2OGWA 3EW9A 1FP6A 2DQYA 4CMAA 3TSWA 1XMOB 5IKXA 1JA9A 3UG6A 3COSA 3EXFB 3AF0A 2VQEB 3NOQA 1DNPA 1DTEA 1SQFA 1M6EX 1PHPA 1RZRA 2PX3A 1OWPA 2H4ZA 3DG9A 4RF3A 2QEQA 3EWAA 4JT9A 1D2RA 2EL9A 2CK3A 2WNHA 3O8OB 1I5OA 1OUMA 3EUFA 2WD7B 2X7HA 3ZDEA 1JWAB 4I5GA 3QWAA 5EZYA 5LA6F 3HACA 5K0CA 2O8DB 2CDAA 4RL6A 1XDBA 1P62B 1FNDA 1V37A 3CSUA 1W88A 1M1ZA 4IMIB 1O89A 3KQYA 1EQUA 2VSNA 5F7OA 2HFKA 4JMPA 2AMFA 1DFIA 2ZJOA 2FP4A 2Y0CA 3HJHA 5F76A 1NXPA 2F3SA 2G9NA 2I03A 3LGSA 4AIRA 1Y6RA 3NB0A 3JQ9C 1TM3E 2Q07A 1USWA 1JLHA 2RARA 1W96A 4PZ9A 1BQEA 3LLUA 4UULA 4Z0TA 4F45A 5IJ0B 3P4UA 3LCCA 4H1HA 4A0HA 3HI6A 3STYA 4GGPA 4RD2A 3CZCA 4BXOB 1KZ9A 3PGMA 4W6ZA 1AMOA 4G65A 2FE1A 3OCYA 4Q1BA 1WUJS 2PWAA 1VJ5A 1KI6A 1FFBA 1PEKE 1ZI9A 3OLWA 4JSTA 1YR8A 2OLJA 2QLFA 2FCRA 3FB1A 3Q0TA 4YCCA 1QZXA 3KXIA 4GLBA 1J56A 2REQB 3QBVA 4J9VA 4U0KA 4EF5A 7MHTA 1AKVA 3NBXX 4N76A 4BNWA 1OI2A 1T2AA 2QX7A 4NL4H 4QYIB 5M7EA 2Q3HA 2DPXA 4CM9D 4DUGD 1KK3A 5BUZA 2QR2A 1B0UA 3OU6A 1GWNA 2GJSA 3L41A 4PG8A 4ETWA 1TUBA 3A1DA 3O31A 2BFDA 5CDYA 1SZCA 4Y2PA 1HNXB 5IARA 2XUOA 3C7CB 2HSGA 3OD5A 4IMPA 4MLPA 2R8EA 1EGMB 5AKEA 4US2R 4OX9B 1GG5A 1T5DX 3D6FA 1ESCA 1U0HC 3NNDA 3GN1A 4K0RA 2ZRGA 3ZNPA 2QN1A 2YJTD 1WKBA 1QK3A 4K6HA 1C5KA 5A7FA 4MI9A 3EC7A 2F1KA 2DC1A 4FN5A 1UMCA 2XEXA 3F9CA 4GWGA 5CDSA 4XA8A 2BLLA 3LSYA 3OZWA 2YBDA 4J94A 4MITA 3S27A 1JRLA 3O8NA 4FFWA 3HABA 1S3FA 2AX4A 3ZNQA 4WK4B 1AF4A 4I4TB 2BKEA 2GZHA 3O0TA 4OHCA 1F8XA 2YTZA 1J7KA 2IU4A 4KIWA 1UPTA 1FUYB 4ON9A 2QN8A 3LVQE 3JWHA 1S2OA 2P67A 2Q5JA 1DPFA 4RHFA 4UHFA 4UFPA 1T9CA 3UH0A 1CEEA 3A3YA 3C1UA 1J06A 1NAIA 4L4YA 1M2FA 4JK3A 3R7AA 4D02A 1REQA 4QBIA 4MS3B 1EHIA 2BEWB 2I6TA 3C98A 3VPXA 4II7A 1QWOA 2BBSA 1K97A 3RFVA 1DDIA 2QLJA 4G0QA 3SAJA 4Z54A 1UMKA 1JYSA 2O2HA 5DBOA 4P4LA 4OXKA 4Y1RA 1H4VB 3QYAA 1Y6ZA 2O8FA 4CEJB 3IUNA 3R3VA 4INJA 4QXMA 2BHNA 4YJKA 1I4EB 2PNFA 3PVZA 2BGNA 2JFPA 3RLFA 1RRPA 1O6FA 4UTRA 2Q29A 2UYHA 2ABWA 3V42A 5LP6F 1WPGA 3AVPA 5IVIA 5HOEA 2C94A 3TD9A 2C9MA 4LX8A 1KRWA 2QZSA 3L01A 5BOSA 1JQKA 1BXKA 5KNBD 3C8HA 2EV9A 4I0WB 2ZYUX 2H11A 4XWOA 1AGRA 1I7PA 2RGYA 3I0ZA 2D1FA 4XCVA 4Y0AA 5ALFA 1ABBA 3S8YA 3Q8MA 3I9LA 5ALLA 1CRZA 5AVXA 2H17A 4X95A 5JSUA 5I7SA 1KH1A 2D7JA 1T9KA 3UM9A 2WYHA 4B3IA 3PYXA 2R3SA 2IHTA 1L4BA 4XGNA 1WF6A 2XUHA 3ORSA 3BJRA 3KJEA 1C7IA 2B1JA 1EG7A 3DP7A 4RKWA 5CW1A 2QNRA 1YH3A 3C7AA 4Q4AA 5GJVC 3ROPA 1R3DA 1AV6A 2V7XA 4HEHA 1XZQA 1T43A 4URFA 3G0BA 3VYUB 4DY4A 4FX2A 1GTZA 