5DLML

Complex of influenza m2e and antibody
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DVLLTQTPLSLPVSLGEQASISCRSSQSIVHSIGDTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHFPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of monoclonal antibody
publication title Crystal Structure of the Conserved Amino Terminus of the Extracellular Domain of Matrix Protein 2 of Influenza A Virus Gripped by an Antibody.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 217
chains with identical sequence M
ec nomenclature
pdb deposition date 2015-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dlmL01
5F9WC 3ILPB 3SKOB 3U30B 2QQLH 1MCDA 4L8SB 5MEOA 1VACB 4XBEH 3X12B 1VKXB 2XA8H 1A9EA 3O45B 3G5YB 5CINL 4WVRA 3T0DA 3T65B 2BDNL 4Y5XB 1JBJA 3P4NA 1QFWI 2YKLL 4WENB 5JO5B 3SKJH 2NNAA 4UQ2B 5ID0A 2J5LB 4YXKL 1MCIA 4FNLL 1RI8A 5C3TA 4JFHD 3FZUD 3UROR 3QHZL 5IROA 4BKLB 1ACZA 3RY6C 2ZUSA 1EGJH 5DD1L 1XGTB 3SGEH 5HHOB 2P8MB 2FJFB 2PXYD 4LAJH 4Z7NE 1DEDA 1JHLL 3WUWG 4FQJH 2BSRA 4QXUH 5GS1A 1AO7E 1UGNA 2YD3A 3VXME 4R0LC 5HHVL 4N1CA 1NGXA 2X4PB 4PRHB 1MJUL 3QCUH 1OTTC 5CZVH 4WW2C 2AQ1A 1BD2A 5F9JA 1EMTH 3S35L 3BT2H 2CO6B 3DV4A 1MHPH 1CICA 1XCQA 3EYFB 4C54A 3IDGA 1B3JA 5DI8A 3NN8A 3MRLB 1GC1C 1V3MA 4GXVH 3MGTA 2VXVL 4TULL 5I75B 2H1PL 1AGCB 1KTLB 2DLTA 3TNNB 4OLWL 3PP3K 5BQ7B 1AGFA 1A3RL 2WBJB 3BPLC 4Y7MA 4LMQE 4LU5H 3DARA 1UB5B 5IBTL 1WAAA 1KT2B 1VPOL 1F5WA 3CLEH 5C0JB 4WI3A 3P4OB 4UU9B 4QWWC 5TH2B 4LLDA 3DMMB 4HH9B 2H32H 2ICCA 5I15H 5K9JH 5E8EB 3TT3H 3C6LC 3W2DL 1BVZA 1J05A 1NH6A 3IDXH 1KN2H 1ZWIA 2XZCH 3O4LE 2WIIB 3G5ZB 1A9BA 4H1LG 3MNVB 1DSFL 1QR4A 2M8XA 4KTEL 3MYZA 5IB2A 4GOSA 4KHXL 4JY5L 1A6WL 2R1YA 4ZS7H 2MMXA 3VFPA 1PFCA 3KLHD 3C2AL 3E6FB 3EZJB 5HHPB 4BUHA 1PKOA 4DN4L 1RJZB 2VTFA 3QA3A 4Y4KC 2B8OT 4WTXA 3V4PL 2P5ED 5CD5D 5HDBF 2J12B 5CIPB 5DEGB 4NO5B 3DETC 3RDTB 1SEBA 2P5WD 2NY3C 2RGSA 2UY7A 3L95B 4PRBA 5T3ZD 4ONHA 4KY1H 1F4XL 5CINH 5MERA 4Y2DB 5E94B 5D7SH 3UJTH 5GGRA 3ZDYF 2VKWA 5C0ND 2BY0A 2IADB 3BGFC 1A1NA 2YUXA 4XPFL 5B8CA 4GG8A 4PJDF 4FNLH 3AFLA 2W91A 4KFZC 4YDJB 4O2EB 1A7PH 2A2QT 5ILTL 2BC4A 3LKRB 2ICES 1MAKA 1IM3B 4YFLI 1YEHL 3DVGB 5DD1H 1MJ8H 4KGJA 5F97E 2NX5E 2MKWA 5F1NB 2X4SA 1OM3L 1T2QH 5IFJA 3RTQC 1FL5A 3KPRD 4OLVH 1G0XA 4NWUH 1X7QB 4OD1H 1YECL 3SO3C 3QQ3A 2V7HB 2PO6B 3L3IA 2X1XR 1OAXL 1QSFE 3FB7A 3LZFH 3VW3L 5FB8B 2VN4A 5J12B 1TNNA 5TQ0L 1UT9A 3IJYB 2Y5EA 3P9LB 2QHRH 4AEIL 4GG6B 4HG4K 5EOCH 3QEHA 1AGDB 3RZCB 4KKBD 1XF3B 2XPGB 1LILA 5D5MA 1F3DJ 3RWCB 3S5LB 4KV5F 1XGQB 1XF5A 1JHKL 3MJ9A 4HZLA 4ZODA 4PD4K 5C3LD 4BH7B 2VQUA 1NCCH 4OF0A 3MOBL 5FO9B 3BJLA 3LQAH 5KOVC 3EZ8A 3HC3H 1NGZA 4G8FB 4NO0B 3NH7H 3QNZA 1SEQL 2XFXA 1WWWX 1B4RA 1MQKL 3OJDB 1AGEB 2QBWA 3SGKC 1ES0B 1I75A 5MEQA 1N3NA 2FEDC 3A67H 5E56A 3G5VA 3BKYL 4LHUA 2ED7A 2YC1A 3DXAD 4KKCC 3TH2T 3MRRB 4OKDA 2BHYA 4PRIB 3VXUD 2QSCL 3MRBA 3SCMB 5BRZE 2CO7B 4JY5H 3QDJE 2PR4H 1MF2H 2VNCA 3A6OA 1MI5D 5D7JC 1NMAL 5IBLD 3VXUA 2IPTH 5C0FB 1JPTH 1NAMH 3S3PA 1MRCH 1GZQB 4PJ5B 1DE4A 4PBXA 1CBVL 1ZGLB 4YNYB 3H0TA 1YNKH 1DQTA 4PRPE 5K9KB 4MXWL 4UINH 4LCYB 4LLYB 3AUVA 3O3EA 4S2SB 1Q9KA 2ZPKH 4KZDH 3LKNB 3UTZA 2DKUA 2NZ9C 1OP3K 3U79A 4ODSH 3RVUD 1WCQA 5HYJB 3JVGA 2F58L 4U6YA 5A2KH 4RAVB 1IAIH 4IDJH 1BM3H 3E8UH 4ZOBA 5I30L 2EDFA 3H3KA 5F9WB 4KK6D 3MGOB 4J3VA 4NQTA 3GMNA 3V7AG 2YN3A 4Y19B 5IIEB 2C4FU 3L3HA 1OB1B 1JJUA 3JXAA 1XF2B 3DURB 2AEIT 1R5IB 1DUYA 4N8VA 5DO2C 5T1KB 3FB5A 3HS0A 4LLWB 4UBDD 2FL5A 3SE4C 3SHSA 4X99A 3S96B 1PD6A 4QHKJ 2F15A 3PWLB 5D2LF 2Z93B 2D4FA 4EUPH 1EX0A 4IM8A 3V4VH 4MD4B 4OZFG 5FYJL 3LEYL 4HWEL 3EOAA 1MCQA 4GW1B 1KEMH 2VC2H 3BKMH 5TQ0H 4CU6A 3S88H 1FL6A 4NM8H 2E7LC 5BV7C 4QOKE 3U4BH 5JUEH 3CSYA 4OLZH 5CP7A 1RV6X 1MY5A 4J8RA 4R0LB 4I3SH 4K9EH 5DMIL 3ARBD 4JZJA 5EWIL 1QSEB 3O2WL 4NOBA 1JPSL 5D96C 3UXFA 4WW2B 5GZOC 1HSBA 1OAZH 4U1HB 1SEQH 4RAHA 4DKEL 5DHVH 5TGBA 1Y18A 5JHDD 4N5EC 1RUQH 1F11B 1I8KA 1MQKH 1ZEAL 4K8RD 4MAUH 1WZ1L 1MCCA 1I8MB 2HRPL 2WP3T 5JHDA 5DDHA 3HUJB 3HI1A 4FRWA 1S7TA 3VFTB 3KJ4C 4GS7C 2UWEA 3SJVE 4MA8L 1B2WL 3FQTB 1ND0A 3ZT5A 1P1ZA 1TTUA 1PLGL 3BPLB 4OFPA 2E9WA 3BPCB 5F44A 2XNAB 2WLYA 3EO1A 3FFCB 5FOBB 4GUPB 2VXTH 3BH8B 3I6LE 3QDMD 1UWGH 1AQDA 1KJMB 5DR5L 4OJFL 1OAUL 2R4SL 1YPZA 3HI5L 3C6LB 1CBVH 3IVKB 3IYLW 1FSKC 1XGRA 3D1MC 1QFUH 3C5ZA 2YRLA 3QDMA 5KTEL 2VDML 4D9LL 5I0DA 5F7LB 4ONOA 5HDQL 3WFBH 2CIKB 2AJ3A 1U41A 3PWJB 3CU7A 4P4RA 5IG7B 1OSPH 1DL7L 2VAJA 1UWEH 4ZNEE 3QSKB 5K33A 4ZFZB 4P5MB 3WIHA 5I1AA 4E0RB 3C9NB 2X70A 3EKCA 4X98B 4KVNL 2A73B 3U7YL 1LE5A 5ID1A 2VZVA 2NY3B 2D03L 4FZEH 4Z7VB 3VXOB 1PYWA 2APFA 1JZ3A 2Y1VA 5HD8C 2D31A 1MLCB 4MX7A 4JR9L 4LDEB 1QLFB 3BGFB 3DNKA 4IRZH 3LEYH 5HHMB 4UNVA 1BFOB 2KQMA 4MA3A 3MNWB 2EDTA 3B9EA 2ARJB 1X5GA 3BAEH 1V5JA 1U8MB 2FJHB 3F62A 1ZHBA 2AJSL 4Z7UE 3QNXB 5EO9A 1MEXH 4G9DB 4CU8A 5TDPA 3RTQB 3VH8G 2A77L 1QLEL 1XR8B 2P4AB 3HFML 3OB8A 3GUTB 1IMHC 3K3QA 5CLTA 1SM3L 3T1FB 1JPSH 4JDVB 5T5FL 4N8PA 1Q38A 3BOVA 4M6NL 2EXYC 3ARGC 3SDCD 2HMIC 1I8LC 3BUYB 4I0PD 4TSAH 1D6EA 4KUZH 4CVXB 3BMVA 1ZEAH 4XMKH 2MHAA 5EU5B 5JHLL 