5DL8A

Crystal structure of acinetobacter baumannii occab4
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
391
structure length
391
Chain Sequence
NPNQQTEDEWKFTLKNAYINRDFDNDALKDTGSWSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAVRLSSDKHVADTVLPFNKETQSQASDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTNLKSQLSDQLYAEIGRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLYNKHYVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIGESAYPLPDGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFKAANGEKNHETESNVILNYAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
molecule tags Membrane protein
molecule keywords Benzoate transport porin BenP
total genus 111
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl8A00
4LSHA 2XE5A 4RJXA 3T0SA 2J1NA 3K19A 3VY8X 3POQA 1PHOA 3WI4A 4RJWA 1GFQA 2PRNA 1OSMA 1BH3A 2XG6A 3SY9A 4LSEA 1HXUA 4KRAA 3POUA 4LSFA 2OMFA 3EMNX 2FGQX 3NSGA 3UPGA 2XE3A 1HXTA 3A2SX 8PRNA 4FSOA 2J4UP 3SZDA 2XE2A 3O0EA 6PRNA 3T20A 1HXXA 1MPFA 4KR8A 4GCQA 4D5UA 2ZLDA 3T24A 3JTYA 5DL8A 3VZUX 2Y2XA 4FMSA 3HWBA 5DL6A 2O4VA 2ODJA 3VY9X 3PORA 4GCPA 1GFPA 4GCSA 4KR4A 4C69X 3PRNA 2Y0HA 4D65A 1PRNA 3VZTX 4JFBA 4LSIA 3SYBA 1H6S1 1OPFA 3VZWX 5FVNA 1GFOA 4FRTA 5DL7A 2PORA 3POXA 2Y0KA 3WI5A 5DL5A 3SZVA 1GFNA 4D64A 3FYXA 1GFMA 5PRNA 7PRNA 3UU2A 2K4TA 4FT6A 4FSPA 2ZFGA 4BUMX 4AUIA 4FOZA 3SYSA 3HW9A 2XE1A 1E54A 4FRXA 2FGRA 3SY7A 2QTKA 1BT9A 5JDPA 2Y0LA
chains in the Genus database with same CATH superfamily
4PR7A 4U9CA 1QJPA 4LSHA 2XE5A 4GF4A 4RJXA 3LK3A 2J1NA 3LK2A 2WVPA 5E79O 2ERVA 4E1TA 3K19A 3VY8X 3POQA 3AA6A 1PHOA 4G75A 1ZHYA 4O3WA 4RJWA 3AA6B 3WI4A 1GFQA 2PRNA 4K3CA 4C00A 1OSMA 3VE2A 1BH3A 3WU2O 3AA1A 3LK2B 5KAIO 2XG6A 4LSEA 4JCHA 5G38A 3SY9A 4B61A 2WJQA 3DA4A 1HXUA 3PGRA 4XNKA 4IL6O 3AA7A 3T0SA 5AFUK 2IWWA 4KRAA 3POUA 3PQUA 4LSFA 2OMFA 4AFKA 3KZIO 4FESA 3EMNX 5TISO 2FGQX 3NSGA 3UPGA 3GP6A 1IZNB 3DWOX 2XE3A 1HXTA 3AAAA 4QQ1A 4O49A 2KDYA 4G76A 3AAEB 3A2SX 8PRNA 4FSOA 2J4UP 2Y7SA 4FQEA 3SZDA 4AKMA 2XE2A 3G7GA 3PF1A 3O0EA 4O3YA 3JCUO 6PRNA 5H2FO 3T20A 3A0BO 3DZMA 3C5OA 1HXXA 1MPFA 4KR8A 5B5EO 2JQYA 5GV0A 4GCQA 4D5UA 3BRYA 3BS0A 1ORMA 2M07A 4FZMA 1Q9FA 2ZLDA 4K3BA 4N75A 2R4PA 4AKRA 3T24A 3JTYA 5DL8A 3VZUX 2Y2XA 2M06A 3A0HO 1QJ9A 