5DKFA

Reaction of phosphorylated chey with imidazole 3 of 3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein CheY
publication title Imidazole as a Small Molecule Analogue in Two-Component Signal Transduction.
pubmed doi rcsb
source organism Escherichia coli o157:h7
molecule tags Metal binding protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dkfA00
2R48A 3I09A 4W5QA 2NT4A 2MYNA 3K9CA 1Z16A 1JLKA 3OMXA 4CBVA 4FE4A 4O1HA 3ROFA 3HO1A 1C0EA 3CFYA 4P98A 1EWTA 3QLVA 1GCAA 2OENG 1NATA 5E3JA 3O74A 1KMIY 2JB9A 3TX6A 4MGEA 1DCMA 3N0RA 1ZY2A 2GKGA 4EYKA 3HXMA 5DGCA 3ROTA 3H5IA 3OO0A 3N0XA 1TJYA 1QP0A 3JPWA 5JS1A 3CNBA 4PYRA 4EYQA 3NNNA 1Z18A 4RS3A 1LJLA 3NNSA 4D6YA 4YO7A 1RXIA 4YGXB 5JNUA 4MS3B 3EULA 1RPJA 4H3KB 1EFAA 3P9YA 4RSMA 1DBWA 1U2PA 2FKAA 2QVGA 3BRQA 4YRZA 1VPWA 2PE5A 2RJOA 5DCLA 2PMCA 2GI4A 1A04A 3QX9A 3RVMA 2PUGA 1FFWA 1P6UA 4RY9A 1NXPA 2DRIA 1QO0A 2MYUA 1DJMA 4ZMRA 4YWHA 3MM4A 4QYWA 1AB6A 4OBBA 3IPAA 4PEVA 4G0ZA 4E7PA 3HM9A 3UKJA 5JNWA 5CNIA 1A0OA 4KRFA 2A9PA 1MB3A 3CHYA 3RH0A 1JFTA 2H0AA 3C3WA 3KYJB 3CZ5A 5IEBA 4F8JA 1PEAA 1LBHA 3NBMA 2R4QA 2NZVG 4RZSA 5KC9A 2QU7A 5HM6A 2HQOA 3A3KA 4ML3A 3MIZA 1GUBA 4LE2A 5T7BA 1D5WA 3GYBA 3Q15C 4RV5A 1LBIA 4DN6A 2FW0A 3C3MA 3HEBA 4MS3A 5FWXA 2QR3A 4WT7A 2N9UA 2E4UA 6ABPA 1KRXA 4XARA 2W42A 1BA2A 4IF4A 3KG2A 3CZCA 3O75A 1JFVA 2I6FA 3FDFA 3HV2A 2M1ZA 1T34A 1URPA 4RKQA 2RJNA 5TPZD 3OLWA 4KMRA 3GRCA 1RZRD 3D8UA 1MAVA 3DBIA 1ABEA 1E2BA 4DADA 4KV7A 3OM0A 4RK0A 2PUFA 4L85A 3BREA 4MLCA 5GQSA 2MYPA 3CG0A 1VRVA 4KREA 3CG4A 3OLVA 4G86A 1CHNA 1XHEA 4IMJB 3LKBA 1TM2A 1DBQA 1JDNA 5TPWB 3GBPA 3Q7RA 5BR1A 8ABPA 4MRMB 3H75A 1E6MA 5I4CA 1NXVA 2WWVD 1U2QA 3IP9A 3R0JA 1Z26A 1DBPA 2A9QA 5KWSA 2IPAB 1YTUA 2YHBA 4Z9BA 1YK0A 2VYCA 1TVMA 1NXTA 2IYNA 3HK2A 1W25A 3LUKA 4Z9AA 4YS6A 4Z4EA 1DCKA 3N75A 2HSGA 2Q5CA 4IMIB 2FMIA 5FBHA 5EWJB 4S05A 5B3JA 4NICA 2IPLA 2JBAB 5TE9A 5FWYA 3TB6A 4Q7EA 5BQ3A 3LKVA 3HDGA 1NXXA 3MF4A 3MMNA 4N03A 3DGFC 5HSGA 1M2FA 3OQOA 4Z4HA 4OATA 5IC5A 5DKFA 1ZN2A 2IDMA 2GX6A 3LUAA 4JA2A 3MA0A 3Q7SA 1TMYA 1D1PA 5KI6A 2OQRA 2FEPA 3M9WA 1Z2EA 1DZ3A 5TPWA 1EWKA 3RVKA 5IUJC 4MRMA 1NTRA 4ZMSA 4RK1A 5D2CA 1QMPA 4Z4CA 4W5OA 1GUDA 4PICA 5JNRA 4N41A 4TLLB 3IP7A 1U0SY 1FQWA 1PUXA 2L18A 3GT7A 5JNVA 1ZDMA 2NUBA 4OLBA 4MR7B 1FFGA 1NXOA 3TMYA 4B09A 2CWDA 2E4WA 2IPMA 1LK0A 1MVOA 3GV0A 3KYIB 5HQJA 3LUCA 3LOPA 4JAVC 2IKSA 1RXEA 2ID7A 2CD7A 1DG9A 3Q41A 5EWJA 4EYGA 1UDRA 3CRNA 4HNQA 2JBAA 3H5WA 3ILYA 3JTEA 3LUFA 3QK7A 1YS6A 3F7NA 3KCNA 4ZPJA 3H6HA 2WMYA 4RY0A 3OM1A 3KHTA 1ZH2A 2FTKE 3C97A 1XHFA 2PL1A 3GWGA 4DQDA 1AB5A 1JL3A 4GNRA 2O20A 3A10A 1DRJA 3GA5A 3SG0A 3H1GA 3URMA 4G97A 4YR7A 4OLAA 2BGGA 2LP4Y 2B1JA 3LUGA 3T38A 3RVPA 1D2AA 1TLFA 4WWHA 1GLGA 4IRXA 3CU5A 4Z99A 3L6UA 3D02A 1JYFA 2PUCA 4MR7A 4F12A 3UUGA 1ZESA 4H60A 2QW1A 4YV7A 4G0XA 1NXSA 1NXWA 4MS4B 5IEJA 5F64A 2AYXA 1QP4A 2R47A 5ABPA 4F3TA 2L2QA 2E4YA 4FE7A 4N47A 2WB4A 3QLUC 3T95A 5EWMB 4HNSA 3DZDA 4EY3A 2NZUG 1SXHA 3NHZA 3O2JA 4QYMA 2IPNA 3I45A 3TO5A 3JPYA 4MLDA 3HJFA 3O21A 5CNKA 2LUOA 2PUEA 4XLTA 2KYRA 4W5TA 1PNRA 1QQAA 5BRJA 3IDOA 3SQNA 1Z2DA 5IUNC 1U04A 3GBVA 1K68A 3RVSA 1APBA 1JX6A 1ZHHA 1JF8A 2PUBA 3H5VA 1M2EA 1XWWA 2FSPA 4WXEA 1IIBA 4XAQA 4ETMA 5JNSA 2F8TA 1DP4A 4W5RA 1JWLA 3H5TA 3KJXA 5EWLB 1USKA 2HQRA 3N0WA 1D4ZA 1DCFA 3DLHA 2YHAA 3QLVC 4JP1A 4MS4A 2FQXA 1ZVVA 3H6GA 3Q7TA 2JK1A 1ZGGA 3H1EA 4TLMB 5HKOA 4HYEA 4NV3A 1QQBA 1GCGA 5EWMA 1SD5A 2WJWA 3HDVA 2XDYA 4LDAA 1QP7A 4D6XA 2LBPA 4XFKA 3OLYA 4MQFB 2F8SA 3O1JC 2FN8A 2QXYA 2FQWA 3HUUA 4JASB 4ZJPA 1ZGZA 4XASA 3CKMA 6CHYA 3EGCA 3O1IC 3HCWA 4TMYA 2E4ZA 4KVFA 4YCSA 1JFSA 4JB0A 1F4VA 4RY8A 2GBPA 2GWRA 4RKRA 3G1WA 3HSYA 3MYYA 1JYEA 3CS3A 4EYOA 3FFXA 2FLKA 3SNKA 1YIOA 2MSLA 4EVSA 5C5EA 1BVHA 2NT3A 5EWLA 1YMUA 1P6QA 3RVLA 1EHCA 1A2OA 3E61A 3S99A 4LX8A 4Q6BA 1J56A 3O2QB 4MQEB 2WY2D 4LE1A 1M5UA 3A0UA 2TMYA 3N6VA 2LPMA 3N53A 4ZYLA 2A9RA 3BILA 2X7XA 3RVQA 3OQMA 4RWEA 2ID9A 5TPZA 2QVCA 2R25B 2PLNA 4Q6WA 1RZRA 3EQ2A 1DC8A 3FGZA 4MQFA 3I5AA 1JHZA 2FXIA 3QLUA 1C4WA 3T6KA 5ED4A 4E7OA 2FMHA 1SXIA 3QEKA 1QO0D 3BBLA 1F51E 5TQJA 2HPHA 1USIA 4LRQA 5CHYA 5JS2A 5GOTA 4KZKA 1ZITA 4ETIA 1RNLA 1LJUA 2M98A 3DLBA 1SRRA 4Z4GA 1OXKB 3KS9A 3QEMB 4D74A 4WXMA 4RXMA 5FBKA 5KC8A 1SXGA 4ETNA 4YP9A 4LE0A 2WRZA 3HUTA 4KQ9A 4MQEA 3IP6A 5PNTA 4H3HB 4OG2A 1QKKA 2AYZA 3QX8A 1FSPA 4RXTA 2B4AA 3F6CA 4N76A 1BDJA 1ZH4A 3C6QA 2CHFA 3HS3A 4KK3A 1YMVA 3HZHA 4PZ0A 2PAFA 1CEYA 1W9HA 1QNLA 2FLWA 3LUHA 4XXHA 5KQMA 2J48A 4RDCA 5TQ0B 3VNBA 1FFSA 2IOYA 3LUDA 2CHEA 2HJ9A 3FFWA 1ABFA 1USGA 3OMWA 3SAJA 1DC7A 4W5NA 3DGEC 1PNTA 2PUDA 4KFCA 4LZLA 3KLNA 2JCGA 1E6KA 5IUKC 2L19A 3JVDA 4TN5A 3F73A 3E3MA 4Y9TA 2QZJA 5FWXB 4Z4FA 5IX8A 1WETA 4GPAA 5IBQA 3UK0A 5T3YA 3QEMA 5B3JC 2FN9A 1BAPA 5CNMA 1CYEA 3O1HB 2FVYA 4MS1B 4JB2A 4KK4A 2JVJA 4YLEA 2RGYA 4S04A 1M5TA 4IGAA 2FEKA 4WZZA 1KRWA 1B00A 4O5AA 3VNAA 3L49A 1Z12A 3GL9A 3O2SB 1Z13A 3H5OA 3I42A 3IPCA 2FEWB 1MB0A 2H3HA 4G0QA 1YK1A 3EQZA 1PEYA 3EODA 3F6PA 3KSMA 1EAYA 4LDZA 5TQ0A 2A9OA 2WJAA 4IILA 