4GRLD 3RL1B 1CD8A 1SJEB 3HZYB 4MA8H 4IMKA 4IMLB 4P4KC 4NRXB 3P73A 3UP1A 1ZHLA 1I1FB 3UZVB 2VXSL 3BGAA 1VEOA 1EJOH 4TUJA 2M2DA 3VA2C 3O6FA 4WGVB 3MV8A 4WFGE 3BSZH 3OJ2C 4DVRH 1ZVSA 4JHAL 3BQUD 5DHYA 4JAMA 4NKMA 1OAUH 5ICXB 2N7AA 4JRYB 4BZ2L 1FH5L 4WFHE 5FYKD 3IETB 3PQYD 4A6YL 1YN6B 1NUGA 3DSFL 5KTEH 4LLQA 4X83A 5CEZD 3GEWB 4D2NA 5F93C 4MQ7B 1MHEB 4XC3H 3SEPA 1QZ1A 3PQYA 5E6ID 4K23L 1JFQL 1YA5A 1ULVA 4PJGE 5GGVH 1LNUB 4P2RA 2D4DA 3K1KC 5D7JB 4YHLL 2CIIA 3ARTA 4U49A 1MFNA 5L6YL 1ZOXA 3QG7L 3PABA 5ANME 1MJ7H 3EW3B 2FLRT 4HGWB 3UTOA 3U7YH 4RQQB 5E2TL 1OD7A 3QPQD 2ZUQC 4XX1G 1C7SA 2ADJA 1FQ9C 2WMPA 1GPOL 3MODL 2VXUH 3F8UB 2IEPA 3REVA 4R8WL 3OJMB 1RPQA 5D1QC 3ILQC 2C3HA 4JR9H 4PJFE 4XH2B 1CN4A 4Z0XA 5IVXB 4KJPC 2C4XA 4BK5A 2E6PA 3ES6A 2AVGA 4L4JA 1YEEL 4QTHB 2DQFA 4KPHL 1H3XA 3LV3B 3JV4A 5I8EB 1DZBA 1AJ7L 1JP5A 1RHFA 4PJ7F 3RI5F 4J4PA 3CDGB 1J11A 1SM3H 3AM8C 4LRNL 2Y07H 2PUQT 2KZWA 4XNUH 4MB5A 3ROOA 1O7VA 3S4SA 3B6SB 4X9FA 3OPZH 2YK1H 4BFEA 2QQNH 3MV9D 3N1MC 4KJYA 3QFDA 1K8DA 2BRQA 1BJ1J 3FRUB 5CBEB 5F6HJ 5BV7B 4OCRH 1U2HA 2XI9A 1MCEA 4G6FB 4OKVB 5AAWA 3KPQA 3STLB 4URTB 2GHWB 2OTWA 3IXTA 3GHEH 4LPTA 5D96B 1EXUB 3ZKXC 3MNZA 3MV11 5C86A 4BM7A 1TZIA 5C0CA 1X5KA 4Z7OF 4U1LA 2CKBL 2J3SA 1T0PB 5JLZA 1E6JH 3KPSE 3QO0A 1S7XB 1AKJD 1JHTB 1FH5H 1EFXB 5FM5M 3BZEA 5C08E 1RUPH 3KJ4B 4GS7B 4RMVA 5BMFH 3L9RA 5ETUA 3W9EB 1G0DA 1A4JB 1AKJA 5F72S 1NFDE 3BIKA 4PLNC 4XI5D 3LS5H 2NY6D 1FP5A 1U42A 4NCC1 5IKCB 2VITB 1PQZB 4J3WA 5IBUB 4ZFOA 5JNYB 1CE6A 3ULSA 5CEXA 3GRWA 3T0AA 1VERA 5EBWB 1IZJA 1WFNA 1DBBH 1PSKL 1ITBB 2AEPH 3DX9A 5L0QC 1HQRB 3WO4C 1FSKB 1MWAA 4EN3A 5EU6B 4U1KA 1LO2H 5CZXC 3TBVB 3E3QE 4NBXB 1U8NB 1S9YB 3PL6C 3VGBA 1C5CH 5BOZG 1A3QA 3IFOB 3GGWB 2DWEB 4HUMB 4JPWL 5HGHA 2VSDA 2NYYD 3GJFH 3CUPA 2R9HC 4MHHI 4AIOA 5MHSE 2QEJA 5IK3A 3EGSA 4IIQC 1GH7A 1NJ9A 2P7TA 1OGAB 5FYLD 1HKLH 4PG2A 1LK2A 2PETA 1OGTA 3T0XA 5FKAB 3B3IB 5EBMA 5EFIA 4D9QE 2X2YA 4HUKB 1AGDA 4PG9A 3GSRA 3LSOB 2HJKB 4Y5YA 1U6AL 3GB7A 2FIKA 4OV5A 2GT9A 4NKOA 4P46C 2Q76B 4KQ4L 2AV7B 5E1AA 5E5RB 5GGTL 4JFYA 2IANB 3LEXB 15C8L 1FZMA 1JGDB 1WCBA 3MLXL 4XAWL 3W0WA 2QADD 4U6VH 4GKSB 4POYA 3AXLB 4Z77A 2CRZA 4GRWB 5KJRL 5FHAH 4RIRA 4MA7H 1ZHNB 5E8NB 3OXRA 3T0VA 1RK0A 3MR9A 2ZG3A 4PJBE 5ESVB 1HH9B 3KWWB 5GXBB 4AIXA 5J6HB 3UJIL 3S6CA 2W0FA 1AI1H 4WWKA 1KJ2H 1F02I 4HSQA 43C9A 4OUOA 2CRIA 1GOGA 5F7NC 3HZMA 3H9HA 2OJEB 3MV7D 3ARGB 4LDOB 2P8LB 1U8LA 1TLKA 3BN9C 3ZO0A 5GISL 3O2DA 1A7RL 2H26A 2J8OA 1F00I 4F7CB 1U36A 1MHHB 1JGVL 4H5SA 4NHUA 5IJVA 3OGOE 5D8JL 2D7TL 1I3RB 4JN2B 3MROA 4P4KB 4WJ5B 1ZTXH 1JZ5A 3K7UA 3HI6L 1R5VA 5I1EH 3SQOH 3CDYA 4U0RC 4OBSA 5C0IA 3EDJA 1T20A 2QR0A 3GMOA 3PJSB 1ZS8A 4NQEB 4F37F 5DC9B 4MD5B 4ZG1A 5JA9A 1JN6A 2VLJB 3P11L 1E4WL 3TA3A 4XX1E 1PSKH 5CILH 4MNGE 5KZCB 4JFFE 3WIIL 1P6FA 3VXRD 3MLTA 1C1EL 2NTFB 3SDXB 3S3JA 5IT2H 5J13C 2W38A 1ONQA 3WNKA 5SV4A 4M4PA 5INDA 3U7WL 3VXRA 4WY7L 3T8XA 4R90H 5LAXB 5EIQA 2JKXA 1Z9SA 3P0VL 5IFHH 3MUHL 5ENWB 5IUSA 4MNQB 2FX9L 3A6BH 1BLNA 3VFSB 4RA3A 2Y5TB 5FYJU 2UZIL 5DGQA 3HPJB 3PWPA 1KC5L 1HEZA 1DN0A 2X89D 2ZUQB 3N9GL 1J7VR 1T04A 5C8JA 3MRHA 2E7HA 1ZVYA 3QIWC 1SBBA 4TSBH 1RULL 1BGXL 4X9BA 4G5ZH 2FBJL 3FT2B 35C8L 3AS3A 5D1QB 3IJHB 3MLXH 4XAWH 1M4KA 4G8GE 2GK0A 6CGTA 1OF2B 4NC2B 3BP7B 2PW1B 3TN0B 3HAEG 3ZKND 2AXHA 2QSQA 2RBLA 2OTPA 3D85D 2HWZL 3P4MB 3HLAA 1H3VA 2F54D 3W11D 4LVHC 5FGCB 1DLHB 5I66B 1YEFH 1UM6H 3RPIA 3QQ9D 3GI8L 4G7VL 4LLUA 2BJMH 2F74B 2XRAH 4ZUVA 3LRGA 1BFTA 3UJIH 5ISZE 4LOUC 5JXEA 3GSNA 2G75B 4ZUTA 2HT3C 4M93C 3QWRD 3FFCA 1S8DB 5E8DL 5EU3A 2LAAA 2SEBB 1L9NA 1IKNC 2HKHH 1D5XA 5C9JB 1CFNA 2DYPD 5GISH 2BERA 4RZCA 4RNRB 2CMRL 4TNWF 1RIUL 3O8XA 1TVHB 2GFBB 32C2B 2UYLB 3KGRA 2B7DT 1TTGA 4I5BA 4BYHA 4NHCH 3KVQA 1W0VA 5D8JH 4L5FH 2OTUA 5CAYB 3LKOA 5C07B 4Y4HC 2FD6H 2AXFA 1HHJA 3BMWA 4HKXB 5KSUA 3L3OB 1PG7W 3ZKXB 1M71B 1JWSB 5EIIA 5JQ6L 1NMBH 3PGCB 1HXYB 1SJXA 1J1XH 1FORH 4NT6B 3FOLB 5F6IC 3TESA 4TVSa 1AD0B 4EIGB 4P23C 1Z3GL 2WLZA 4Y4KA 1UCTA 1FYHB 1G6RL 4WEMB 3GKWH 2AK4B 2AGJL 3IDUA 3T3MF 5TFSL 4LSUL 5GPRA 1MFDL 4OGZA 4ZSOA 2EC8A 1RZKL 4XVJL 3ARFA 1MCWW 3NA4A 1C1EH 4XMPH 2HKFH 2ESVB 1BBJB 3WKMH 5LVEA 3U7WH 2B1HH 3ZYOA 3QT2A 2XTJE 1BAFH 4BFGA 1P5UA 2Q3AA 2VLRB 5F7DA 3P0VH 3RVTC 3D2UA 5HYIA 5I1LA 4N0UA 4X4YB 3CH8A 2ZKHL 4JFZH 4D0CA 5DJ0B 4HX1A 3LOWA 4KVCL 3BEWA 2R29L 1U8MA 4P5KB 1MCKA 5L0QB 4TVPE 3WO4B 3H8NA 2VDRL 1I9IH 4OIIL 3C6SB 4GAJH 1Q0XL 3MLSH 3D3VE 3PL6B 4YGAB 5DMKB 2ILLA 3WFEL 3RWGA 1FAKT 1TVBB 3T2OA 4LCWE 5AZ2L 2R2BA 1HIML 4IIQB 4PJXE 4YBQC 3GMMA 4PJIA 1YEKL 5IESH 4QRPE 1GGBL 3L3JA 4BSJA 1FYTD 1U91B 2HWZH 2CDEB 4R26L 3PHOA 4M5YL 4ZXBD 2CPCA 2YPVH 1N59B 3LDBC 2R0ZL 4G7VH 4P46B 1FAIH 4IOIB 1GL4B 5ALCL 1I4FB 5JORB 3JUYA 1QKZH 1VB9A 3U83A 1EFQA 3IDIA 2D2OA 1AP2B 5E8DH 3O9WA 3D6GA 3PUCA 2W0PA 3TZVD 4L29A 3F7YB 1HYSD 1N6VA 4W6WB 1U95A 4I1NB 1RIUH 1JYNA 3QFJA 3EDEA 3KLAB 4M6MH 3BI9X 1CDUA 1DJSA 1W8OA 3EO9H 1RZ7H 3CX5J 5EH1A 4UMGA 3OAUH 1NCDH 1MHEA 1V3JA 4NRYA 1IM9B 3TCXA 5ICYB 1P7HL 1JUFB 3GBLA 2WBKA 4NN5C 4OGYH 1LO4H 4ELMF 4PRAA 1VFOA 1HSAA 3RWDA 