1CHDA 1KYQA 3G5TA 3KQPA 5DMHA 3TX2A 2O1EA 1JU9A 2BGUA 2JAOA 2W43A 3QJGA 4EKIA 2IH5A 4OJQA 3DAGA 4IY1A 2C99A 3T3EA 4Z53A 2HMWA 3QVOA 4QATA 4W4TA 3O8BA 2FPMA 4BO8A 3E5NA 3HB9A 4HZUB 1PWXA 4BNHA 2EWMA 3L4EA 3N2ZB 3O3CA 4Z0NA 3QV1A 3ESYA 1E77A 3PX2A 2O2YA 3HKCA 3QA3E 4P4SA 1RRKA 3Q7RA 1H3EA 3SXUB 3WWOA 3F8WA 2OQVA 4DKXA 4PYJA 3EBOA 1JNYA 3AI3A 3MCTA 1TUGA 2V65A 3VZDA 5KOJB 1NN3A 1P45A 2XTJA 3TH5A 3MTAA 4O4JA 1EFLA 3PZRA 2GZMA 2ZSDA 3B20A 4IIVA 5L8VA 2Z6UA 5FIUA 3RTDA 1TADA 5JD5A 3BD6A 4LRWA 1UUFA 3IVMA 3OX4A 1U7PA 3TD6A 3UUFA 2P68A 5G4KB 4S3MA 1ADGA 4ZALA 1S89A 1P7VA 2ORIA 1HE2A 2EZ9A 1H69A 1LU9A 1E1QD 1O1YA 2ZK7A 3JVDA 4GP9A 2Y9PB 2DFNA 1PBNA 1IIRA 2ZI4A 3NYWA 1EDBA 2NTVA 4XB2A 1MQSA 3KDPA 3OT4A 1FSSA 3S0JA 1PWEA 1K86A 1RRGA 3U7HB 1KAOA 4MW7A 2XKAA 1KF0A 3HVJA 1BE8A 4YTEA 3ZV5A 2E4YA 1GRNA 1E5QA 1N8TA 3Q40A 5ESWA 4CFSA 3NAQA 5HP4A 1MDBA 2GPYA 2C96A 3H8JA 5FL7D 4UKDA 4YJFA 1IBSA 3KLPX 4J91A 2CSUA 3UB4A 3SBXA 1XRLA 4UPEA 3D3EA 3H3JA 4FDVA 5AK3A 2ZUEA 3U5ZB 3F4LA 3CZ9A 3R0JA 4ABYA 4BQSA 1K4YA 4JEIA 2Z2IA 4DR4B 2I2AA 2OHVA 2CV2A 1KK2A 1OI3A 3KJZA 5BSMA 3WAGA 3C85A 1N0WA 1G8AA 1JT9A 3BOSA 3DO6A 1JFRA 3G2MA 4N5NA 2BUCA 4EG3A 4OLHA 4AYXA 1SEVA 4J16A 3WL5A 1MT3A 2KM1A 2XMPA 4RIEA 4A2WA 1KVUA 1XRQA 3IRVA 4O8ZA 4BNTA 3ED5A 4D96A 4FD2A 3IXQA 5EGSA 3DGEC 2VRBA 4M86A 4DLAA 3RRXA 2RAUA 5C46F 5LQRA 3OUUA 1GZ3A 4F5YA 5ER9A 3ZE1B 1L1QA 2DH6A 4HKTA 1JECA 1L7PA 4BCCA 5K99A 1CUYA 2QTVA 3X1YA 4CI9A 1UM9A 3M5PA 1A5AB 4X6YA 3GZNA 2VHQA 2Q6LA 2W2LD 4FDLA 5DYNA 5ER6A 2R2AA 4BE4A 4YY3B 4CETA 2GBPA 4L3VA 4WN3A 3OQJA 1X86B 2VHCA 3AF5A 3IUEA 1GUYA 1J2EA 2IYPA 1W8DA 1J1UA 1ENPA 3OURA 1GKUB 1UM8A 2RB4A 3OP4A 4P2BA 2AUTA 2PKWA 1E20A 3IQEA 3FF4A 4M9RA 1GDDA 4OYHA 1R6BX 4ZQIA 4BO7A 1O0CA 4X90A 3C3CA 1YS7A 2HC9A 2P9EA 4K6GA 2V98A 1C81A 3KPVA 2Q5IA 1HLDA 1GPDG 2ODAA 2PJDA 3TCXB 4AVYA 1MAVA 5TEVA 2F62A 1U0JA 3E15A 4LXTA 3OBBA 4FFBB 5H81A 2VZ8A 4NBRA 1ISFA 1LUAA 3CF6R 5HS4A 2GN6A 3II6X 5FBKA 2ZUBA 5HF8A 3SEFA 1UBTS 3W0LB 3IEUA 3U7GA 1K88A 3AR6A 1OYWA 2FPIB 1ODFA 1XD9A 4IEEA 4NBSA 2DXIA 4LJSA 3HWSA 1VKRA 3JPWA 3MWEB 4Q05A 4Y6LA 4XE5A 1SNYA 4FCTA 2LNDA 5J5AA 3DBRB 4F97A 2NU6A 5T4FA 4JNCA 1AUQA 3EPJA 4X6LA 4BVKA 5T3YA 1XG5A 4PQEA 3HWX1 1RJDA 4Z7QB 4LZLA 3AIKA 1E3IA 3FH0A 4ND1A 1AT1A 3QKRA 4AJPA 1A71A 4E31A 3X44A 2NVOA 3KSZO 1NVUQ 1GAQA 2O3JA 3OSZA 3RIXA 4L75A 4UFOA 3FCXA 4MQFA 4V24A 5EJ7A 1PFWA 5IDXA 3PT5A 5A1TA 2VPWA 4ZK2A 2VLBA 4M7WA 3CLKA 4RVGA 4MVJD 