5DLOA

S. aureus mazf in complex with substrate analogue
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
PIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition, regulation mechanism and activity regulation of MazF mRNA interferase.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 35
structure length 114
sequence length 114
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dloA00
2VUBA 5CKHA 4MZPA 5CO7A 3G7ZA 5CQYA 3JSCA 3VUBA 3JRZA 5CQXA 5HK3A 2C06A 4HKEA 5CR2A 5CCAA 5HK0A 4VUBA 1NE8A 4ME7A 5HKCA 4ELZC 4MDXA 4OF1A 5DLOA 4MZMA 1X75C 2KMTA 3TCJA 4ELYC 3HPWA 5CK9A 3NFCA 4MZTA 5CKBA 1M1FA 5CKFA 1VUBA 5CKDA 5CKEA 2MF2A 1UB4A
chains in the Genus database with same CATH superfamily
1K0SA 2DL8A 2ENMA 4ANJA 3I56Q 4M7AE 1KQSP 1YJ9A 3QYGB 4XTYA 3WVEB 3M54A 4JUVA 2LQNA 2YWWA 3PIPA 3CCVA 4HKEA 1WPYA 3JAME 4RG2A 5C6SA 1YIJQ 4JZ4A 4C8QD 3GNGA 2RM4A 1RACB 2CP7A 3QDRB 1UHFA 2DVJA 2CP0A 3QDFA 4BE0A 4C5EA 1PRLC 1DJ7B 1UGPB 2VGNA 5LJ5h 1U5SA 4FT4A 1AWOA 2WSFE 3CC2Q 4F04B 4M77B 2EGCA 1AWJA 4JJDA 1R0CB 4PJOD 4DEYA 2E3IA 1ZHIA 3A8LB 4M7AA 2GFUA 1OPLA 1M90U 1UB4A 1UJ0A 1MMAA 4RG8A 2E41A 2J6FA 4J6YA 2LP5A 2A7YA 2F2WA 2E10A 4X34A 4M7AC 5CCAA 3CCST 4D8KA 3FEOA 1KQ2A 2RB6A 2LDMA 4C0FA 3OYFA 3OA6A 4IURA 3G6ET 1KHIA 4ZN3A 2DX1A 5LL6S 4J9BA 3CD6Q 1S72A 2KR3A 1MNEA 1FMWA 4M78C 4E7LA 4FYVB 2X4YA 2C06A 3MEAA 1YJ9Q 1ACMB 1M3BA 3VU3C 1YI2A 3CCLA 2Z0WA 3SWNB 4N4GA 4BE1A 1EX4A 2XMFA 4X1VA 2YLCA 5A2QE 3UDCA 3VJPA 1BU1A 4A4HA 2FRWA 2FVUA 1B34A 1YJ9T 4RTYA 1Y71A 2QQBA 4Z02A 1RADB 3KUFA 1WHMA 2MYSA 4B9XA 3A8OB 3OYHA 3C0CA 3RKWA 3CCQT 2JW4A 1OV3A 2DXBA 3MKDA 4AFQC 3RDVA 1W6XA 5GAOr 4RUGA 3VS2A 3CXCP 2PZ1A 1RLPC 2WACA 2O9SA 1K9AA 2P84A 4OB0B 2D1XA 2RI5A 2LJ3A 4M7DB 3KBGA 1VQ5A 2XDPA 2HL3A 5KE2A 1VA7A 3OBYA 1SRLA 3CMEQ 1K9MU 1G3TA 3EFSA 3OYJA 1QCFA 5GAN3 4F14A 2DBKA 3M0SA 2RHXA 1KQ1A 4BI3A 3H0FA 1RAHB 1WJRA 2J05A 4RTWA 1YHQQ 3JCMQ 3JCMX 3EHQA 5GANd 2XK0A 1NEBA 1T0HA 1UJYA 4VUBA 2EJ9A 4ME7A 4OF1A 3J81E 3A8MB 4JRIA 1QKXA 2AIRB 2DTHA 4PK4A 4RTUA 2KRSA 3JCMc 3M0QA 1BCOA 2XD0A 3FJ5A 1TUDA 1PRMC 1BBZA 2ZCFB 3OYAA 4AMCA 2JS2A 3EFOB 4A4KA 2Y90A 1UGRB 4DEXA 1YHQT 2OTLQ 1VQ9Q 4M75F 4HA8A 1B3QA 3CMAT 3RIRA 1EFNA 1BIBA 2E4HA 3SHWA 3QO3A 2DIQA 2KE9A 1SEMA 1T0JA 2HSEB 4BB7A 4IKFA 2DTOA 4MZPA 1M2VB 1YIJT 1Y0MA 2NUZA 1K73C 3L2ZA 2V1RA 2KYBA 1U1TA 2D6FA 3PNWC 1Y07A 4NOYA 4PNOA 2LQKA 1M3CA 2OTJT 1QVGS 4FW2A 1NYFA 4E7KA 3CPWP 4DOWA 4DOVA 3NTHA 3EG1A 2DYBA 5LJ3f 5GAOq 3CC4Q 4M75E 2HQHA 3CXCA 2RHYA 1VQ7A 2LMJA 4C0DB 3O8VA 2E5KA 1KK7A 3V7CA 1N8RC 1I0CA 3I55T 4LNPA 3CCUT 1XQHA 2Y4YA 5I2SA 1ZX6A 1GRIA 3PMTA 4C5HA 4C8QC 2O4XA 3UPUA 2YHTA 2DAQA 3M59A 2FEIA 4A4GA 3CCSA 5CVIA 2QA4A 1K8AC 2XKOC 5LJ5e 1WGSA 2GQVA 5GAOp 1PKSA 4A63B 2DM1A 3GIBA 3DLMA 4N4HA 1E7OA 4PJOE 2XDDA 2DXUA 1X2QA 3QKJA 2NLUA 4K11A 5FWCA 3V8LA 2D9TA 2DPPB 1IGQA 5DLOA 5FU7C 1RI9A 2RH2A 3EGUA 2P0PA 2QA4Q 2O9VA 5L23A 2K3XA 2MCNA 1AVZC 3MPUB 5KCOA 4QQDA 2RK2A 2KGTA 3JCMf 2RHIA 2GQIA 1NJIC 1TUCA 5FRNA 3NPFA 1VOMA 4M77G 1KIKA 2MAMA 4MMKA 2PTKA 1WXBA 4BE2A 2FRYA 4J9CA 3BFMA 2ZPEB 1PD1A 1RABB 2K5LA 4LDXA 3EGXA 1PSEA 1BKBA 3UT1A 1H8KA 3HFNA 4ZN1A 1ARKA 4YTLA 2QTXA 5GMKe 2EKOA 1PWTA 2EQUA 5IHNA 1VQ7Q 4OMMA 3AT1B 3HSBA 