5DL8A

Crystal structure of acinetobacter baumannii occab4
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
391
structure length
391
Chain Sequence
NPNQQTEDEWKFTLKNAYINRDFDNDALKDTGSWSQAASLFYKSKMHDTPLVIADKPITIGADASVQYAVRLSSDKHVADTVLPFNKETQSQASDYLKYGATLKLGYDKTLLSVGELWLDLPVTAVDASRQLLTSYWGTNLKSQLSDQLYAEIGRVEKVSPRNEEDFKKFSFTANGITKESDGLNYIDLRYQFTPSLKGEYYFGNLEDLYNKHYVGLEHTWKQPTFALTSKFKYFNAKDDGNTFDIDAENIGLLETVKVKNHTFGLGYQQIIGESAYPLPDGFLPETYFINWNATGFFKEDEKSYHVMYGYDFKDYIPGLNAMVKYVYGHDFKAANGEKNHETESNVILNYAFQQPLLKGFALQYIRIDYNVKHGNDFGEDRLFVNYTKKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Benzoate transport porin BenP
publication title Structural Insights into Outer Membrane Permeability of Acinetobacter baumannii.
pubmed doi rcsb
source organism Acinetobacter baumannii ab307-0294
molecule tags Membrane protein
total genus 111
structure length 391
sequence length 391
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5dl8A00
3SY9A 3SYBA 7PRNA 1PRNA 2ZFGA 1GFNA 1GFOA 2XE3A 3WI5A 4GCPA 2PRNA 4LSEA 3T0SA 3SYSA 4D65A 4D64A 4AUIA 1H6S1 1BT9A 4GCQA 3VZUX 3VY8X 4RJWA 1OSMA 3T20A 2QTKA 3HWBA 5DL7A 5PRNA 4FT6A 1HXUA 1E54A 4LSHA 4FMSA 2Y0KA 4FRXA 4KR8A 3K19A 1HXTA 3NSGA 8PRNA 3SZDA 4KRAA 3PRNA 4FRTA 3FYXA 4FSPA 2PORA 1GFQA 4KR4A 3SY7A 4GCSA 3UPGA 3POXA 2Y0LA 3VZTX 3POUA 3EMNX 2J4UP 6PRNA 3VZWX 2OMFA 2XE5A 3JTYA 5DL5A 3WI4A 3UU2A 5DL6A 4FOZA 4C69X 1GFPA 4LSFA 2J1NA 4JFBA 5DL8A 4FSOA 2XE1A 2XE2A 2ZLDA 2O4VA 3HW9A 1MPFA 2Y0HA 3T24A 1OPFA 3POQA 3A2SX 4BUMX 3O0EA 2XG6A 2Y2XA 2FGRA 3SZVA 1HXXA 3VY9X 2ODJA 4LSIA 2FGQX 4D5UA 5FVNA 3PORA 1BH3A 2K4TA 4RJXA 1PHOA 1GFMA 5JDPA
chains in the Genus database with same CATH superfamily
