5DLML

Complex of influenza m2e and antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DVLLTQTPLSLPVSLGEQASISCRSSQSIVHSIGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Heavy chain of monoclonal antibody
total genus 49
structure length 217
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmL01
1EBPA 3WHXB 1DQJB 3MFGB 4JFQB 4UIMA 1A6WH 1H5BB 3SKNA 2R0ZH 2ENSA 1S9WA 2GJZA 3HNSH 3PWLA 4KRMB 3V7AG 2DLGA 1JFQH 5DT1L 3T8XB 2XTLA 3NFNA 4YXHL 2YA0A 5GRJH 2OK0H 3QNXB 4U1HA 5IVXE 4KTYA 4JHBA 1AQDB 3DRQA 4RWYH 1L9NA 4I3SH 2F53E 4N9GB 5IKCA 1Q72H 4PJ5D 4UTAL 4POZC 3EO0A 5D1QC 3CMOH 2VXVH 3TO2A 5D7LD 4X6FB 2NZIA 3NFPA 2ZUXA 1CDJA 1Q0YH 2BK8A 3C5ZB 1C16B 3HI5L 2Z31A 4M1DL 5KANG 4Z8FL 5T33H 1A6ZA 1BQSA 1ZK9A 5EPMB 4NZJA 4MVBD 3T8XA 4LSVL 2YN5A 5CD3A 3MNVB 2WBWB 5TH2B 2G5BA 1ND0A 1LEGA 2PCPB 1U3HD 5KSBA 1YJDC 2DDQH 4LHUD 1QFUH 1SJEA 2XTJD 3GMRA 4ZO8A 4QRUA 3RWDA 2DB8A 3U30B 3RWHA 2QL1A 3B8YA 4JJHA 4M8QB 4QRQA 5D1QA 1QLRB 1XR9A 5EZOL 3GB7A 4MGXA 1X5IA 1A6ZB 5F7HA 3GJFK 5DR5L 4JDTL 2R1WB 2O61A 4QYOB 3IDJB 5LGJA 2BMKB 1KEGH 2JJTC 4DKEL 4JREC 1IJ9A 4OZIE 4I48A 1YN6B 3NMEA 3TVMD 4OFDA 3R1GH 1L7TL 4HXBL 5GHWH 3B9AA 1KN4L 5CBEB 1LO3H 3MCLL 1L0XA 3B3IB 3U0PA 2HJFB 2PYFB 4M6OL 2AAVA 4OV5B 1MAML 1TZHB 3GSXA 4OLVH 3D3VE 3UJJH 3UAJD 4PJAF 2IADB 1WCBB 4JPWH 4XZUA 2X5PA 4ZTPH 2QQQA 2E27H 1FQ9C 3BQUC 1V05A 2YXFA 4I48B 4Y4KB 4OZFG 4K9EC 2A6KA 4Z0BH 2GJ6B 3UTSE 4GAYB 3Q0HA 5EOCL 3B3IA 5EUOE 3SDCD 4U6YA 1MLCB 5ICXA 4XNUL 3L3HB 5B39A 4PY7B 5CHNA 3C5ZD 3M1BB 1IT9H 3STBA 1U2HA 4NNPL 4OT1H 5JA8B 4YDKH 1N2RA 1I9IH 4KQ4L 1A9BB 2VE6B 2IH3A 2CLVB 2YZ1A 1WF5A 3VXUD 1U3HB 3QDGD 3HPLA 1PW3A 3MV7A 3DV4B 1OTSD 1FL6A 5GS3A 5A3ID 3W9DA 3LQZB 4ZPTB 2VR4A 2QSQA 3PL6C 2ICES 3WFHA 3QIUD 3TV3H 5BW7C 1NJ9A 2AQ3A 3SOBH 1FVDA 4LQFL 1Z9OA 1DVFD 1MHHB 2FX8L 2GJJA 3MLRH 3WKNA 4F9LA 4H0GA 1I3RA 1XCQB 3I02B 3QRFM 5HHVH 4L3AA 2FWOA 3L3KB 2RGSA 1TJGL 1U3HA 3L3DA 5C09E 4C55A 4PJ8A 3NABH 3GHEL 2D3VA 1AI1L 3RRQA 2F53A 1NLDL 2CRZA 5K33A 2YEZA 1LDSA 2NY6D 4MZ3A 4ZNEA 3RZCA 4H26B 1I1AC 2PXYC 4GMSL 5J57B 3PP4L 5HVGB 1ZA3B 4PGJA 4IOIA 2A77L 1IKNC 4R90H 2NQCA 4UV7H 3S96A 3GJEB 2BVUA 5HGHA 4MAYA 4NC1E 2EYSA 4K7FB 1RVFL 4Q58C 3O3UN 5DRZB 5I1HL 1A7QL 3ARGA 4HMCA 3V5DB 1INEH 4PJIA 1F02I 4HMDA 1E4XI 4QRTB 4CMHB 4Z95L 1NCDH 2E6JA 1FVCA 1AY1H 1SY6L 3HUJE 3AY4C 3TNMB 4P9ML 5C9KA 2JIXD 3SDCB 2GEEA 1RPQA 3MCKA 4QY8B 2W9EH 4EVNB 1BQHB 2EDTA 4FG6D 4HUUA 3HMXA 5FIEA 5JLZA 1NC4D 2Q86A 1JK8B 1QBBA 2H2SC 3MJ7A 3BOVA 5ISZD 2FIKB 4HLZH 2WWKO 4GKSB 1ZT7B 3W81A 3GMQB 3W2DH 1KPVB 1ZHBA 2B4CH 4HJJL 3ZHDA 1ACYH 3D2UB 3S36X 1L7IL 3U46B 4YHML 5E2WL 2ARJB 4LCCB 4RBPK 5I8EA 2COQA 2F19H 2BCKB 3PHQB 3KYAA 2FYYB 1GXEA 3MV8B 4TVPH 4ZS7L 3THML 2WSKA 4GO6B 4JO2L 2XTJC 5F89A 4PBWD 4AENB 4E41B 4P46B 4NQDA 3BD3A 2DM7A 1MPAL 3SDAA 4N8PA 4U3CA 1IE5A 2X4PB 3IRZA 3NA9L 4RISL 3TZVA 3BN3B 2PTTB 2C4FT 3D2UA 1NGZA 4PBVC 4JDVA 1UXSB 3H3KA 2O5XL 4QTIH 5KSUB 4BSWB 2Y5TB 3MLWH 1QLEL 3RGVA 1YEJH 1AO7B 2VH5H 4XH2B 2MCG1 5C09D 2AV1B 2VXTH 1PBYA 1NL0L 1DN0B 2YSSB 1YEKL 1MCPH 2CIIA 4G7YH 4Z7NF 1ZT1B 2V9RA 3JTTB 3X17A 1ACYL 4LHUG 4NQDB 4WO4C 3OAYH 3U4BH 1VACB 2P42B 1VFBB 1KFAL 3L3GA 3TZVB 3OR7A 2ZUTA 1TJIL 2PTTA 1EDQA 1DDHA 1UJ3B 5IMMB 2ADFL 1S3KL 3CDFA 3AXLA 4XNQA 1AE6H 2WWKT 4ODVL 4Q9CA 1ZHKA 4KAQH 1JF1B 1IBGH 4GW1B 4Y5XC 1E6JL 1QBMH 1A9EA 5HGGS 4OQTL 1NAMH 4YHPB 1GGBL 4M6AA 1G7IB 4RCAA 3O2VH 4BM7A 2MNUA 3EYFB 1MFBL 5HHQB 2VITB 4P2RA 3DOSA 5IBTH 4L8SA 1TQCC 1F3JA 1YEIH 1G7MA 2ADJA 4LCWB 3MXVL 4K3DL 1UJ3A 1GYAA 1LDPL 3D0VA 1FO0H 3LKPB 3O8XB 3FFCA 1A3QA 4KQ3L 3HZVA 2W07A 5EIIA 3VJ6B 2BFVH 3GDBA 2D7OA 3BSZH 3H9ZA 4D9QD 3LDBB 2AK1L 4OGXH 4XPBL 1BJ1H 3QULA 3EYSL 4DGYH 1AFVL 3V6ZB 2WV3A 5IV2A 4NQTA 1ORQB 3W2DL 5DJ6B 1BVKB 3QJFA 3RTQD 4Y5VB 1VCAA 4OFVA 1T2QH 3VD9A 3KDMA 4M93B 1CL7H 4X4YB 5FYKL 2MQ3A 2K3TA 2Y36H 1CLYH 2LU4A 1MFEL 3QFDB 4QF1A 4R4BB 4PJFB 1B0GB 2QADC 5DRNA 3AAZA 4XPGH 3IDJA 1NEUA 4KTEL 3BRDA 1AO7D 4J12A 5E9DD 1NEZA 1P5VA 4G9FA 1OGAE 2IC2A 3MRDA 5EN2A 1EUTA 4ZUVB 1LK3H 5GGUB 5EOQH 4HSQA 4I77H 3TT3L 1F90L 4XP1H 5E6ID 3G5ZB 1CL7I 5T3XL 1GC1L 4OV5A 1EGJL 1NMAL 1U8KA 4XPFL 5KS9F 4Z9KB 1QSED 4UV7L 4QHMA 1I9IL 4YDKL 3QDJB 1NGYB 1OT1A 2ATPB 4ZXBC 4L9LC 4F3FA 3MRHA 5D70H 2BY0A 1NBZB 1FNGB 2JJWA 4U33A 1YNTB 2YUXA 3CD4A 3GBLA 2DIAA 4LF3B 5JOPD 3P9WB 4MZ2A 2VQ1B 1U8MB 1LQSR 4NP4L 3QHZL 4ZTPL 1H3PL 1UM5H 4KK8D 5DC4B 5D5ME 1JWSA 1P84J 1C7TA 4NQXA 3GSWB 4QHNB 5HHOD 1EXUA 3SOBL 4HH8A 1QSFE 4QWWD 4KY1L 4P5TB 5TPWL 4DKFL 3SDXF 3H7BA 5F7NC 4OF6A 1OAZL 4LKXB 1GZQB 4O2CA 1EFXA 4LLYB 1NDMA 3GSXB 3H42L 4H20H 4XXDA 5HJ3B 1JN6B 3FOMA 2IADA 3OB0H 4ONHA 2HKFL 3SGEH 1IT9L 3SQOH 5IB1A 2HWZH 5SV3A 1DLHB 4IRSA 4CNIA 2NXYC 2Y6SC 3VFGH 1K5NB 1M7DB 4ODWA 2R56H 3IJSB 2H8PA 2YN3A 3VGAB 3QCVL 2C26A 4NO5A 5BRZA 2X09A 4XHJC 1DEEA 3V4PL 1RZ7H 3QDGB 4PB0H 4RNRB 1IKFH 1T0PB 5KVDH 4PP2A 3VXSE 1A3RH 3PL6D 2IALA 1D9KB 3EZJB 4P3CL 4NQUA 4OD3L 3TN0B 5CGMA 1CGTA 1QSEB 3BZ4A 4S1QL 3OB8A 1DVFB 5JDJA 2GKIA 3RP1A 5ISZA 7FABH 1T21A 1C08A 4ZDHA 3VGEA 