5DLEA 3QELB 3K4HA 3N8IA 1NY5A 4N0QA 1P2FA 4UHKA 3HVRA 2JVKA 4RU1A 4KPYA 3FMVA 3JVIA 3M6MD 2LIVA 4KNYA 1R8JA 9ABPA 3LMKA 3EJWA 3EAFA 1BDHA 4N0PA 2FMKA 1YVUA 3A0RB 4RK5A 4O1IA 4EVQA 3RVNA 5KQPA 5TQ2B 3TD9A 2PJUA 3CTPA 3T8YA 1QPZA 3QLTA 1I3CA 1D1QA 3NNDA 4G0PA 1VKRA 4MR9B 3SY8A 1VLZA 4EVRA 3JS5A 1OXBB 4MS1A 1L5ZA 3ILHA 5C5CA 1KGSA 5BRAA 2JRLA 2L17A 3EDCA 4G0YA 4G0OA 5FWYB 1ISRA 1MIHA 2MYTA 4MYRA 2VK2A 5KQGA 2MSWA 3B2NA 4FB4A 1JH9A 4F06A 4MR8B 4KQCA 4MAAA 3M9XA 3RQIA 4NCAA 2V0NA 5KQLA 1Z17A 1EWVA 4QPJC 4NCBA 1S8NA 3LUJA 5DTEA 3G85A 1E6LA 4Z4IA 1ZAYA 3QELA 4F11A 2ZAYA 2E4XA 2PUAA 3FFTA 4MPTA 5CNJA 2P9HA 1Z15A 2VUIB 1YS7A 3IP5A 4JOQA 3LFTA 3H5LA 3KKEA 3MQ4A 1P8AA 2E4VA 1PHRA 3OLXA 1HEYA 4G0MA 4EUKA 2QV0A 3LTEA 5TQ2A 1Y1LA 4Z0NA 3W9SA 2MSKA 4RK6A 4RXUA 2JVIA 2FMFA 1L5YA 4MR9A 3RVRA 3BRSA 3RVOA 7ABPA 4OTZA 3KTOA 2P4UA 1ISSA 4PE5B 1DRKA 4HNRA 3CLKA 3H1FA 3OLZA 3KLOA 3OO1A 4NQRA 2PL9A 3C3KA 4P1ZA 4WUTA 4MR8A 1JDPA 3OQNA 2FQYA 2QSJA 2HQBA 3NHMA 4L4UA 1BDIA 1JBEA 4RK4A 2PKXA 4RK7A 3Q9SA 1K66A 2ZWMA 5IULC 5JNTA 4EGSA 4M88A 2RDMA 4UHJA 2VUHB 4QICA 3SM9A 3JY6A 3RVJA 1U8TA 1Z25A 1H9CA
chains in the Genus database with same CATH superfamily
3W4IA 5J2UA 4Z4QA 4CTMA 3WDSA 3DAHA 4MGZR 4QDUA 3IJRA 4MGKR 4RHCA 4WNAB 2NLOA 1WXXA 1G60A 3K1YA 4KDFA 1J42A 2D4HA 1ACJA 1CX9B 2HD4A 3IIIA 1OHHD 3HDHA 3DE3X 4UBNA 5AVSA 2OENG 2XUIA 1YZFA 3MAAC 1KSGA 1FVFA 3HA2A 2ZB2A 3PPVA 3ZNNA 1VP3A 5J58A 4Y2PA 5KTPA 1EUCB 2FUG1 1Y37A 4CLDA 5LLTA 2XTZA 1Z5OA 3Q5GA 4CMEC 2UZAA 4YYEA 4BMSA 4IVPA 1Y4AE 4C4AA 2ALJA 3H5IA 4M54A 3OO0A 4CDRA 1PE0A 3AM1A 1HG0A 3CNBA 2WJHA 4PYRA 2Q3CA 3ZZTA 1ZOIA 3FNEA 4TZTA 1SMKA 1DINA 1A8PA 2GEKA 5FI3A 4YYZA 2V1XA 3O92A 4QDXA 5GZ6A 3V8PA 3L4KA 5LOVA 1PNQA 2E4AA 1EK0A 2XYQA 2CCKA 3LWDA 3CVJA 4UAVA 3TG2A 1DBWA 4QOSA 3RTBA 3T5AA 1B41A 2VRWA 4LYHA 5D5QA 3RFTA 2YCLA 4Q4AA 3UK6A 5BMVA 2HXYA 2KBEA 3SIPA 4JI4B 4TROA 2PUGA 1FRVA 1II8B 3NHBA 2PKRA 3ZW9A 1OREA 3ONDA 4HXGA 3BJIC 4LRTB 1L5GB 3X1DA 4Q3NA 4YWHA 4KZPA 1PWYE 4QYWA 1EVEA 2KE5A 1KK0A 1WXEA 3ST7A 1NV8A 3F6YA 3W6OA 4JXZA 4GLLA 4J75A 2J9RA 3DE7X 5U4QA 4B80A 3OIWA 1WMEA 4NPAA 4WFJA 4DV6B 1MB3A 2K4MA 3WXMA 3COWA 1HPLA 3PA6A 3S8EA 5DYNA 4M3NA 4TS1A 7MDHA 1VG8A 2INGX 5ALDA 4F8JA 1LBHA 4LFBB 1MW9X 5G0VA 2GSWA 2QU7A 4WA8A 5FL7A 1Z5GA 4R9RA 3ML1A 2V8BA 2B83A 1J8FA 1DEKA 3CLSD 4M99A 1BD4A 1HLPA 2NZ2A 1NBMD 3PX3A 3GYBA 1ZD1A 4E09A 2TRSB 2V7XA 3J7TA 4QXAA 2HJWA 4DNQA 4RUKA 3AI2A 4B84A 1Y5LA 3CPSA 4OSOA 3CE6A 5ESWA 3W5BA 4JSYA 2B0JA 2W42A 2HNBA 4N7JA 5FAXA 3HBLA 1R74A 3CUUA 1JLLB 4PTLA 5HZHA 5K8LA 4CG1A 3CVXA 3CZCA 2GEVA 5JYEA 3FDFA 2VDUE 2QQEA 4RQBA 5CUQA 2V58A 1Z08A 5BV8A 3UENA 3MT7A 1WG8A 1AUXA 3HA7A 4LVCA 3THRA 3GRCA 1IY0A 3WRVA 4A6DA 1YR1A 3ZHRA 4BU0A 4C3VA 2VZ0A 3S2UA 3AERA 1U9CA 5EY5B 4N5IX 4EFMA 1YZVA 1Z36A 1IN6A 3EXFB 4PM4A 4B44A 4FT4A 2Y93A 4RE5A 1SUWA 3KJGA 4L85A 5AJZA 4H3SA 1ZRHA 1JG2A 4YRLA 1VRVA 1SBCA 4F56A 2BEWA 3P45A 1H2FA 5L3RA 3WB1A 4D82A 2WD7B 3QOWA 1XLVA 3IEPA 3SSMA 2ZUTA 4XGNA 3TJMA 2C1EA 2IEGA 1AKNA 4YIKA 5KOHA 4CI0B 3AFGA 4CR8A 1OGYA 3U56A 4IIFA 4OI0A 1U0NA 4G5OA 5K20A 2RC5A 4UUOA 3GWZA 2YHBA 4IM7A 1KTVA 1Y81A 3WGUA 3D1VA 2IYNA 3HK2A 1IHUA 2WKQA 1U4SA 4TTSA 3RRXA 5AW3A 2WAXA 1GRCA 1BCSB 1DAHA 1KY2A 4P5PA 1G8AA 4II3A 1FQKA 3A3OA 3IAFA 1A8UA 4ZAWA 2WKRA 3CH4B 5FULA 5JO9A 4IIHA 3WTCA 3KQKA 4C6HA 2VIIA 3DTNA 4UAUA 3DMPA 2X4DA 1N6PA 4JDPA 1GZ3A 4S2UA 2DCUA 4J2HA 1MEOA 3MMNA 3PD0A 3MF4A 4K5QA 2KX7A 2J6BA 3BF8A 4ZYTA 5DKFA 4B32A 1Q7CA 1CT9A 3IPXA 2XGJA 1NJ6A 1GM5A 3RRBA 4BBJA 5KVCA 3WISA 1QANA 2CE7A 4KIWA 3V8BA 1FNSA 1C30B 1R0ZA 3LX6A 5BWLA 1EEXB 1AV6A 3ACCA 1XMOB 4KOAA 1OXSC 3DUFA 3MERA 3MQ2A 1SNYA 5TDHA 1E1QA 1NJ8A 3UJBA 3F71A 1PGNA 1YAJA 2H9IA 2GJ9A 5CMLA 2PPVA 1GRQA 2BISA 3GT7A 3KE9A 4GO1A 4OHCA 3WZLA 5A1JA 1NJ5A 1U3TA 2BMAA 5LCXA 4DV5B 2ZIUB 4JC0A 4MIOA 4ZQFA 3G2PA 3ESQA 4U2CA 2YY6A 2L0XA 3CISA 1D5CA 3FIJA 3H17A 3E0XA 3LY8A 3OM9A 4ARZA 4DPLA 4EELA 3PLNA 2OBLA 5GJBA 3IMGA 3MC1A 2ZYAA 1JU9A 3VR5A 2UYOA 4HB3A 4HDNA 4PIPA 1FW6A 1QIJA 2HLHA 4MUFA 2BMJA 5DYYA 1IXYA 2ZK7A 3KCNA 1MO3A 2MR5A 3LCRA 3OM1A 2BUBA 1Y6JA 4RZXA 4ZT2A 1OX4B 3ENQA 1FDTA 2ZIZA 1TD9A 2BP7B 3E03A 4IYJA 2X5OA 4A5OA 1GQ2A 3ROEA 2PL1A 2IHKA 3ZNPA 5BR8B 3K0AB 4JQCA 4NARA 4YJHA 5AOAA 1P5FA 4E3ZA 3AK4A 3HWX1 2BBOA 2PXCA 3M70A 4RAQA 2BFBB 4RVDA 3STHA 4L4XA 4E0BA 2UZ0A 4FOLA 5FUQA 2MMGA 4V03A 1PCXA 3K9LA 4G97A 1WM1A 1PQ4A 2OC9A 2TMKA 4NU6A 1GJRA 4W7SA 3TRJA 4PQYA 1YBAA 5L9AA 1NMZA 3PK0A 3N58A 4XD7A 1NI3A 1Y3BE 4ALJA 2GWHA 3U5ZB 4MWSA 4GGPA 9ATCA 2JIOA 2DE0X 4PXSA 4G37A 1N3YA 3ZZUA 1O95A 1IOZA 1DXOA 1R88A 1OAOC 2VXOA 2XMQA 2O5VA 4GPD1 1JKJB 3RIHA 3UPUA 1NVAA 2YIDA 4G0XA 1NXWA 2GMWA 1AH2A 5FH9A 4HVAA 3VOAA 1BHSA 4RGYA 2R47A 3KOXA 4YMHA 3Q8MA 3R3VA 1QWSA 4MPJA 2ZULA 3HKDA 5HJ7A 5DT2A 4F6LA 2DFVA 2EBFX 2O4UX 1SELA 3FTQA 3EEYA 3PGMA 4G2TA 3O2JA 4QDOA 2O8NA 4Q1VA 1XQYA 3D7MA 4PHFA 5DEOA 4NXNB 3BXHA 3KO8A 3KFVA 4M1SA 1HDYA 4UNNA 3E7FA 1G7TA 2WD8A 3H0KA 5ALOA 1BFUA 2VDWA 4E03A 2D6FA 2P0EA 4HEJA 3W7BA 3N0TA 4HWKA 4XYGA 2IUUA 1X1RA 