2NUPA 4JLGA 2VXFA 3RESA 1WXUA 5CK9A 2QQ9A 2JM9A 5IN1A 2RNAA 4KUIA 3P8DA 3KFVA 4OMOA 5D7UA 1UGSB 4MDWA 2VXEA 1ZSGA 1NYGA 8AT1B 2EGEA 2Y4XA 3RMQA 1PM3A 1YJNA 3QYHB 1MGQA 1VYVA 4XTVA 5I11A 3OYIA 4ZGJB 1R8OB 4XAXB 2EKHA 2PVGB 2QG9B 2PVOB 4BI4A 1G3SA 2P4RA 3VS3A 4J7IA 4Z88A 1WQWA 5EC7A 3RERA 5HY6A 1FWZA 2A08A 5J3BA 5GANe 1VQNA 4XTXA 1AHJB 4KH1B 2MOXA 1WIEA 2WSCE 1X27A 4J7FA 3A5ZB 1VQOA 4LDYA 4C0DC 5FW9A 4PLLA 1VQLT 1X69A 2BUDA 2CUDA 2XIDA 5HKCA 2DD5A 3I9QA 3X28B 4M75C 4MDXA 1QVFP 5I21A 2DTIA 2EJGA 1XNIA 4XTZA 1K76A 2AK5A 2XG8D 1VQOQ 2A3LA 2J06A 2X3WD 1D1BA 2C0IA 2LNVA 5GAN6 2J6KA 4RTTA 5KYWA 1RI0A 2FPEA 3I55Q 1VQLA 1AZGB 1QMCA 2JVVA 4F17A 1ZUKA 2RK1A 2FZCB 2DXCA 2G3RA 1BIAA 3INZA 3MP8A 2NUTA 3OYCA 4ZGDB 1F1BB 1WA7A 2FPDA 1QVGA 4J9EA 1PHTA 1W2BP 2L3RA 3UF4A 3X24B 2XHCA 2CZ1B 5GAMg 2K6DA 2K9GA 1RUWA 4M7DG 3V8JA 5D6YA 5A0LA 3SD4A 1GFDA 4PFZA 4M7AD 4WF2A 3ZBDA 4J83A 1M3AA 1LPLA 2YT6A 2FYKA 4BACA 1M1KC 2YUOA 3FLGA 2GTJA 4ZGEB 2E6ZA 3MJXA 3EGXB 4FYWB 1D0XA 4F16A 4J6XA 1JXOA 2L3QA 2BZ8A 1NE8A 1PG5B 1NLOC 3D7SB 3GOXA 4LE9A 4M75D 2VKNA 2RF0A 3FB9A 2ATCB 1VQ8A 1MNDA 1OU9A 2D0QB 2ECZA 2R57A 1VQ5T 3H6ZA 4LDWA 3VV0A 3WVDB 5GAMj 4J5YA 1VQPQ 4N4IA 2KT8A 3QPHA 2QGFB 1T3SA 5IHKA 4PLIA 3CCRA 3L2RA 4QQGA 2SEMA 5CAIA 1W1FA 4J9FA 3H8ZA 1Q81C 2JTFA 5J39A 2HBPA 4M7DD 1VQ7T 4M77C 2QEXA 1VQMA 1N27A 1VQ6Q 1OZ2A 3G4SA 2C0TA 5HK3A 2L8DA 3N5BB 3H41A 4LD9K 1ZSZA 5KE3A 2EW3A 2JOYA 3NTIA 1AWXA 3JB9G 2HQEA 1X6OA 3BE3A 5GMKl 1R0BG 2R5AA 3PFSA 4R56A 3J7AF 2K3YA 2GNCA 4M75G 4X9CA 2YUQA 5KYYB 2A37A 2BE9B 3GLXA 1WJQA 3CCQQ 3QZ9B 2YRCA 2LQ8A 2LT4A 2CSQA 2O31A 2B8AA 4C5GA 3LLRA 4XTUA 4E7SA 5I22A 1VUBA 4C5IA 4BY6C 1WFWA 2VUBA 4PL6A 1BI1A 2K79A 4M7AG 2KNBB 2V8KA 3JRZA 3QSUA 2K7AA 2X9HA 3CPFA 4EMKA 4PJOF 1KQSS 4FSXA 1JQQA 1BK2A 1K73R 4AFUC 2EJFA 3CCUA 2CDTA 3FRNA 2COZA 3CQTA 1BB9A 5D6WA 4QT7A 2CKKA 3SEMA 2RPNA 5FU6C 1HJDA 4IUPA 1OEBA 4Z8AA 1NG2A 3CD6A 1W2BS 3OSSC 4C8QB 4RCCA 1M30A 2P0QA 2BZXA 3OS2A 1D3BA 1JJ2P 2L5QA 4LDVA 1YJWA 4E47A 2CT4A 4JRQA 2PNIA 1SSFA 4OB3B 2DRMA 1QVFA 1UFFA 5CQXA 2QASA 3QJYA 4HXJA 2DVEA 4D6WA 4XU1A 1PCXA 2O2OA 1QLYA 2DBMA 4D8DA 1NEGA 1FX7A 1WHLA 1G2BA 3CCEA 2LCSA 1GBQA 1SRMA 3G71A 2OTJQ 4DBQA 1UGVA 1KFZA 1V1CA 1G83A 4IIOA 1G3WA 1JU5C 1WQ7A 1NPPA 1ZA2B 3ZEHA 1AOJA 3OQ5A 4C8QF 2FL7A 2LJ0A 1XOVA 3DB3A 4OB2B 1OX8A 1T3LA 2AZSA 3VS5A 1JEGA 1HD3A 4LD6A 2F5TX 1NBEB 2MK5A 1I4K1 2I0NA 3BDLA 3QWYA 1YITQ 4J8OA 1I07A 3REAB 3CCRT 2FPFA 3OYKA 1K0XA 4M4ZA 4CC4B 5GAOl 2AT1B 3CMAA 3OB9A 3CEYA 4HCBA 4C8QE 5AYFA 4C0GA 2EYYA 2EYZA 1JJ2A 3CCQA 1VQ8T 2ABLA 4PJOG 1NJIR 3OW2S 1ZUYA 3KXTA 1PSFA 1KD1R 1UUEA 2FZKB 2KEAA 2DD4A 5GJVB 3EHRA 4PJOC 3J80E 2DZCA 2MF2A 3TVTA 4C92E 4OMPA 1SPKA 1YIJA 1ZQ1A 3MP1A 2HKQB 1R77A 1VQPA 5CIUA 1TXQA 4XU2A 4M7AB 2V1QA 1QKWA 2DA9A 1S72T 2LJ1A 3CBPA 3S3MA 2NWMA 2E12A 1K73U 1Q86U 4M78D 3CC7A 2M1HA 3OBWA 3G71T 3UA6A 4KRTA 4C92G 3OYGA 1YCSB 1VQKQ 3EG0A 5L8RE 4B6MA 1LNXA 2EVRA 2JTMA 3CBMA 2W10A 3X26B 1GFCA 2ZAEA 3VUBA 2JS0A 2IVWA 4M75B 2DERA 3HKSA 3URGA 1RL2A 3CCMA 4ATOA 2DFUA 3CC7Q 1NLPC 3QBYA 2LNHB 3PIOA 1PKTA 4HCZA 5LJ5f 2CP2A 5CKDA 3JCMP 3H0HA 3E2UA 2EQMA 4XK8E 3EGDB 1KC8U 1O75A 4A4FA 3DB4A 5FU7B 5GMKi 1V29B 5IT9E 1KD1C 4JPBW 2YRDA 3CCEQ 1D0ZA 