3DX9A 43CAB 4XNZB 1DUYA 2Q20A 3HB3C 4LSQL 4N5UA 1EERB 4JKKA 5FK9B 4Q0XL 1XGUB 2JELH 3EJZD 3JSSA 5C7XH 3B2UC 5IB3A 2XTJB 4YGAB 4MLIA 3S35X 1OAXH 2Q86B 4WHTA 3QZWB 1A7PL 2VO5A 1UADC 5CAYB 4PP1D 3WUZA 2GIYA 3BIKA 4N0UB 1G0YR 4G9DA 3T0DA 3KXFB 3M8OH 1INQA 1KPVA 1ZHBB 5FK9A 4X80H 5E2UL 1VFAB 2VXUH 1JNNL 4KTEH 4FQXA 4H26A 1ONQA 4HCRA 5LGHL 3IAPA 4XWOC 1HQ4B 4WWKB 1FNSH 4JM4L 4AENA 3SDYH 3O9WC 1DQDL 5DEFA 3S35L 2OZ4L 3CSYA 3ZE1F 1HH6B 3MRCB 1Y18B 2P46B 1KTLB 5IK3B 3F7PC 2XA3A 1F4AA 4NIKB 3RPIB 3HI6H 1Q9OA 1Q9LB 1MELA 5EA0L 4XMKL 1CFTB 4YXLL 2KL6A 1AJ7H 1HQ4A 4UMGA 1A1OA 4CVWA 4LL9A 5FKPB 5HYFA 5FOJA 3O3DA 3OJDA 4JFOB 2AXHA 1NGXB 1FFOB 4OF0A 4HS8L 1G6RA 1A4KB 5FYJD 4HHAA 4PG2C 3WSQL 3OQ3B 4P3DA 2YD1A 1QRNA 1NFDB 5ANME 5IG7A 1TTUA 1JF6A 3BI9X 4K7PX 3RUGF 4C58B 4FQQB 3SY0A 1NC4A 3SPVA 4PJAA 4OZGA 2MQCA 2Q8BH 5DMGC 1BREA 3QRGH 2JJSC 3QUYC 4DOHE 1FZOA 1S3KH 3GJFB 1MHEA 5EU4B 4XB7A 5D8JL 3FTGA 4ZS6D 5DHYA 4UU9B 2R4SH 1X5KA 3TBTB 3PWUA 5C9JA 2A0LC 3WD5H 4U1MA 1FZMB 3EJZC 3W11C 4NQCB 4AK1A 1CI5A 3CK0H 5EZIH 1YEIL 1NBVL 3HC0B 3HZYB 4FTVA 5IQ7H 4ZXBB 4F58L 5I1CL 3SDDA 1D5XA 2R15A 2C1PA 5EO0B 1RUML 1AQDA 1WGOA 2YRZA 4QTHB 1QFHA 3Q3GA 5DDHA 3STLB 5IKCB 1T83A 1PSKH 4MDJA 4MQTB 4HKXB 2APTA 5A2IH 2P7TB 3Q5OA 1T2XA 2X70A 3KDMB 4OLYH 2I60H 5C0BD 3QFDA 3WLBB 2NY2C 4DVBA 1RK0B 4PRHE 4YHPA 1KFAH 1LEKA 3HZYA 1QFWM 1LEIB 4AT6B 5EOTA 1AFVH 3MJ9H 2YUWA 2XN9B 1NEZB 4YPJA 5HHQA 1UA6L 1OAKH 2L4OA 3NCCB 4L3EA 4LCIH 4OUUA 1EHXA 4XMPL 4L8SB 4X99B 4QRUB 1KCKA 5HHOE 1PKQE 2HG5A 1A6TB 3MPCA 4JVPA 2FJHA 3D0VB 2AJYH 1FE8L 4WJ5B 5GGVY 3TFKD 5C0AE 1S9VB 2VDPH 3EJYC 1DLFH 5J56B 1S7QB 4HV8B 3TNNA 1I7RB 1S7WB 4U7KA 5DYOB 5IBTL 3ZDXE 1KPUA 5DSCA 1UT9A 3ARFB 1J05A 1MFBH 3IDIB 4LBEB 3MRRB 4ZS7H 1T0MB 5T3ZD 2W9DL 1VADA 5CEYB 2J4WH 2Y1VA 1RIUH 4JRXE 5DJ6A 2XG5A 1S5IH 4WHYG 4OIIL 5F9OL 1IAII 3WYRA 2VDRL 4G7VH 1OARL 1A64A 2VDKL 1J8HB 3T0WA 1AXSB 5DJYA 2GI7A 4MXWH 3V52L 4XVTL 4XZUB 4MMZC 2ZG3A 4U1NB 3GI9L 1YMMB 2SEBB 5J8OA 3CDCA 3O3AA 4M6NH 5IFHH 2BX5A 1Y0LA 5C0NC 2OZ4A 5HHNA 2EXYC 2BERA 1GRWA 2C4FU 1MCPL 4BQ8A 1EUUA 1P4BL 3S97C 1XIWA 1CCZA 3G5ZA 3TF7C 1WAAF 5JW3L 2WINA 4H0IA 1U8KB 1C5DA 3GFUA 5GXBB 5SWQA 4HLJA 1G9NL 4LQFH 5JPNA 4GMTH 3BGFC 4YX2L 4KUZH 1WBXA 1EEZB 4OCNC 1YMMA 4RISH 3EO1B 1JTOA 5KSBE 3GSVB 3K0WA 4N0FB 2ERJB 3EFFB 5DRXA 4LARL 4R4NC 2XN9D 4WUUA 3PXHA 2EIZA 3W9DB 3QUXC 1N3NA 5ITBL 1FNFA 3T65B 1NLDH 4NJAL 3EDJA 4ZMAT 2LTQB 3A6CH 4XRCB 3OJ2C 5BQ7A 3NABL 5KVGH 1T66C 2EDHA 2R2CA 1QHPA 1A7RL 1LHZA 4X7TB 3TN0A 4KRPD 3F62A 3B5TA 4XVUD 3MGTB 3X11B 5E99L 2FBJL 3IU3B 1JPGB 5L6YL 1MI5D 1C08B 4ZDHB 2BOCB 4KUCD 1B0RA 5B38B 4MJIB 3NIGF 3WXVL 3VCLB 5HXMA 3HC3H 4PREA 2QSVA 3QCUL 4JFYA 2IANA 2V9QA 2P4AB 3FMGH 1RY7B 1XF3A 2P5EB 4IIQA 4IMLA 3T0EE 4OIIH 3O6FD 5EO9A 5TE4L 3V6OC 3K80A 3RNQA 4IDJH 2K9UA 4NM8H 3GJEA 3RWEB 1G6VK 3X11A 3KLAB 5DJDA 4JHZA 4PJGF 3KPRD 1K5NA 1OF2B 1M7DA 5T3XD 3R1GL 4LARH 3KXFA 1OL0A 2VISA 2YPKA 3ARBA 4N1HB 4R8WH 3QDGA 3KLHD 4OKVA 3HG1A 1TVDA 5LGKA 4Y4FD 4PB9L 4NPYB 4R2GB 1AI1H 3GSQA 4WO4B 5TQ0H 5IMOB 4JKPH 1XZ0A 2P8PB 4WI6A 1A6VL 1U92A 4WHDA 3B2UD 1JK8A 3MJ7B 4XHQA 2EEDA 1KOAA 5D1ZD 1N6QH 4P9HC 2OL3A 4JPWL 4RGMC 1QO3B 3OL2A 5I16A 3ZE2F 2W1NA 1SMOA 4LGPB 3FAXA 1ZANH 2EE6A 2M26A 1MAMH 3HCVA 3ET9F 1T4KA 1MVUA 4QCIB 4OLUH 1P7QB 4NYLA 2QTEA 5FCSH 1GVIA 3U82B 1WTLA 2H2PC 1BLNA 5B3NA 2B0SH 2DQUH 4XP9H 2JB5L 3DHMA 3VXUB 5I71C 5EU6A 4P46A 2X4OA 1S5IL 1LO2H 2EDRA 1LK2B 1E4JA 4I3SL 1R5VB 4NC1C 4G43A 3SE8L 1MI5B 4U0RB 3C8KB 4CVXA 1XF2A 4HEME 1CDUA 4N90E 4DCQB 5F7LB 3DYMA 4KTDL 5C71A 2R8SH 2CH8A 1A1NB 4XNMA 3CLEL 3AU1A 1MJJB 4UBDC 1I1AA 3QXAA 1YPZE 1M7IA 5GSVA 3LH2L 5ICYA 2Z93A 1BQLH 3ARBC 3TLRA 2A1WL 2E27L 5EOCJ 2FSEB 4CVXB 1CWVA 4U1MB 2G60L 3QRGL 1KPRA 3H9SB 3N1QC 4ZD3H 3JV6A 3OSKA 2IJ0C 3HI1B 4LDOB 1B4JL 4HUXB 1G7IA 1D5XB 4PJ9B 3AUVA 4HXBH 5GHWL 3EYFA 3P73A 5DK0A 4KGLA 3LZFL 5GIRB 4YXHH 3U36A 5K59E 3AM8A 4NM4L 5MEOB 4Q9RL 3FRPA 5FGBA 3RY4A 5A1AA 4ELKA 1TMCB 5C6TH 2FJGA 1NC4B 4BUGA 3WNNA 5CJXC 5L7XL 3HE6C 4I5BA 4MCYA 3GJFA 5EU4A 1IGMH 4WW1A 5FDWA 5D6CB 1CFBA 1OD9A 3LRSB 2G2RB 2GITB 1NGQH 4O5LL 4TUKH 2A38A 3OR6A 4OGAD 4TTGA 4RGNE 1IEAA 4Z0XA 4RMRA 3TZVC 1I85C 5SWZA 1JYWA 3GI8H 4K23L 3QFJB 2JJSA 4LLWB 4WFED 3ZE2E 1WT5A 4ZXBA 5I6XB 3PP3H 3LEXA 4PJ5B 1U8HB 5HGDA 4QTHA 1H0DA 1U42A 4ZUVA 3MO1A 2LVCA 2NXYB 1KEMH 3FRUA 4EI5D 3EYUL 4OJFH 2AQ1A 5DT1H 4CU6A 1G0XA 1NBYB 4G80A 4IRSD 3T3MF 5BVJA 3BPOC 1KYOK 5I1EH 1JTTA 3E6HA 4R0LA 3SGJC 3DGGB 1I1FA 3SDCC 5IW1A 3UC0H 1S9YB 2WIIA 1FFPA 4Z7QE 5BMFL 2G75B 2NY6B 3BDXA 4LSQH 5HPMA 4HK0A 3OZ9H 7FABL 1AR2A 2R29L 5F9WB 3DMMC 3UDWC 5CFHA 5T5FL 1LO4H 5JHDE 4XNZC 1AGFA 3WFDH 3UTQB 3C8DA 2V5TA 4MAYC 1CDCA 5IVXA 1DVFC 4MD0B 1KBGL 1PG7W 4TUOA 3NPZB 3MBEB 1GSMA 4GAGH 3DIFB 4H1LH 2KQNA 3WJLA 3EO1A 4K71C 2G75A 2HKHH 5EORH 4G42A 1FAKT 4I3RL 5CD5C 2X44D 1XGPA 4KI1A 3EYQC 1KB5A 3OJMB 1J1XL 4U6XB 4UT9L 4M62H 3ZKMD 1MVFA 4N1CA 1RIVH 4ODTL 4JY6A 4XVUC 2APFA 4RMSA 1BM3L 1AP2A 4OZIB 1EO8L 4NZTL 1SY6A 2GTZA 3CZJA 1BF2A 1CICD 1FH5L 5B21A 