3UAQA 4FMSA 3HWBA 4FUVA 2O4VA 2ODJA 5DL6A 3VY9X 1P4TA 1MM5A 2KXPB 3AA1B 4UB8O 2R4LA 2XMXA 3PORA 1THQA 3DWNA 4O4UA 4PJ0O 3NJTA 5D5DA 4N58A 5EE2A 4GCPA 1GFPA 2MHLA 4GCSA 4KR4A 4FZLA 1G90A 4Z3TA 4UB6O 5AFUL 3AA0B 4RL9A 2LFUA 3LK3B 5GTIO 4XNLA 4C69X 1ZHWA 3HOLA 2N2MA 3PGSA 3PRNA 3DA3A 4PUXA 5G26A 5ADXK 5G39A 5GTHO 3TZGA 2Y0HA 3AA7B 3AAEA 3BRZA 3PGUA 4GHBA 4N74A 4D65A 3KVDD 5B66O 2YNKA 1MM4A 3HOEA 1PRNA 2GE4A 3VZTX 4AZLA 2AXTO 3AA0A 4JFBA 1QJ8A 4LSIA 3SYBA 3LK41 1H6S1 1OPFA 1S5LO 3VZWX 5FVNA 1ZHZA 4RLBA 1T16A 2W80C 2W81C 2KZ7B 1GFOA 1YS5A 3LK42 4FRTA 2KC0A 2PORA 3POXA 4RLCA 4O4XA 5DL7A 2Y0KA 3WI5A 2R8AA 4N59A 5DL5A 3SZVA 1GFNA 5KAFO 4AYEC 4AYID 4D64A 3FYXA 1GFMA 1T1LA 5PRNA 4AYMC 2XTRA 7PRNA 3UU2A 2K4TA 4F4BA 4FT6A 3QRAA 4AKRB 4AYDC 1BXWA 2R89A 4FSPA 2ZFGA 2KXPA 1ZHXA 2F1VA 4BUMX 4AUIA 4AYNA 3RBHA 4FOZA 3QRCA 1Q9GA 2MNHA 2R4OA 3SYSA 5IYUA 2JMMA 3HW9A 2LHFA 2X9KA 2YPVA 4CTDA 2XE1A 2WJRA 1E54A 4FRXA 2X27X 2K0LA 5G3AA 2F1TA 2FGRA 5T5FA 3SY7A 3V8UA 2R4NA 2QTKA 4C4VA 1BT9A 4O3ZA 2IWVA 2R88A 4C4VB 2F1CX 2N2LA 4O3XB 4E1SA 3AAAB 3VE1A 5JDPA 1IZNA 2Y0LA 3PQSA 2XTQA 1ZHTA 2KZ7A 4FZNA 5ADXL
chains in the Genus database with same CATH topology
4U9CA 1QJPA 4LSHA 2XE5A 4GF4A 4RJXA 3LK3A 2J1NA 3LK2A 3T0SA 4E1TA 2ERVA 3K19A 3VY8X 3POQA 3AA6A 1PHOA 4G75A 1ZHYA 4O3WA 4RJWA 3AA6B 3WI4A 1GFQA 2PRNA 1OSMA 3VE2A 1BH3A 3AA1A 3LK2B 2XG6A 4LSEA 4JCHA 3SY9A 4B61A 3DA4A 5AFUK 1HXUA 4XNKA 3AA7A 4KRAA 3POUA 3PQUA 4LSFA 2OMFA 4AFKA 4FESA 3EMNX 2FGQX 3NSGA 3UPGA 3GP6A 1IZNB 2XE3A 1HXTA 3AAAA 4QQ1A 4O49A 2KDYA 4G76A 3AAEB 3A2SX 8PRNA 4FSOA 2J4UP 2Y7SA 3SZDA 4AKMA 2XE2A 3G7GA 3O0EA 4O3YA 6PRNA 3T20A 3C5OA 1HXXA 1MPFA 4KR8A 5GV0A 4GCQA 4D5UA 4FZMA 1ORMA 2M07A 1Q9FA 2ZLDA 4AKRA 3T24A 3JTYA 5DL8A 3VZUX 2Y2XA 2M06A 3UAQA 1QJ9A 4FMSA 3HWBA 4FUVA 2O4VA 2ODJA 5DL6A 3VY9X 1P4TA 1MM5A 2KXPB 3AA1B 2XMXA 3PORA 1THQA 4O4UA 5D5DA 4N58A 5EE2A 4GCPA 1GFPA 2MHLA 4GCSA 4KR4A 4FZLA 1G90A 4Z3TA 5AFUL 3AA0B 4RL9A 2LFUA 3LK3B 4XNLA 4C69X 1ZHWA 3HOLA 2N2MA 3PRNA 3DA3A 4PUXA 5G26A 5ADXK 3TZGA 2Y0HA 3AA7B 3AAEA 4D65A 4GHBA 3KVDD 2YNKA 1MM4A 3HOEA 1PRNA 2GE4A 3VZTX 4AZLA 3AA0A 4JFBA 4LSIA 1QJ8A 3SYBA 3LK41 1H6S1 1OPFA 3VZWX 5FVNA 1ZHZA 4RLBA 2KZ7B 2W80C 2W81C 1GFOA 1YS5A 3LK42 4FRTA 2KC0A 2PORA 3POXA 4RLCA 