1U3OA 1Y57A 1WX6A 4F7UA 3HRSA 1U06A 5LJ3e 4KGXB 3LH5A 4LXCA 3OMCA 5GANf 4M7DA 3OS0A 2X35A 3MEVA 3QIIA 2LCLA 4EMHA 1RAEB 2JTEA 3QG1A 2RI2A 3CC2T 1ZUUA 3L2WA 4M7DC 3VRYA 1NPRA 2EGAA 4R0KA 1MV3A 1K4US 1K9MR 3CXCS 2PVDB 2J6OA 1FMVA 1RAGB 1VQNT 2BIVA 1TTHB 1X75C 1ZBJA 2L2PA 2M0YA 4AFZC 1H3HA 2GF7A 1OULA 3I55A 5KYNA 2NUTB 2VC8A 4GLMA 1VQ4Q 2KSSA 3OYYA 2DO3A 1M90R 4M77F 2IG0A 1TUGB 3I5SA 1VQNQ 1WHGA 1UEBA 1VQ5Q 5KYWB 2EFIA 4J6WA 4NL2A 2CH4W 1VQPT 4WTOB 4LDUA 2EQJA 3V8KA 4FM4B 1Z9ZA 4FYXB 4JLIA 5CQYA 1JJ2S 2F1LA 2M0OA 4OGEA 5DY9A 2K5FA 2K4YA 2DKGA 2EQIA 1KD1U 4XQ3A 3SB2A 3G4SQ 2CREA 2CGHA 2E1HA 4NL3A 5KYYA 4KH0B 1NZ9A 4OMNA 2CS7A 2F2XA 4FL6A 2RQVA 1VQMT 3L42A 2KBTA 2OAUA 5IAYA 3NHNA 3LWIA 4Y92A 2EPDA 2YUNA 4CC3A 4PFPA 1N6AA 3S3OA 1YJWT 3OW2A 3JCMe 1XJWB 2KMTA 2DL5A 1VQ9A 3LX7A 1Z9QA 2XI9A 1Y7XA 4XU0A 1LCKA 3EGDA 5FROA 4E7ZA 4PJJA 2F5KA 5GAN5 2I2LA 4M78B 2CYZB 2RQRA 1GXIE 3VS4A 2M9UA 4PJMA 1YCYA 5AT1B 1CSKA 2L0AA 3CC4T 4J9GA 3JV3A 1D3BB 3S6WA 4JDSA 4RTZA 2DEUA 2V8JA 2OJ2A 4ZNXA 4M78F 1VQOT 2ZPHB 3O5ZA 3RMSA 1QP3A 1YHQA 4PFOA 2CUBA 2RD1A 3JCMV 2RQTA 2E3HA 4HVVA 4NS5A 4J9DA 2DZ9A 2CZ0B 3LW5E 1VQLQ 1YJWQ 2MI6A 3OYEA 2H3EB 5GAN8 1SSHA 1QP2A 1I81A 1ZLMA 3I35A 4JJBA 5KCHA 1ABOA 1M2OA 2HZYA 2RI3A 1U1SA 2E6NA 3CCLQ 1YI2Q 4ELZC 5KYUA 5FLXE 1VQ6A 1IREB 1JO8A 4O5VA 3NFCA 3FJPA 3QHSA 2JMAA 2VASA 3UWNA 3EH2A 2DEQA 4M77E 1M8MA 1G8XA 4A54A 1TS9A 4LUDA 1YWPA 3CCMQ 2F2VA 2M16A 5D6XA 4AFSC 2DJQA 4L5GA 3M57A 2KQWA 1NJIU 1C6VX 1H641 1YITT 1BI2A 4HVUA 1QWFA 2NYSA 1OI1A 2RN8A 4C8QG 2FHDA 3MP6A 3META 4F7UG 4ORZA 2RA2A 1YP5A 1TOVA 3THKA 1OOTA 3EG3A 1KHCA 3OYBA 2LTOA 4FU6A 2DJZA 4Y91A 2YSQA 3LH0A 3OYDA 3CCJA 1U8RA 2DNUA 4ELYC 2EQKA 1M5Q1 2KXCA 1AZEA 3SDZA 4CC2A 2A36A 3DLLA 1FYNA 4CC7A 2LQWA 3JCMb 4PJOA 3HTRA 1G5VA 2MMPA 3PTAA 1D0YA 3E9GA 2H8HA 4GY5A 2DILA 1JXMA 2X4XA 2K3BA 2JNGA 1D1AA 3JB9H 2A0FB 3ULRB 1UE9A 4RTXA 1K1ZA 2QQSA 1Q7YR 1QW1A 3MCAB 3LYIA 1S1NA 1GBRA 1WLPB 3EH1A 4DQ2A 2X3XD 1AT1B 1LOJA 2IIMA 2K57A 3PVLA 4E7IA 5GAOm 3JCMW 1IHVA 2K5IA 3VS0A 1VQKA 2EIFA 2YDLA 1SHGA 1Y96B 3CCSQ 1Q82C 4DBHA 5IH2A 2JN0A 3VS6A 2EYXA 2ZGWA 2DE0X 3Q1JA 2LX7A 1AD5A 1YJNT 2HMAA 2MWPA 3U23A 2LCCA 3CD6T 2PUOB 3P8HA 3G71Q 4UC4A 5FU6B 1RAAB 4EMKB 4EMKC 3FIFA 2D8JA 3C4SA 2DETA 2DIGA 3PMIA 1W2BA 1C1AA 2NUPB 4JJCA 4AT1B 3DKMA 9ATCB 3BY7A 3HP9A 2VVKA 1M90C 2LT1A 1D09B 2KAFA 5LJ3d 3RR6A 2JMCA 1QCOA 2AKKA 4ESRA 2KT1A 3PE0A 5GANg 1VQMQ 3A98A 4IUVA 4LN2A 3CCJT 3NMZC 2CZ6B 1X01A 2DMOA 2VWFA 2CH4A 2JZ2A 2F69A 1BI3A 1ZA1B 1M27C 2AKLA 4C0ZA 2VV5A 1JBMA 4BI8B 2H3JA 5CO7A 4V2SA 1BYMA 1IO6A 1FXXA 2RO0A 2X51A 4EMGA 1OX9A 3H0IA 1IHWA 1ZSZB 1CKBA 1ZSZC 4M78E 4JZ3A 1OQKA 1Q82U 1AWWA 3GF5A 4CI0C 2X4WA 3OSVA 1TH7A 3M0TA 2E64A 3HHTB 3JCMJ 2XDBA 5GAN4 1N8RR 3GP8A 5FWBA 2D8HA 4GLKA 2LRQA 1WJSA 1G3YA 1B34B 1GCQC 3CC2A 2RJCA 4OMQA 5GMKj 1MMDA 4PJLA 2O4XB 3QXEB 2FG0A 3CC4A 4PJNA 4M78G 4EDUA 4HCCA 1VQ4T 3VUZA 3QWXX 1H92A 3I56T 2KVQG 3VRZA 4BD3A 2DL4A 2RQWA 1KSWA 4C92A 1KC8R 3E1SA 5CKHA 3M5AA 1VYUA 1B07A 1UG1A 4E6RA 1I1JA 1WHJA 2LVMA 1YWOA 2L89A 4GBQA 2M51A 1TSFA 4OMFB 1K8AU 2KYMA 3CPWS 2OX7A 1YITA 2QI2A 4AG2C 2D0NA 3ZFJA 2E65A 1MV0B 1BI0A 3JB9F 4PKCC 1M9SA 3FDRA 1I5LA 1TWBA 1X6BA 4A53A 3IQLA 2KK4A 1C0MA 