5DKFA

Reaction of phosphorylated chey with imidazole 3 of 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
molecule keywords Chemotaxis protein CheY
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dkfA00
3QLVC 4PYRA 2JVIA 4LZLA 2ZWMA 2FLWA 4RWEA 3QELA 1QKKA 3KJXA 1URPA 2MSLA 5B3JA 3C97A 4W5NA 1JDPA 1RZRA 4ZMRA 1QP7A 3NBMA 3TMYA 3FFXA 3VNBA 3QEKA 3LUJA 2FVYA 5FWXB 3DLBA 1ZDMA 2HQOA 3QLVA 4RKQA 1P6QA 3EAFA 5EWLA 1OXKB 4MQFB 1M2EA 2LPMA 1UDRA 4EYGA 5B3JC 3MM4A 2PJUA 3M9XA 2H3HA 4Q6BA 5BRAA 5JNSA 4IGAA 3LTEA 4F06A 2HQRA 2E4XA 3B2NA 2FW0A 4P1ZA 5BR1A 1JFSA 1BDJA 1YMUA 2NT4A 4RK5A 3FDFA 4RY9A 1TMYA 1JH9A 4KRFA 3OLZA 2FMFA 1DBQA 4JAVC 1U2PA 3I5AA 4D6XA 3Q15C 3QELB 3QK7A 2BGGA 4DADA 5BRJA 3BILA 2JVJA 1DBPA 4DN6A 3Q9SA 1DC8A 4XLTA 4B09A 5FWYA 3F6PA 5CNIA 3GWGA 5KQPA 1DCMA 1RXEA 1EFAA 2RGYA 1CYEA 4EVQA 2FQWA 4S04A 1U2QA 3HZHA 3QEMB 1FQWA 3A0UA 3OO1A 4MS1A 3KCNA 2FEKA 3CLKA 2HSGA 3GL9A 4LRQA 5JNWA 4WUTA 4JP1A 1KMIY 1Y1LA 4HYEA 2PKXA 3O74A 2F8SA 3LUFA 4WZZA 2RJNA 5CNJA 5JS2A 3O1JC 1AB6A 1ABFA 1Z26A 2WJWA 1ZH4A 1L5YA 2FXIA 4XXHA 2PE5A 3FGZA 3K4HA 4YS6A 5TQ2A 1YMVA 4OLBA 3LOPA 3OM0A 3K9CA 3OLVA 2MYPA 4OTZA 4LDZA 3N8IA 4MGEA 1DRJA 5FBHA 3IDOA 1LK0A 3Q41A 4PZ0A 4Z4HA 4EUKA 1W9HA 4MQEA 4ETMA 2QVCA 1FSPA 4KFCA 3N0RA 2MYTA 3KYIB 4Y9TA 5BQ3A 4KVFA 5IX8A 4MPTA 5HSGA 3O2JA 2WY2D 2MSKA 3EGCA 3LUCA 4YP9A 4HNSA 5TE9A 5C5EA 4EYKA 1VLZA 4YRZA 3NNDA 1QPZA 4RY8A 1DRKA 1B00A 1ISSA 1QQBA 3IP9A 4O1IA 4QICA 1LJUA 2FSPA 4Z9BA 4W5QA 2M98A 3E3MA 3HDVA 2QSJA 4MR9B 3CG4A 5DCLA 1S8NA 2GKGA 2A9QA 2AYXA 1C0EA 1DBWA 2FLKA 4WXEA 5HQJA 5TQ0B 2IKSA 3O2SB 3UKJA 3CRNA 2L18A 3GT7A 4IMJB 4MR7B 4N41A 4F12A 4OLAA 3OQNA 3D8UA 2FTKE 4UHKA 1SXHA 1NXOA 3BBLA 4ZMSA 3TD9A 3JTEA 3GRCA 3ROTA 1QQAA 3HXMA 5IUJC 4L85A 6CHYA 1DG9A 1P6UA 3EULA 4IMIB 5CNMA 1E6KA 3OQOA 1HEYA 1C4WA 3GYBA 4GPAA 1Z2EA 5TQJA 4LX8A 1E6LA 3MIZA 1ZVVA 1Z18A 3BREA 4QYWA 2H0AA 2OENG 3O75A 2GBPA 3H1EA 3H6GA 4NCAA 5KC8A 1BDHA 5I4CA 1KRWA 3MQ4A 2R47A 2P9HA 4RDCA 1M5TA 2L19A 4KQCA 1QO0D 4MS3A 1PHRA 4D6YA 5IUNC 4LE0A 3GV0A 5TQ2B 4N47A 4Q6WA 3IPAA 3OLYA 5FWYB 5ED4A 3T95A 3JY6A 4MRMB 5IC5A 3E61A 3HSYA 3KHTA 4M88A 1JX6A 3QLTA 1EWVA 2A9OA 3QLUA 2N9UA 4NICA 3DBIA 3NHMA 3HO1A 2R48A 1QO0A 1NXTA 2CD7A 4EY3A 2QU7A 4N03A 4G97A 4O5AA 3H5TA 1NXPA 4RSMA 3IP5A 4MLDA 1JLKA 1JDNA 3Q7RA 4RKRA 4LDAA 3H75A 3HDGA 1D2AA 3OMXA 4PE5B 2CHEA 5FBKA 1JF8A 1DP4A 5IEJA 2PMCA 4OATA 4JB2A 4XAQA 3FMVA 5EWLB 2JCGA 5KI6A 3GBVA 3F73A 3CTPA 3H1GA 4RS3A 1JHZA 4G0PA 3BRSA 1Z12A 2ZAYA 3A0RB 4YGXB 3HJFA 3I45A 2CHFA 5TPWB 2LBPA 4JA2A 1ZESA 3TO5A 3OLWA 2A9RA 2FEPA 2QW1A 4LE1A 3RVLA 5TPZA 1D5WA 1NXVA 1QNLA 3NHZA 3CZ5A 5F64A 3SAJA 2FMKA 1GUBA 4MR8A 4F3TA 4H60A 3SM9A 3R0JA 2PUEA 4D74A 1ZY2A 4RK1A 2HQBA 3H5WA 2L2QA 4KZKA 4Z9AA 3GBPA 3G1WA 3HS3A 4TLLB 4G0ZA 1PEYA 1USIA 2PLNA 3DZDA 3N75A 1SRRA 2X7XA 1P2FA 1ZN2A 2PAFA 3OLXA 4RXUA 4E7PA 1MB0A 3O21A 1A0OA 1AB5A 1YTUA 3RVSA 1APBA 4KPYA 2JRLA 4EGSA 3CNBA 1JWLA 4FB4A 4WWHA 3OO0A 3S99A 4W5OA 1QP4A 1KGSA 2V0NA 1ZITA 4MS3B 5IEBA 3UK0A 1P8AA 3CHYA 4FE4A 4YV7A 2FEWB 2FMHA 3TX6A 2IPLA 3MA0A 1PUXA 3N0WA 3ROFA 4G0QA 1FFGA 4RY0A 3HV2A 1EHCA 3H5VA 4MQFA 2QV0A 4RK0A 4TMYA 4GNRA 4JOQA 1ZGZA 1CHNA 5ABPA 2HPHA 4IF4A 4JB0A 3OM1A 1FFSA 2ID9A 2VUIB 1PNTA 1GUDA 1K68A 3HVRA 1VPWA 3FFWA 3QX8A 1DCKA 5DGCA 1NXWA 1JFVA 2FN8A 5DLEA 4ML3A 1USKA 2PUCA 1A04A 3DGEC 2DRIA 3CU5A 3L49A 3M9WA 1M2FA 4PEVA 2LP4Y 2QXYA 3G85A 3HUUA 2JBAB 4RXTA 4EVSA 1ABEA 5HKOA 3EQZA 5IUKC 3F6CA 3C3KA 1BVHA 5EWJB 1NXSA 2IPNA 2HJ9A 1WETA 2PUFA 1QMPA 2P4UA 4F8JA 1CEYA 4MS4B 2FQXA 3CS3A 2RJOA 3DGFC 3MF4A 3N6VA 1BA2A 1TJYA 4QYMA 9ABPA 3OMWA 5TQ0A 1U8TA 4P98A 4MR8B 3ILHA 2E4WA 4Z4FA 1IIBA 3NNSA 1DC7A 4MYRA 5HM6A 3KKEA 2PUAA 3IP7A 5JNVA 3RVJA 3GA5A 5PNTA 2WJAA 3L6UA 2E4UA 3FFTA 3H5OA 1OXBB 3URMA 3RQIA 3CKMA 3LUGA 3H5IA 1KRXA 3C3WA 4W5RA 2JVKA 3CFYA 2FN9A 1PEAA 4RZSA 2B4AA 4KK4A 4WXMA 5EWJA 5FWXA 3JVIA 1LBHA 2PUGA 4NV3A 5KQLA 4KREA 2WMYA 4HNQA 5JNRA 2Q5CA 4MLCA 4N0QA 4OBBA 4G0XA 4RK4A 2R25B 1U04A 3O1HB 2VUHB 1MIHA 4YWHA 1Z16A 1K66A 2IOYA 3EODA 3LUHA 2A9PA 1XHEA 1MB3A 5KQGA 1M5UA 1W25A 1LBIA 2IYNA 3HEBA 4HNRA 3D02A 4MR7A 5DTEA 4EVRA 3QX9A 3C6QA 1TVMA 1BAPA 3NNNA 2MYNA 2JK1A 4UHJA 3QLUC 2PUDA 4XARA 2OQRA 3KTOA 1USGA 1NTRA 4ZYLA 2E4ZA 1RZRD 1JBEA 4JASB 1L5ZA 2JB9A 1GCAA 3VNAA 1JL3A 3W9SA 2NT3A 6ABPA 3JS5A 2AYZA 7ABPA 3RVRA 1BDIA 1YK1A 1NY5A 5CHYA 3KS9A 3RVQA 4TN5A 2WB4A 3RVMA 1ZHHA 4ETIA 4XASA 4NCBA 4TLMB 5T7BA 1EWTA 4Z4EA 4IILA 3O1IC 5KC9A 3HK2A 3LUDA 1H9CA 2NZUG 5CNKA 3H1FA 4YCSA 5TPZD 1Z13A 1VKRA 4H3HB 4MQEB 2PL9A 4RV5A 1J56A 2I6FA 3MMNA 1PNRA 2L17A 4Z0NA 1FFWA 4Z99A 1YS7A 3KLNA 1ZH2A 2GX6A 3DLHA 1GCGA 3SNKA 1RXIA 3LKVA 2NUBA 3KG2A 4MRMA 3TB6A 2E4YA 1ZGGA 5C5CA 4IRXA 4OG2A 1RPJA 4H3KB 4O1HA 1YK0A 3KLOA 4WT7A 3A10A 1XHFA 2R4QA 2QZJA 3T6KA 3CZCA 3O2QB 4ZJPA 3A3KA 4N0PA 4MAAA 4KV7A 1VRVA 2PUBA 3M6MD 1Z15A 2QR3A 1MAVA 4RK7A 3SY8A 4RU1A 4ZPJA 4ETNA 4S05A 4MS1B 4EYQA 3QEMA 2MSWA 3RVKA 4W5TA 1DZ3A 2CWDA 2TMYA 1YIOA 2NZVG 1NATA 2E4VA 3F7NA 