5DKFA

Reaction of phosphorylated chey with imidazole 3 of 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dkfA00
1S8NA 3UK0A 4UHKA 3S99A 2FQWA 3OLWA 3HXMA 5TPZD 3OLXA 2HQOA 5T7BA 3I42A 3O74A 2L2QA 3CG4A 2WJAA 2P9HA 3E61A 3HM9A 1GUDA 3QELA 2L19A 2VK2A 2FN8A 5DTEA 3OQNA 4EVQA 4QYMA 5D2CA 4KQCA 4RK6A 3JVDA 4Z4CA 3QX9A 2HQBA 5JNVA 3KYJB 4G97A 4LE2A 3URMA 3OQOA 3FFWA 3QLUC 5EWMB 5KI6A 3QX8A 1F51E 5TQ0B 3H5OA 4WT7A 4XARA 3A0UA 3MA0A 3NBMA 4KREA 2E4XA 1D1PA 2R4QA 4WZZA 1P6QA 1U04A 4YS6A 1BDHA 3D8UA 3JS5A 1ABFA 5CNJA 3SY8A 4PYRA 5ED4A 4EYKA 3DBIA 4IILA 4L85A 4RDCA 4F8JA 5IEBA 1FFWA 3ILYA 5F64A 1ABEA 4YGXB 4N41A 1QMPA 4ZYLA 3Q7TA 3QLVA 4WXMA 4E7PA 5I4CA 5IEJA 1LJLA 4KV7A 4HNQA 4Z99A 3O2JA 5TPWB 1EHCA 1JHZA 2CWDA 3OO1A 4O1IA 1QO0A 3H6GA 3MF4A 3DGEC 2E4VA 2FLWA 4MLCA 5B3JA 2MYPA 1ZH4A 4B09A 2GX6A 2IPLA 3C97A 3QEMA 4O5AA 4DADA 1U2PA 1YS7A 3NHZA 2OQRA 2GKGA 3KKEA 3LUFA 2MSKA 5TQJA 3RVSA 9ABPA 1JFSA 4XASA 4YRZA 2FQXA 1SD5A 5IUNC 1UDRA 3GT7A 1YVUA 1I3CA 1W25A 3HUUA 1ZAYA 1NXOA 1JYFA 2PUGA 4RKQA 2JVKA 4QICA 4XAQA 2IPNA 2FXIA 1JFTA 3C6QA 3LTEA 1PHRA 1SXIA 2GBPA 3K4HA 2E4UA 4MS3A 4EYGA 1R8JA 1TVMA 1Z26A 3Q41A 2WB4A 4FE7A 4MRMB 5EWJB 1L5ZA 3OO0A 1BAPA 4RU1A 3UUGA 5C5CA 2QVCA 3RVNA 2RJOA 3M9XA 4Z4EA 1KRXA 5IUJC 4JB2A 3Q15C 4KNYA 2FKAA 4M88A 3KS9A 4ZMRA 1M2FA 2NT3A 5BRAA 5C5EA 5CNKA 4OLAA 2QXYA 4E7OA 1QNLA 4RSMA 3HDGA 3HV2A 3DLBA 3GBVA 1XHEA 2PL9A 4LZLA 2JRLA 5GQSA 2IKSA 1YK1A 1FFSA 3MIZA 5HSGA 2JBAB 2FSPA 1M2EA 3LKVA 4F11A 1TM2A 1U8TA 1JBEA 4EUKA 1JF8A 4MQEB 1Z2DA 3ROFA 2TMYA 1PNRA 4LDAA 2WJWA 4MR9A 1YS6A 4KMRA 3RVOA 1LBHA 4JA2A 1WETA 2GI4A 1JLKA 2QSJA 4G0XA 2FMIA 2QR3A 3JY6A 5JNRA 2FTKE 4W5NA 4MRMA 1K66A 1TLFA 4RKRA 5JNWA 1ZVVA 3HO1A 4CBVA 2FW0A 4S04A 1RXEA 4G0ZA 3CTPA 3CG0A 1DBQA 3RH0A 1P2FA 4UHJA 1JH9A 3LUKA 1TJYA 3C3MA 4G0YA 3KTOA 3N53A 2LIVA 3L49A 3TO5A 3EJWA 2FMKA 1NXVA 4MS1B 2ID7A 3GA5A 3KHTA 3KSMA 3O75A 5FBKA 1USGA 3LMKA 4KZKA 1GUBA 3W9SA 3G85A 1MB3A 4ETNA 1JX6A 5TE9A 1YTUA 2FEPA 2LP4Y 2YHBA 2P4UA 5DCLA 1SXGA 3LKBA 4RK7A 2JB9A 3OLVA 3M9WA 1QQBA 4ZMSA 4G0QA 4XXHA 1Y1LA 5E3JA 4MR7B 3RVPA 3RVKA 4RK0A 1VRVA 4MQFB 3HCWA 4RZSA 4D6YA 1K68A 2A9PA 4OBBA 1EFAA 2KYRA 4TN5A 2PUBA 3DLHA 5JS2A 1YIOA 4QPJC 1BDIA 1JDNA 2WRZA 4G0MA 4MR8B 1GLGA 4HYEA 1SXHA 3LUCA 2F8TA 1RNLA 4N0QA 1DP4A 3B2NA 4MS1A 2JK1A 4G86A 2PKXA 1LK0A 2B4AA 4H3KB 1XWWA 1NXWA 3MM4A 1AB5A 4P98A 2FN9A 2W42A 2NUBA 3OMXA 4Z4IA 3CKMA 4MLDA 2MYTA 1DJMA 5KWSA 3MYYA 4EVSA 3O21A 4HNSA 5CHYA 2MSWA 3OM1A 4KVFA 2PUDA 1Z25A 3FDFA 4KFCA 1DBWA 3TB6A 2HJ9A 2I6FA 2M98A 5KQMA 5DKFA 1IIBA 3RQIA 4EVRA 1F4VA 3BBLA 7ABPA 1DC7A 3HUTA 5FBHA 1RZRA 4RK5A 4MQFA 2AYXA 3QLUA 3P9YA 4JB0A 5EWMA 1Z16A 1Z18A 5EWLB 5TQ0A 1PEYA 3IPCA 2IDMA 2QU7A 2M1ZA 3H5IA 3Q9SA 4QYWA 5FWYB 4YCSA 2FQYA 2PLNA 3LUHA 2HPHA 4W5QA 3NNSA 4JOQA 2RJNA 3QK7A 3N0RA 1ZDMA 5KC8A 4FE4A 4RS3A 3T95A 5JNSA 3TX6A 1BA2A 3QLTA 3SAJA 4Y9TA 3KG2A 1A2OA 3HS3A 2OENG 3IPAA 3MQ4A 5BRJA 2PUCA 1D1QA 2B1JA 2FEWB 1APBA 4OATA 3OLZA 3L6UA 4H3HB 3H1FA 4Z9AA 4MS4B 5TPWA 4KQ9A 1LBIA 3GBPA 3EULA 1EWTA 1ZN2A 4PZ0A 4RXUA 3IP6A 1NTRA 3KJXA 2GWRA 1DCMA 1JFVA 1EWVA 2LPMA 1BDJA 3IP5A 1USKA 3H5TA 3KYIB 3N75A 5TQ2B 1TMYA 1PUXA 4MYRA 3RVLA 4MGEA 3VNBA 4EYQA 1QP7A 1L5YA 1B00A 1Z17A 1ZITA 2QVGA 5HQJA 1E6LA 1CYEA 2PUAA 4DQDA 4NQRA 4TLLB 1MB0A 2F8SA 4EGSA 4YP9A 5GOTA 2L17A 3RVMA 4NICA 4EY3A 1YMUA 4GPAA 1RXIA 1DBPA 3EQ2A 4ZPJA 4W5TA 5FWYA 3SG0A 4N47A 3H1GA 1ZY2A 4KPYA 4IF4A 5TPZA 2JVJA 4NCBA 1Z12A 3SNKA 3OLYA 2H0AA 5EWJA 3H5WA 2A9RA 2N9UA 1KMIY 2VYCA 2QZJA 3I5AA 1JDPA 1MAVA 1XHFA 1KGSA 3MMNA 4ML3A 1D4ZA 2R47A 3CZCA 4OG2A 1ISRA 4WXEA 2ZAYA 4JASB 2MYUA 3BREA 4P1ZA 1HEYA 4ETIA 5IULC 4WWHA 2FLKA 3GWGA 4Z4FA 3A0RB 3I09A 1KRWA 1DRJA 2JCGA 3I45A 3JPWA 4DN6A 2WMYA 5DLEA 6ABPA 2PJUA 3T6KA 2RDMA 1E6KA 1T34A 3NHMA 1H9CA 4G0PA 1U2QA 2JBAA 4IMIB 3R0JA 2A9QA 3FGZA 2Q5CA 3Q7SA 4MQEA 4ZJPA 2LBPA 4KRFA 3LUGA 2FVYA 3NNDA 1P6UA 3VNAA 1AB6A 3H5LA 4LX8A 3H5VA 1JL3A 1OXKB 1BVHA 3A10A 1E6MA 3F6PA 3FFTA 1ZHHA 5CNMA 1DCKA 3EDCA 3CU5A 3HEBA 4Q6BA 2RGYA 1CEYA 1U0SY 2BGGA 5IC5A 1ISSA 1D2AA 2NZUG 3C3WA 3O1JC 1DCFA 3ILHA 1USIA 2FEKA 4YO7A 1FFGA 3LOPA 3QLVC 5HM6A 2HSGA 5IX8A 1QPZA 3LUJA 4N0PA 3K9CA 1GCGA 4KK3A 3H75A 4RY9A 3IDOA 3N6VA 5KQPA 3HSYA 3EODA 3QEMB 4IGAA 5B3JC 2V0NA 1RPJA 1SRRA 3UKJA 5PNTA 4RWEA 4JAVC 5JS1A 2QV0A 3EQZA 4L4UA 1VPWA 5BQ3A 2PL1A 4RXTA 1P8AA 1URPA 2L18A 3GL9A 4PE5B 3O1IC 2HQRA 2NT4A 2AYZA 1J56A 3A3KA 4N76A 3CNBA 3EAFA 1QKKA 2IPAB 4MS3B 4YWHA 1MVOA 1VLZA 2PUFA 2X7XA 2R48A 4MR7A 2MYNA 3KLNA 4YLEA 4O1HA 6CHYA 1M5UA 2PAFA 5JNTA 3H1EA 2QW1A 2LUOA 1OXBB 3EGCA 3OM0A 3D02A 3CHYA 1JYEA 2XDYA 4Z9BA 1E2BA 1DG9A 1Z15A 1ZGGA 3JPYA 4MR8A 4Z0NA 4N03A 3DGFC 1JWLA 1C4WA 1YMVA 3CLKA 4FB4A 4IMJB 1DZ3A 3H6HA 5IUKC 3F7NA 2FMHA 4F12A 3T38A 2E4WA 3OMWA 5KQGA 4NCAA 4F3TA 3GV0A 1PNTA 3BRSA 4EYOA 1NXPA 4TMYA 1YK0A 3BRQA 4JP1A 4YV7A 5KQLA 4LE0A 3N0XA 2CHFA 1CHNA 1NATA 1PEAA 2A9OA 3GYBA 3N0WA 4NV3A 1M5TA 3O2SB 2ID9A 2WY2D 2E4YA 1A04A 3RVJA 3NNNA 4G0OA 4H60A 4MR9B 