3PGRA 5IYUA 4O49A 3SY9A 3SYBA 7PRNA 2AXTO 3LK41 4FESA 3A0HO 3LK3B 3UAQA 4AYMC 1PRNA 2ZFGA 3BRZA 1GFNA 2KXPA 3DA3A 2K0LA 1GFOA 2XE3A 3AAAA 3DZMA 3HOLA 4GCPA 2PRNA 1S5LO 4LSEA 3WI5A 3T0SA 2Y7SA 4O4UA 2W80C 3SYSA 2YNKA 3DWOX 3RBHA 4D64A 4D65A 4C4VA 2R4OA 4K3BA 2W81C 1T16A 2GE4A 2R8AA 4AUIA 2R4NA 3C5OA 1H6S1 3G7GA 1BT9A 3QRCA 4GCQA 5T5FA 3VZUX 3PQSA 3VY8X 4FUVA 4RLCA 2IWVA 3KZIO 4RJWA 3HOEA 2XTRA 1OSMA 2X27X 4G75A 2IWWA 3T20A 2QTKA 3HWBA 4G76A 4XNKA 5DL7A 4PJ0O 5PRNA 4AYID 3BS0A 1HXUA 4FT6A 3AA0B 3AA7A 3VE2A 1E54A 4LSHA 4FMSA 3WU2O 1YS5A 1ZHXA 1IZNA 2R88A 5AFUK 2F1CX 2Y0KA 4IL6O 4N74A 1QJ9A 4FRXA 5G39A 4O3WA 4KR8A 3AA6A 4E1TA 3K19A 2XTQA 1HXTA 1Q9GA 2N2MA 3NSGA 3LK2A 8PRNA 2XMXA 4E1SA 3DA4A 4B61A 5ADXK 3SZDA 4KRAA 3PRNA 4FZNA 2N2LA 4FRTA 2R4PA 3FYXA 4FQEA 3DWNA 4FSPA 5KAFO 2KC0A 2PORA 2R4LA 4AKRB 1BXWA 1GFQA 2KZ7A 4KR4A 3SY7A 3AAEB 4GCSA 1MM5A 4PR7A 4UB8O 3UPGA 1ZHTA 4FZLA 2LHFA 4K3CA 5E79O 4GF4A 1QJ8A 3POXA 2Y0LA 3PQUA 3VZTX 2MHLA 3POUA 3AA1B 3EMNX 4RL9A 3LK3A 3A0BO 4FZMA 2M07A 4N75A 4UB6O 3GP6A 4AFKA 3VZWX 6PRNA 2J4UP 2OMFA 2XE5A 3BRYA 3JTYA 5DL5A 1QJPA 4AYEC 1G90A 3WI4A 2JMMA 3UU2A 5DL6A 3PF1A 2KDYA 4PUXA 4CTDA 4FOZA 4AKRA 5KAIO 4C69X 2JQYA 4N58A 4Z3TA 5AFUL 2KXPB 3TZGA 1GFPA 5G26A 3AAAB 1THQA 4QQ1A 4LSFA 2J1NA 4JFBA 4JCHA 4O3XB 5DL8A 5GTHO 2X9KA 4FSOA 5H2FO 2XE1A 5B5EO 1ZHZA 4C4VB 1Q9FA 3VE1A 2R89A 2XE2A 1ORMA 2ERVA 3AA0A 2ZLDA 5ADXL 4AKMA 4XNLA 5GTIO 2O4VA 3QRAA 1MPFA 2WJQA 3HW9A 5G3AA 4O4XA 5G38A 1T1LA 3NJTA 1MM4A 1ZHYA 2F1VA 2Y0HA 3PGUA 1OPFA 1ZHWA 4O3ZA 3JCUO 3T24A 3POQA 1P4TA 2F1TA 3A2SX 3AA7B 4GHBA 3O0EA 2XG6A 5EE2A 4BUMX 4AZLA 1IZNB 2Y2XA 5TISO 4O3YA 3LK42 4U9CA 2FGRA 2MNHA 4RLBA 1HXXA 3AA6B 3SZVA 3VY9X 4AYNA 3V8UA 4N59A 5GV0A 3KVDD 2ODJA 2M06A 3PGSA 2YPVA 4LSIA 3LK2B 3AAEA 2FGQX 2LFUA 4D5UA 4F4BA 5FVNA 3PORA 1BH3A 5D5DA 2K4TA 3AA1A 2WJRA 2KZ7B 4AYDC 5B66O 4RJXA 2WVPA 1PHOA 4C00A 1GFMA 5JDPA
chains in the Genus database with same CATH topology