1Z2DA 4L4UA 3HUTA 3JPWA 5E3JA 2B1JA 2PL1A 2XDYA 4PICA 1F51E 4DQDA 1SXGA 5JS1A 2YHBA 3Q7SA 5TPWA 3LUAA 2IPAB 1Z17A 3RVPA 1EAYA 4NQRA 5D2CA 3JVDA 4CBVA 4RXMA 4LE2A 1XWWA 3JPYA 4MS4A 3I42A 8ABPA 2O20A 3I09A 1T34A 2YHAA 3SQNA 1YVUA 1LJLA 2ID7A 4QPJC 3OQMA 2W42A 4N76A 2MYUA 2FMIA 3BRQA 2VYCA 5EWMB 2QVGA 2VK2A 2M1ZA 3H5LA 5IBQA 1EWKA 3MYYA 3EJWA 3EQ2A 4G86A 3CG0A 2F8TA 1SD5A 1MVOA 4XFKA 3P9YA 4EYOA 3Q7TA 1GLGA 1JYFA 4YO7A 2RDMA 4MR9A 4F11A 3LUKA 2J48A 2WRZA 4G0YA 3UUGA 4Z4IA 1U0SY 3LMKA 5DKFA 3LKBA 1D1QA 4E7OA 5GOTA 1DJMA 3EDCA 3KSMA 2FQYA 3RH0A 1D4ZA 4YR7A 1R8JA 3N53A 4G0OA 4KMRA 5GQSA 5KWSA 1QP0A 3IPCA 2GWRA 5KQMA 1A2OA 1ISRA 4FE7A 4KNYA 1TLFA 4Q7EA 5EWMA 2FKAA 3RVNA 3T38A 3C3MA 3H6HA 2IDMA 1JYEA 4Z4CA 5T3YA 5JNUA 2JBAA 4RK6A 2LIVA 4G0MA 2WWVD 3LFTA 1ZAYA 1YS6A 2IPMA 1F4VA 3SG0A 4Z4GA 3HCWA 3KYJB 3RVOA 2GI4A 5IULC 4KQ9A 1Z25A 1E2BA 1E6MA 2KYRA 4KK3A 5JNTA 1NXXA 1RNLA 1D1PA 3HM9A 2LUOA 3N0XA 4YLEA 1SXIA 3ILYA 1DCFA 1TM2A 3T8YA 1JFTA 1I3CA 3IP6A
chains in the Genus database with same CATH superfamily
1QDLB 4NV0A 3M83A 1WOYA 3I9MA 4J1TC 3R0IA 2FLWA 4QATA 2CUZA 2RSLA 3EX7C 1WSWA 5BURA 5B3JA 1ZJ4A 5TY0A 5ALWA 1QU2A 3CVWA 3EIXA 3E5HA 3EARA 4HZUB 5FUXA 3ZG6A 4K40A 3F78A 4M0PA 2IPOA 1CJMA 2DE0X 1LV7A 2QYSA 3EEIA 4YWJA 4DJTA 1PTJA 2AH5A 5EVCA 3DDOA 5J9FA 4LJKA 4QFDA 1SHLA 3HHEA 3ZDEA 4BCDA 4ESHA 3VVBA 2JKZA 4DLYA 5HKKD 4ZAXA 4CM9A 4CEJB 1I7QB 4EEXA 5JADA 4GPZA 4Q9HA 3HP1A 1FYDA 2H3HA 2WILA 4BL5A 3DFMA 2XXJA 1L2TA 3FMFA 4CMBA 5BR1A 2FW0A 4CQLA 3L0ZA 1YMUA 2XMGA 3P97A 1QP8A 3JTMA 2YC2C 4JBXA 2FMFA 4ACBA 2HNBA 1PS0A 2QAGA 1U2PA 5CLJA 2C2XA 4I1OA 2WYOA 4YK7A 3EVBA 3PBKA 2WAYA 3EHEA 4RIFA 1S3SA 3GJ6A 5HMMA 1M2OB 5ALLA 2AFIA 2OV3A 3G8YA 3B9BA 1UKZA 2V98A 2VYNA 3F6PA 1OKKA 3MOGA 4EZIA 2Q6IA 4ZVOA 1CJTC 3OPVA 4P7JA 3NWOA 3FE2A 2BMVA 4TKVB 4EX7A 4CN9A 1VFPA 2ODWA 3HKEA 2XRFA 5KWJA 2WZBA 2FI1A 4M87A 3L1VA 3ANSA 1G6KA 1Z0ZA 2FGKA 1K5DA 3EH2A 5HFNA 5KUTA 1GG9A 2X77A 3AU9A 3C7CB 1W47A 4PGMA 3RNOA 4AM8A 1ZVJA 2PX4A 1ESNA 5DTQA 2QLTA 4YVFA 1XZMA 3GRRA 1RJWA 1BROA 1QIGA 4QASA 4J7AA 5CDYA 3O1JC 2RGNA 5IFKA 4CDGA 4AJNA 2FXIA 4FOSA 4YS6A 3BX1A 5GIPE 2J0EA 1C41A 2FW6A 4C3VA 1NWCA 3NHPA 1A2KC 1ZXXA 3OCJA 4Q0MA 3SE7A 3P0EA 2E5LB 5IANA 2RE8A 3OESA 3FCEA 1E1QD 4A8JB 1GUAA 2REOA 2XE6A 3M1YA 4OCZA 4YCLA 2OUIA 2OA0A 4H15A 3SFVA 1FSPA 1PT5A 1JW9B 4PX9A 2B3TA 3FLEA 4KBYA 1MOQA 2FUG1 1YQXA 3M7IA 5DSZA 4DWWA 2W6CX 5LM3A 4KUHA 5H16A 2J5XA 3QKTA 4DM3A 2W2QA 4KE7A 4PNPA 2FWIA 1BYUA 4V39A 5JAHA 2ZXFA 4AXXA 4EHJA 5IN5A 5K0JA 3PQ6A 3VC1A 3U2QA 4EYKA 3K6SB 4GXNA 1Z8NA 2IFTA 5DTRA 5AUOB 3NV7A 1ZUD1 2NQ2C 3GFBA 3W77A 3ZHVA 1YS1X 2WHYA 4W7SA 5GVSA 1U4SA 3GVCA 5KDDA 2ATEA 1T6YA 1ZM4A 1X7YA 5JEDA 3HH8A 3KZXA 3OJLA 1XYYA 4KYUA 3KEMA 4BP3A 2BZSA 4NPHA 3G5LA 1MO5A 3V1TC 1S8NA 4OK5A 4ZQGA 3UWKA 5EMJA 1E0AA 3LXUX 4DLBA 2IKSA 3FVVA 3G1UA 4DRZA 5TIIA 4TMKA 5FUBA 1W2WB 2F90A 2G3YA 2H7XA 2W6ZA 3A6EA 3ABRB 4MITA 1P7ZA 1P2GA 2C1XA 3I28A 1RABA 3IOMA 4L5IA 1ZS9A 4L6CA 2BVNA 4QEDA 3WK6A 3BBLA 3KEOA 4J16A 2W4IA 3WY9A 4R9VA 3KT6A 3LT1A 1NYRA 4ZXPA 2XODA 4BZZA 2ZUUA 1CQJA 1GNRA 1G5HA 2GLTA 2HT1A 1Y7HA 3S40A 4QQRA 1USUA 1Z2EA 5TQJA 4K6MA 3MJ4A 2BPOA 3P4XA 3FIJA 4BLRA 1L4BA 4I3GA 3OURA 4DCPA 1EFRD 3BRCA 1NV9A 1ZA2A 2X9NA 3OIYA 4IHJF 3KUKA 1XC7A 1KRWA 3DQQA 3D6TB 3PQ4A 4ZOCA 1J5EB 4LNAA 3KUDA 2GHQA 1Z35A 5CG1A 1W49A 2XD9A 1TA9A 3LY8A 7AT1A 4ZHQA 1JDVA 3GV0A 3CX4A 4XR4A 1NUHA 3TZCA 1D6JA 1JEQB 3KZKA 3E0XA 4QYXA 2FCAA 5KAPA 4E88A 1HG0A 3K71B 2PANA 3AEZA 3IVMA 4XQ0A 4BO3A 1XBTA 1EWVA 3VYTB 2XMCA 3L01A 5HEKA 4E6EA 1XZ8A 2CHVA 3LX4A 3WB0A 5L7TA 4OHMA 3BE5A 2AOTA 1EA7A 1M6WA 4RPHA 5KINB 1O57A 3B3QA 3MTEA 2CE7A 2VH5R 1CRLA 4DCTA 1JLKA 1NFRA 2YQ4A 1ZICA 3JASB 4D99A 2UZ1A 3HDGA 4GWGA 1E2MA 3EEBA 1RAHA 3O83A 5FBKA 2HHAA 2O7VA 3CF4G 4TZKA 4FWTA 5FL7A 5IEJA 5DXFA 1AQYA 1OWMA 1IB0A 1NBAA 2Q3LA 1KIAA 2BT4A 2Z98A 3BXPA 4XIIA 4FLFA 1NXQA 1UDXA 3SYTA 3X0DA 3C3PA 1I3MA 5HGXA 3CTPA 4Z7JA 4Y0AA 2E55A 1EGHA 4PFSA 4Q3NA 1GR1A 3WADA 4J4BA 1JIJA 4NNJA 2O5VA 3LSYA 1N6LA 1A4UA 4C21A 3L8MA 1CUEA 4C0BA 4EDFA 4UM8B 1S7GA 2A9RA 3RDPA 2I65A 3L7BA 3O0DA 1J33A 4QPCA 4WOBA 5HQ3A 2FPGA 4F6CA 3ND8A 3S2FA 1NXVA 1CUWA 3TLGA 1VOTA 3E7DA 4K9OA 1Q7EA 4ER3A 4N49A 1OZAA 5IAJA 5K0ZA 2NUTB 1VIAA 3O0TA 3OTQA 3R0JA 4DSTA 4RK1A 3MJRA 4I14A 3COJA 1YCHA 3H5WA 2L2QA 4JKIA 4NCNA 1KDYA 4R2WA 4ARSA 1UMBB 1A9XB 1PHPA 2I3GA 5A06A 1USIA 3C6YA 4ZDWA 3ZDAA 5G0VA 3BZUA 4DLTA 3MZ0A 2ZI5A 4C6SA 2Q8QA 4DUPA 4R2IA 4FGUA 4CMEA 3E7FA 4EAQA 4X41A 1HDGO 2WWXA 3TH5A 4DEXA 4CPDA 4RH0A 2W11A 3RVSA 2WINI 3VA7A 1NRJB 1U65A 3CB4A 3DXZA 3IQFA 3ONEA 3QVWA 4FHEA 5FO0A 4DC9A 4ENVA 3ZVLA 1QP4A 1YDGA 3SOZA 3NH9A 4ZJYA 3DP9A 3UK0A 5BSFA 3RF7A 4DL9A 4DWVA 3H2YA 4BMSA 2P2GA 1NC3A 1TM3E 2FEWB 2V7GA 3U61B 3MA0A 4DXAA 1GHTA 2PRIA 5ALIA 1MZPA 4N01A 5K0NA 2VQFB 4K6HA 3U1TA 4YCCA 1D2EA 1WLYA 5TF0A 1BVYF 1TA4A 4AY6A 3J81A 4Y1RB 2VQ6A 4X3CA 2ZRCA 4NZZA 1TPYA 1JIXA 5E1MA 5FXMA 3UKDA 4AC9A 1SBZA 4G4JA 3PUKA 5DXJA 3PC2A 1WV1A 2V8OA 3VR5D 4EK9A 4CLEA 2PUCA 