5FWXB 5KC9A 1D5WA 4KK4A 1Z13A 4GNRA 1ZGZA 1DRKA 3F73A 4W5OA 4RV5A 3HJFA 3ROTA 1QO0D 1QP4A 3T8YA 5EWLA 3HK2A 1ZESA 1MIHA 3IP7A 4W5RA 3Q7RA 2JVIA 5ABPA 4LDZA 4OLBA 5BR1A 2MSLA 4Q7EA 1LJUA 3SM9A 3BILA 4XLTA 4RY8A 4S05A 1RZRD 2FMFA 2YHAA 2CHEA 3CRNA 3TD9A 4ETMA 3DZDA 3FFXA 3KCNA 3KLOA 5T3YA 5IBQA 1EAYA 2PMCA 4Z4HA 4Q6WA 4HNRA 2O20A 4OTZA 2J48A 1EWKA 2IYNA 3HZHA 1A0OA 1FSPA 4XFKA 1FQWA 3JTEA 3RVRA 3FMVA 4RK1A 2R25B 3HVRA 4F06A 4YR7A 3LUAA 3O2QB 1NXSA 4LE1A 4MS4A 4D74A 2CD7A 2IPMA 3CFYA 3IP9A 4LRQA 4Z4GA 4MAAA 2IOYA 3JVIA 2NZVG 3N8IA 3QELB 5FWXA 1VKRA 3M6MD 1W9HA 5TQ2A 3E3MA 2ZWMA 1NY5A 3LUDA 1QQAA 2VUIB 2VUHB 3QEKA 4TLMB 2WWVD 2PE5A 1C0EA 4MPTA 2H3HA 3CZ5A 1ZH2A 4D6XA 3GRCA 1NXTA 2E4ZA 3SQNA 8ABPA 2DRIA 1GCAA 3OQMA 5JNUA 3HDVA 1QP0A 4RK4A 3G1WA 1NXXA 5DGCA 3CS3A 3O1HB 1DC8A 4RY0A 4RXMA 3LFTA 3F6CA 2PUEA 3RVQA 4PEVA 5HKOA 4WUTA 4IRXA 3TMYA 4PICA 3C3KA 5CNIA 1Z2EA
chains in the Genus database with same CATH superfamily
1TT5B 2AOXA 2D2XA 2ST1A 3EZLA 4JEUA 4R9RA 1DHTA 1X9HA 1Q17A 1KE1A 2R4UA 2OM2A 3W2TA 1U8FO 2EBFX 3AYXB 3TLCA 1VMDA 4JLKA 2W6JA 1X77A 3CLUC 1QZ3A 1CJBA 1SBHA 4I4NA 4N6NA 5K8LA 1K5GA 3FR7A 2FUNB 2XLBA 2E82A 1TQ6A 5SYAA 5F98A 3JVDA 4L75A 3RUIA 1I3NA 4FNOA 1J1ZA 4DM3A 3AXSA 2YUIA 3UK7A 1VHLA 3R0XA 1VJ0A 2OBXA 3AKYA 4GZ3A 3CRQA 1Z4PX 4LJ4A 2FCAA 4DUGD 3DKRA 4RQTA 5DTMA 4NMXB 1W88B 5EMJA 4GRIA 4JJIA 4MWTA 5CVVA 1JXQA 4POOA 5A02A 1PX2A 4ZVUA 4MW2A 4PANA 1GGJA 2PMWB 2TMDA 4CCSA 1QGOA 4OFBA 2VPXA 5KYYB 3TG2A 2EFEB 5AK0A 5ESDA 3RSGA 3RYIA 3LCJA 1UWKA 2VNSA 1HI9A 2QPTA 4KSYA 3OY2A 2X77A 4PYRA 3VH2A 4CNQA 3IEIA 1SVUA 3CW8X 3PRKE 1HE1C 5LZ7A 4CM9D 1QK5A 3X1MA 5CXSA 1PU2A 1QMPA 2FUG1 3MT7A 4WXMA 5FX2A 1XD2B 5G1PA 4J03A 1BVRA 4Z99A 4AF7A 3CH5A 4E5UA 4UHDA 2IHBA 1L5RA 3MF4A 3VU9B 3ZVMA 3DB2A 4WK4B 2PANA 3KT8A 3NUGA 2WQZA 4JSRA 3QEMA 1BEEA 1VPLA 2ZW9A 2CZQA 1C9JA 1T3LA 1ULBA 1RQ7A 2PSEA 3EEQA 1XTUA 1OXXK 5EUCA 4BVHA 1AQJA 4G0UA 4MUMA 2QGNA 4LFBB 3LL4A 3AJDA 4KDRA 1SVWA 1R00A 2PPVA 5JYEA 7MHTA 3VAAA 1EFRA 3ZJ5A 1IULA 2A9JA 5LQUA 4C6RA 1ZZGA 4I6JA 2DQ4A 1VE6A 1WZNA 2XB2A 3KZNA 5E38A 5DV9A 1SXIA 1XMSA 2R4TA 4KWCA 4QBGB 3GB9A 5L3QA 4MTLA 1SQFA 3NIBA 4UE6A 3DEAA 5B2ZA 4B73A 2RD2A 4BNDA 3WJ7A 5L51A 3D9QX 5C9ZA 1B1CA 4FW9A 4UVGA 1NLZA 1JMKC 4MVCA 4NENA 3EIFA 1J99A 1GP2A 1YVDA 2JEZA 5DO9A 4UVIA 2AG6A 2DSNA 3AVQA 3FJOA 3X3HA 4DNXA 2XWJI 3JAKA 1Y8QB 1RPNA 2OP1A 4DR5B 4L0MA 2BLNA 1J8QA 4DPMA 3BYZA 4M36A 2VQEB 2BSAA 3P0EA 4R8VA 4R9SA 5JJKA 3WB1A 1K5PA 3QOYA 5AVXA 2JEYA 1E96A 3L7LA 3N1UA 1DX4A 4QECA 4WI1A 3FNEA 2BF7A 4P81A 5E7IA 3OP1A 3MILA 4CT0A 1N2EA 2FH5B 3R3SA 5IMSA 5A0TA 2FSGA 2D54A 3LBAA 4JOSA 4EW6A 5CDGA 2XYQA 1QYDA 1ENOA 3THOA 1UPXA 3EPKA 2G72A 4PHCA 1T36B 1UAAA 1UJBA 2FMXA 3KKPA 3DBOB 4RHUA 4YBRA 5KTTA 4IJWA 3ANLA 4G0XA 4R6XA 1RZVA 2IJGX 4K9RA 3VKWA 4CQJA 4DQVA 4YCBA 3D6TB 2OYSA 3BIOA 4MW4A 5CTJA 1KEVA 1KNQA 5K8JB 4U6QA 4I81A 1XXHE 2YBDA 3ZCPA 1MJNA 3UT5A 3CTPA 3DE7X 1D8AA 2WIDA 3HJGA 1J2EA 2UVPA 1G4UR 3GC6A 3RC9A 4QHTA 5LA6B 3F2VA 4EA9A 2JG3A 1WMEA 5SV2A 3O4FA 2ADOA 3H1AA 4NG5A 3IDAA 5ADWA 1XAHA 3K0KA 4X85A 4NXNB 1L3IA 3TZCA 4A91A 3LSYA 2QL9A 2OV2A 2WZDA 4HRXA 5TE9A 5ADUS 1O5OA 2D2FA 2OY0A 4FZ3A 2Z08A 3T94A 3TE7A 5DM60 3FFAA 3NHUA 5FHRA 1A9SA 3ZI4A 2D7DA 1KQFA 5G1OA 3PKZA 1E0JA 3NH9A 3QG5A 2FR1A 4LK3A 5ALTA 5ILOA 1TA4A 2VWPA 4ZQEA 4BNWA 1DOAA 1UIRA 1CZLA 2YIDA 3AI3A 4FXOA 4RPLA 5CW1A 5K45A 3LBNA 3T7DA 4MVJP 5JDCA 2IZ7A 5AVVA 3OE4A 5A5GA 4RK0A 1ZK3A 2QD4A 3OOEA 4LSWA 4A6DA 1SB9A 1SXJD 1IHDA 2FCRA 2VAMA 3QV1A 3UMFA 5A4FS 4AMGA 1CY8A 2GJSA 1ZUD1 2RHLA 1XJWA 1T6YA 2GNOA 2Q1UA 3LHDA 3DLHA 1YC2A 4IIXA 5M3BA 1GUFA 1FTYA 2P8JA 3R41A 1LUAA 5AOAA 1FX0A 1E8MA 1GGVA 4JUAA 5FOSA 1ESMA 3EXG2 1GCIA 3WZ2A 4UQLA 2IS4A 1Z6ZA 3QXJA 4CJXA 3DE3X 1VP9A 4C22A 4URUR 1Z4OA 3E82A 3C15C 1E2GA 1NXWA 3UHFA 2DLNA 1T13A 3DPUA 2LR0A 1UODA 4IZIA 4YEDA 9LDTA 5IBCA 2H7CA 2MHCA 4NC9A 7YASA 2B99A 2PGIA 5KOJB 3A2NA 1MZPA 3X1ZA 1HLDA 2AFHB 4YUXA 3U0VA 4KVFA 4LGVA 1YONA 4LQCA 4D26A 1T8YA 2B8NA 4HEHA 1HUQA 2JGLA 3HSKA 1BFDA 2VSXA 4OQXA 4PZLA 4BVAA 2H31A 1BXGB 3SM3A 2ZCVA 1K9VF 1SD2A 4KKVA 5B1DA 4D8TA 3PQCA 2W90A 1U9CA 1ZWLA 2WSSD 2I7XA 3A31A 1OXUA 4N40A 4IDOA 8GPBA 2PH5A 3HUTA 4QELA 2HHLA 1B73A 3I8OA 4P93A 1LF0A 1L5HA 3ZDZB 3S81A 3DCYA 4QEZA 5C46F 1NASA 4CIYA 4JB0A 1A2KC 1Z18A 3CCCA 1GU0A 3LHKA 3CH6A 3CA8A 3PV0A 3RSCA 3PNBA 3H9EO 4BUJA 2NP7A 3H5IA 4KI0A 2Q9CA 4HCJA 2ZJ8A 4IQFA 3KE8A 4C4YA 4KPEC 1YZUA 4ERNA 1MX5A 4PNHA 1H05A 3O03A 1ONPA 4NU5A 5EEHA 5KC8A 4JJ4A 2ENWA 2EFCB 4NZZA 3GRFA 3DR5A 2WJIA 1UPTA 3MWGA 1YVRA 2CBGA 2H2FA 4C06A 3W4JA 3GQBA 3IQHX 2EP5A 2GEVA 4HUJA 4HX2A 4BGIA 2CT8A 1OAOC 2O4CA 1UC9A 3DKPA 2YYZA 1L7VC 1GZ4A 1MDBA 1T4MA 5D84A 2MINA 4LYFA 3I76A 3U39A 4ABTA 2FN7A 3GF4A 3CCBA 3GEBA 3K31A 4MRVA 1FDOA 4TTVA 3K70D 1OY1A 2UZ1A 2EKPA 4CM5A 3VVBA 1ZITA 2XEDA 1B16A 1EA7A 4DQDA 3SLRA 2PGOA 3DZBA 3IMKA 2F8TA 2ONYA 3CTMA 1DJQA 2YFKA 3B85A 5AO9A 3JQ9C 1JXOA 1ZQ9A 3ZZ0A 1G21A 2J09A 4W5TA 1CY0A 4MV0A 5JNUA 3F6BX 1ZHOA 1RJ9B 3T41A 