5DL8A

Crystal structure of acinetobacter baumannii occab4
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
391
structure length
391
Chain Sequence
NPNQQTEDEWKFTLKNAYINRDFDNDALKDTGSWSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAVRLSSDKHVADTVLPFNKETQSQASDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTNLKSQLSDQLYAEIGRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLYNKHYVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIGESAYPLPDGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFKAANGEKNHETESNVILNYAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
molecule tags Membrane protein
molecule keywords Benzoate transport porin BenP
total genus 111
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl8A00
4FMSA 5DL6A 5FVNA 1MPFA 7PRNA 3SY9A 4D64A 2Y0KA 3UU2A 5PRNA 3NSGA 4GCPA 2XE1A 4GCQA 8PRNA 1HXTA 1PRNA 2J4UP 2Y0LA 1H6S1 4KR4A 4FT6A 6PRNA 3VZWX 3EMNX 4D5UA 5DL7A 1GFQA 2PORA 3POXA 3SZDA 2FGQX 2XE5A 2ODJA 3PORA 3WI4A 3SY7A 4D65A 3HW9A 4JFBA 2ZFGA 2FGRA 2Y2XA 2XE2A 4GCSA 3SYSA 4RJXA 2ZLDA 4KRAA 3VZTX 3SZVA 1BT9A 2K4TA 3T20A 3FYXA 3POUA 3JTYA 5JDPA 1BH3A 2J1NA 3PRNA 1HXUA 3SYBA 3A2SX 2O4VA 4LSIA 4BUMX 1GFMA 1OSMA 3UPGA 3POQA 4RJWA 3VY8X 2XE3A 3VY9X 2PRNA 4LSEA 1GFOA 1PHOA 1HXXA 4FRXA 4LSFA 1E54A 4KR8A 3T0SA 1OPFA 2QTKA 4LSHA 1GFPA 2Y0HA 4FSPA 5DL5A 2XG6A 3T24A 4FRTA 4FSOA 3WI5A 5DL8A 4C69X 3O0EA 3VZUX 3K19A 4FOZA 1GFNA 4AUIA 2OMFA 3HWBA
chains in the Genus database with same CATH superfamily
4FMSA 3LK3A 4N59A 5DL6A 2X27X 5FVNA 1P4TA 1MPFA 3VE2A 7PRNA 2W81C 3QRCA 4N74A 4AKRA 5AFUL 4E1SA 2ERVA 2X9KA 1IZNA 4FZNA 2K0LA 4N58A 1IZNB 3SY9A 4D64A 2IWWA 2Y7SA 4AYNA 4C4VB 2Y0KA 3AAAB 4JCHA 3UU2A 3AAAA 5PRNA 3NJTA 3NSGA 3PGSA 4GCPA 2MNHA 2XE1A 2KXPA 5B5EO 1BXWA 2N2MA 2JMMA 5GTIO 4FZMA 2KDYA 4FESA 2IWVA 1HXTA 4GCQA 8PRNA 1PRNA 4O3ZA 2J4UP 2Y0LA 4AYMC 2YNKA 5ADXK 3HOLA 2W80C 3DA4A 1H6S1 2R88A 4CTDA 2KZ7B 5G26A 4C00A 2KZ7A 3BRZA 4FT6A 4KR4A 3GP6A 4AYEC 6PRNA 3AA6A 3PGRA 1QJPA 2WVPA 3EMNX 3VZWX 4RL9A 3AAEB 4D5UA 1MM5A 3UAQA 3AA7B 5DL7A 4O3XB 3AA7A 1QJ8A 3AA0B 3LK41 2F1VA 1GFQA 2PORA 4XNKA 3POXA 1ZHTA 2WJQA 4N75A 3SZDA 3TZGA 2FGQX 3AA1B 4FUVA 2XE5A 2MHLA 2ODJA 3PORA 5D5DA 2XTRA 4O3YA 3A0BO 3RBHA 1ZHZA 5KAFO 3WI4A 3SY7A 4D65A 2WJRA 