3AR6A 4LJRA 1JMYA 4FMDB 3EGDA 3ZE8A 3G2IA 3GIDA 5JLJA 1KPIA 1NM5C 1YACA 3HUUA 2Y1OA 1UBSB 3M6AA 1I4DD 3WGLA 2PT6A 4H7HA 1TECE 3QFHA 2IYXA 3SYLA 4AMBA 1F8FA 1BVHA 5J2UF 4O8CA 2I6SA 4H59A 4DNOA 2V7VA 1OVMA 2HJ9A 4D4JA 5E8RA 4ZI3A 1X86B 2YJ5A 1QHHA 4L3OA 2CCKA 1E7YA 1WXWA 2RGDA 2VF8A 4O2LA 3HXOA 2RJOA 2ILTA 4YIKA 2N42A 4EMSA 3PJEA 2FDCA 2H17A 5BNFA 3ZZUA 1DSSG 1ZD4A 4EI7A 2AG1A 4J6EA 3ES9A 1HKHA 2NVUB 3S5UA 1N8KA 2W2KA 2WMDA 3TEJA 3KKEA 3RYCB 2HU8A 2GCPA 4X6LA 1OY1A 3ZIDA 2WYHA 3GA5A 1CQJB 3T3PB 4YP7A 3WKEA 1OFVA 1E3QA 2B4KA 3ABIA 1O4VA 5A0VA 1N78A 3PFNA 4HVLA 4QTXA 1LC0A 2OWDA 4YLGA 3ADDA 3VKUA 4IOJA 4U00A 4U1RA 3LUGA 4ZO6A 3P52A 5EGSA 1JEEA 5HR5A 3I5XA 4CV3A 3OHMA 1CUDA 3HCOA 2IBTA 3ZW8A 4KK4A 4QT0A 2F8LA 1MVNA 2OB1A 4RD0A 1GPAA 3JVIA 2FW7A 1JE0A 1Q44A 3GRVA 3BULA 4FVTA 2X0EA 4BVEA 2ZM5A 1KU0A 1NAIA 3OEEA 1AUOA 1PYDA 3TZQA 1Q95A 5C8YA 3OZDA 2II6A 5AK6A 2ZDGA 4A23A 4EL0A 1ADYA 4G0XA 2FWPA 2ZSFA 2W2PA 4ZVVA 4C7VA 1U7XA 2LVBA 3KDPA 4K05A 5EP1A 2OD9A 3UFXB 1WW2A 3BMCA 1ZGAA 3LUHA 3NHYA 4Z86A 4CKBA 5KQGA 4XUCA 4J0JA 4U7JA 4H1TA 1IQUA 4EZEA 3GLFA 5REQB 3DBHB 3BN3A 5GAJA 3ISVA 2ADMA 5B7GA 4KFTA 2ZRBA 3WK5A 1XD9A 4B3MB 1OQAA 2G63A 3ME5A 5BQFA 3UT5B 1E9CA 1KJ9A 2ZRGA 4TLCA 2HMUA 4YJGA 2C2HA 1J2YA 1IN6A 3D9QX 3D7RA 4O4IF 2DM6A 3DG9A 1ZK1A 1U0FA 2PD4A 4ZU3A 4HXYA 3KLBA 3C98A 5C4IA 1AHHA 3AY3A 3EOBI 2H7VA 4FZVA 2A9KA 2O9JA 2VHQA 5K0EA 5LZ8A 2W70A 2OAP1 2A94A 4WCFB 2Z9DA 5AJTA 1CCWA 4PLHA 2P6UA 1PW7A 2P27A 4HNUA 3WKBA 1U5CA 1TK2A 4KFSA 1BXGA 2QOEA 3PGLA 5ILGA 4EPRA 2J59A 4OAPA 3ND6A 3WK8A 4NK5A 2CK3A 1YIAA 4QUJA 4QYTA 1SEPA 2DLDA 3B6JA 4H3HB 2PL9A 1PJBA 3M8KA 4KO1S 5I7FA 2P6RA 2A1UB 5LNK1 3OSZA 1RQLA 2OBBA 3D4BA 1FFWA 2ZJFA 3C70A 1YS7A 1B0ZA 2IU4A 4PLFA 5TJ9A 4ENWA 2KX7A 3WE7A 2Q6OA 1IDOA 3OY2A 3KQSA 3KT0A 4X91A 1W35A 1Z0KA 1SK8A 5A9SA 3OAAD 4OHKA 5HIAA 4EY5A 5JJCA 1CF4A 1PZGA 2CLHB 1SB8A 4W7IA 1CZLA 1KJIA 1LFDB 1RI1A 3TPFA 1SVSA 2QMZA 3CZPA 3V9AA 3OT4A 2WUEA 2GD2A 3TDKA 3H3JA 1UIRA 3LJKA 5FWDA 1YVPA 3WA7A 1YL5A 2ZRKA 3HB9A 1Y3DE 1BMFD 4XX1A 2HWKA 1VPEA 4JQOA 1G5PA 2G70A 1YNOA 3HYSA 5C2JB 1NULA 1YONA 4RU1A 3PFIA 2BKEA 3REGA 1GRQA 2GTPA 2YWDA 1II0A 4AP5A 4EYQA 2ZYUX 3P0HA 4F5DA 4QJIA 1DZ3A 1ZJJA 2K2WA 3DVAA 4NBUA 1PFUA 1EK0A 2I4TA 1Q1AA 2YVLA 1Z6AA 4KB5A 5IKEA 2BGWA 2Z6AA 1PDOA 2OECA 3HUTA 3JPWA 3KZNA 4A73A 4XQ9A 1MW8X 2D5AA 4FI3F 1EGAA 2FFQA 4XD2A 1V71A 3V1UA 3TGPA 1YUMA 4BPBA 5I4IA 1DDGA 3ND7A 2VBFA 2RGGA 2XDAA 1OHHA 4K03A 5EGNA 1AURA 1RWBA 2IPAB 4JSTA 5JWRA 2XLBA 4M9RA 2BLLA 4XYEA 2JF0A 1BMFA 1RHMA 1WIWA 3JR7A 1OXMA 2QRHA 3EFBA 1XLWA 2G6TA 1U0EA 2H16A 2PH1A 1VPLA 2X3UA 2YXEA 3LVRE 4H17A 1D1SA 1JEOA 3SI7A 5IK2D 3AHFA 1WU8A 3RFXA 1B76A 1DQZA 5U4QA 4I55A 1QAQA 2RAVA 1DC5A 3SQNA 4XDZA 4AWXA 5DYYA 4ZCRA 1OXUA 2W42A 2JAPA 1F17A 3CNLA 5EP3A 4ZWNA 3STTA 4UM9B 4BX3A 5I4KA 1V47A 5J58A 1DO8A 2IY9A 1NOKA 2PCLA 1EWYA 4DRYA 5K8UA 2UXDB 1HQKA 2I6XA 5JZ9A 1L9KA 1XQ9A 2OQIA 4LZZA 1Q3HA 2FW8A 2YDYA 1NQWA 3N86A 4GPD1 4TVKA 5CFLA 2UUBB 4UZSA 4HGRA 3U5TA 1X9GA 1G3RA 1SCDA 3LG2A 5AM0A 5KNBA 2ZSUA 3FCOA 3ODPA 4NBTA 4V2UA 4HRAA 3R75A 1ILWA 3NDPA 1ISIA 1C3VA 3EGXA 3IR5A 4E21A 1N6KA 1HTWA 3DWEX 1CUJA 3UUGA 3EMVA 3EPJA 3KOWA 4Z4IA 1YOBA 3IO3A 1D1QA 3MBIA 4MRAA 5CJPA 3ZH2A 1M2OA 1O94A 1VFNA 3UPDA 4D4GA 3A6KA 2WG1A 1EVJA 1YB1A 3RH0A 1B8PA 1SN7A 2P6NA 3KR9A 3KOXA 2EKBA 1HOXA 4IQFA 1ZJWA 5LIRA 4S2UA 1EVIA 4RF2A 3UJ7A 4FE7A 3B5IA 1Y7LA 1E9BA 2R6DA 4KQJA 4B3BA 3AQIA 3DAFA 3T38A 4V02A 5C5DA 2R1ZA 3O90A 4Z4CA 4FT2A 2FYTA 2GZAA 4E12A 3NTOA 2ZYIA 1C3LA 1HT2E 4PG4A 4Y2XA 2DKNA 3NKFA 1K7YA 4YAKA 1F7UA 1WB9A 1H9AA 4CMIA 2D5CA 5CTAA 4RV9A 5DSXA 2YNMA 1VMKA 4BEBA 3DM9B 1JGTA 1RWWA 4IJWA 3LLVA 2Y9PB 1C3EA 4NP6A 1E2UA 2LUOA 1IBRA 2VSYA 1XL1A 3I2KA 1UBRS 4FC7A 4HSGA 1CB0A 4R2MA 3ZXSA 3OLQA 4YJFB 1LI5A 3KYCB 1H8EA 1ZL2A 2F00A 2F9FA 2D1SA 2IY7A 1QYCA 5EZSA 1PO7A 4PYRA 4C0LA 3D6VA 2M32A 3OX4A 5LR6A 1J0BA 4L78A 3HDQA 4UEQA 5AVSA 1M0TA 4DV5B 3RAPR 4NYIQ 1ZSVA 4UC0A 4MUJA 3LQQA 4R9SA 1RIFA 5H82A 4PYJA 5GONB 1N2HA 1WXGA 2IVZA 4OI4A 3LTNC 2WV9A 1MR3F 3AOEA 4QA9A 3O8QB 3ZCPA 1EP3B 4OKNA 3BMNB 3UMCA 1EFDN 1ZDMA 2ENUA 9LDTA 5HBGA 3A11A 4M49A 1VIVA 2GPWA 2YNMD 3LA6A 3JAMA 3MPUA 1OZ0A 1LWNA 1T5TA 1MNQA 3KQMA 4MQFB 4Y2PA 3WYAA 3ZBQA 1S8FA 1T1IA 1XD2B 2RKWA 5K3BA 3TQRA 1L6IA 3PNSA 5DULA 4IO1A 1SXJB 1GRNA 3P94A 1G8KA 3EHDA 4GMDA 2VPPA 3AOEC 1E9SA 1IZ0A 1WM1A 3FSGA 3O03A 2CSXA 3ZY4A 1TMYA 2RHHA 3UXYA 3WIDA 2AW5A 3T3NA 1SCUB 2PYZA 4RE6A 4BYGA 1NU8A 1S2MA 1VSQA 2P79A 2Q5IA 3CNEA 3DZGA 3E9NA 4J90A 3S2YA 3QK7A 1J09A 2F1KA 2I55A 2HIGA 1F9EA 2J46A 2JVJA 2PEYA 2ZQYA 3JQ9A 1GPH1 3HLYA 4LN1A 1GKIA 5KQPA 4TS3A 5ECYA 3RS7A 3LXMA 4C6HA 3PTAA 2QN3A 1EZZA 1PNOA 4X5OA 1NI4B 1CYEA 2XXBA 4CTOA 3MWEB 3OO1A 3A0UA 3SYNA 1GILA 2P1RA 2ZB8A 4IG9A 3X3HA 4YHHB 3NTVA 3TNDA 1ECBA 5A03A 1C4OA 1RHQA 1U8UA 5K51A 4AMUA 1Q0UA 3FUUA 1ABFA 2QL6A 1YZKA 4RPLA 1OFUX 3K4HA 1RYBA 4KN8A 1E61A 1O6ZA 2QTRA 2N1MA 2IUUA 4JVOA 4EKDA 1K4MA 3TGLA 3GYGA 2ZYDA 3CX6A 3SC4A 1NW6A 1V5GA 2R44A 5DBFA 3PDIB 2ERXA 4EUFA 