1M2VA 1QCNA 1NM7A 4Y28E 4CRIA 4EIKA 2GFAA 3E9FA 5GAMf 2GBQA 3CMET 2FB7A 5GMKm 1KJWA 2JM8A 3M4YA 5J26A 5GMKh 4FIBA 1HK9A 5CKFA 2BTTA 3EFOA 1V76A 3H9NA 3SWNC 4C92D 1K8AR 3CCVT 1PNJA 3FC3A 2E5QA 1WYXA 3M0UA 2QA4T 1W70A 1YFNA 2V8IA 2HAXA 2COWA 3T9NA 4IUQA 2G6FX 3RKXA 1N9SA 4C92F 1SHFA 2J7IA 1A0NB 2OAWA 3TSZA 2RJDA 1IXDA 1SKUB 1AEYA 4M78A 3MHXA 5C0MA 1VQKT 4ZTJA 3PGGA 4Z89A 1Q86R 1X43A 1TU0B 3OS1A 3GPLA 3V7SA 4R55A 1LVKA 1WHKA 4F7UF 4ZTFA 4F7UE 2QAZA 1P92A 5KH6A 3WXMB 3QJ6A 3L2QA 5GAMd 1WZOA 4QW2A 3RBBB 1HXDA 3JSCA 4KT0E 4N0AA 1E6HA 1BCMA 2YLBA 2YUPA 3G6EQ 2HD0A 2ED1A 1OPKA 4B9WA 4HCKA 2DYIA 4N0AC 5GANh 2YXYA 4HT8A 3A8HB 4X9DA 1M4ZA 2DF6A 4QVCA 3JCMg 3L2VA 2CZ7B 3VYGA 2DRKA 2X4JA 2V26A 1X2KA 8ATCB 4M7DF 2WSEE 2C0OA 1OZ3A 3REBB 1IB8A 3ZL7C 1M1KU 2MPXC 3CCRQ 2JT4A 4QKUA 5HCKA 3UATA 2KRNA 3TQ7P 3CCMT 3SWNA 2P4TA 2ZZDA 4DBFA 3MEUA 4J9IA 2HBWA 1GCQA 4L6V5 3VS7A 2KXDA 5KYXA 1KQSA 2QEXQ 1WNLA 3GBQA 3M0PA 2CP6A 1WHHA 1WI7A 5IXBA 2ZPIB 2EBPA 2ESWA 2LC4A 1J3TA 4FSSA 3L2UA 3GNFB 2HDAA 2OTJA 3SFMA 4E7JA 1YN8A 2P0KA 3BW1A 4JS5A 3CCJQ 1ZBXA 3S3NA 5KYUB 1H3ZA 1UGQB 1UHCA 4P5NA 2ROLA 2DK3A 3A8GB 2L3PA 3LGFA 4RKUE 2KROA 4J9HA 5GANj 4Q5WA 3RKYA 4FT2A 1QVPA 1Q86C 2EAYA 3LWHA 2LZ6B 2XU8A 3G6EA 5GAMh 1MMNA 4QVDA 3QZ5B 3CCET 2PQWA 3HRUA 3M56A 1MMGA 2COYA 2CP5A 3TCJA 1VIFA 4WCIA 2CP3A 2LX9A 3M4GA 1Q7YC 5IHIA 3JB9D 4C92B 3VYHB 2ZPFB 4C92C 2FZGB 1YJNQ 4FW1A 5ECAA 3I5RA 3E19A 5GAOn 1RAFB 4KGZB 1D1CA 2PU9B 3CC7T 5FRMA 1KG1A 5DLQE 3X20B 3TEEA 2KRMA 3VS1A 2QK0A 3CCUQ 4AG1C 1M1FA 3UA7A 1W4SA 2DXTA 2SRCA 3TREA 3OS5A 4M75A 1B7TA 1CKAA 2KI7A 3OYNA 3M53A 3HRTA 2DL7A 2EWNA 6AT1B 1XTDA 1QVGP 3AHUA 1O9SA 4LUEA 1QQJA 5CR2A 3CCVQ 3JB9I 3F70A 2BE7D 1LJOA 5IXFA 4BDZA 3M55A 1Q81R 3M9QA 4QVZA 1EZZB 2GCXA 1RLQC 4HVWA 3R6OA 3ER0A 3PVQA 2HSPA 2ROTA 2A28A 3CPWA 4FCYA 1KC8C 3LGLA 3EG9A 2RJEA 1TG0A 4MMLA 3V7RA 3OW2P 2M02A 3OMGA 1M8VA 3EG9B 4L59A 4RCBA 3HPWA 3CMAQ 4JRKA 1M1GA 3OYLA 2R58A 1IZ6A 5DM7R 3A1PA 3BDUA 1M1KR 2HEQA 1I5OB 1Q81U 4M7DE 4M77A 4O6JA 2HCKA 2VGMA 3X25B 2EYWA 1PC0A 2OTLT 2QDLA 5CKEA 2EYQA 1VQ6T 7AT1B 4EPCA 1UECA 1UTIA 3OYMA 2RMOA 2L3SA 2PUKB 3C95A 1VQ9T 1Y96A 1RAIB 3CMEA 2MWOA 2HNIA 2E70A 1SF9A 2KDSA 1GL5A 2FO0A 2QYZA 2YRVA 3L1AA 4DA4A 3ME9A 4TVRA 2JJ9A 4A4EA 2RQUA 3TU4K 5LJ3h 3HL8A 2QDYB 5EG2A 2QQAA 2R5MA 2MIOA 1N5ZA 2GTOA 2QTVA 1JB0E 4BUGA 1VYTA 2O88A 3RNJA 3ASKA 4IUTA 4BDYA 4OB1B 1VQ4A 3CBOA 4XTWA 4F7UB 3CCLT 1YI2T 4PJOB 1JRIA 1EIFA 2HKNA 1VIEA 4OGCA 2RHZA 2IPOB 1WDXA 3C12A 4BY6B 2VB6A 2ZPBB 1MHNA 3NTKA 1HYOA 4HT9A 1UDLA 1FMKA 4KULA 1OU8A 3QUIA 2QXFA 5I2MA 4XU3A 2ZPGB 3HFOA 1Q82R 2O01E 3EFRA 5HK0A 2CSIA 4JS4A 2BZYA 2DLPA 3EG2A 4MZMA 3MO8A 3M58A 2DL3A 5CKBA 4DBRA 2QQRA 5A0DA 4C8QA 3G7ZA 3RUXA 4KGVB 1MUZA 3G1JA 1YNZA 1N8RU 2HL5C 4KBMB 1YBYA 5KYXB 5LJ3j 1IRXA 5A0GA 2RJFA 4E2FB 1Q7YU 1X6GA 1S72Q 4RMOA 3NGPA 1QWEA 4OVAA 4IUUA 4RTVA 1GCPA 1SG5A 2AZVA 4OP0A 4KUDK 1PD0A 5GAN2 3OY9A 3VKIA 5GAMe 2K2MA 2AHJB 4OMLA 2HQXA 3P8BB 2VYTA 1QVFS 4E7HA 1IGUA 3EAEA 2OTLA 2KY9A 3I56A 2GGRA 4M7AF 3MEWA 2JUFA 2CT3A 4FYYB 4MZTA 3PT9A 1VQ8Q 5LJ3g 2K2VA 3JCMh 2ED0A 5LJ5j 1WXTA 2QGGA 1ABQA 1Q95G 3JCMd 3R6NA 2JXBA 3M0RA 4II1A 2OI3A 2B86A 5M9OA 3G4ST 4M77D 4JJNK 4JRPA 1N9RA 3TSWA 1E6GA 1K9MC 4QQ6A 1OYXA 3JB9J 5GJWB 2QEXT 1I8FA 3C94A 2BKDN 2RHUA 2W0ZA 5LJ5g 2XICA 5GAN7 4IIMA 5LJ5d 1HSQA