1CDEA 2JVJA 1ZK1A 5FDFA 4YCAA 3NWOA 3UXMA 3SNKA 1MPTA 4MUXA 3D6VA 1EFLA 2H0AA 3IKLA 4QYIB 4OH1A 1SCAA 4EAQA 5BOSA 3RASA 4BLRA 4E3ZA 3EA0A 4QEDA 3SVZA 3KJQA 4B0OA 2ONJA 2BGIA 1TI7A 3EGOA 3UB4A 1HG1A 1JR3D 3O38A 1HGXA 3QXGA 1U3GA 3CW9A 1AKWA 4NE2A 2F9MA 2W4QA 3I8XA 4MMYB 3PTAA 2YIJA 3ZV4A 4Q7JB 1JJFA 4QRHA 3GWGA 4IEEA 3QFHA 1BO6A 5E2IA 1KP9A 5IDQA 1XE3A 3BB4A 4Q3OA 3PC7A 4AJ1A 5LZ8A 3W0LB 3TS1A 3E7PA 3GLQA 1VC2A 5IJAA 2R85A 3KUUA 1IK4A 1G3UA 2HBZA 3B3JA 3DBRB 4GOOD 4BMPB 2WIAA 4DT1A 1RW4A 5IC6A 4YP5A 1WCXA 2I0FA 3OTQA 3R0JA 1J9EA 3REFA 1QG4A 4XFDA 3OPYA 3A3PA 2OYRA 1XNJA 1TOAA 4BJ3A 3NYRA 5HIKA 5JAUA 3LUGA 5A9TA 4M1SA 1P6UA 1H0HA 3BRWA 4H08A 1IOVA 4EO7A 1EVLA 1CE8B 4KJXA 3VDNB 4TKUA 4OF4A 2XMSA 5K0LA 3R77A 3CGWA 1PCXA 4GR5A 4Z49A 3B3QA 5B6PA 1OLXB 1RR6A 3IKVA 4X44A 4YAKA 4ZI2A 2PKRA 2Y8EA 1E4VA 1C3EA 3UJ9A 2NOAA 2BJWA 2G17A 3MTIA 3NTLA 1VECA 3VVLA 5L45A 1TADA 4QA9A 3I1YA 4HGYA 3WYCA 3ZWOA 3O1JC 2A0XA 1CUWA 2BHLA 5CFQA 2FEKA 4I4IA 1GPBA 4MVJG 2J41A 4LY3A 3DB1A 4BFWA 4D0NA 4ER0A 4OX9B 4LZJA 1KDVA 3JWIA 4J16C 3WBKA 1A7KA 2I6XA 4JGGA 1P2DA 4C0HA 4RY9A 3N6VA 4P9NA 4XI9A 4BAUA 2YJTD 2F3TA 2XMQA 5MFZA 3BMNA 1IXZA 1UXIA 2OXFA 3SC4A 2H52A 1FL9A 3DFUA 4IKPA 4RGBA 2ZSEA 4F8EA 2M6KA 3IP1A 2R6R1 2WVAA 5JYBA 2CD9A 4LWQA 1OW3B 1YD7A 4LCEA 3VR4D 3W8EA 4J3NA 1LH0A 3DNMA 1GUZA 2FZGA 3CZ4A 3G8BA 1NQOA 2AN4A 3ZE6A 4DAEA 2IFTA 4XGIA 2NQ2C 3N2ZB 3NBAA 3OLCX 5DM4A 4AP5A 2GHQA 3KE9A 2JGKA 2OGSA 1Q20A 3NYWA 2C4TA 1W7AA 2P9QA 3ZE7A 5CDYA 6CHYA 4KN5A 1SC6A 2GPAA 1U3VA 1ZIOA 4NDAA 5EIOA 4UXJA 1VIVA 2BLLA 2BR3A 2ZKLA 1ULSA 1PK8A 3PNMA 2QRKA 1GAEO 1AE1A 1N0UA 4P82A 2O3SA 4XVHA 2D2VA 3E7DA 3KKOA 1NW4A 4CDNA 2MCFA 1E1RA 3IE0A 1QYVA 5K6RA 1ZA1A 4S1WA 721PA 1CUEA 3FZEA 4FYIA 3MMPA 1I9GA 4BLPA 1KSHA 4WUVA 3T3OA 3IR7A 2YC2C 3GMDA 3P9QA 1JWAB 4W1QA 4HT3B 3ZDEA 4KR3A 1F6BA 5G02A 2QQFA 1U1CA 1HE4A 5KTYA 2F8MA 3CRW1 1QDEA 4YRQA 4OHZA 1NU6A 2OE2A 4XUGB 4C6HA 3EXHB 2C3OA 4XQGA 1IUOA 1CHNA 1EWRA 5KJCA 2NTJA 2CJXA 1EG7A 2BFPA 1VLHA 4IOJA 2FJUA 3HVIA 4NV3A 4EDFA 2QBYB 2ID9A 3CZPA 3R5FA 3DWIA 4KHZA 4R3UC 1FOEB 5ARBA 5BSGA 2Q5FA 3P71T 4N01A 3VHLB 1NNEA 4F45A 3AVVA 3OKCA 5LZ5A 3P27A 4HDSA 4KK4A 2ZQZA 3JD0A 1QJ4A 2GNPA 2OKCA 5LP6A 2J5KA 2B8WA 1HPLA 1KVSA 3QPBA 4PZUA 3F6EX 3DMHA 2OSBA 4EFKA 3HJFA 1AGPA 2VSFA 1F8YA 3WMXA 4TZ6A 5AJVB 2I2DA 1SKYB 3QY9A 4QNRA 3AGQA 1S2GA 4HYYA 5CVCA 4B81A 8OHMA 2HM7A 1B26A 1F48A 3TRFA 4MWSA 4OOFA 5ALDA 3U61B 2BEVB 3VH4A 3RU9A 4NCHA 1Y8RB 3AL3A 4JEIA 5K99A 4UPEA 1L4KA 3JZFA 3AQ4A 3VU1A 4ETMA 4K3VA 2QM0A 1T15A 2YFHA 1CD5A 1RRGA 1L6RA 2DECA 3KQQA 4MUAA 4UUAA 5CVDA 3SEZA 3TYXA 5CB8A 1HNZB 4ZDKA 3VZBA 2JGNA 3P2OA 3IT3A 2B5VA 4L28A 3JQEA 1SOWA 4KQEA 2M6LA 4AMUA 2VYQA 3ZJVA 3W2HA 2VJNA 1NW3A 1SC3A 5EERA 1ZRNA 3S2ZA 5DXJA 1U0TA 3KXLA 4MAAA 5KS2A 2P79A 5FLXA 1G20B 1T6ZA 4OXQA 1E3WB 1JS1X 1FFDA 1YE8A 5TQ2A 2N1BA 1E2HA 3QVUA 2ZITA 4KQHA 3EXFA 1U7UA 1RYHA 2WWVD 2W22A 5AXBA 2BCGY 2YOGA 2WFMA 4KUGA 1IUKA 3NLLA 1WB6A 3RTGA 3SP1A 5J58A 2PE5A 4N6GA 4D6XA 2C4MA 2KSQA 3RRBA 8ABPA 1JEYB 2GRAA 5DHFA 2UYHA 1X8LA 3MHPA 3W9BA 5CFPA 2ODWA 4MYDA 5JCZA 3A1NA 1EUCA 4URHA 1TA0A 4FZ5A 5FUYA 1YA4A 4EHHA 1Y42X 5I8PA 4QDXA 1TCAA 2YJ3A 2NU7A 2OV6A 4TS3A 2AC7A 1KI2A 4NE7A 2JEOA 3P9CA 3HP4A 1SR8A 1IONA 3FXAA 5EIBD 1LDYA 5AXCA 4PZDA 5HUQA 1Z4QA 1X94A 3EFEA 2EJWA 2A8YA 2OILA 4HFMA 421PA 4EATA 3LP8A 3JAWA 2CXQA 2PY6A 2PKQP 3G2MA 4PGAA 1MPXA 3FMIA 5AJYA 4U8HA 4OQYA 3V3TA 2AIRA 1RAEA 2VJKA 3LCRA 3RVDA 4CV3A 5BURA 4RFSA 2VBGA 1MAAA 1D04A 3DG9A 3GJ8A 3HN6A 1QHEA 1PYGA 1IWBB 1O54A 3A6FA 4RZQA 5TGZA 3ESBA 4J2TA 1SVLA 3GVCA 3QVOA 3VGJA 3PKJA 4B33A 4EVQA 1UXOA 3PLNA 3EGEA 3U7GA 4Z4CA 1CUIA 3FNGA 2FX5A 4M0EA 2FW1A 4D42A 5ALGA 3ESRA 4Q24A 3PFWO 1KXZA 3FHCB 3KRTA 1K6XA 2VT6A 3V8NA 2F3SA 3B6MA 4GOJA 3AFMA 4GPD1 4N7JA 4DG8A 4GI2A 4PXYA 4D3ZA 1DLIA 3N8DA 4FMCF 2E4XA 1D1PA 4BP8A 1WSAA 1TW3A 4LYDA 4RJ2A 4WZZA 4AAYA 4HBZA 3TB4A 2P1ZA 3V80A 3PDIB 3K92A 2XWPA 4M9ZA 2Q3CA 1AGYA 4CMAA 4BDTA 4MKGA 3BH0A 4NFLA 2GEKA 1N6IA 2ZR8A 5BQPA 4WZAB 3BICA 2Q3LA 2X5XA 4RDCA 5KSPA 5CLQA 5YASA 5K3DA 1S6YA 3N70A 2DWPA 5BN1A 4ES6A 4NTZA 3AV0B 4ANFA 1ZSVA 4TVSA 1JH8A 4R2HA 4CKCB 3REQB 1EX7A 3NQ41 3X2SA 1I5RA 1R6TA 4DHWA 1C4OA 3C4QA 1P1CA 3OCWA 5EMLA 5F21A 2B34A 4J0JA 1YZVA 2BFBB 4Q9KA 1QE5A 4PZEA 5HQ3B 3BQ9A 3PB3A 2IHKA 2J1LA 2LXNA 3BGVA 5E6UB 2QYSA 1X7ZB 3W8NA 4YUYA 4OI2A 4DV5B 1WNFA 1VKHA 3GUUA 5AQ1A 3GXBA 1XXHA 3SSMA 4BV9A 4X8OA 4DIOA 1WM1A 1QTNA 4OXIA 3VO8A 4H7KA 5IUNC 1I3CA 1W25A 4P36A 4PYKA 2EC5A 3VKFA 5CIQA 4TTIA 1W46A 3C5WP 4IMPA 4K9DA 5CFNA 2YINC 4KNVA 2P2NA 3BMQB 3DFKA 3C6QA 1U4SA 3KAJA 4LNUB 4EG8A 2BUBA 2ID8A 4MS3A 4JVOA 3PJDA 3MJSA 3PZBA 1G16A 1Z26A 2OV1A 2OSVA 3R09A 3MYRA 1KFCB 1PR1A 2HXYA 1SB8A 2WBLC 4EBBA 3N2NA 5I51A 5LOVF 3QEAZ 1QOPB 4TSRA 1UBKS 2HBQA 3MWLA 4J7CA 4BNLA 2DUMA 3M6FA 2EL7A 2DR0A 3GGOA 4BX9A 1GNLA 4LHVA 2Z95A 3TZBA 5IVKA 1U9ZA 2CFIA 3O9ZA 4XUEA 1CX9B 5G3YA 1NBHA 4KIJA 2BMVA 1U9IC 2QVLA 3KXIA 1M2FA 3ECSA 4H2DA 1F8UA 2F90A 3E22A 5GWXA 5BRAA 5C5EA 1SCIA 