4FMBB 3F6BX 3R6WA 5JI3E 4WZBA 4IHQA 3JQQA 3GLKA 4P83A 1UBLS 4DGSA 2Q1XA 2X0RA 5IFLA 2Q0SA 1J4AA 2XB6A 1OW3B 1SVWA 1UL1X 2UZ1B 1W8DA 1K6IA 1T4GA 1EFVA 1NKTA 3B13B 2IIQA 2GF0A 4FOTA 2XXAA 3H18A 1N0IA 1JU3A 1XALA 3VRHA 3D6AA 4TL7A 1MT3A 2BGIA 1VLZA 3PC6A 4RLQA 3L18A 2EG9A 2I4RA 4RY8A 3ZCUA 3IB6A 2PUJA 3IH5A 3R9IA 4C7MA 1D2NA 4BBPA 4U7FA 1EFPB 1M73E 3L43A 1I0ZA 3UJ9A 3Q9UA 3GDWA 1VP3A 1Y8AA 3VOBA 5EE5B 4ZCIA 5KWIA 1CEQA 4JVSB 3E1KA 1VYTA 3PKIA 5E2AA 4WXEA 1JNXX 2HWYA 4LJ6A 3ZNQA 4QOHA 5D6NA 4ALNA 5ILOA 2XT6A 2ZUCA 3OOHA 4KRXA 5ALPA 5LCXA 4Z2YA 3JARB 4KNVA 4F12A 3PA8A 5LSAA 4B83A 4ZMSA 2O0KA 2Q5HA 3NCHA 4CL0A 1T2CA 2EFGA 3ZGNA 2PLRA 3TXXA 3QJ5A 4UU1A 3VVCA 1A9XA 1ZL0A 2PQ0A 4IMIB 5DI3B 2EDCA 1V7CA 4MIYA 2ZM6B 2RAPA 1PZHA 1NBEA 1EQUA 3GA0A 5I5EA 3HRIA 3AF4A 3DH0A 4TRRA 1E92A 1HLDA 2P77A 3GXBA 2JNWA 3HO8A 5LOVB 1T9HA 1WCYA 1ZMBA 4GQBA 4F04A 3VU1A 3PS9A 5EQJB 5I8ZA 3JVVA 1DBRA 1YU9A 4LF8B 2C4HA 2EJWA 4TKZA 4XQEA 1LLCA 2OHHA 3NMUF 3CRW1 1OI7A 2QS9A 5IJAA 4RTOA 5EZ6B 2QJTA 2R6ZA 1FK8A 1SU6A 5CXSA 2XRZA 4MDFA 2PO7A 4KQCA 1QO0D 5D7NA 4D4KA 1NGSA 2P9FA 4DA0A 1JKFA 2FEAA 5KO2A 5FWYB 4EG1A 5DYNA 3WWPA 1QQ7A 2NU9A 3OZFA 3EQ9A 3IE0A 4WPGA 5KOHA 3DTTA 4Q3LA 1SVUA 2EOAA 1QIJA 5H59A 2A2ZA 4WNCA 1VMAA 3AIKA 5SZKB 1WW8A 4I8XA 2VLBA 2DLCX 3R9XA 4ZC8A 3UMJA 4C3ZA 3LU1A 4O5AA 4A2CA 4BLUA 1ZUNA 1L1RA 5GONA 1R5BA 2AR7A 3ZWMA 4D5GA 3WGQA 1XCPA 3LBNA 3JAKA 4WZAB 4GLFA 4XWKA 1PN3A 2NSJA 5FFFA 3FDZA 2O0MA 4JLPA 1QYXA 2OFXA 1DMRA 1W6RA 4KSCA 1B8NA 1J2TA 2BFWA 3OCYA 2TS1A 1FNBA 1MDBA 2C84A 4E2XA 2V6MA 4I81A 3H1GA 1OLXB 4N40A 3Q7IA 3I45A 3O73A 2G9NA 2W2VA 3RFTA 3W4JA 3WWCA 1TM4E 2DCMA 3DWFA 4H4CA 5AW5A 4B75A 1JALA 4DLNA 4U2DA 3N2NA 3VNQA 4HYQA 3HJRA 1E6WA 5DGXA 3A58B 2OLKA 2H4FA 4H0FA 1AHNA 2AOUB 3ILSA 3LVFO 3TTXA 2QIOA 5T6BA 1PD0A 3E35A 4KTVE 3ZWYA 5J1TB 2QTBA 4XGNA 3D1JA 3UOGA 2VATA 3WOHA 1F4LA 1UBFA 3N2LA 4LHYA 4EKYA 1EWQA 5P21A 5J4KA 3MCAA 1SHZA 1NI4A 3I6ZA 1GU7A 1X80B 4LSWA 3UK6A 2OD2A 1G0NA 3FKQA 1K7SN 2FFRA 1NE2A 3DE1X 4MW2A 4YRCA 2PSDA 2PVSA 2C0PA 3DDNA 3QIAA 2BSXA 5KSYA 2X1VA 4RXUA 3NUGA 1O58A 5KNDD 3BXHA 3C74A 4UHCA 2DFNA 3FSRA 3MBOA 5F1KA 2CLFB 1YTUA 5MN4A 2HR1A 3C85A 1AA9A 2VSFA 1XE3A 3JQGA 5CVJA 1UM9A 4FWBA 1VBKA 2DY0A 4HX2A 1IN8A 4DR5B 1EBUA 1YOVB 4B46A 4L3WA 4FYKA 4HPXB 5GIOE 4TLBA 3EXEB 4GR4A 3UV7A 1XKQA 4TKLA 4KWIA 2AR9A 3JATB 2JFUA 3DTVB 3K09A 1AOXA 2WSMA 4GS5A 4CJXA 4DYHA 3STYA 3FHLA 1BHJA 3BPSA 4GLBA 3GJRA 1QR6A 4QGFA 1Z5PA 3GUZA 2OP0A 3N8DA 3PNOA 4GNRA 4WW0A 4Y9RA 2WFLB 1E7RA 2HOQA 3UKOA 4DLRA 1V9SA 1KYXA 1P6XA 4PN7A 3SC2B 2H1VA 3QVGB 2CLOB 4A36A 2ID9A 1SXJA 3MHPA 1QHFA 1TFRA 2FN8A 3BK1A 1MGPA 3DGEC 4JJEA 1RRGA 2YCBA 4NJMB 1JQLB 2JDIA 3I1FA 1PVOA 2V5AA 1VCNA 3LA8A 3P27A 1UKEA 1L7PA 4DSNA 4OSEA 1GO2A 2QAJA 3CY6A 2IHVA 3MXTA 4IZIA 1IBCA 1SBQA 4JGGA 4OGKA 3B60A 4XYMA 4LQDA 3F6CA 2CLKB 2GSDA 5F4ZA 2B8NA 3SJUA 2NZ8A 3NETA 1YZVA 2JGJA 4P0TA 4KWCA 3ZZ0A 4DPMA 2ODTX 3WC4A 2PMBA 5KMGA 4IEIA 1H4VB 1W4LA 2MHCA 4X54A 1RYYA 4RVNA 1CEYA 2Q0HA 2Q5FA 1JDBB 2F4NA 2JARA 4K8RB 3L46A 2HN9A 3O84A 3OMWA 5B1DA 5TQ0A 4W9MC 2ZFUA 2O05A 3J80A 1NG1A 5B57C 1ULBA 1IZ8A 2VK8A 3NNSA 1DC7A 4I4NA 4TWIA 4YJHA 4XJVA 2PMEA 1BW9A 5JT1A 2GLXA 1MV5A 2ZYHA 3R9WA 3GG2A 2XNSA 3R5JA 4UD2A 3R7WB 1UINA 3W5IA 1XCBA 4S1PA 4L0QA 2JFHA 3LCVB 3LYLA 3MUEA 4Y6SA 3T5TA 3EXIB 4KYIB 5HFAA 3Q8KA 3WLJA 4P53A 1GPWB 2H1SA 1N1GA 1XTKA 3RQIA 3Q6NA 2DFTA 4OI0A 3T7AA 1NQVA 3W5DA 4INOA 3N87A 1E18A 4X0EA 2O8DB 1J25A 2QX7A 3H17A 3QRWA 1PWXA 4BNUA 3TOSA 5AOAA 2XKAA 1SUPA 4QBGB 2FK7A 1CUXA 1R3UA 3NT4A 4DB4A 4OHWA 3WICA 1BDBA 4HNQA 1L5HA 4MEBA 4QXRA 1CX9B 1C50A 3EF3A 3E58A 4HZUA 5AJXA 5EJFA 1JHPA 2IKQA 4RK4A 3AVWA 1H2EA 3K5PA 4BAZA 4NSNA 1PR4A 3RC2A 1SKMA 1EX6A 3TTUA 2QIPA 3TCKA 4PNHA 3GGDA 2C88A 3K0FA 3P4YA 4LRWA 1Z8HA 4I50B 4DBZA 3T3DA 3LCRA 5IRCD 5J2UA 2BEVB 3ZIUA 4PC2A 4GC9A 4Z9XA 4C7OA 2V74B 4IDFA 4S1OA 4QRHA 3SJBA 3ZIAA 3WL6A 3IT1A 1I0LA 1XDSA 4JLDA 4BATA 3ACCA 1WPXA 2XX3A 3CUWA 4QUGA 1CVRA 3N58A 3ZQJA 3HEMA 3K8ZA 3KTOA 3EXFB 4HDQB 3R7FA 2CB0A 1MBZA 2BFEB 3LF1A 3GEGA 3K2IA 1ODFA 3LL7A 3WSTA 4NFHA 4UCWA 4CM9D 4EJSC 1PSWA 2O5EA 4HN4B 1L7DA 4MDYA 5BOVA 4Y67A 4YN3A 5JS6A 3UJCA 3L1HA 3JS5A 3MS4A 4FDLA 5KYUA 7ABPA 3PQEA 1CNFA 5J2TB 3GLHE 2E37A 4DIBA 4JI7B 4H27A 3MWDA 1M6VA 3DPUA 3KSUA 4MH0R 5E1BA 3T7DA 2UU9B 1T0BA 1SMKA 4PC1A 1TRKA 3B6KA 1OC2A 3MWYW 1YR9A 3OZVA 1MC1A 4QULA 1HRKA 1Z68A 4MYSA 1KDOA 3B52X 5JAQA 3WFIA 2QMHA 3ZVNA 1SUFA 4Z4EA 1EZ4A 2B2XA 4TV8B 3BL5A 4E4YA 3FYUB 3FYDA 4D5EA 1X19A 1EZ1A 3MTQA 3OEWA 4CMJA 3K1ZA 5FOWA 2PPVA 1LBTA 2AZDA 2Q2NA 4HLUA 2H0QA 1Z39A 5T4EA 1XMPA 2OBXA 4RHFA 4QEKA 2I6FA 3MMNA 4G5HA 2G0TA 1QS0A 3C5EA 4M7OA 1P1JA 2NYRA 4YRMA 1SXJD 3OX3A 5I51A 3RJ9A 2VJYA 2C59A 2GX6A 1T6NA 2HJWA 1Y1SA 4R41A 4ZKEA 3T4PA 1T1GA 5JQGB 2FH5B 3SSAA 4IW3B 4BZPA 5C5CA 4BV3A 3G9QA 4GBED 4OQFA 2H08A 1W4RA 3JQGB 3LCUA 4WT7A 4TKUB 1MRSA 2H00A 4FJ0A 3TPCA 4ISBA 3I5YA 4D44A 1H5QA 4WGFA 2Z3VA 5EZYA 1FJGB 4GBJA 3M6MD 1MO3A 3SMQA 4F1JA 2GKOA 4L72A 1ZUWA 1I2BA 3KTDA 1V3VA 