2ACKA 3NIWA 3U7EB 3GLRA 4BOYA 2RAVA 3ISVA 5KNBA 4AY2A 3TZ6A 4INZA 1P17A 3QVVA 3LK7A 2K7ZA 2Q8QA 2XCQA 4MQLA 1XZAA 1N3LA 4WOCA 4V0QA 2HW8A 3MVEA 3RABA 5EGSA 2PUBA 3U1TA 1LPBB 1VBNA 1DP4A 3TS1A 5IVHA 1A9RA 1Y0BA 5ITSA 2V4UA 2XB9A 1DCFA 1E7YA 2B69A 3DCJA 4MS4A 3W5UA 4UTPA 3CXRA 1ZVVA 3LBIA 5KHAA 9LDTA 1EWQA 2VP0A 4M0LA 4GRAA 3I3SR 3K1AA 3QEAZ 4OU4A 1Q3KA 3A6EA 4EMUA 2W71A 4YRGA 4H1VA 4QU9A 5TMDA 1ZINA 1AKVA 3I5YA 4QXMA 1QYCA 1PL8A 1G4HA 1NR1A 4FR0A 4R0VA 4B2PA 1ZJ6A 2Z3VA 4D9KA 5JS8A 1XFDA 3H9CA 1UXGA 3KKZA 2W5UA 1A9PA 3NOOA 2QW0X 3K96A 1E2GA 4TWJA 2KB0A 2XMPA 3KFLA 4LHSA 2I65A 2YXPX 3H42B 5E9WA 4D57A 1ECGA 3ZGLA 1IVYA 1SZDA 2BE7A 2NACA 2W2LD 4FMCF 2QE6A 3J80A 1TL7C 2VT2A 1LNZA 4ZVQA 3ZBUA 5L3ZA 3AY3A 2HK9A 4QBGB 3NOQA 5BWCA 1WCV1 1JFSA 2XYRA 4Z9XA 5BP7A 1JLRA 4KHPB 4BEJA 2GYWA 2OSVA 1V8FA 3LQ1A 4WMLA 1LEHA 2R8OA 3FWYA 1CUJA 4TV8B 3VOTA 3B1FA 3ZIAA 2NT3A 3O73A 3FOWA 4HB4A 4P3NA 1DWUA 1IBSA 1ZXXA 1R9JA 2G6TA 3HYSA 4LZZA 5TVGA 3VKVA 3JD2A 3O8CA 1BJKA 3IH5A 1RR6A 2PWYA 1JDBC 5SYAA 3UOAB 1JEYB 5AMXA 2ZDGA 4JEUA 4YRSA 1VMEA 4BY9E 3FDZB 3IDZA 2OV3A 1N9GA 3IUEA 1RRCA 3VYWA 1R8YA 1U6KA 3R3UA 4BU1A 3MOIA 2XF8A 1G55A 5CJJA 5G53C 3NMUF 3DMTC 3NTUA 5HRAA 3JASA 5G0SA 3RT1A 1CJKC 2RBEA 3RS3A 4OGKA 1M6YA 4UOEA 2G25A 1CUZA 5BYBA 2Y68A 1OYWA 3H2JA 4G26A 2H63A 3B70A 1GRNA 2CLEB 3J81A 1JGTA 2GPTA 5LZ2A 1U63A 1MPTA 1T6ZA 2AOTB 2BZ1A 4ETIA 1KI1A 2WSSD 5HMLA 4KDRA 1F4LA 1L6RA 1OXKB 1Y3HA 2C2HA 4UD2A 2V9CA 3EXEA 1GZ7A 4RENA 5AXDA 3EPLA 3QEMB 4YT8A 4UEOA 1NQOA 3W8EA 1EMDA 5JADA 1SXGA 3REQA 4CG3A 1TJ4A 2V7TA 4B5KA 4M0MA 1HQYE 5CXQA 2D4AA 2RH9B 1RXCA 1BDJA 3MRVA 2WUFA 2PFGA 4HNHA 3EDQA 4AC9A 3KZCA 3SFZA 3ZD7A 4V2UA 4ID3A 4C0SA 3GNQA 2GM3A 2R7NA 3VHXA 1QAQA 3TD6A 4G67A 2FRDA 1XVLA 5HWSA 1ABFA 1A97A 2WJ6A 3I72A 3PXEA 4LS3A 4F71A 4Z2AA 3PKIA 4U63A 5IC4A 1RXVA 2R66A 1PNTA 2B4KA 1FVHA 4K2AA 4GL4A 1OFHA 1R6TA 4Q00A 4UTNA 3FZNA 3MCAA 3ABQB 3TOCA 3TX2A 2OMKA 5IUKC 1PD0A 1FIUA 1GNTA 4TN5A 4DARA 4U9UA 2R8BA 1ESNA 2JH3A 2WF9A 3QFFA 4PO3X 4E1AA 1GUFA 1VI5A 3ZGXA 4G4SP 4WJLA 2VA9A 1NX9A 3HXOA 3K2BA 1VB3A 5CA0A 1YQDA 1HF3A 1PLLA 1WBDA 4L8VA 5JQWA 5CNMA 5D87A 3RADC 1YI0A 2CK3A 4MS1B 3V4LA 2AB0A 3P71T 1NNLA 5LXTF 4TXMA 1L5KA 2A5YB 4D4JA 3FN4A 1JLMA 4WZZA 1ENZA 1WUYA 2CNDA 2OWEA 2PSDA 4K26A 5FA6A 3T52A 3FSGA 2FX5A 1E98A 2ZVDA 3SYNA 1Z6QA 4C87A 2EBWA 1P44A 2FG7C 3DWFA 4MP3A 3DL4A 3WWYA 2PK3A 1MRSA 3B51X 3H83A 3RV3A 3MMZA 4MQMA 5GV8A 1PFVA 1NYRA 4ND4A 2R79A 4IJ5A 2O8FA 4LHXA 3AUXA 3ONNA 5TEVA 1JEQA 1RC0A 1L8LA 1HMYA 1LK5A 1OX6A 2ZOSA 4X8MA 1WU7A 1P2FA 1QAOA 2RKOA 3OZUA 4GC9A 3RJ9A 5H7XA 4B7ZA 4RU1A 4JJKA 4KRGA 3WGLA 3A6JA 1E6EA 2NVUA 3CN7A 1BDHA 1WPQA 3GJTA 1P91A 2PD3A 2ZM6B 2MHCA 2EXXA 1CJCA 3U2QA 3N7UA 1L3IA 3FWHA 1JLSA 3NASA 2DXIA 3F3SA 1U0TA 3OHPA 1KNXA 3NBFA 4RBNA 3VR5H 4YJ2F 5AD1A 4BX3A 1QPZA 1V2HE 5FYQA 5MHTA 4H7EA 4EA9A 4G0PA 2IV7A 3RFCA 4DLTA 1BIFA 3I83A 4IOMA 4QWMA 2O57A 4UUAA 3ZVMA 1M2NA 1UIRA 4KO3S 1JNXX 4KRXA 1NUAA 3OEED 1KEKA 1L4BA 2PLAA 3S3TA 1Q92A 4AI6A 2IL1A 4NY1A 4FB4A 2GT1A 5JTUA 3M4JA 3M9XA 3LDUA 4E6PA 4MKFA 4PC1A 4QPJC 5BXQC 2K2QB 4OP3A 3H4MA 5DTEA 4L08A 1XCBA 2QA5A 3HVUA 3LECA 4L6IA 3W8FA 3Q9UA 4Q5IA 2R9VA 2G0TA 1OYOA 1XZGA 2WYUA 4MWCA 5LBIA 4MINA 2IPOA 3C6MA 4C76A 3JAWB 3MHTA 3VJLA 1Z15A 2XEXA 3IP5A 2YJ5A 3IDQA 3UH1A 1TQ6A 2Q6VA 1PHRA 1I1QB 1QH1A 1Y1QA 1G8KA 4O8ZA 3ND9A 3K9GA 3WGVA 3MXTA 1UEXC 3V6MA 3W0LB 4EMBA 4RK6A 2I7DA 3RS5A 3WZMA 3ABRB 1WA5A 1WY5A 2AE1A 4KW7A 4Q18A 3GRUA 5HUQA 5JY6A 3GRAA 2VYNA 3BWVA 3KTOA 4FBGA 4QDTA 3WBFA 3JW8A 2FKNA 3FPSA 3WP1B 2I1VB 3B6MA 4J43A 3L7CA 4R68A 2WG0A 3GCWA 2Q3JA 5EYPB 2ODNA 1B8NA 3CT6A 2NQ8A 4P1ZA 3SDZA 4HNUA 3KJZA 2BTQB 4IDNA 3U7JA 4O4LF 1QVZA 2VAVA 2XI4A 2WIDA 3TLMA 3C4JA 3C3JA 5EXXA 1YIAA 4GDMA 2ZWMA 5JNTA 5A03A 2A0YA 5C34B 3SHWA 5ILGA 4BP3A 3FB1A 5F35A 4DYHA 3WXBA 3FNBA 1Z25A 2C1ZA 2FJUA 4IIYA 2F8LA 2H51A 3MILA 5HIMA 3GEDA 1ZK3A 4Y6SA 3ZVRA 4C14A 2Q27A 1VJ0A 3EN0A 3TL2A 4BYGA 2EZ8A 4I1RA 3ESBA 1AUQA 1S96A 1P77A 3LYUA 4KEAA 3V48A 1N6HA 2XVMA 2FPIB 3U6BA 1CE8B 3LJKA 2CUKA 2H4ZA 3B5JA 3Q12A 1U0FA 1DQRA 4ND8B 3SI7A 1NOJA 4WSOA 1DCMA 1Z06A 4D9HA 4DB2A 1BMFD 1QGOA 3EASA 4QT4A 2ZTLA 3UWPA 1N8TA 1QIEA 2GSDA 3KYBA 2GZDA 3REFA 1TOAA 4H6WA 2QAGA 2JI7A 1I24A 5ALJA 3I58A 2W37A 4P7JA 1LLQA 3PL1A 4P0QB 4K6HA 3SCZA 3AHHA 3UW3A 3WLOA 1KQNA 4DTCA 3B3FA 1EUZA 2E1RA 3BD7A 2PUTA 4INAA 3F96A 1UEIA 4FFLA 2P5TB 4AUNA 3PS9A 2NU8B 1X87A 4WCFB 5LP6C 4EB8A 3K6SB 1SR8A 4AJ9A 1EDZA 2C2BA 2PH7A 4A1FA 1SUIA 4R8MA 4YJ2A 3JAKA 5CB4F 2Q2OA 1QUEA 1TI7A 2HLPA 1NU8A 1N9KA 1YI8A 4RTMA 3NWBA 3AP2A 2DKOA 3O8LA 2GBIA 4MI1A 3R75A 5HOQA 4ER6A 3UXMA 5AKKA 1L7PA 4JI0B 4CM7A 3FHTA 4KUHA 1CY0A 4M9ZA 4DDVA 4CLOB 3NLLA 2DFDA 3NDIA 2H2DA 4ISBA 1JFTA 4L15A 5F7XA 5CTJA 4RD3A 4B45A 3TLGA 6AT1A 4MIYA 3IKVA 3ZW7A 4EB6B 3G5AA 4QAQA 5JV5A 3DPUA 8MHTA 3NIFB 4H0NA 2C8JA 4AULA 4EGAA 3GEHA 4LF7B 2DR2A 2V7QD 4RFLA 3RFUA 5A4JA 1LV7A 2KPOA 2J5BA 2RGNC 1NVFA 4HP8A 4ARAA 4ZHQF 2I6SA 2ENWA 3VUEA 2NZJA 4BNXA 1KTIA 1EVKA 1TIKA 3SVZA 1EVQA 1YE5A 1OWOA 1QCZA 