chains in the Genus database with same CATH topology
2GF7A 4XTZA 3SWNC 4C92D 3I55A 2XG8D 2VC8A 4M7AE 2A3LA 2KSSA 3OYYA 3CCVT 1YJ9A 3QYGB 2DO3A 4XTYA 4M77F 3WVEB 3M54A 4JUVA 3FC3A 2IG0A 2LNVA 3PIPA 3CCVA 4HKEA 2E5QA 5GAN6 1WPYA 2QA4T 3JAME 1UEBA 4RG2A 1RI0A 5C6SA 1VQLA 2V8IA 2EFIA 2HAXA 4J6WA 4C8QD 3GNGA 4NL2A 3T9NA 2RM4A 4IUQA 4C92F 3RKXA 1N9SA 1VQPT 2JVVA 3QDRB 5GANe 4LDUA 2RK1A 2EQJA 2RJDA 3V8KA 4FM4B 4M78A 2DXCA 2G3RA 4C5EA 4BE0A 3MHXA 1YIJA 4JLIA 5C0MA 1BIAA 3INZA 3MP8A 1DJ7B 5CQYA 4ZTJA 1VQKT 3OYCA 4ZGDB 3PGGA 1UGPB 2VGNA 3OS1A 1JJ2S 5LJ5h 3GPLA 1QVGA 4FT4A 2WSFE 2M0OA 4OGEA 5DY9A 3V7SA 4R55A 2K5FA 4F7UF 4ZTFA 4M77B 4F7UE 2L3RA 1P92A 2K4YA 5KH6A 2DKGA 3X24B 2XHCA 2CZ1B 5GAMg 3WXMB 3QJ6A 4PJOD 1KD1U 4M7DG 4XQ3A 3V8JA 5GAMd 3L2QA 3SB2A 1ZHIA 3A8LB 5D6YA 5A0LA 3SD4A 2GFUA 4M7AA 4M7AD 4WF2A 2CGHA 2E1HA 4NL3A 3ZBDA 4J83A 1NZ9A 1M90U 1UB4A 2FYKA 4QW2A 4RG8A 2CS7A 4BACA 2E41A 4FL6A 1M1KC 1HXDA 3JSCA 4J6YA 3FLGA 4ZGEB 1VQMT 4KT0E 3L42A 2OAUA 4N0AA 2E6ZA 5IAYA 3LWIA 2A7YA 2E10A 4X34A 2YLBA 4M7AC 4J6XA 2HD0A 5CCAA 1N6AA 3CCST 1NE8A 4B9WA 3S3OA 3FEOA 4N0AC 2RB6A 3JCMe 5GANh 2LDMA 3GOXA 3OW2A 1KQ2A 4HT8A 4C0FA 3A8HB 4X9DA 1M4ZA 2KMTA 4M75D 4QVCA 3JCMg 3L2VA 3OYFA 2CZ7B 4IURA 3VYGA 3OA6A 3G6ET 1VQ9A 1KHIA 3LX7A 3FB9A 2X4JA 1VQ8A 2XI9A 1Y7XA 4ZN3A 4XU0A 5LL6S 2D0QB 5FROA 4M7DF 2R57A 1VQ5T 2WSEE 3H6ZA 4LDWA 3VV0A 3WVDB 5GAMj 1S72A 2F5KA 4M78C 4E7LA 1OZ3A 4J5YA 2I2LA 2X4YA 2CYZB 3MEAA 4M78B 3QPHA 4N4IA 5GAN5 1M1KU 2C06A 1GXIE 2M9UA 1YCYA 4PLIA 3CCRA 3L2RA 3VU3C 3CC4T 4QQGA 1YI2A 3CCLA 5CAIA 1D3BB 3H8ZA 3SWNB 4N4GA 3S6WA 1Q81C 3CCMT 4JDSA 3SWNA 4BE1A 2P4TA 2JTFA 2ZZDA 5J39A 3MEUA 2HBPA 4M7DD 2YLCA 2V8JA 5A2QE 3UDCA 3VJPA 1VQ7T 4L6V5 4M77C 2QEXA 4M78F 4A4HA 2ZPHB 1VQOT 2FVUA 1YJWT 1VQMA 1KQSA 1B34A 1WNLA 1YJ9T 1Y71A 2QQBA 3RMSA 1QP3A 1N27A 1YHQA 1OZ2A 4Z02A 2RD1A 3JCMV 3G4SA 3KUFA 5HK3A 2L8DA 2ZPIB 2LC4A 4B9XA 3N5BB 3A8OB 4NS5A 3OYHA 3L2UA 3GNFB 3RKWA 2OTJA 3SFMA 3CCQT 4LD9K 2DXBA 4E7JA 2P0KA 3BW1A 4JS5A 1ZBXA 5KE3A 3S3NA 2DZ9A 5GAOr 1H3ZA 1UGQB 2CZ0B 4P5NA 2JOYA 2WACA 3LW5E 2DK3A 3A8GB 3NTIA 3LGFA 4RKUE 2MI6A 3OYEA 3JB9G 5GAN8 1QP2A 2HQEA 4Q5WA 4OB0B 3RKYA 5GANj 1X6OA 1I81A 5GMKl 4FT2A 2R5AA 3PFSA 4R56A 3J7AF 2K3YA 1QVPA 2RI5A 4M75G 1Q86C 4M7DB 3KBGA 2EAYA 1VQ5A 4X9CA 5KCHA 2XDPA 3LWHA 4M7DA 1VQ6T 3OS0A 2XU8A 5KE2A 2RI3A 3GLXA 3G6EA 1U1SA 5GAMh 2E6NA 1WJQA 4QVDA 3QZ5B 3CCET 3OBYA 3QZ9B 2PQWA 2LQ8A 3HRUA 5FLXE 4ELZC 3M56A 1VQ6A 2LT4A 4C5GA 1K9MU 2B8AA 1IREB 1G3TA 3EFSA 3LLRA 4O5VA 3TCJA 3OYJA 4XTUA 1VIFA 3NFCA 3FJPA 3QHSA 5GAN3 1VUBA 2LX9A 4C5IA 3M4GA 4BY6C 2RHXA 1Q7YC 3UWNA 1KQ1A 2DEQA 4BI3A 2VUBA 4PL6A 1BI1A 3JB9D 1WJRA 4M77E 3VYHB 4A54A 2ZPFB 4C92B 4C92C 4M7AG 2V8KA 3JRZA 3QSUA 3JCMQ 3CPFA 3JCMX 3E19A 5GAOn 4EMKA 5GANd 2XK0A 4PJOF 2PU9B 1KQSS 2M16A 4FSXA 3CC7T 5D6XA 5FRMA 4VUBA 1KG1A 2EJ9A 5DLQE 3X20B 4ME7A 4L5GA 3TEEA 4OF1A 3J81E 3M57A 3A8MB 2EJFA 2KQWA 3CCUA 1NJIU 1H641 4JRIA 1YITT 1M1FA 3FRNA 2DTHA 1W4SA 1BI2A 2DXTA 5D6WA 3JCMc 2CKKA 3TREA 1VQNT 3OS5A 2XD0A 4M75A 1OI1A 5FU6C 4IUPA 2ZCFB 3OYNA 3OYAA 3CD6A 3M53A 4C8QG 3HRTA 3OSSC 