4YMWA 4B43A 3FYHA 1N36B 4QTTB 3VR4D 2WWGA 4ECAA 5EP3A 2IYWA 1TF2A 1RJGA 3PNVA 3S2GA 2E6KA 4H1VA 1XAJA 1SPXA 4UBOA 4XWYA 4I5EA 1JKJA 3G8BA 3BDVA 1BYUA 4LJRA 2VJOA 3A27A 3U3OA 3W9SA 1P80A 2QQEA 3GA0A 4IWNA 3K05A 1B93A 5AKLA 1AV7A 1QOQB 2Q3EA 3CRZA 3Q7TA 3UIEA 4F8EA 5LMCA 3FDJA 1SD5A 2VJMB 4UEOA 3MXTA 3A2MA 3UC9A 4C88A 1A8PA 4RF4A 3TEFA 2BEWA 1PRYA 1XSEA 2ISQA 2PG3A 3GLHB 3H05A 2NPFA 4BO1A 1QO0A 3OLYA 5ALOA 1W73A 5ITWA 1ZRHA 4EFDA 1JT2A 4RD6A 3ZY4A 3OQOA 1H6DA 1ZH2A 2X7XA 2ZSJA 3Q3JB 1W2WB 1GNPA 1DJNA 2JFUA 2XOEA 2IV3A 4LF5B 1VRCA 4W7HA 2W93A 2BSXA 3CX3A 5BW8A 2D4AA 4MGEA 3I6ZA 2FUEA 1KHHA 3EEFA 1EAMA 2ATXA 1I7NA 1C4OA 1MGOA 4UNSA 4BGEA 2NACA 4OSOA 4WY5A 4DKJA 3B1YA 1UP6A 2QDXA 1JTEA 3BSYA 3DE6X 2YJ4A 3RUIA 5FUBA 3FLAA 1R88A 3BHIA 2JGMA 4QTUB 5EUCA 4P92A 4RPJA 4ZT3A 4OMFG 4R4JA 1KYZA 3SZUA 1AJEA 1XJ0A 2QYTA 3E81A 3REOA 3FNBA 3M3HA 4L95C 3VKWA 3WBJA 4C6TB 4ACBA 5CEFA 2RH5A 2XR1A 5CIQA 2IP2A 5L51A 2QPTA 1U3DA 1W48A 2FZGA 3PDIB 3WE7A 4E07A 2GRUA 4WGFA 2G77B 1LW7A 6REQA 3THOA 1HQDA 2XE7A 2OYSA 2FMHA 5J43A 4WE3A 1WDLA 2OWDA 1IK6A 2R00C 3JR7A 4MQ5A 1YCFA 4FNGA 1VGRA 4N49A 5GY7A 1A8QA 1J70A 1JH8A 4UC0A 5SZIA 4AP6A 4BMCA 2GTHA 1SBTA 4V0KA 3OHPA 3NHFA 1EK2A 2XCOA 2VYCA 2LDBA 4Z0PA 1N8NA 4F4DA 4DR5B 1KEVA 1J0EA 3SU8A 2HLDD 3ETDA 3OM0A 2JHAA 4IRUB 4MVCA 2P5TB 4A91A 4NDNE 1CVRA 3KXDA 4PZYA 3WHLA 1LGYA 2HF9A 2DCMA 4RZUA 5FOQA 1I51A 4NENA 3O4GA 1CE8B 5JASA 2ZQ5A 2JD0A 2QW1A 2BDUA 2F3RA 4FI3F 5JRDS 3IQFA 3DMDA 3OEHA 2ZU0C 3OCJA 1C1XB 1ZH6A 3R5FA 1U8UA 2AMLA 3KD3A 3GVHA 4GPBA 1E3WA 1SK9A 4HQOA 1EVYA 3MTQA 4C0HA 1KQPA 3BKWA 3QE9Y 3TAHA 1ZM2A 4HJRA 1TA9A 4F3YA 2IU0A 5LXTA 3OCUA 4L6CA 4TL9A 2J9FA 3Q8WA 1T8UA 8ADHA 5HKLA 3QVGA 1KI3A 3M1YA 3K3PA 4EW3A 5KB3A 5ALXA 1R15A 1Z4QA 5LKRA 1ZNYA 3Q3HA 3VOSA 3WKDA 1MD9A 2BUBA 2CFRA 4LSWA 2QMZA 1P8AA 3GUHA 4NJEA 1XP8A 5I4IA 3FPCA 1M10A 1K5PA 4DLPA 3FTFA 2AHRA 4ER7A 4DQVA 1GCIA 1RM4A 3GARA 3PHLA 2O50A 3VKVA 2FX3A 4YCLA 4GOOD 3DBRA 1RSZA 4YJGB 3TCNA 2CMHA 2SCUB 5KMGA 1CR2A 1BFKA 3VTZA 4JLJA 1E2FA 1AGXA 2G1UA 4GZ6A 2XOKD 2XZOA 4IDBA 4AW9A 3I5AA 3DEJA 4X1YA 2BEUB 1HPLA 4G5OA 2OSBA 4Q9LA 3SGLA 1VCNA 3SYNA 3EZNA 2HHJA 3GHYA 4WESB 3HSKA 4WQMA 3EXG2 2WIKA 1AM4D 3PL1A 1JA1A 1EP1B 3RIHA 3EQ9A 4X7RA 1FDIA 2IPXA 4F3KA 3AR5A 4FQ7A 1XWWA 4NV3A 5C5IA 4MW6A 2ZM5A 1NUHA 1IONA 3O7MA 3WK5A 4Z4EA 3S7ZA 4DCNA 1IJBA 1U3GA 4MKHA 1XPJA 2IUTA 2YFYA 3HUEA 4EW1A 1Q17A 2C78A 2GMWA 2X0RA 2YC2C 4AJNA 1JFSA 2IODA 1NVXQ 