3HW9A 2R4PA 5G39A 3AA0A 1YS5A 4JFBA 2ZFGA 3JCUO 3PGUA 3LK3B 2FGRA 2KC0A 3DZMA 3HOEA 3DWNA 2Y2XA 2XE2A 4GCSA 4E1TA 3SYSA 4O4UA 4RLCA 4RJXA 5GV0A 2ZLDA 4G76A 4KRAA 4AZLA 3VZTX 2LFUA 4AYDC 2R4OA 3SZVA 3VE1A 1BT9A 1ZHYA 2K4TA 1S5LO 2KXPB 2R89A 4PJ0O 2R4NA 3PQUA 3C5OA 3V8UA 3T20A 5KAIO 3LK42 4IL6O 3FYXA 5EE2A 1ORMA 3POUA 3LK2A 3JTYA 5JDPA 4FZLA 1BH3A 1MM4A 2GE4A 2J1NA 1HXUA 2M06A 3A0HO 3PRNA 5G3AA 3SYBA 4AFKA 4AKRB 3A2SX 1ZHXA 2O4VA 4G75A 3AA6B 2JQYA 4LSIA 4BUMX 1GFMA 3BS0A 1Q9FA 1OSMA 3QRAA 3BRYA 3UPGA 3LK2B 4AKMA 3KVDD 5GTHO 3HWBA 4QQ1A 3POQA 4K3CA 4RJWA 3VY8X 3WU2O 3PF1A 2R4LA 3PQSA 5T5FA 2XTQA 5AFUK 1T1LA 2XE3A 2YPVA 3VY9X 3AA1A 5E79O 4Z3TA 5IYUA 2AXTO 2PRNA 3DWOX 4RLBA 4LSEA 2XMXA 3KZIO 4U9CA 1GFOA 4XNLA 1PHOA 1HXXA 4FRXA 4LSFA 5ADXL 1E54A 4GHBA 4KR8A 3T0SA 1OPFA 4F4BA 2QTKA 3AAEA 4B61A 4LSHA 4UB8O 1GFPA 2Y0HA 1ZHWA 4FSPA 3DA3A 4O4XA 2M07A 4PUXA 5H2FO 5DL5A 4FQEA 2XG6A 4K3BA 1THQA 2R8AA 4FRTA 4O3WA 4FSOA 3T24A 3WI5A 5DL8A 1G90A 2N2LA 4C69X 3G7GA 5TISO 4AYID 3O0EA 5G38A 3VZUX 1T16A 2F1CX 3K19A 4FOZA 4GF4A 1GFNA 1QJ9A 4AUIA 4PR7A 4C4VA 1Q9GA 4O49A 4UB6O 2OMFA 5B66O 2LHFA 2F1TA
chains in the Genus database with same CATH topology
4FMSA 3LK3A 4N59A 5DL6A 2X27X 5FVNA 1P4TA 1MPFA 3VE2A 7PRNA 2W81C 3QRCA 4AKRA 5AFUL 4E1SA 2ERVA 3SY9A 1IZNA 4FZNA 2K0LA 4N58A 1IZNB 4D64A 2Y7SA 4AYNA 2Y0KA 3AAAB 4JCHA 3UU2A 3AAAA 5PRNA 3NSGA 4GCPA 2MNHA 2XE1A 2KXPA 1BXWA 2N2MA 2JMMA 4FZMA 2KDYA 4FESA 4GCQA 1HXTA 8PRNA 1PRNA 4O3ZA 2J4UP 2Y0LA 4AYMC 2YNKA 5ADXK 3HOLA 2W80C 3DA4A 1H6S1 2KZ7B 5G26A 2KZ7A 4FT6A 4KR4A 4AYEC 3GP6A 6PRNA 3AA6A 1QJPA 3VZWX 3EMNX 4D5UA 4RL9A 3AAEB 1MM5A 3UAQA 3AA7B 5DL7A 4O3XB 3AA7A 1QJ8A 3AA0B 3LK41 2F1VA 1GFQA 2PORA 4XNKA 3POXA 1ZHTA 3SZDA 3TZGA 2FGQX 3AA1B 4FUVA 2XE5A 2MHLA 2ODJA 3PORA 5D5DA 2XTRA 4O3YA 3RBHA 1ZHZA 3WI4A 3SY7A 4D65A 3HW9A 3AA0A 1YS5A 4JFBA 2ZFGA 3LK3B 2FGRA 2KC0A 3HOEA 2Y2XA 2XE2A 4GCSA 4E1TA 3SYSA 4O4UA 4RLCA 4RJXA 5GV0A 2ZLDA 4G76A 4KRAA 4AZLA 3VZTX 2LFUA 4AYDC 3SZVA 3VE1A 1BT9A 1ZHYA 2K4TA 2KXPB 3V8UA 3T20A 3PQUA 3C5OA 3LK42 3FYXA 5EE2A 1ORMA 3POUA 3LK2A 3JTYA 5JDPA 4FZLA 1BH3A 1MM4A 2GE4A 2J1NA 1HXUA 2M06A 3PRNA 3SYBA 4AFKA 4AKRB 3A2SX 1ZHXA 2O4VA 4G75A 3AA6B 4LSIA 4BUMX 1GFMA 1Q9FA 1OSMA 3QRAA 3UPGA 3LK2B 4AKMA 3KVDD 3HWBA 