5CNKA 3OI7A 1BRTA 1GHTA 3NATA 1ZWKA 2YIMA 2IPOA 3KOXA 3FNRA 3U49A 5DP1A 3A1WA 2AWOA 2J3MA 2WTBA 3FF4A 2VG8A 6REQA 1PLLA 1T6XA 1KPGA 2JDID 4Q3CA 1HNNA 4A82A 4TSFA 3HXTA 2WDZA 1PLKA 1PN3A 1DUVG 1X87A 5DEIA 1R8XA 1U8TA 2AV6A 1JBEA 3GWZA 2CMKA 4GKAA 2WJZB 4JC4A 5EMNA 4ID9A 3X1YA 4EUKA 3L7DA 3F5SA 1BWPA 3I9OA 1EAMA 2HCBA 3QBEA 1T29A 2ZJ1A 4Z2YA 2DQYA 3WFZA 1U4OA 2WA1A 1HZJA 2E5FA 2G83A 1UBFA 1G7RA 3DEKA 3GIWA 3HBMA 3T7KA 1K66A 3O6VA 3C6KA 2XRMA 3LC1O 4RKRA 4WEQA 1BOOA 2PS0A 5KBYA 3D7MA 4IGFA 3TQCA 1PTJA 4RTKA 4QATA 2NZ2A 1IDN1 4G0ZA 4RBNA 1M8FA 4OKSA 4RLSA 5EFOA 1KEKA 2OLEA 2DC1A 1P2FA 1JH9A 3KC2A 3J80A 2CLMB 1W44A 3DEFA 1LD3A 2FMKA 3DZ8A 3NANA 5JWHA 2XI4A 4A7PA 1RWMA 2R00C 3WK6A 2CFTA 4PNZA 5HW0A 4P3PA 2A7XA 3A27A 1Z08A 2VOJA 3AZPA 1KOJA 2C99A 4HI0E 3TCNA 4ATNA 4D8WA 1U2EA 1V11B 1S9DA 4LCJA 1JB1A 3PIRA 2X3YA 4TM7A 2QG4A 5T41A 1SCQA 1GG8A 4PFSA 1IHUA 5KMGA 1MMFB 2X0JA 1XZEA 2FP3A 1IEXA 2ESRA 2VF4X 3BFKA 2OBNA 2JFYA 4YMIA 2CZCA 3U3MA 3L7OA 1PSZA 5DIFA 4NYIR 5CYOA 2L69A 1F1JA 1KOLA 3RVPA 1NRXA 1R66A 4NDNE 2FWMX 3H5NA 3IX7A 1PT6A 2X8LA 3NBZC 4J6FA 4RKWA 3C3JA 3RC2A 3H19A 3SOZA 5AHWA 2X3FA 4Q0MA 4QOFA 1RYMA 2W83A 3RS9A 5I7SA 4OK5A 5FOWA 4DR3B 3L92A 3Q2OA 2X1LA 2XVXA 4HAZA 3ZGXA 5JRJA 1E89A 4G0MA 3C6ZA 4QXMA 2HSWA 1B41A 1O95D 2ZIAA 3PRJA 2ARKA 4FBGA 4WFKA 3WMFA 3K6RA 4BC0A 4MS1A 1NJ2A 2ZCUA 3L6BA 4D3DA 2HCJB 3OT1B 4H3KB 4WFQA 1K5DA 1VHQA 3V9AA 3AV3A 1N34B 4I36A 3GH1A 2FMTA 4EO4A 4WACA 1DTWB 2QVXX 4H27A 4C4OA 3K5IA 3U4CA 1VPTA 1KZYC 1XMJA 1XX6A 1YQUA 2YJ6A 5DULA 5CA1F 5LNK1 5HUJA 4PW0A 1YI0A 1ZL0A 4BCDA 3BDAA 1BFUA 1GKKA 3F49S 3FSGA 4QUKA 4EWLA 1CV2A 4KGDA 4R2JA 1VRCA 3ZYCA 3V8EA 3LXUX 5KPDA 1F4VA 2R8EA 2WC1A 4DMLA 2QTRA 3DOHA 2Z3VA 3P94A 2ZPAA 3WLMA 3IOEA 4JBYA 1QORA 1M7GA 1RWNA 3AZOA 4CTOA 4EECA 4GQAA 4L9WA 2VOEA 5EWMA 5FWDA 3TR0A 5CEFA 1Y3HA 4L8FA 3VR6D 3IPCA 3W05A 1BHSA 3M2TA 4UHBA 4ZC8A 4JITA 2HPHA 4BVEA 1MX3A 2EF1A 2ZRBA 4P5PA 1IBKB 2QT9A 1DAEA 3M4ZA 2YW2A 1DIGA 2CXSA 3T1YB 4HZUA 3F8WA 4LWZA 4RS3A 1R64A 1HE8B 1W76A 3A05A 1QKJA 4X5OA 1EFPA 3DA8A 1Z5GA 4A3SA 1AUPA 3BF8A 4IXTA 5IN5A 4QT4A 3L7YA 2ETXA 2Z4RA 4Y2YA 3JVEA 4YRGA 1BJTA 5K8UA 5G41A 5B57C 3EVCA 2SKEA 4PFQA 4CKZA 5B1IA 3HB9A 2XNDA 3H6KA 2Q3HA 4Z9AA 4DQKA 1J2RA 3ZWQA 5KPJA 2FUEA 2GVDC 2QPLA 5JCPA 2QRQA 4RXUA 4RJKA 1NTRA 2DWCA 4DNPA 3ZK7A 2AOUA 1EWVA 5CAEA 2GYUA 3JRXA 3H5TA 4NY1A 4LK2A 4J1TA 4X71A 5ER6A 3PNLA 1A9TA 2ZU0C 1XGKA 2UV8A 4FHDA 2ZE7A 1JVSA 5HQJA 1E92A 3R44A 5IH3A 5TS2A 1Z5OA 2HPAA 3DT8A 4YP9A 4ZICA 3ZVKA 1NOJA 5FFFA 3PBKA 1A3CA 1SU7A 5A0FA 4N47A 1HLFA 1KA9H 3KR9A 4DV7B 2EKDA 5DISB 5JSQA 4B8YA 1FFYA 1PJTA 3QJGA 2WSMA 3T0FA 3M89A 4NCBA 4WDQA 4XGKA 5IT0A 2XD4A 1A5ZA 1TQDA 1T9GS 1W5EA 2FOLA 4CRWB 4MJ3A 1V4BA 4OBXA 4QU8A 3A04A 2UUPA 4OQQA 5F5XA 3AKZA 1Z5UA 1JDPA 1QGAA 4L8LA 1KGSA 1P19A 2XUFA 4LZZA 2DFLA 2HNKA 3MCTA 2D6FA 2ZBGA 2V59A 4AXBA 4ZYUA 1XPOA 2FZWA 3OX4A 4MI6A 1J06A 3OY7A 4ZD6A 2PEYA 4YRAA 4ZZ0A 4KXMA 3ZY3A 4DPKA 2I9KA 1DBIA 1E98A 1Q44A 2JHPA 5E6SB 4F38A 3P2EA 2R6AA 2NO5A 3ASVA 3HXLA 3I09A 4JB8A 1UR5A 4TYQA 3ZLBA 4YV0A 4WA8A 2G08A 3QF4A 3BMOA 4NULA 1GD1O 4DN6A 2IYOA 3KPYA 1RC8A 2XRFA 1YIDA 2HJWA 3LP6A 5C1OA 4XCXA 4F4CA 2HA2A 1U90A 4IMIB 5ITZB 3AEYA 2WF5A 2Q5CA 4QUAA 4X3OA 5FJIA 2WK1A 2O48X 1FMLA 5ALVA 4CMEA 1NUTA 3BM5A 1AB6A 2DPHA 2HF9A 1TEXA 4QBKA 3HGMA 3WICA 3F6PA 4IEFB 1Y7HA 4EHAA 4Z3KA 5KWVA 1T9GR 5HKBA 1G8YA 3MCUA 5K6TA 1FE8A 1XLTA 4U7PB 3SGLA 5HDBB 3H7AA 4G37A 1ISSA 5LZ4A 4XIJA 3U1VA 5ALUA 3S0JA 4RTQA 3BRCA 1DJMA 1DQPA 4XJXA 4D8YA 2HB6A 3GEDA 4PBTA 1B76A 4ER5A 3CXRA 1FDWA 3L05A 3MJ4A 4GWLA 4U9UA 3ZE8A 2PFGA 5MGNA 4Q02A 3ANNA 5JC1A 3EEOA 1K6JA 1U2GA 2P40A 3HN7A 3MGGA 4KMSA 1B43A 1KXJA 4LOHA 3UGQA 1OZHA 1KY5A 3K8QA 5AKKA 4C3VA 4WD3A 3R9WA 1FB5A 1KI1A 2W98A 1UAYA 1ZMRA 2VH5R 3GRPA 2C4HA 4EYSA 3FOEC 5I9BA 2Z6VA 3DW1X 3F3KA 3SZ3A 2VLIA 4HVLA 4MINA 3NHPA 1DAGA 1ML3A 2ZRJA 4FTWA 1RXCA 4F3RA 1PVDA 4L4UA 3COZA 1PR4A 5ICSA 4BLTA 2FV8A 2L18A 3K0FA 1FW8A 3MPOA 3O1IC 2HQRA 2YVLA 4X1KA 4W8OA 3TJMA 5KDDA 2J0VA 3ADCA 1CQIB 2EKBA 1SXJE 3H5AA 3M81A 3B3FA 2IPAB 2ZI3A 4BECA 3DC7A 1B8NA 4BGEA 2C9CA 2VC2B 1VG0B 2XUAA 4RZ3A 2J0QA 3TXXA 4OFWA 3IQDB 3QVGB 4P84A 4WOPA 4YWJA 1A5SB 3OZFA 4IOMA 1CRLA 4UUNA 5EJ4A 1OXBB 1VE1A 5B3AA 4Q3BA 4I3GA 3W6NA 4ZYZA 4JGBA 5EE1A 3K6KA 1E2IA 4Z9BA 2YOFA 1IIRA 5F1YA 3OZAA 3SXUB 1V16A 3QNUA 4KR2A 5KOYA 1K3FA 2PJRA 3P9IA 3CRZA 5LQRA 3ITEA 2EP8A 4X60A 1QIDA 1PZEA 5IU6A 1QDUA 2AFVA 2FXVA 4YIKA 3KQHA 2IS6A 3ZE0B 5T6BA 2QRVB 1KSFX 1PZGA 3O9VA 3R9IA 1T2CA 3OA2A 2AH5A 4X8MA 4DJDC 4KR7A 5IHPA 5HM8A 1S0UA 1O6ZA 4GUDA 4MRRA 3LZCA 4Q12A 5T6MA 2HADA 2Y4OA 1NATA 3F9CA 4YJ3A 3RWBA 3WSWA 5BV1A 2ON6A 2CFSA 2B7LA 2F1OA 1EQUA 2ZRMA 1ZGJA 1X8KA 1A9XA 2C00A 3V34A 2PIDA 2Z8YA 3AG5A 1YF3A 1V35A 1PSWA 2RHCA 2W2OA 4MHOA 4PSDA 1E9DA 4ZT4A 1ZN9A 3IFSA 4DMRA 1OB5A 4LNAA 3U4GA 4ZI7A 1UJMA 4AP9A 1N5RA 3OC6A 5EIWA 4GS5A 2NO0A 5IG2A 4IHAA 4AY2A 3BK2A 3FWZA 4RMHA 2N75A 3WA6A 2YWCA 3C8HA 4C78A 4S12A 1R6BX 2FDXA 4RMIA 2CMHA 1KS9A 1W87A 