1RKBA 1RJDA 2E4UA 1P7CA 3B8HA 4Q3OA 1RLOA 2R1TB 3B1KA 4IF4A 3HDJA 4E14A 4Z8YA 3MG9A 3UCXA 1K89A 5JEDA 4MPPA 2I6FA 4D6PA 2JAPA 2ZTSA 5EJ4A 5ICGA 1YUMA 1IY8A 2RGEA 3HCEA 3OLWA 3OJXA 4GXQA 3BK2A 3S2ZA 1YDFA 1UBTS 4QBKA 3MXOA 4N12A 2WFMA 4FK8A 4CM9D 4YUYA 4RHXA 2YWFA 1YR2A 3HU5A 3V33A 5EERA 5K0FA 1LX6A 1E2DA 3BREA 5GQSA 2GCIA 2ZATA 5GIPE 3CIFA 3H11A 1MLDA 5JXWA 1PR9A 1UPBA 3GNTA 3OLVA 3MT0A 4OK5A 1XHEA 4U6NA 4D1YA 4RJKA 1ULAA 4MRPA 5LQNA 1XMQB 4DM4A 4JITA 1HE4A 4NBSA 4B40A 2WQ6A 2Q50A 4MRMB 3EGXA 4KP7A 2H4XA 1V4BA 5EI5A 2BGIA 2PS3A 4I1SA 2JCSA 1VGRA 2JZOA 1D07A 2I33A 1Z26A 2I6XA 2IPAB 1LI4A 1QVVA 2VNIA 3O4GA 3CX7A 3TIFA 2VYCA 4CN9A 4IX1A 6ADHA 2IF0A 2XSZA 3LUKA 4AMZA 1CUEA 2PX3A 2C9OA 4GI5A 4L78A 2DBYA 3UICA 5EN4A 1G1AA 4G1UC 3NDRA 1C1XA 1IAVA 4G65A 3IA2A 4P7BA 1YRWA 4I14A 4DRXB 5KS2A 5J40A 4BHTA 3WRXC 1Z5PA 4NICA 4KDCA 4KYTA 2C5EA 4Q7EA 1YR9A 3U7IA 4WXPA 4NOJA 4B7XA 5A4DA 2R7LA 1CS0A 4OATA 5KB3A 1Z73A 1MC1A 3W2EA 3ZD6A 4QEKA 1C0IA 1TMYA 1GKYA 2FEPA 2XKBA 2P35A 1KNQA 4V0LA 3V00A 1RLMA 1FE8A 1XB2A 5F77A 2RBGA 5D2CA 1UT8A 3C39A 3PTLA 5CB4A 1GUDA 4PICA 4N41A 4DC9A 2OUKA 3UJ6A 3CO5A 4QULA 1M8FA 1MT3A 1XZPA 3KSBC 1D6JA 2RHCA 1W5BA 3NAMA 3EGWA 4GOND 1N2EA 4E4YA 1QK5A 2EG5A 4FKZA 4FMPA 4NDNE 1Q7BA 1X7YA 2A8YA 3E3NA 3RRFA 2HHHB 4D0LB 1OU4A 4XRGA 3GN2A 4GRIA 3RVDA 1PJSA 5CCBA 3AT1A 1BD3A 1IVNA 2LKDA 1W6UA 4F1JA 4YAEA 2L69A 1EHIA 1MD9A 1QZUA 1T1RA 1ZLYA 3ELUA 1KY5A 1X7ZA 3AEKA 3CMCO 4XFDA 4CEIB 3NGXA 4DCJA 1CV2A 1SQFA 2WMYA 4QAJA 4QNNA 4E32A 2UXCB 1JIXA 2OGWA 3AJDA 3IAHA 3OUZA 1NP3A 4FDMA 1B15A 2OOKA 2XADA 2XCIA 4JP8A 2BFDB 4MWOA 4DIUA 3C97A 4PG6A 2D3TA 4UU0A 4Z49A 1P7VA 5COBA 4YV1A 3C1AA 4ZAYA 3GCXA 3IUJA 3E9YA 1KEZA 4L3VA 3BYZA 3COJA 4EW6A 4OQZA 4WX2B 4YQEA 4IWXA 4KXXA 2IYXA 4OFXA 3GJ7A 1SBQA 5E6SA 4CIDA 1ISJA 5AJTA 1EX9A 3KQNA 3VNUA 2Y9PB 3RVPA 2JPDA 3JYHA 3VMMA 3QVKA 1K8QA 1QX3A 3QH4A 3D02A 2XDQA 4PR0A 5K8TA 2CDBA 3PEUA 1XCMA 3FF4A 5JDIC 1ZXBA 1XA3A 4QPDA 3NGMA 4DSNA 2CSUA 2ZQZA 1TIPA 3ZD9A 3UGJA 1KOGA 3IURA 1JHRA 1EUQA 1ZMBA 2CVHA 4TYWA 4YTEA 1Q2XA 5IM4A 4LXXA 2O4CA 4ENSA 5KYYB 1PVVA 2P79A 2AG6A 1L4NA 1RI2A 4EF4A 2C5BA 4I55F 2C96A 3OWXA 4QYMA 4ENWA 4ICIA 2PT7A 1KEVA 1GKUB 1VM6A 3CUSA 3Q3CA 4LF8B 4BAUA 1PP4A 4PCAA 5LWQA 2O3SA 1PFGA 3WBJA 2CZCA 4JV5B 4Q0MA 3WKEA 2KYRA 5ENZA 4IP0A 1U7XA 2HMSA 3T9DA 1E9SA 3G68A 3TK1A 3W9BA 5LP6B 3JQEA 5DTIA 1U5AA 5IUNC 1NNEA 2GBFA 2NOAA 1ZL0A 1JX6A 4QFBA 5I8ZA 1NXQA 4LIPD 4LDNA 5LWHA 4FNGA 4P5EA 3M6UA 3T5DA 3A1EA 5BSEA 3LOQA 1JWLA 3JQCA 4E13A 1TRHA 1WUKS 4FIDA 1SCDA 4J94A 5JYBA 3W2HA 3OFJA 4JP1A 1W4ZA 1L7EA 3R3JA 4PN3A 1QPGA 1L4FA 2XVYA 3D0QA 4UZFA 2YCBA 5HKOA 1LZKA 2HT6A 1LLCA 3MJEA 2CMGA 4RD1A 3RRMA 5CIYA 4URZR 3W5SA 5IJXA 2WJWA 2AXEA 2QRNA 4X0EA 5T3UA 3KQTA 2YHIB 4EHHA 3R3YA 3E1GA 3O03A 4C7BA 4K8OA 5ECDA 3GDGA 4A36A 2IBTA 4KITB 1XNQB 1XZCA 4XTCS 3L46A 5IASA 2XCOA 1NE7A 1RRMA 2VQDA 1HEUA 3QIVA 1X92A 3EXG2 2LWIA 4YRCA 5KNCA 5EEHA 1B0ZA 1CRPA 3M2TA 4AY4A 1J99A 2JLVA 1TZCA 4RSRA 5FNVB 3T5GA 3F8SA 3VZCA 2QYSA 1OASA 1RIFA 4P31A 2GUWA 1H2ZA 1A9QA 4I66A 5KCZA 1EBUA 1O2DA 2K2WA 3EXHA 1EJ0A 3IQFA 3LT1A 1P7YA 4EVSA 5C5EA 4C2UA 1PBNA 3ONFA 5E4JA 4RDXA 1K4KA 2HGSA 1W5EA 3RSFA 3RVLA 3EXFA 3JCZA 2NTJA 5ECGC 1OOEA 1C3OB 2BMWA 1Y33E 2YNMC 3CUYA 4R9SA 3UAVA 1SXPA 5FOQA 1CZKA 3UH0A 4D4GA 1LPAB 3FKSA 4L5AA 2C7BA 3A0UA 6LDHA 1WQ4A 1T1JA 3AEQA 4LN1A 4RD2A 5E7MA 1PNOA 3WWDA 3QKRB 5JUWA 2XB8A 4EX7A 2O6LA 4EI8A 1BG6A 2PLNA 4DQ0A 3C1OA 3LQYA 4Q1BA 1DC8A 4HAXA 3QI7A 4L1KA 1VMIA 3GUHA 3L05A 4PPQA 4L6CA 2Z43A 4WDRA 1XZQA 2CXQA 4ZN6A 3F74A 3CUTA 3V32A 1LU9A 1OBOA 4M36A 2XNKA 3L1HA 1R4MA 3KJNA 2OP1A 1ECJA 1PG2A 4HZUA 4ED9A 1KP2A 4K81B 1LQUA 3ES9A 3K4PA 5EMHA 4ZKEA 1R9MA 2FZEA 1QE0A 1Q84A 1M2WA 1XA0A 3BE6A 3EDRA 3EHEA 1C9YA 4UDNA 3WS7A 3MMPA 5TEWA 2IP2A 3A4IA 1R7RA 2A0UA 4OUDB 2HMVA 2CL5A 1W19A 4P6VF 1DBRA 3QLJA 1NVTA 1XPRA 4I55A 3U49A 2C2WA 2B21A 1SU7A 2JAQA 1P5RA 1RBZA 2XMGA 4LE0A 1DJNA 2N75A 4R2XA 3FPHA 4CMGA 1CB7A 1L7RA 3LSTA 4U2EA 4UEQA 4DJTA 4FZVA 5AI6A 3ILXA 2LCFA 4PZYA 4TSKA 4E4TA 4N3GA 1NC3A 3E22B 1M8PA 1TT5A 3DMNA 3KVVA 2O50A 3AG6A 3WMEA 3W1WA 2QTMA 4AMBA 1EFHA 4GYYA 4FHDA 1FUIA 1KS2A 3BDIA 3GEPA 5AW6A 1MB2A 4BO2A 5KOJB 2YBEA 4QM6A 2GVZC 1T9KA 4AKGA 1IBCA 3L1JA 4K9OA 4LZLA 5L4SA 3P2MA 3UMGA 5F1YA 3D6FA 4EZEA 1K7EB 2VR1A 1R10A 3F8TA 1BCRA 2XJ4A 4GM1A 4RZUA 1FVXA 4JJIA 3KBBA 4MYUA 1N6KA 1Z29A 2G17A 2JLBA 5BUSA 1BROA 2D62A 3D43A 4I4CA 1F14A 2VDPB 3ENNA 3GPDG 1NVGA 3DZ8A 4HNGA 4H59A 1E69A 3KETA 4NEQA 4ZO8A 4TT8A 2OCBA 3O1HB 3NEAA 3O82A 1GVNB 2BP7A 2GF9A 1IIRA 1EFVA 2FK7A 4P4UA 3Q8XB 1ESCA 2YV1A 3DNMA 2QRVA 3K0AA 4UPDA 1O96B 1F5SA 4D5EA 1LZLA 2P2YA 4Z6KA 5JNLA 4XH9B 2Y8EA 1FRQA 4QOIA 1L3BA 3E15A 3BIFA 2FP4B 2CLIB 1E7WA 3TRKA 1XZFA 2Z9BA 821PA 8OHMA 3MW8A 2J6CA 4GPEA 4LK3A 3NJ4A 4YFVA 2PFSA 5CDGA 2SKEA 1IUKA 3GLGB 3CF2A 4JI5B 2I67A 3QE4A 1AKUA 3BE5A 5F12A 3W8NA 2P27A 1NN5A 2GAJA 3E23A 3SC4A 7ADHA 1C9NA 2CVFA 4YLGA 3QBVA 1X80B 4YMSA 4A5SA 2P9BA 4KNYA 1JDTA 1YJQA 2NNWB 3OMLA 4ADSG 3ZTTA 3GZJA 2ZJ1A 3WOVA 4BVBA 