4C8QB 1W2BS 2EWNA 2FHDA 3MP6A 3META 1XTDA 2P0QA 2RA2A 4RCCA 4F7UG 3AHUA 4A4KA 2Y90A 3OS2A 1KHCA 1O9SA 1UGRB 3OYBA 1YHQT 2LTOA 5CR2A 4FU6A 1D3BA 4M75F 3JB9I 3F70A 2DJZA 4HA8A 4Y91A 1LJOA 3CMAT 4BDZA 3RIRA 3LH0A 3M55A 3M9QA 3OYDA 3CCJA 1U8RA 1BIBA 4QVZA 4ELYC 2L5QA 2DIQA 3QO3A 2GCXA 4LDVA 1YJWA 2EQKA 1M5Q1 3R6OA 4E47A 4JRQA 4BB7A 4IKFA 3ER0A 1SSFA 3SDZA 2DTOA 4MZPA 4OB3B 1QVFA 5CQXA 3DLLA 3QJYA 1YIJT 2DVEA 4D6WA 3JCMb 1K73C 4PJOA 3CPWA 3L2ZA 1G5VA 2MMPA 4XU1A 1KC8C 1U1TA 2D6FA 3LGLA 3PTAA 3PNWC 1Y07A 3E9GA 4NOYA 4PNOA 2LQKA 2RJEA 4GY5A 4MMLA 3V7RA 2OTJT 1QVGS 2X4XA 3OMGA 1M8VA 2JNGA 3JB9H 4L59A 4RCBA 1FX7A 3HPWA 4E7KA 4JRKA 4DOWA 1M1GA 3NTHA 4DOVA 3CCEA 2QQSA 3OYLA 5LJ3f 2R58A 5GAOq 3G71A 1QW1A 3MCAB 3LYIA 4M75E 1IZ6A 5DM7R 3CXCA 2RHYA 3BDUA 1VQ7A 4C0DB 3O8VA 4DQ2A 1G3WA 3V7CA 1N8RC 1Q81U 3CCUT 3I55T 4M7DE 1WQ7A 1NPPA 1XQHA 2Y4YA 5I2SA 1LOJA 3PMTA 3ZEHA 4C5HA 3OQ5A 4C8QF 2FL7A 4M77A 1XOVA 3DB3A 4O6JA 4C8QC 2K57A 4OB2B 3X25B 2VGMA 4E7IA 2O4XA 3UPUA 5GAOm 2YHTA 2DAQA 2K5IA 3M59A 3JCMW 1VQKA 2EIFA 4A4GA 2OTLT 3CCSA 5CKEA 2EYQA 1Y96B 5CVIA 2QA4A 1K8AC 2XKOC 5LJ5e 1WGSA 4LD6A 2GQVA 2F5TX 1Q82C 5GAOp 2JN0A 4EPCA 3OYMA 2ZGWA 1I4K1 2PUKB 3C95A 3DLMA 3GIBA 1VQ9T 1Y96A 3Q1JA 3CMEA 4N4HA 1YJNT 4PJOE 2XDDA 2DXUA 2MWPA 2LCCA 3BDLA 3QKJA 2NLUA 2MWOA 3CD6T 2HNIA 2PUOB 2E70A 2D9TA 2DPPB 3P8HA 4J8OA 3V8LA 4UC4A 2KDSA 5FU6B 5DLOA 2YRVA 3L1AA 5FU7C 4EMKB 3CCRT 2RH2A 4DA4A 4EMKC 3FIFA 3ME9A 3C4SA 2P0PA 2DIGA 3PMIA 3OYKA 1W2BA 4TVRA 2K3XA 3DKMA 4A4EA 5KCOA 3BY7A 5GAOl 4QQDA 3CMAA 2RK2A 5LJ3h 3TU4K 3HL8A 3CEYA 3HP9A 3OB9A 1M90C 2LT1A 2KAFA 3JCMf 5AYFA 2QDYB 2RHIA 4C0GA 4C8QE 4HCBA 5EG2A 5LJ3d 3CCQA 1JJ2A 2QQAA 1VQ8T 2R5MA 4PJOG 1NJIC 5FRNA 3OW2S 1JB0E 4BUGA 5GANg 4M77G 4IUVA 3CCJT 3ASKA 2MAMA 3KXTA 4MMKA 2CZ6B 4IUTA 4OB1B 4BDYA 1X01A 1PSFA 4BE2A 3CBOA 1VQ4A 4XTWA 4F7UB 3CCLT 1YI2T 2ZPEB 3BFMA 4PJOB 2JZ2A 2K5LA 1EIFA 1JRIA 2DD4A 2F69A 4LDXA 1BI3A 4PJOC 1PSEA 1VIEA 4OGCA 2RHZA 3J80E 1BKBA 3UT1A 2DZCA 2MF2A 4C0ZA 3C12A 4C92E 4BY6B 2VV5A 1JBMA 3HFNA 4ZN1A 4BI8B 1ZQ1A 1MHNA 2ZPBB 2H3JA 2QTXA 3MP1A 5CO7A 4YTLA 3NTKA 2EKOA 5GMKe 4V2SA 1VQPA 2EQUA 4HT9A 5CIUA 4KULA 4XU2A 1BYMA 3QUIA 2QXFA 5I2MA 4M7AB 1FXXA 2RO0A 2ZPGB 4XU3A 3HFOA 4EMGA 3HSBA 1S72T 3CBPA 4JLGA 2O01E 3EFRA 5HK0A 3S3MA 2VXFA 2E12A 3RESA 4JS4A 1K73U 4M78E 1Q82U 1Q86U 4MZMA 4M78D 3CC7A 3MO8A 2XDBA 2M1HA 3OBWA 5CK9A 3M58A 3G71T 2QQ9A 4C92G 3GF5A 5CKBA 4CI0C 3OYGA 5IN1A 2X4WA 3OSVA 1TH7A 4KUIA 2E64A 2QQRA 3P8DA 3HHTB 5A0DA 5L8RE 4C8QA 1LNXA 2JTMA 3CBMA 3X26B 5GAN4 3GP8A 3JCMJ 3G7ZA 3RUXA 1UGSB 4MDWA 3VUBA 4GLKA 2IVWA 2VXEA 2LRQA 1WJSA 1G3YA 4KBMB 1B34B 4M75B 1N8RU 1YBYA 3HKSA 3URGA 3CC2A 5LJ3j 2RJCA 1RL2A 5A0GA 2RJFA 5GMKj 3CCMA 2Y4XA 3RMQA 1Q7YU 4ATOA 2O4XB 4RMOA 3QXEB 1YJNA 3QBYA 3CC4A 3QYHB 4M78G 4OVAA 1MGQA 4IUUA 3PIOA 4HCZA 4EDUA 5LJ5f 4XTVA 4HCCA 1VQ4T 3VUZA 3I56T 5CKDA 3JCMP 2KVQG 4OP0A 4BD3A 4C92A 4KUDK 5GAN2 3E1SA 5CKHA 3OYIA 2EQMA 4XK8E 3M5AA 3OY9A 3VKIA 1KC8U 5GAMe 1O75A 1R8OB 4ZGJB 4A4FA 4XAXB 2PVGB 2AHJB 3DB4A 5FU7B 5GMKi 2HQXA 2PVOB 3P8BB 1V29B 2LVMA 2VYTA 1G3SA 4BI4A 5IT9E 1QVFS 2L89A 1KD1C 4J7IA 4OMFB 1K8AU 4E7HA 3CPWS 3EAEA 1WQWA 2KY9A 3I56A 2OTLA 1YITA 2QI2A 3RERA 4M7AF 4F7UA 