4KZEH 2PTTB 2VZSA 4XAKD 1FNGB 1D7FA 4WTZA 5IHUL 1G6RH 5TFSH 3MV01 1DLFL 3FONA 2V5RA 3IB4A 4LLVA 3JWDL 4IOFD 4XPTL 4U0QB 4QRTA 2VLME 4U7KA 1I8IB 4WU7B 3U4AA 5D6CB 5LCVH 3QPXL 3MA9H 5H94A 4NQDB 1W72H 4U0RB 5DA0B 5FGSA 4O4YL 3CJJA 4RBPK 5JXAH 3MMEA 4WV1C 3LKSA 6FABH 2ZKHH 5C0GA 1W8NA 5DRNA 1MCFA 4KVCH 4RAUB 1GGUA 4GH7B 5DJ6B 2DJSA 4EQ2A 3VFGL 1VCAA 1KF9B 1BHGA 2IPUG 5FOJA 1F4YH 4M3JA 4MLIA 3RJQB 2CDFA 5J13B 1UC6A 3QH3B 1WZMA 4F58L 2VLKA 2BVPB 2KL6A 4XWOC 1EGJA 3B9KA 4PTUA 2ADFH 4PUBL 2ZG2A 5HDBE 3WE6B 2VB5A 5L2JA 1MLBB 3QJFB 4LEOB 1YEKH 2J6EH 4JM2D 5JDSA 1A6PA 2X4QA 1W0WB 5E8PB 3NCYS 1F58L 3LEVH 3QDGB 4YHIB 4AT6B 2VH5L 1FVDA 3E1F1 5D7IE 1G7MA 1UH4A 3OKDB 4XHJC 1FO0L 3H7BA 4PR5B 3ZDYE 3CSGA 1GYAA 1IEAB 4PB0H 3QIWB 4IRJA 1S7VB 5ALCH 4XVUD 4PJDE 4K71C 5B3JF 1A6UH 1EXUA 1DQJA 1MJJA 5A40E 4J1UB 2P42B 2A6KA 2AI0L 4F37K 3LD8C 2OR8A 3PDDA 3T0EC 4S1RL 4I2XE 3QI9B 4U1JB 3ZE0F 2FSEB 4Y1AE 3WO3B 5ICZA 1T1XA 4MJ2A 4LVHB 5L88H 5DS8B 2NPLX 2JK5B 1OT1A 1CK0H 1KG0A 4PV8B 1D9KA 2BNRA 3O0RL 3SY0A 1T0MB 3OKEA 1PG7H 4HJ0D 2H32A 4HQQL 1M1SA 1T4KB 4PLKD 4UTAL 4M93B 4GMSH 2XA3A 2P24A 4HC1H 4KK9D 4JFDD 4X0KB 4YAQA 3UTSA 4TUKL 5GSVB 1UB6A 5EA0H 4PJCF 1KN4L 3X14B 2FX7L 2BCKA 4L4VE 4FXKA 1DLFH 3D18B 4MJ5B 1QBLL 3NCJH 4HJGA 4R7DA 4TSCL 5I1CL 2X4TA 3QPXH 3DWTA 1P4LB 1ORSA 4YR6B 1R0AL 5L2KB 2DQIH 5F6IB 5DK2A 4JKMA 4P23B 4XC1L 1XAUA 1GSMA 1IFHH 5F21B 4A6YB 2BVTA 3VWKB 3IFNL 5CLWA 1INDH 1BOGA 5J56B 4JLRB 4F2MA 2KDGA 1H3GA 2DWDA 4XP6L 4ZOEA 3X3FL 5GIRB 1P53A 1CG9B 4L3EB 1EHLL 4QNPF 5D4QA 1G7QA 5GS0D 5M95B 1N6QL 1NCBH 1JWMB 3L3DA 1NBVH 1B6DA 1JZ7A 5TDNA 1HINL 1PY4A 1QFOA 2QSTA 4PJEE 5KG9B 5JDJA 1A6AB 2WNGA 4TNWK 5ELIA 4OM1H 5ADPH 2NR6C 3QDAA 1T3FB 1RK1A 3V6OE 1B9ZA 4YHKL 2NW2A 5I1IH 4YC2C 2JIXB 5CJQL 5IMKA 1EAPA 3V5KB 4LGRB 1BQHB 3I75B 4H88L 1FNSH 4YBHA 2OL3H 1Q9LB 4Q9QL 1OTSC 1ZA6A 1EA9C 1OT2A 2AXJA 1T5WA 2DQUL 2EIZA 4U7SA 3ZTJH 1RSFA 3UAJD 3HC0A 4H25A 2DIBA 5JMRA 1A6ZA 2E27H 4IS6A 1SVZA 4PS4H 3MUZ1 4GW4B 3LDBB 2I24N 3VD5A 1BFVH 4QTIH 1H15A 2VKXA 4AEHL 5KSAA 4MMZC 4NYLA 2YRPA 2DI8A 1BZ9A 4JO1H 2FR4B 1MIMH 5BCAA 3NZHL 4Z7WA 3BHBB 2GJ6E 1OWRM 2ARWA 3WJLC 2HTKD 3L1OH 4LHUG 4JKPH 1EEQA 3NCYP 1FGVL 2ZSWA 2EH7L 4FQXA 4ZTPH 3F12A 1J12A 1AD9A 5C09D 2FX7H 1NGPL 4C56D 1FIEA 1WBYB 3QIUA 4BUGA 3QXDB 1L6XA 5EC1B 4WUUB 3X3GL 2VWEC 1VENA 4L8DA 3UTTB 3T09A 3TFKC 3N1PC 1NAMA 3RWHA 3CMGA 5C09A 2CKBB 1T1YB 2I25N 4XCYB 1S7WB 2NY4D 4NN5B 2WUBL 4RMSA 3AROA 1RZKC 1KLUB 2AJYL 5IB5A 3IKKA 3X17A 4JQXA 4PRNA 4LHJB 3C2SA 5FUZL 5DUBB 3TIDB 4HAFA 3SOBH 1EHLH 3QQNA 2Z8WC 3UO1H 4LSRL 3FFDA 3MXVL 2BMKA 4JFHE 5HHXH 3I2CH 1UFUA 3H3BC 3LRSA 5IB4B 2JB5L 4N8VG 1OAYL 5T1LB 3JTTA 5JA8B 5C0DA 4RFNC 3AREA 3OKLA 2X4OB 3OKOB 4RFEA 3VXSD 2C1PA 5CUSH 4EUPA 3DROA 4M7LT 4WNQB 3D25B 2COQA 1HOCA 4DQOL 1Y0LA 3ZKMD 1NC4A 1TCRB 4E5XA 1CLOL 1TETH 3IDYC 2R0LH 5T3XD 4M43H 1DCLA 5I8KL 2VYRE 4LASL 4AG4L 2YSSB 4B53A 2CGRH 1DVFD 1BWWA 1LO5A 5C0AD 4HEPG 3NFPA 1MRDL 4MDJA 5C6TH 3VWJC 5A3ID 2NXYC 2DICA 3OG4B 5HY9B 2O5YL 4ORZC 5ESAA 1HDMA 1FLRL 1KJ3H 4U6HA 1V7NL 3PNWB 1OAKH 1FFPB 4NZUL 1MCWM 3KHOA 5DHVA 2IQAB 4LARL 1KPRA 1S9VB 5DJ8B 2VZOA 1S7QB 1M6OB 4K71B 4AMKH 2V17L 2M26A 2HJFA 1JTPA 4EDWL 5FF6A 3CFBA 2ZJSL 1KCUH 3LD8B 3T0EB 3T77B 2Y36L 1G7IA 4OD3L 3SKUD 4UUJA 3BP5B 3H3PL 4HIIA 4JHWL 2V2TB 4KROC 3BZDA 1UXSB 1PG7X 1J1PH 2NLJA 2XYCA 4PLJC 3WUWB 3MLZL 4X4ZA 3LKPA 4WI2A 4Y16C 1FNAA 4EDXA 3GMQA 5IEHA 2C9AA 3RUGB 2P5EE 2RB8A 1UM5L 5KVFL 2IBZX 1TNMA 1WTLA 1QA9B 5F8QC 4DGIH 3RGVD 3JWDC 4X6CE 3T3PE 4P3CH 1J87A 4X6BB 4YHMH 4FFVD 2P5WE 3TEUA 4JVWA 4FXGB 2H2PD 1CFVL 5GHWL 1UKSA 3RGVA 4HXAH 4QYOB 2X40A 3RJDA 5DD5H 4JN1H 4Q9BA 4YDKH 4P2QA 1PDKA 2OK0H 1Y6MR 1S5IH 4NFDA 3DUHA 3MUY1 4LFHD 2EKSB 4XBPB 4P3DB 3MXVH 2FJGB 5C0EA 4I18A 4U1MB 4K3EL 5HI5D 4LDLB 1LO0L 3WNLA 1DANU 2AKRB 4PJAB 2P43B 4PJ9C 3EUUA 1WZLA 4AEFA 4D0BB 5DD6A 3O3BB 1E6OH 1U8JA 3QJHA 1ACYL 2AEWA 2JF1A 3ZDXF 3FQWB 2ZOLB 1ZE3C 3KPRE 1KB9K 3MLRH 4DQOH 2B2XH 5DFVD 4CNIB 2DAVA 3EAKA 4N8CH 4H1LB 1CLOH 1T0NB 1TJIL 5JW4M 5I17A 3TPUB 4GKNA 4XCEA 4G9FA 4YHYC 5CKGA 4ZDHA 2WW8A 2A38A 1KB5H 2HG5B 3U46A 2FECL 4JEGB 2PNDA 2QV2A 3KXFB 3CMOL 4HS8L 2I60H 5D71H 4U1SA 1G7PA 4O9HL 3OKYA 3PV6A 4YC2B 4K7FB 1RIVH 2ITCB 3TNMB 4XNMA 2CKNA 3WEXA 2GJZB 3MBEC 1JYWA 5DYOB 4TTDC 3E3QC 4NNPL 2WK2A 3FO9B 3B9VA 3SGDI 3HZKB 2R8SL 1DDHB 4N0CC 4ZUWB 5H37G 3Q3GB 2ADIA 3GK8H 2F8OA 1JZ2A 1BJ8A 3FCTB 4FP8H 4TVPH 1RURL 3SE9H 4MCZB 2WUCH 1MPAL 3T4YB 1P2CA 3DXAE 2EE3A 4K2UL 1BFSA 1FV1A 1M7DB 3D87B 1E4KA 2APXA 4PJ7E 3VXUE 2E8ZA 2C3VA 3K46A 3QRFM 4HFWA 1SVCP 3MLZH 1QOKA 5B38A 2PYED 4P2OC 2L0DA 5D7LB 1MI5E 4PP2A 2VLLB 1YQ2A 4MJIA 5JR1L 4D8PB 4HKZB 1JCKA 1UWXK 2YEZB 1UCBL 3P9MA 5DJYA 1CFVH 3WN5C 4RRPA 2YWYA 2UZXB 1HNFA 1NBZA 3MJ6A 5HJ3B 1U8HA 3H9SD 1NEZA 2EYSB 3PGFL 1QR1A 3INUL 4UT7H 4X9HA 4MNHB 1ZANH 2YMXL 2ZCHH 1G6RB 3IDNA 3MOAH 2DLEA 4X7TA 3CZFA 4OQTA 3VRLE 5EN2B 3ARDC 3S8WA 3V8CA 3S37L 2DD8L 4HIEB 2VDQH 5J06A 3FTGB 3W9DA 5EUKB 1F3RB 4HCRL 5HGBB 3V6FA 3ZKSD 4ZYKA 5AD0A 3B2UC 5MEND 3STZB 3DIFA 3GJEA 2Z92A 4OAWA 2H3NA 3LN5A 3NBNA 