1CFSB 4Z6AT 3GIVA 4G6FD 3QUML 4K7PH 3IKCB 4X5WB 5JW4M 1JYVA 5GGVL 4KMQA 3MGTA 3H2WA 4M5ZL 3S3SA 3WS6C 4IM8A 2XY1A 1JVKA 2ZUYA 2Y23A 1HIMH 3MV8D 4C83B 5B38A 4WFEE 4L29B 3QWRA 5LKNA 3UTTD 4P46D 2VDOL 4O9HL 1LE5B 4Y8DC 3VWKC 1U8NB 5C0EA 5J13B 2ZCLL 4OQTA 5J6HA 1O5DT 2VLLA 3KS0H 2BNRE 3RVXD 1J8KA 5GGQH 4JFDA 4JZJB 3RWGB 2D7TH 3LKNB 1W0WB 3O6ML 1KC5L 4OB5L 3WKML 5JIPA 3MRBB 3SCMC 3QDME 3T08A 2BC4B 1XGRB 5GGTL 3MMEA 3BWUC 4JFQA 1OSZA 3WIHL 1V7NH 3PQYD 2VLKD 3UTOA 5D93B 2GYSA 5ITFB 4K9EL 1FGNH 2PYEB 1A14L 4K7PL 1A22B 4XAKD 5F21B 4D3CH 1B9ZA 2NX5E 2XXCB 1GC1H 2FHCA 3CPLB 1U91A 5T3ZL 3P77A 1R5WA 1OAZH 2NX5B 2OQJB 2B0SL 4PJXE 1JGDB 2JTDA 2VTFA 1J9CT 2BOCA 4CADA 1ZHLB 2PW2A 3MJ8A 2DKUA 3JXAA 4V1DA 4P49A 1IL1B 1IC7L 4FZEH 3B9KC 4LGSB 2UV3A 3MLUL 3WN5C 5I0ZA 4RAUA 1P53A 4GSDH 5GZNC 4G8GA 1I1RA 2DWEA 4F8QA 2Y36L 4P4KD 3MLYH 4TSCL 2AI0L 3C60D 1T5WA 2CQVA 2YKLH 3BKJH 4M8QA 4GLRH 5CUSL 3FONA 1A5FH 3D0LA 1X3DA 5DVLA 4RGMB 4NQSA 3P3YA 5IF0A 3MROB 3Q1SL 2BFVL 4JKWA 1I8IA 4N0YH 2E7HA 5FCUH 5TE7H 1GAFH 4Z7WB 2DQCH 5GJTL 2DWEB 5C09A 1MJJA 2NY5C 1G6RL 4QNPF 5DVMA 3LMJL 4GXUM 1LMKA 4U3XA 3U0PB 5ICYB 3MXWH 2PXYA 4OJFL 3L5JA 3D2UD 4PGDA 3D0LB 2FSEA 3NACL 3BE1H 5A2FA 2K7PA 3HE7D 5IG7B 5JXAL 1NPUA 1A3LH 1WCBA 5IJVB 3IJYA 4PBXA 3SY0B 2EZ0C 4HIJA 5DD5L 1MCSA 2HT3D 5D1XB 4WEBL 5HYSA 1OSPL 2EH7L 2Y5EA 1UGNA 3IU4L 1LP9B 1M4KA 4DVRL 4IS6B 1AD0A 4HKBA 4KVCL 4WIQA 4LSUH 1LK2A 5GJSH 4YH6A 5E9DE 4YK4B 4M7LL 2WUCL 1G7JB 2QSCH 3EKCA 1RK1A 3D85D 4NN7C 4RFOH 5E2TH 1HOCA 3DNKA 2VE6A 4GAJH 5D7KE 5INDA 1FFRA 3RVUD 1MJUL 4M1CC 1S5HA 4ONGH 1F8TH 5E6IA 1JZ6A 5FA4B 1OW0A 1JNHB 5L2JB 2EXWD 4YAQB 2HLFC 1F6LL 3WIFA 2XYCA 1TJHL 2D7MA 3QUKB 3RBSA 1E4KC 1DL7H 2BNRA 2RFXB 2C7UA 4A6YB 3C60B 5EU7C 4Q6YA 4YIQA 1AO7E 3PHOB 3TA3D 5F1IB 4ZSOA 2IQ9H 1EO7A 4TVPL 1F13A 1FGVL 4LVOB 2EICA 4S0SD 5F1NB 3RX5A 4LLUB 4PGCB 4AG4L 1U8LA 3QUYA 1CVRA 4QRPE 3P0GB 4M7LH 5FA4A 1G7QB 5F9JB 4WU7A 4GBXD 4NUGL 1LWRA 1REIA 5FGBC 4PRNB 1IGCH 3TJEH 2Z8VC 4YPGA 5DI8A 1CU4L 4EQ3A 1LE9B 5JXEA 3MX0A 2GQHA 1VA9A 3BEWB 5F9OH 5KTEH 2XZQL 3TEUA 5CD5D 3KLSA 1X5XA 1PKQA 2XFXA 3LKRB 5F1NA 5FOBA 3BAEL 1MWAB 1P9MC 4NWTL 3QEQB 1ZEAH 3HMWH 3EDDA 3AGVA 2IF7A 5GPRA 1I8MA 4K8RD 5CZVL 4PRHB 4X5XB 5HD8D 3BKYL 4TRPL 4DW2L 5DFVD 4OCMC 1D9KD 2ESVB 3OKMA 3I2CL 5HDOA 1PZ5A 1BQHA 4GXVL 4HX1B 3KPQA 3PWPE 3SDDD 3U4AA 3KVQA 4AL8H 5DQJA 4D0DA 4QKXB 3B8SA 3NFSH 1ADQL 2ED8A 3L5XH 4R3SA 2A6JA 3DO7A 4OFPA 4M61B 3OKLA 2CMRH 4FQXC 5CEZL 1JF5A 4HJ0C 2NYYC 4PJFE 5KAQG 5JW4R 4JPKH 4NOFA 1PYWA 3WV0A 3PHQA 3O3BA 3RWCB 2BVYA 1J0KA 3M17A 3TA3B 4KDTA 5SWQB 4HCRL 2GTZB 1CGUA 5BO1H 4PB9H 4MNGE 3TIEB 5KZCB 3VW3H 2V2WA 3VRJA 2E6PA 3F7QA 4ZUSA 5D7SL 2C3VA 3QWRD 1U8PA 5DMKB 3Q6FA 8CGTA 4OCWL 2WUBH 3KPMA 3VXRA 4LLMA 2C3HA 1F2QA 3HAEA 4Q97A 3P4NA 2BY2A 3MLTA 4U4BA 5HHOA 3O3BB 1S7TB 4PRPB 5GRUH 4QHUB 2DD8H 5ILTL 1GL4B 3F12A 3BEVB 5AZEH 3PP4H 3CFIC 5CP3H 2UWEB 4NKMB 4AIOA 4G8GE 4CL7A 5CSZA 3HC3L 2LQRA 1M7XA 4LFHG 1FFNA 4WHCA 2HH0H 3BX7C 4J3SA 5JW5A 4JHAL 1CFQB 1BX2A 5LAXA 3E3QC 4JAMA 5GGQL 3SKMA 3MR9B 3V5KA 1MRFH 1YEFH 5HHVL 5DD6A 5F88A 4XI5D 5H94A 4YUEL 2AK4B 3ARFD 1K4DA 3HE6A 5IT2L 1M71B 1HIML 1TZGL 5SV4A 5FYLH 1FIEA 5JDSA 1Y6NR 3UBXB 4X9FA 5FGSA 1L7TH 1KGCD 1ZV5A 3QEHB 3O3EA 4KKCD 3E2HB 3HZVB 3BVNA 3QBTB 5BZDB 3RAJL 1FH5H 3ARDA 4DN3L 3QPQD 4HUNB 1IL1A 5MI0C 4OF7A 3ARXA 3DVFA 3PQYB 2AXFA 2EDXA 4RAUB 5IVOA 1Z3GL 5I30H 4I2XA 1SM3L 4UIKH 4ZFOL 1R3KA 2HFFA 1JUFB 4XXCC 5DUMH 1MCKA 4OCYH 1WIOA 3HZMA 12E8H 1NGPL 2HJFA 1H3VA 2QBWA 5C07E 5JR1H 3RWIB 5KOVC 4Q9QL 3DXAE 1C12B 5DUBB 2LE9A 3MBEC 1NCCL 2DMBA 2WMPA 2XA8H 4UI2A 5C8JA 1T7XA 2VXQH 3WFBL 5LBSL 4ZAKD 3LOWA 4DTGH 1CD1B 4YQXL 4OZHA 1U91B 1WSST 1RHHA 3O81A 4I3GA 3BYYA 2APVA 4QRQB 4QOKE 1K3ZA 3EDFA 1NANH 5BRZD 2A83A 1U8IA 2PTVA 3L3HA 1V3LA 2NY1B 4M5ZH 5GISL 1PEWA 4CADB 3IXTB 1CYGA 4OZFB 1ETZA 2Y07L 3BZFA 1XCTB 5AAMA 1UB5A 4UT6H 4LMQI 5KJRL 2OJZL 4O51A 1J1PH 1RIVL 4KJYA 5J1TC 2ESVE 2EE3A 2JCCA 5GS2D 1U8MA 4YHLH 2FZ3B 2YPVH 4Z7WF 1ODAA 1JRHH 2Z0BA 4OTXH 2F9BT 2J6EH 4GW4A 4M9OA 2DI8A 4IRJD 4G3YH 1UWEL 1KCRL 2JB6B 3TO4B 3ILPB 1M05B 2BSSA 3T1FA 4DAGL 1KYOJ 5EFIA 3MLXL 3L5IA 2RJMA 4B53A 3AREC 3ULVC 4M4RA 5FA3B 5CZXD 3L3DB 4PRIE 4LEOB 4RIRB 2YXMA 1NSNH 5C0IB 3DROB 5CEZE 1Z5LA 5ACMA 5IFJA 1PSKL 4D94A 4NBZB 5I1GL 4FQCL 1NGWB 1S7RA 3TIDB 1ED3A 5F96H 4HUMB 2V5YA 4XT1C 1RUMH 3QUZC 2R4RH 5CLTA 2AJXH 5DJCA 4MNGB 2P44B 1D5IH 4P2QD 2JB6A 2NXZC 3U79A 3TBVA 2ITDB 3O6LL 4UT7L 4YR6B 4CNIB 5DFWH 1NCWH 2C3XA 1IEBB 5EUKA 5C08E 1G7QA 3BP4A 2WBJA 3C9NB 1FZKA 3CFKB 4KC3B 3R8BB 2NNAA 1MSPA 2D0GA 4JFHE 1JZ8A 4NO5B 3PV6A 4MSWB 3HC4H 1UKQA 1FVCB 3NCJH 4FQHB 2CIKA 2DOCA 3K74B 1KJVA 1JWMB 2DQHH 1HILA 3B43A 4KMLB 2Q3ZA 2ORBL 1SVZA 5C0RL 1P7QD 2MPAL 4AM0A 5CJ5A 3CX5J 3TA3C 5JLZB 3KYNB 3V7AE 4LLWA 3C8HA 1NDGA 1IRAY 4C56D 1K8DB 4Y19D 3VFNA 1JNHA 2DYPD 5L2JA 3LEXB 4PJ5A 1I3GL 2N1KA 3ZKNC 4R7NA 4HDIA 1OQOA 2F53B 3P11H 2AW2A 5F8QC 5E1AA 3U46A 3VXRE 1MIEH 4M3JA 1IAIH 3VRIA 3K81A 3TGXA 3MV8A 4JZNB 4YDIL 5I2IB 3RHWF 3TT3H 5D9SA 3UPRB 