3G79A 2C3YA 4TKUA 3CTMA 1WDKA 2D0IA 2YIJA 5CCDA 3B7GA 1M2EA 3VQTA 4JI7B 1J2RA 3KIPA 5C7YA 2ERCA 2HK8A 5D7BA 2WTMA 1WMDA 4LSZA 1CS0B 3ZCVA 3I2YX 4GBJA 4NJEB 2ZYWX 1XMQB 4OLJA 3M6WA 1P4HA 2IEIA 5JOQA 1VB3A 5U1PA 2ZTLA 4FR0A 1YT5A 3ZH9B 1HXHA 2PGLA 2DTEA 1NF9A 4JB3A 1I7SB 3A1WA 3A3KA 4IEFB 3ZBQA 3EDMA 1BE1A 5J1SB 2DFLA 3RSFA 3GAFA 1ZOOA 4UVGA 3RPEA 4DADA 5KO2A 1KXJA 3LDHA 4R9SA 4FOSA 5CB0A 3CJTA 2VCYA 4R1OA 1YJCA 1ZYUA 3WQHA 1KSFX 5HKOA 3LY9A 3NT5A 1A97A 4KQWA 1NPTO 2QSUA 3UFXA 3LE8A 2PD3A 4LNHA 5FOUA 1AB6A 2H1HA 2CGEA 3B6KA 1NFQA 4L4ZA 4NTZA 4RLFA 3O8DA 1UZLA 1DKLA 4ND4A 1YJBA 5GVSA 1SZPA 1XEXB 5ICGA 3V8NA 4X97A 2RHWA 2SKCA 3O8QB 1C9JA 4LJ5A 2PANA 4AF7A 3FRJA 2AG8A 2QKYA 2P2SA 3BM5A 3PUIA 4BMVA 1AOXA 4KQ1A 2B4QA 5K6TA 2VATA 2NYUA 4UE2A 1TCUA 5BVGA 1XC7A 3AV3A 4B3MB 4F5EA 4YJ2A 1B23P 3IODA 3PCTA 1A2OA 5TJ9A 3TSYA 1WY5A 5KDLA 4D9GA 2AG6A 1FLAA 1W75A 2ZSUA 4CNQA 1T26A 1UK8A 1ISIA 2YCBA 1G18A 4BVHA 3M5WA 3VSAA 3ENZA 3W5AA 2IQIA 2JFNA 5JROA 1II9A 1O97C 3I04M 3MAGA 3RUEA 2IS2A 4HQFA 2M98A 5DYYA 3VPGA 3OLXA 1YZLA 2OV8A 1RXEA 4M76B 2OO3A 5FNZA 1RMQA 2FUG6 1ADYA 1PI3A 4X8LA 1ADBA 2JFFA 3A25A 2HIAA 1XA0A 2QTWB 8GPBA 1YOVB 5CIWA 2JI9A 4LHWA 4FW8A 4K3UA 5L3RA 3QU5A 3OF3A 1KI9A 4C4XA 2NXJA 3PI7A 3ZLTA 1CZNA 4E51A 1NVVR 1Z47A 3T4EA 4DA9A 1V16A 3IXMA 3K7EA 3SI7A 3SM9A 1TEVA 1U0GA 3TUJC 1V1MB 1ESZA 5DI9A 5HEKA 2GWHA 4OUDB 5J2TF 1LSJA 1RQLA 4PZDA 5IVKA 4AZ3A 3GL9A 1OLSB 3L7YA 2LBPA 4HZUA 3K2BA 4UHKA 4OMUA 2IPAB 4AKTA 4M8NE 5DSZA 3T5PA 4OHYA 5CDFA 2COUA 4CVNA 1OFVA 3IERA 5IPFA 1FFXA 2RHLA 4AFNA 2QJRA 4RZSA 1ARZA 2FSFA 4WLEA 5TY0A 2ZE7A 2NZUG 4G0VA 5C80A 2Y8EA 4QGFA 4X66B 5EN4A 2CNWA 2WWVD 4CKEB 4BVFA 4Q4AB 4YCJA 3TSOA 2FMXA 1G8MA 5EKXA 1FK8A 1ZN8A 2PIAA 3AM4A 4KE8A 1QOZA 3AHHA 1X39A 2A5YB 3EQ8A 2V8OA 5BN3A 1U2GA 1ZD8A 1K4KA 4B85A 2ZUWA 3NIFB 1DAEA 2H0RA 2JGIA 4LJ7A 4R5HA 2JCYA 4M7RA 3UG7A 6ABPA 4RULA 1CY0A 1C30A 4WOJA 1P5RA 1P73A 4JUCA 1JYFA 1RZVA 2OV6A 4YBRA 5DXJA 3V8BA 3ZDXB 1PQWA 1RBYA 3AC0A 5T64A 3KYIB 3F74A 3ZDFA 3FVWA 3F9IA 4HAIA 4JYCA 2QU7A 3U4CA 4ZT5A 3FUCA 5JSQA 4WGGA 4YR7A 1XQ6A 2PYDA 2ZBRA 3FHOA 4MDEA 3PUXA 4PLVA 1YZYA 1C0PA 4ZVSA 5ALMA 2B7CA 1KY2A 2BTEA 2E4ZA 4RQTA 4JGBA 2FFBA 2IEZA 4DM4A 4ESEA 2EG5A 1U1FA 4FGWA 4BBPA 4U7HA 4UMVA 5CM8B 1V26A 2QG9A 4HAUA 3RANA 3R5SA 2J9RA 4B6PA 3GNQA 4IX1A 3OX3A 1P39A 5CM9C 1LTHR 3EF3A 3NH9A 3ODPA 1VG8A 4Z8YA 5DT2A 1U3UA 2WAOA 4R1QA 1YRWA 3RR2A 2VR1A 4E09A 1C1DA 1BCSA 1H2RS 4PZPA 1Q0HA 