5L7YA 2D1FA 1RZRD 2UVQA 1KJIA 1NE2A 3A28A 1PJ8A 5FWAA 4PXAA 2CF5A 4ZRMA 1RYFA 3WNDA 5LDDC 2C5FA 5AQEA 4JQOA 1E2QA 4DZZA 2W2KB 4AJ9A 1ZSYA 1C9MA 2O6LA 4EG0A 1JNXX 4NZMA 1YNOA 5EKXA 4JLMA 4D41A 3E8SA 4I55F 3VHXB 3BG5A 4IDGA 4FEEA 4CIDA 2XWBF 2J3IA 3EVAA 5CVJA 5I9SA 2I2WA 4REQA 5CEEA 2IBSA 5HYVA 1ND6A 4MA4A 2VAXA 1JHMA 1GTZA 2I78A 2ZI7A 1KL7A 2OXCA 3AF0A 4RQUA 2ETVA 3DDCA 5KVCA 1MU0A 1JI3A 4IF6A 4ARVA 1CQZA 1IRIA 1PZFA 2EZ9A 3BL6A 1IN4A 1ECLA 1NYLA 2E4ZA 1T0PA 4DIMA 1HDEA 1Z7YA 3PU6A 1G5IA 4LHEA 4V0RA 5B7QA 5DGCA 2AMLA 5KJ1A 4ACAA 4RESA 4HWSA 1VJGA 3ZCRA 3R40A 3RDPA 4ZI5A 4P3KA 4BVBA 1Z4NA 1MAHA 2CNKA 3DVLA 2WWYA 3R3UA 4WVFA 4D9EA 2DPGA 5IS2A 5KJ6A 4HQ6A 1VCHA 2IP2A 4WUTA 3ACDA 2I1WA 3U4QA 2NZYA 4TS4A 1DO8A 1K5HA 1KK1A 4WECA 2D5LA 2PS9A 4GDMA 4L4XA 4UHKA 4JFAA 4Y1FA 5FV4A 1EVYA 3CF4G 5AKHA 1JLLB 1HT2E 1CNFA 3QTTA 3IP3A 1M1XB 1WF6A 2P77A 1Z5VA 3I1FA 2D74A 2ONKA 3ICOA 1SQSA 3VYSB 3FUWA 1Z6AA 1SKBA 2HGSA 3AR2A 4PYNA 2YRFA 5DTEA 3V1TC 3UWMA 4EG3A 4KBYA 3RABA 5DIZA 4RSRA 1U98A 1O96A 2I6UA 2QR2A 4JLUA 5GJCA 2TECE 1DTSA 3IDFA 3LP5A 1ZH0A 2WMOB 6AT1A 3FBTA 3RK1A 4P7FA 2CEKA 2OQ2A 4K6MA 3RUDA 1WKCA 5H02A 2NUPB 4U7FA 3KJEA 3A0UA 1HV8A 4NK5A 3WIDA 4CLDA 4HC4A 1ZGBA 5BNIA 4QDOA 3GAZA 4L0DA 1TYBE 3D8UA 5CB4A 4GOKA 4YQEA 1S2DA 1V9SA 4W5JA 3FTPA 2GTIA 4U1RA 4WN3A 4E31A 3OH8A 2N0SA 2X4IA 5KYXA 4QOHA 4ARZA 4C89A 1NA5A 3U44B 3EVNA 4IOKA 1W1IA 4E51A 3W2FA 4F8JA 4GX2A 3K1AA 1ZCZA 3D5TA 3IPRA 3E53A 3O3OB 1V6AA 3QA9A 1GPLA 5F64A 3L7CA 3F4KA 3TLGB 4ADSG 4M4SA 4BBZA 4HNQA 4EY8A 5BP7A 3NW9A 3HN2A 4B9EA 1KEPA 4IH1A 1NQXA 1B3BA 3N0TA 1NC3A 2Y6VA 1SIOA 4GLFA 4MUGA 5KIAA 3O83A 3SQLA 4H18A 1N5LA 2NYRA 4LUCA 4GH5A 4MVJD 3W5VA 3ER8A 2FI1A 1E9FA 1QWSA 4YLGA 3SS7X 1JVNA 1GN8A 1P0FA 3K5HA 3H2SA 3FUTA 2ZB3A 1ISIA 3RT9A 4AM8A 5KAPA 2ZAMA 2WAAA 4ZHQF 3F4LA 4B6QA 4DRXA 1BCSB 1YVUA 1JFRA 2AJBA 1ARZA 2NAPA 1TECE 3AR8A 2NSYA 1JYFA 3CVOA 3O8QB 4X45A 5H8WA 1SHTX 2QHXA 1PDVA 3BXGA 5D3ZA 5BPHA 1LLUA 2W70A 3TVTA 1FTNA 3ETEA 4OLHA 5LQAA 1XBTA 1O0BA 1AZLA 1NX9A 4BQFA 4DLAA 4XDZA 4H7PA 1ZX1A 2P69A 1DQYA 4LJAA 1PT7A 2C42A 1JQAA 2BEUB 1GKIA 3STWA 3QUTA 3GJRA 4P7BA 2VHWA 2DBZA 3N2YA 1RP7A 2WKQA 1MLDA 2ZUSA 4JZKA 3HR4A 1IJKA 1QC5B 2I7CA 5DJ5A 1M73E 5CURA 1FYXA 4HUQB 4H15A 2PRSA 1KC1A 3I32A 2P9TA 3MUFA 5FV7A 3OUTA 2IUUA 4CKBA 4L7VA 3NI2A 3ROQA 1KK2A 4ENQA 2DJ5A 4NKRA 3FSRA 1B23P 2EQBA 5G53C 4FFSA 4MKIA 2ZZKA 4RSMA 1DG3A 4BGVA 1M6NA 4OHMA 2XTNA 2XUOA 3HDHA 1GPNA 3HV2A 3O0TA 5DLPA 1QZTA 1MOQA 1WHSA 3TSCA 3HACA 3CLVA 1FFSA 3FIUA 4P3OA 4IWYA 3A2LA 2A3RA 4YRPA 1RJFA 1WXXA 5EA2A 3VC1A 2D5AA 2ODQA 3GRAA 3ZW7A 4F11A 3KQLA 1QFZA 3NTQA 1EX1A 5DHRA 3ERCA 3G8DA 4L6CA 2H0QA 2LKCA 2LE0A 2ZJFA 3MS7A 3C8UA 3L40A 4PO8A 2HWWA 5HK8A 4ZIRA 1MRZA 2VNHA 3F7MA 2JC3A 4U9IS 5K3OA 4WKOA 2VTBA 2Q2OA 3OZBA 3I4FA 3D2CA 2ZDQA 3PEVA 1E79A 1ODJA 2VPZA 3KSUA 3LD9A 3R7LA 3B70A 4FB5A 2I5PO 1U63A 4BTLA 1W8DA 1VYHA 4DLPA 3HCRA 1C8VB 4M83A 3ZV6A 1IQPA 3DSRA 1RRVA 1ZOIA 2PBZA 2Q6OA 3OTIA 1CVRA 4ECAA 1B14A 2NVWA 4DUGA 2PDAA 1DKRA 1W5AA 3THXA 5ENDA 1E59A 2D7CA 2D62A 2NO6A 3IRVA 2F55A 1RP1A 3LMKA 4IJKA 2R1TA 1PEKE 1WLYA 3B78A 4BEJA 4CLHA 2BFDA 3M49A 4EH1A 1FUYB 1ZOOA 4GXRA 2YHBA 1UBNA 4GHWA 1KJZA 3FPCA 5EUBA 4E1BA 5CD1A 3FYTA 1KEEB 2CE7A 1H1LB 1XMPA 4NYMQ 3ITKA 1EDEA 2JKZA 4GBMA 4BO4A 4EPWA 1R0XA 2PFKA 3GZNA 2BM9A 1KIFA 4ZYXA 4CMIB 1EU1A 2O5CA 2Q2VA 5BW8A 3QKUA 5KX5F 1SXQA 2G06A 4OUDA 4L5JA 2JIPA 5KB3A 3C6YA 5KYUB 3ROZA 1W2GA 3W7VA 1NFRA 2QUKA 4RZSA 5CLIA 1CIJA 3FYDA 4QAJA 4UBJA 4ECEA 1TYAE 4QU5A 3RSFA 4KP7A 4YQYA 4M0CA 4IS3A 4CETA 2EARA 1I7NA 3LNTA 4IUYA 2CMGA 1YJCA 4YHBA 3SQOA 2R7KA 4YP0A 2WRZA 4MWDA 2FSIA 3RS0A 3KDPA 1N1MA 1SHUX 2JLZA 2CSUA 1RQGA 2HMTA 4N5LA 5AVZA 3U16A 1P9OA 2VVTA 2JK1A 1G291 2YNMA 2ZQ5A 3D7NA 2E48A 2J4DA 2VQSA 3OIUA 1L5OA 4CG1A 4R0MA 2I7VA 4Z7OB 3GELA 4OQDA 4F21A 3UNXA 4ZC1A 2AG8A 2WHPB 2QIPA 4LAFA 4C5AA 1IB6A 3TIGA 2HYDA 3UJNA 3DO6A 1IVYA 3B3AA 1GGHA 5K0BA 4KGVA 1KZ9A 2RHDA 1IOLA 1D9ZA 1N25A 2M98A 3E1KA 3PICA 3CMCO 2WB2A 4LF5B 2V7QA 4MAFA 3FA2A 2JGRA 4LVCA 2I6GA 1M54A 1NW9B 3G89A 4WJZA 1PT5A 3RRNA 1V1JA 1JG2A 2C3PA 4WXRA 2JLQA 5BY2A 4CDMA 4GPZA 1I7PA 4CIAA 1W581 1X9IA 4C0JA 4PCUA 4MO2A 3ZTWA 2HA3A 4RMNA 1EK2A 4Q4LA 3Q9SA 1JP7A 4FINA 1Z4LA 2Q7DA 5EZQA 2F64A 3AKEA 4J4TA 2WU3A 1A8PA 1N6PA 4X8LA 5H4GA 5IAOA 2WOOA 1TF5A 4CXMA 3W8DA 1NONA 4C29A 1QV9A 2I4RA 4NBKA 1H8ED 4MUFA 5FKJA 1R0LA 2Z9DA 1YUBA 2P0EA 4WKNA 4RPGA 5AW3A 3B5EA 4QDJA 1U3CA 3W8RA 3IUQA 5AVYA 5EJAA 2PQ6A 5CT8A 1SHLA 4P58A 2KMLA 3FYCA 4N8SA 2Q6IA 1D4AA 3FNFA 3ECAA 4J75A 2WHEA 1CRPA 4PO1A 4P3NA 1POWA 1SVKA 5DVZA 4R68A 1MRSA 4UUQA 5TPWA 2OHHA 4JC5A 3UQYS 5AUOB 2O2GA 1C3LA 2V03A 3LX6A 1AZWA 2H1OA 1MT3A 1WXEA 4DW8A 2LPMA 4I4TA 1ONOA 3R4CA 1LRLA 2QD2A 4JA0A 3FJ1A 4OJTA 5FL7D 4OK3A 3SE0A 5EIEA 3WLAA 4EYQA 1PUXA 2XZTA 1SKMA 4AKIA 1OLSB 1B00A 2C4KA 3AUJB 2OYCA 1QCCA 1CBUA 1YB1A 2PXXA 2BM1A 1JR4A 1JPUA 2ZAOA 3A37A 3L1HA 4G5FA 5T4EA 3RBAA 1SNYA 4FVTA 4EGSA 3VKGA 2YJZA 1GT91 1QH8A 2QSUA 5KHOC 2ALJA 4XR9A 