4O4XA 5DL7A 2Y0KA 3WI5A 4N59A 4AYID 5DL5A 3SZVA 1GFNA 4AYEC 4D64A 3FYXA 1GFMA 5PRNA 4AYMC 7PRNA 2XTRA 3UU2A 2K4TA 4F4BA 4FT6A 3QRAA 4AKRB 4AYDC 1BXWA 4FSPA 2ZFGA 2KXPA 1ZHXA 2F1VA 4BUMX 4AUIA 4AYNA 3RBHA 4FOZA 3QRCA 1Q9GA 2MNHA 3SYSA 5IYUA 2JMMA 3HW9A 2LHFA 2YPVA 2XE1A 1E54A 4FRXA 2X27X 2K0LA 2F1TA 2FGRA 5T5FA 3SY7A 3V8UA 2QTKA 1BT9A 4O3ZA 2N2LA 4O3XB 4E1SA 3AAAB 3VE1A 5JDPA 1IZNA 2Y0LA 3PQSA 2XTQA 1ZHTA 2KZ7A 4FZNA 5ADXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSH A;  2XE5 A;  4RJX A;  3T0S A;  2J1N A;  3K19 A;  3VY8 X;  3POQ A;  1PHO A;  3WI4 A;  4RJW A;  1GFQ A;  2PRN A;  1OSM A;  1BH3 A;  2XG6 A;  3SY9 A;  4LSE A;  1HXU A;  4KRA A;  3POU A;  4LSF A;  2OMF A;  3EMN X;  2FGQ X;  3NSG A;  3UPG A;  2XE3 A;  1HXT A;  3A2S X;  8PRN A;  4FSO A;  2J4U P;  3SZD A;  2XE2 A;  3O0E A;  6PRN A;  3T20 A;  1HXX A;  1MPF A;  4KR8 A;  4GCQ A;  4D5U A;  2ZLD A;  3T24 A;  3JTY A;  5DL8 A;  3VZU X;  2Y2X A;  4FMS A;  3HWB A;  5DL6 A;  2O4V A;  2ODJ A;  3VY9 X;  3POR A;  4GCP A;  1GFP A;  4GCS A;  4KR4 A;  4C69 X;  3PRN A;  2Y0H A;  4D65 A;  1PRN A;  3VZT X;  4JFB A;  4LSI A;  3SYB A;  1H6S 1;  1OPF A;  3VZW X;  5FVN A;  1GFO A;  4FRT A;  5DL7 A;  2POR A;  3POX A;  2Y0K A;  3WI5 A;  5DL5 A;  3SZV A;  1GFN A;  4D64 A;  3FYX A;  1GFM A;  5PRN A;  7PRN A;  3UU2 A;  2K4T A;  4FT6 A;  4FSP A;  2ZFG A;  4BUM X;  4AUI A;  4FOZ A;  3SYS A;  3HW9 A;  2XE1 A;  1E54 A;  4FRX A;  2FGR A;  3SY7 A;  2QTK A;  1BT9 A;  5JDP A;  2Y0L A; 
#chains in the Genus database with same CATH topology
 4PR7 A;  4U9C A;  1QJP A;  4LSH A;  2XE5 A;  4GF4 A;  4RJX A;  3LK3 A;  2J1N A;  3LK2 A;  2WVP A;  5E79 O;  2ERV A;  4E1T A;  3K19 A;  3VY8 X;  3POQ A;  3AA6 A;  1PHO A;  4G75 A;  1ZHY A;  4O3W A;  4RJW A;  3AA6 B;  3WI4 A;  1GFQ A;  2PRN A;  4K3C A;  4C00 A;  1OSM A;  3VE2 A;  1BH3 A;  3WU2 O;  3AA1 A;  3LK2 B;  5KAI O;  2XG6 A;  4LSE A;  4JCH A;  5G38 A;  3SY9 A;  4B61 A;  2WJQ A;  3DA4 A;  1HXU A;  3PGR A;  4XNK A;  4IL6 O;  3AA7 A;  3T0S A;  5AFU K;  2IWW A;  4KRA A;  3POU A;  3PQU A;  4LSF A;  2OMF A;  4AFK A;  3KZI O;  4FES A;  3EMN X;  5TIS O;  2FGQ X;  3NSG A;  3UPG A;  3GP6 A;  1IZN B;  3DWO X;  2XE3 A;  1HXT A;  3AAA A;  4QQ1 A;  4O49 A;  2KDY A;  4G76 A;  3AAE B;  