3LT4A 3AOEC 3NM6B 4HVLA 5CDFE 3IJEB 4PSDA 3T5TA 1ZOIA 2VJYA 4IDFA 4JP2A 3GQBA 4KK4A 2GILA 3ZDBA 3FM9A 2QN6A 4CKEA 1C3XA 2EDCA 3AUKA 1X1RA 2Z04A 1KEZA 4GEKA 3L3BA 1PUIA 4NMHA 1G42A 5LN1A 4BWYA 4WA7A 4DQ0A 5JSZB 3HO6A 4ZT6A 4N39A 4GE3A 1ES9A 3JYNA 2PUHA 3MFQA 1HLFA 4O4HB 1TUIA 3KUXA 3G1WA 4M1OA 2HV8A 2I22A 3CPJB 4BNXA 1WTCA 1GR1A 4BP1A 5BN4A 4JMLA 3G2QA 1NJ6A 1P4AA 3Q2IA 4LIPD 4XQCA 1UOQA 3H97A 3RVLA 4N9WA 4DQKA 2E21A 1NXWA 1RJEA 1XD8A 4NECA 5KCMA 4MRMB 4POOA 4CLEA 4NYMR 3GPLA 1RXCA 3PDCA 2OXEA 1N2BA 4YRMA 3ICCA 3UCXA 2BIFA 3GLSA 4QPCA 4F6LA 3K1ZA 4XSVA 2GQ0A 1Z73A 1X80A 3P0JA 1MABA 1S2LA 2D0OB 3YASA 3N6VA 4PYKA 3IKTA 1IEVA 2I78A 3H2JA 5E1MA 3VR4A 3OIUA 3TQCA 1RZRD 1E63A 4BQOA 2VJBA 3ILVA 5AI8A 2VYVA 1JE1A 3G13A 4I1SA 5K8CA 2XCTB 5IBRA 4CIWA 3LQKA 3LWBA 4EG4A 1EZ4A 2VFAA 5EIOA 3A4LA 4CN9A 3ADBA 3GAMA 2D1SA 3VX3A 4F4HA 5E6UB 1E64A 3LYLA 3OIDA 1ACMA 2VC2B 4JC8A 1ZNQO 3PDUA 4KOAA 3EMBA 2YXEA 3PC2A 4MUYA 1T2FA 4M1YA 3N05A 1A4IA 5F3RA 3IJRA 1QLWA 2B69A 4IBOA 1SKQA 3A58B 4AF8A 1G5QA 1KS9A 1RXYA 1F0YA 2WOOA 2NOAA 2FF7A 5IYZB 5K3EA 2H92A 4Q1VA 3FZYA 3NATA 4OLFA 5LYYA 1X74A 4R3UC 1T0BA 1YE3A 3OM9A 2JRLA 4PGFA 5FLYA 3V80A 4AJLA 3LKDA 1FBNA 2HO5A 4I99A 2R8OA 4JH0A 3MAJA 1L5OA 5DH9A 4FDAA 1DBWA 1GLVA 1XZCA 3PXCX 4HL6A 4BTLA 4R41A 4CEIA 4TKLA 3S2FA 1JEDA 1GGMA 4LK2A 4BUCA 5EIBC 1J22A 2HLPA 2A33A 1IPEA 2AFHA 3DBHA 3FFTA 4OREX 3UMGA 3A9RA 1WUTA 2Q1XA 1U1CA 2BLNA 1UIMA 3DF9A 1YBHA 3DKKA 5JJ5A 1Q1AA 2ZJBA 1XZKA 3GEDA 1OC4A 2RH4A 5A4FS 3H6GA 4FE3A 2QQ5A 1H9BA 4ZOLF 1U1DA 2VXOA 1ZCJA 4FS3A 1YZVA 5CK4A 3RSOA 5JALA 2BAGA 1U0FA 2YMQA 5TPWA 2MCFA 1F2UA 4OHXA 4CCYB 3E0XA 4U00A 3JATB 4R8VA 3NDPA 4MCJA 2GKGA 4C4SA 5C52B 4OQXA 3EGCA 3Q41A 3S40A 3SZLA 3I92A 3NPAA 1XO1A 2PRZA 1V7CA 4HAZA 3A1EA 2I99A 4EH1A 3WKBA 3E6AA 3OT1B 2IUSA 3A10A 2HSJA 2Z2ZA 1M73E 3T1VA 4IO0A 3KJGA 1YTLA 2QJWA 2YXPX 4DJEC 2NSYA 1AKEA 1VMDA 4C0SA 4URXR 4MV8A 5JH7A 4DV3B 3JAMA 2OCPA 1F9AA 2GNOA 5FTLA 1SXJA 4GOMD 3UJAA 1M75A 4BB6A 2C3OA 1ECFA 1VPLA 4OK6A 2GZDA 3FF1A 4WV3A 4B6SA 5JNUA 1IG3A 4RHXA 1CY2A 4U2EA 2ZAOA 4NOMA 2QP3A 4F21A 3KQUA 3JQAD 2IY9A 2AXPA 4NQRA 2WFLA 3WDLA 2CBZA 3HB5X 4AURA 4O08A 3ILHA 1ZIYA 2D5LA 3KXLA 3UB2A 4CYMA 5KJCA 3PB3A 4NG5A 2Z8YM 2ZBDA 2Q5EA 1Z6AA 3ZXIA 1P2DA 3MIIA 3X2FA 3QQPA 2I1QA 5K9ZA 3JD2A 4QEDA 5FWYB 2PM8A 4G86A 3OA0A 3DE3X 1RPJA 4NHOA 4P0TA 1PNRA 1KFJB 1ODLA 1L7BA 4FYPA 1JJ7A 5E3IA 3EIUA 3GCDA 2V8BA 4IH1A 1I2BA 2QRVA 5KREA 1SIBE 4LGVA 