4QQ1A 3POQA 4RJWA 3VY8X 5AFUK 3PQSA 5T5FA 2XTQA 2XE3A 2YPVA 3VY9X 3AA1A 4Z3TA 5IYUA 2PRNA 4RLBA 4LSEA 2XMXA 4U9CA 1GFOA 4XNLA 1PHOA 1HXXA 4FRXA 4LSFA 5ADXL 1E54A 4GHBA 4KR8A 3T0SA 1OPFA 4F4BA 2QTKA 3AAEA 4B61A 4LSHA 1GFPA 2Y0HA 1ZHWA 4FSPA 3DA3A 4O4XA 2M07A 4PUXA 5DL5A 2XG6A 4O3WA 1THQA 4FRTA 3T24A 1G90A 4FSOA 3WI5A 5DL8A 2N2LA 4C69X 3G7GA 4AYID 3O0EA 3VZUX 3K19A 4FOZA 4GF4A 1GFNA 1QJ9A 4AUIA 1Q9GA 4O49A 2OMFA 2LHFA 2F1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMS A;  5DL6 A;  5FVN A;  1MPF A;  7PRN A;  3SY9 A;  4D64 A;  2Y0K A;  3UU2 A;  5PRN A;  3NSG A;  4GCP A;  2XE1 A;  4GCQ A;  8PRN A;  1HXT A;  1PRN A;  2J4U P;  2Y0L A;  1H6S 1;  4KR4 A;  4FT6 A;  6PRN A;  3VZW X;  3EMN X;  4D5U A;  5DL7 A;  1GFQ A;  2POR A;  3POX A;  3SZD A;  2FGQ X;  2XE5 A;  2ODJ A;  3POR A;  3WI4 A;  3SY7 A;  4D65 A;  3HW9 A;  4JFB A;  2ZFG A;  2FGR A;  2Y2X A;  2XE2 A;  4GCS A;  3SYS A;  4RJX A;  2ZLD A;  4KRA A;  3VZT X;  3SZV A;  1BT9 A;  2K4T A;  3T20 A;  3FYX A;  3POU A;  3JTY A;  5JDP A;  1BH3 A;  2J1N A;  3PRN A;  1HXU A;  3SYB A;  3A2S X;  2O4V A;  4LSI A;  4BUM X;  1GFM A;  1OSM A;  3UPG A;  3POQ A;  4RJW A;  3VY8 X;  2XE3 A;  3VY9 X;  2PRN A;  4LSE A;  1GFO A;  1PHO A;  1HXX A;  4FRX A;  4LSF A;  1E54 A;  4KR8 A;  3T0S A;  1OPF A;  2QTK A;  4LSH A;  1GFP A;  2Y0H A;  4FSP A;  5DL5 A;  2XG6 A;  3T24 A;  4FRT A;  4FSO A;  3WI5 A;  5DL8 A;  4C69 X;  3O0E A;  3VZU X;  3K19 A;  4FOZ A;  1GFN A;  4AUI A;  2OMF A;  3HWB A; 
#chains in the Genus database with same CATH topology
 4FMS A;  3LK3 A;  4N59 A;  5DL6 A;  2X27 X;  5FVN A;  1P4T A;  1MPF A;  3VE2 A;  7PRN A;  2W81 C;  3QRC A;  4N74 A;  4AKR A;  5AFU L;  4E1S A;  2ERV A;  2X9K A;  1IZN A;  4FZN A;  2K0L A;  4N58 A;  1IZN B;  3SY9 A;  4D64 A;  2IWW A;  2Y7S A;  4AYN A;  4C4V B;  2Y0K A;  3AAA B;  4JCH A;  3UU2 A;  3AAA A;  5PRN A;  3NJT A;  3NSG A;  3PGS A;  4GCP A;  2MNH A;  2XE1 A;  2KXP A;  5B5E O;  1BXW A;  2N2M A;  2JMM A;  5GTI O;  4FZM A;  2KDY A;  4FES A;  2IWV A;  1HXT A;  4GCQ A;  8PRN A;  1PRN A;  4O3Z A;  2J4U P;  2Y0L A;  4AYM C;  2YNK A;  5ADX K;  3HOL A;  2W80 C;  3DA4 A;  1H6S 1;  2R88 A;  4CTD A;  2KZ7 B;  5G26 A;  4C00 A;  2KZ7 A;  3BRZ A;  4FT6 A;  4KR4 A;  3GP6 A;  4AYE C;  