1AC0A 2WBKA 4YXLH 4R0LB 5C07D 2CDFA 1RURL 3MODL 2N7AA 2ZUVA 1UXWA 1U8LB 3VFNB 2DQIL 2EO9A 3SDXB 5E4EC 3VH8B 1VERA 2GT9B 3QEQD 2VDLH 4HUWA 4HC1A 2P5ED 4PG2A 4NQED 3H9SD 1K8IB 3SO3B 1ONQB 4FXKA 4QOKA 4YFEA 3MOBL 3K1DA 1ZS8A 3T0XA 4HUUB 4JZJC 2MKWA 4F7MA 3U7AA 1UB6B 5IVXB 3H3BC 4ZNCD 3VFUB 4P4RB 1UWEH 2XPGB 3EYSH 4MNQB 1JNNH 3B9KB 2F54A 3DX7A 1I7UA 3K2MC 1CVSC 1DBBH 3VI3E 4LPUA 5F44A 3D69B 1LP9F 4MJ5B 4HWZA 4HQQH 4LIQL 3EFDH 4FQXD 1XH3B 1W0VB 4IOFC 4PR5B 4NHUA 5JQHC 5KSBF 3UTSA 5FYJH 3UZEA 4E42A 4UT7H 3IDMB 2XZCH 2CKBH 3WNPA 1D5IL 3MA7A 4R3SB 1MCEA 4GS7B 4MNQA 2PW1A 5FO9A 4WCYL 1MAJA 1FSKB 3MZTA 4JPIB 3PWNB 3X14B 5DURD 5JMRA 4QXTA 4DEPC 5KZCD 1YN7A 3MLSL 1MCWW 1YPZF 4JAMB 1GGIH 1EJOL 1PDKA 3FFCB 4XPHL 1HHGB 1UVQB 3KYOB 4L29A 2BRRH 5F1SA 4JFPA 4NO2A 5H35A 5IGXH 4Y5XB 3W5NA 3LPWA 4U1HB 4E41E 1A3RL 4PGBB 2D4FA 4BFBD 1MCBA 5EIQA 1M6OB 5JOEA 3GBMH 2VDQH 3TBTA 1OLLA 5HHXH 4X4YA 4ZUSB 4CRPA 2VXTL 1UEYA 4P59L 5IB4B 4QF1B 4G5ZL 4GBXC 2DQEL 5DUML 5DRNB 4F7TB 3ZYZA 1RMFH 5CD3B 1ZAGA 2ZSWB 3WDJA 2AXFB 2HRLA 3OMZA 1JGLL 5HDBF 1LNUA 1T1YA 1B0WA 1DTUA 1AIFA 5J12B 4E9LA 3CUPB 4AIZB 2D0HA 3H42H 5CSZB 5GGUA 2NY0C 5CP7B 1CK0H 4OFYA 4PLJC 3RY5A 1ZE3C 3GNML 5BXFB 1R5WB 2DS4A 5LG1A 3EUUA 1CR9H 2ZUWA 1CFQA 5IB4A 1CLOH 2FJFA 2X1QA 3SKMB 5IESH 4BKLB 1VENA 4JFZL 5DD6B 1KJ2A 5F88B 4KJQD 1LEIA 1WEJH 5I1JH 4JO4L 4UV4L 3EO9H 4YNYA 4KFZC 1MQKH 3QULB 4WI9A 1FDLL 5GZOD 5D1ZA 2YS4A 4F33A 5GS0C 4NT6B 5DWUL 5E0QA 2AXGB 5EUOB 4APQA 1KENL 1IM3A 2YA2A 5F9WC 3C6SA 3IETB 5L2KE 4UOW1 3Q6GH 5D2NC 5DJ8B 4KXZI 4JVUA 1KNOA 1I8KB 2CJUL 1RZJC 4OCXH 1S78C 3G5VB 2E9JA 4ZTOL 4NRYA 1BWWA 5D1ZB 4EI5A 1S9XA 3KJ6H 2YMXH 3O9WD 4UTBH 2A73B 4OCWH 5D1XD 3SE3C 3H9HA 1YJDH 3LN4B 4JFHD 3OWEA 3NA4A 3TH3T 1F3DH 3O9WA 2WANA 2R2BB 4JPVL 4EN3B 3IDNB 1CG9B 1G9NH 3KWWA 2A9ML 3AFLA 5SWZD 5FXCH 5EH1A 2BSRA 4FQPA 5D7LE 3TVMC 4IHOA 4JPKL 4O2EA 2NW3A 1G9NC 4WI4A 3VFPB 1ED3B 4M6NL 2OLDA 5IFHL 4YXKH 2DL9A 4P99A 1XCTA 2E8ZA 1Q94B 3GSWA 2Q8AH 4EDWL 5JHLH 1XCQA 3D39D 3SKJL 3SGJA 1WZKA 2BRRL 4YR6A 2I25N 3L3KA 4MX7A 1QD0A 2J8HA 1BFOB 5DRXB 1EJOH 3X13B 1RUQL 1FN4A 1CE1H 2X1WL 3CSBA 5CGTA 2FEDC 1J87A 5IQ9A 3QQ4A 1JWMA 3P4OB 3HNVH 2NY3D 4GW4B 4IEFB 5F1IA 1JN6A 4AM0B 2J7LA 3IKKA 2XZCL 1F4XH 1FRGH 5J1AA 4ONHB 4M7JH 1NBQA 2E5EA 3GK8L 5IHUH 1UJTA 3ILPA 1M05A 2BSSB 3T1FB 5B8CC 1JGVH 5J3HD 1T7YA 2VZ3A 3BWAB 4RMVA 4J23A 5M7QA 1N7MH 3BUTA 1WWWX 1GIGH 4M7KH 2H8PB 1B0RB 4MB4A 4G6AC 1BD2E 1C5CH 3VDBA 4MLSA 1UA6H 1RUPH 1L0YA 3FHAA 5F3HA 3ULUE 4OLVL 2Q8BL 3BRGC 2X10A 5FGCE 4CMMA 1NFKA 3MUJA 4M6OH 1MRCL 2OR9H 1QSEA 3RA7H 1T7VA 3LPGA 1Z9LA 3QH3A 4H88L 2V7HB 1MWAA 2W38A 3DURA 3KLAA 3O4LA 4G6JL 4EUPB 1VKXA 2OR7A 3DETD 3OKEB 4OSUL 4AQOA 3C09C 5ALBL 3ULSB 4LNRA 5HDBE 2CRYA 1I3UA 3RZCB 1X9QA 3MLVH 4QOKB 2UWEF 4WO4A 5CZVH 3H0TA 4WWID 5I1CH 2YWYA 2OTPA 4P9HL 3TZVD 3I75B 4MJID 5JUEH 1FG2A 3BT2H 4CJ1A 3V2AR 3FT4B 2QR0B 4MNHB 4NZRL 3BKMH 2OZ4H 5EWIL 3VWJD 3IDUA 4KVCH 3F58H 5DJ0A 2X9XA 3WIIH 1P7QA 3IU4H 4NYLB 3CFBB 5C0JB 3KPRB 5JIHA 1JHTA 2IBZX 4NGHH 1A7NL 3RWCA 1BLNB 2O5YH 4X98B 4H25B 3QAZC 2FGZA 4LVNB 1B2WL 3OTTA 4HH9A 5FYJE 5IFAH 4Y4FB 1MHPL 4Y5YB 3V5HB 4P9MH 1TPXC 4R2GD 4QRPA 4I13B 3P9MB 1TITA 3MRLB 3UO1L 3KYKH 1VGKB 1P6FA 3HE7A 1K8IA 4BZ2H 4F7EA 3CFBA 3MRMA 1TJHH 5GJTH 3VFSB 1ZS8B 1WWCA 2IAND 3S5LG 1UB6A 2XZAH 3OJDB 4JFOA 5E4IA 2R4RL 1ZLUK 1JGLH 5I8OL 4P3DB 4QGYA 2MQ0A 2BDNH 3K4AA 3IXAB 3WLBA 2H1PL 4W4OA 4UIMB 1H5BA 1OAQH 2EDYA 3RGVB 35C8H 3QEGH 1BF8A 2AERT 3H6JA 1CICB 4QRRD 4Z76A 2Z91A 4O02H 3REVB 3FQNB 3LEVH 3HS0A 4PTTB 4PPTA 2ZUQB 2Z8SA 3DETC 1C5BL 1CLZL 5DK0B 5FF6B 5MP6H 3MA7B 4N9GA 3L3GB 1YDPA 2AABH 3FKUS 4TQEL 4HFWA 1HWGB 3O2DH 3PWNA 4WNQA 3WJJA 4I9WE 3VXNB 3DX8B 4XGZA 4DWHA 3Q2CA 3ECBA 4QRRE 1ZHKB 3U7WL 5EPMA 1J1PL 2V2TA 3G6JA 1JMXA 3L5WB 3IFLL 3VH8G 4RX4D 2NZ9D 4O2FB 2JELL 2VRAA 2DQFA 2GSIB 4Z7VF 5IW3A 1ZA6B 5MEND 3GO1H 4CW1A 1K2DA 1T1ZB 4JRYB 4XCFL 2VLKB 4N8VA 4YK4C 1IILE 4HIHA 4PJHF 1A5FL 3BXNA 3KR3L 5F7DB 4YQXH 4IIQC 3TJHC 1EVUA 2R2EA 3KPRE 3QIWC 4KRNA 5A2KH 4YHIB 2V2TB 3LD8C 1EHLL 1MCLA 3RKDD 4QXWA 4MDIA 4P3WA 2R1XB 5FUCE 3DVGA 5D1XC 1KELL 4YBHA 5F1KC 5TDOA 4KZEH 1IKFL 1BFTA 1X5YA 2R69H 1DSFH 4KKBC 5C0FA 1S9XB 3EO0B 1UZ6F 3WFCL 4YHNA 4N8VG 5DMYA 1U3JA 5FGCB 3RDTB 4EIGB 2R2EB 1N59A 2VB5A 4WW2F 4XAWH 5JPNB 1R0AL 4D8PA 4QNPE 3LQAL 4DFHA 5GS1A 4PS4H 1KJ2L 2VABA 3S36L 4KZDH 3T0AA 3LQAH 4HD9A 1A7OL 3VA6A 1SJEB 2H2SD 1PLGL 4DZBA 4MYWB 2APBA 4O2EB 2UVEA 1BD2A 5TE6L 5GGTH 5D7JD 4XXDB 5C0GB 4J3WA 2EDNA 4OM0L 1T0NA 2AK4D 4F57H 4D8PB 4X7TA 1P2CB 3DVNA 3LEVL 2CUHA 2G9HA 4M1GH 3D25A 2AJZB 4HIIB 35C8L 4WTWA 4IRSB 4WTZA 4TPRH 4DFIA 4FQJH 5JNYA 4A6YL 3GSOB 3DROA 4P0DA 4OGXL 3EOYG 1AR1D 3PUCA 1J5OL 2WINB 1U9KA 2HH0L 1VPOH 2DTMH 5C07A 1HKFA 4WFFE 3FO2A 1QPXA 5DJCB 4JG1H 4YE4H 4GUPA 2KZWA 3I02A 2FLRT 4Y4KA 1XGTB 3C6LC 1EEYB 1N0XL 2FGWL 4G6MH 4ODTH 4LHJB 5ACLA 1ZLVK 3BPCA 1AHWC 5DFVC 1V3JA 1E0OB 5ECJE 1GZQA 3E8UL 1XR8A 4MA8L 1RFDH 3DO3A 2DQTH 3FRPG 4PTUB 1F4HA 3O2DL 4Y2DD 2IGFL 2UYLB 2F8XC 3FOMB 2P5WD 4MA1B 