2YV5A 3C41J 2MTBA 1XCMA 2QXUA 2A3RA 3U7FB 3MVEA 4W5TA 4ARAA 1LGYA 1QIKA 1TJ5A 2NZVG 1Q14A 4RBNA 3EDMA 4KQ1A 1BCSA 5CBKA 3U4HA 3QEOA 2DPHA 1GQSA 1DKMA 3G13A 3KQHA 1W0JA 3DMTA 4AJ2A 5KNCD 1MAUA 2DKOA 2ZJBA 4L4ZA 4B3GA 1L5FA 1YE3A 2XDWA 4TMWA 3T35A 4P82A 1E7QA 2BKAA 5IW8A 4IM7A 2Q6TA 3A6ZA 3E15A 5IM4F 1A5BB 3ELWA 4QXAA 3L6OO 4FYYA 3U40A 4YAGA 5ITVA 4YRNA 2A1TS 3JVDA 4CRWB 4B80A 2O50A 3KE8A 4BO2A 1YT5A 3CIOA 1GU1A 2HPZA 1Q7GA 3U3JA 2A88A 3ERCA 4J0KA 1K9SA 1VB3A 2Y8EA 4BO6A 1W2HA 1GGKA 4K81B 4ETWA 1KS9A 2AEMA 4UNNA 1YV9A 4QVIA 2CXHA 2CNDA 4M6WA 3L79A 2UVQA 1EP9A 3AJRA 5EAIA 4DY6A 2VP6A 1ZIPA 4N76A 3MLAA 1U2RA 3H6KA 3DSRA 2XZDA 3MGKA 1MFZA 4LVUA 4BP1A 1LK7A 1ZRNA 4RLFA 1HMYA 2QPLA 4A3SA 2V55B 3MYYA 2D0DA 3ND9A 1WB5A 1Z4OA 4IMPA 5JCZA 2FJ0A 1V6AA 4HDRB 4KXYA 5I7OA 4H0NA 4YDHB 4N54A 1ZJ5A 4V0ME 2E49A 1IXRC 1SBHA 2XYQA 3KWJA 1Y3AA 1Y7PA 3FHJA 3QVSA 2NM0A 5FA6A 1AA6A 5JXGA 2AN3A 4EG3A 4ZOEA 2PRSA 5FL7D 1Y8RB 4YREA 4GI7A 1XZEA 2R7MA 3JV7A 4FIDA 3MTIA 3LKBA 3FNFA 1H2FA 1QQ6A 5JW6A 4Q34A 1RCTE 2FQYA 2WYWA 3F0TA 4Q1EA 1F3LA 4G0OA 4KDFA 1DL5A 4JC8A 5K6RA 5KQMA 1NMEA 2YWBA 2CVHA 4YCMA 3ZWAA 4BFCA 4PTLA 3DBLB 2WNHA 2BFFB 2BP7A 4GRDA 4G26A 2EFJA 1YI0A 2PQ6A 4BNDB 1W75A 2R5FA 3G0GA 2I2AA 3HN6A 1YS6A 4YCAA 1M1NA 4H7DA 1SQ5A 3QVKA 4NCJA 1RMYA 2GI4A 5DN6A 4R7TA 2ZBQA 4XOIA 4B76A 2WICA 2ES4A 5HCNA 1XDWA 1CDOA 3G8DA 3WYDA 3K1AB 5IH7A 2ZSBA 1PJLA 2HUPA 3QPUA 2ZI7A 2UAGA 4D46A 2DH5A 2JD1A 4MP8A 5JHHB 2VUTA 1C8BA 1JLHA 3CMMA 3HKDA 4ZT2A 4B8ZA 3A6JA 3TN7A 1W29A 1G8SA 1J22A 4Q7LA 1BMQA 1YJBA 4AAYA 3T1QA 3U7EB 1Y3BE 4W9NC 2AC4A 4PWZA 3LT0A 3BCRA 4OY3A 3VHRA 1Z08A 3TMYA 4JUAA 4C22A 5EMHA 3KM0A 4LMBA 1JSXA 2V4MA 1GYQA 1NYQA 1T1JA 4J75A 1NNUA 4LXUA 2FKNA 4M76B 1YL7A 4TKMA 3I8OA 1SZJG 1F06A 5HF8A 4GH5A 1O8BA 1NVTA 1UUFA 2R5NA 2WE8A 2UZ3A 1W5AA 3AF3A 1MX3A 3GFSA 5L3QB 4KXMA 4N3NA 2Q6LA 2XAUA 5BN1A 1RLOA 3GJXC 1O6BA 5GZ1A 4GHWA 4OHFA 5AQEA 2F3RA 3AI7A 2XEDA 1EUCA 2NU8A 3RK0A 4X7MA 1NURA 5F2EA 1XO1A 1PGNA 1TU3A 2GO1A 2WJ4A 2WMNB 3M5DA 5C80A 3EXG1 1RHRA 2QNIA 4F2DA 4C7OB 4D9NA 2I7DA 2XNDD 4FNOA 5ALHA 4D82A 4C1BA 2QTVB 4UEWA 2AJTA 1JA1A 2GN9A 1RQPA 2H2DA 2O0JA 2ZR0A 4DADA 1DBPA 1RZVA 4CEHB 4IR7A 2XLCA 4B0PA 4ENTA 3UAYA 3PX3A 2J09A 2DP4E 4UNPA 4TQAA 5CEFA 4RD1A 1NIJA 5HZMA 5AK4A 3WRVA 2AZ4A 1XIVA 1Z6PA 3OD5A 5AKJA 3G2HA 3VHXB 5IZCC 2B34A 1FQWA 4MUBA 4DHEA 1AU9A 2FEKA 3AUJB 3GL9A 3PYLA 4KLZA 4MUXA 3BKXA 4JN6B 3IAS6 1I9CA 4TMXA 1PVDA 1C30A 2JATA 3AFGA 4A91A 1Y1LA 5T4FA 3AHEA 3LX5A 4QGGA 4OLHA 5G4KB 1H4TA 4Q4JB 2RHGB 4GU5A 3ZV7A 5IVHA 3OTWA 1N32B 1D8AA 4WN3A 3RQSA 3TW6A 3FGZA 1DJPA 4LRUA 3F5DA 5KTNA 2PUTA 2QLNA 5BYJA 1AXGA 1SC9A 2YOHA 5EIBC 1OKKD 3CF4A 1DRJA 1JHOA 1U9IC 3Q41A 2NSHA 1IRIA 4PRLA 2PX2A 3OX1A 4AURA 2VA9A 3QVMA 1M76A 2GJ9A 4JBYA 2F8MA 2C5FA 1JSCA 1PLKA 1Q74A 2VCHA 4M1YA 1V1JA 3GJYA 5J2TF 1XVLA 3A1UA 2B1QA 2PRZA 3V00A 5JFTA 1VBMA 2H4ZA 2GPNA 3SD7A 2BELA 2ECQA 2QRGA 4KACA 1GXSB 3FA2A 2QU8A 4QREA 2UZ4A 1OTHA 4B6JA 3LC7O 3EGCA 5JQGA 3EFOB 1R15A 1M6NA 4Y0VA 2VHCA 4HLNA 4YP9A 3GUUA 3OCWA 1BCRB 4OQYA 3SLKA 4YXWD 5C5EA 1LB1B 4P4UA 2WJIA 3RUIA 5B30A 2WIGA 2AJCA 3HG7A 2UVPA 3H7AA 2MJLA 3KRTA 1HNNA 1XFAA 4H7EA 4AW9A 3UCXA 1QQBA 3O6VA 1ZK2A 3GLHB 3C5VA 3NBZC 1LJUA 1PV1A 2FSPA 1S3FA 2XRYA 3AB7A 4LVNA 4DHWA 4RSRA 1W96A 1XMQB 4DMHA 4G5GA 4R84A 5CT8A 4XKJA 5DCLA 3SBOA 1MW9X 3O5AA 4JUDX 1RQGA 2FLKA 4UATA 1JG6A 1G5TA 1ADJA 2QLJA 2PEZA 4D92A 2ANBA 3FWPA 5G3ZA 1I80A 3F7MA 1S2IA 2X0DA 3WLHA 4HRYA 4HWKA 4CKCB 1FX1A 3HXMA 5K09A 1UJ6A 2QLFA 5CLHA 3S2EA 4EPVA 2AE2A 1E9AA 3W6PA 1U5AA 3FBWA 1KOGA 2JANA 3IEIA 4X66B 2O1WA 4WEQA 5CFMA 1Z18A 1G8HA 2WNIA 1GTL1 2ID4A 1QRSA 5ARDA 4XYLA 4BJ5A 1DEHA 3NM4A 4LBWA 5KC8A 4HAUA 3DAGA 4R8SA 3T7IA 5I4CA 2W83A 2C97A 1PKXA 2P41A 2R1TA 3T7TA 1DNPA 2FMXA 4QQFA 1DOAA 1PHRA 4DR6B 3IE2A 3GJZA 3N7AA 4OHYA 4A6XA 4JV5B 2YJZA 4ON9A 1WO8A 4BOYA 3B1YA 4HS4A 1QVAA 1H6CA 1OYOA 2NUPB 3DAOA 5JYBA 3BS4A 2CXQA 1ECLA 3E1GA 1N2GA 4PQYA 5E7MA 4Y6QA 1UOPA 2VT7A 3N3BC 4PQGA 5DLDA 1ULHA 5J59A 1FPQA 3QKSA 5IAKA 1O97D 5TMDA 1IXYA 4A0FA 4NJMA 2X14A 1WXFA 3MXOA 4FFPA 3VNRA 2IHUA 1B6SA 2DC1A 3GBVA 3F73A 1R3DA 1T6XA 2C95A 4AFNA 3GMIA 4LQCA 3ZW9A 5K3OA 5HHTA 1ZN7A 2LBPA 3P2EA 4JA2A 4QARA 1EPUA 4DLVA 2TSYB 2EX1A 1UFVA 2WSIA 3W5UA 5CG2A 5K6TA 2I91A 3FR8A 3RNLA 3HVHA 1SCNE 2HA5A 3LW7A 4WBXC 4L0DA 4FHFA 5FI5A 1JKJA 1KKLA 5CCDA 3CZ5A 3M5PA 1AUPA 5LZ2A 1T2VA 4D3DA 1GUBA 2DQKA 4Q9NA 2DF8A 3DD1A 4D57A 4GPBA 3S8MA 1F2VA 1R4AA 2HBYA 3RYIB 2BZ0A 1KI3A 3W6OA 3TR0A 1O5OA 2F1JA 3DNPA 4KO8A 1PEYA 4F3RA 3FSGD 1H85A 1LPOA 5LUAA 2Q4OA 2ISCA 2WSBA 4OGWA 1ZM2A 4W4TA 1ECPA 4BRSA 1RE1A 3AFOA 3ZGLA 2RGWA 2R2GA 2PAFA 1XXLA 4BEWA 1TFUA 1Q7TA 2PRJA 3NDRA 4QWWA 3DDUA 2F67A 5THQA 2XY4A 3M6WA 5CFQA 3O21A 4IXTA 4UEJA 1Z37A 1UJNA 3DOFA 1F6BA 2HQ1A 4V38A 5HX7A 1THZA 4M36A 2P2DA 2JBHA 3ZJYA 1GG8A 1JWLA 4GYWA 2XGGA 5C5IA 4DMRA 1PS8A 2X0JA 3V4RA 1AGNA 3S28A 5GPBA 3R44A 1LDMA 3Q1KA 3ZHSA 2I78A 4ZQBA 1OFIA 2PG3A 4MEAA 3E0QA 3O8CA 2NO5A 2IH4A 3I92A 4YMSA 4ZXFA 3L0IB 4BKPA 1GN8A 