5IYUA 4O49A 3SY9A 3SYBA 7PRNA 3LK41 4FESA 3LK3B 3UAQA 4AYMC 1PRNA 2ZFGA 3DA3A 1GFNA 2KXPA 2K0LA 1GFOA 2XE3A 3AAAA 3HOLA 4GCPA 3WI5A 2PRNA 4LSEA 3T0SA 2Y7SA 4O4UA 2W80C 3SYSA 2YNKA 3RBHA 4D65A 4D64A 2W81C 2GE4A 4AUIA 3C5OA 1H6S1 3G7GA 1BT9A 3QRCA 4GCQA 5T5FA 3VZUX 3PQSA 3VY8X 4FUVA 4RLCA 4RJWA 3HOEA 2XTRA 1OSMA 2X27X 4G75A 3T20A 2QTKA 3HWBA 4G76A 4XNKA 5DL7A 5PRNA 4AYID 4FT6A 1HXUA 3AA0B 3AA7A 3VE2A 1E54A 4LSHA 4FMSA 5AFUK 1YS5A 1ZHXA 1IZNA 2Y0KA 1QJ9A 4FRXA 4O3WA 4KR8A 3AA6A 4E1TA 3K19A 2XTQA 1HXTA 1Q9GA 2N2MA 3NSGA 3LK2A 8PRNA 2XMXA 4E1SA 3DA4A 4B61A 5ADXK 3SZDA 4KRAA 3PRNA 4FZNA 2N2LA 4FRTA 3FYXA 4FSPA 2KC0A 2PORA 4AKRB 1BXWA 1GFQA 2KZ7A 4KR4A 3SY7A 3AAEB 4GCSA 1MM5A 3UPGA 1ZHTA 4FZLA 2LHFA 4GF4A 1QJ8A 3POXA 2Y0LA 3PQUA 3VZTX 2MHLA 3POUA 3AA1B 3EMNX 4RL9A 3LK3A 4FZMA 2J4UP 2M07A 4AFKA 3GP6A 6PRNA 3VZWX 2OMFA 2XE5A 3JTYA 5DL5A 1QJPA 4AYEC 1G90A 3WI4A 2JMMA 3UU2A 5DL6A 2KDYA 4PUXA 4FOZA 4AKRA 4C69X 4Z3TA 4N58A 5AFUL 2KXPB 3TZGA 1GFPA 5G26A 3AAAB 1THQA 4QQ1A 4LSFA 2J1NA 4JFBA 4JCHA 4O3XB 5DL8A 4FSOA 2XE1A 1ZHZA 1Q9FA 3VE1A 2XE2A 1ORMA 2ERVA 3AA0A 2ZLDA 5ADXL 4AKMA 4XNLA 2O4VA 3QRAA 1MPFA 3HW9A 4O4XA 1MM4A 1ZHYA 2F1VA 2Y0HA 4O3ZA 1OPFA 1ZHWA 3T24A 3POQA 1P4TA 2F1TA 3A2SX 3AA7B 4GHBA 3O0EA 2XG6A 5EE2A 4BUMX 4AZLA 1IZNB 2Y2XA 4O3YA 3LK42 4U9CA 2FGRA 2MNHA 4RLBA 1HXXA 3AA6B 3SZVA 3VY9X 4AYNA 3V8UA 4N59A 5GV0A 3KVDD 2ODJA 2M06A 2YPVA 4LSIA 3LK2B 3AAEA 2FGQX 2LFUA 4D5UA 4F4BA 5FVNA 3PORA 1BH3A 5D5DA 2K4TA 3AA1A 2KZ7B 4AYDC 4RJXA 1PHOA 1GFMA 5JDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY9 A;  3SYB A;  7PRN A;  1PRN A;  2ZFG A;  1GFN A;  1GFO A;  2XE3 A;  3WI5 A;  4GCP A;  2PRN A;  4LSE A;  3T0S A;  3SYS A;  4D65 A;  4D64 A;  4AUI A;  1H6S 1;  1BT9 A;  4GCQ A;  3VZU X;  3VY8 X;  4RJW A;  1OSM A;  3T20 A;  2QTK A;  3HWB A;  5DL7 A;  5PRN A;  4FT6 A;  1HXU A;  1E54 A;  4LSH A;  4FMS A;  2Y0K A;  4FRX A;  4KR8 A;  3K19 A;  1HXT A;  3NSG A;  8PRN A;  3SZD A;  4KRA A;  3PRN A;  4FRT A;  3FYX A;  4FSP A;  2POR A;  1GFQ A;  4KR4 A;  3SY7 A;  4GCS A;  3UPG A;  3POX A;  2Y0L A;  3VZT X;  3POU A;  