5FTJA 3ZIUA 3LO5A 4Y2XA 2H9YA 4MJXA 1I4TD 1V35A 2I34A 2ZAYA 4PLZA 2O8VA 4HXFB 1E2NA 4II3A 4R7ZA 3W5VA 1N2GA 3CUVA 1RBZA 2RHMA 2X19A 1ZSYA 2WWRA 3K8ZA 3RV4A 1KJWA 2QP4A 2W6CX 3LNTA 4XDHA 3NEYA 1WNTA 3O2SB 3LCMA 3DOCA 1ZINA 1UBMS 5CHYA 5CP8A 4CIXA 1YMVA 3H9UA 3FVVA 4Q3AA 3R4VA 4DMUB 3FNRA 1ZNXA 4DJAA 2GJ8A 3SOZA 4EUKA 1RHQA 1SU7A 3P5BA 2IYEA 5FEMA 5ICMA 3K73O 1XZIA 2GBGA 2GCEA 1HRDA 3V2GA 1EQAA 1P17A 2X1HA 2AN9A 3LPMA 1G20E 3ZWBA 4BLSA 5BY2A 2PZAA 1C0KA 1DGQA 1UOPA 3PNOA 4EHJA 1UBJS 1AK2A 2AF4C 4Q82A 1WW2A 4JJ6A 3PDJA 2NP7A 4QUBA 1T15A 3P2EA 1R0KA 2OCYC 4EBBA 2LXNA 1E9AA 1ECCA 3LA8A 4R3NA 1X15A 2P6UA 2PDAA 3SR3A 1ZL2A 2TRSB 2P5YA 4EA7A 1O5OA 3N8IA 1AKNA 2XHEA 1YTUA 4GNRA 3V4RA 2VNSA 5IM5A 2OZLA 3AY6A 4G23A 2D1YA 5CB8A 2Y66A 2YY5A 4O4IA 4MIOA 3SJUA 3OJOA 4TTPA 1PJTA 1U0RA 3EA4A 3D7NA 2X58A 4K9KA 3TZ6A 5KUTA 2R7MA 4LXQA 1PGPA 1JPVA 1V8FA 2J0VA 1S7CA 2WP0A 1FYFA 5HS6A 3L0ZA 1XE3A 3Q7QA 2X5OA 1N6NA 4JT4A 4X7PA 5EJ4A 5KZMB 5EKTA 2FOLA 3IMGA 2QAGA 5AVRA 1U0BB 4MR7A 4QQRA 2QN7A 2QP9X 1J8DA 1ZGGA 3A32A 3HXKA 1DE0A 3DGFC 4RF5A 4E32A 5CB6A 3DBIA 2OD7A 1DFHA 1ISHA 3C8UA 3HM2A 5LSAA 6LDHA 1Z13A 5ARDA 2MSNA 2OB2A 5CD9A 1UBGA 4BGVA 3P9SA 1RDFA 1UP7A 4WOPA 4GZMA 4AZWA 5CPBA 4LOHA 4D3XA 2FFQA 1PJCA 1ZL0A 4KVGA 2H9AA 2ZJAA 2R8ZA 3RFUA 1EFAA 3C5EA 1K8QA 4QQKA 3F3MA 1YNOA 3LHIA 4RY2A 1PL6A 2EZTA 1SBQA 2XQGA 4BP3A 3NHAA 2X1LA 4A8TA 2IOFA 1IM2A 1XDUA 3PNYA 4P31A 4R05A 4DQXA 1Q0TA 1D1TA 1J8MF 1TJNA 1YI8A 1Z4LA 5TGZA 4RPCA 5AVYA 5JAUA 3TFOA 4FK8A 3MRSA 5BQ5A 5I3CA 5JZSA 1J8FA 2PL3A 3E61A 9LDBA 1U11A 4H7DA 1WHTA 3EISA 3HY3A 3F73A 4NBLA 1KERA 4D41A 5H68A 4QL3A 5F7ZA 3LNCA 4YHHB 2Q8PA 4UOEA 2DG2A 2IEBA 4V3BA 4B4VA 4CLDA 1PJLA 4BVEA 1UODA 3IOYA 4CR6A 2HU5A 1CC1S 1M6WA 3HCEA 5BSUA 1PAUA 2HCFA 3NC4A 1OAOA 1TKAA 4U6SA 4MMZB 1I24A 1TVEA 3OEEA 4G5QA 5BR8B 2GX6A 2SKDA 3BN3A 4EFNA 5EHQA 1U0TA 2O8DA 1DTWA 1SC4A 4KO4S 3WIBA 3TLYA 4L0DA 2J4FA 2QPOA 2ZJ2A 5JCZA 4QQNA 4O4LF 4BV3A 2ZRHA 2QW8A 4UUOA 4KLCA 1JQAA 4K9NA 3VNRA 1SVUA 1KIAA 1ADCA 2XHZA 4NZNA 4YRLA 1U3WA 2EP5A 1VKJA 3LW7A 5ALUA 1SG9A 3BF7A 2GPNA 4BE9A 4JYPA 4Y2GA 2YIDA 3GDFA 4GUDA 1AKTA 1QUEA 2QTZA 2EKLA 2VJQA 1MC5A 1XTPA 2INGX 4TTRA 1QTRA 1RMYA 1IDOA 1K3TA 1H0SA 2YWXA 2YXBA 4FU0A 4NU5A 3JZDA 3PQ5A 2R1UA 2YJGA 1YRBA 2O7RA 4O2AB 1HYQA 1FUEA 1VOTA 3DUWA 4OAPA 3TNLA 1OZFA 1PR4A 3O4FA 3P9CA 5F7XA 4JBYA 4BFTA 3IL2A 5IRCD 2J8ZA 4LDAA 2VUHB 3DOHA 3AVQA 4OU5A 1M5RA 3CKMA 2IXTA 3LVFO 4LGMA 5JQGB 5L3ZA 