4NMLA 2HMAA 3HA7A 3EBOA 4NI5A 1OAAA 4PX3A 1QOQB 1TL7C 3DPIA 3OF2A 3UENA 4ZCMA 4CI0B 5HJ7A 1C30B 1K6IA 2GAJA 3GBSA 2IYYA 1UH5A 2QYOA 1NUPA 2ZJ4A 5KJFA 3I92A 2I62A 3W7BA 1XRNA 4P4SB 1N2JA 4L08A 2O7SA 1Q1QA 4I8IA 3QPUA 3D8HA 4ML3A 4LS3A 5CR9A 1T43A 3CCFA 5F51A 4MGYR 1Z0UA 2E18A 3AF2A 3BHJA 2ZS9A 4B7ZA 3OEED 2Y1WA 3QWHA 1SXJA 1LSUA 2CDRA 2PJDA 3GVPA 3QKIA 5IULC 3M3DA 1EINA 3AY3A 1I0LA 3ROEA 3UWOA 1SCBA 1QVAA 3L0PA 4GT1A 4C03A 3KZ1E 2F7SA 2IV3A 2RC5A 2WZQA 1NR1A 3LK6A 4GWGA 5JV5A 3AX6A 1ABBA 5ALQA 3E5HA 1GKLA 3I0MA 2JIZA 4QXOA 3T6KA 3M9LA 2YQ5A 3VO2A 4BWGA 5CFZA 1H9CA 2I4IA 3GZJA 3THYB 3PT9A 4J2HA 4PCVA 4M3NA 1D4OA 4LVOA 3T5DA 2ACWA 3TAUA 3EIEA 3Q7SA 4RO0A 4K0KB 4Y2JA 1KYVA 4HRAA 4MQEA 1ORDA 2WV9A 1W5FA 3OIVA 3JWEA 4J7XA 3RLIA 1A77A 2FMUA 3QBTA 3A9VA 4LX8A 3TDNA 1X80B 1FRQA 3SSOA 2VNKA 2WSIA 4IL5A 3RG8A 3R5SA 1KORA 3SC2A 4CN8A 5KINB 3EDMA 3HKCB 4C7MA 1N9GB 3VJRA 1Q1GA 2QD5A 3LBHA 4X0EA 3UG7A 4MVJI 3HKBA 3WMRA 1UADA 3ESDA 3KVNA 3L02A 2O0MA 4HLNA 3CSDA 3I9V1 4HWGA 4Y9RA 1VBFA 1C9KA 1WXFA 3C3WA 4N1AA 5TMPA 3RQSA 3K70C 2QAIA 1IPEA 2CNNA 4EHJA 1MD9A 3LOPA 4YXWA 4GX0A 2XJ4A 3A26A 3C1TA 2YICA 3RRXA 1XZQA 2FWAA 1GEGA 3T7EA 3DOUA 3KAPA 4JU9A 5C8YA 2KW5A 5EXSA 1QAMA 3WSVA 4EQZA 2FPSA 4IGAA 3E5RA 3ISTA 3WK9A 2H1FA 4LQLA 3AR9A 3PCTA 8AT1A 4FN4A 2C98A 4MV7A 2LD4A 1N2BA 5B4UA 5ULLA 5IXSA 1PQUA 2FY8A 4WY2A 1P4RA 2C2MA 2GN2A 1J00A 2OXEA 3FOCA 1GFZA 2VFAA 1L8AA 2XYHA 3GL9A 2WU8A 4HXYA 4YMGA 5HXAA 5CDSA 4AY6A 1KQPA 2P2GA 1Y1TA 3F6SA 3WV4A 1Z06A 4CQLB 2Z2KA 3QKTA 1QJCA 1W1UA 3QE3A 1U6JA 2H63A 4EGAA 4FBMA 5JXHA 4HWRA 1RKXA 1N4DA 4YWHA 1EA5A 2PUFA 5FA6A 2NX2A 2WT9A 2ZI4A 1OWNA 3NS7A 4X20B 5JJ5A 4I7EA 1RWWA 1HFWA 3RJ5A 5JNTA 3K0HA 2ERYA 2PT6A 1FUKA 5C1PA 1XZJA 3GVHA 2J0EA 1PWYE 1ZUNB 4Q4HB 4UMDA 4ZO6A 5IJ9A 1JYEA 1WY7A 3MEQA 5IHXA 1YAJA 2ZEJA 2FZ4A 2YY6A 2LV8A 3KQYA 5D3KA 1F8XA 1C4WA 3ED5A 3GOHA 4YJKA 3P2JA 2YUTA 3T3MB 4UTVA 1BQ4A 1RC0A 1ACJA 1UJ6A 4YAWA 4IDHA 3B1JA 4A0HA 4DFDA 1N57A 1NJFA 3KWFA 3OMWA 2P5YA 3CXUA 3DOIA 2BMDA 3V4VB 3AIIA 5IK2A 1ID8A 4MQUA 3IESA 4A03A 4BNFA 2OOSA 2OFFA 2QM3A 2PQ0A 2QTNA 2PT5A 2O0JA 4D4GA 4LE0A 1M5RA 4OP2A 2OGWA 4DOMA 3D43A 1N5JA 1PEAA 3K96A 4MUIA 5K3EA 3FDXA 3PYXA 2WUVA 3NKVA 3W78A 4UOEA 1YSCA 3GRZA 2QRJA 1FMCA 3AY6A 3IDQA 3ZVLA 4RPIA 2DP4E 2YIVX 1Z13A 1A71A 1BS1A 1NBWB 4EO9A 1L4HA 4RV5A 4XTRA 5DN6D 1IBCA 4NBUA 4ZYTA 2DHDA 1WEHA 3D81A 4KLCA 3ROTA 1MZVA 2BFFA 2PH7A 1QO0D 3H9JA 4I1RA 3EIHA 4XA8A 4XIGS 3RRJA 3T4EA 5DX8A 2J8ZA 4J94A 4WFIA 4JBXA 4BPRA 5K3CA 3IP7A 2YJGA 1QBKC 4FMCB 2GPNA 5ABPA 2C4WA 3UAVA 4OLBA 4OI4A 1I1OA 3CINA 3QHPA 5DBHX 4YHHB 3SM9A 1NOKA 1FS6A 1XB2A 2G80A 2ZRQA 2O5EA 4J9VA 1XPUA 3IIEA 1OYWA 3LGXA 2PMFA 1SPBS 3BKXA 3R3ZA 2WAOA 4GBJA 3B7GA 4TQAA 5T3YA 3VZRA 5DNCA 3GLGE 5BVGA 2GM4A 1IM2A 1XRJA 3DBLA 2JJMA 4M60A 1NQ5A 1BKDR 2AJDA 1OCEA 3BXPA 4NJOA 1DJNA 4E2WA 5K8CA 2R25B 1IQUA 3II6X 3DEZA 2CLKB 3WGVA 1NXSA 3JYHA 4LE1A 1FS5A 1QYXA 3FTEA 2FHSA 4OH7A 1YR6A 1AO3A 3H7IA 3OQ1A 1WCYA 2Q46A 4RE6A 1I4WA 1WBDA 2B78A 4Z4GA 3MGCA 4W6QA 3FGNA 2NZVG 3D7KA 1KYXA 4R2KA 5C81A 2GK4A 4NDZA 3E1GA 3TLXA 4ZJYA 2QJWA 3GOQA 1JG1A 4ZMBA 4DXAA 1E58A 2HHJA 3JQGA 2VAWA 2VUHB 4FFVA 4HLCA 3FGPA 5LP6F 5G4LA 1YBHA 1RWXA 1TC1A 4HVCA 2GBGA 2RGAA 3PC4A 1P45A 2CLSA 1QFSA 2H4XA 5H82A 3DZKA 4JQZA 1Y4SA 2X58A 4F85A 4C2BA 1GILA 1RHUA 2XYGA 4QOIA 4O4HB 1CXZA 3ROPA 5LOVB 1E1LA 4JI0B 1FZQA 2JGJA 1CY7A 2QAGA 2GCOA 2DR3A 3J7TA 3R9KA 1A5TA 1XVVA 1JXMA 2Y66A 5BN5A 3BJRA 5LUAA 2Q0HA 3P19A 1YCGA 3HXMA 3BAFA 2C5GA 5BSUA 2AZ4A 4ZU3A 2O52A 4W9MC 4Q48A 4ZVOA 4MKFA 3WNZA 4YAIA 3W6PA 4C7KA 3LCUA 4M54A 1CUUA 5CD9A 3N2GA 4INPA 3HM9A 1NJGA 4IIEA 1EHIA 4AU1A 5AMXA 2LIPA 1YB6A 3H1BA 3ZU4A 2AJLI 2I3BA 1TTQB 4W7SA 1YXMA 4F4FA 1W4ZA 3WXBA 1DE0A 3RIGA 2JZCA 2UXDB 3L77A 5KYVA 1LQTA 2MTBA 3NUZA 3R6DA 1C1DA 4GI3A 2GD2A 2VQ3A 4J7UA 1A97A 3WJ2A 3TPFA 4WT7A 1SC1A 5J4HA 4KREA 4X94A 1JEQB 2AKEA 1JNYA 1UOPA 1Z6YA 1HA3A 1Q57A 1Z8NA 2Z5VA 4RNCA 4OXRA 5C0OE 4C88A 5HS4A 1K8XB 3KKMA 3OBBA 3PUIA 5TVKA 3K09C 1SBZA 4ZZ2A 3UZUA 2Y9MB 5PGMA 2NQTA 4BMXA 1SOAA 1RLJA 1N78A 2AJ8A 4DEYA 4KE6A 1E0SA 2HHHB 2W6NA 1KDTA 3Q9LA 4UBNA 1NMZA 3C3PA 3DKIA 4WLOA 4XEHA 2R0QC 4ZQBA 3WGLA 4FHFA 1N3IA 2BKEA 4RGVA 1B0PA 1U2ZA 2PD3A 4KV7A 4PQFA 4FCVA 3SKXA 3VPCA 3EXG1 1NFFA 1UK9A 2CWDA 4YALA 3GCWA 5LYJB 4RDHA 3T3PB 1RMQA 4FHGA 4UJ5A 1NQTA 5BUZA 4PX2A 1Z8FA 1F2UB 1S96A 2HMUA 3HM2A 3AKDA 1E9BA 1UBHS 4XOUA 4DADA 3NHJA 2QQGA 1Q12A 2D7JA 3AR7A 3AUUA 1VE5A 3JWHA 2DQZA 3M1YA 1JFSA 2JH9A 5DSXA 1JV2B 1L7MA 1W5SA 4O3FA 3FBGA 4LX0A 1NVUQ 3T4PA 1VB5A 3P4YA 4QUEA 4RKQA 3T3NA 5EIBC 2B30A 1F12A 3FPFA 4W1RA 2PXCA 2IPNA 3KLPX 4RHFA 3LM8A 4HDAA 4N9QA 4RABA 5L6LB 4I3HA 4BX2A 3R6WA 2C57A 2UZ3A 2RH4A 3LVQE 1CF2O 4B2YA 2FSVC 4ENTA 3SIPA 2WKRA 1JHDA 1BAPA 2NADA 3NASA 4GMKA 5CCDA 1XCJA 5CITA 3JQBA 4YV2A 4Z4EA 3EVDA 4O2AA 4HGQA 1FDTA 2JIDA 4WHMA 2J87A 3L04A 1D03A 2P30A 5LLDA 4A2QA 1C4KA 2CXUA 3KS9A 3SJUA 2KQUA 4JWTA 4D8UA 4CDRA 4ZCTA 2ZUEA 4KVAA 1LA2A 2YZMA 2C5EA 4PRYA 1TO6A 5DX1A 4P4NA 4HPWA 