3EMN X;  2J4U P;  6PRN A;  3VZW X;  2OMF A;  2XE5 A;  3JTY A;  5DL5 A;  3WI4 A;  3UU2 A;  5DL6 A;  4FOZ A;  4C69 X;  1GFP A;  4LSF A;  2J1N A;  4JFB A;  5DL8 A;  4FSO A;  2XE1 A;  2XE2 A;  2ZLD A;  2O4V A;  3HW9 A;  1MPF A;  2Y0H A;  3T24 A;  1OPF A;  3POQ A;  3A2S X;  4BUM X;  3O0E A;  2XG6 A;  2Y2X A;  2FGR A;  3SZV A;  1HXX A;  3VY9 X;  2ODJ A;  4LSI A;  2FGQ X;  4D5U A;  5FVN A;  3POR A;  1BH3 A;  2K4T A;  4RJX A;  1PHO A;  1GFM A;  5JDP A; 
#chains in the Genus database with same CATH topology
 3PGR A;  5IYU A;  4O49 A;  3SY9 A;  3SYB A;  7PRN A;  2AXT O;  3LK4 1;  4FES A;  3A0H O;  3LK3 B;  3UAQ A;  4AYM C;  1PRN A;  2ZFG A;  3BRZ A;  1GFN A;  2KXP A;  3DA3 A;  2K0L A;  1GFO A;  2XE3 A;  3AAA A;  3DZM A;  3HOL A;  4GCP A;  2PRN A;  1S5L O;  4LSE A;  3WI5 A;  3T0S A;  2Y7S A;  4O4U A;  2W80 C;  3SYS A;  2YNK A;  3DWO X;  3RBH A;  4D64 A;  4D65 A;  4C4V A;  2R4O A;  4K3B A;  2W81 C;  1T16 A;  2GE4 A;  2R8A A;  4AUI A;  2R4N A;  3C5O A;  1H6S 1;  3G7G A;  1BT9 A;  3QRC A;  4GCQ A;  5T5F A;  3VZU X;  3PQS A;  3VY8 X;  4FUV A;  4RLC A;  2IWV A;  3KZI O;  4RJW A;  3HOE A;  2XTR A;  1OSM A;  2X27 X;  4G75 A;  2IWW A;  3T20 A;  2QTK A;  3HWB A;  4G76 A;  4XNK A;  5DL7 A;  4PJ0 O;  5PRN A;  4AYI D;  3BS0 A;  1HXU A;  4FT6 A;  3AA0 B;  3AA7 A;  3VE2 A;  1E54 A;  4LSH A;  4FMS A;  3WU2 O;  1YS5 A;  1ZHX A;  1IZN A;  2R88 A;  5AFU K;  2F1C X;  2Y0K A;  4IL6 O;  4N74 A;  1QJ9 A;  4FRX A;  5G39 A;  4O3W A;  4KR8 A;  3AA6 A;  4E1T A;  3K19 A;  2XTQ A;  1HXT A;  1Q9G A;  2N2M A;  3NSG A;  3LK2 A;  8PRN A;  2XMX A;  4E1S A;  3DA4 A;  4B61 A;  5ADX K;  3SZD A;  4KRA A;  3PRN A;  4FZN A;  2N2L A;  4FRT A;  2R4P A;  3FYX A;  4FQE A;  3DWN A;  4FSP A;  5KAF O;  2KC0 A;  2POR A;  2R4L A;  4AKR B;  1BXW A;  1GFQ A;  2KZ7 A;  4KR4 A;  3SY7 A;  3AAE B;  4GCS A;  1MM5 A;  4PR7 A;  4UB8 O;  3UPG A;  1ZHT A;  4FZL A;  2LHF A;  4K3C A;  5E79 