3A2S X;  8PRN A;  4FSO A;  2J4U P;  2Y7S A;  4FQE A;  3SZD A;  4AKM A;  2XE2 A;  3G7G A;  3PF1 A;  3O0E A;  4O3Y A;  3JCU O;  6PRN A;  5H2F O;  3T20 A;  3A0B O;  3DZM A;  3C5O A;  1HXX A;  1MPF A;  4KR8 A;  5B5E O;  2JQY A;  5GV0 A;  4GCQ A;  4D5U A;  3BRY A;  3BS0 A;  1ORM A;  2M07 A;  4FZM A;  1Q9F A;  2ZLD A;  4K3B A;  4N75 A;  2R4P A;  4AKR A;  3T24 A;  3JTY A;  5DL8 A;  3VZU X;  2Y2X A;  2M06 A;  3A0H O;  1QJ9 A;  3UAQ A;  4FMS A;  3HWB A;  4FUV A;  2O4V A;  2ODJ A;  5DL6 A;  3VY9 X;  1P4T A;  1MM5 A;  2KXP B;  3AA1 B;  4UB8 O;  2R4L A;  2XMX A;  3POR A;  1THQ A;  3DWN A;  4O4U A;  4PJ0 O;  3NJT A;  5D5D A;  4N58 A;  5EE2 A;  4GCP A;  1GFP A;  2MHL A;  4GCS A;  4KR4 A;  4FZL A;  1G90 A;  4Z3T A;  4UB6 O;  5AFU L;  3AA0 B;  4RL9 A;  2LFU A;  3LK3 B;  5GTI O;  4XNL A;  4C69 X;  1ZHW A;  3HOL A;  2N2M A;  3PGS A;  3PRN A;  3DA3 A;  4PUX A;  5G26 A;  5ADX K;  5G39 A;  5GTH O;  3TZG A;  2Y0H A;  3AA7 B;  3AAE A;  3BRZ A;  3PGU A;  4GHB A;  4N74 A;  4D65 A;  3KVD D;  5B66 O;  2YNK A;  1MM4 A;  3HOE A;  1PRN A;  2GE4 A;  3VZT X;  4AZL A;  2AXT O;  3AA0 A;  4JFB A;  1QJ8 A;  4LSI A;  3SYB A;  3LK4 1;  1H6S 1;  1OPF A;  1S5L O;  3VZW X;  5FVN A;  1ZHZ A;  4RLB A;  1T16 A;  2W80 C;  2W81 C;  2KZ7 B;  1GFO A;  1YS5 A;  3LK4 2;  4FRT A;  2KC0 A;  2POR A;  3POX A;  4RLC A;  4O4X A;  5DL7 A;  2Y0K A;  3WI5 A;  2R8A A;  4N59 A;  5DL5 A;  3SZV A;  1GFN A;  5KAF O;  4AYE C;  4AYI D;  4D64 A;  3FYX A;  1GFM A;  1T1L A;  5PRN A;  4AYM C;  2XTR A;  7PRN A;  3UU2 A;  2K4T A;  4F4B A;  4FT6 A;  3QRA A;  4AKR B;  4AYD C;  1BXW A;  2R89 A;  4FSP A;  2ZFG A;  2KXP A;  1ZHX A;  2F1V A;  4BUM X;  4AUI A;  4AYN A;  3RBH A;  4FOZ A;  3QRC A;  1Q9G A;  2MNH A;  2R4O A;  3SYS A;  5IYU A;  2JMM A;  3HW9 A;  2LHF A;  2X9K A;  2YPV A;  4CTD A;  2XE1 A;  2WJR A;  1E54 A;  4FRX A;  2X27 X;  2K0L A;  5G3A A;  2F1T A;  2FGR A;  5T5F A;  3SY7 A;  3V8U A;  2R4N A;  2QTK A;  4C4V A;  1BT9 A;  4O3Z A;  2IWV A;  2R88 A;  4C4V B;  2F1C X;  2N2L A;  4O3X B;  4E1S A;  3AAA B;  3VE1 A;  5JDP A;  1IZN A;  2Y0L A;  3PQS A;  2XTQ A;  1ZHT A;  2KZ7 A;  4FZN A;  5ADX L; 
#chains in the Genus database with same CATH homology