1JZQA 1T2DA 1RXSA 3CPSA 5F9FA 3KZVA 3LAWA 1FFGA 2A1TR 2YUIA 3LHDA 2CE2X 4RY0A 3RT7A 2GJ8A 5CMLA 3D8RA 2QV0A 1ZIXA 2BUCA 2DHDA 3UXMA 2BMWA 3IUPA 4RPGA 5DNYB 2XE8A 2V3WA 2AX3A 1BE6A 1HSZA 2VUIB 2W6PA 3AEKA 3H86A 4RTJA 1U6KA 3QX8A 4ZQFA 4ENSA 3IHLA 1S7CA 5BP7A 1LBEA 2HRBA 2WM2A 5GJVC 1XUOA 3ZHYA 4XA8A 5AJWA 3OICA 2LP4Y 4XVQA 4GOLD 1N34B 2ZT6A 1M1ZA 3H2HA 3WFZA 1V6SA 5KYUB 1JEYB 4LGCA 3FVTA 1JJAA 1T8UA 3C3KA 1FFBA 5IDVA 3U0VA 1I94B 1HBJA 2C5BA 4BGUA 3NHUA 4FYWA 2BKXA 4XCXA 4QGHA 1N5OX 3WKCA 4ZVTA 4F2HA 2JGDA 1IK6A 1Z4PX 3QG1A 4JFRA 5ECWA 3JQ8A 4OOEA 4XGRA 5EN4A 1HFJA 1O94D 2PLAA 1BOFA 3ILHA 4I08A 4I19A 3BERA 4PQEA 1F5SA 1Y9EA 1CTQA 5AM2A 4Z4FA 3IR6A 5L45A 1L8LA 1VI2A 1WCXA 1ZVMA 3JQ6A 4J0IA 4IIHA 1IY2A 4P6VF 2ZR9A 4D3YA 4Q1VA 3ZUGA 2R7LA 2ZT5A 3K9FC 3H97A 2R4UA 1RAIA 4X24A 5TT0A 4EBBA 4UXHA 3SQLA 1WXXA 3ECCA 3JXEA 1UJMA 1SHKA 5B5SA 1GGJA 1N2SA 3BSWA 3CKMA 2F3UA 2CDNA 1ZC3A 3C3WA 2N3ZA 1RM3A 1W4AA 2GAIA 3M6VA 4PX3A 4X90A 3SZLA 4IJUA 3A1WA 4QNMA 1G5RA 2R1TB 4NU5A 4CV2A 3TW8B 3ZZ1A 1VE7A 4GX2A 2Q5CA 4TTSA 2B61A 4B4DA 3FI9A 1GSOA 3AU8A 5C35A 4PLPA 1ZOLA 1G41A 2BMFA 1GDDA 2YR0A 3MT0A 2R7NA 3FWZA 2PIAA 3U4IA 2H07A 2O8NA 1X8XA 3I76A 1E58A 5F5XA 4GECA 2VBGA 1I5OA 4FLEA 3ZWCA 1X1RA 1JIIA 1KO7A 4AJOA 1GZ5A 1XF1A 1JILA 1ZRMA 2WJVA 3AONB 4L3VA 1ECGA 2BFNA 3OPYB 3SIRA 3SEZA 3DVSX 1PFKA 2R6GA 5C1DA 5JWHA 4BQNA 1I24A 1XDBA 3DHNA 3EN0A 4H7IA 3PXAA 4IRMA 4P31A 2PUDA 1M66A 3KAJA 1XDDA 4WLOA 5D3KA 3SEQA 1RM0A 4B7XA 5ALTA 2V7PA 3ZLJA 2EAUA 5DGDA 1Z7EA 3BMOA 1N6NA 2A0WA 4GMXA 3KQWA 3NAZA 5GV8A 1TM1E 1QV9A 1P3Y1 2XUZA 4IVRA 3PA6A 1HQYE 3M6IA 4BVFA 2CL6X 1B8OA 3KS9A 1XJQA 4X7PA 3M6UA 1F0PA 1ZJZA 4L5JA 3SSMA 4KR2A 2BOVA 1SA0B 1WP9A 1EUZA 2IX9A 3DV0B 5CGQB 5I3ZA 1EWTA 1Y82A 1NSYA 4IILA 5KC9A 3PQ7A 1NOIA 2YMLA 2X0FA 1JS1X 3HK2A 2C07A 3X1MA 1N25A 1YQEA 4AB1A 2CY0A 4EEKA 1JE1A 3DEJA 3UWSA 1B2LA 4HNTA 3VDNB 5HRAA 1BQ4A 1KP2A 1N1EA 1P1FA 3GELA 3I4LA 3PX2A 4LA4A 4TS9A 4LXYA 4M4SA 3Q2IA 1LA2A 2H59A 2H3EA 2PQMA 4UM5A 4YAIA 3CNNA 4KPEC 1OASA 1V8PA 1Z38A 3AV0B 3TBKA 2WWIA 1Z73A 3CR8A 4MKIA 4X7BA 5FUYA 3AUYA 4AJJA 4ER7A 1NBWB 5K3EA 2ZRIA 5FA8A 2BCEA 4IRXA 1V5IA 2IEYA 3KLMX 5J4HA 1NUPA 4O1HA 5DEIA 1PFGA 1GKYA 3PNBA 1F2TB 3CZQA 1MGOA 2XKJE 2YUTA 3H2KA 4GKBA 3IO5A 1COZA 2RHCA 4FS8A 3TDNA 1JMVA 1OX5A 4L8GA 2AN4A 4F38A 5ALGA 3GUHA 2BBWA 2H48A 1A50B 3OP1A 5HXAA 3PEEA 1F8YA 1IN7A 5CFRA 1CR2A 1WG8A 2FPPA 2CYBA 1Z5UA 1KH1A 3QEMA 3RVKA 2HIAA 4LZPA 4B3CA 1W87A 2HM7A 4EHIA 3S29A 5KYYB 3B1XA 1UK7A 4KI7A 1F6DA 5DX1A 2HF2A 4Q3DA 1UODA 1YXMA 2O6HA 4DV7B 3A6HA 5AKEA 1N6HA 3IMKA 1NVKA 1CS0B 4Y6LA 4WX2B 4BUJA 1FDVA 2AHOA 4C78A 3FWNA 4ZP1A 3VFDA 2XZTA 3T9EA 3EEQA 4FYXA 3AKDA 5EQFA 3N0TA 1NZDA 4AIRA 2OO5A 1TM5E 1TJPB 2FZWA 2NZYA 2OFPA 2Q3FA 2RARA 3BH7A 3MTDA 3QY9A 1GNSA 2BE9A 4CIXA 1I6LA 2ZREA 4N5HX 4ARZB 3T5GA 1HT3A 1NSFA 2M2IA 4K8OA 5DO9A 4OXYA 5IAEA 2O20A 1L7RA 1W36B 4LCBA 3CR7A 4GZMA 3TI7A 4OGFA 2VK4A 5K8LA 3EZ6A 1DEKA 4UZEA 1QQTA 2XUQA 2B0JA 1C7RA 1E8DA 4A2QA 4TS1A 1C3OA 1KRHA 4KYVA 3AVVA 4WN9A 1JFFB 2XQGA 2DQSA 2Y1XA 3BXZA 3ZCTA 2XT0A 3DBVO 2X8JB 3UJNA 3GJSA 1BGWA 2C4TA 3C4QA 4QU9A 3HCNA 2QBYB 2PRKA 2OBMA 4N65A 2A5FA 2WD8A 1J06A 3K4PA 2F8TA 4BX0A 2B5VA 2CXUA 2G76A 1K5GA 2CNNA 3Q7TA 1T0JB 4QYIB 3GAMA 5KKCA 3LUKA 2MU1A 2DQYA 4LJ9A 4UXJA 3AY7A 4FD3A 1WKVA 2Z4RA 1A98A 3L9XA 1TF7A 4HTFA 4ZOAA 4AO7A 4K6CA 5HKLA 2H9IA 4UFNA 1T3HA 3N8KA 2FSFA 1PBTA 2GWRA 3TEMA 1VL6A 1OI4A 2QTZA 3NVKI 1NJ6A 3T5PA 2FKAA 2HU5A 1C1YA 1IHUA 1EK6A 2W2MA 1BYIA 3HBJA 5DZSA 2LIVA 3C7KA 5G2OA 1JP7A 4WFQA 2AR0A 4ND8B 1WQ1R 4Z4GA 1YR2A 1HYGA 2AMLA 1WULS 3BA6A 3ZKAA 3AKCA 4Y2SA 1VL2A 1L5OA 1M7HA 2AMVA 2Q2QA 2J1LA 3LKZA 2VT3A 1SXIA 2XGOA 4I4TB 4NV1A 1XGKA 1XMIA 2FRDA 2Z8YA 3O8LA 4FR2A 2PH3A 2ONJA 1Z0UA 2IV2X 1BN6A 1VKJA 4U2EA 3ZGVA 4HVAA 4AJ9A 1OLUA 1B16A 5DASA 2QMYA 2ZWMA 3HNPA 4QBIA 4TRNA 1V3TA 5CT9A 4CW7A 3QEBZ 2D13A 3UG7A 4DQXA 3RJTA 4FGZA 1BXKA 4DUYB 1RDFA 5DFAA 3RRFA 4HEA1 2GEVA 2Q1UA 3SFZA 1Z34A 3OQ1A 1TF5A 4A0GA 3LUJA 1SCKA 1DWQA 2WVAA 2Z95A 4CTMA 3EQ7A 1UDWA 2VT6A 1X15A 1T35A 3AW8A 3EAQA 4S1WA 2GCEA 3ZHXA 2O59A 1NMQA 3K05A 1LSOA 3ZZNA 1FDUA 1Z4LA 4B0OA 2EQBA 2UDPA 5IWAB 3UA3A 3MM4A 3EMDA 4YP0A 4HEHA 4JI0B 4IY1A 4XE5A 2FFJA 2E4XA 4P1ZA 1QIEA 4LJAA 1ZVKA 2ZB4A 4MUGA 3HVIA 3MK31 2BLNA 2QEQA 1P9WA 3GQVA 1U3FA 1RKXA 4ACAA 1JXQA 5KYKA 5BRJA 4C2UA 4KWTA 1O8CA 3G2PA 2AZTA 4FOLA 2XE4A 3GWZA 3FRJA 1EJ2A 4BNNA 4KKVA 2X8AA 1R1DA 1L0BA 3C8MA 2PWYA 1TQDA 3NHWA 5JPCA 1OH7A 1U7UA 2QW8A 2ZJ6A 1H69A 1ONOA 1ZGJA 4MS1A 5JVDF 4PSUA 4OJTA 1E2QA 4IOMA 4YP5A 3F3KA 4YRDA 5JNWA 1ZX1A 2GZDA 4FPXA 4NEHB 1KQOA 4BBJA 5AW7A 3GP8A 3PF9A 4N5IX 4JLMA 4I66A 2OEPA 3VI3B 1P4GA 2WJ6A 3A4NA 3VPAA 5KMGB 1JDZA 2FEXA 3A3OA 2QORA 3BB3A 3BFJA 2P11A 3F3MA 3UO8B 4TTRA 4EFDA 3QXCA 1F8XA 1ST2A 2E7ZA 1ZGCA 4JOSA 4TN1A 1SU4A 4XXHA 1P5JA 4PZUA 4PXSA 5ESWA 5TJHA 3AKYA 1Y1PA 4KJZA 1XJ5A 5KTOA 2RH4A 5FD8A 4QKQA 5BV1A 3RV4A 4B7AA 2GBLC 2JH9A 2Y76A 1M2GA 3EEYA 4NG4A 4MGEA 3DDZX 4NFSA 4PZ9A 1FP6A 3IDOA 2YV3A 3ZHRA 4MQEA 1N4AA 