5IR1A 3ORJA 3NTCL 4D9LL 1NSNL 2W60B 4WFHD 2HMIC 5IB1B 5D2LF 1XGTA 4MAYB 5DRZA 4H1LG 2J8UE 2FATH 1OSZB 3MV7B 3DV4A 4H5SB 3PL6A 5EWIH 5GS0D 2HLFD 4LPWA 1LVEA 4G7YL 4LNRB 1FPTL 4QCIA 4NO0A 4JANA 4OTXL 5TF0A 3U4EA 4DZ8B 1P5UA 4DOHB 1RZGA 1ZSDB 4M7ZC 5D7JB 3V6BR 4L3EE 2J88L 3MUZ1 4L4JA 1HSAA 1QOKA 3LV3A 4NO3A 1KIPA 5HVFB 2CLRA 4P2OC 3ZL4H 3SGKC 3WUWB 2EC9T 5ALBH 1JTPA 2WM0A 3INUL 1J8HE 4BSJA 5TDPB 4MD4A 3GSUA 1FO0A 5MERA 3MNZA 3B9KD 4MXQC 4HF5L 1HZHL 5HHME 1UQSB 1J0YA 1WAAE 5IMOA 3TYGH 5BJTA 1U92B 4XCEA 2A2QT 5DVOA 2VLRD 4PJCF 2I27N 2PYED 3LV3B 1NGXA 2AV7B 2ZKHL 1KLFA 5FFLA 1VKXB 3WUWA 4QRPB 3FCTB 2CDEA 3RY6C 2QQNH 4MD4B 1T4KB 4J2XA 5KSAC 3VXME 5E8OA 4OF3A 1K85A 2B1HH 1F4YL 2VAJA 4MMXC 1ULVA 3WO4C 2PO6B 1FV1A 2EIDA 4OF5A 2XN9E 4E42B 1ZT1A 3MLWL 5DHYB 4UU9A 4RFNC 5CZXC 4GG8B 1ACZA 1VACA 3IFNL 3VXQB 1JJUA 1ZT7A 4P2RD 3UYRL 4CAGA 1J0HA 4LCYB 1OP9A 4X4XA 4NRZA 2O5ZH 4JFFB 1XFPA 2HN7B 4P4KB 3ULVH 2HFEA 3MV7D 1K6QL 1JPFA 4HBQA 3QDMD 3GMPB 3LRHA 3KPRA 1A9EB 4UAOC 2C9AA 3DWTA 3VXUE 1WC7B 1HYSD 5ERWB 3RWJA 3FOLA 4DQOH 3WJJC 3KPSE 1L7IH 1KB5L 1RV6X 3VFVB 5E8NA 2NY5L 4G8FB 3L9RA 4LCWA 43C9A 4PLOB 2ADGB 4KK6C 3CDGA 4Y4KC 1MFDL 4JHWL 4K94H 3PGDA 3EBAA 4EUPG 3VG0L 1D6EB 4LPVA 5EZLB 4GG6A 4BK5A 2CIIB 2X9WA 1ZWIB 2NY2D 1MUJB 1F4XL 1T3FB 5DK3A 2VXSL 5FHBL 2R1YB 3JUZA 3PHOA 3WCYA 4XWGL 1J86A 2DD8L 2ADGA 4HIHB 3AXLB 4X6CA 1FORH 2Z31B 2W9LA 2FJGB 2UY6A 3NAAL 4TNVK 4NNPH 2R2HA 4XP9L 2FRGP 3BGMB 3O2WH 4MCYB 3DVGB 1YPZA 5ESQB 3E3QE 1HE7A 3L7FA 4HBCH 5I0DA 1CF8H 4HGWA 4H1LA 1WZ1L 5C0CE 3RY6A 3MRPB 5L8KB 1N8ZA 1Z2KA 3IYLW 4J1UB 2NLJA 1MFDH 5FB8A 4FABH 5DXWA 5DJYB 5DJ8A 1CGYA 1SJXA 3HRPA 4OZ4B 5GS1B 1F2XK 4WTXA 2YC1B 3G5VA 3KJ4C 4AEIL 2FDBP 1T03H 2AJUL 5L9DL 4RAHA 2QQKL 2VDNL 3CFEA 4U0RC 4MS8C 3A6BL 4LIQE 4XI5C 4LLVB 3PDOA 2VYRE 3L3JA 3ZHLA 1KEGL 1KLUB 3PG2A 4Y19B 3VDCA 4D3CL 4MDIB 2F53D 5IW1B 1HH9A 1ZLSL 3S5LA 2AJZA 1II4E 4Y7MA 2LAGB 1MF2L 1MJ7L 4EBQH 5CINH 3O4OB 3WIHH 1X5FA 4XVSL 3AS1A 3D48R 3WS3A 2WBJC 5HHMB 2WP3O 3GRWH 1NDMB 5C07B 3ESUF 5SX5H 3TJEL 4L9DA 4QHMB 1J12A 2AJSL 2ENYA 3I9GH 3LB6D 5CBAB 3MGOA 4P23A 1TXKA 3RWGA 4MVBC 4XC1L 4NC2B 3UTTB 4NQEB 1CFNA 4MAUH 2IQAA 2XXMB 1E27A 3SBWC 4PJEF 2BC4A 5FUZH 1Q72L 4UTAH 5FEBA 2VR5A 3TYGL 3BHBA 3NCEB 1MFAH 3MZGB 2H32B 2CK0H 2GTWA 5ADOL 4QXGH 5EZJB 3BEVA 3FO9B 1WAAA 3QDJE 4M02A 4U1IA 1A6WL 4GRWH 1SHMA 1DQLL 4QHNA 4PJDA 4KDWA 3RHWK 3MNWA 3VG0H 2YPLA 5DJDB 4XPTH 2OQJA 5KBNC 2ARJQ 2OTWA 4ZFFB 1CDGA 1ZHLA 4PJ8B 2HJKB 1EK3A 5DMIL 1OAKL 4LCIL 3SE9L 5IEKB 4QT5B 2ED9A 4OKVB 3HUJB 3GBML 3UROR 4XBEH 1FZJA 4WHYH 3FO9A 4NPYA 4DN4H 2FR4B 4Q6IC 4PRPD 4Z78A 1FYHB 4BSVA 3RL2A 5FKAB 4K7FA 1OTTC 2I60L 4GKOA 2CLRB 4OI7A 4X0KA 2D9CA 4IRJC 3VGAC 4DEPB 3LAFA 1PX3A 3OKEA 2EECA 5I16B 4HS3A 2OMNA 5DJZB 5ID1A 3HCVB 1CD9B 2XQYG 1P7KB 4WI2A 3D5OF 4PTUA 3JV0A 1I8IB 3UCRA 4KRLB 4O58L 5CCKL 5KS9A 4QY8A 5AWNL 1MJ8H 5CLWA 2VLJD 2WIMA 3QB7C 4PLKC 1N6UA 4OV6F 3S7GA 3VXUA 3FQXA 2XWTA 4ISVB 2GAZB 4K94C 5KG9A 3MUGB 1FG2B 3L6FA 4YHYB 2FX9L 1FJ1A 3I3EA 1GGCL 1OF2A 2J8UB 4K7PY 5K9JH 3MRFA 5IEHA 1NC2B 2PTUA 4H5SA 2VISB 2YPKB 1CXHA 5ESVA 4ONFL 4PYGA 3JWOH 3V6OA 1P9MA 2P43B 1WBZA 3SGKA 1X5LA 5BS0A 4HIJB 1XGUA 3NCYP 1CFTA 3R4DA 3WN5B 5BCAA 1ZLWH 4XNYL 5CUSH 3L3OB 1A1OB 2I5YL 3OJVC 4XPAH 2GK0B 2P47B 3QIWA 3O3DB 5GSVB 3DXAB 1FFOA 4WRLA 3PWPD 1IGYB 4M1GL 1TNNA 3C87A 5A2LH 4YFLI 5DGQA 2JJUA 5CMAA 4L4VD 4U1JA 5SX4H 3ULUH 5GRVL 3NIFE 3RL1B 3EHBD 4L9LB 3MRKB 4UUJB 1P1ZB 3BIBX 1JNLL 4K3JH 2XTJE 1RURH 3O11B 4BH7A 4LCUA 1PLGH 4F58H 2KQMA 5CZKA 1PD6A 3IDXH 5I1AB 1T20B 3O4LE 1VFBA 3AS0A 4XP5H 4QXUL 1MRDL 4HXAH 4YIQB 2VZOA 3OR7B 3U6RB 1FYTE 1UCBH 3P11L 1XGQA 3OXRB 2R4SL 3RU8H 1FG9C 3AREA 2AEPH 3JZ7A 2J5LC 4BUHA 2BJML 4LQ1A 3X12B 1KN2L 1JYXA 1F11B 4I18B 4DK6A 3VU2A 1HEZA 1J7VR 3QO0B 4PJ7A 1PG7H 3IRPX 1CGSL 5C0IA 1NMBH 4LRNL 5I1AA 5CILL 5JXED 5E5RB 4YHZL 3B9VA 2HTLC 5JHDB 5BVPH 4JFFA 4QHKI 4F57L 5SWZB 3FB7A 3KR3H 4N5ED 1QSZA 1F4WL 5FUCC 1F00I 4XCFH 2D03H 1AKJA 3UJTL 1F6FB 1U8OA 1VGEL 5ADPL 5C3LD 4GQ9L 2P48B 9CGTA 4GT7A 3O4OC 2Y06L 4OUUB 1MCDA 3MO1B 2V7NB 1D5MA 4FG6C 5FUZL 4C4KO 4EOWL 4LSSL 4ZSOB 2X4UA 2RR3A 5KSVA 5HY9A 1IKNA 3GHBH 4G6KH 4PRHD 1HKLL 4OCSL 1P4LA 4S2SA 2X4RA 4LLUA 4PGCA 1S7QA 4ZOAA 4TQEH 4XC3H 4ENEC 3DSNA 5DQDL 3ULUF 5KS9E 1OGTA 4RWHA 4KDVA 4F2MA 5EO0A 4JN1L 5MEPA 4PJ8C 3MRRA 4AZ8A 4W81A 5DDHB 1RIHH 1EMTH 4HKZA 5EIVA 3BMVA 3Q5TA 4OIAA 5CINL 3NCYS 3L95A 3MRJB 1BFVH 2R0WH 3GEWB 5F6HI 2H1PH 3BDBA 4X6CB 3EJYD 3U2SB 3SQOL 2FB4H 5TDNA 3BYTA 3ARRA 1FLRL 1WFNA 2E9BA 4GW5B 3VFTB 3U0WH 2P8LA 3ZO0A 1LEKB 2DAVA 4RRPG 4L8CB 1JPST 5HYQB 1U8HA 2HVKB 3JTSB 2A6DA 5HHNB 4Y2DA 4ODSH 1H0DB 1LO5B 4I1NB 5LCVL 1W72H 2P8MB 4X99A 2VSCA 1RJZA 1NH6A 2OI9B 2EDOA 4PRPA 1ZT4A 1EO5A 3JV4A 5B39G 2VZSA 4LHUB 4PFEA 3V0VB 2DLFL 1S7WA 5DYOA 4G8EA 4ODHH 1I4FA 2YC1A 5HYQA 1SEBB 5D5MA 3D3VB 3ARVA 4Z7WE 4GRMA 3IDIA 3RZCD 2XA8L 1X6LA 1ZGLB 4HWZB 3KLDA 1JL8A 3GZKA 1W0VA 4YGVA 3U1SL 3VFOB 4F9PA 1VEMA 2H32A 3IB4A 1YZZA 5E8EA 5F7FA 3M17B 3NZ8A 3TA3A 2GJ6E 3UTSB 3TBSA 1U8NA 