1QGUB 7REQA 1T25A 1U6JA 2CNWD 2GPJA 3KKKA 4U1RA 5CNMA 1S8OA 2JEYA 4EGCB 5ITZA 4X7MA 5FBRB 4XOIA 4OGWA 4J0JA 1LZLA 2VEDA 2AUNA 4PE5B 2I2CA 1O87A 4MW9A 4J0IA 1X13A 1CUIA 1W6UA 3NBYC 4OBBA 4OHMA 4CEHA 4K9RA 2AJCA 3DMTC 1AK9A 2IGTA 4NFLA 3P2IA 2NNWB 4U7DA 3RBAA 1V9SA 3GVXA 3FDFA 1XTJA 1BN7A 2ZWOA 2CHGA 1N0VC 3DL0A 3KKNA 3PQ7A 3PGJA 4LC9A 3V4SA 1WUHS 3DXYA 2X86A 5IAGA 3NOXA 3CVYA 4XXHA 4F3NA 1S3GA 5IJXA 1DIAA 1QVAA 6REQB 4KPUA 2WKWA 1YZTA 3HL4A 4MRRA 1AUPA 2QI9C 3OOSA 4L2IA 5EHIA 1USVA 4A16A 2O2JA 1DAFA 3BEOA 4GLLA 5GWXA 4CV1A 3R09A 1HWYA 5IZCC 5K8IA 5DMXA 1NOIA 1QVVA 3R23A 5KNCA 3O7WA 1JLMA 4D43A 1DAPA 3K5HA 2Y4OA 1KDTA 2IE8A 3GR6A 3RAGA 1T9DA 2CDBA 4IJKA 3IDZA 5DIFA 2HJVA 3D7LA 1YR7A 3BXZA 2G5TA 1Z36A 3OT5A 4RDIA 2JHFA 2M6KA 3FVQA 3T8YA 4EFLA 3F7MA 3H0EA 3SX4A 1GG2A 4OU4A 4D6YA 2ZTMA 4KXLA 1TGYA 2GB4A 2H1LA 2JA1A 3H2KA 3H87A 3CLTC 3I9JA 3OWOA 5ALKA 5IKPA 4U7PB 5D5PA 2VWQA 3LUPA 4F46A 1GA1A 5AM1A 3S5JA 3G2JA 5KNDD 1ZMRA 1NXSA 3HN7A 3DV9A 1DSSG 1PX2A 1X38A 3HU5A 4KKXB 4LY3A 2C2OA 2C42A 2JAPA 4IX9A 4OXQA 1TKCA 4XQ9A 1V5EA 3GLHA 1GCUA 2H31A 1MC1A 2A7QA 2EF1A 3U4AA 2PSSA 2OBMA 2WUDA 2BGWA 4G1FA 4BFSA 1M1NA 4QU0A 1W2GA 4Y18A 2XDWA 4W5HA 1J2YA 3T1QA 3SNHA 1IL0A 1PF7E 1V96A 2GFIA 1C1DB 4BFZA 3FPBA 5H82A 4OVKA 4NJMA 4WLUA 1K8ZB 3DAFA 3B1XA 1ZRMA 4IVPA 3KOZA 3FDZA 4TXMA 4UNIA 2CB0A 1OMOA 2JLSA 5AUNB 1CEYA 1I3KA 1QZUA 3CZ5A 1H6BA 1U8XX 4O29A 3LLMA 3GU3A 5K0GA 3SXUA 1TI7A 4G2NA 4RQBA 1G8JA 2R8RA 4PO9A 1J0AA 3TLGA 4WNYA 2C58A 1PJ4A 1YL7A 4HAXA 5SZHB 2GVZC 1ORVA 4IHJF 4P6VF 2VH1A 1H0HA 4PTLA 3DMTA 2AZ4A 3KWFA 4Q4LA 5IDYA 4D97A 1DQYA 1E6LA 1XMJA 4INOA 2B4YA 3EX7C 2GPTA 3DHVA 1MIOA 3P5SA 1F3LA 1V48A 3RSQA 2HK6A 2PQ2A 2PMCA 4Y1EA 4F3RA 5JPDA 2PUCA 2CUNA 1EVJA 2AZMA 2CD9A 2OGUA 2VRWA 4ALIA 1TEHA 4HQNA 2G4CA 4YB8A 2FZVA 3AVWA 1OXTA 1PT6A 2V7UA 2WWTA 1TC1A 2D2EA 1NXOA 3DAHA 3EUWA 3V8RA 2HMUA 4MO2A 3JQ8A 3B9QA 3UOWA 4IQ8A 1JJBA 1Q0PA 1P3DA 1CPYA 4OFWA 4YCNA 3ZJTA 3PXXA 4ZQFA 1ULZA 4Y2SA 3VUEA 1KEPA 2OFWA 2PT9A 4FHFA 1SOWA 2BJWA 4LHVA 1UL1X 4WZ6A 4Q21A 1MHTA 1SWWA 1MFZA 2GD1O 2PCJA 1WBJB 2A67A 1N5RA 4NBUA 2VA8A 1EM6A 3DL7A 3QPUA 5ALYA 4LYFA 1E3LA 4FW9A 1T9ZA 4AP5A 4GRDA 1B8VA 2ETXA 4MIKA 2R7NA 3U39A 4DBZA 4IFEA 5AW1A 5AJHA 3V3KA 3ER6A 4B82A 5B58T 2RHDA 4O0LA 5G3ZA 3S7TA 3V46A 1J0CA 2YVQA 4RO0A 3P4XA 3T3OA 4BTVA 3JAWA 1ZRSA 2W8BA 3EG9A 1YWGO 5ARBA 2ZSHA 1JXAA 3N3BC 1CVIA 1XTRA 2XA9A 1BDHA 3DO5A 4M1EA 1PVDA 1CZLA 3UQYS 2Y92A 1RYDA 