5DL1A

Clpp from staphylococcus aureus in complex with av145
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
191
structure length
188
Chain Sequence
LIPTVIETTERAYDIYSRLLKDRIIMLGSQIDDNVANSIVSQLLFLQAQDSEKDIYLYINSPGGSVTAGFAIYDTIQHIKPDVQTICIGMAASMGSFLLAAGAKGKRFALPNAEVMIHQPLGGAQGQATEIEIAANHILKTREKLNRILSERTGQSIEKIQKDTDRDNFLTAEEAKEYGLIDEVMVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reversible Inhibitors Arrest ClpP in a Defined Conformational State that Can Be Revoked by ClpX Association.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords ATP-dependent Clp protease proteolytic subunit
total genus 59
structure length 188
sequence length 191
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 3.4.21.92: Endopeptidase Clp.
pdb deposition date 2015-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00574 CLP_protease Clp protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5dl1A00
3KQFA 4B3IA 2IEXA 4QFEA 3PEAA 4FNBA 4FZWA 5INFA 2FZSA 4YLHA 4ZDEA 4JSBA 1XNVA 3K50A 3LKEA 3TDCA 5FIFA 3RSTA 1YG8A 3TVUA 3Q1TA 4GHNA 1EF9A 4LK5A 3V5IA 1Q52A 1Q51A 1ON9A 2CBYA 4I42A 4I52A 2VSUA 3T8BA 5DZKH 1PIXA 5CTCA 4RYFA 5G1QA 2VSUE 2PBPA 2VX2A 1WDLA 3HRXA 3R6HA 5IKLB 4F47A 2A7KA 1W2XA 3HP0A 4FN8A 3SWXA 2NP9A 3P5MA 2X24A 4U19A 2F9IA 2CE3A 3RRVA 4Q1IA 4ZDBA 2DEOA 1FC7A 2PG8A 5KJPA 2ZL3A 3KTHA 3Q0GA 3ST9A 1JXZA 4U18A 3KTKA 5DUFA 2DUBA 3QYRA 4EMMA 2PPYA 3ZWAA 1WDMA 4MOUA 4OG1A 3QWDA 2ZL4A 4K3WA 4ELWA 4K2NA 4JCRA 1N6FA 3FF6A 4RYFH 5C90A 2GTRA 1TYFA 3OT6A 4RCNA 4WCZA 3RSIA 3ZWCA 1XX4A 2A7SA 2F6QA 3R0OA 4JYJA 4U0HA 3KTIA 3KTJA 5FUSA 2ZQRA 4JOTA 3NJDA 3T3WA 2C8TA 3R9QA 2VSSF 3VIVA 3T8AA 3R9SA 3HLN1 3QK8A 4FN7A 3WG5A 2J5II 4ASIA 4GM2A 2ZQQA 5G1RA 2Q34A 3QXZA 4B3JA 3M6NA 4ZDCA 4OLQA 3GF7A 1NZYB 4WYOB 5JBXA 3GLMA 5JBWA 3U9RB 1PJHA 1XNWA 2Q35A 1HNOA 1WDKA 1UYVA 4L8KA 3MYBA 4ELSA 3Q0JA 2Q2XA 4KD6A 2VSSA 2ZL2A 3NJBA 1RJMA 1Y7OA 1VRGA 1DUBA 2F6IA 2WTBA 3DJAA 5KDRA 3SLLA 5INIA 3T89A 2D3TA 3BF0A 1HNUA 3BPPA 4EMPA 1XNYA 4NNQA 3TT6A 5MGBA 1X0UA 4JJTA 5C9GA 5DKPA 3H0QA 4ZDDA 3STAA 3P85A 3K8XA 4IZDA 3QKAA 4ELXA 2VSUC 3H0UA 3HINA 1N6EA 4JFCA 2EJ5A 3ZW9A 1OD4A 3QXIA 3KTGA 3V5EA 1OD2A 3TRRA 1EF8A 