2E7MA 1YQVH 4Y88A 5HJ3A 4ELMB 1IGIL 5DD1L 2B5IC 3C5JB 2VLLB 1OWRM 1DBKL 1U36A 5DGRA 4GUPB 3MRQB 3GIZL 4NJAH 1A7BA 3HFML 1BWMA 4NJ9H 5DEGB 1XIWC 3T3PE 5T3XH 3CVHL 1CXKA 3KPMB 5AD0A 2AJVH 2FNBA 3FL7A 3MMEB 5EOQL 3WS3B 3VFOA 5DZNA 1UYWH 1XF5A 4HULB 5DD3H 4XCCH 4X8JA 4P5MB 1RUKL 3DARA 1DJSA 5GZND 2KH2B 4ESKA 2X05A 1DFBL 1A6UL 4PRBB 3QUZA 4Z7UB 4S1RH 1E6OL 4RBPH 1R3LB 3CPLA 2YUZA 4X5WA 1ERNA 2XZZA 4H88H 3QEGL 3J7HA 1JGDA 4NP4H 1BBJA 1MRCH 4HUVB 1DUYB 4N0CC 3SKNB 2PW2B 1NFDF 1UCTA 1TVHB 2D7NA 3QXVA 4ZD3L 2O5YL 1IAIM 4GRLD 4LEXL 4DGIH 5E7BA 1X5JA 2GTWB 1I7ZB 4L8DA 3GSQB 4UDUB 1AIFB 4P23C 5I75B 4NKIH 5D2LA 4U1IB 4ZOBA 4KI5F 1N7ML 1A6PA 1YEHL 4Q9BA 4DKAA 2D31A 2GFBB 4NKDA 2VR9A 1JPGA 4K3DH 3O6KL 2FEEL 4J8RA 1RIUL 1OQXA 5E4EB 5TF1H 1O0VA 1INQB 2CR3A 4BKLA 3B9EA 5D7SH 4XP4H 5FDYA 3WNMA 4HWEH 2P5WE 1ZEAL 4HC1H 5GGTA 2PCPA 2Y4SA 5KSBB 4YNYB 4P5TD 4QEGA 3GUTB 1YEEH 2DI9A 2JF1A 1M1SA 4EIZC 4JRXB 4GFTB 4NGHL 2ADFH 3MJ6A 5ICZB 4J8RB 1MFEH 1MIMH 4OD2A 1QVOA 3L1OH 3F7RA 1YY9D 3X3GL 1CS6A 2FHFA 2FECL 2YK1H 4UZGA 3ZE0E 3RPIA 5FUOH 3N9GL 4B7IA 3W0WA 4GQPH 5K9QG 4QWWC 2RCSH 4UUJA 1AQKH 2IPKB 4X83A 4R96A 4RMUA 3TBWB 3GUTA 1YN6A 4W6XB 5JUEL 4FFZH 3SKOB 3E0GA 2W0PA 4ZODA 1FV1B 2DQJL 2B2XL 4P4KC 4Y19E 2B7DT 3QHFH 1AGBB 5KVEH 4KJWD 2J8UA 2L7JA 1NGWA 3A67L 3T3ME 3DXAD 5DJXB 2JIXB 3MXVH 1P4IL 3G08A 1N5AA 3X3FH 2VAAB 4P5KA 2J88H 2IPKA 4Z7QF 4G6JH 5IB2B 1FNEB 3EJJX 3L3OA 3BPLB 4MAYD 1NAKH 4EKXA 3RA7L 2F19L 1OAYH 5ERWA 3RWJB 1BZ7A 3OAZK 1E6JH 1QBML 4HZLA 4TVPD 1CD8A 3T09A 4C56A 5GIRA 1MH5A 5I15L 4P57A 4PGDB 4F37F 5E8NB 5C6PB 1N2RB 4S1DC 4LVEA 1HK6A 4KU1A 2IH3B 2IPTH 4ODUA 5T3ZE 4G6FB 1RQ5A 1WCQA 3HC0A 1F5WA 4KV5E 1G0DA 4XCYB 4NOBA 4YFDB 2IGFH 4HIXL 4PJBA 2HVJB 1MQKL 4TULH 4IS6A 1FRGL 3CU7A 5MENA 2ZSVA 4X6BA 1T20A 2IQ9L 4QTIL 5DJ2B 2F5AH 5C0BA 1H9VA 1G7JA 2PN5A 1A6UH 3O45A 3WJLC 4OM1H 1HOCB 3C6LA 4KK8C 1KT2B 3LRGA 1CZ8L 3ZT5A 4DVBB 1YJDL 4NFBA 4BZYA 4JKLA 5I73C 4U1LB 4FFWC 3QXDB 1H5BC 1A2YA 3HA0A 1BAFH 3Q1SH 5T3XE 4FTVD 1KLGB 2DLEA 4QRSA 4U1SA 1WJ3A 3PIQB 5EBWA 4YO0B 1CBVH 2MSPA 2WUCH 2OL3L 2AGJL 2NXYD 2YKLL 3BKJL 5FUOL 3WL9B 2HG5B 5JW3H 2VERN 3VFTA 3RIAF 2OR8A 1YUHB 2XI9A 5HGHB 4ETYA 2R0KL 4EUPA 1LO0H 4I5BB 1NC2D 1AKJB 4HV8A 4PJIB 4L8CA 3VG9C 5DD5H 2W9EL 4XNXH 1YEEL 4Y2DB 2R23B 4XCCL 1T0MA 3V52H 5IOPA 1Z6JT 5CIPH 3NACH 4X6EB 4Y16D 2ERJC 1F58L 1INEL 1S7VA 2JLLA 2P24A 3G5YA 1RZ8B 4NHUB 3LQMA 3FN0H 5F7KC 4KQ4H 3DYPA 4BFGA 3DV6B 1VGEH 3VH8A 5ADPH 5IMLB 2XKUA 2ICWJ 1YN7B 1DQTA 3GBNH 1ZGLA 1UACH 1OVZA 4XBPA 4H8WL 3NZHL 5AZ2H 4PJGE 3GHEH 2VLKE 2R9HD 3G6JE 4QHUA 2HTKC 4JFPB 5H35B 1NBYA 4U0QB 1KELH 4X6CE 2DQEH 4Y5XA 2Q87A 3KPSD 2ZCLH 2UWEA 4NKMA 1IGFL 1RIHL 2IBGA 4O9HH 1BHGA 1CGSH 1NCAH 3MJ9L 2HVKA 4ZO9A 5JQ6L 3S4SA 1IC7H 1TTGA 4GKZB 1SYVA 1DQJA 3RTQA 2Z31D 3F5WB 1BVZA 1RU9L 1PYWB 3IS1X 4U05A 3T2QA 3VDAA 4BK4A 3B2VL 3RVTD 4BQBA 2Z8RA 1LE5A 4YHOL 5D7IB 4JM2F 2D0FA 3MV9A 4HXAL 5EZJA 1Q1JH 1OHQA 5F3BB 2FECI 2NR6C 3T4AB 1Q1JL 1W0WA 1EJ6A 2ZP0T 3IU3A 1CXLA 3Q6FB 2FX7H 4FZ8L 3SDAC 4DGVL 4XX1G 3QXUA 5FYJL 3SEPA 3QPQC 3WFCH 3C2SA 3LQAC 2HFGL 3QQ3B 4NBYB 5DQ9A 2Y72A 1QFWL 2B4CC 3VFRB 5I66B 4X7EC 4KJPC 4M3KB 2FCBA 5FF6A 5CJOL 2DQGL 1T5XA 5IROA 1BVLA 5T5NG 4R9HA 1OAQL 1UC6A 4M1DH 2W92A 5TFSH 5FKAA 1I9EA 5ESAB 1EV2E 1FC2D 1G9MC 1F97A 1GGIL 3SJVB 5C2BH 3FFDB 5DUBA 4YBQC 1OP5K 1J18A 1EIBA 5IMKB 4R0LC 4PJ5E 1KCVH 1PFCA 4HS8H 4X6DE 1MRDH 4JFDB 4JZJA 3RGVD 1EGJH 4XPFH 3KLHC 1L4IA 1BEYL 5FM8A 2ZNWA 2M8XA 4C56E 1KXQE 5ESAA 4LSRL 2VSDA 2UZIH 3I84A 5LWYH 4K55A 3MTRA 5TJWK 4TSBL 4I3RH 4FQ2L 4JLRA 3O9WB 3MNVA 5E8DL 5C86A 1EMTL 4N90D 4MQXC 3ULUL 4UDUA 4JN1H 3VMOA 1CT8A 4PRIB 1UJ3C 4KGJA 4PJ7F 1W0YT 4MQSB 4KKAC 2N7BA 4KK9D 4PY7A 2ZOLA 5CHNB 3ULVF 3DBXB 1Z9SA 4XBEL 2NYYD 5HPOA 4U1JB 1N59B 4P2OD 4WTZG 4KRPB 4LSSH 2CDGA 1KNOB 1A9BA 2DM4A 3G6DH 1JZ2A 3TO4A 5GGSA 5IBLC 4P2QA 3UC0L 2BVTA 4JREB 1RJCA 5D1XA 2WZPD 5LXGL 2OK0L 4BH7B 4XNMB 1YNTA 2WW8A 3IDYC 1JZ3A 1BJMA 1AXIB 1LP9A 4QRPD 1QTYT 1QBLH 5CJQL 3HPJA 3U30C 5JZ7C 1T89C 5CCKH 1VHPA 1JWSB 2DF3A 4Y4HD 2HT3C 3N1PC 3R0NA 2Q6WB 3OF6A 4PG9A 4NQXB 2MFNA 2HMID 5INDB 4FQCH 4U6HA 2KUTA 1Q9WB 3VXOB 4O4YL 4HUXA 4ODVH 2HVJA 5TFSL 1KB9K 2IPTL 3PV6B 4MSWA 4YC2C 2CLZB 3I9GL 5IVZA 2FZ3A 1ZVHA 3T1WA 2F8VA 3BQUA 3N0PB 3O45B 3WFZA 2DL2A 4ELKB 4IOIB 3S37H 2BY3A 2FO1A 3H7LA 2CLVA 1QR1A 3IDXL 2V7HA 5L8JB 1I9JH 4ZS6C 1YY9C 3EYOB 2IMNA 4KRPC 3SE8H 2AJXL 4YBLB 2CLZA 5IVZB 4R26L 5BV7C 4UB0L 3PIQA 4KROB 3WFHB 3BD4A 3PGFH 1LD9B 3K8KA 5I8CA 2CPCA 5KSVB 4TYUA 5J1AB 5IR1B 3FB6A 3OHXB 4JO2H 4OZIF 1ZVYA 1ES0B 3AMLA 2IAMC 2NMSA 5DA0B 3LHPL 2ITDA 3R06B 1P4LB 2DJ4A 3O6FA 4HS6A 2OR9L 3FB5A 3BP5B 2H26A 2QR0A 4MNHA 4FFVD 5J1SC 4WV1B 3TBYB 3I6LE 1YEGH 4W70A 1H3PH 4TTDC 3BGAA 1LD9A 2B5IB 3V79C 1FYTA 2OSLA 3C6LB 1ZHNA 4HAGA 4LVHC 1ES0A 3MV9E 4Q9QH 2NR6D 3ARTA 3KPSA 1NGPH 4MB3A 3SO3C 3AS2A 1RHFA 4UT6L 4WW2C 2H3NB 3LVEA 3P9MA 5AWNH 1AKJD 1VFAA 5A3IC 4OZHE 2YMXL 3CZFA 3RVXC 3VRIB 2M1KA 4LLQA 3MCKB 3WL9A 4MXQD 5ANMB 2AV1A 3BW9B 4NNXB 3S6CA 4WWKA 1NCUA 4R90L 1PVHA 