3RYFA 2RGCA 4AXXA 4DG5A 4OGFA 4H7HA 4QT0A 3DLBA 1HTWA 5KNLA 3R8XA 1BC5A 4F3KA 2AQ8A 4O8ZA 3ZTTA 4I3FA 5CA1B 1W4BA 1XL1A 4UOQA 1WW3A 5BOSB 3EXEB 5HPYB 2J3KA 2ORED 1UZMA 1Z4KA 1YDWA 2FPGB 5DNUA 2XAAA 1CIPA 3VGPA 4RF3A 1YJQA 4JY7A 2XGSA 4M9RA 3VKVA 2SCUB 1ZD4A 2FSVA 2ZIXB 3UOGA 4AUEA 1FLVA 1ZA2A 3PFHA 3Q98A 3WIBA 5AVUA 5LQDA 3ZHXA 5IJZA 3NJ8A 3R0ZA 2FPLA 3G9UA 3GUVA 3HBNA 3A6ZA 4MQ6A 4A0SA 5BNFA 5AKJA 3AONB 3FVQA 3C3BA 3HJHA 2AG0A 4S2UA 4XD2A 3RV3A 4N3AA 1W8IA 5HFJA 3KUKA 3CG0A 1LPPA 2A5JA 2OHIA 3DEJA 3E9CA 4HDMB 3WK4A 1SQ6A 4DM7A 4D0GA 5KSOA 3JAMA 4H7JA 3N53A 3AEQB 1N5DA 5GP1A 3HYTA 2H1LA 1A50B 3KFXA 3MGBA 3RLFA 3SBXA 4D8XA 3DAHA 1DQSA 3KSMA 4QM6A 1SQGA 2XQIA 4PN7A 5EJ9A 2XVYA 1TUGA 2QR5A 4HAVA 1TJ4A 2VYNA 5C4GB 1K4MA 4YMHA 1OF1A 4J4HA 2QRMA 1JQLB 1HZZC 3L5OA 5AVKA 4C07A 4E5DA 1D8TA 2FEPA 4EG7A 3OZDA 4R8SA 3MG9A 2JLXA 2PKEA 1TCBA 1U3TA 1NUAA 3O8OA 3HRHA 3ZVNA 1M34E 2E2WA 1M2WA 4N54A 4EBFA 1D5CA 3TIFA 1XVAA 2WKPA 4CCWA 3QY0A 2OVFA 3WYBA 1SFRA 1L7QA 2OQIA 3ET5A 1NI4B 3KK0A 3SR0A 5E3JA 4EJSB 1NXQA 1BGXT 3HNRA 4DSOA 1E7YA 1WB5A 2B61A 3C87A 1H2HA 4YMVA 4CFZA 1XEWX 2C96A 3GGSA 4HTFA 1I2ZA 4R51A 5JT1A 4OHFA 1JMYA 3L8DA 4F93B 4CUZA 1E77A 1Y37A 2Q3DA 3N7AA 3QFTA 4HDQB 4Y6QA 4BX3A 1IMOA 3T5GA 2ATCA 1C2TA 4EELA 3AR4A 4XM1A 1DDOA 1NJ6A 1VBKA 3R3HA 4TV9A 3B48A 3FB4A 3WE7A 1WEKA 2I55A 2EFGA 2XVMA 3K5WA 4JWKA 5HZGA 2Y4NA 4LMBA 1ZW1A 1XQWA 1HDGO 3FHOA 1KTVA 4Q7LA 3D4LA 2VEDA 4G1BA 5D5PA 1ZP6A 3T1NA 2P8SA 2FP4A 1CDDA 1Y6QA 2IF2A 2O8VA 2OBLA 1SK8A 5KTSA 4HZGA 4HNSA 4B4OA 2G07A 2HLDA 2QNRA 3F2IA 3OM1A 3E3NA 1I1NA 3L1UA 5KNBD 2GOYA 5AK5A 5L40A 1N6OA 2C77A 3Q1KA 4HX9A 3WNVA 5KQMA 2Z0MA 3H2IA 1U2SA 4EVRA 2JHCA 3GJ7A 2O9JA 4B35A 1Q92A 3GFQA 2OHGA 4HDRA 4WN9A 4BKUA 1REQA 2G77B 3DDNA 3P9ZA 4YTEA 3U81A 2WF8A 3VTAA 1R0YA 1EVKA 4HDKA 4QJ3A 3H04A 3V42A 1VMAA 2FX2A 1HYGA 5DYGA 1DXHA 1EJ0A 1T5LA 4J76A 4D80A 1R0KA 1RFGE 4DDUA 1OFUA 1W36D 1OKKD 4IZOA 4DR4B 1EQAA 2XTMA 3T5PA 5DU2A 5EJ6A 2WEKA 3ENQA 4ARIA 2G1KA 2HNBA 4AICA 4LGCA 1E4EB 1HH4A 1SCNE 2ZTLA 1OU0A 3LX5A 5FTMA 4IJVA 5TEWA 1CLUA 1VTKA 2HL6A 3ZE9A 1W52X 1V0JA 4KX5A 2ZJ7A 4NYJR 3T95A 3NBKA 3LF1A 3LQKA 5ALZA 2X13A 4C1BA 1UPCA 3D0QA 4GM1A 4LXGA 3HS3A 4UNRA 5LJIA 2B1JA 2WYIA 1VSTA 3DE4X 1AXRA 1P5RA 2QTVA 4MVJE 1JXAA 2AKYA 2JLRA 1BGWA 1O9BA 3DMNA 4L2IA 4OSPA 3TNJA 3C7CB 3DOJA 5LU8A 2HGZA 2UXCB 2RAPA 1Q84A 1PL7A 3PX3A 2D1RA 1J9GA 1ENYA 2EGGA 2L82A 4PSUA 4YYEA 2NVOA 1ADJA 2X8JB 4V0NA 1C14A 3EGXB 5G0SA 4L4RA 5KQRA 1XTBA 1AY0A 1TB4A 2M32A 5DN9A 4LF4B 5HDQA 4LCBA 3MMZA 5FUVA 4DLNA 5E8RA 3DKKA 5DE3A 3KHKA 4BLVA 4TKLA 1O95C 4A8JA 4EI7A 1CJTC 2QTLA 4B6FA 4BXOB 1QLWA 2OAGA 5IDVA 2BGKA 4KTTE 4RKEA 3VNVA 1BW9A 1JEAA 5BSMA 1A7AA 4NICA 3U2QA 4CEIA 4GPAA 4EFLA 2A94A 2O1WA 5BNZA 3WMWA 5JSZA 4BX0A 2VHEA 3OICA 2DTDA 1YFLA 4KPYA 1LGYA 3CRVA 3REOA 1V7CA 1E20A 3HI6A 4YB8A 3RB8A 2FEAA 3L7JA 2H06A 1UBRS 2IW3A 2RH9B 2E55A 1Q0TA 5A04A 4AO7A 3GI1A 3PEYA 1F0KA 2XITA 2X86A 2XODA 2P62A 3EC1A 3HBFA 4O2BA 1CSEE 4LN1A 5CPBA 5E1BA 1C41A 4BO9A 2VR1A 1GIAA 4LV8B 4BZWA 1QLHA 1EJ2A 2OORC 2VF7A 2W6CX 3O1LA 4PX9A 1JDZA 1GGMA 1J21A 2CYCA 1XG5A 5DM1A 4CR8A 1DT3A 2KBEA 2O3UA 1PGOA 3RVBA 1YRLA 2V7EA 4UAUA 4DL9A 4S3MA 1XCPA 1RHKA 4CQNA 2JGDA 4QHYA 4DSTA 4U3JA 4TWBA 3ZGVA 1I7SB 2EW2A 3DHWC 1B42A 2EW1A 1D07A 5EZYA 2D8AA 3I4CA 1CC1S 5I9MA 2WJ6A 1VRWA 5BV0A 3ZCTA 1SHZA 3FGZA 3SYRA 5KWEA 1D2HA 1LZLA 2GKSA 3DAFA 3MTBA 3LQQA 4BGUA 3G17A 4KWIA 1I14A 2R7NA 1FP4A 2RCNA 5DMHA 4KRFA 3BDIA 3VV3A 2VT3A 2FPRA 4B3BA 2JBHA 3KQKA 1JL3A 3N07A 1BVHA 1J07A 3FFTA 4ZCLA 2O2JA 4K8OA 1TZ2A 3KD2A 1NL3A 3CZAA 4DCTA 3B51X 4ZOAA 3BGOS 3CF6R 3NGLA 2EJTA 2BJVA 3PUZA 4DABA 1U0SY 3AIKA 2QM7A 4JYCA 2EWMA 2GLTA 4RMJA 4RZUA 1Q0HA 1UMCB 1F3LA 2NZUG 4CLRA 4PYIA 2EGUA 2C9YA 2XB6A 2A0YA 1USIA 3QMMA 3QOWA 3FH0A 4R1SA 4NJEB 1X1RA 3WLNA 2Q8PA 1FYFA 4KHPB 1VG8A 2EXXA 1BE1A 3D2LA 2RG7A 2HC9A 4GPBA 5E1OA 2B6HA 1EZ4A 5B6IA 1R27A 3F5FA 4WXYB 5EP1A 2H4ZA 2AXQA 4RHTA 2Q5QA 5ALXA 1A2BA 3CPSA 3QEBZ 2AOTB 1OIWA 2PCJA 2V0NA 5LDGA 1MXFA 2A92A 5JS1A 1QRRA 2CWWA 4I55B 4JI3B 4UCFA 1ZHFA 1PV2A 5JLAA 5BQ5A 2ZJ5A 5FPPA 5LMCA 3X1KA 1W85B 2DWQA 3F9RA 5ALPA 4B80A 4U2EA 4HFJA 1N0WA 1OH7A 4FK8A 1EXNA 3EUEA 3S8MA 2VYVD 3CNBA 3P32A 4BV8A 1TCVA 3GLGA 4HB3A 3CEMA 3PUJA 3DFZA 4IO0A 5LWQA 5CCXA 4MR7A 5CLFA 3ONEA 3KLNA 3OMLA 1J90A 3EZGA 4DIUA 2PAFA 4A2WA 1YT5A 1AKYA 3GN1A 4DNFA 4QWWA 3RARA 3K53A 2G82A 2PYZA 3RIEA 4ARSA 2JBWA 1N32B 4MI9A 1GOTA 4R8KA 4LYEA 1OLUB 1U5AA 1ZGGA 1I4DD 2ZFUA 2JZNA 4MR8A 4N03A 3U3DA 1I4LD 3W2IA 3UFXA 1RQNA 1VL8A 3WB2A 4DUPA 5KQSA 4UBKA 3IVRA 1OZAA 1KGDA 1GM5A 1J5EB 1MOPA 2G9QA 2HU2A 3IEXA 3AI2A 2NUAB 3NOOA 3LX4A 3FYUC 1AA6A 4G0VA 2FLVA 3RSOA 4MCHA 5I48A 5K51A 2WF9A 2DHQA 1I0IA 1KQ3A 1LTQA 3BRSA 1ML4A 2LVBA 4WY5A 5ILGA 5JE8A 3ZI7A 6Q21A 2EDAA 4FKMA 5KQLA 2CMDA 1RCTE 3FNQA 3F96A 2G67A 4JQSA 3WQRA 3UHOA 3N0WA 4FMBB 1JILA 1W4CA 4NS1A 2AD5A 4BZXA 2EU8A 2BDEA 2WG1A 1PR6A 2JASA 3FKSA 4PSKA 4AG5A 4G4JA 4L7QA 4W5OA 2P68A 3ON5A 4AD8A 2J3LA 5A03A 3KNZA 1DV1A 