1WZ8A 5DL1A 3ZWBA 1O8UA 3PE8A 5DTPA 2QQ3A 2J5GA 2F9YA 4QIJA 1UYRA 5E0NX 3ZW8A 3IAVA 3FDUA 3DORA 2VSUF 3IBBA 1FCFA 1SZOA 2VSSE 3LAOA 4MI2A 2W3PA 3G64A 4G2RA 3PGQA 3P2LA 3OC7A 3BEZA 4JCTA 5G1SA 3ISAA 1ON3A 2J5SA 3N6RB 2FBMA 4U1AA 3MT6A 5DU8A 5E0SA 4IZBA 3GF3A 3I47A 4ZU2A 5CTBA 1TG6A 4I4ZA 1MJ3A 3QMJA 1EY3A 3TT7A 4FNDA 2UZFA 3MOYA 3R9TA 4KWBA 4U0GA 4KPKA 4EMLA 4K29A 1N6DA 2VREA 2ZL0A 4L6WA 4JCSA 1SG4A 3JU1A 3TZ3A 4OMRA 4DI1A 1YG6A 3IB9A 4HC8A 1UIYA 4WZ8B 4U0GH 4IZCA 5DZKA 3TVWA 1FC9A 3L3SA 3MFMA 4FJWD 5INGA 4JVTA 2F9IB 3H02A 4HNKA 3PZKA 5DUCA 1UYSA 4JWVA 3OMEA 1K39A 5DTWA 2BZRA 3QREA 3T88A 2A81A 2F9YB 4JCQA 4MXIA 4B3HA 4KNPA 2X58A 1J7XA 5KDRB 3GMAA 1HZDA 4Q0GA 4FB8A 1FC6A 3GKBA 3TLFA 4NEKA 3H0JA 3U9SB 3TV5A 3M6MA 1XO6A 2J5GD 2J5IB 5DU6A 1DCIA 1NZYA 4QIIA 2J5IA 2HW5A 1UYTA 2FW2A 4ZDFA 1K32A 3H0SA 5E0SH 4FZWC 3HE2A 5DU4A 3U9TB 3H81A 4JYLA 1RJNA 4Z0MA 3Q7HA
chains in the Genus database with same CATH superfamily
3KQFA 4B3IA 2IEXA 4QFEA 3PEAA 4FNBA 4FZWA 5INFA 2FZSA 4YLHA 4ZDEA 4JSBA 1XNVA 3K50A 3LKEA 3TDCA 5FIFA 3RSTA 1YG8A 3TVUA 3Q1TA 4GHNA 1EF9A 4LK5A 3V5IA 4J2UA 1Q52A 1Q51A 1ON9A 2CBYA 4I42A 4I52A 2VSUA 3T8BA 5DZKH 1PIXA 5CTCA 4RYFA 5G1QA 2VSUE 2PBPA 2VX2A 1WDLA 3HRXA 3R6HA 5IKLB 4F47A 2A7KA 1W2XA 3HP0A 4FN8A 3SWXA 2NP9A 3P5MA 2X24A 4U19A 2F9IA 2CE3A 3RRVA 4Q1IA 4ZDBA 2DEOA 1FC7A 2PG8A 5KJPA 2ZL3A 3KTHA 3Q0GA 3ST9A 1JXZA 4U18A 3KTKA 5DUFA 2DUBA 3QYRA 4EMMA 2PPYA 3ZWAA 1WDMA 4MOUA 4OG1A 3QWDA 2ZL4A 4K3WA 4ELWA 4K2NA 4JCRA 1N6FA 3FF6A 4RYFH 5C90A 2GTRA 1TYFA 3OT6A 4RCNA 4WCZA 3RSIA 3ZWCA 1XX4A 2A7SA 2F6QA 3R0OA 4JYJA 4U0HA 3KTIA 3KTJA 5FUSA 2ZQRA 4JOTA 3NJDA 4HDTA 3T3WA 2C8TA 4NARA 3R9QA 2VSSF 3VIVA 3T8AA 3R9SA 3HLN1 3QK8A 4FN7A 3WG5A 2J5II 4ASIA 4GM2A 2ZQQA 5G1RA 2Q34A 3QXZA 4B3JA 3M6NA 4ZDCA 4OLQA 3GF7A 1NZYB 4WYOB 5JBXA 3GLMA 5JBWA 3U9RB 1PJHA 1XNWA 2Q35A 1HNOA 1WDKA 1UYVA 4L8KA 3MYBA 4ELSA 3Q0JA 2Q2XA 4KD6A 2VSSA 2ZL2A 3NJBA 1RJMA 1Y7OA 1VRGA 1DUBA 2F6IA 2WTBA 5HUQA 3DJAA 5KDRA 3SLLA 5INIA 3T89A 2D3TA 3BF0A 1HNUA 3BPPA 4EMPA 1XNYA 4NNQA 3TT6A 5MGBA 1X0UA 4JJTA 5C9GA 5DKPA 3H0QA 4ZDDA 3STAA 3P85A 3K8XA 4IZDA 3QKAA 4ELXA 2VSUC 3H0UA 3HINA 1N6EA 4JFCA 2EJ5A 3ZW9A 1OD4A 