6PRN A;  3AA6 A;  3PGR A;  1QJP A;  2WVP A;  3EMN X;  3VZW X;  4RL9 A;  3AAE B;  4D5U A;  1MM5 A;  3UAQ A;  3AA7 B;  5DL7 A;  4O3X B;  3AA7 A;  1QJ8 A;  3AA0 B;  3LK4 1;  2F1V A;  1GFQ A;  2POR A;  4XNK A;  3POX A;  1ZHT A;  2WJQ A;  4N75 A;  3SZD A;  3TZG A;  2FGQ X;  3AA1 B;  4FUV A;  2XE5 A;  2MHL A;  2ODJ A;  3POR A;  5D5D A;  2XTR A;  4O3Y A;  3A0B O;  3RBH A;  1ZHZ A;  5KAF O;  3WI4 A;  3SY7 A;  4D65 A;  2WJR A;  3HW9 A;  2R4P A;  5G39 A;  3AA0 A;  1YS5 A;  4JFB A;  2ZFG A;  3JCU O;  3PGU A;  3LK3 B;  2FGR A;  2KC0 A;  3DZM A;  3HOE A;  3DWN A;  2Y2X A;  2XE2 A;  4GCS A;  4E1T A;  3SYS A;  4O4U A;  4RLC A;  4RJX A;  5GV0 A;  2ZLD A;  4G76 A;  4KRA A;  4AZL A;  3VZT X;  2LFU A;  4AYD C;  2R4O A;  3SZV A;  3VE1 A;  1BT9 A;  1ZHY A;  2K4T A;  1S5L O;  2KXP B;  2R89 A;  4PJ0 O;  2R4N A;  3PQU A;  3C5O A;  3V8U A;  3T20 A;  5KAI O;  3LK4 2;  4IL6 O;  3FYX A;  5EE2 A;  1ORM A;  3POU A;  3LK2 A;  3JTY A;  5JDP A;  4FZL A;  1BH3 A;  1MM4 A;  2GE4 A;  2J1N A;  1HXU A;  2M06 A;  3A0H O;  3PRN A;  5G3A A;  3SYB A;  4AFK A;  4AKR B;  3A2S X;  1ZHX A;  2O4V A;  4G75 A;  3AA6 B;  2JQY A;  4LSI A;  4BUM X;  1GFM A;  3BS0 A;  1Q9F A;  1OSM A;  3QRA A;  3BRY A;  3UPG A;  3LK2 B;  4AKM A;  3KVD D;  5GTH O;  3HWB A;  4QQ1 A;  3POQ A;  4K3C A;  4RJW A;  3VY8 X;  3WU2 O;  3PF1 A;  2R4L A;  3PQS A;  5T5F A;  2XTQ A;  5AFU K;  1T1L A;  2XE3 A;  2YPV A;  3VY9 X;  3AA1 A;  5E79 O;  4Z3T A;  5IYU A;  2AXT O;  2PRN A;  3DWO X;  4RLB A;  4LSE A;  2XMX A;  3KZI O;  4U9C A;  1GFO A;  4XNL A;  1PHO A;  1HXX A;  4FRX A;  4LSF A;  5ADX L;  1E54 A;  4GHB A;  4KR8 A;  3T0S A;  1OPF A;  4F4B A;  2QTK A;  3AAE A;  4B61 A;  4LSH A;  4UB8 O;  1GFP A;  2Y0H A;  1ZHW A;  4FSP A;  3DA3 A;  4O4X A;  2M07 A;  4PUX A;  5H2F O;  5DL5 A;  4FQE A;  2XG6 A;  4K3B A;  1THQ A;  2R8A A;  4FRT A;  4O3W A;  4FSO A;  3T24 A;  3WI5 A;  5DL8 A;  1G90 A;  2N2L A;  4C69 X;  3G7G A;  5TIS O;  4AYI D;  3O0E A;  5G38 A;  3VZU X;  1T16 A;  2F1C X;  3K19 A;  4FOZ A;  4GF4 A;  1GFN A;  1QJ9 A;  4AUI A;  4PR7 A;  4C4V A;  1Q9G A;  4O49 A;  4UB6 O;  2OMF A;  5B66 O;  2LHF A;  2F1T A; 
#chains in the Genus database with same CATH homology