5EORL 1HZHL 1TJIH 1YMHA 1ZT1A 3DJ9A 4HS6B 1I9RH 1NDGB 4NQCD 3OR7B 1MUJB 3BEVB 3WLWC 2IALB 3NAAH 4XVTL 3GI9L 4GAFB 4JFPA 4UV4L 4PJ8C 5ERWB 5CWSB 4C4KO 4Q0XH 2FDBP 4P57B 1IAMA 4XGZA 3WFCL 1RVFL 2VDKL 4JJHA 3VFWB 3S4SG 4OUUA 4OTXL 4X5XA 4NUGL 2JCCF 3IDYB 4BFIB 5JHDE 5DTFB 3ZL4H 2HLFD 1KELL 3IDJB 1NL0L 4F7PB 3VG0L 4FQLL 3V0VA 3OB0K 1RURH 3TCLB 1FJ1B 3VWJB 1FGNL 5EZLA 2NXYB 1U3JA 2IQ9H 5ANMB 5FO8B 1CR9H 1HNGA 2O5XH 1QPPA 4GKZA 2JELH 2VDLL 5F3BB 3HKFA 3EYUL 1YY8A 4M5ZH 4Y4HA 4ZOAA 3BKCH 2C3XA 1I7UA 2GAZA 3GKZA 1AO7A 4FQQA 3MRPB 3VXMA 5D5MF 5HHOD 4OZFB 4QT5B 3AU1B 5JR1H 5C2BL 1YQVH 5C9KA 4PRHD 1KIQB 2BFVL 5K59E 1O7SA 3HNVH 4KROB 4I77H 4APQD 3WNOA 4D94A 4JRWA 1L0YA 3PV7A 1JV5B 4NQXB 4EI6B 4KI5D 5A16B 4Y16B 2DL9A 2I07B 4APQA 4OLXL 5ALBH 1UM4H 3HG1E 1ETZA 4M1GH 3CLFH 1CQYA 4XBGB 4DW2L 5CHNB 1D3CA 1MCLA 2DD8H 4U33A 4JJ5B 5LBSL 5KSBB 2D0HA 1FCCA 4HCRH 3GJFA 1OY3B 5DWUH 2DBLH 1ZLUH 5MEPB 5IGXL 1NC2A 2HYMA 8CGTA 1FE8H 2Y06L 1AH1A 5F7EH 1R3HA 5DZOA 4G7YH 3DMMD 3O4LA 3FT3A 3HHRB 1MREL 2A6JB 2A6IA 3CK0H 4YZFE 3IXAB 2IPKB 1J8HB 4PJ9B 1YDPB 1LP9F 4HUWB 5A2LH 1UJ3A 4J3TA 4S1SL 4HPOH 5SX5K 2Z35A 3TWCL 1OCWH 1PEZA 4ELKB 5CGMA 4E41D 4Q9RH 1QNZH 3MUGB 1U92B 4DK3A 2OX5A 4F9PC 2DQGH 2VR9A 4U4BA 4KJWC 5C08B 9CGTA 5GSRA 4E41A 4GSDL 3GSWB 4YHYB 4F80A 4NO3B 5ECJE 2L7JA 2J7LA 1CLCA 3RDTD 3SDAD 1FO0B 5D9SB 4JANB 1SBSL 1EEZA 4OGAC 2C26A 1NLDL 4HWUA 3OAYK 4Y2DD 3MQIA 1KJ2A 3SDAA 4BSVA 3AGVA 4NKDA 1JNNL 1DQQB 4F7MB 2VAAB 1A7NL 3HC4L 3HNTH 1G1YA 2VDLH 3RWEB 1MHCB 1NGYA 3MBEB 1OAQL 4CVZB 3DUUA 2NX5A 2XT1B 5IOPB 1U8OB 5D1XB 4OSUH 4MCYA 1M7XA 4DKFH 1XGPB 3WDIA 2OCFD 2NW3B 3DO7B 4G6KL 4Y8AA 3RZWA 3QQ4A 4D0DB 1FFRA 1DFBL 3CVHH 1MAMH 4HUUB 3NVQA 1CDJA 5FYKE 1QSFA 3PQYE 1FG2B 2BFVH 3WLBB 3RKPA 2PO6D 5CEZE 1T89C 3MLVH 4WI7A 4FQHA 4M6OH 4WHYH 5ACZA 3MJGX 1R3JB 2PTVA 4QF1A 1X44A 5D72H 1CQKA 3VH8B 4P2OB 2OR9H 2Z4QA 1A4KA 2Y4SA 5DEZA 5DEFB 4N68A 3RZCD 4IOSD 4HWZA 4R6UA 1CT8B 4QHNA 1SHMA 4WV1A 1VGKB 1AXSB 2KUTA 1FFQA 5LG1A 4NC0B 1FN4A 1LD9B 3ORJA 3IKCA 4OZIA 1Q8MA 3HRPA 4HXBH 2DI7A 1YMMB 3WN5B 2IPUK 2F5AL 2L4OA 4NO0D 1WT5A 3GSQA 1HXMB 1S78C 2DKSA 3SKNB 4HF5H 4JQVA 2HLAB 2DQCL 3TJHD 4TOYH 2R0KL 2ICEA 1C5DB 3P77A 3B5GA 4NQVA 1XF1A 2ITDB 5LGJB 1UXWB 1IGYB 2HTLD 1YPZF 3SGDH 4Z5RA 4Y5VC 1KCVL 3GIZL 4ZTOL 3T3ME 2YPLB 3ARDB 5EUOF 5BRZA 5HVFB 5JMOC 3RWIA 3QDJA 3CCHA 4PRID 2AJXL 3V5DA 3ZKQD 1NFIA 2A6DA 4LQFL 2QTEA 4EXPX 4CL7A 3VFRB 3SCMD 3TWCH 4Z8FH 3QUYD 4OCWL 4WU5B 4XP9H 2NQCA 1IKFH 4LNRB 3NIFF 5E2WL 4NM4L 4HHAB 4PRPA 2EZ0C 1YEJL 3PF2A 3QUYA 1TCMA 4PJ5D 3ZHDA 3MV9E 4V1DB 1OQOA 2CK2A 3DX8B 1XGUA 1MRFH 4XPGL 3VE0A 5BS0B 3KYOB 4F3FA 2H2SC 1K4DB 5T3ZL 3RRQA 5IR1A 4ZO9A 4PJ8B 1DQDH 3RNQB 3BP5A 2BSSB 3VXPB 3FB8A 3QRGL 2AERT 5HYJD 2JJSA 3HE6D 1BBDL 2EEDA 3DX6A 3F7PC 3TO4C 3HC4H 4FFZL 2B4CL 3ZTNH 4YFEA 3V4UL 4X4XA 4YQXH 3G6DH 4JFFB 4QHMA 1NGWB 4NKIH 3G5XA 3I6KB 2XZQL 5J7CC 2EO1A 2C3GA 2Q8AL 4DJMA 4N1EA 4ODWB 5LQBL 1DFBH 3DGGA 3SDDC 2DRUA 2VIRA 1IEBB 2D9QB 4QCIB 5AG8A 2A74B 1K4CB 4JFQA 2MCPL 1SYSB 3FO0L 4K3JH 2LTQC 4HJJH 3F7QA 5GRJH 1E28A 4QOKA 1ZLSL 3MFGB 3QIBC 5MI0C 4FABL 4X6DB 3MTRA 3MJ9L 5EU4A 1DTUA 3BD4A 1JTOA 4R4BA 4RGOH 3NFNA 4Y4FC 2GY5A 2FHBA 3HR6A 4X8XA 1XGYH 2H6PA 5FGRA 1C08B 4TQEL 4P48A 1F90H 4G8GB 2V2XB 4XTRC 1OTTD 5MP6H 1R24A 1QSED 3WL9B 4OZGE 5JIIA 4X4ME 1TITA 4C55A 2XWBB 2YWZA 4ZUUA 1N4XL 2BVUA 1CGXA 5CBAA 3GM0A 3P0GB 2QQKH 4ELME 2XN9B 3QUXC 4N9GA 5FYLE 1BF2A 1ZT4B 5E4EC 3SJVA 3DVFA 1CDBA 2WINB 4Z76A 1YNTA 2X7LB 2ORBH 4EOWL 4O51A 5E9DB 1GOFA 4N0FA 3T04D 4L3CB 4X8JB 1CLZL 3UPAA 1WEJL 2FHCA 1I7RB 5HDLA 3G6JE 4QWWD 5CMAA 1IQWL 1JMXA 3OKMA 5IVNA 4LGPB 2P47B 4X7CC 3C6LD 1V7MH 3SPVA 4AY0A 4EJ1C 1G7HA 2CUHA 1P9MA 4WUKH 2XQBH 5T3ZH 2NTSP 1MFCL 1LEKA 4HZAA 3HB3C 4L1HA 4ZNEA 2IAMA 3KYMB 3TBSA 4DVBA 3TIEA 3MCLL 3FQRB 2BY2A 2KZ1B 1FZKB 1QD0A 3MV7E 1IGML 3ARPA 1NCUA 3MLPA 3FQXA 5EBLA 4FTVB 2XZQH 4ESKA 3DETD 1AE6H 4ODVL 5JW4R 2NY1C 5BXFB 4C57C 4KAQL 3VFNB 4KKLD 4PBWD 2IH3A 3DVNB 1CDIA 3BJ91 5HHMD 1F4WL 3LKQB 3C8KA 5FO7A 3ULVF 1ZLSH 3WBDA 5SWSB 2HRLA 1KCRH 3ECBB 5E00A 3MJ9H 4Z7UA 2D7MA 1DQLH 1YJDL 2IFFH 3QG6B 3JUZA 4WTZG 2VXQL 3MRNB 4LSVL 4KRMB 4X7DC 5HVWA 5T33L 3RTQD 4PJXB 4MZ2A 4OF7A 4TQEH 1T03H 3VXRE 2VQ1B 3MO1A 1NUNB 1W72A 2KBGA 4ERSH 4BK4A 3U0WH 1I7ZB 2QSVA 3IGAB 1MFAL 2BNUB 3JTSB 4WFED 3MBXL 5CKAA 3KPNB 2MNUA 4OZHB 4PY8J 3VXTA 4ETQA 1F8TH 2CLZA 5CCKL 3CFEA 1KV3A 4PJCE 4HD9A 3LMJL 3ROLB 3Q1SL 4P49A 3TV3H 1CF8H 1Z5LA 5I18L 3QXVA 3LAFA 1GGCL 3WXWL 1HILB 8FABA 4Z78B 2CH8A 3RNKA 3RVXC 2J6EA 5HHNA 4KJQC 3V5HB 4JFXA 1VFUA 4LSTL 2EDWA 4CN6A 2FB4L 2MJWA 2NY5L 1RD6A 4Y5VB 4JRYD 1WBZA 1B6UA 4G43A 3KPLA 1I3VA 4YHPB 5FDWA 4FQ2L 2F54E 4KKCD 2ATKA 3WIHL 3MACH 4PJGA 1INQA 4N0RA 4XNYL 2GUOA 1JK8A 1KFAH 3GMLB 1N8ZB 3LB6C 3LRHA 5F96L 4QNPE 1OP5K 4CADB 2XQYG 2EYRA 2GKIA 4WDIB 4HK0B 3PWNB 4QRUB 4M8QB 5D7JD 1P4IH 1E4XL 4GW5B 4PY7B 3BESR 2UVFA 1GHFH 2R56L 3I9GL 3ULUF 4R3SB 1B0GB 3OKKA 3V8OA 2DM2A 5JPNB 4JPKL 4Q2ZA 4ODVH 1JNHB 2G5BA 1F2XK 5GS1C 2BSTB 4PJFA 5DD0L 4M61A 1MVFA 1PZ5A 3BP4A 5B22A 3TO4B 2IFGA 1OARL 5A16A 