O;  4GF4 A;  1QJ8 A;  3POX A;  2Y0L A;  3PQU A;  3VZT X;  2MHL A;  3POU A;  3AA1 B;  3EMN X;  4RL9 A;  3LK3 A;  3A0B O;  4FZM A;  2M07 A;  4N75 A;  4UB6 O;  3GP6 A;  4AFK A;  3VZW X;  6PRN A;  2J4U P;  2OMF A;  2XE5 A;  3BRY A;  3JTY A;  5DL5 A;  1QJP A;  4AYE C;  1G90 A;  3WI4 A;  2JMM A;  3UU2 A;  5DL6 A;  3PF1 A;  2KDY A;  4PUX A;  4CTD A;  4FOZ A;  4AKR A;  5KAI O;  4C69 X;  2JQY A;  4N58 A;  4Z3T A;  5AFU L;  2KXP B;  3TZG A;  1GFP A;  5G26 A;  3AAA B;  1THQ A;  4QQ1 A;  4LSF A;  2J1N A;  4JFB A;  4JCH A;  4O3X B;  5DL8 A;  5GTH O;  2X9K A;  4FSO A;  5H2F O;  2XE1 A;  5B5E O;  1ZHZ A;  4C4V B;  1Q9F A;  3VE1 A;  2R89 A;  2XE2 A;  1ORM A;  2ERV A;  3AA0 A;  2ZLD A;  5ADX L;  4AKM A;  4XNL A;  5GTI O;  2O4V A;  3QRA A;  1MPF A;  2WJQ A;  3HW9 A;  5G3A A;  4O4X A;  5G38 A;  1T1L A;  3NJT A;  1MM4 A;  1ZHY A;  2F1V A;  2Y0H A;  3PGU A;  1OPF A;  1ZHW A;  4O3Z A;  3JCU O;  3T24 A;  3POQ A;  1P4T A;  2F1T A;  3A2S X;  3AA7 B;  4GHB A;  3O0E A;  2XG6 A;  5EE2 A;  4BUM X;  4AZL A;  1IZN B;  2Y2X A;  5TIS O;  4O3Y A;  3LK4 2;  4U9C A;  2FGR A;  2MNH A;  4RLB A;  1HXX A;  3AA6 B;  3SZV A;  3VY9 X;  4AYN A;  3V8U A;  4N59 A;  5GV0 A;  3KVD D;  2ODJ A;  2M06 A;  3PGS A;  2YPV A;  4LSI A;  3LK2 B;  3AAE A;  2FGQ X;  2LFU A;  4D5U A;  4F4B A;  5FVN A;  3POR A;  1BH3 A;  5D5D A;  2K4T A;  3AA1 A;  2WJR A;  2KZ7 B;  4AYD C;  5B66 O;  4RJX A;  2WVP A;  1PHO A;  4C00 A;  1GFM A;  5JDP A; 
#chains in the Genus database with same CATH homology
 5IYU A;  4O49 A;  3SY9 A;  3SYB A;  7PRN A;  3LK4 1;  4FES A;  3LK3 B;  3UAQ A;  4AYM C;  1PRN A;  2ZFG A;  3DA3 A;  1GFN A;  2KXP A;  2K0L A;  1GFO A;  2XE3 A;  3AAA A;  3HOL A;  4GCP A;  3WI5 A;  2PRN A;  4LSE A;  3T0S A;  2Y7S A;  4O4U A;  2W80 C;  3SYS A;  2YNK A;  3RBH A;  4D65 A;  4D64 A;  2W81 C;  2GE4 A;  4AUI A;  3C5O A;  1H6S 1;  3G7G A;  1BT9 A;  3QRC A;  4GCQ A;  5T5F A;  3VZU X;  