4KJPD 4ZO7A 5I18H 1RAMA 1T04B 4Y16B 3DMMD 2ZCKL 3P30L 2AV7A 3GMNB 4HFUH 2Z8WC 2ZZUT 3LS4H 3QCTH 3D3VA 4PP1C 4HCRH 4LEXH 4DGIL 4GG6F 1ORSB 4WFGD 2CR6A 1KACB 1IAMA 2ESVA 4PJCE 5JR1L 2X4NA 3IGAB 4KROD 2VL5A 5I1KL 4JFEB 1KV3A 3F12B 5CEZH 3BUYB 4UIKL 1J0IA 1XF1A 3HB3D 2ZPKL 3DO7B 4UQ2A 1G7MB 2ADJB 4PGEA 2DWDA 3QIBD 5H37G 5SX4I 5DRWB 1ORSA 3AS3A 4ZUWB 4YZFF 2VLRB 3FB8A 5KSUA 5I76B 4BA8A 5F93C 1T1WA 2KDGA 4KWUA 3W9EB 3ESVF 3G6JB 1QA9A 4PIRF 3JTTA 4OIBA 5HI3D 2DICA 3DRQB 3QUZB 5DHXB 3IFNH 3FMGL 1MCFA 3CUPA 5D6DA 4CW1B 4GRLB 3WFEH 1ORQA 4MA7H 4X6FA 2AJSH 43C9B 2CGRH 5IWLC 4JR9H 1ZLWK 4HWNA 2VLRA 3VXTA 1HSBB 5IBUG 3SJVA 4K71B 3BN9D 2VC2H 5AYUL 4I8DA 4JE4B 5DWUH 3CH1B 4JR9L 4Y89A 2FBJH 5DA4A 4JRYD 3W9EA 3GI9H 2Z91B 3UPCA 4PJXF 5HDQL 4R97C 2XNAA 3MV9B 3SCMD 1YYMH 1B6DA 5AEAA 4EBQL 3S34L 4O00A 1ZMYA 3O2WL 5D2LB 5C0FB 1BOYA 3KXFD 4XCNA 3GMMB 2OXHA 3CXDL 3VWKD 3RFZC 5EO1A 5EC2A 2W9DH 3RWIA 5J12C 5JPMA 1D3CA 3KPLA 1BD2D 5EC1B 4GXVH 5I8KL 1GJIA 3CFDA 2MHAB 4KI5D 1C7SA 3K4ZA 4OCLC 2DJSA 3BPOB 3GM0A 2VDPL 2F58L 4U6VH 1ZGLP 1EGJA 1CD1A 3U0WL 4PRIA 4WUUE 4XHJD 1FP5A 3BH8A 3K8LA 1OD7A 2VQ1A 1N64H 4WW2B 5KVFL 5INCB 4NQCD 4P59H 1HI6A 2X2YA 3QIBB 3O3EB 4RGNC 2FJFB 3FN9A 5T1DH 1R3HB 3ARDB 1KJ2B 5K59F 3MROA 1CD0A 5D72H 3BZFB 3O4LD 1ZVSB 4HPOL 1WZ1H 3RDTC 3CVHB 5DSCB 3ARFA 3L3IB 4AJ0A 2PR4H 5EN2B 2DTSA 1R3KB 3GMRB 5IWLA 5H8DA 4GAYA 1P69B 4FFWD 4PJBF 3NIFF 5JXEC 3RWDB 4U6YB 1EFXB 3UTZB 2CUMA 5FO7A 15C8H 2IANE 4L4VE 3HN3A 1R5IB 4HF5H 4F8TA 1R3HA 3UMTA 3FT3A 1FL3A 3EOTL 1NCDL 1D5ZA 3HMWL 5ETUA 3QSKB 4LF3A 1RHHB 1WISA 1CFVL 1GAFL 1XIWB 4ZAKA 2PYFA 3SCMA 4LRIA 3VFMB 4X7FC 1N4XL 1YMHA 5IB5A 3QFJE 1FVDB 1F42A 3EYQD 5HGBB 1NLBL 3FT3B 4TNVF 5E6IC 2EEBA 1KG0A 4P2QB 3Q48A 4NQEA 3MJ9A 4UOJA 3T2NL 3EYOA 2VUOA 1SVCP 3GMOB 4RFEB 3F6LA 1OSPH 2EH7H 2ZSVB 4X6BB 5L2KD 3P0YL 3QPXL 5C0BB 4AMKH 4R4FH 5E00B 3M1BA 5C0DB 5DEZA 3TO4C 4J6RL 1MFCL 4LNVA 3BKCL 2DQTL 4XBGB 4DGVH 4FZ8H 3KYNA 5I1IL 5EBMA 4WHTB 1S7XB 4RGNB 4U6HB 1MHCA 4JRXD 3O4LB 4BYHA 3CVHH 2UUDH 3A6OA 4G9DB 5H37H 3LMJH 5CWSA 1KJ2H 4FRWA 2YOCA 2QSTA 2FL5B 3P9LB 1RZFH 1WFOA 2WWMD 2Q7YB 4YO0A 4JG1L 1AHWA 2X4QA 3B6SA 3MNZB 3BQUB 2G5RA 2XY2A 2UYLA 4PJHA 4Y2OA 5F70A 3ULUD 2H6PA 1T66D 2E7CA 4KJQC 1ITCA 1X4XA 2F5BH 1HH6A 1IEBA 3HMXH 3SDXA 2ILLA 1BFSA 3OGCA 1EHLH 1Q9LA 4MA8H 5F6HJ 2VDOH 1ITBB 4JANB 3WSQH 1QFWH 2JK5A 3WEXB 3OKMB 5AZ2L 2FYYA 3CXHJ 4G9FE 3ZDYF 2VDMH 1FBIL 4PY8I 1IM9A 1WBYA 3QH3B 3O6LH 4E41A 2DQCL 1AJ7L 3BP5A 3QUMH 2RIKA 3B9KA 5J3HC 4DKEH 5LXGH 4X4XB 1E4WH 4MA3B 1EZVY 2CRIA 2EDKA 5DR5H 2IWGA 2DYPA 1QP1A 1JHKL 1F58H 3KPNB 4U1KA 5GRWA 4FQXB 2XOTA 4OLZH 4M62L 4OZGB 3MRMB 4EVNA 2V17L 5B4MD 3B2VH 3TCLB 2C3WA 4FFVC 4QHLB 4DTGL 1FZOB 3HLAA 4TSCH 3RZCC 1IM9B 1WBYB 1NFDE 3BUYA 5ISZE 5MP6L 1CLZH 1IGJB 5DHVB 6FABL 1BPVA 2K1MA 2H3NA 5CMAB 4PGEB 2YPLD 3MUY1 2C3VB 3RVUC 3RL1A 2R56L 5JOFA 2V5RA 3CCHA 1FNHA 1HKLH 2EXWC 3U9PH 5EU7E 3V4UH 1CICA 1IC5H 2BDNL 4GG6B 1AGCB 3HKFA 1Z3GH 4M9PA 4PUBL 1JZ5A 1YC7A 1EAJA 1T3FA 1NKOA 3SDAB 2HRPH 3B5GA 4ZUUB 2IH1A 2XZAL 4YHOH 4F7PB 4U1GC 1KJMB 2X42A 3DX8A 2HN7A 3ZE1E 3IDGB 2IBBA 2V2XA 3HZKB 3OXSA 3QI9D 4Y4FC 4Y5YC 4C54A 1JI2A 1RUAH 2DIBA 5JW4Q 3VXTB 1V7NL 3WS6A 2BVQB 2FEDD 3CCHB 5C2BL 4KK9C 3CJJA 3CH1A 2BNUB 4X9BA 5E8PA 1D9KC 2VL5B 1RI8A 4GXUN 2F5AL 1I1CA 1QSVA 3LEYL 1NCAL 5EUOF 5LBSH 1Q0XL 2DQFB 3SJVD 5JORB 4WY7H 2I9TA 2OX5A 3CAFA 1IAKA 2LTQC 3QUXA 4N0UE 4OCRL 5FO9B 2YRPA 5KVDL 5MEOA 3PWJB 2F5BL 5CP3A 3RQ3A 3IDGA 3C5ZC 4KVNH 1FZMA 1OW0C 4PJFA 4FXGB 2RBLA 4WJ5A 1JF1A 2AEPL 4OCYL 5I1LA 5BZDA 4EXKA 1GGUA 2KPNA 3WFDL 3WE6A 2XV6B 2OL3H 1A0QL 4Z5RA 4NUJA 1P84K 1BZQK 2BNRD 1KJ3H 2GHWB 4CUCA 4L5FH 2IG2H 4CN1A 2I07B 4LDLB 2NW2A 2QLVB 4PS4L 3S36H 1E4WL 4WNQB 4KKAD 3V7MA 2X70B 5L88H 5EUOA 4YHNB 3HTLX 4X6DA 1QEWB 2EEAA 4URTB 2H41A 3CH8A 4Q6IA 1CZ8H 1JNLH 3QFJA 4OZGE 4BZ2L 3VJ6A 1TZGH 2NY7H 4U1NA 5BV7H 1P6AB 3EYUH 1UKSA 1QQDB 1NBZA 3IT8D 1MCQA 3TWCL 1INDL 1KBGH 2CO7B 2QHLA 2DQJH 4UNVA 1B4JH 5CBEA 3VWJA 3QJFB 3FJTA 1MRFL 1YEFL 5BXFA 3HRZA 1KIQB 3IFOB 2ZJSH 2NY4B 4X6DB 3UTZA 4R4BA 1JHLL 1KCSH 5EC2B 3NZHH 5TDNB 4GW5A 1V3MA 3GRWA 4HBCL 3H3PL 1P2CA 3DVNB 3I3BA 1LGVA 5HTSA 2YWZA 1N4XH 1ND0B 1LEGB 3ARDD 3BKML 3WHE1 4TOYL 1DEDA 1E27B 3I85A 4YEEA 5MI0B 2A6KB 3FN3A 3MACH 5HHPA 4GLRI 1OAYL 4K8RL 5DUPL 4OM1L 1U3HC 1MLCA 5ICXB 5INCA 3GSRA 4NQCE 2ADIA 1LP9E 1G7PA 3HNVL 5I75C 4XXCA 3MLVL 5HGBA 4LVOC 4N1EA 2YD2A 1WVZA 1MHPH 3BKCH 4NC0B 2Q6WA 3U83A 3CVHA 1JI1A 4OSUH 4R4FL 3RKDC 2J5LB 1C5BH 3T0EC 1Q9WA 3TT1H 3VXOA 3TFKC 2Q8AL 5JHLL 3WIIL 3UXFA 1IZJA 5D1QD 1RZKH 2Z9TA 5FYKH 5JIIA 4GRWF 3O0RL 1IC4H 2NY5H 1XIWD 3QUZD 2IANB 1TLKA 4V1DD 4F15C 1NFIB 2IALB 2P5EA 3DLQR 1FVEA 4DQOL 1KTDB 3O0RH 1RUPL 1FL3B 5A43C 1NUNB 1H3XA 3VI4F 5EBMB 3OKKA 4TUJA 4X8XA 5ETUB 4KHTH 5L7XH 4PJXB 2IBZY 1A6VH 2C1OB 1K6QH 3BHBB 2NNAB 3MBXH 3CLFL 5ACZB 5E94B 4NZDA 3QEUB 3BPLC 5E1HB 5B39B 3VFPA 3KYKL 5BQ7B 4CN6A 4HW6A 3ILQD 3QQ9D 1WWAX 4CMMB 1F8TL 5EB9A 1Q94A 1VFUA 1KG0B 3LKNA 3VWKB 2W0FA 1LO2L 4NQDE 2HLAB 4ZUTB 3UTSD 1JYNA 