4HC1A 3IDMA 1CICC 2R1WA 4PTTB 3PP4L 5FCUH 4XMLL 4JO4H 4RX4D 2RCSL 2GTWA 2ADGB 4BA8A 5DO2D 3PWVB 2H8PB 1QRNB 2VXQH 3MLWH 5SWZD 5C7XH 1B4JL 3HAEB 5D1ZA 3SDDB 5JOFA 2BY1A 1Q1JH 1U3HA 1B0RB 1JPGB 2DQEL 2XG5A 1X5AA 4L9LA 3Q6FA 3REWB 1T1WA 2P45B 2X4NB 1S9WB 5SWZA 3BKJH 2LTQB 2ARJQ 2H45A 4NP4L 2DQTL 3QIBB 5MI0B 3QXAA 1HHHB 4K8RH 4XHQA 5F71A 1TZGL 2AW2A 2VZTA 5F1IB 4Y4FB 5BO1L 2DMKA 3CFCL 4LIQE 3BZFB 4G6FD 4YGVB 1A2YA 3PWUB 1AR2A 4M7LH 4YIQA 5GZOD 2W0KA 2CLVA 5I18H 1RMFH 1NEUA 3WFZA 4I2XB 4JG0H 1GGCH 1T66D 2NXZC 3WXWH 3BYTA 1KTKE 4HMEA 3KPSA 3TBYA 2GSGB 3MJ7A 4PGZA 5EOQL 4N5ED 2DF3A 1KJVA 3QUXB 1H3UA 3GSXB 5E4EB 4G6ML 1HQ4B 4RISH 3KLHC 1HWHB 1FDLH 4JKKA 1FYTE 4YXHL 1EFXD 1CGYA 1NFDA 3ARZA 3CFKA 1AY1H 5F89A 5CD5C 3JV6A 2OL3A 3CPLB 3UC0L 4DZ8A 4PJHE 1WWCA 4R4FH 4YX2L 2ZUTA 4XPHH 5F96H 5B39A 1FFOA 4ZPVB 5TF1H 1PKQA 12E8L 5EOTB 1MY7A 5E95B 5B8CC 3MRMB 4P59H 5MHSD 1MNUH 1G7JB 1K3IA 5EU6D 4ZO7A 4L8CB 1IC5L 5HSFA 4H0IA 5EZIL 2B4CC 3Q6GH 1RZFL 5CJ5A 1BF8A 5IMMA 5E7BA 2J8UE 3S9DB 4WI8A 3QUKB 5IMOB 1U58B 4KHTL 1CL7L 3FMGL 4HIXH 2OZ4H 2V2WA 5BZWB 3QHFH 2PYFB 1Z9OA 3GIVA 4R7NA 1KENL 4G6JH 2XKNA 1A14L 4XAKE 3SKMA 3VFVA 3HUJF 4U1IB 1EUUA 4L8BA 4AH2B 3O41B 1EO8L 3UPRB 2NY1B 3ULVL 5JIPA 1DBKL 2YOCA 4I3GA 4X7EC 4IHOA 4X6FB 5IW1B 5D2NE 2IAND 4KKBC 1KIRB 4YEFA 5HD8D 3U0TB 5F88A 4M7KL 2Y7QB 3HR5B 3VFUA 3PDGA 2EDXA 3DRTB 4NP4H 4S10A 1GZPA 3C5JB 3TBWA 1S5HB 4PJBA 5J11C 4U31A 1FPTH 1KEGL 3L5WA 3KDMA 5F7FA 3SDYL 5DSCB 4AENA 5AUMB 5F7YC 3FQNB 2IBBA 4XCCH 1AFVL 4MSWB 3DYPA 1JGLH 1C12A 3UEZA 4HKJB 2FH6A 4LBEB 5EBGA 3IU3A 4QRRE 4UQ3A 3ARGD 5FIEA 2OM5A 4YPGB 5DJCB 5EOQH 4V2BA 4D3CL 4JKLA 5CS7A 5I1DA 1YN7B 3UMTA 4CMMA 3BP6B 5FYKH 4J23A 3U6RA 4EUPG 1HWGB 3WDJA 5IP4A 1H0DA 5IBLC 4YXHH 4NSKA 4R4NC 5IMLA 3GRWL 4MWFA 5CEZH 4Z7VF 5LWYH 3MRDA 1RZGB 4B0MM 4GAYA 3LH2L 4UOW0 4BZYA 5GGRY 4JB9H 4OCSL 4PB9L 4S11A 3UZEA 1NCWH 3RL2B 1MWAL 3JVGC 2IH1A 4M7JH 4NQED 2EIEA 4DAGL 1WUNT 5DJXB 2FO1A 4R2GC 3U0PA 4MNGA 1QBML 4M62H 1CGSH 2YXFA 5IB1A 3NZ8A 1GVIA 5H2BA 3RVUC 3HPLA 5FEBA 2O61A 2X4UA 4U7MA 3TF7C 5KZCD 3BH9A 5MEOB 4KMLB 1BJMA 3MREB 1IC5H 1A9EB 4MD0A 1F3JA 2C7UA 3QUZD 1CDCA 1RZJL 2I5YH 2NNAB 1Q72L 4KHTH 5ID0B 4DGYL 4PJIF 5SWQA 4I3RH 3UBXI 3QUZA 4C4KT 4DCQA 2BZDA 2NY2C 4JFDE 3RP1A 4XCFL 4TNVF 2BSRB 1DBKH 5GS1B 2G5RA 2GTZA 1EK3A 1IE5A 1NGXB 3NIGE 2NY7L 1YJDC 3L3KA 3P0YH 4JZJC 1E4JA 4HDIA 2BHZA 4PGJA 5D1QD 1N7ML 3ILQD 4LPYA 3FRPA 1BD2B 5FA4A 4HT1L 1U8KA 4KJPD 5I2IA 4RDQG 3DV4B 3TN0D 1CICB 1XCQB 5IHLB 3RKDC 3C8HA 3ABZA 4UT6H 3HNSH 1R3LA 5DI8B 3NN8B 5CJOH 3OAZK 5ISZA 2NMSA 3KPOA 3MGTB 3K81A 4MGXA 5C0BD 2J4WL 3AAZA 3O2DL 5DVKA 1AGFB 4CDHA 3VDAA 1LO3L 4POZC 5C0BA 2JJVA 3O6LH 4DTGL 4JREC 2MQ3A 2Q6WA 4HK3N 3K1DA 4LLDB 5E08L 3OKNA 3V52H 1J05B 1EV2E 3QXTA 3C5ZC 4YJZL 1ZWIB 5K93A 5C07D 3X13A 3B9DA 2AS5M 2AV1A 1A9BB 5FHBH 4NKQB 5IB2B 1CVSC 2NXZB 2NY5C 3DTXA 2R1YB 3VFPB 4YUEH 2VZ1A 1KB5A 2EXWC 3QA3B 4XVSH 3WD5L 4NNXA 5DJ2A 1QBMH 3CD4A 3I50L 1IBGL 3VXNA 3ESVF 1C16A 1P4BL 3BZ4A 1P69B 1SEBB 1J5OL 4J3XA 3D39E 1JYVA 4F7TA 4PRBB 4ONHB 5MERB 3OQ3B 2DLFL 3EDDA 3MRKA 5GGRB 1DBJL 2PF6A 5DVLA 5FYLH 5TJWK 5KS9E 1A1NB 2VLRD 4GAGL 3AMLA 4JY6A 4GG8B 3S3SA 5B8CB 3ZYJA 5DJAA 1IGCH 3OBAA 4Q58C 2BC4B 3D3VA 2K1MA 1F2QA 4LKXA 1WBXA 3EJJX 5CZXD 2BNQE 4LCWA 5C09E 3PL6D 4C56E 3U9PH 2X4SB 4PJXA 5B38G 5IFJB 4JDTL 4DWHA 2EDDA 2P48B 1FL5B 2ZZUT 4QRPA 2R9HD 3NACH 5E2UH 2BNUA 3QQ3B 4KXZI 1N7MH 3L3IB 3R06A 1U3ZA 4RWYH 25C8L 2V5SA 2F19L 3FB7B 1A64A 1LHZA 1D5BA 4PPTA 2IG2L 5KVDL 2W9EH 4JM4H 1RU9L 2BVEA 1K6QL 1C5BL 3GSNL 3KR3H 3QEHB 4DOHE 4RRPG 1N5AA 5D5MB 1NEZG 1ZSDA 4ORGA 1Z0MA 5B21A 1XF5B 1FCGA 3GO1L 4HZLB 4M03A 4LNVA 4FFWC 1NPUA 3KLDA 3O2DH 4IMKC 4IRSA 2ZNXA 2YN5A 1NGZB 3QNZB 2XFXB 1I9JH 2BK8A 4YDIL 3VRJA 5L9DH 4WCYH 1J86A 3V7MA 5JQHC 3O6FC 5D7KD 3HMWL 5E08H 1VADA 5FGBA 1KSRA 5MEQB 1N3NB 1F13A 2J88H 5GJSL 3VXSE 3G5VB 2A83A 2LV4A 4LHUB 3SBWA 2YC1B 4GXUM 1TXKA 3CXDL 3TO2A 3QEGL 3D9AL 3G08A 1IM9D 3QEUA 4M48H 1T5XA 3MRBB 5T3XE 1IGIL 1T7VA 5I8OH 2E5EA 3VXUB 5I8CA 4ZS6C 4ZAKA 1WITA 3T2NL 1J10A 1RZ8A 2D7OA 1DE4B 3ZLQC 5I71C 2N7BA 4NWTH 5DJDA 5C0AE 3H0TB 5I6XC 4JPVL 4JO2H 3M8OH 2ZWLT 1VFMA 1P4BH 3HRZA 4NJAH 3O3EB 1Q9KB 4AIZA 1BEYL 3UTZB 4NQDD 1T6VN 1UQSA 3RAJH 5I1JH 1YYLL 4U6YB 3KPTA 4R2GB 4XP5L 3GMNB 5A43C 1Q94A 1LP9E 3RWFA 1IL1A 1TJGL 3L3HB 3JSSA 5E8OA 1QP1A 1DUYB 4N8VB 4YXLH 1X6LA 4J2XA 3FB5B 3HS0B 2FL5B 2YBRA 3F7VA 2JLLA 4X99B 4EBQL 1A1OA 5T5NG 2YHGA 3FQUA 1HYRC 4J4PC 3HA0A 4Y88A 4DUWA 5DK3A 3EJYC 3VI4F 4MXVF 3EOAB 1YEGH 2YD8A 2QL1A 1KBGH 4CJ1A 3ULVC 5D7IA 3EYVA 4XPBL 4RMQA 3N50A 1FL6B 5J1TC 1A1MA 2NY2B 3ZSTA 3QDGD 1A22B 3SE3C 2HH0H 4PJDA 4RCAA 5GRWA 2O5ZL 4DKDC 3CSYB 4NOFA 1WISA 3BXNA 3QIWD 4J8RB 4LVEA 1T83A 3E6HA 4JZJB 1DBAL 4FMFA 1HSBB 4Y1AA 3S34L 4Z7WF 5DQDH 3ETBF 5FM5O 1NKRA 2C1OA 1KPUA 5TGBB 2AQ2A 5LJYH 1Y18B 5JTWA 3QI9D 3MLUH 1KTRL 3HMXA 4G8EA 4BQBA 1I8KB 2A9ML 1YEDA 3KS0J 5JHDB 5DDHB 4OFDA 2A1WL 1S7TB 1NDMA 2ZG1A 2UWEB 4H26A 2I26N 1D6VL 1ND0B 4LOUD 1VGEH 1P1ZB 1CE1L 4NJ9L 5GGSA 4CAGA 3QEQE 3QO1A 1YYML 1CZ8L 3EO1B 4L4VA 4JREB 