1L5LA 4AKTA 1PQPA 2NO9A 1TZCA 4RD0A 4QZVA 3VOAA 1YL6A 4TRJA 3VOTA 4XVCA 4EKEA 4YX9A 2WTEA 2DETA 4WV3A 4XFJA 2JVIA 4BRUA 4DSZA 2A67A 4Z7NB 1KOFA 3MRVA 4B3TB 2Q4RA 4HDNA 2JF0A 1A8QA 3HJRA 3TFOA 4FS3A 3JASB 2YRWA 1DX9A 3L0CA 3ZUGA 1Y9ZA 1NYQA 5IRCD 3NVMB 2JLVA 4DC0A 1G7CA 4LJ9A 2IYNA 3WKAA 2ENUA 3HLTA 1L7PA 2JI4A 3PCRB 3QM1A 4YIHA 2ZIWB 5EMMA 4KDFA 2XWSA 3WO1A 3EOBI 3GG2A 3FLEA 1MA3A 3WP0A 2VNIA 4V1CI 3GFSA 4D8VA 4GQBA 2O06A 1PL6A 5LB4A 5ELXA 1I7DA 1PG5A 1CVIA 3DBHA 4NECA 3WL4A 4B44A 4IXDA 5AW6A 2NVUA 2PGAA 5AJZA 2N46A 3BWCA 4BQQA 1SHKA 3RS2A 4KLAA 2A35A 5BV2P 4KYVA 3H8JA 3BQMB 1N77A 1CB7A 4NSNA 1ZZEA 4ZHQB 1P1IA 2CDAA 4IIFA 4KPUA 3HU5A 5CG1A 3OZEA 3DE6X 3SQNA 4B7XA 3PHHA 3CEAA 4GQIA 5CLJA 3BWXA 1KJQA 4TKMA 4GMHA 4ND7A 2R2GA 1MKYA 1DC8A 3H9QA 3MLAA 4S0ZA 2AN1A 4KXXA 4A0FA 5BR8B 3KU4A 3NDJA 5ESXA 1UBUS 1EPUA 3DKVA 2V45A 3GROA 1P7VA 3RYIB 2PWPA 1DADA 1E2FA 1KI6A 1X2EA 2PYDA 4ITVA 1RFLA 2BRUC 4TV8A 3ZWPA 5LQCA 3DONA 1P4GA 3GH3A 2UAGA 1JIUA 2F4VB 4C6SA 5DT9A 5E9JA 2CCGA 4F8YA 3GT4A 2AS0A 4AJPA 2Q99A 1NJ5A 1WDTA 4Z2AA 1EVJA 1UWVA 5TPZD 2DUNA 3GHHA 2QJTA 1N2GA 2ZRCA 1AKRA 1M76A 1TTHA 2WJAA 1XQ6A 3IBCA 3O2NA 4LDRA 4FI3C 4ERXA 1ZLXA 1KEWA 1YBAA 3M1AA 4BJ6A 2EFJA 4QYMA 3GUZA 5IWCA 3HRIA 3ADPA 1YDGA 3C8ZA 2V58A 5JNVA 1M2OB 2O4UX 4R9VA 1GJRA 3FFWA 1B6SA 2FFRA 5CM2Z 1T2EA 3WGOA 5AW0A 1IXKA 1DC3A 5JS7A 3W5DA 3QKRA 4D9JA 1NBEA 4EF5A 3SJZA 3O84A 4RPJA 2G3YA 3SPXA 3WL8A 1KZGB 1P6QA 1DOHA 1YACA 4WESA 1II8A 3N2KA 4LWOA 5JDIA 3K20A 4MCIA 4OHXA 2JCXA 3VNSA 5BWOA 4HSEA 4NPHA 4MPPA 3HZOA 4EZIA 4FQ5A 2IY8A 1XPJA 2IC5A 3OU6A 1XDSA 4QXAA 4WZBE 4L85A 3RJTA 4JJ6A 4PU0A 1ZI8A 4GP9A 1W0JD 4WY8A 3HWSA 4NENB 4C7XA 3GLFA 1VI6A 3HYSA 2MIIA 4Q7KA 1KY3A 5ADVA 1NP3A 2GPTA 2Y1LA 1PGNA 3IELA 2VHVA 4M53A 3DGEC 1M2NA 4IFTA 2B0JA 4MLCA 1DRUA 1SY7A 1R4NB 1VL6A 4X7RA 3SYKA 4B09A 4ZCIA 2G8NA 5I7RA 1KIMA 1FEZA 3FI9A 1L7EA 3NHZA 3I04M 1RPAA 3E5MA 3KL2A 4ND4A 2ZSJA 5H9WA 3GGCA 1U3WA 4JJZA 3D3NA 4AS1A 4M22A 3RVSA 3KJGA 1SD5A 4EKIA 2IF0A 3I3SR 1K8YB 3PJRA 5JW6A 3UCFA 2YJNA 2P2ZA 3EVBA 1XPRA 2VZEA 5KX5B 4AZSA 5B55A 4HDCA 5MHTA 1JHOA 4M0DA 5IARA 5C4MA 2X40A 5CB0A 1A9RA 2YW9A 3U6KA 4UBMA 3KXKA 1L5ZA 2W2NA 4TXMA 1U8EA 3JRNA 3N39C 3ZIAD 1M33A 5HKLA 1Z3IX 3N8HA 4GKJB 2RJOA 4TTQA 5JZVA 1TCCA 3NEJA 3WA7A 2I66A 3LHIA 3M6VA 1MEEA 4W1PA 4M88A 2UVPB 3M6XA 4FFBA 3KKKA 5C8ZA 4KCGA 1X86B 1T1IA 1Y5IA 2YHSA 3KEFA 2ZYTX 2VDJA 4JYPA 3WY9A 4B76A 3IKJA 2CSXA 3AI1A 3CUSA 3WRXC 3KETA 3P0IA 3TNFA 2YMPA 1KSGA 5FT9A 3V2GA 1ZM2A 2PL9A 3JD2A 2F2TA 4A23A 1H6CA 2JRLA 2ACEA 4JHLA 1XU9A 2GBLA 2IKSA 2W4IA 3DYBA 1O0CA 3COVA 5E7MA 3GJ6A 5MN4A 2GDZA 1ZC4A 1LCIA 1TM2A 2Q9UA 4LJSA 1TZMA 1EUDB 2IEIA 3G2JA 1NVAA 3G3EA 4Y2PA 5DEOA 4CG3A 4CT5A 1RBQA 4MR9A 1YS6A 3HKDA 1KHTA 1GXSA 1MIOB 4H3VA 1Q7RA 2BELA 1L2TA 1JJAA 4B8ZA 2QR3A 3GFBA 2ORIA 3L6DA 4MRMA 3MJDA 4Y1RA 1WMSA 3EF0A 4CV2A 3CISA 1EX6A 3I9MA 4GL2A 2QG9A 2CN1A 2I1QA 1RDFA 4MSUA 2VT7A 5ENVA 1AS3A 1FX0B 4KO4S 1ZVJA 3RFCA 3C6XA 2BMEA 3V55A 2QUHA 3OE1A 2P9JA 2CNBA 4TLCA 3VVCA 2DERA 3M6AA 2G9UA 2PQ2A 3DTTA 3R24A 3VHRA 1K7CA 1PWXA 4TMWA 5HBGA 4EHFA 3EF3A 1U2RA 4YLYA 1GUBA 2C88A 2V6IA 1A4UA 4IHJF 1OJLA 4YRDA 5C3MA 2HIAA 5D6OA 3WK8A 4BQNA 2DUUA 2R6DA 3I2KA 1B0AA 2DBVO 4JC0A 4WERA 5KYKA 3U60B 1LRKA 1HE3A 3UJPA 3OTHA 3KTAB 3VRHA 1K27A 2ZREA 1PDWA 3LC7O 2PX6A 1USWA 1R0CA 4UNPA 3QLJA 1S4MA 4XCQA 4IS2A 2DTEA 3KQPA 3LT5A 2JFQA 4DLRA 1SG6A 1WZIA 1CLEA 2VPIA 2Y0PA 2FR8A 4Z54A 1HKUA 1P73A 1RYEA 4J0DA 1JKXA 1N2ZA 4K9LA 3HCWA 1IBMB 1G5PA 2P1DA 1L5HB 2QDXA 1SOVA 1CCWA 2KYRA 4J91A 3ZIUA 4EUSA 1EXVA 4ZVMA 3EEFA 2H1WA 3OJWA 5IP5A 3DE0X 3O3CA 3LQ4A 3H84A 4RVGA 1S9HA 3P20A 1JDNA 1NMSA 3UGKA 5JATA 3DH0A 4G81A 2ZWVA 1GLGA 2BONA 4HYEA 4NCJA 2RE8A 4FWBA 1GG5A 4RD3A 3F78A 1XTTA 3PR3A 3MMXA 1DP4A 5GM1A 5JR3A 3QZUA 3JZAA 4HNAA 4UCWA 1OTHA 2Z9BA 2CYBA 3AESB 4L3OA 4OB8A 4X9XA 5KTKA 1QRTA 4MH0R 5DTIA 1E62A 1AB5A 2YJ4A 2FN9A 3AILA 3Q2IA 4ZI3A 2R1ZA 3D2BA 2C95A 1CP2A 4UM9B 2YV3A 1Q7BA 1H65A 2O5VA 3DPSA 4MUYA 4UZEA 3PA6A 3WL5A 4AX4A 2JLWA 5ICMA 1RJDA 2B35A 5CTAA 2RH8A 3KOOA 4GX1A 4TPKA 4IYJA 3C41J 2XNJA 4AKHA 2J4FA 1N0VC 1FTGA 1DBWA 2RGDA 1JB9A 2R6ZA 4ZVTA 3KUXA 4L74A 4P6VF 2DMRA 2SBTA 3D4BA 4JBHA 4BUCA 1IMJA 3HCPA 4XB1A 1I2MA 4BRZA 5CJJA 4RV9A 3FLMA 2E49A 3PNQA 3QLUA 3S44A 2BM8A 4HPJB 4L9RA 3TLKA 5J23A 3EEYA 1YI8A 2W6JD 1QTRA 3T3HA 3WYGA 1QOZA 4QYWA 2G0AA 4M98A 1XOIA 4YI5A 4BNHA 4YCSA 3ORFA 1NUUA 4U5QA 5DCWA 5M29A 1LC3A 1RYDA 2FPUA 2P2DA 1DIHA 2OBYA 5JJLA 4R5HA 1NF3A 1NM5C 3D3QA 4QBHA 3H1PA 4KVZA 2BMFA 1HE5A 2ACVA 3T7AA 2QP9X 1U3FA 5GJVC 3MTGA 3S2IA 3QX3A 4AZ0A 3T5MA 1APBA 1EVIA 3A9WA 2ZRKA 3EWSA 4UFNA 4YUZA 1Q91A 2DVMA 3WAJA 3H1FA 5DI3B 1YZ3A 2IOQA 2V7XA 3UQZA 4MS4B 3S5JA 3W5UA 4Q9NA 3AC0A 2FSHA 4ZQIA 4XD7A 4NH4A 1DKOA 1EWTA 1Q0QA 2XRYA 3KV3O 3WNQA 2IVZA 2FZKA 4FWIB 1ESZA 4IEIA 1B2LA 1STOA 1KK0A 2BGUA 3A32A 3CNLA 3N9IA 3ICCA 5HQTA 3FPHA 2X0FA 1AKEA 3H9GA 4PIVA 1L5YA 1AA9A 2G4CA 2GPBA 2BFCA 2BF4A 3R0QA 2YMLA 1IBRA 2Z5FA 4DC1A 1BH2A 5JHGB 3N6XA 4HLUC </