3BPTA 3QXIA 3KTGA 3V5EA 1OD2A 3TRRA 1EF8A 1WZ8A 5DL1A 3ZWBA 1O8UA 3PE8A 5DTPA 2QQ3A 2J5GA 2YJGA 2F9YA 4QIJA 1UYRA 5E0NX 3ZW8A 3IAVA 3FDUA 3DORA 2VSUF 3IBBA 1FCFA 1SZOA 2VSSE 3LAOA 4MI2A 2W3PA 3G64A 4G2RA 3PGQA 3P2LA 3OC7A 3BEZA 4JCTA 5G1SA 3ISAA 1ON3A 2J5SA 3N6RB 2FBMA 4U1AA 3MT6A 5DU8A 5E0SA 4IZBA 3GF3A 3I47A 4ZU2A 5CTBA 1TG6A 4I4ZA 1MJ3A 3QMJA 1EY3A 3TT7A 4FNDA 2UZFA 3MOYA 3R9TA 4KWBA 4U0GA 4KPKA 4EMLA 4K29A 1N6DA 2VREA 2ZL0A 4L6WA 4JCSA 1SG4A 3JU1A 3TZ3A 4OMRA 4DI1A 1YG6A 3IB9A 4HC8A 1UIYA 4WZ8B 4U0GH 4IZCA 5DZKA 3TVWA 1FC9A 3L3SA 3MFMA 4FJWD 5INGA 4JVTA 2F9IB 3H02A 4HNKA 3PZKA 5DUCA 1UYSA 4JWVA 3OMEA 1K39A 5DTWA 2BZRA 3QREA 3T88A 2A81A 2F9YB 4JCQA 4MXIA 4B3HA 4KNPA 2X58A 1J7XA 5KDRB 3GMAA 1HZDA 4Q0GA 4FB8A 1FC6A 3GKBA 3TLFA 4NEKA 3H0JA 3U9SB 3TV5A 3M6MA 1XO6A 2J5GD 2J5IB 5DU6A 1DCIA 1NZYA 4QIIA 2J5IA 2HW5A 1UYTA 2FW2A 4ZDFA 1K32A 3H0SA 5E0SH 4FZWC 3HE2A 5DU4A 3U9TB 3H81A 4JYLA 1RJNA 4Z0MA 3Q7HA
chains in the Genus database with same CATH topology
3KQFA 4B3IA 2IEXA 4QFEA 3PEAA 4FNBA 4FZWA 5INFA 2FZSA 4YLHA 4ZDEA 4JSBA 1XNVA 3K50A 3LKEA 3TDCA 5FIFA 3RSTA 1YG8A 3TVUA 3Q1TA 4GHNA 1EF9A 4LK5A 3V5IA 4J2UA 1Q52A 1Q51A 1ON9A 2CBYA 4I42A 4I52A 2VSUA 3T8BA 5DZKH 1PIXA 5CTCA 4RYFA 5G1QA 2VSUE 2PBPA 2VX2A 1WDLA 3HRXA 3R6HA 5IKLB 4F47A 2A7KA 1W2XA 3HP0A 4FN8A 3SWXA 2NP9A 3P5MA 2X24A 4U19A 2F9IA 2CE3A 3RRVA 4Q1IA 4ZDBA 2DEOA 1FC7A 2PG8A 5KJPA 2ZL3A 3KTHA 3Q0GA 3ST9A 1JXZA 4U18A 3KTKA 5DUFA 2DUBA 3QYRA 4EMMA 2PPYA 3ZWAA 1WDMA 4MOUA 4OG1A 3QWDA 2ZL4A 4K3WA 4ELWA 4K2NA 4JCRA 1N6FA 3FF6A 4RYFH 5C90A 2GTRA 1TYFA 3OT6A 4RCNA 4WCZA 3RSIA 3ZWCA 1XX4A 2A7SA 2F6QA 3R0OA 4JYJA 4U0HA 3KTIA 3KTJA 5FUSA 2ZQRA 4JOTA 3NJDA 4HDTA 3T3WA 2C8TA 4NARA 3R9QA 2VSSF 3VIVA 3T8AA 3R9SA 3HLN1 3QK8A 4FN7A 3WG5A 2J5II 4ASIA 4GM2A 2ZQQA 5G1RA 2Q34A 3QXZA 4B3JA 3M6NA 4ZDCA 4OLQA 3GF7A 1NZYB 4WYOB 5JBXA 3GLMA 5JBWA 3U9RB 1PJHA 1XNWA 2Q35A 1HNOA 1WDKA 1UYVA 4L8KA 3MYBA 4ELSA 3Q0JA 2Q2XA 4KD6A 2VSSA 2ZL2A 3NJBA 1RJMA 1Y7OA 1VRGA 1DUBA 2F6IA 2WTBA 5HUQA 3DJAA 5KDRA 3SLLA 5INIA 3T89A 2D3TA 3BF0A 1HNUA 3BPPA 4EMPA 1XNYA 4NNQA 3TT6A 5MGBA 1X0UA 4JJTA 5C9GA 5DKPA 3H0QA 4ZDDA 3STAA 3P85A 3K8XA 4IZDA 3QKAA 4ELXA 2VSUC 