2W9LA 5DJZA 2NY6C 4AEEA 4HS3A 4YFDB 3L5JA 1K5NA 2QQLL 2OI9C 1AQDB 1PZUB 1UZ6F 1YPZB 2R2HA 3DVIA 1T80A 5EG6C 1XGRB 4EN3C 4XBEL 2XA8L 3C5ZB 4TNVK 4QY8A 4YK4C 3QDMB 5DUML 1ZAGA 4B7IA 5DLMH 1XZ0A 3FT4A 5HI4D 5ABDE 3QULA 2W0LA 2ICWI 2AJ3B 3QAZC 3SKJL 4P4RB 4JZOA 5IVZA 2Y72A 2HJLA 4MXQD 3RY5A 1H8NA 4LIQH 3VWKD 4FZ8H 5J4MA 4PG2C 1JGEA 4KUCF 5I1AB 3QYCA 5EUOE 2X70B 2DOCA 1EGJL 2G2RA 2CUIA 4Q6YA 1DBMH 1DQMH 3GSUA 1LE5B 1RZJC 4L3ED 5ID1B 3LS4H 1MH5A 4FQJL 4Y5YC 4QXUL 4LCCA 2HFEA 4YLQT 4PGDA 3PHQA 4NDMA 4PJEA 3MRJA 2VSCA 1PYWB 3C87A 3QCUL 3NIFE 3I85A 3L7EA 2PYEE 5CZVL 5HBBA 2D31B 4DUXA 5I74C 4MX7B 1GAFH 5KAQG 1EMTL 3BT2L 5TE6H 3V6OA 3CVHA 2DLHA 2FEEL 2Z31D 1MHPL 4MA3B 1T7ZA 2YA1A 2MQCA 2JB6A 4BZ1H 1T22A 5I9QC 5HVGB 2Z31A 4GXVL 2JIXD 1GIGH 1ZHBB 1L7IH 2HAZA 4RGNC 5EO9B 1J0HA 4NZTL 3X11A 3H9SE 5TDPB 1SJHA 3K4AA 3BWAA 4WWKC 4LU5L 3T2QA 5E2JA 1KTDA 1V3KA 3CLEL 3RX7A 3MRQA 3O6KH 1CGWA 1CS6A 5D2LA 5ACMA 1D6EB 2J1KA 4O2CA 4OM0H 4OLEA 2A9MH 5I15L 5K9JL 3TT3L 4XNXL 2MHAB 4LF3A 5MENE 1OW0A 4KK8C 1KN2L 1E0OB 2XZCL 2RIKA 1A7BA 4A2LA 2GJ6A 1T1ZA 2B5IC 3P73B 1ZHLB 2APTA 3N1FC 4ALAH 4NQCE 4JRXD 3JZ7A 4TUJB 3TVMA 4EKXA 2EDRA 3O6FB 3MV8B 3TA3C 5DRWA 1ZVSB 4JRXA 1N5YH 5DHYB 1ZA3A 4JAMB 4NKMB 4I8DA 3MREA 3UTTD 5DUMH 3CZJA 4LLQB 3DBXA 2GSIA 4KY1L 5FV1L 2XQYK 3UJTL 5D7SL 5I19H 3PQYB 1A0QH 1IGJA 3M17A 4P2RB 1I7TA 2IWGA 3GNMH 5SX4I 2CIIB 2HFGH 4GMTH 1A7PL 3PABB 5I1KH 1AIFA 2Z8VC 5I71B 1RUKH 5I6XB 1MJ8L 5IFAH 3MXWL 1QPXA 3THMH 1T2QL 5FKPA 1I3GH 2ADJB 4DKAA 2ED8A 5FK9A 4OLVL 2K3TA 4NWUL 4OD1L 5E5MA 3REVB 4M8VA 2PXYA 4YHOH 4YHZH 4YPJA 4OFKA 3LZFL 4Z0XB 5HHOE 3TBTA 5T1LD 2CJUH 3OF6D 4BH8A 5AWNH 1MFBH 2QHRL 3RVWC 5EOCL 3ES6B 1QQDB 4PRHE 1UACL 3KPMA 2DQFB 4MVBC 2V5TA 3JV4B 1A6TA 2DQHH 4XXDA 4NZTH 5FDYA 4JZNA 4KI5E 1NCCL 4XWOD 5E0QA 5BW7A 3LQAL 3HC3L 4QEGA 3UPCA 5JXEC 4CVWA 3NH7L 4CMHC 4O02H 1QFPA 3QQ9C 3ROOB 3S4SB 4KJYB 3QFDB 1K8DB 4AM0A 1EZVX 2BRRH 4HV8A 3O8XC 1R5WA 3QNYA 5IV2A 3QXWA 4XNXH 3A67L 5T1MA 1YZZA 1IC4H 3JWOH 4N0YH 3BIAX 1H3WM 3KPQB 4RFOH 2OTWB 3IXTB 3QWOA 3MNZB 1N64H 2PR4L 1MF2L 3OXSA 4JPIA 3T0ED 1TZIB 5C0CB 3C09C 4U1LB 2DJ4A 3K4DA 2HT2C 2IPTL 1JPTL 4K94L 1NAML 2FWOA 3FO2A 1MRCL 5JLZB 3CDFA 1YNKL 3QO0B 3KJ6H 4UINL 3CX5K 3BZEB 2P5EA 3ARFC 4E41E 1JGUL 2ZPKL 3L9RB 4KZDL 5KVEH 5ETUB 3B9AA 4I9WD 4X6CA 4XNQA 1JRHH 1AKJB 4GQ9H 4ODSL 3BIKB 3NTCH 2YXMA 2P5WA 3MRCA 1IAIL 2C4FT 1BM3L 3E8UL 3K8KA 2XWJA 4IDJL 2EDJA 4ZFOB 1CE6B 1P7KA 2V9TA 3ULSB 5CEXB 4IJ3C 3QBTB 2VL4A 4NQSA 4LAQH 1D5MA 4FQ1H 2OI9B 5DA4A 3DX9B 3TYFA 1MWAB 1NSNH 4EN3B 5GS0H 4U1KB 3MXWH 4YK4B 1TJHH 3HZVA 1GGTA 1H3PH 4F8TA 4TPRL 3QAZB 5HGHB 2N1KA 3KPPA 3CUPB 3V4VL 4OQ1A 4KRNA 1QHPA 2R2EA 4J7RA 5IK3B 3EGSB 1KEML 3MJ8A 1NJ9B 2P7TB 1I3UA 3T0WA 2VC2L 2C5DC 3BKML 3KPRA 1LK2B 3S88L 1OGTB 4JHBA 2RR3A 4K7PH 3QP3A 4NM8L 5EFIB 5EBMB 3ZE2F 1NBYA 5HI3D 5JUEL 3U4BL 5I0ZA 3WS3A 1UACH 4PG9B 4MHHG 3GSRB 4Y5YB 2APVA 4G8IA 4OLZL 3GB7B 2FIKB 4OV5B 4JGJA 2GT9B 4NKOB 2Q86A 4I3SL 2DB8A 4K9EL 2B20A 4OT1H 5E1AB 3L7FA 3JV0A 4JFYB 1WIOA 5I74B 1FZMB 3GSVA 3I02A 1OAZL 4GG6E 1WCBB 2PCPA 3W0WB 1JNLH 1H5BA 2WQ8A 2GW5A 4OZIE 3MGAA 1JTTA 3O9WC 3KXFD 1RUQL 4Z77B 3DLQR 4MAUL 4RIRB 4S1QH 4NCDA 3OXRB 2OR7A 1RK0B 2CLRA 3MR9B 3TZVC 4M9PA 5LXGH 4RGNB 5T5NF 1OTSD 2W0FB 1EVTC 1WC7A 4WWKB 3F6LA 3H7LA 3TYGH 2GITA 43C9B 3DXAA 3HZMB 3H9HB 2VXTL 1IC7H 2M1KA 4PJ7A 4XNZC 1U8LB 1ZLWH 4K94H 1TQBC 4WI5A 3BWUC 1UWGL 2H26B 3F6IA 5E6YA 3VFMA 4PRIE 1MI5A 3DPBA 1QFUL 2Q7YA 4H5SB 1T7WA 1ITCA 4NHUB 5IJVB 4WHTA 3PG2A 1JGUH 5D7LD 1X4XA 3MROB 4L4TD 3WFBL 1VFBA 2B5IB 3RX5A 1R5VB 4QHKI 2EDNA 5J8OA 5C0IB 1T20B 1OSPL 4PJ5E 2QR0B 3GMOB 1ZT7A 1ZS8B 4H0HB 1CLYH 4L4TA 1FG9C 1UWEL 4MQSB 3VGGA 1CGUA 2D0GA 2LU7A 3D69A 3VXQA 1JN6B 3TA3B 3AVEA 4K3DH 4MAYD 5HYJE 2EC9U 3V0AC 4FZEL 1G7LA 3MLTB 3TFKD 1ONQB 4D9RD 4TPRH 5INDB 1UEMA 3VXRB 3B9KC 4IRZL 2DMCA 3T8XB 2DL2A 3JWNC 3FHAA 1OTUC 4DGVH 3KYNA 3FAWA 2CQVA 1VDGA 3BAEL 4ZFGL 1BLNB 5EZJA 2G9HA 4NC1E 2EDKA 3PWPB 1HEZB 2FGWL 1DN0B 4JM2C 1T04B 2AEQH 5C8JB 3DECA 3MRHB 1MEXL 3ALWA 1WWBX 4FN0A 2WWKO 5T3XH 4X6EA 1V3LA 4IRJC 2VDNH 5GGUA 4CBPA 5GRUH 2GK0B 3I3EA 3ARBA 1NANI 2X1QA 4XVUC 4TSAL 5D93C 4KUZL 1ADQH 3HLAB 4XMKL 1QSEE 4X9GA 3WV0A 2HFFA 2X4RA 2W1NA 3RPIB 4LLUB 3OR6A 3EFFA 3R1GH 5F7KC 1D9KC 4ZUVB 1QVOA 3G9VA 2VZUA 5KAQF 3K0WA 2WWMC 1LEIA 3GSNB 1FVCA 4CMHB 1QFWH 4ZUTB 1EJOL 3VRIA 3JWOC 5EU3B 3CFIC 4P9HH 3NA9H 3HUJE 4HJ0C 5SX4H 1D5XB 4OCXH 1CFNB 3BSZL 4DVRL 4RZCB 2NXYD 3O8XB 4J6RL 1FC1A 1HHKA 3GMPA 1WSST 4NN6C 4I5BB 5EDXA 1W0VB 4F9LA 2FO4A 1TTFA 1D5IH 2OTUB 3LKOB 1ZGLP 2XICA 3NPZB 4QXTA 5FM4A 1QEWA 1HHJB 1KNOA 2AXFB 4UOW1 4XC3L 3V95A 5KSUB 5EIIB 1TVDA 2BP3A 1UKTA 4ZUSA 5J3HC 2W9DH 3OV6A 3MPCA 5GGVL 3O3DA 2KH2B 3C09B 5IM7A 4Y4KB 3EOTL 1MJ7L 3HG1D 1RFDH 4NZRH 3IFLH 4FFYH 4XB7A 5B39G 1E27A 4YH6A 4U1NA 4F33A 4NPYA 1IARB 4PLJD 3ZTJG 4OQTL 4ZSOB 3HG1A 3ARFB 3EO0A 3GBNH 3J8F7 3RIFF 2VXUL 3RU8L 4CDGC 2D7PA 5I1HH 5I1LB 5L7XH 5F7DB 3D2UB 2RJMA 4N0UB 4YO0A 1FVEA 4D0CB 1F45A 4HX1B 1I85A 4ZFGH 3BEWB 4Z7VE 2VRAA 4AJ0A 4WGWB 4UIKH 1XEDA 5DRXA 2OZ4A 2FGWH 3T4AA 