 4U9C A;  1QJP A;  4LSH A;  2XE5 A;  4GF4 A;  4RJX A;  3LK3 A;  2J1N A;  3LK2 A;  3T0S A;  4E1T A;  2ERV A;  3K19 A;  3VY8 X;  3POQ A;  3AA6 A;  1PHO A;  4G75 A;  1ZHY A;  4O3W A;  4RJW A;  3AA6 B;  3WI4 A;  1GFQ A;  2PRN A;  1OSM A;  3VE2 A;  1BH3 A;  3AA1 A;  3LK2 B;  2XG6 A;  4LSE A;  4JCH A;  3SY9 A;  4B61 A;  3DA4 A;  5AFU K;  1HXU A;  4XNK A;  3AA7 A;  4KRA A;  3POU A;  3PQU A;  4LSF A;  2OMF A;  4AFK A;  4FES A;  3EMN X;  2FGQ X;  3NSG A;  3UPG A;  3GP6 A;  1IZN B;  2XE3 A;  1HXT A;  3AAA A;  4QQ1 A;  4O49 A;  2KDY A;  4G76 A;  3AAE B;  3A2S X;  8PRN A;  4FSO A;  2J4U P;  2Y7S A;  3SZD A;  4AKM A;  2XE2 A;  3G7G A;  3O0E A;  4O3Y A;  6PRN A;  3T20 A;  3C5O A;  1HXX A;  1MPF A;  4KR8 A;  5GV0 A;  4GCQ A;  4D5U A;  4FZM A;  1ORM A;  2M07 A;  1Q9F A;  2ZLD A;  4AKR A;  3T24 A;  3JTY A;  5DL8 A;  3VZU X;  2Y2X A;  2M06 A;  3UAQ A;  1QJ9 A;  4FMS A;  3HWB A;  4FUV A;  2O4V A;  2ODJ A;  5DL6 A;  3VY9 X;  1P4T A;  1MM5 A;  2KXP B;  3AA1 B;  2XMX A;  3POR A;  1THQ A;  4O4U A;  5D5D A;  4N58 A;  5EE2 A;  4GCP A;  1GFP A;  2MHL A;  4GCS A;  4KR4 A;  4FZL A;  1G90 A;  4Z3T A;  5AFU L;  3AA0 B;  4RL9 A;  2LFU A;  3LK3 B;  4XNL A;  4C69 X;  1ZHW A;  3HOL A;  2N2M A;  3PRN A;  3DA3 A;  4PUX A;  5G26 A;  5ADX K;  3TZG A;  2Y0H A;  3AA7 B;  3AAE A;  4D65 A;  4GHB A;  3KVD D;  2YNK A;  1MM4 A;  3HOE A;  1PRN A;  2GE4 A;  3VZT X;  4AZL A;  3AA0 A;  4JFB A;  4LSI A;  1QJ8 A;  3SYB A;  3LK4 1;  1H6S 1;  1OPF A;  3VZW X;  5FVN A;  1ZHZ A;  4RLB A;  2KZ7 B;  2W80 C;  2W81 C;  1GFO A;  1YS5 A;  3LK4 2;  4FRT A;  2KC0 A;  2POR A;  3POX A;  4RLC A;  4O4X A;  5DL7 A;  2Y0K A;  3WI5 A;  4N59 A;  4AYI D;  5DL5 A;  3SZV A;  1GFN A;  4AYE C;  4D64 A;  3FYX A;  1GFM A;  5PRN A;  4AYM C;  7PRN A;  2XTR A;  3UU2 A;  2K4T A;  4F4B A;  4FT6 A;  3QRA A;  4AKR B;  4AYD C;  1BXW A;  4FSP A;  2ZFG A;  2KXP A;  1ZHX A;  2F1V A;  4BUM X;  4AUI A;  4AYN A;  3RBH A;  4FOZ A;  3QRC A;  1Q9G A;  2MNH A;  3SYS A;  5IYU A;  2JMM A;  3HW9 A;  2LHF A;  2YPV A;  2XE1 A;  1E54 A;  4FRX A;  2X27 X;  2K0L A;  2F1T A;  2FGR A;  5T5F A;  3SY7 A;  3V8U A;  2QTK A;  1BT9 A;  4O3Z A;  2N2L A;  4O3X B;  4E1S A;  3AAA B;  3VE1 A;  5JDP A;  1IZN A;  2Y0L A;  3PQS A;  2XTQ A;  1ZHT A;  2KZ7 A;  4FZN A;  5ADX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...