1AO0A 1UOOA 3UUFA 1ZM4A 3Q88A 1T13A 2BJWA 2HBRA 2IYAA 4OK6A 1WABA 4KB5A 1GNQA 1J2JA 1C8KA 1PEKE 1B8PA 4PX9A 1GXSB 1CJMA 2CYCA 4GH5A 4IDGA 4MP8A 1CQJB 3RK1A 2IYRA 1S2MA 2C4UA 1Z0IA 5BRAA 3WKDA 4L8FA 2Q4DA 1P4RA 1W7AA 1RJGA 2JFZA 5JDCA 4MVWA 4X3CA 1RSZA 1BMQA 3BFPA 2FFAA 2VPPA 2WZDA 3LUBA 4JUAA 4HN2A 3AR4A 3SZMA 2ONZA 4AS1A 1HDCA 3TAUA 4NNOA 3I5XA 4R2JA 3OKCA 3VAAA 2OK7A 2W6IA 1OWPA 2FW6A 1DMSA 1L5WA 2ZANA 2B99A 5LQAA 3AY7A 1WSAA 2QOEA 5AKLA 1JN0A 1OWNA 2Q9BA 4GBGA 5CNJA 3G8CA 4KR7A 4U4AA 2VUIB 1XDSA 4KN6A 2PZFA 1V6SA 2W00A 3ITKA 5IWCA 1VKJA 2FRVA 3B6ZA 2DH6A 5K1ZA 1LH0A 2COKA 2AFIB 4AICA 3ODPA 1K63A 3TNYA 2IXDA 1Y5NA 1RHMA 1U7TA 2JZCA 5TNXA 3WE7A 1TMGE 5JAOA 3EOBI 3ROXA 4PAMA 5KKNB 2VHEA 4K6FA 3T1QA 4D9IA 2FSSA 4K1XA 3G0BA 1VIVA 2JIQA 3K2QA 1JZSA 2OT3B 2VQ6A 3GFQA 4RSHA 3H4IA 5EP3A 3ADPA 4BB9A 2NTNA 3HKCA 4JFAA 4IO1A 4N7RA 5FPYA 2OM6A 2GNAA 1TAHA 5LMNB 5LU9A 4B6QA 4RKEA 5EE1A 3EZ9A 2VWGA 4D4KA 3F9RA 4KOEC 1VA5A 1FNBA 3C3KA 3QVGA 5KTMA 3MWEB 3JD3A 1ZUHA 3LG2A 3LTNC 3GI1A 4CLRA 3NHMA 4PZEA 2H48A 1KZHA 4RK4A 2QG6A 2WM3A 3Q9SA 3QRWA 1LKZA 2P40A 3FLMA 4GQAA 4PX2A 3GVIA 1JKMA 1AIPA 4GOLD 2AG1A 2D8AA 4MNTA 4O4IF 5FBRB 1OBHA 3WWEA 1TPYA 3FCYA 2JA1A 4ZQEA 1AHNA 3RVJA 1NU6A 2BJHA 2XOKD 1WHSA 3N8HA 3DF7A 5FKJA 13PKA 1JS1X 1YHZA 2XWBF 4PZ9A 3ZXUB 2M32A 2AQKA 5I51A 1R6AA 2MYNA 2QNRA 4CEJA 2AN3A 1Z16A 4EGCB 4NYJR 4DMMA 3AESB 3I2JA 1OBVA 1N78A 4UQPA 2CFSA 4NCKA 4UM8B 4COOA 1BEEA 4PZZA 1NRWA 1LVGA 4G4SO 4BQSA 3L01A 2V6GA 4J1QA 3A9CA 3N0RA 4IINA 5F1PA 3CRQA 1GL6A 2RHJA 4OQ4A 4UZSA 4BNFA 3OFKA 1Z0FA 1HZJA 1UBCA 4K6OA 5DGCA 1IJEA 3PGXA 2O7RA 1RLUA 2VS1A 1AZWA 2RGDA 1NX6A 4BGIA 1JIKA 2HA6A 3LT2A 4FJ1A 3LVRE 3RSOA 2R5NA 5KNCH 3P97A 3PC7A 1LJLA 2IYTA 3NM5A 5CRIA 5F2OA 4YO7A 1HGXA 3BDVA 4MS3B 1AF7A 2QRZA 2OP0A 3RSSA 3W5AA 1UCFA 1SPBS 3C16C 3T9EA 4X1OA 2WSIA 2RJOA 2B34A 4RA6B 1JR6A 1J8YF 2EYQA 1CG6A 2P2DA 2BW0A 1P4HA 1KIAA 2Z1NA 4NOLA 3FPJA 3WK8A 5AVRA 2DBRA 4HWRA 4GGMX 1QO0A 3OZBA 3BSSA 3BMOB 4A6PA 5KYTA 1DJMA 1DNPA 2RHHA 2F3SA 2HJRA 1GFWA 1J9GA 1TCAA 3G9QA 3HCRA 4O6VA 1C7EA 5CX1A 5ALEA 4LDPA 5AO9A 4F5WA 2H57A 3IPAA 3LX4A 5IJ0A 2X7JA 5JNWA 1UOPA 2AFHB 5CNIA 2J9YB 2NZYA 4FX5A 2GEBA 3DE1X 4HL6A 2GZ2A 3RH0A 1VFPA 3E7DA 4IDAA 4RVCA 1TCUA 4XB1A 5ALHA 5F98A 3QSYA 4TT3A 5IEBA 5AICA 1FYWA 3VU8A 2J5KA 1ULBA 5EKUA 1N0VC 4KR0A 4FLFA 3WRWA 3H16A 3EG9B 3HYCA 1DKPA 1GDHA 3MIZA 1XWIA 1GUBA 1P0FA 1T5HX 1JDVA 3TLCA 3GXBA 1GA6A 3P0JA 1R00A 2HSJA 2R62A 3EVCA 1U3FA 3QWFA 3LZ6A 1LV8A 1XA4A 2O2DA 5HF6A 4DBLC 5C5IA 4IH9A 1XXHB 4E5UA 1Q15A 1UJ2A 4AD8A 4MCAA 1POXA 1SCBA 3CNNA 4TLCA 3QKSB 3U9LA 1Y9DA 4FR2A 4L7VA 1NF2A 1IPFA 4MW5A 1PJ8A 4DKXA 4RADA 4G24A 4EHFA 3DE4X 4EUSA 1ZBQA 1C80A 4HUTA 2GOYA 5B7NA 1K06A 3JVVA 2QLJA 4KLRA 4GQBA 5DSXA 1A9XA 4ARCA 4ZCSA 2K5UA 1DDGA 1KMMA 2EARA 4K05A 5IF3A 2QTVB 4JNKA 2FFBA 1BWQA 2J9ZB 4MCHA 4CDGA 4KREA 3WVNA 1GARA 2VTDA 3VR6D 2GASA 3ZDBA 1B8UA 3I0ZA 8ABPA 4YCCA 4O4IA 4PRKA 4IDQA 3PLRA 4L95C 1CZHA 4RLSA 2HRZA 2ZDHA 1OTHA 2OHIA 1U2QA 1NVVR 2GARA 4KE8A 5CVCA 3RSLA 3N3BC 2ZRAA 1Y7PA 4O2BF 3LNTA 3CPJB 4R5MA 4FI3F 3CTMA 1BVRA 4KYVA 1Z6XA 2B8NA 4TQUS 3DDOA 3D3WB 3N2ZB 4MQ4A 2W0SA 2BR5A 4OL0A 5LXTB 2HK6A 1MR3F 2OO5A 4B9EA 1QE5A 2P91A 1VL0A 4DMRA 2XIJA 3H1TA 4N82A 4QJ5A 4QYSA 1E6CA 4FNAA 3BQNB 1TJ5A 3MJDA 5EWJB 4B3JA 4B2YA 4V1CA 4JLOA 3PD7A 4DBZA 3PQ8A 5EXPA 1G64A 2WM8A 2ZIGA 3DKPA 1PZGA 4BX0A 3LQFA 2C2KA 3VOSA 1CU1A 3I6YA 4HX2A 4QPNA 1PF7E 1C8LA 2RCYA 4BN5A 5IKXA 2ZZMA 3ETLA 4TVOA 3SE0A 5ITVA 2R8XA 1OVGA 2HHJA 1IWPB 2YFYA 3OC0A 1SKBA 2MINB 1EP3B 1J49A 3V1YA 5BSWA 1M6EX 3G0IA 2P6UA 3KB8A 3TINA 3HZZA 3PC4A 4J49A 4Q9JA 1RPZA 3BFXA 2Q7OE 3JAWA 1YVEI 2GDZA 1XI2A 4MICA 5C8XA 1SBYA 3OCCA 4NE2A 2W6QA 2IHBA 4G1MB 2OFOA 4MV5A 5BYJA 4AVYA 5I7WA 3B2EA 4ES6A 3RTAA 3C4QA 1KSHA 3CV3A 4CRWB 4AO6A 3K16A 3C3CA 1V7QA 4O4HF 1E3WB 1I3MA 1SB8A 3TQRA 4I9NA 5LDHA 2G09A 5FWNA 1FFXB 4LXHA 4D3XA 2IKSA 1RXEA 3OCWA 2OLKA 4GOMD 4JSRA 5FA5A 4EJ6A 2UYHA 2QUJA 3HFGA 3TZEA 1P2VA 5H82A 4QOJA 1U1DA 1XU7A 3DZIA 2EKZA 2BTQA 3NPAA 2G5CA 4OJQA 3DYBA 2GHIA 4IIEA 4M0PA 4NJEB 4ZYXA 2FTKE 1B8OA 1YZHA 4OLHA 5HUJA 5HXAA 8GPBA 1TC1A 2F90A 2IOQA 2YRXA 4H7KA 4JD5A 4XDGA 3AUUA 4CHTA 1WZ2A 4OREX 1Y3DE 5JBNA 4EPTA 3A10A 3V8NA 3EGOA 5F2EA 3OTIA 1KEWA 2HBZA 3NP9A 2ODPA 1RP1A 1JG3A 4H35A 3PXGA 2AOUB 2H07A 3MJTA 4EL5A 1P19A 2HI0A 1Z0DA 3O8OB 4AMUA 3SXUB 2W4MA 4K8RB 5CVVA 4C3OB 1DIGA 2Y1KA 1QFZA 3DEJA 4GOOD 4DLVA 1JYFA 3AR3A 5LQUA 2LV8A 4MR7A 2O54A 4KPFC 3N2IA 2QN2A 1J70A 2O8CA 2X13A 4B3SB 2GTHA 1OH8A 3H9BA 4C4XA 4M37A 4BUJA 3C8ZA 1PUIA 2KBFA 4PLYA 4XLLA 5ALGA 2ZJ6A 3SDBA 1C2YA 3LCVB 3BN3A 2IW3A 3IS3A 5HR5A 1EDOA 1ORIA 4IQGA 4YI5A 3LD9A 4J6FA 2J0UA 4OGLA 1SHZA 2GN2A 2HAEA 4N3AA 3KKQA 4MWBA 5IG2A 5IVKA 1CBUA 1EH5A 1FYFA 1R4NA 2ZWAA 3BDAA 5AVZA 5CDHA 3R3ZA 4M9XA 5TJ9A 1TMOA 1N1DA 2FDRA 4DYVA 1M1ZA 4MVJM 2Z95A 1ZFNA 1ZI8A 3ECCA 4HK4A 4R1UA 1GAXA 2BSAA 1M8JA 4MUHA 3MTBA 3ZWKA 1OA1A 2DB3A 2CEAA 3BL6A 4CUKA 2OOSA 1NGSA 1TGYA 2EW1A 2JAXA 3BULA 3CIOA 1WV0A 1W2GA 1P2GA 3TPFA 4DA4A 1JF8A 2P5YA 4MHOA 