1WUTA 3CA8A 5CYOA 1DOHA 3V97A 4D8WA 5EJ4A 3BFVA 2DBYA 4IWNA 4WHMA 1TZ2A 1W5TA 3QZUA 3IL2A 2BJVA 9ATCA 4ZGWA 3MCTA 3U44A 4JWKA 1Q0HA 1Q83A 3CCCA 4RF3A 3LK7A 5ALZA 3UPUA 3RV3A 2COUA 5FX2A 4MHTA 4WCFC 1IUOA 5LVAA 3DD5A 1FFYA 3AEYA 5SY6A 5HF6A 1GQRA 1AQIA 2JFQA 3AJEA 2XYRA 4IEFB 4F3CA 4YRQA 3HBLA 5ENVA 3REFA 3MIIA 3D3EA 2JJ1A 3LSTA 1KZ9A 1YGPA 2AOWA 3CG4A 1J0AA 1BJKA 2ZAOA 1KVSA 1N7GA 5FL3A 4F91B 5HUHA 4RHXA 3UVEA 5K03A 3CO5A 3WLSA 4E31A 1RQ7A 3U31A 4EENA 3IRUA 4MVYA 1P2BA 2ECPA 3T5DA 2RKOA 4IMJB 4DSZA 4CETA 2BRUC 1C1XB 5I7SA 3CLSD 3QVJA 2OTCA 4BJ6A 2O7NA 4C4TA 3OFNA 4ND1A 5F7ZA 1U3WA 1NVBA 1O95A 1UQUA 5LMNB 4A9AA 1SVNA 2YYAA 4L85A 1KA9H 3NCTA 4KXFB 4BLQA 5AVYA 3GP3A 3PEUA 4KMMA 1KXZA 1VL5A 4M22A 4PXAA 1XMSA 4B31A 2C3MA 4BJHB 4HNGA 2R1UA 3H87A 2GHTA 4OQXA 1GUZA 5KS2A 1G7RA 1I4OA 2I4IA 5D3MB 4AQYB 4J9UE 1UAAA 3KTFA 1XQ6A 2IEBA 1N57A 5HCUA 4ALMA 1VYVA 1EMDA 3JVEA 5K1ZA 1LSUA 3C7AA 5CK4A 4Z3OA 3ZWOA 2YZMA 4N47A 3MSCA 2VUSA 3TW0A 4G23A 4ZQCB 3A8TA 5BNZA 1LPNA 2IOFA 3QLTA 4GWKA 2V5VA 4BMDA 5BSUA 4TRMA 5JARA 2AWOA 4PLCA 3HO1A 3DAPA 2X8JA 4MUAA 3ZYZA 5DH9A 2P9EA 2B21A 3PXXA 1G55A 1BRMA 1NQXA 3P9SA 4QUKA 1XR3A 3GCZA 2BKUA 3HB4X 3AVPA 4KMSA 3OMXA 3NAMA 1ISFA 2P9JA 3UCEA 1DP4A 3L4SO 3HPQA 2C4MA 1S8OA 3INTA 2ON6A 4MGKR 3ZQ6A 2GM4A 4PGGA 4D9MA 2JKVA 1KY5A 3MMPA 4IHAA 4Q15A 4KL8S 4G5YA 1N8TA 1LKZA 4KO3S 4OUDA 4DLWA 1K8RA 4X94A 3TQCA 1YKFA 3O91A 1Q20A 4OQLA 1VKHA 2IZ6A 1YRBA 1IJFA 3PG5A 3ICQB 2DFLA 2A5DA 2CCGA 3L40A 4HI0E 2B5OA 2OQ2A 2R7AA 1M5RA 2C1ZA 2DZDA 2P7IA 4K9LA 4ID9A 4A0HA 4ZV9A 2I29A 5DTJA 2O14A 3ZGXA 1PDVA 3Q12A 2QN6A 5FTKA 4O5OA 1QTQA 4AZ0A 1SUWA 2O2HA 4XTRA 3SE0A 3N2KB 3NASA 2IHTA 3LGAA 3COSA 4U5QA 3T3HA 3UF0A 5BYKA 4NHEA 5I9IA 2R0QC 3G23A 2PMFA 1Q21A 5AI6A 5A6SB 4DIDA 3WGYA 3GLFB 5CXXA 3UQZA 1T26A 2KMLA 2PM8A 2OM6A 2NSYA 3OX2A 3NU1A 4MOWA 3DMGA 3KD2A 1YS4A 3KPYA 4BNIA 1KDZA 4MVXA 2O54A 3AF6A 1OA1A 3TS1A 2YWFA 5KIAA 1C3XA 1TQHA 4Q9LA 1HF3A 5M04A 5JU6A 2Y0EA 1WHTA 4N8DA 4YAEA 2P9YA 1LF5A 1JQBA 1W9MA 2AQHA 2XMPA 2XSZA 2YW9A 4J76A 3NT5A 4JLSA 2N47A 3BK2A 1JQEA 4K6FA 1N6OA 4NJEB 3PUJA 4L8LA 2ZCVA 5AM4A 3TX6A 4UTPA 3NTQA 1RRCA 1Q0PA 1TW2A 5FF9A 4RF4A 5BYBA 3ZD8A 4AQ7A 1XPRA 1HWYA 4FHZA 1FTSA 1NUSA 4HDNB 4RVOA 5IABA 3L4JA 1DS6A 1FRQA 2OGWA 3TK1A 4CUJA 4DGQA 4QDZA 2D4HA 2WJPA 2QY9A 3A2LA 3BYZA 3PQ5A 1XCOA 4JB0A 4JZKA 1H5NA 1NQTA 1E59A 2XQKA 3KZ1E 1E4EA 2VNSA 3PGXA 4HQRA 3OEHA 3M9WA 1KMMA 1RRPA 4YRTA 1AGRA 1EFHA 1U2EA 1TNDA 4FKBA 1G4HA 1KZGB 1MMFB 3TIXB 4RXTA 3W34A 1KFCB 4UBMA 4AKGA 1G16A 4QDOA 4LOHA 3T34A 3AHDA 4OQDA 4KN6A 1G8MA 4DCCA 1B42A 3ZPXA 4LOLA 4FEEA 4PFKA 2JCXA 2VDNB 2ZYWX 3UJPA 2V9CA 2FPWA 1Y8QA 5DM4A 4C7KA 2X9QA 4L0MA 2RK3A 1RM5A 2AIRA 3DV0A 3TLBA 5DYGA 3D6UA 3X44A 2P2YA 4LY0A 4QYMA 4DCUA 1VSTA 3N0VA 4J8PA 9ABPA 1U63A 2FWNA 2WVHA 2COEA 4KXUA 1P4AA 2MOKA 5D8DA 2OD7A 4RPIA 4ZODA 4GG1A 4ITRC 3WRXC 1WUJS 1PVVA 2B0CA 2YXDA 1G20A 3QBEA 2QJOA 4EUHA 3O31A 4AY2A 1NQ5A 1RPAA 3MC1A 3AGQA 3OQPA 2C04A 1UBJS 4E51A 1RI4A 5BOSA 3URMA 4I6EA 3ENKA 3VZSA 1MO4A 1R6XA 3C15C 4DLSA 1X92A 2J4FA 4RHEA 4WY8A 2FY8A 3CFYA 4UUBA 1IVSA 4L4XA 1R7RA 1PTKA 1H22A 3JYQA 3RG2A 1LBHA 1AIPA 1H2ZA 1ZG3A 3CMCO 4D6PA 5KYTA 3HP4A 1H05A 3COYA 2D7DA 2ODQA 4XGQA 2BH2A 4YONB 5EJMA 2RHBA 3NH6A 3MPOA 2WD9A 1CY2A 2Z5VA 4RMGA 4Z0HO 1P5FA 3TOCA 2CBZA 1V16A 1MB3A 1ZVQA 1BE0A 2GF9A 2GNOA 2I1LA 2JJ2A 2FSSA 2V7EA 3F90A 4O6VA 1NTOA 3WGHA 2Z2KA 4EA9A 4CI0B 1E20A 4U2BA 4KUGA 3EVTA 4B7CA 1H6DA 4BX9A 2CN1A 3U19A 1FUUA 2PU7A 2Q3EA 4MP3A 2P9ZA 2ZSDA 3R3ZA 1BAPA 2IY8A 4EVRA 1ILEA 3ZGZA 1KAQA 4QJ3A 2HRCA 2IHZA 1XEFA 1TT5B 3EXHA 4S0XA 4AU1A 4IFEA 5AHXA 2V4UA 4QTZA 1W1IA 1Z6YA 4KWEA 1X94A 4XVUA 4QM6A 1AHPA 1F7VA 1RYEA 2V7BA 2IIVA 4FBGA 4Y1GA 3MWGA 2DHCA 3LX6A 5DNUA 3R3UA 3F96A 3FGPA 3WVNA 1B0AA 3IPLA 1C2YA 2GRUA 5KSZA 3AEQB 1BMDA 4Z9YA 4XASA 1OR8A 4L5YA 4OHPA 3EISA 1XMXA 5T7BA 2QTHA 4EKIA 4DW8A 2DPYA 1Y5NA 3BWMA 4O2AB 2PT7A 1XYVA 1VECA 1NDQA 2H1RA 3PD1A 4D98A 2VS1A 4E11A 4HT3B 1UEIA 2XA2A 2P5UA 1X1DA 1FUIA 3N2KA 5CYPA 1P1CA 4X64B 2EGHA 3ET4A 3IJEB 1K3UB 1VKRA 2B83A 4OGGA 2P62A 3DPIA 3LLSA 1L4MA 2DUJA 4KXXA 3I6IA 1XNGA 5BXQC 3DCJA 3RAFC 4DAEA 1MVLA 2O2GA 5D87A 4R31A 4KG7A 4H16A 1GCGA 4JEUA 3V46A 1AGYA 4H7JA 1KHTA 1KJ8A 3MFQA 4JBLA 1E2NA 1YQWA 1ZGGA 1EEHA 1X7YB 2IYUA 1WS6A 2L82A 2R4TA 3Q1LA 3BMQB 4H3KB 1VJ0A 1OFGA 3SXUB 2QRPA 1BG6A 4X1KA 4YASA 4BNXA 2PBZA 3L6CA 4QEZA 3TLAA 5JMOA 3CF2A 2JJYA 4LK2A 2K5UA 1E6EA 5AW2A 3HJUA 5FNVA 5AW9A 2B2CA 4PC7A 3G79A 4MAAA 1N92A 1A1SA 2ZE7A 3EZXA 4MIKA 4UJ3A 3WWYA 1E7SA 5WRFA 3SJZA 4CM3A 3B1VA 1P4RA 2GRJA 3K1JA 4HRXA 2DEUA 2HZBA 1JR3A 5BNTA 1XKTA 3RS3A 1R00A 1VL8A 3M0EA 1LH0A 4URFA 3NDBB 1UC9A 3QVXA 1K7FB 3UAGA 4LOIA 3FTFA 1E4EB 5BW8A 1CP2A 1YUBA 5E6SA 2OYRA 1H0KA 2YMMA 4E03A 4ZV4A 4O4LB 2ZP1A 3QE3A 3W79A 1QOPB 3C14C 3MB8A 2B8TA 1KOJA 2AZMA 2D06A 3GNLA 2XR1A 3ORHA 4RIEA 1EHIA 1YC2A 1CUSA 1GKUB 1ZAKA 4QXMA 5KTYA 2N0SA 4EY8A 1YL6A 2ZB7A 5J40A 3SX0A 4DZRA 4B7ZA 2OCKA 3AP3A 4L57A 3R8CA 3UW1A 2HH9A 4BMZA 1H2WA 1DTWB 1K0UA 3I42A 4I9FA 