3H0UA 3HINA 1N6EA 4JFCA 2EJ5A 3ZW9A 1OD4A 3BPTA 3QXIA 3KTGA 3V5EA 1OD2A 3TRRA 1EF8A 1WZ8A 5DL1A 3ZWBA 1O8UA 3PE8A 5DTPA 2QQ3A 2J5GA 2YJGA 2F9YA 4QIJA 1UYRA 5E0NX 3ZW8A 3IAVA 3FDUA 3DORA 2VSUF 3IBBA 1FCFA 1SZOA 2VSSE 3LAOA 4MI2A 2W3PA 3G64A 4G2RA 3PGQA 3P2LA 3OC7A 3BEZA 4JCTA 5G1SA 3ISAA 1ON3A 2J5SA 3N6RB 2FBMA 4U1AA 3MT6A 5DU8A 5E0SA 4IZBA 3GF3A 3I47A 4ZU2A 5CTBA 1TG6A 4I4ZA 1MJ3A 3QMJA 1EY3A 3TT7A 4FNDA 2UZFA 3MOYA 3R9TA 4KWBA 4U0GA 4KPKA 4EMLA 4K29A 1N6DA 2VREA 2ZL0A 4L6WA 4JCSA 1SG4A 3JU1A 3TZ3A 4OMRA 4DI1A 1YG6A 3IB9A 4HC8A 1UIYA 4WZ8B 4U0GH 4IZCA 5DZKA 3TVWA 1FC9A 3L3SA 3MFMA 4FJWD 5INGA 4JVTA 2F9IB 3H02A 4HNKA 3PZKA 5DUCA 1UYSA 4JWVA 3OMEA 1K39A 5DTWA 2BZRA 3QREA 3T88A 2A81A 2F9YB 4JCQA 4MXIA 4B3HA 4KNPA 2X58A 1J7XA 5KDRB 3GMAA 1HZDA 4Q0GA 4FB8A 1FC6A 3GKBA 3TLFA 4NEKA 3H0JA 3U9SB 3TV5A 3M6MA 1XO6A 2J5GD 2J5IB 5DU6A 1DCIA 1NZYA 4QIIA 2J5IA 2HW5A 1UYTA 2FW2A 4ZDFA 1K32A 3H0SA 5E0SH 4FZWC 3HE2A 5DU4A 3U9TB 3H81A 4JYLA 1RJNA 4Z0MA 3Q7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQF A;  4B3I A;  2IEX A;  4QFE A;  3PEA A;  4FNB A;  4FZW A;  5INF A;  2FZS A;  4YLH A;  4ZDE A;  4JSB A;  1XNV A;  3K50 A;  3LKE A;  3TDC A;  5FIF A;  3RST A;  1YG8 A;  3TVU A;  3Q1T A;  4GHN A;  1EF9 A;  4LK5 A;  3V5I A;  1Q52 A;  1Q51 A;  1ON9 A;  2CBY A;  4I42 A;  4I52 A;  2VSU A;  3T8B A;  5DZK H;  1PIX A;  5CTC A;  4RYF A;  5G1Q A;  2VSU E;  2PBP A;  2VX2 A;  1WDL A;  3HRX A;  3R6H A;  5IKL B;  4F47 A;  2A7K A;  1W2X A;  3HP0 A;  4FN8 A;  3SWX A;  2NP9 A;  3P5M A;  2X24 A;  4U19 A;  2F9I A;  2CE3 A;  3RRV A;  4Q1I A;  4ZDB A;  2DEO A;  1FC7 A;  2PG8 A;  5KJP A;  2ZL3 A;  3KTH A;  3Q0G A;  3ST9 A;  1JXZ A;  4U18 A;  3KTK A;  5DUF A;  2DUB A;  3QYR A;  4EMM A;  2PPY A;  3ZWA A;  1WDM A;  4MOU A;  4OG1 A;  3QWD A;  2ZL4 A;  4K3W A;  4ELW A;  4K2N A;  4JCR A;  1N6F A;  3FF6 A;  4RYF H;  5C90 A;  2GTR A;  1TYF A;  3OT6 A;  4RCN A;  4WCZ A;  3RSI A;  3ZWC A;  1XX4 A;  2A7S A;  2F6Q A;  3R0O A;  4JYJ A;  4U0H A;  3KTI A;  3KTJ A;  5FUS A;  2ZQR A;  4JOT A;  3NJD A;  3T3W A;  2C8T A;  3R9Q A;  2VSS F;  3VIV A;  3T8A A;  3R9S A;  3HLN 1;  3QK8 A;  4FN7 A;  3WG5 A;  2J5I I;  4ASI A;  4GM2 A;  