2ZCKH 1EEYA 1W2KT 5HHME 3VD7A 4F7EA 4UNTA 3TT1H 1ZKAA 3IF1A 1XH3A 1QYGL 3RWGB 1OLZA 3SO3B 2Y07L 2R2BB 4PRDA 5GS3A 3QR2A 4XNUL 1J8HD 4K7PX 4HIHA 4PJ9D 4PGEA 2PW2A 3GMMB 2YK1L 3OPZL 2QQNL 2KQNA 4PJIB 1AGBA 3L3JB 5BVJA 4NRZA 4OCRL 3LQAC 1UVQA 5FAAA 3PHOB 2HVJA 3SDCA 2BOCA 4I0PA 5DMGD 3VDBA 2IJ0C 4WFEE 5B4MC 3F5WA 2QKIA 1CDGA 3GHEL 5KSAC 4XRCA 3RUGF 4H20H 4NIKB 2EDYA 4OZ4A 4PJHB 4EEEA 4GRLA 5CGYC 4JFOA 1IAIM 3IDIB 1FIGH 1UH2A 3O9WB 4L29B 1L7TL 1OWWA 3MLYH 1E6JL 1U95B 1A47A 4FQXC 4R96A 2OMNA 4JDZA 3QFJB 4J6RH 4KGLA 2HTKC 5JZ7C 4I48A 1RUPL 3QIUC 4AZ8A 5BMFL 5I1GH 1HHIA 2W65A 3BQUA 1F3DH 4K94C 3LS5L 5D1XD 3TLRA 3L5IA 4NRYB 4HWBA 4N0CD 4PJAF 4KTYA 2H9GA 4PRAB 1HSAB 3RWDB 3WIFA 4JRYE 3VFOA 3OG6B 1T21A 4XNZB 4TUOA 2MTPA 3EOTH 4JQXC 5E6IA 5TPWH 1MCJA 1DBBL 1X5ZA 2AEPL 2AJUH 5I16A 3FONB 4LLVB 1LO2L 4OQTH 4QRTB 1C5CL 3PIQA 2HFTA 4LEXH 4YBLC 2OJZH 5H94B 3RU8H 4NNYA 1AQKH 1MFEH 4OFYD 3MMEB 3LKSB 5TQ2H 1HKLL 2R2CA 3O3UN 4Z9KB 3WFDH 2VZ3A 4X80L 3AREC 5C0GB 4JO3H 5DRNB 1YMMD 3SO5A 4YHNA 2R23A 1QQDA 5F6HI 2R1XA 2MPAL 1U93A 2D7NA 2P46B 4EI5D 4HGKC 1REIA 1K2DA 4HBQA 1A3LH 2CDFB 4NO2A 5IVXE 2VLKB 3PXHA 2R0WH 1VHPA 1QYGH 4EI5A 3BE1H 3RGHA 3B9KB 1BQLH 4PTUB 4Q6IC 1QFWM 4WW1A 2YPLD 1UG9A 3ARDD 2VL5A 4U6VL 3P40A 5L2JB 5DD3H 1GCFA 4WEBH 5FHAL 5JDSB 3STBA 5SWZE 1KYOK 4K9EC 1ZLVH 2X4QB 4MA7L 3SE3A 1CFTA 2JE8A 1FVDB 3FRPG 1G7MB 3MV9A 1DVFC 2PKDA 3H7BB 1AI1L 4IRJB 1KIUA 4V1DD 5EO0A 3WLWD 1KJ2L 1DQJB 1MJJB 3LIZH 1G0YR 3GDBA 5BS0D 4OLYL 3HCVA 2A6KB 3VMNA 2YD5A 4PJ8D 2VN7A 5D93B 1M05B 3RWJA 1L7TH 5ICZB 1T1XB 3EJZC 1A5FH 2X9WA 1EH9A 5J1AA 1KG0B 4Z7UF 1D9KB 1ZTXL 2BNRB 3SY0B 3BGMA 1JNJA 3OKEB 2H32B 5I1EL 3SQOL 4F15C 2P24B 4LCUA 1GOHA 1UEYA 4JCMA 2Y6SC 4U3HA 1IC1A 1TMCB 3OX8A 4YAQB 3UTSB 1UB6B 1PKQE 1CFQA 3M1BB 1OP9A 3PGDA 4OCYH 4G42A 5CILL 1EHNA 2BCKB 3RGVC 4FXKB 2ED9A 1CD9B 2OQJA 4NN6B 2P8PA 4HJGB 2E9IA 2NCMA 4FFVC 4R7DB 5ESQA 5IT2L 1I1AD 4FQCH 1LK3L 3EOBA 3QCTH 2Q8BH 2X4TB 4LLMA 4I18C 1ORSB 4R90L 1I1AA 4I0KA 5IFHL 4OZGA 5DK2B 2QJDA 4X4MA 5EU6E 4FQIH 4UOJA 3FOMA 1G9MH 4J3OC 1NANH 4NBZB 4PV9A 4X80H 3A6BL 4JG1H 1BOGB 4MB4A 5HI5C 4F2MB 4ELMA 3EHBD 3A6CH 2DWDB 2VDPH 2B0SH 2MPAH 1NUDA 4LGSB 1GXEA 3ZHLA 4DK6A 1G7QB 2XN9D 1OGAE 3L3DB 2R4RH 4TSBL 5TDNB 3AS2A 4G5ZL 5EO1A 4HWNA 3L5XL 1JPST 1RUAH 3MFFA 4UZGA 4B50A 1G9NH 5DFVC 2OXHA 3IJSA 4PJGF 5E9DD 1R3IH 3WMSA 3W82A 3G6JA 2FYYA 5J89A 1RK1B 4YDVA 4ZOCA 1IQDA 2IANE 3MCG1 1YEFL 2NW2B 1UM6L 5IMKB 1EAPB 1BREA 1IAOA 2BJML 2XRAL 3VD3A 1J1OH 1D5ZA 5CIPH 1T7XA 3CAFA 1ZA6B 4GRWE 4LSPH 1INEL 3JBG7 1T5WB 2EIZB 2FATL 5HYSA 1Z9LA 4OLYH 2HKHL 3HC0B 4FOMA 4H25B 4PJFF 2GCYA 3VDCA 1A6ZB 4IS6B 4GRMA 3VJ6A 3DGCR 1XIWD 2WSKA 3FN0H 1CXIA 3MV7A 3BIBX 3NCFB 1E4KC 4NHCL 2F53D 1XIWA 4KKAC 3BO8A 3IFPA 4L5FL 4KJWD 3C5SA 3RIFK 1H15B 2FD6L 5IW6A 5KSAB 5JOPD 4NYLB 4JFED 1NMBL 4FTVD 1S7RA 2F53A 3K2UH 1BZ9B 5LGHL 2R69L 3F7RA 1J1XL 1FORL 3NCCB 1DUZA 4PYGA 4QXGH 4Z7WB 4YWGH 4O58L 4OGAD 4JFEA 5KSBF 4Y2OA 4UIMA 5JPMA 3GKWL 2AJZA 2ZSWB 4HLZH 4FQXB 3F12B 1AD9B 3FN9A 2DLIA 3QIUB 5SWSD 4PREA 4L8DB 4XMPL 2HKFL 4NQEE 4ONGH 1LK3H 3H9YA 1NAMB 3WKML 5HYQA 1IAKA 3RWHB 5C09B 3BW9A 4N90D 5EB9A 2B1HL 4EZMA 1BAFL 2V7NA 1IVLA 3RBSA 4JFZL 5IB5B 5HGAA 2I9TA 1L9MA 3SDXE 4M1CC 2BXYA 4S0SD 3ZMRA 1URLA 1SY6A 4PRNB 1I1CA 1P84J 1I9IL 1XR9A 4GAJL 3MLSL 4LVOC 5AAMA 4YBLB 4PJCA 5KSVA 3FFDB 2BMKB 4QHUA 3RBGA 3KYKH 2X89A 1ORQA 5TE4H 1S9XA 3L5XH 3LRSB 1NFDF 1IT9H 3UX9B 3LQZA 5JIKA 5IESL 1KCSH 1UZ6E 3JTTB 5C0DB 3AREB 3OKLB 2DDQH 1YEIH 4RFEB 1F6AA 1P7QD 4XCNA 2C1PB 4GBXD 4EUPB 3DROB 5FECA 3ALPA 1HOCB 1Y0LB 1NC4B 4YEEA 2YPVL 3BDYL 4E5XB 1FAIL 1N6UA 1P7QA 3D85A 2VERN 1K8IA 4GBXA 4KDVA 4HFUH 2F54A 4LKCA 4HPYH 1QKZL 4S1DC 4HUXA 5HHQA 2FEEI 1INEH 5IF0A 2FATH 4X7SL 3WXVH 3UYPA 2BSED 3NPSC 3U30C 2DQDH 4MB3A 1LO5B 2OLDA 1ZK9A 3NFPB 3QWRA 5C0BE 4MDJB 4PGBB 2HVKA 5ESAB 1HDMB 3H9ZA 4ONFL 4U6HB 4M6ML 4M1DH 5DHVB 2DYPA 1CVRA 2EZ0D 2HN7A 1KPRB 3EO9L 1DEEA 1RZ7L 1EBAA 2XWTA 1NCDL 3OAUL 1FBIH 4OI9A 2HJFB 4OGYL 1LO4L 4UDUA 5LGHH 2R69H 3DRQA 4L9DA 5IQ7H 5FF6B 3CFBB 3WUZA 2H2SD 1RZIA 4UILH 4UNUA 4KZEL 1G7IB 4O58H 4CKVX 4UUJB 4HIIB 5C07E 3Q5OA 2E3VA 3BVNA 5GGVY 1BJ1H 3CVIH 4U6XA 3TO4D 1X9QA 3NABH 3UTPD 2NLJB 3PDOA 3G04A 4PJBF 3LKPB 3UBXA 4EDXB 5LCVL 1MIEH 3GMQB 3KNBA 3MA9L 4APQC 3ZDZE 1W72L 5IEHB 4F15B 4ZMAT 5JXAL 1LEGA 1QRND 3S36H 2O93L 4MS8C 6FABL 2VDOH 5JW3H 1G9EA 3SDDD 2EEAA 2BX5A 4DN3H 1S7SA 3RGVB 2GIYA 1F4YL 1A21A 3QIBD 4P2QB 1XMWA 1MVUA 1G9MC 7FABH 2VLRE 3CFJA 1GC1H 5GRXG 5KVMC 4Y4FD 4LVNC 5C0EB 3IU4H 4I18B 4KRPC 4RMUA 5IQ9A 3UJJH 2CD0A 2ADFL 4HUVA 1NGQL 2J6EL 5DD6B 4XTRD 1PX4A 1U8JB 3QJHB 1UJ3C 1GGYA 3V6ZA 3LEVL 1F6FB 1TZHA 3EIFA 3U9UA 1FYTA 2GJJA 3BDYH 3QUXD 4PB0L 4JQIH 5I17B 1A6UL 4XZUA 4GKNB 4XCEB 4G9FB 3GMRA 4ZXBA 1YUHA 3P30H 4PJHA 1OQXA 4ZDHB 4WHYG 4UV7H 4X7SH 3CC5A 1EPFA 5FA3A 3U46B 5FYJE 5ITBH 4WRLA 1UJTA 4NUJA 2Z91A 4LSQH 4U1SB 1IEHA 1G7PB 2X41A 5AZEH 1CXEA 3SDAC 5L88L 3PV6B 3TZVA 2W60A 4ONFH 4X6DF 1CK0L 3BD3A 2LABA 2A9NH 4XNMB 2LU3A 5EZOH 1CD1A 3WEXB 5IWLC 4W4OA 1PG7L 1EHXA 1I1YA 3OGCA 4G6AC 4GMSL 