3ZFJA 3MEWA 3HRSA 5LJ3e 1FWZA 2E65A 2JUFA 5HY6A 3OMCA 5GANf 4MZTA 1BI0A 3PT9A 3JB9F 5LJ3g 2K2VA 5J3BA 3JCMh 4PKCC 1M9SA 2X35A 3FDRA 3MEVA 3QIIA 2LCLA 4XTXA 4EMHA 5LJ5j 1I5LA 1VQNA 1AHJB 3QG1A 4A53A 3JCMd 2KK4A 2RI2A 3CC2T 3L2WA 2WSCE 4M7DC 4II1A 4J7FA 3A5ZB 1NPRA 4LDYA 4C0DC 1VQOA 4Y28E 4PLLA 4CRIA 3CXCS 1VQLT 2PVDB 5M9OA 2GFAA 3E9FA 3G4ST 2BUDA 5GAMf 2XIDA 4M77D 4JJNK 4JRPA 1N9RA 3CMET 2FB7A 2DD5A 3X28B 5HKCA 4QQ6A 4M75C 2BIVA 1OYXA 5GMKm 3JB9J 1K9MC 4MDXA 1X75C 2QEXT 1I8FA 3C94A 2BKDN 3M4YA 5I21A 2DTIA 5J26A 2EJGA 2RHUA 5GMKh 4FIBA 1HK9A 5CKFA 2XICA 1XNIA 5LJ5g 5GAN7 5LJ5d
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUB A;  5CKH A;  4MZP A;  5CO7 A;  3G7Z A;  5CQY A;  3JSC A;  3VUB A;  3JRZ A;  5CQX A;  5HK3 A;  2C06 A;  4HKE A;  5CR2 A;  5CCA A;  5HK0 A;  4VUB A;  1NE8 A;  4ME7 A;  5HKC A;  4ELZ C;  4MDX A;  4OF1 A;  5DLO A;  4MZM A;  1X75 C;  2KMT A;  3TCJ A;  4ELY C;  3HPW A;  5CK9 A;  3NFC A;  4MZT A;  5CKB A;  1M1F A;  5CKF A;  1VUB A;  5CKD A;  5CKE A;  2MF2 A;  1UB4 A; 
#chains in the Genus database with same CATH topology
 1K0S A;  2DL8 A;  2ENM A;  4ANJ A;  3I56 Q;  4M7A E;  1KQS P;  1YJ9 A;  3QYG B;  4XTY A;  3WVE B;  3M54 A;  4JUV A;  2LQN A;  2YWW A;  3PIP A;  3CCV A;  4HKE A;  1WPY A;  3JAM E;  4RG2 A;  5C6S A;  1YIJ Q;  4JZ4 A;  4C8Q D;  3GNG A;  2RM4 A;  1RAC B;  2CP7 A;  3QDR B;  1UHF A;  2DVJ A;  2CP0 A;  3QDF A;  4BE0 A;  4C5E A;  1PRL C;  1DJ7 B;  1UGP B;  2VGN A;  5LJ5 h;  1U5S A;  4FT4 A;  1AWO A;  2WSF E;  3CC2 Q;  4F04 B;  4M77 B;  2EGC A;  1AWJ A;  4JJD A;  1R0C B;  4PJO D;  4DEY A;  2E3I A;  1ZHI A;  3A8L B;  4M7A A;  2GFU A;  1OPL A;  1M90 U;  1UB4 A;  1UJ0 A;  1MMA A;  4RG8 A;  2E41 A;  2J6F A;  4J6Y A;  2LP5 A;  2A7Y A;  2F2W A;  2E10 A;  4X34 A;  4M7A C;  5CCA A;  3CCS T;  4D8K A;  3FEO A;  1KQ2 A;  2RB6 A;  2LDM A;  4C0F A;  3OYF A;  3OA6 A;  4IUR A;  3G6E T;  1KHI A;  4ZN3 A;  2DX1 A;  5LL6 S;  4J9B A;  3CD6 Q;  1S72 A;  2KR3 A;  1MNE A;  1FMW A;  4M78 C;  4E7L A;  4FYV B;  2X4Y A;  2C06 A;  3MEA A;  1YJ9 Q;  1ACM B;  1M3B A;  3VU3 C;  1YI2 A;  3CCL A;  2Z0W A;  3SWN B;  4N4G A;  4BE1 A;  1EX4 A;  2XMF A;  4X1V A;  2YLC A;  5A2Q E;  3UDC A;  3VJP A;  1BU1 A;  4A4H A;  2FRW A;  2FVU A;  1B34 A;  1YJ9 T;  4RTY A;  1Y71 A;  2QQB A;  4Z02 A;  1RAD B;  3KUF A;  1WHM A;  2MYS A;  4B9X A;  3A8O B;  3OYH A;  3C0C A;  3RKW A;  3CCQ T;  2JW4 A;  1OV3 A;  2DXB A;  3MKD A;  4AFQ C;  3RDV A;  1W6X A;  5GAO r;  4RUG A;  3VS2 A;  3CXC P;  2PZ1 A;  1RLP C;  2WAC A;  2O9S A;  1K9A A;  2P84 A;  4OB0 B;  2D1X A;  2RI5 A;  2LJ3 A;  4M7D B;  3KBG A;  1VQ5 A;  2XDP A;  2HL3 A;  5KE2 A;  1VA7 A;  3OBY A;  1SRL A;  3CME Q;  1K9M U;  1G3T A;  3EFS A;  3OYJ A;  1QCF A;  5GAN 3;  4F14 A;  2DBK A;  3M0S A;  2RHX A;  1KQ1 A;  4BI3 A;  3H0F A;  1RAH B;  1WJR A;  2J05 A;  4RTW A;  1YHQ Q;  3JCM Q;  3JCM X;  3EHQ A;  5GAN d;  2XK0 A;  1NEB A;  1T0H A;  1UJY A;  4VUB A;  2EJ9 A;  4ME7 A;  4OF1 A;  3J81 E;  3A8M B;  4JRI A;  1QKX A;  2AIR B;  2DTH A;  4PK4 A;  4RTU A;  2KRS A;  3JCM c;  3M0Q A;  1BCO A;  2XD0 A;  3FJ5 A;  1TUD A;  1PRM C;  1BBZ A;  2ZCF B;  3OYA A;  4AMC A;  2JS2 A;  3EFO B;  4A4K A;  2Y90 A;  1UGR