2ZQQ A;  5G1R A;  2Q34 A;  3QXZ A;  4B3J A;  3M6N A;  4ZDC A;  4OLQ A;  3GF7 A;  1NZY B;  4WYO B;  5JBX A;  3GLM A;  5JBW A;  3U9R B;  1PJH A;  1XNW A;  2Q35 A;  1HNO A;  1WDK A;  1UYV A;  4L8K A;  3MYB A;  4ELS A;  3Q0J A;  2Q2X A;  4KD6 A;  2VSS A;  2ZL2 A;  3NJB A;  1RJM A;  1Y7O A;  1VRG A;  1DUB A;  2F6I A;  2WTB A;  3DJA A;  5KDR A;  3SLL A;  5INI A;  3T89 A;  2D3T A;  3BF0 A;  1HNU A;  3BPP A;  4EMP A;  1XNY A;  4NNQ A;  3TT6 A;  5MGB A;  1X0U A;  4JJT A;  5C9G A;  5DKP A;  3H0Q A;  4ZDD A;  3STA A;  3P85 A;  3K8X A;  4IZD A;  3QKA A;  4ELX A;  2VSU C;  3H0U A;  3HIN A;  1N6E A;  4JFC A;  2EJ5 A;  3ZW9 A;  1OD4 A;  3QXI A;  3KTG A;  3V5E A;  1OD2 A;  3TRR A;  1EF8 A;  1WZ8 A;  5DL1 A;  3ZWB A;  1O8U A;  3PE8 A;  5DTP A;  2QQ3 A;  2J5G A;  2F9Y A;  4QIJ A;  1UYR A;  5E0N X;  3ZW8 A;  3IAV A;  3FDU A;  3DOR A;  2VSU F;  3IBB A;  1FCF A;  1SZO A;  2VSS E;  3LAO A;  4MI2 A;  2W3P A;  3G64 A;  4G2R A;  3PGQ A;  3P2L A;  3OC7 A;  3BEZ A;  4JCT A;  5G1S A;  3ISA A;  1ON3 A;  2J5S A;  3N6R B;  2FBM A;  4U1A A;  3MT6 A;  5DU8 A;  5E0S A;  4IZB A;  3GF3 A;  3I47 A;  4ZU2 A;  5CTB A;  1TG6 A;  4I4Z A;  1MJ3 A;  3QMJ A;  1EY3 A;  3TT7 A;  4FND A;  2UZF A;  3MOY A;  3R9T A;  4KWB A;  4U0G A;  4KPK A;  4EML A;  4K29 A;  1N6D A;  2VRE A;  2ZL0 A;  4L6W A;  4JCS A;  1SG4 A;  3JU1 A;  3TZ3 A;  4OMR A;  4DI1 A;  1YG6 A;  3IB9 A;  4HC8 A;  1UIY A;  4WZ8 B;  4U0G H;  4IZC A;  5DZK A;  3TVW A;  1FC9 A;  3L3S A;  3MFM A;  4FJW D;  5ING A;  4JVT A;  2F9I B;  3H02 A;  4HNK A;  3PZK A;  5DUC A;  1UYS A;  4JWV A;  3OME A;  1K39 A;  5DTW A;  2BZR A;  3QRE A;  3T88 A;  2A81 A;  2F9Y B;  4JCQ A;  4MXI A;  4B3H A;  4KNP A;  2X58 A;  1J7X A;  5KDR B;  3GMA A;  1HZD A;  4Q0G A;  4FB8 A;  1FC6 A;  3GKB A;  3TLF A;  4NEK A;  3H0J A;  3U9S B;  3TV5 A;  3M6M A;  1XO6 A;  2J5G D;  2J5I B;  5DU6 A;  1DCI A;  1NZY A;  4QII A;  2J5I A;  2HW5 A;  1UYT A;  2FW2 A;  4ZDF A;  1K32 A;  3H0S A;  5E0S H;  4FZW C;  3HE2 A;  5DU4 A;  3U9T B;  3H81 A;  4JYL A;  1RJN A;  4Z0M A;  3Q7H A; 
#chains in the Genus database with same CATH topology