3P4LA 5KTEL 3C6LD 1A1MA 1YYLL 3VGGA 2VLJB 1FN4B 2JCCE 3DTXB 4NKIL 3S34H 2J8OA 4P48A 3TNMA 1TQBB 3Q6GL 5HDQH 2BNQD 3R8QA 2JK5B 2K7QA 2WWMC 1KTRL 4YXKL 3U1SH 2JJTA 2OSLB 4KH2A 3ZTJH 1JHLH 5C1MB 3NPSC 4YEFA 3KHOA 3BZ4B 1HCVA 5D9SB 1VESA 3P77B 3RL2B 1NAKL 1T21B 1FGVH 4GKSA 1R5VA 5D7LB 1MF2H 3DX6A 3PDGA 2P49B 3QISA 5DZLA 4Y4HB 2PETA 3SGEI 4CU8A 4Y1AE 4L9LA 4U1KB 3F7VB 3NBNA 4LCCA 1RUKH 3O41A 2ZWLT 4JM2C 3WXWL 3FQWB 4M7LT 4NO0D 5LCVH 3HLAB 3MBED 3BDYL 4K3EL 4KPHH 1AGDB 4L4VB 2GAZA 4JRXA 1N5YL 4GBXB 2XPGA 1F3DJ 1FJ1B 5DHVA 4HIEA 3VWJC 3BIKB 4N0UA 1NC2A 3C09B 4JFED 1CTNA 1F45A 4V2CB 2DI7A 2X89A 2MOVA 4EQ2A 3OXRA 4Q2ZB 2R0WL 5BS0B 4ALAH 3FFCE 3SDCA 3QCUH 4FABL 1RZKL 1DBJL 1TENA 2VZVA 3X12A 5J11C 5F9DC 3EGSB 4HPYH 2YD7A 4NZUL 3ZDZF 4JPVH 4OCRH 5D2NA 3K46A 3PWUB 3BZEA 1QSFA 5TGBB 4GS7C 5DK2B 3D9AH 5I18L 2EC8A 3REWA 5MEQB 1P1ZA 3MXWL 1CE1L 2BCKA 2AEQH 2WK2A 4BQ9A 4EOWH 4DUWA 2PO6A 3O11A 4LVNC 1JRHI 2O26U 2R9HC 4WCYH 1BZ7B 1U58A 5D6CA 3KGRA 2GJ6D 1WLHA 4U31A 1E28A 2OJEB 1A4KA 1A47A 4PJGB 4E5XB 3V0AC 3LKSA 4P4KA 5DK2A 4GMTL 3OG4B 1OY3B 4EZMA 5HY9B 1UEMA 2FB4L 1S9WB 4F7EB 1QPPA 5CJXA 5E99H 3D87B 2VLRE 1AGCA 2YD3A 4ODHL 1HYRC 4PJBB 4Z5RB 5F7MC 3EO9L 3OKNB 1LNUB 1T1YB 3TWCH 2VDQL 4MA1C 5MENB 3G04A 5SWSE 3TV3L 4HKZB 1IMHC 3LS4L 3QCTL 4PJGA 4E5XA 4Y5VA 1DDHB 5EBGA 4NN5B 3I50H 2FJHB 2WLZA 3QIUB 3T0EA 1W72A 5CIPB 4NQCA 5GGVH 1R3IL 1CK0L 4OLZL 2AJVL 2HRPL 4B0MM 4Z7OF 5DO2D 4UAOB 3E6FA 4JY4A 4PUBH 4QRSB 3MRDB 2I9TB 4EXPX 1A0QH 3QI9A 4NCC2 2P8MA 3HE6D 4U2ZA 2ICEA 2HTKD 4I0KA 1NBVH 3PWJA 1IEAB 4XNUH 4YBLC 4WW2A 3RPKA 1ZT4B 1EEUA 5FAAA 2HJLA 5I73B 3D1MC 1RK0A 3ARPA 1T7WA 3GSNB 4S2SB 1PKOA 1ZVSA 5DC9B 4N8CH 5KW9H 4Y16C 1NMCB 1I4FB 4WFGE 2Y7QB 3TYFA 2I07A 2I5YH 4NCDA 4QO1A 3DMMA 4XTRC 4Z7UF 3UDWA 3VA2C 5K9OB 4JFZH 3WDIA 4YC2B 5F7UA 3RWFB 1QEWA 1DBML 4JY6B 3GSRB 3NZ8B 4NCC1 2DQHL 3LB6C 1S9VA 4YHIA 1U8JB 4OZ4A 4P23B 5HYIA 3MRQA 4CDGC 3OKLB 3TPUA 2X4TA 5GRZA 2AJYL 1FLRH 1MJ8L 4MD5B 3HRZB 4OLXL 3MC0A 4B7LA 4P2OB 5MHSE 1BFVL 3BP7B 3VMNA 1HXMA 4PV9B 4YHZH 5GS0H 4XRCA 3K7UA 3OX8A 1GOGA 4ZFZB 1U8JA 1CGVA 2DDQL 4PRDA 5AAWA 2MKLC 1W8NA 3SDDC 3QPXH 3MRHB 1BJ8A 1V5JA 4JGJA 4TSAH 2BJMH 4GKZA 3DUSB 1OWWA 4LLMB 2C1OA 3RU8L 3UX9B 4L1DA 4XMLL 3X13A 1MWAH 3GMOA 4OLYL 4RFEA 5T5FH 4POYA 1BD2B 3UEZA 2YBRB 3GHBL 4G6KL 5E8EB 5K9KB 2VDLL 1I7ZA 5I8OH 1J0JA 4PP2B 2QQLL 2MPAH 4HZAA 5IHZB 1D9KA 3MUHL 1X5AA 5JTWA 5E5UB 3STZA 1WBXB 4LASH 1ROWA 4Z78B 4M48H 5J6GB 3VWKA 5ISZB 2J3SA 4PRAB 3DUSA 2D03L 2XICA 2PYEE 3I3DA 1IVLA 43CAA 1NUDA 3QNYA 5H2BA 3UJIH 4AMKL 4AH2A 1GOFA 2EZ0D 4YE4L 5DQ9B 1UFUA 5IHLB 3U48A 3B6SB 1F3RB 3VFRA 1YC8A 3TN0C 1I3GH 3QG6A 5C0CD 4PRBA 2ZUQC 5CILH 4W6WB 1BVLB 4XPAL 3GGWB 4A6YH 4ONOA 2BVPB 3QZWA 4XNYH 1TFHA 3EYVB 3DHJA 3S35H 2LVEA 1QSEE 5D7LA 4QRTA 1I7TB 5ESVB 4NQSB 3S4SG 4NFCA 4EN3D 5E94A 4U1GB 1L9MA 1NUGA 3C2AH 3WEXA 4F37K 4Z7UE 1Z9MA 5K93A 5E8DH 1RD6A 5C09B 2DM3A 5F9AC 4RMWA 2R8SL 4A2LA 5C0AA 3DXAA 1DVFA 4LMQE 2HWZL 2E7LA 4NQDD 1IGYA 5C6TL 1K9TA 4K3GA 3FCTA 3FT2A 2D7QA 2F58H 3GSNH 5IJVA 3IJYB 4HK3N 5I8EB 3T04D 8FABA 5C0JA 3SDYL 4DUXA 2A9NL 3OPZH 2PO6D 2NY3C 2WAHA 5HI3C 1CE6B 1PY4A 3MUGA 2Z93B 2H45A 2Z4QA 1S78D 2I9LB 2FO4A 5D72L 1CDHA 5E70A 4EJ1C 4M1CD 4MJ6A 4JFXA 3CDYA 5T1DL 2VXQL 3WFBH 1MY7A 3BZEB 5TDPA 1NGZB 2XRAH 3FQRA 3VE0A 5MERB 5KW9L 3JV6B 1S5HB 1UQSA 2J1KA 4JO1L 4Z7WA 3VFSA 1CQYA 5JZ7D 5C08D 4JJ5A 4YHKL 4OBRA 1J0ZA 2A0LD 3IAQA 1PX4A 4JCLA 3W11D 4M6MH 1C1EL 1DQQA 3EOTH 5C0CA 4JFXB 5GSRB 3VFWB 2Y07H 1D5BB 1RJLB 1YNKL 4NSKA 2V2XB 3PNWB 3ZTNL 4Q2ZA 4RRPA 2BVQA 4BELD 3RAJH 1MCNA 4XWGH 1HYSC 2HTLD 3D9AL 4ZOEA 3A6BH 5F9JA 1M7IB 2WP3T 4D0CA 3U7YH 4U1SB 2VITA 3S3PA 3Q3GB 3STLA 3B4NA 1DQQB 1KCRH 1F3JB 1KIUA 2AJ3B 2HAZA 2X4UB 4YUEH 4G3YL 4HLZG 3NPSB 1JPTL 1W72B 5CIPA 3OGOE 1N6QL 4WDIA 3REWB 5MEQA 1X6NA 5I1LB 1BMGA 4XCYA 3QEQA 1CICC 1OPGH 1IQWH 3QXWA 4QRRA 4PJ7B 4F2MB 4LRIC 1S7SA 1UWGH 3ME0A 5KJRH 1TDQA 1UACL 2FHBA 4PJCA 5IV2B 4X6EA 4CGTA 1I3VA 5T1KD 1QLFB 3UTPD 4HX1A 3CDGB 1T6WA 5F7DA 2QQKH 2VDNH 5FB8B 5EU3B 2PO6C 2AEQL 2ZPKH 4TRPH 5B8CA 4MQ7A 5IT2H 1U8OB 4Y4HC 2V6HA 4M61A 4EDXB 4LSTL 3MRGB 3I6KB 5HPMB 3PV7A 3JV5A 4NWTH 4PLJD 4X4ZA 3QIWD 5EBWB 4ORZC 4X6DF 4HKXA 2NY1D 3VD4A 4XNXL 5SWSB 4LLVA 4CU7A 4HPYL 4MHHI 1BQUA 1AE6L 2ZNXA 4K2UH 3ABZA 3NIGE 3RDTA 3JV4B 5LQBH 5IBLD 2X4RB 3PF2A 2CDFB 5EU5A 1YEGL 3RX8A 2FH8A 4MA7L 5E5MB 4ALAL 1I8MB 2VABB 5F97E 3O3AB 1EHNA 1OARH 2AGJH 3P4MB 1MEXH 4PJDE 5AZEL 1YYLH 3RJDA 3AB0B 2YZ8A 1SYSA 5DTFA 3UAJC 3QQNA 4DZBB 4FQLH 4H1LB 1FORL 2VL4A 2O93L 4NQVB 2ARWA 4DN3H 4IRJB 5A16A 4J1UA 2NLJB 4NN6C 4I77L 3BDYH 4KPHL 3MJGX 4KQ3H 4ZPVA 3TO4D 1T04A 4Y16A 1FAIL 1P4IH 4OZHF 4PRDB 3JWOC 5L9DH 1TCRA 4WWKD 4HWBL 3T4AA 4LCCC 4C57C 3A67H 1KTKE 1FFPB 4LAJH 1GHFL 4XAKE 3GSVA 1WUNT 3EFFA 2VWEC 1EFXD 3THMH 5CEYA 1ZOXA 5D7IF 5HVHC 4TULL 4WUUB 4Q74A 1CL7L 3BMWA 3S3JA 2DQDL 2C5DC 2F15A 1HINL 2HP4A 2CMRL 3D6GA 4X7CC 4TUOB 1TCRB 3JWNC 1ADQH 1M71A 3STZB 1DCLA 3L1OL 3X3GH 4OAWA 5D93C 5I9QB 3LIZH 2V2WB 3LHPH 3QHTC 1H3GA 1MAKA 3W0WD 3NVQA