4X85A 3AWDA 4IIUA 2YFQA 4S35A 4OB7A 2OK8A 2YHAA 4IYJA 1OZGA 4WEOA 3R7LA 1RKVA 3I2IA 4IGEA 4R2LA 4ENRA 1KVTA 2QQFA 2H6EA 1YJQA 2YZ2A 3QQPA 4MO2A 4BMXA 3PVSA 1DIOB 4E5VA 5F51A 4QLAA 3W6UA 3NHKA 3FCXA 1RAAA 3KLPX 2PS0A 1P7CA 3ZCQA 2JD0A 5AHRA 1YB2A 1Z6XA 3S1AB 3ZR4B 3C4JA 3Q0TA 4N8EA 5ITWA 3LFHA 5DWQA 1UMDA 2NNLD 3PHBE 3DTYA 4KJXA 4XIGS 2JFWA 5DCYA 1CR0A 3WJAA 1S3GA 4J3JA 4HDSB 2VQ3A 4J16C 5CA0B 4E32A 5L4NA 3KVOA 1E1QA 2JLQA 2O5RA 2PR7A 1XZNA 1E2IA 2C5AA 2HU7A 2IU6A 2WF9A 3D43A 3G7SA 4LECA 3LMKA 4XQGA 5FLXA 1LX7A 1JDSA 2EL7A 5GZ3A 1H1TA 1W76A 3WMGA 4X00A 3NANA 4Y6OA 4AS2A 3WGZA 2EHDA 3A26A 1ZD8A 1FTWA 3QKSB 1ENYA 1QC5A 3GVHA 2ZUWA 4JXKA 4CQJA 2NVWA 4PGFA 2BDEA 2BHSA 3CCFA 3V1NA 3TRDA 2GJAA 1M83A 4LX0A 2GSWA 2R751 5IYZB 4LVCA 2JH8A 4N0EA 4UOQA 4MVJG 4JSYA 3VPBA 1IUNA 3DL2A 2HPAA 3OG9A 1RU3A 4BWYA 3QXJA 3ASZA 5B7PA 3BVPA 4UUOA 5CGZA 3PNVA 1RPNA 2XDQB 2VJAA 5KNCH 2VEOA 2PAAA 3DFUA 4ZI7F 1LVHA 4YPFA 4CEIA 5B7NA 2Z3ZA 3CN9A 1HFKA 2O3RA 3PENA 3UOWA 3HU3A 4YLEA 3WGNA 3P9KA 5KKAA 4XUDA 4CF7A 2DYKA 3RYHB 3OSUA 5ALRA 3ILYA 4IIJB 1CG6A 5DCUA 5BSKA 3UBTA 2WKPA 4MUEA 5ARBA 3JR3A 2GAJA 2QRLA 3L5KA 1YZQA 2HWXA 1IONA 3EIUA 1JQ3A 4M38A 1FLNA 2ILVA 4Y2TA 3AEQA 3D3WB 3FGOA 4IX9A 4M9XA 4FILA 4OKSA 5KU7A 3F46A 1UXIA 3OKFA 1RZRA 3CH4B 1C1DA 1WY5A 3MRXA 1ISJA 3ZVKA 2P4EA 4NHOA 4EF4A 1EBFA 5GGXA 4RDXA 5FUMA 4QDUA 1RLUA 4IL5A 4RKQA 1QYDA 1E2GA 1P6QA 2RHJA 3X1WA 4MQBA 3OOYA 2BL4A 3OEED 4GIBA 4MW6A 3S4YA 4ZMBA 5ALUA 5CD9A 5I8PA 3ZOKA 3T7EA 3ZHOA 3X1KA 1E2EA 3TX2A 2QRNA 3SBXA 2I1QA 1R6AA 1M8PA 3PXDA 1A7JA 1TEVA 3B2NA 1PL8A 2Z56A 4IJMA 4NATA 2Y92A 1KBQA 4NIMA 1FDOA 4PLVA 4EJ6A 2BUBA 3SXUA 1GU0A 3GHHA 2VJLA 3CTMA 1GUFA 1DRWA 4QU5A 1NU6A 2DX7A 1ZI8A 2ZPUA 3QU5A 3ZDRA 1FYEA 1NVVR 1UMCA 3KZOA 2C7BA 4RM2A 3WMFA 1MOPA 1IY8A 1RP1A 1JHVA 2BF7A 2Q9CA 3IP8A 2NU9B 4E5DA 3LQ4A 5JLAA 7YASA 1XP5A 1UKAA 4ZI7A 5EHIA 3WYCA 4ZN6A 1IDN1 1X7ZA 2QRUA 2FQWA 3SF8B 4PGAA 2VT2A 1T9ZA 4QGAA 4R4JA 1RIIA 3T99A 2WUDA 5BVHA 3CVVA 1MNAA 3EXHB 3EGEA 3P9CA 5TGDA 3TECE 4YUAA 1KQNA 4QFCA 3JQBA 1IB6A 2EKPA 4FBLA 4B84A 1B23P 5CJ2A 3UG6A 4B32A 4B3XA 3CR3C 4TTVA 3KBBA 3ZY5A 5EEGA 4W8OA 1DAFA 4N6NA 3BWXA 4WOCA 2J6HA 3DC7A 1LY1A 2ST1A 4H1HA 3T9FA 5KDOA 4IJQA 4OQNA 3AF0A 3D5TA 1I30A 4WOKA 4TXNA 5ES3A 1YDEA 4OHVA 4YAOA 1GPYA 4OLBA 3H1BA 1KZHA 1G8JA 4B82A 2DVMA 4MJ3A 1N4DA 1SPXA 2C0QA 3HA3A 2C7QA 4FMDF 1H2AS 1U90A 3RU7A 1D9ZA 3SHTA 1OAOA 2R62A 3NHLA 4JHLA 1B15A 3KB1A 2ZIVB 1TQ6A 3G0BA 2M6KA 4CR7A 4LSZA 4BQPA 4H1VA 2P5YA 1UT6A 4YJ2F 3T7SA 3S2IA 4IZOA 1CETA 4JJGA 1H65A 3LUBA 3MB5A 4MRPA 4WQMA 3QTTA 4I4TF 5AW3A 2VSOA 5F3WB 3DOOA 1SD2A 3U3MA 1T5OA 3KVRA 3BDIA 4Q24A 1GDTA 1EVEA 2O8EB 5JTTA 2XH8A 1G59A 4A5SA 1FSZA 2BFDA 3K0HA 4MDEA 1NC1A 4OJKA 3O8NA 1ZLXA 3U80A 4OP3A 4W63A 2IHYA 1IG3A 2IU0A 5BSHA 4PX5A 1DAGA 1N0WA 1PZXA 4BFYA 4CLRB 2EZ4A 1CYDA 2DWPA 5DHRA 2VHTA 1OBOA 3C7DB 1DKRA 1B73A 2OV4A 2A8YA 4GICA 4DIFA 5A4KA 3OJFA 3U4DA 4ZARA 2J6CA 2GN4A 4D0NA 3K96A 1AY0A 4OL9A 4YA6A 1WVMA 4RD2A 2PXCA 5HQJA 2ATXA 3LQRA 3UKJA 1VLMA 2AX4A 2VNHA 1AKQA 4O4HB 3A2KA 2I7VA 2PZKA 3NHSA 3EC7A 4N41A 2XQFA 2E89A 2WU1A 3EDRA 3P45A 4JYAB 2Q62A 1L5MA 4TOIA 2MDTA 4ASUD 5HQTA 4L02A 4Q7MB 4PCLA 4GVPA 3M33A 2ZRFA 1HZJA 2QYTA 2XITA 1OLOA 3W7BA 4ES6A 3L7NA 3H8WA 4RHCA 1P81A 2YV4A 2FCRA 1A1VA 4P38A 1XEWX 4UHDA 1XXHB 2I2BA 2PHZA 3DYIA 3UWOA 4DJAA 3FPGA 2JLYA 3DULA 4M37A 5FPKA 4GEKA 3RSSA 2NPIA 1K5PA 3JQPA 1THTA 4GC5A 4G07A 1U7HA 1NASA 2QX9A 4RQAA 4BKMA 5KBYA 3PRYA 4RV4A 4GZLA 1T3ZA 3FYCA 1M1UA 4AWBA 2A3NA 5FBZA 4MWCA 2BGJA 5F35A 4BMYA 1N1MA 3AJAA 1NNI1 1R37A 2W00A 3GCDA 1JDUA 3MTAA 4JQZA 3W1EA 4GYKA 4NMXB 2BBTA 3K0BA 1OUMA 4G97A 3TZLA 3SJAA 3WHKA 3D4NA 1JIVA 3WLNA 3N70A 4EQ6A 1ADGA 3PFCA 3GPLA 1DCTA 1TF2A 4QPNA 4E08A 2MWMA 1LPAB 2XCIA 1ZBQA 1G8FA 3LVQE 4LDAA 4C0QC 1X13A 3X1XA 3ZU2A 2HDNB 2QG6A 4C7BA 1HDRA 4JB2A 4A2PA 2X7JA 5EWLB 4B5LA 1LW7A 2CJPA 2QL5A 4M1SA 1R18A 4Y7CA 1QG2A 1WUYA 2G67A 3MW8A 4G0PA 4M1KA 1LNZA 4IYRA 1G21B 4ZVUA 3BRWA 2HF7A 5ALNA 3ZHTA 4LOKA 1E3WB 1WB6A 2IUFA 1KKUA 2CJWB 3WHPA 3WS7A 5BWOA 2QRZA 3SIXA 1TEHA 4ASUA 1II9A 3RVLA 3MFYA 3K2EA 5KYWB 5F64A 2WD7A 4WDQA 1UPXA 1DIRA 5AOVA 2WJ3A 3TJMA 2JAXA 3CT4A 5CDFE 1U0HC 2GILA 3CZMA 4F3TA 2XTJA 2QJWA 2QTAA 4KGDA 1D4FA 1YZUA 1DDOA 3GBPA 4IIDA 4Q1CA 4XDHA 4Z8XA 3ZWXA 1X7ZB 3HCRA 3R3JA 4UAJA 1ODTC 1LXCA 5BQXA 4B43A 3LY9A 3HJGA 1EFCA 2OVFA 2BEVA 2D0OB 3CZAA 5CX1A 3F4BA 4DMUB 3IEVA 2WYIA 5E0KB 2W4QA 1Z07A 3A6DA 3ITEA 5KQSA 1KBZA 3IPXA 2QMUA 1QZ3A 3PHJA 4DDTA 2P6MA 3H9JA 4NECA 4AJPA 3WJ7A 2P35A 2D59A 3GMDA 3FUVA 4I1SA 5BR4A 5HQ3B 4KHPB 2R60A 1EE9A 2TYSB 3EGXB 2R1VA 1GITA 1W5EA 1ML4A 2XIQA 2ZPTX 1Z5OA 2DMRA 3C7TA 4JL5A 5DWDA 4DJFC 1QRUA 3MWFA 3AZOA 2ZKIA 4RKFA 1S2DA 5CAEA 1E9DA 2TRSB 4LSMA 3HB1A 5BW4A 2HLHA 2NIPA 2YVUA 1UKBA 4EHDA 1PUXA 2V03A 3PC8A 4K3VA 1PWHA 4UQOA 4JI4B 2C9CA 3AM1A 3FPJA 2WYVA 5ED0A 4BNZA 1AO3A 3H1PA 4WFJA 4P7FA 1Z45A 1AQUA 4RK0A 3RWMB 1XWIA 3PXBA 4MRVA 1R50A 2XF2A 3L0SA 2BR3A 5DBIA 1DU4A 1WA5A 5JECA 1ANKA 4GD3Q 1U1GA 2IZ7A 2EWVA