2J0SA 2HPAA 2GN6A 2YWEA 3H5VA 1CUXA 1N2XA 3KR0A 4XVHA 3ANYB 4BB0A 1HSOA 2CY0A 3FVQA 1XQWA 2B82A 2HHAA 2XH8A 4IZIA 1ZKMA 3GFRA 4LWOA 4WBXC 4NVRA 4Z9FA 4CLOA 1W4CA 1GPDG 2YWGA 1THGA 3IV9A 2FPGB 4HH1A 3D4PA 1E79D 4M0EA 4BKMA 5BQXA 2XMZA 3I8SA 3TZQA 4IIJB 5FUMA 1YVRA 3DOUA 4CF3A 3E3OA 3M5WA 2G8NA 3LFHA 5EWMA 1QIKA 5EIHA 5L6LB 1SBNE 4D6XA 2TSYB 2NO5A 4OX9Y 5DVZA 3DWEX 4GDFA 1SXJD 2W2MA 2VDVE 1J8MF 3DEZA 4FQ7A 3FOAA 2Y27A 4KBGA 3U44B 1SIUA 2VHUA 4OK3A 5AM4A 4Q05A 1DAIA 5EUQB 2ZS8A 2G1KA 2VPZA 4ZI5A 4JBWA 1OQAA 3KU4A 1SVIA 2NXNA 3INYA 1HLFA 2R1TA 2X77A 1MHTA 4FBLA 1H05A 2QM0A 1ZH8A 2WIAA 3HKBB 4O4HA 1ZL2A 2ISCA 5E9JA 2IXEA 3H13A 1XV5A 4Z1MA 3G1WA 1MJNA 4BUZA 1W4LA 1YFKA 5CFPA 1DXQA 2AX4A 1IM8A 2PX8A 2Z8ZA 3HWRA 4J1NA 2OGTA 2EF0A 2QN3A 2ZRDA 1HORA 4HYQA 3NU1A 3CUKA 4F1KA 3I6IA 3MINA 4DPKA 1JDZA 1IWOA 2FZKA 4D8UA 3R7LA 4C0KA 4DVGA 3E61A 5K0EA 4R9NA 4WDQA 4CMIB 1GQRA 2Q3HA 1V8OA 2BDTA 4Q6BA 1WS6A 5AK6A 1GUYA 2ZT6A 3KUCA 2FPUA 5ALWA 4HRYA 4N0EA 3O47A 4PQGA 5FBLB 3R6LA 4ZGWA 4ZHQB 3F98A 2VF5X 4MVJI 2A9RA 1VHLA 4YI3A 1W36D 1XVUA 4RWEA 3M6VA 4CMAA 2I1LA 3O91A 4MITA 5BVGA 1ZA2A 2JLRA 4KFSA 3LLSA 1U7UA 4NEHB 4KSBA 3T6KA 4ZTUB 4L5CA 2FSVA 1E5DA 4XM1A 1E2MA 4RV4A 1DUIA 4W1PA 5L7WA 4IWNA 4U5QA 2P4EA 1COWA 4RORA 3P5BA 3H8WA 3QFSA 4FS3A 2HPHA 3REGA 5CEFA 4ZU1X 4XQGA 4OLJA 1GR0A 1YKFA 2FW1A 3A2LA 4HXEB 3GT3A 3L7AA 2M98A 2NUTB 2Q3BA 1W52X 2NXWA 4BLVA 2ZJ3A 1HSZA 4RA9A 3FA2A 9LDBA 2ZIWB 1KEEB 2ZUEA 4D74A 5K99A 4BNKA 4WXMA 4RXMA 1KJIA 4I4LA 3ZHVA 3TFOA 4QBHA 5JDCC 5BQPA 3LPNA 3QW4B 3CEJA 2WWWA 1R16A 1GOTA 3IUPA 4MW7A 4HMOA 2W6JD 5HBRA 2XUJA 3QPBA 4Q1AA 1UP4A 4NENB 4ZEVA 1KDOA 1QU3A 3V4PB 4ITRC 2HSEA 2ZIEA 2Z8YA 5KX5A 2YJ3A 1NG9A 4W6ZA 3GJXC 4IRMA 1M2VB 1SWVA 3PGLA 2DJIA 2PSJA 3QXCA 4GX5A 1FTSA 4V0KA 4N5NA 3AUSA 1R1DA 2ZETA 3SM3A 4PHGA 3AWIA 4LY0A 5CU7A 4ER5A 4MV0A 4UEJA 3AUAA 1T9ZA 2QZPA 2ZS9A 1UBKS 5A9SA 2WVHA 3C8MA 2IYLD 4EY7A 3KQQA 4K9DA 1SURA 2XX3A 5EPOA 1W6RA 2O8VA 4NZ9A 5FLXA 2QU8A 4PGMA 4TXLA 3SU8A 1N5DA 3PQFA 5EXEA 1NMSA 5EXDA 2PXXA 3TQIA 2JLCA 3PHIA 4JX9A 4FFMA 4BQPA 4J1TC 4ZYZA 721PA 3K1JA 4LC9A 1GPWB 3C85A 4QJIA 3DCNA 1XF1A 3D5QA 5TS3A 4BC0A 4J4TA 4HMPA 2BFDA 3AY6A 2GK4A 2N3ZA 2PJDA 3EF3A 3KWMA 1PZNA 4J0DA 5BVHB 4A2QA 3IESA 1XMVA 1VSQA 3VZDA 2BFPA 2BM1A 3WHIA 2IOFK 3QX3A 3GA7A 3I12A 3PDIA 1CZUA 3QOYA 2JGAA 4UU1A 2WVJA 4BB6A 1LQTA 4N0DA 4DXDA 4NR0A 4C5AA 3SEFA 1QH9A 3DE0X 3EQZA 3CW8X 5BOVA 4NCNA 1GKIA 4AF6A 4HKTA 4YCDA 4F5YA 5JR3A 1TYBE 3SS8A 3CRVA 2QUAA 1LY1A 4ARBA 5D5HA 3VI4B 2JVKA 5D6OA 1QRSA 4X91A 3RFXA 1HDIA 3FMVA 2YIVX 5DM0A 1O5OA 1QHIA 3ZZNA 4A2PA 4BNLA 4HEHA 4DLWA 1A1VA 1MN6A 3DBRA 4KPUB 2VRNA 2WDPA 2BYTA 5DYWA 3L8EA 2OHJA 4R54A 3PEEA 1NI5A 2E3JA 1J33A 3IQZA 1Z4IA 3FMOB 5E1DA 3WWPA 2XCLA 3ER6A 4IUDS 2BKUA 1WRBA 2BTOA 2FWRA 4Y2XA 4YY3B 4BRSA 3B20A 4XX1A 3EQ8A 5F73A 1X9IA 4LSGA 3SWWA 3X44A 4MVJD 1B0PA 1GSOA 3D6UA 3G9TA 2QJFA 4R2HA 4CZ2A 3GBSA 3GJ0A 4GNKA 3K9HA 3A8TA 5CK4A 3B2NA 3RFFA 5AVVA 5JSUA 1TD1A 1E8MA 2P65A 3ONVA 1EWVA 3KOUA 3VSAA 5B3AA 5B58C 1JAZA 1UPAA 4URXR 1X1TA 4GR9A 5C9ZA 3GFTA 1N3IA 3R24A 4RULA 3BPSA 2Q0SA 3FJ1A 3JQAD 3R4VA 4ZVLA 2J3HA 2NYAA 3FFTA 4HUQB 4XWGA 2X9GA 2I03A 2QQ0A 4U9HS 5TF0A 2ZJ8A 2HWWA 3AZQA 4NE7A 2OBBA 4OA5A 2GETA 5LQMA 1HEYA 3P4UA 3OPYA 3HY3A 2AJ8A 4I1IA 4Q4JA 4X93A 4B82A 4YIHA 3I2IA 1YA4A 2PRJA 2Y0PA 2MSKA 3KAKA 2C9CA 3PEVA 2QE7A 3A3YA 2Z6VA 2D0PB 2IH4A 2PJZA 5JVDF 1K6EA 2BKLA 5DBFA 1FLDA 1T0UA 2C03A 3JR7A 2CD9A 2Z83A 3ANMA 2IUYA 1MB9A 3KL2A 4KWTA 4IV0A 4MRVA 1N8KA 2C4HA 2Y1FA 3U7QB 2DR0A 4B8ZA 4HTFA 4GBED 2W22A 1UMCA 3A9TA 2P9ZA 3P4XA 3UFBA 5I7FA 5K3OA 4UPVA 1XZNA 1XEAA 3PJFA 2VSNA 4DZZA 4QGSA 2B37A 1MJHA 4KNVA 5JZBA 2V1UA 3WC4A 2VAPA 2XODA 4FC7A 4IDOA 4ZEMA 1U3DA 1YKSA 2F9MA 3UJ3X 2ISSD 1E32A 2H11A 1N2HA 4NYJQ 2WSBA 2FW9A 2Y2UA 3MD9A 2PRIA 2P2CA 4W5QA 2QQ5A 2FFHA 3GZNB 4NECA 1M34B 1ZLXA 4FIZA 4QE3A 2Z9DA 1T8UA 3FZEA 2F62A 1NW3A 1Y98A 4YRQA 2Z6QA 3ER9A 3HXTA 3DDHA 4JK3A 4IIGA 4P98A 4PTZA 4UULA 5LC1A 3ZKWA 5MFPA 1KO1A 4F3CA 1C4KA 1TUBB 1KMIY 5E3JA 4DILA 4PBRA 3LHSA 4KGXA 3M49A 3IT0A 1X1DA 4NMHA 1IY9A 2BFAA 1VGVA 2MSEB 3D4LA 5GM1A 1NUSA 4I9HA 3MN1A 1UZLA 3JPWA 4X45A 2VDRB 4OM7A 5H0IA 1X7GA 5JPIA 2C20A 3W2GA 2RMKA 3L7IA 4XB2A 1AGRA 3LCJA 2CFIA 4QSHA 2OO5C 5I9LA 4PYIA 4YGXB 5FNZA 3C7TA 1T3ZA 4ID9A 5K9ZA 1P3Y1 2UVPA 1VMAA 3GY0A 4RSMA 4EZBA 3BRQA 4F92B 2D2XA 2VHZA 1GCIA 4RLFA 3AKCA 4ZQGA 4D46A 1NRIA 2W8ZA 2YVAA 3U7RA 3A2MA 3W3AA 3UJNA 1FMJA 3M5PA 3GQBA 1YB6A 2D2IA 1SULA 5HX7A 3FJYA 3H9GA 1NKTA 4YV2A 3W5IA 2CN1A 3AVTA 3B85A 3UANA 5HA5A 5ALPA 2WYIA 4B79A 1SG0A 3SZRA 3H0CA 3PC2A 4XYEA 4DTIA 2CE2X 5BNTA 3GPLA 1X7DA 4US1R 3BMCB 1UK7A 4WCVA 5ECYA 5KYVA 3GA0A 3BE4A 2A5JA 4UZEA 4ZQCB 3VX4A 1GFSA 4G01B 3B12A 2YZ7A 4FNOA 3ISJA 3N39C 3FY4A 3KEMA 1KMQA 5B64A 3C3YA 4ACBA 4H7JA 5F9HA 2XZTA 5CEJA 1CUYA 1NWCA 1P9WA 1DFGA 1FTWA 1H9AA 1YZKA 3EUAA 4JLNA 1T43A 3Q15C 1ISHA 4RV5A 3GRKA 3UV7A 2AD1A 2A94A 3F4BA 3TZCA 1N75A 2DCMA 1TEVA 2ZRFA 4KIGA 1IEQA 2MSDB 4M1ZA 5J59A 2ZVQX 3EARA 3GLHA 1NC1A 5K0NA 2Q46A 4N5HX 