3PQS A;  3VY8 X;  4FUV A;  4RLC A;  4RJW A;  3HOE A;  2XTR A;  1OSM A;  2X27 X;  4G75 A;  3T20 A;  2QTK A;  3HWB A;  4G76 A;  4XNK A;  5DL7 A;  5PRN A;  4AYI D;  4FT6 A;  1HXU A;  3AA0 B;  3AA7 A;  3VE2 A;  1E54 A;  4LSH A;  4FMS A;  5AFU K;  1YS5 A;  1ZHX A;  1IZN A;  2Y0K A;  1QJ9 A;  4FRX A;  4O3W A;  4KR8 A;  3AA6 A;  4E1T A;  3K19 A;  2XTQ A;  1HXT A;  1Q9G A;  2N2M A;  3NSG A;  3LK2 A;  8PRN A;  2XMX A;  4E1S A;  3DA4 A;  4B61 A;  5ADX K;  3SZD A;  4KRA A;  3PRN A;  4FZN A;  2N2L A;  4FRT A;  3FYX A;  4FSP A;  2KC0 A;  2POR A;  4AKR B;  1BXW A;  1GFQ A;  2KZ7 A;  4KR4 A;  3SY7 A;  3AAE B;  4GCS A;  1MM5 A;  3UPG A;  1ZHT A;  4FZL A;  2LHF A;  4GF4 A;  1QJ8 A;  3POX A;  2Y0L A;  3PQU A;  3VZT X;  2MHL A;  3POU A;  3AA1 B;  3EMN X;  4RL9 A;  3LK3 A;  4FZM A;  2J4U P;  2M07 A;  4AFK A;  3GP6 A;  6PRN A;  3VZW X;  2OMF A;  2XE5 A;  3JTY A;  5DL5 A;  1QJP A;  4AYE C;  1G90 A;  3WI4 A;  2JMM A;  3UU2 A;  5DL6 A;  2KDY A;  4PUX A;  4FOZ A;  4AKR A;  4C69 X;  4Z3T A;  4N58 A;  5AFU L;  2KXP B;  3TZG A;  1GFP A;  5G26 A;  3AAA B;  1THQ A;  4QQ1 A;  4LSF A;  2J1N A;  4JFB A;  4JCH A;  4O3X B;  5DL8 A;  4FSO A;  2XE1 A;  1ZHZ A;  1Q9F A;  3VE1 A;  2XE2 A;  1ORM A;  2ERV A;  3AA0 A;  2ZLD A;  5ADX L;  4AKM A;  4XNL A;  2O4V A;  3QRA A;  1MPF A;  3HW9 A;  4O4X A;  1MM4 A;  1ZHY A;  2F1V A;  2Y0H A;  4O3Z A;  1OPF A;  1ZHW A;  3T24 A;  3POQ A;  1P4T A;  2F1T A;  3A2S X;  3AA7 B;  4GHB A;  3O0E A;  2XG6 A;  5EE2 A;  4BUM X;  4AZL A;  1IZN B;  2Y2X A;  4O3Y A;  3LK4 2;  4U9C A;  2FGR A;  2MNH A;  4RLB A;  1HXX A;  3AA6 B;  3SZV A;  3VY9 X;  4AYN A;  3V8U A;  4N59 A;  5GV0 A;  3KVD D;  2ODJ A;  2M06 A;  2YPV A;  4LSI A;  3LK2 B;  3AAE A;  2FGQ X;  2LFU A;  4D5U A;  4F4B A;  5FVN A;  3POR A;  1BH3 A;  5D5D A;  2K4T A;  3AA1 A;  2KZ7 B;  4AYD C;  4RJX A;  1PHO A;  1GFM A;  5JDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...