2IEDA 2IXEA 3ONWA 2C31A 2FLWA 1DAMA 1ZO8A 5LDDC 1OIVA 1NMSA 5AK0A 1T4CB 4PV7A 3CT6A 3I45A 4Q16A 5IF3A 1YHNA 2V0CA 3MCAA 3NYQA 4GMDA 5B3JC 1ZAYA 3AM1A 3QX8A 1PEYA 2FPGB 5LMZA 4K9PA 4GLJA 4IS3A 3VC1A 4C7OA 1NRXA 2NXEA 1RWVA 2PRKA 1GNRA 4DDWA 1EFPB 1L7MA 1TM2A 1MRZA 3R6WA 2WA2A 3JZFA 3PQFA 1B42A 1VGVA 1O95C 3FVTA 4KGVA 3EVAA 4WOBA 4AMYA 3W6OA 1GTMA 3B1WA 4WBNB 5ED0A 1ZM3A 4TMZA 2C7PA 2DRIA 3GFRA 4BL5A 5CYGA 5IJ9B 1DWOA 1O94D 1EKXA 1Q0LA 2WZCA 5KWJA 1MZVA 1QG0A 1LC3A 3EVCA 4IF4A 1NUAA 3LIPA 4OHWA 2D2FA 2ERYA 3P2KA 4ND3A 4X93A 3OQ6A 3NWEA 1JG6A 4J2HA 2GYWA 1VBMA 3B3GA 3Q6NA 2NUBA 2I7TA 1NDHA 4HDRB 1M0TA 5JECA 5GAJA 2R47A 3AZPA 1HC7A 4HAWA 4IZIA 1VBNA 3AQIA 3L40A 4MUGA 3FNQA 1JS1X 3DH0A 4XD7A 2B3TA 2XSZA 3NBQA 1NXTA 5H5JA 3TDNA 4KITB 1VPDA 5FWAA 2DUJA 2VBCA 3FSGA 2QRKA 5AOCA 1H5NA 1O54A 3VV2A 4HPXB 5CXSA 4DR6B 1UK6A 5L7YA 3A4NA 2Q0QA 2JH3A 3N2GB 4YXWA 1TUEA 3IUJA 3DOFA 4PZAA 4TS3A 5A02A 2WUVA 4LQCA 4MROA 3O9VA 4UQOA 4LXHA 2PMDA 1Y4DE 3HYCA 2WMNB 3JYHA 3BREA 3M4ZA 1RTKA 4D2IA 5FULA 1YDGA 1Y6FA 1FJHA 1AVTA 4MEAA 1JG2A 4G56A 1K6MA 4QPNA 1LDEA 1C9EA 5JJBA 1P61B 2H9IA 4G0NA 1PP4A 1E4EA 3F8SA 3R4CA 1C1YA 1T24A 3B60A 3E7FA 3S1AB 1RYYA 1NV8A 4AJEA 5LQMA 1H0RA 5DX0A 5DNVA 1N78A 5T6MA 1Z6YA 2B4RO 3GXBA 4D3SA 5I9NA 4EY4A 2FMTA 3C3WA 3BMQA 4FLEA 1WKVA 3VZRA 2PJZA 4OI0A 3G2KA 4Q7EA 5EIFA 3FPJA 4HGOA 1NKSA 2X4LA 2F9LA 3SM3A 2RAFA 4R8SA 1GAEO 4WKBA 1QZ3A 2O6HA 1Q1NA 1H1TA 3FFWA 3E18A 3IDQA 1R6VA 1DG9A 2QTNA 1ZZGA 4FP9A 4Z4QA 2M9MA 1CVLA 3BGVA 5J2UA 4Q4CA 1ML4A 1ZIDA 3BZUA 3O9MA 4MIYA 2Q6IA 3WGKA 1UBRS 4JI4B 3DZIA 1TT5A 4BEBA 1YJQA 3IBYA 2VXCA 2ZUSA 2XB6A 2QL6A 3N2KB 4YJGA 5ITSA 5JZ9A 1WD5A 1N2CA 1NF2A 2D0PB 1GQSA 4UAUA 3WBBA 4B3BA 5JNLA 2WJ3A 2C7QA 5CLQA 3TECE 1P5ZB 3NLLA 1ZDMA 4RCYA 4YUXA 1TZMA 4EB6B 1QRUA 4AMBA 2OA0A 3JRNA 2P35A 3AY7A 1P29A 1ONOA 3DDCA 5KOYA 2PJRA 1FDSA 2P0YA 3DM9B 1R0XA 3HC7A 3VR6H 5BOSB 3NMUF 3DW3X 4TVBA 3O21A 1IY1A 1C7EA 1EFVB 1RMTA 1Y82A 1LV7A 2O2EA 2XY4A 1VA5A 4QG7A 1I80A 2BZSA 1A76A 1GTL1 1Y98A 2OHXA 3OLZA 1PLKA 4O2BB 5A62A 1C41A 4IXWA 4IGIA 2G9QA 2VS1A 1VZ3A 2PXXA 1NLMA 2QE6A 5CNJA 1D2HA 3ES9A 3ILXA 2XNDA 1AF7A 1X0XA 3OZDA 3KEOA 4R8RA 3S3TA 4AJ4A 4E03A 5CXXA 1EINA 3HJTA 3I6QA 4G41A 3UEOA 3EZ6A 2R7KA 4MR8B 3D6HA 2HUNA 3ZVLA 2A0WA 4BZZA 3J81A 4BX0A 2Q1TA 3C5VA 4RZXA 2C29D 2J46A 1LI4A 2E37A 4A4DA 4W5JA 1E1MA 5F64A 1S1CA 3HJAA 2B9EA 4MDHA 1UFOA 1HFEL 5A3SA 3UB3A 2ZYDA 1Z08A 1PDVA 4K1XA 4QFDA 4R9VA 3JARA 5I01A