 3KQF A;  4B3I A;  2IEX A;  4QFE A;  3PEA A;  4FNB A;  4FZW A;  5INF A;  2FZS A;  4YLH A;  4ZDE A;  4JSB A;  1XNV A;  3K50 A;  3LKE A;  3TDC A;  5FIF A;  3RST A;  1YG8 A;  3TVU A;  3Q1T A;  4GHN A;  1EF9 A;  4LK5 A;  3V5I A;  4J2U A;  1Q52 A;  1Q51 A;  1ON9 A;  2CBY A;  4I42 A;  4I52 A;  2VSU A;  3T8B A;  5DZK H;  1PIX A;  5CTC A;  4RYF A;  5G1Q A;  2VSU E;  2PBP A;  2VX2 A;  1WDL A;  3HRX A;  3R6H A;  5IKL B;  4F47 A;  2A7K A;  1W2X A;  3HP0 A;  4FN8 A;  3SWX A;  2NP9 A;  3P5M A;  2X24 A;  4U19 A;  2F9I A;  2CE3 A;  3RRV A;  4Q1I A;  4ZDB A;  2DEO A;  1FC7 A;  2PG8 A;  5KJP A;  2ZL3 A;  3KTH A;  3Q0G A;  3ST9 A;  1JXZ A;  4U18 A;  3KTK A;  5DUF A;  2DUB A;  3QYR A;  4EMM A;  2PPY A;  3ZWA A;  1WDM A;  4MOU A;  4OG1 A;  3QWD A;  2ZL4 A;  4K3W A;  4ELW A;  4K2N A;  4JCR A;  1N6F A;  3FF6 A;  4RYF H;  5C90 A;  2GTR A;  1TYF A;  3OT6 A;  4RCN A;  4WCZ A;  3RSI A;  3ZWC A;  1XX4 A;  2A7S A;  2F6Q A;  3R0O A;  4JYJ A;  4U0H A;  3KTI A;  3KTJ A;  5FUS A;  2ZQR A;  4JOT A;  3NJD A;  4HDT A;  3T3W A;  2C8T A;  4NAR A;  3R9Q A;  2VSS F;  3VIV A;  3T8A A;  3R9S A;  3HLN 1;  3QK8 A;  4FN7 A;  3WG5 A;  2J5I I;  4ASI A;  4GM2 A;  2ZQQ A;  5G1R A;  2Q34 A;  3QXZ A;  4B3J A;  3M6N A;  4ZDC A;  4OLQ A;  3GF7 A;  1NZY B;  4WYO B;  5JBX A;  3GLM A;  5JBW A;  3U9R B;  1PJH A;  1XNW A;  2Q35 A;  1HNO A;  1WDK A;  1UYV A;  4L8K A;  3MYB A;  4ELS A;  3Q0J A;  2Q2X A;  4KD6 A;  2VSS A;  2ZL2 A;  3NJB A;  1RJM A;  1Y7O A;  1VRG A;  1DUB A;  2F6I A;  2WTB A;  5HUQ A;  3DJA A;  5KDR A;  3SLL A;  5INI A;  3T89 A;  2D3T A;  3BF0 A;  1HNU A;  3BPP A;  4EMP A;  1XNY A;  4NNQ A;  3TT6 A;  5MGB A;  1X0U A;  4JJT A;  5C9G A;  5DKP A;  3H0Q A;  4ZDD A;  3STA A;  3P85 A;  3K8X A;  4IZD A;  3QKA A;  4ELX A;  2VSU C;  3H0U A;  3HIN A;  1N6E A;  4JFC A;  2EJ5 A;  3ZW9 A;  1OD4 A;  3BPT A;  3QXI A;  3KTG A;  3V5E A;  1OD2 A;  3TRR A;  1EF8 A;  1WZ8 A;  5DL1 A;  3ZWB A;  1O8U A;  3PE8 A;  5DTP A;  2QQ3 A;  2J5G A;  2YJG A;  2F9Y A;  4QIJ A;  1UYR A;  5E0N X;  3ZW8 A;  3IAV A;  3FDU A;  3DOR A;  2VSU F;  3IBB A;  1FCF A;  1SZO A;  2VSS E;  3LAO A;  4MI2 A;  2W3P A;  3G64 A;  4G2R A;  3PGQ A;  3P2L A;  3OC7 A;  3BEZ A;  4JCT A;  5G1S A;  3ISA A;  1ON3 A;  2J5S A;  3N6R B;  2FBM