1WMFA 1GR1A 4AQ7A 1TVCA 5DP1A 2R8RA 2VTVA 3PE6A 3TKLA 2BFOA 3KB6A 3MRSA 1CPYA 1J0XO 3HV2A 3WBBA 2ZSUA 3R7NA 5TPZD 4I0WB 2QVYX 1QC5B 3OIUA 3P2OA 1X7XA 4X24A 1ABEA 3SHTA 5CLGA 5BUQA 1ZH0A 3UFXA 4FEEA 4TX1A 1KJJA 1W0KA 3AETB 1TZ2A 3KVYA 3B6KA 5KTYA 1N25A 3NM4A 4GI3A 5HFJA 3IHWA 4ZP1A 3PSHA 1QRAA 4PG8A 4YP1A 4JLUA 1RYNA 3L43A 3GLGA 4ZMBA 2ZR0A 3M4ZA 4BNZA 3GBPA 1Z8FA 3GG9A 2Y66A 1Y8RB 5ALRA 3H75A 4LRXA 3MMXA 3PKZA 1UKYA 1NXVA 1XLTC 2EQBA 1DADA 3BKXA 2HIGA 1XU9A 1E1RA 4EA7A 2R1UA 1WKCA 4PRYA 4IR7A 1SY7A 3Q10A 1DC4A 2P0AA 1UP6A 2YYAA 3COVA 3FAKA 1WAMA 3QWAA 4JN6B 4W1QA 2B4TO 1N7IA 2FPLA 4XSVA 1L5SA 1PR6A 1YBFA 1OI3A 1VYVA 3E9EA 3HCFA 4YS6A 1ZGHA 2I66A 1GXSA 1Z38A 3O90A 4HWSA 5DHTA 4A7PA 3ABOB 4D0NA 3VYVA 1AK1A 1M76A 4RIGA 2O6HA 1CS4C 5ADUS 4KQWA 4HDRA 1KERA 3K2IA 4JQOA 1AN0A 1E9VA 3PVZA 2CV1A 4XA8A 3HBAA 2I22A 4QTYA 5IKMA 4TVSA 2X41A 4U7WA 5D3KA 5BQ3A 3F8WA 3DGFC 4FI3C 3SVTA 2WM2A 1FS5A 3F6RA 3OKPA 5IC5A 4QKQA 4I9FA 1Y7TA 2ZBRA 1VE7A 3PHHA 1ULUA 3HBJA 3EIWA 4JA2A 4MWTA 4AF8A 1CD5A 3RHTA 1GZ6A 1I14A 4Y0AA 1UK9A 1EA5A 3CURA 3S2GA 3F47A 4QUAA 3VSEA 4NWIA 3ZQJA 4BNWA 1J1UA 1UF9A 3AB3A 1P1KA 2EIXA 4HDSB 5HBGA 4F2PA 5KVVA 3HXQA 4KIUA 2EFYA 2WICA 5G2OA 3HJAA 4ACAA 2B35A 4O4JA 4W5OA 2BI4A 1ZCJA 2PGXA 4MV4A 1NZJA 4QOHA 4AZ3A 2CDCA 1SUEA 2I1WA 3E53A 2Q7DA 4YRNA 2G82A 4CNQA 2G83A 1FFGA 3M7IA 4B09A 1GDTA 2HUNA 1G20B 3I23A 2PRYA 4YJFB 1GAQA 2W70A 4W6QA 1CY7A 5K0ZA 4HO1X 3FHCB 4KXQA 3ZN2A 1G21A 3Q41A 3T1VA 1AZSC 4TPKA 4CW7A 4B81A 4UNSA 2DGDA 3TNLA 3HHPA 1VKZA 3IC5A 5DWQA 3ASYA 2QTTA 2ZE6A 2YC4C 4IIUA 2R6DA 2M6RA 2G77B 2VPIA 4M86A 5I4BA 1P0PA 3NX4A 1L6IA 1QHEA 1SQGA 1CUSA 1F9EA 3U3ZA 2IHVA 4ZICA 2IXAA 4ZANA 1AQIA 5JJLA 3DW1X 3SSOA 1P6XA 2EVWX 3DHYA 4Q16A 2OZPA 3H1GA 2H2FA 1YBHA 2WAMA 1FDSA 4ZAGA 3VZQA 1PT7A 3DVAA 4BNIA 1R3DA 2D5LA 2LP4Y 4RACA 5KSZA 1TCVA 1X19A 1YVPA 1YQWA 3HI4A 2ACEA 1JMKC 3H2ZA 4OMUA 4R05A 5JHGB 1ZJZA 2GCEA 2V6FA 4TRNA 4Q3LA 1T4BA 4C05A 4JT8A 1L2TA 3OIDA 4G9GA 5B1DA 4EB3A 1BXZA 3OQVA 5DDIP 2ZEJA 1ZIYA 2CLKB 3ZH2A 2L2QA 3RAPR 5AQ1A 1T2NA 3EUWA 1QDEA 2B25A 2WB4A 3CJRA 3HN7A 3T95A 2GQ0A 3A14A 2FSVC 2RAPA 3KKLA 2IU6A 1UADA 3NH6A 3PE4A 1FX0A 4UE3S 3TUJC 2Q0XA 4EY3A 3GLGE 4HAUA 3TCNA 3GJ6A 1TJ3A 3JQ7A 1AQJA 4MUYA 1OHHA 5KIAA 2WIGA 3KXIA 4K28A 5K0BA 2O2EA 3C45A 4WK6A 1E0KA 3HJFA 3P96A 2NVOA 3I2HA 1IM2A 5K3SA 4HT3B 4DMGA 1ZVMA 1NQUA 4F84A 1HDOA 3KSAC 3CONA 3UGTA 4F8YA 1K68A 4HWTA 4QGAA 1DHTA 2YFKA 1QHFA 1K2WA 2F43A 3R2JA 3VR4H 4OHFA 4J0HA 5I9NA 1XWWA 2C9ZA 1I9GA 3H5RA 5IK2A 4Q1FA 1Y4DE 1RKVA 3DBVO 1YIDA 4LJ6A 1A71A 2CXXA 4DC1A 1QE3A 2FQXA 4ZRNA 4BNYA 4ZK2A 5KWIA 1H4QA 3PHCA 1ZGGA 3H1EA 1YZUA 1ZR4A 2C2OA 1Y1RA 1UC9A 1F4PA 3AJ8A 3G3EA 4GXRA 1P7ZA 2GZRA 3TIVA 1GYPA 4DLAA 4GW3A 4DVJA 2PH1A 1DBIA 4J9UE 1EGHA 5K8JB 1Z75A 3EFHA 3N5KA 2W0MA 4ZCMA 3TBHA 3VVMA 2Q3LA 1JJBA 1GV1A 3PENA 1QP7A 2GF2A 3B78A 4MQFB 2OHVA 3U0VA 2FFRA 1J23A 4WPGA 1UAYA 4MKHA 4NK4A 4MO2A 4AK9A 5IXJA 3ZD8A 2PYIA 3PTAA 2Z5FA 4C4SA 2PL5A 3OOWA 4KR9A 3CKMA 2WJGA 4DUPA 2AFIE 1EFLA 1SFRA 3WJ1A 2WWIA 4EEXA 2HV9A 3U16A 3D8BA 1HNWB 3N2GA 2RGBA 4YCBA 4OHZA 3ZCRA 3PJEA 4DM7A 5C8YB 1SOMA 5JAIA 2P9EA 1NBMA 3M3HA 5LQKA 5K8VA 4YDHB 5ES3A 1U28A 3ICWA 3SC6A 3VAYA 1DWPA 1KFCB 2ZXFA 3IBFA 1S7CA 3N2EA 3X1YA 1RIIA 3NHRA 5LJLA 2XLCA 1DXHA 2PRSA 4Q9AA 4Y2TA 4LX8A 3L06A 3I61A 3RYCA 1XMSA 1N92A 1B4DA 3NKFA 1JA1A 2GZAA 3OX1A 4OQFA 3R0ZA 3JQ8B 2H06A 5HDQA 1RQXA 3QA3E 1HH4A 2X7XA 2QN8A 5DNAA 3O8DA 3CBGA 5JMOA 3T94A 3SBDA 4ZKDA 4EYSA 1M6VB 2PMDA 3EQ2A 3LFUA 3OHMA 2YV2A 4JP2A 2PGIA 4C2TA 4DQVA 1QO7A 1ZUWA 2GPAA 3C3PA 3QBDA 5AQEA 5FF9A 5KQSA 3KP1A 4MPDA 4LV5B 1IM5A 1KC1A 4EI7A 2VZEA 4NF2A 2HQ1A 1UBMS 3IE0A 1JIQA 4MK4A 4M1YA 1VRWA 4JR0A 3FBTA 5GOZA 5HF8A 1IZ7A 4ARSA 5F9MA 5GOTA 1U3UA 2BGMA 4FXOA 3UHOA 2OILA 1STOA 3UWKA 3OM8A 1JBQA 3GUCA 3QITA 5FUBA 3O26A 4J76A 3UG6A 1PWHA 4BLTA 4CMCA 3HP1A 3RF6A 2JEYA 4PNPA 4BJ6A 4WIAA 4EF6A 4TTTS 2VHJA 1A4RA 3VOBA 4S0XA 2GN9A 2LZ0A 3SNHA 2X7HA 3TZHA 3THWB 2EDCA 2B78A 3U4QA 5G1PA 4DM3A 5PNTA 3SDSA 1HMPA 3LY9A 2ZFUA 5B1SA 4WLFA 5K6RA 1LX7A 4UHDA 3SS9X 1C7FA 2IVFA 1E94E 2JGDA 5DW0A 4KK3A 1GGJA 2UKDA 2RIRA 2YIMA 1WTCA 5FOVA 1W9HA 4KN8A 4JY7A 2XQVA 4B87A 5KNBD 2YHSA 1R5NA 3EPRA 2HKIA 1W5TA 1A5ZA 3SE7A 1W76A 2BM0A 2EDAA 2OAEA 4IJ6A 1UPXA 3CGWA 3EFOB 3K70C 1LVHA 3MT9A 4DY6A 1GNLA 1KVTA 2ZITA 4F9TA 3HCCA 5JO0A 4QUJA 1MOQA 2Y4NA 2P77A 4KX5A 1Z4NA 1N5IA 1Q22A 1V5IA 2CCJA 1Q1BA 2C2GA 6Q21A 2AFHE 3IVXA 1A9SA 4G6ZA 4J03A 5LP1A 1J24A 1QHHB 4BKUA 4GMKA 3THSA 1U5BB 5A02A 4OHXA 1U0OC 2J41A 5AIBA 4IXDA 4NJEA 4XWKA 4ND1A 1KDRA 1AXEA 1T8TA 5HCNA 1KRWA 3IPYA 1WSDA 2VCHA 4CHGA 2AK3A 5TSDA 3QMVA 3DJYA 5DTRA 2IFTA 5EXSA 1KF0A 2KLHA 2QLTA 1KU6A 3H5OA 2I87A 4MWGA 4MWDA 2VYFA 4JLKA 4MSUA 4RANA 5AI8A 2IBMA 1T24A 5EMLA 3VZSA 4CODB 1IHDA 1XXHE 1Y6RA 3DO8A 3ED5A 3KSMA 2GFHA 3OC6A 4WN9B 4Y6GB 5AIAA 3WFZA 4BKQA 3AHDA 3LV8A 3LM8A 4O29A 5AW5A 3RT9A 5HGJA 3JQBA 2HB6A 1XDGA 1PQPA 4MEJA 4KPYA 1SK9A 5JJBA 2PR2A 3GDHA 2FB9A 1W44A 3HL0A 2B1IA 4JBNA 2X2EA 4KQJA 4CKBA 3E2MA 3IQHX 4MJXA 3G1UA 4AUEA 