 4FMS A;  3LK3 A;  4N59 A;  5DL6 A;  2X27 X;  5FVN A;  1P4T A;  1MPF A;  3VE2 A;  7PRN A;  2W81 C;  3QRC A;  4AKR A;  5AFU L;  4E1S A;  2ERV A;  3SY9 A;  1IZN A;  4FZN A;  2K0L A;  4N58 A;  1IZN B;  4D64 A;  2Y7S A;  4AYN A;  2Y0K A;  3AAA B;  4JCH A;  3UU2 A;  3AAA A;  5PRN A;  3NSG A;  4GCP A;  2MNH A;  2XE1 A;  2KXP A;  1BXW A;  2N2M A;  2JMM A;  4FZM A;  2KDY A;  4FES A;  4GCQ A;  1HXT A;  8PRN A;  1PRN A;  4O3Z A;  2J4U P;  2Y0L A;  4AYM C;  2YNK A;  5ADX K;  3HOL A;  2W80 C;  3DA4 A;  1H6S 1;  2KZ7 B;  5G26 A;  2KZ7 A;  4FT6 A;  4KR4 A;  4AYE C;  3GP6 A;  6PRN A;  3AA6 A;  1QJP A;  3VZW X;  3EMN X;  4D5U A;  4RL9 A;  3AAE B;  1MM5 A;  3UAQ A;  3AA7 B;  5DL7 A;  4O3X B;  3AA7 A;  1QJ8 A;  3AA0 B;  3LK4 1;  2F1V A;  1GFQ A;  2POR A;  4XNK A;  3POX A;  1ZHT A;  3SZD A;  3TZG A;  2FGQ X;  3AA1 B;  4FUV A;  2XE5 A;  2MHL A;  2ODJ A;  3POR A;  5D5D A;  2XTR A;  4O3Y A;  3RBH A;  1ZHZ A;  3WI4 A;  3SY7 A;  4D65 A;  3HW9 A;  3AA0 A;  1YS5 A;  4JFB A;  2ZFG A;  3LK3 B;  2FGR A;  2KC0 A;  3HOE A;  2Y2X A;  2XE2 A;  4GCS A;  4E1T A;  3SYS A;  4O4U A;  4RLC A;  4RJX A;  5GV0 A;  2ZLD A;  4G76 A;  4KRA A;  4AZL A;  3VZT X;  2LFU A;  4AYD C;  3SZV A;  3VE1 A;  1BT9 A;  1ZHY A;  2K4T A;  2KXP B;  3V8U A;  3T20 A;  3PQU A;  3C5O A;  3LK4 2;  3FYX A;  5EE2 A;  1ORM A;  3POU A;  3LK2 A;  3JTY A;  5JDP A;  4FZL A;  1BH3 A;  1MM4 A;  2GE4 A;  2J1N A;  1HXU A;  2M06 A;  3PRN A;  3SYB A;  4AFK A;  4AKR B;  3A2S X;  1ZHX A;  2O4V A;  4G75 A;  3AA6 B;  4LSI A;  4BUM X;  1GFM A;  1Q9F A;  1OSM A;  3QRA A;  3UPG A;  3LK2 B;  4AKM A;  3KVD D;  3HWB A;  4QQ1 A;  3POQ A;  4RJW A;  3VY8 X;  5AFU K;  3PQS A;  5T5F A;  2XTQ A;  2XE3 A;  2YPV A;  3VY9 X;  3AA1 A;  4Z3T A;  5IYU A;  2PRN A;  4RLB A;  4LSE A;  2XMX A;  4U9C A;  1GFO A;  4XNL A;  1PHO A;  1HXX A;  4FRX A;  4LSF A;  5ADX L;  1E54 A;  4GHB A;  4KR8 A;  3T0S A;  1OPF A;  4F4B A;  2QTK A;  3AAE A;  4B61 A;  4LSH A;  1GFP A;  2Y0H A;  1ZHW A;  4FSP A;  3DA3 A;  4O4X A;  2M07 A;  4PUX A;  5DL5 A;  2XG6 A;  4O3W A;  1THQ A;  4FRT A;  3T24 A;  1G90 A;  4FSO A;  3WI5 A;  5DL8 A;  2N2L A;  4C69 X;  3G7G A;  4AYI D;  3O0E A;  3VZU X;  3K19 A;  4FOZ A;  4GF4 A;  1GFN A;  1QJ9 A;  4AUI A;  1Q9G A;  4O49 A;  2OMF A;  2LHF A;  2F1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...