A;  4U1A A;  3MT6 A;  5DU8 A;  5E0S A;  4IZB A;  3GF3 A;  3I47 A;  4ZU2 A;  5CTB A;  1TG6 A;  4I4Z A;  1MJ3 A;  3QMJ A;  1EY3 A;  3TT7 A;  4FND A;  2UZF A;  3MOY A;  3R9T A;  4KWB A;  4U0G A;  4KPK A;  4EML A;  4K29 A;  1N6D A;  2VRE A;  2ZL0 A;  4L6W A;  4JCS A;  1SG4 A;  3JU1 A;  3TZ3 A;  4OMR A;  4DI1 A;  1YG6 A;  3IB9 A;  4HC8 A;  1UIY A;  4WZ8 B;  4U0G H;  4IZC A;  5DZK A;  3TVW A;  1FC9 A;  3L3S A;  3MFM A;  4FJW D;  5ING A;  4JVT A;  2F9I B;  3H02 A;  4HNK A;  3PZK A;  5DUC A;  1UYS A;  4JWV A;  3OME A;  1K39 A;  5DTW A;  2BZR A;  3QRE A;  3T88 A;  2A81 A;  2F9Y B;  4JCQ A;  4MXI A;  4B3H A;  4KNP A;  2X58 A;  1J7X A;  5KDR B;  3GMA A;  1HZD A;  4Q0G A;  4FB8 A;  1FC6 A;  3GKB A;  3TLF A;  4NEK A;  3H0J A;  3U9S B;  3TV5 A;  3M6M A;  1XO6 A;  2J5G D;  2J5I B;  5DU6 A;  1DCI A;  1NZY A;  4QII A;  2J5I A;  2HW5 A;  1UYT A;  2FW2 A;  4ZDF A;  1K32 A;  3H0S A;  5E0S H;  4FZW C;  3HE2 A;  5DU4 A;  3U9T B;  3H81 A;  4JYL A;  1RJN A;  4Z0M A;  3Q7H A; 
#chains in the Genus database with same CATH homology
 3KQF A;  4B3I A;  2IEX A;  4QFE A;  3PEA A;  4FNB A;  4FZW A;  5INF A;  2FZS A;  4YLH A;  4ZDE A;  4JSB A;  1XNV A;  3K50 A;  3LKE A;  3TDC A;  5FIF A;  3RST A;  1YG8 A;  3TVU A;  3Q1T A;  4GHN A;  1EF9 A;  4LK5 A;  3V5I A;  4J2U A;  1Q52 A;  1Q51 A;  1ON9 A;  2CBY A;  4I42 A;  4I52 A;  2VSU A;  3T8B A;  5DZK H;  1PIX A;  5CTC A;  4RYF A;  5G1Q A;  2VSU E;  2PBP A;  2VX2 A;  1WDL A;  3HRX A;  3R6H A;  5IKL B;  4F47 A;  2A7K A;  1W2X A;  3HP0 A;  4FN8 A;  3SWX A;  2NP9 A;  3P5M A;  2X24 A;  4U19 A;  2F9I A;  2CE3 A;  3RRV A;  4Q1I A;  4ZDB A;  2DEO A;  1FC7 A;  2PG8 A;  5KJP A;  2ZL3 A;  3KTH A;  3Q0G A;  3ST9 A;  1JXZ A;  4U18 A;  3KTK A;  5DUF A;  2DUB A;  3QYR A;  4EMM A;  2PPY A;  3ZWA A;  1WDM A;  4MOU A;  4OG1 A;  3QWD A;  2ZL4 A;  4K3W A;  4ELW A;  4K2N A;  4JCR A;  1N6F A;  3FF6 A;  4RYF H;  5C90 A;  2GTR A;  1TYF A;  3OT6 A;  4RCN A;  4WCZ A;  3RSI A;  3ZWC A;  1XX4 A;  2A7S A;  2F6Q A;  3R0O A;  4JYJ A;  4U0H A;  3KTI A;  3KTJ A;  5FUS A;  2ZQR A;  4JOT A;  3NJD A;  4HDT A;  3T3W A;  2C8T A;  4NAR A;  3R9Q A;  2VSS F;  3VIV A;  3T8A A;  3R9S A;  3HLN 1;  3QK8 