5D7KE 1HK6A 1EERB 1RJLA 4ZD3L 5EOCJ 2J8UA 2ADIB 2ATPA 1BQSA 4QRSB 2YZ1A 4HC1L 4C58B 1A6VL 5EA0L 2E9JA 1P2CB 5BVPH 1EEUA 1Y6KR 2I9LA 1FV1B 3MRFA 3RQ3A 4AQOA 3N85L 3ZHKA 3EYSH 2C3VB 3NCJL 2FHFA 3OMZA 4HFWB 4KK5C 5B38B 2V9RA 3WJJA 3MRIA 4PP2B 5D2NA 3EYOA 2DQIL 4MJIB 1CXFA 5J1SC 5CJ8A 2NY1D 1IFHL 2F5BH 1INDL 4X5WA 3P9MB 3S97C 5DJYB 5J0BA 1NBZB 4NQDE 2DTMH 1WT5C 3TP4A 5DVMA 5F3HA 1U8HB 1QR1B 1NEZB 4MDIA 4JQVC 1NCBL 2QLVB 1NBVL 5JW5A 1TDQA 1KLGA 1U8IA 5KVGH 4QRRD 4WWID 3IDNB 1NGQH 3WS6A 2UUDK 4X7TB 4OV6F 3CZFB 2YUZA 4EVNA 3O3AA 1JIBA 4QRRA 1FRGH 4OM1L 3W9DB 5ADPL 4P9ML 3L3GA 1A7QH 4ZYKB 3V6FB 5AD0B 4UT9H 5I1IL 4JM2A 4LVOB 3DIFB 3GJEB 5B3NA 2Z92B 4OAWB 1FNSL 2H3NB 5K9QI 3I6GB 3LN5B 2OL3L 3MYJA 4NBYB 3EFDH 1YMHB 4OCLC 1RIHH 1ZT1B 3QUYC 3DV6A 2OS7A 4QHLA 2FCBA 3QDGE 4JFPB 3QUMA 2E7CA 1M05A 2E27L 1RHHA 4PS4L 4XGZB 4ODHH 2JJSC 2BOBA 2XG4A 1S3KH 2OSLA 1BZ7A 3BISA 4KWUA 3RVXD 4OGXL 1BFVL 4KJQD 4QTIL 4OUUB 5C0RH 4X5XB 2XKSA 4NGHH 4AQ1B 3HE6C 3WDHA 1BIIA 2XOTA 1UENA 1PY9A 4JO1L 1MIML 1BQUA 3ZE2E 1CFSA 4ZD3H 1UA6H 5FUOH 3NPSB 3L1OL 4PJXF 3V0VB 2Q20A 2WWKT 2YD4A 4JKPL 3K74B 3LB6D 1A6VH 3LHPL 4KV5E 4DZBA 1CDYA 4ZTPL 3B2VL 1TPXC 3M1BA 5EZLB 3TJEL 3N85H 4ZQKA 4GKZB 4TN9A 4JFDA 1YY9C 1YY8B 4NC1C 4OZHF 5L8JB 5T1DH 4Y4HB 4JE4B 5L8LB 3KAAA 1I7UB 2GAZB 1JPFB 43CAA 4UTBH 1AO7B 1WJ3A 3QZWA 4FQQB 3VXMB 2FZ3A 3MA7A 5HPMA 3ARYA 3AMKA 2AABH 5F9OH 4GFTB 1BD2D 3SOBL 3W39A 1FZJA 5L2KE 1HHGA 1CICD 3UO1L 5BV7H 4Z95H 3S36X 1WFTA 4APQB 5HHXL 4Z6AT 3I2CL 3LN4A 4WO4D 5AEAA 1R3KA 2AK1H 3DHJA 1H9VA 3OZ9H 1ETZB 4KMTH 5DUPH 4QLRA 4G3YL 1HKFA 4L3EE 4WO4A 3QHTC 5AYUL 5CUSL 4P9MH 3GJFB 5ITFA 1ODAA 1IGTA 2EIDA 1U8PA 5DZLA 3TH4T 3ZYZA 4XP1H 5H35A 1NC2B 4MQXD 3CXHK 1NUFA 1R3HB 1TETL 2DMBA 2R0LL 4M00A 4M43L 4LVNB 3O4LB 3FT3B 4KRPB 5IEKA 4G80A 1KGCE 3N1GC 3MRGA 2A6IB 1OSZA 4KQ3H 5BJTA 4BSWA 1UZ8A 2J2ZA 4OBRA 3PHSA 1TENA 1P9MC 2JJUA 4ODBD 2CGRL 3NFSL 2G60H 3F58H 2XZAH 1UJ3B 5C6TL 4RMWA 5DT1H 2IAMC 2ENSA 2NXZD 4LSSH 2Z35B 1KJ3L 1OAKL 3D39D 5D2LE 4OGXH 1OPGL 2RFXA 5L8KB 4QRQA 4AMKL 4OD2A 3J7HA 5GSRB 4DEPC 4E41B 2WANA 3P2TA 3D39A 3U2SA 4K3HA 3C60D 3DX7A 1KCUL 1NLBL 3LQMA 1FFNA 4ZFFA 3DHMA 1KIPA 5GRVL 1EEZB 5KS9A 3PP3H 1ZHKA 5K9OA 3C60A 3LHPH 1KJ2B 2ICWA 3SDAB 3B2VH 3O11A 2BNQD 4BSVB 3TJEH 1WZKA 4NKDB 1J1PL 5EPMA 5D7IF 3SN6N 1NGYB 2BDNH 4JRXE 2XY1A 2BNQA 2YKLH 3DUUB 2NX5B 4KKLC 4C56A 2WZPD 4YXKH 4MCYB 4P2CG 4DGIL 3I3BA 4P3CL 3QHZH 5F7WC 2D3VA 3QQ4B 2JCCA 2ID5A 4YHML 2FX8L 1GJIA 4WUUE 1QSFB 3UTTE 4HXAL 1N2RA 1HH6A 1JHLH 5DD5L 4FQHB 4JN1L 4YDKL 2OK0L 5ACZB 4GRWH 5HHVH 1S5IL 4QF1B 2AXGA 3P3YA 1ED3A 1MJUH 1DANT 4P5TD 2Z4QB 4YDLC 1A4KB 3FN3A 5A2IH 3S35H 4HWZB 4U3CA 1Q9OA 3CX2A 4QHNB 3DSNA 4WV1B 7CGTA 4P5TA 1FN4B 2VISA 4G3YH 3D0VA 3WKNA 3EYQC 5C92A 1E6OL 3IKCB 4OZIB 5AYUH 1LE9A 5IB3A 5DQJA 2VXVH 4CW1A 4TULH 5DK0A 3MLRL 1T7YA 2H1PH 3GSQB 1FZOB 2B2XL 5HYFA 3D48R 5GRVK 4OLWH 2YPKA 4N8CL 3VXSA 1A3RH 2ICEB 3P77B 1S7UA 4NQVB 4W6YB 5IBTH 4Q6IA 1SQ2N 4I4WA 4Z5RB 1VPOH 5CZKA 4KKNA 1KB5L 4LHUD 5BRZB 3RWIB 3QDJB 1BVKA 3NFSH 2I60L 3CCHB 5D71L 3V5DB 1NFIB 2A6DB 3W2DH 1AXIB 5E70A 1W0YT 4PGBA 2BY3A 1BX2A 3FHQA 1EAJA 1DVFA 1RIVL 5CEYA 5EC2A 1S9KC 3Q5TA 5C0AA 4KTEH 1DSFH 1OPGH 4PRPB 4KHXH 1A6WH 1ADQA 2MKLC 3QUYB 3C2AH 4JVPA 3WHE0 2X9XA 2EYTA 1J0JA 1XGUB 3GSOA 4R4ND 3VE0B 3GK8L 4DN4H 4F3FB 1NLBH 4FP8L 4TVPL 3IAQA 4PJEF 3V4PH 5IR1B 3SE9L 2WUCL 3N1QC 4HKBA 3T0BA 3FB8B 1M7IA 5DRZB 4ENEC 4C83A 4ISVA 1LP9A 3DX6B 2A0LD 4R2GD 5CD3A 1F4XH 4X4XB 3DUSA 3T0EE 2Q3ZA 4ODUA 3HE6B 2CDGA 4QHMB 3G5XB 1AR1C 4XPFH 3BPOC 5ILTH 2Q7NA 2ZSVA 2VE6A 4RMRA 3DGGB 5D1ZC 3U82B 2FX8H 1U3HC 1YEHH 2VIRB 5CFHA 4L9LC 3BRFA 1TPXB 1NBQA 4JFQB 4I9WE 3SQBA 1CI5A 1OM3H 3RUGE 4UT7L 1E28B 4QOKB 2L7UA 1ZANL 4PIRF 5GZND 3FB6A 2ZCHL 5EU4B 1YECH 3DYMA 2NY2D 4R4BB 1FNEA 3NFNB 3ZYIA 1OAXH 4JKWA 3MOAL 3WFHA 3VW3H 2H6PB 3OL2A 1WK0A 1JF1A 1RJYA 2VDQL 1AHWA 4AEIH 3VCLA 5J6GA 1OP3H 4FMKA 1R24B 4LMQI 4LQ1A 5C2UB 1KYOJ 1QLRA 4ZUUB 1JHKH 4U1GC 5INCA 3OHXA 4PJAE 5CBAB 1F6LL 3MOBH 3RKDD 2BVOA 3QEQD 4N9GB 1I9RL 1T66C 5FXCH 3CFDA 3SJVB 3CH1A 2YD2A 3NAAL 4W4NA 2LVEA 2DM7A 2DBJA 3QEQA 4CN4A 3P9WB 4Z76B 1EDQA 1WV7T 1YNTB 4O51B 4Q0XL 4N0FB 4JVUA 3PXJA 5TDOA 5IJKA 4POZD 3BKYH 1VFAA 5CSZA 4UDTA 2QSCH 5F1OB 5CMAB 1L6ZA 3OKMB 1G6VK 1NAKL 3KXFE 4W6XB 3ZL4L 1Z9MA 3TH3T 3GFUA 4ODXA 1NMAH 3SPVB 1G7HB 3C5ZD 4H0GA 4QRSA 3TGXA 1LEKB 1HI6A 1BVLA 2IAMB 4OFVA 2ZOKA 4MXWH 2IQ9L 3TBSB 4DVBB 1CR9L 3TIEB 2O5XL 2JELL 5EUOA 1U8QA 3KYAA 4N1HB 2EXWD 4MJ6A 2IBZY 5I76B 4M5ZL 3BKCL 2MQ0A 4DEPB 2F58H 3FQXB 5I30H 5EBLB 1XCTA 1OVZA 3EDKA 5IHZA 2PYEA 3WHXA 1QO3A 1X5HA 1YQVL 3HNVL 1JWUA 4I77L 5D7LE 4E42A 4L4TE 1XF4A 1WAAF 2IH3B 1N0LA 3C08L 3C8KB 5FO7B 1FL3A 2XZZA 2OP4L 4O2FA 5E00B 3LPWA 3RX8A 4Z7UB 2X1WL 5ALBL 4Z7OE 4ZPTA 1UM4L 5FYJH 3H9SA 4HWEH 4M1GL 3CLFL 2BXZA 1LDSA 2CSPA 4J3UA 1PJ9A 2VWEE 2E6QA 3HMXL 3MO1B 1W72B 5DWUL 4OB5L 2DBLL 5KN5A 4PP1C 3VGFA 2EE2A 2VABA 4D9RE 5E99L 1NKOA 5J9PA 3K2MC 1FE8L 2BVQA 5DMIH 3S35X 5EWIH 5F7EL 3I6GA 5MENA 3O2WH 4G7YL 4M7ZC 3VXTB 4ETQB 4YDLB 1IILE 2QQQA 3HE7D 2CLZB 1LWRA