1RM4A 3KQMA 4YAWA 4FE3A 3QV2A 1EIZA 2B4QA 4L4YA 3B1WA 3OLQA 2GHTA 1H6DA 1VZ2A 1IZYA 2QS9A 3BERA 1ZK1A 3NWPA 2IZZA 3WJ7A 5J2TA 5L3QB 3L04A 1UOQA 3SY8A 3TM5A 2HM7A 4C7MA 5ADHA 3KQHA 2PT6A 5BR4A 5EE3A 4BVEA 3FLAA 3ILHA 4MV9A 4ZVUA 3SYLA 4PXAA 3M6XA 1XBTA 5G40A 3IL2A 1WZNA 2F3QA 3I52A 1N5MA 2IS1A 1JUDA 3HACA 2FZWA 4F06A 3Q6NA 4AS2A 2FE4A 1EYZA 1RAIA 1WX1A 4QGBA 4AKTA 5K0CA 2F3UA 3MD0A 4U0KA 3PICA 4ND3A 2BEUA 1V3TA 1CP2A 1J5XA 2AXPA 2B4YA 5E1MA 2Q1TA 4TYQA 1KQFA 2QRQA 2NP6A 3DBOB 5FPTA 1M2KA 2JC3A 2XZPA 5H3LA 3ODGA 1T2VA 1IBRA 4LX0A 2YZGA 1L5MA 4TZ6A 3ZWWA 1FJXA 4LY6A 2VAXA 2D2EA 4LCBA 3UF0A 1WDKA 4OOFA 2BUAA 2IIPA 4OHBA 2Z5GA 4NV0A 4Y2QA 1NPYA 4IIJA 3R6TA 2XTJA 3T15A 5FXMA 2VP2A 2Q6IA 3ZWQA 3LX5A 4HQFA 1U7WA 5AW9A 4WACA 1E99A 1VYHA 2R8ZA 1HTBA 1P9OA 3D31A 3HE3A 1RPAA 3RVRA 5CB0A 4ASUD 5EKXA 3CSDA 4IHAA 4CQMB 4YREA 1EGQA 1N4AA 4M1EA 2ZRMA 1QPBA 2QLMA 1KIMA 2PXHA 1VECA 4B17A 2VJNA 3OLZA 1EUDB 1GIAA 2C59A 2VSQA 3CZAA 3OO1A 1W35A 3EC7A 3VPGA 3O4RA 4LHYA 3WKCA 4QARA 5C3MA 3JSXA 5E0KB 4FWTA 1BKDR 3GPBA 2Y9MB 1EVJA 3CE9A 4LNAA 3SYTA 4BZZA 1U2ZA 4LI3X 3AIMA 1GQQA 1UDWA 2H08A 2NU6B 4UVDA 3CVOA 4CQLA 4JZKA 1YBVA 3BIXA 3UJHA 5FBVB 4BLSA 1Z47A 4ZZ1A 2QP3A 3QYAA 1G6KA 2CUNA 4QBIA 2IXGA 1YASA 3VBCA 5AT1A 2W2LA 3BHIA 2CK3D 4YRAA 1ZSYA 5GP1A 3V8VA 4O1HA 4PBTA 4OFZA 4BVKA 1UBLS 2ARKA 1DAKA 2I2FA 3OUUA 2Q5IA 5AHWA 4HAOA 2B1GA 2C9DA 5KOYA 4GX2A 5IAGA 1SUAA 4DDUA 5KTTA 4MRAA 4N48A 3VKWA 3AF1A 4JXKA 4B9AA 5KMGB 4BTEA 5L8VA 4P84A 2HU8A 1EKXA 1ZY2A 4CIBA 1DKRA 5JYDA 4POOA 4ZVKA 5D7NA 3ROTA 4RPCA 2G8LA 3N0XA 9MHTA 3D8HA 3TLKA 1F2DA 4G81A 1JKIA 1BWPA 1WQ1R 3X43A 4EYQA 1GHTA 1H0RA 3CNEA 4Q93A 1MDFA 3WDKA 4BAGA 3LCUA 1XRLA 1ACMA 1IEVA 3BHJA 4P54A 4QUDA 5FPPA 2I2WA 3ICCA 3RC1A 1U1FA 3JD0A 2BZ0A 4D4MA 4IJQA 1F17A 4WVLA 3EULA 4ND2A 3D81A 1HLGA 1X8JA 3G2HA 4JBLA 5CLHA 2CFCA 4YRDA 4GKJB 4XFJA 3VO8A 4CT4B 5TLSA 1G5PA 4CG0A 2ZI9A 1QYDA 2ILVA 5JI2E 1BEZA 2NVWA 2PU7A 3BK7A 4L8GA 2I3BA 3GFPA 5DNEA 1G5RA 5FBQB 1SVOA 3G2KA 4HWGA 1H1TA 2DFLA 1IY2A 3TMAA 4RL6A 1H2EA 3ZYCA 3EA4A 4H4EA 4WOBA 3WMWA 2ZWPA 4BO7A 3WBKA 1USWA 4LBVA 1PGQA 4MZDA 1KKLA 1FP4A 3NQ41 3LL4A 3UOWA 5ABPA 4IO0A 2WSSA 4KRFA 3HLTA 5EIBD 3NTXA 4R16A 2WPNA 1IUPA 1F0PA 1M2VA 1TKCA 3LPMA 4LC0A 4JJ8A 3M3DA 3UWOA 4G5RA 5CXSA 5MGBA 3OY2A 2WJZB 1OZGA 2A35A 1JKXA 1Y8AA 2ZYHA 1I7QB 3TR6A 4PRZA 4X5OA 4HDMA 5HMMA 1Q44A 2C97A 5T7BA 1D5WA 3KT6A 5MN4A 1H4SA 2PSFA 3B7PA 4DLKA 4LHVA 4BZXA 3AVXA 1WO8A 2N9UA 2XT0A 3KYDA 3LPLA 1W2WB 5CFMA 1ENYA 3K70B 2BLNA 3CH6A 3NC0C 1W5AA 1V48A 3F2VA 4BXOA 4AMYA 1BA2A 1WMSA 1BS9A 3CWCA 4KAAA 3QHAA 5H5JA 1F6BA 2QTBA 5DTJA 1FLAA 1D8AA 1K6MA 4QU8A 3DUWA 5AKHA 1PDOA 1CJSA 2G9QA 3CZ9A 5BY2A 5B7PA 3FFAA 1Q91A 3DMHA 1ODIA 5JW6A 5CM9C 2C98A 3SYKA 3TIGA 4KE6A 3TBFA 1JEDA 1I7PA 2JD1A 2O2ZA 3DBIA 4LFCB 5ITZA 2EW2A 3NH9A 1DDIA 3VH3A 2XZOA 1H2AS 1O1YA 4HDQB 4DADA 3JRNA 5BYKA 2DFNA 3OTQA 4XR9A 2HV8A 2WPDD 4MX8A 3DTVD 4KRYA 2QD3A 2B2NA 3VXKA 1HE3A 3TL6A 1VPDA 1CHNA 2O07A 4FEAA 4RF3A 3HJRA 1YWGO 3VPXA 3LLVA 4HGRA 2I8AA 2XDWA 4J29A 5A0TA 1T2EA 4L9AA 4L8WB 5CA1A 1RRFA 1DTWB 1Q16A 4XVRA 5ULLA 5HS4A 2O8FB 4KLZA 1PTKA 1YFZA 3H1PA 2PIDA 3U3XA 5DNVA 5KWSA 1NMQA 2O3RA 3R6WA 3MTAA 3ILVA 1Q0QA 2V98A 1YK0A 1HLDA 3COYA 3NRCA 4GEGA 3DDCA 5F5NA 4CQJA 4DIEA 1OT3A 3CVUA 3ABSB 3H1AA 5A7GA 4QTXA 4UC0A 3COSA 4BP1A 4DZTA 3G2MA 1WP4A 5ECWA 4IMIB 1W49A 2FMIA 2OGUA 5AHRA 3THYA 4DUGA 1RHRA 4TKVA 3IRVA 1YR6A 2W90A 2PQMA 2HMWA 5B3JA 1XZ8A 3GRFA 2W43A 1W88B 4TUYB 2AG0A 3PT5A 4Q9IA 4IEEA 3WR5A 2EX4A 4UDXX 4UNIA 1JQ5A 5CYOA 2C0QA 3GXOA 1M2FA 4XIFA 4Z4HA 1U81A 1LW6E 1UANA 2CVPA 2XE6A 1CQIA 5JCJD 5EIXA 1OZFA 3A27A 3PUVA 5IAKA 2QM8A 3MA0A 4UVHA 1K5HA 1PV1A 2FJPA 3N7TA 3ORRA 1A95A 3OX4A 3PT9A 3VU9A 1QK3A 3AX6A 1U6IA 5EJFA 2FUG6 2I8LA 1PD1A 2H1HA 1RXYA 4W82A 4RF4A 4AG6A 3BXXA 5THKA 3LP8A 1J5PA 1NNSA 2OCPA 3OEEA 5EEGA 1N5RA 4ALIA 3B5EA 3EGVA 1V8PA 3OJLA 4KQKA 3EMVA 1VKOA 4CF7A 2C7VA 4CMBA 5BW6B 1R8QA 2ZYVX 1G16A 1H8HA 1W85B 1BHQ1 2I2DA 3HUFA 4D96A 2C29D 5CT6A 1G3RA 1I01A 1L1EA 4IXWA 3ZH9B 3LUCA 1UJNA 1SOWA 3UK7A 1M73E 3DFIA 3COZA 4LTMA 4N3NA 3K0KA 4LDRA 4CPDA 2NU7A 1Z9BA 1CR4A 3OI7A 2IWRA 4KGZA 1W2HA 4OF4A 2VPWA 3HM2A 3P9SA 3TSYA 4UUBA 3WNVA 4UM9B 4URVR 1MPXA 2W2KA 5DNDA 4B48A 1VE3A 1A50B 1PR3A 4WEQA 1EXWA 3BEOA 3KOMA 1Q1GA 2XWQA 3EXG1 3PUKA 4ZOQI 3H2KA 1IB0A 3GARA 1UBSB 1K98A 4FFBB 5FYDA 2LRHA 2Z04A 4L4ZA 1JHYA 4LBZA 2PYDA 3UO8B 1XWFA 1VLHA 4L5IA 4PWYA 2FP3A 5MF6A 4B3GA 3G7UA 1T0PA 1UJ5A 1BGXT 1T0HB 2HU7A 2PV0A 4AJLA 4EJ0A 1U28C 5EQJB 1ZM9A 2B1JA 3OUTA 3WYBA 1NMYA 4EGJA 2W8BA 3HXLA 1DJPA 1PJ4A 5KO2A 2A0XA 1V6CA 3VAZA 3OIVA 4BQFA 1H0SA 2FPKA 4CI9A 1IOWA 4YV7A 1JHMA 1YBMA 1ZXLA 2J3DA 4ZCRA 3V2GA 4B6RA 4BCBA 1ZW6A 2AYXA 4GFDA 3S1AA 3DEAA 3SLRA 1RM3A 4X00A 5IU6A 3ROQA 3WGZA 3KAQA 3HKEB 3CR3C 3LDAA 3DZDA 5IBPA 2OCIA 5CCEA 4HQOA 4E33A 4C6SA 2ZRKA 3NHZA 4I5IA 4JLVA 1PQUA 4KUEA 4F1WA 1XR3A 4D9MA 3H4VA 2PLRA 3RHFA 3FPLA 3ADBA 2CMFA 3PXCX 1KP3A 3LIPA 3KR1A 1JPJA 2BEJA 1VRCA 2ZRHA 4X84A 3FR7A 3V55A 4TWRA 4BJ5A 4KQ2A 1YA6A 3T5TA </