A;  4FN7 A;  3WG5 A;  2J5I I;  4ASI A;  4GM2 A;  2ZQQ A;  5G1R A;  2Q34 A;  3QXZ A;  4B3J A;  3M6N A;  4ZDC A;  4OLQ A;  3GF7 A;  1NZY B;  4WYO B;  5JBX A;  3GLM A;  5JBW A;  3U9R B;  1PJH A;  1XNW A;  2Q35 A;  1HNO A;  1WDK A;  1UYV A;  4L8K A;  3MYB A;  4ELS A;  3Q0J A;  2Q2X A;  4KD6 A;  2VSS A;  2ZL2 A;  3NJB A;  1RJM A;  1Y7O A;  1VRG A;  1DUB A;  2F6I A;  2WTB A;  5HUQ A;  3DJA A;  5KDR A;  3SLL A;  5INI A;  3T89 A;  2D3T A;  3BF0 A;  1HNU A;  3BPP A;  4EMP A;  1XNY A;  4NNQ A;  3TT6 A;  5MGB A;  1X0U A;  4JJT A;  5C9G A;  5DKP A;  3H0Q A;  4ZDD A;  3STA A;  3P85 A;  3K8X A;  4IZD A;  3QKA A;  4ELX A;  2VSU C;  3H0U A;  3HIN A;  1N6E A;  4JFC A;  2EJ5 A;  3ZW9 A;  1OD4 A;  3BPT A;  3QXI A;  3KTG A;  3V5E A;  1OD2 A;  3TRR A;  1EF8 A;  1WZ8 A;  5DL1 A;  3ZWB A;  1O8U A;  3PE8 A;  5DTP A;  2QQ3 A;  2J5G A;  2YJG A;  2F9Y A;  4QIJ A;  1UYR A;  5E0N X;  3ZW8 A;  3IAV A;  3FDU A;  3DOR A;  2VSU F;  3IBB A;  1FCF A;  1SZO A;  2VSS E;  3LAO A;  4MI2 A;  2W3P A;  3G64 A;  4G2R A;  3PGQ A;  3P2L A;  3OC7 A;  3BEZ A;  4JCT A;  5G1S A;  3ISA A;  1ON3 A;  2J5S A;  3N6R B;  2FBM A;  4U1A A;  3MT6 A;  5DU8 A;  5E0S A;  4IZB A;  3GF3 A;  3I47 A;  4ZU2 A;  5CTB A;  1TG6 A;  4I4Z A;  1MJ3 A;  3QMJ A;  1EY3 A;  3TT7 A;  4FND A;  2UZF A;  3MOY A;  3R9T A;  4KWB A;  4U0G A;  4KPK A;  4EML A;  4K29 A;  1N6D A;  2VRE A;  2ZL0 A;  4L6W A;  4JCS A;  1SG4 A;  3JU1 A;  3TZ3 A;  4OMR A;  4DI1 A;  1YG6 A;  3IB9 A;  4HC8 A;  1UIY A;  4WZ8 B;  4U0G H;  4IZC A;  5DZK A;  3TVW A;  1FC9 A;  3L3S A;  3MFM A;  4FJW D;  5ING A;  4JVT A;  2F9I B;  3H02 A;  4HNK A;  3PZK A;  5DUC A;  1UYS A;  4JWV A;  3OME A;  1K39 A;  5DTW A;  2BZR A;  3QRE A;  3T88 A;  2A81 A;  2F9Y B;  4JCQ A;  4MXI A;  4B3H A;  4KNP A;  2X58 A;  1J7X A;  5KDR B;  3GMA A;  1HZD A;  4Q0G A;  4FB8 A;  1FC6 A;  3GKB A;  3TLF A;  4NEK A;  3H0J A;  3U9S B;  3TV5 A;  3M6M A;  1XO6 A;  2J5G D;  2J5I B;  5DU6 A;  1DCI A;  1NZY A;  4QII A;  2J5I A;  2HW5 A;  1UYT A;  2FW2 A;  4ZDF A;  1K32 A;  3H0S A;  5E0S H;  4FZW C;  3HE2 A;  5DU4 A;  3U9T B;  3H81 A;  4JYL A;  1RJN A;  4Z0M A;  3Q7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...