B;  4DEX A;  1YHQ T;  2OTL Q;  1VQ9 Q;  4M75 F;  4HA8 A;  1B3Q A;  3CMA T;  3RIR A;  1EFN A;  1BIB A;  2E4H A;  3SHW A;  3QO3 A;  2DIQ A;  2KE9 A;  1SEM A;  1T0J A;  2HSE B;  4BB7 A;  4IKF A;  2DTO A;  4MZP A;  1M2V B;  1YIJ T;  1Y0M A;  2NUZ A;  1K73 C;  3L2Z A;  2V1R A;  2KYB A;  1U1T A;  2D6F A;  3PNW C;  1Y07 A;  4NOY A;  4PNO A;  2LQK A;  1M3C A;  2OTJ T;  1QVG S;  4FW2 A;  1NYF A;  4E7K A;  3CPW P;  4DOW A;  4DOV A;  3NTH A;  3EG1 A;  2DYB A;  5LJ3 f;  5GAO q;  3CC4 Q;  4M75 E;  2HQH A;  3CXC A;  2RHY A;  1VQ7 A;  2LMJ A;  4C0D B;  3O8V A;  2E5K A;  1KK7 A;  3V7C A;  1N8R C;  1I0C A;  3I55 T;  4LNP A;  3CCU T;  1XQH A;  2Y4Y A;  5I2S A;  1ZX6 A;  1GRI A;  3PMT A;  4C5H A;  4C8Q C;  2O4X A;  3UPU A;  2YHT A;  2DAQ A;  3M59 A;  2FEI A;  4A4G A;  3CCS A;  5CVI A;  2QA4 A;  1K8A C;  2XKO C;  5LJ5 e;  1WGS A;  2GQV A;  5GAO p;  1PKS A;  4A63 B;  2DM1 A;  3GIB A;  3DLM A;  4N4H A;  1E7O A;  4PJO E;  2XDD A;  2DXU A;  1X2Q A;  3QKJ A;  2NLU A;  4K11 A;  5FWC A;  3V8L A;  2D9T A;  2DPP B;  1IGQ A;  5DLO A;  5FU7 C;  1RI9 A;  2RH2 A;  3EGU A;  2P0P A;  2QA4 Q;  2O9V A;  5L23 A;  2K3X A;  2MCN A;  1AVZ C;  3MPU B;  5KCO A;  4QQD A;  2RK2 A;  2KGT A;  3JCM f;  2RHI A;  2GQI A;  1NJI C;  1TUC A;  5FRN A;  3NPF A;  1VOM A;  4M77 G;  1KIK A;  2MAM A;  4MMK A;  2PTK A;  1WXB A;  4BE2 A;  2FRY A;  4J9C A;  3BFM A;  2ZPE B;  1PD1 A;  1RAB B;  2K5L A;  4LDX A;  3EGX A;  1PSE A;  1BKB A;  3UT1 A;  1H8K A;  3HFN A;  4ZN1 A;  1ARK A;  4YTL A;  2QTX A;  5GMK e;  2EKO A;  1PWT A;  2EQU A;  5IHN A;  1VQ7 Q;  4OMM A;  3AT1 B;  3HSB A;  2NUP A;  4JLG A;  2VXF A;  3RES A;  1WXU A;  5CK9 A;  2QQ9 A;  2JM9 A;  5IN1 A;  2RNA A;  4KUI A;  3P8D A;  3KFV A;  4OMO A;  5D7U A;  1UGS B;  4MDW A;  2VXE A;  1ZSG A;  1NYG A;  8AT1 B;  2EGE A;  2Y4X A;  3RMQ A;  1PM3 A;  1YJN A;  3QYH B;  1MGQ A;  1VYV A;  4XTV A;  5I11 A;  3OYI A;  4ZGJ B;  1R8O B;  4XAX B;  2EKH A;  2PVG B;  2QG9 B;  2PVO B;  4BI4 A;  1G3S A;  2P4R A;  3VS3 A;  4J7I A;  4Z88 A;  1WQW A;  5EC7 A;  3RER A;  5HY6 A;  1FWZ A;  2A08 A;  5J3B A;  5GAN e;  1VQN A;  4XTX A;  1AHJ B;  4KH1 B;  2MOX A;  1WIE A;  2WSC E;  1X27 A;  4J7F A;  3A5Z B;  1VQO A;  4LDY A;  4C0D C;  5FW9 A;  4PLL A;  1VQL T;  1X69 A;  2BUD A;  2CUD A;  2XID A;  5HKC A;  2DD5 A;  3I9Q A;  3X28 B;  4M75 C;  4MDX A;  1QVF P;  5I21 A;  2DTI A;  2EJG A;  1XNI A;  4XTZ A;  1K76 A;  2AK5 A;  2XG8 D;  1VQO Q;  2A3L A;  2J06 A;  2X3W D;  1D1B A;  2C0I A;  2LNV A;  5GAN 6;  2J6K A;  4RTT A;  5KYW A;  1RI0 A;  2FPE A;  3I55 Q;  1VQL A;  1AZG B;  1QMC A;  2JVV A;  4F17 A;  1ZUK A;  2RK1 A;  2FZC B;  2DXC A;  2G3R A;  1BIA A;  3INZ A;  3MP8 A;  2NUT A;  3OYC A;  4ZGD B;  1F1B B;  1WA7 A;  2FPD A;  1QVG A;  4J9E A;  1PHT A;  1W2B P;  2L3R A;  3UF4 A;  3X24 B;  2XHC A;  2CZ1 B;  5GAM g;  2K6D A;  2K9G A;  1RUW A;  4M7D G;  3V8J A;  5D6Y A;  5A0L A;  3SD4 A;  1GFD A;  4PFZ A;  4M7A D;  4WF2 A;  3ZBD A;  4J83 A;  1M3A A;  1LPL A;  2YT6 A;  2FYK A;  4BAC A;  1M1K C;  2YUO A;  3FLG A;  2GTJ A;  4ZGE B;  2E6Z A;  3MJX A;  3EGX B;  4FYW B;  1D0X A;  4F16 A;  4J6X A;  1JXO A;  2L3Q A;  2BZ8 A;  1NE8 A;  1PG5 B;  1NLO C;  3D7S B;  3GOX A;  4LE9 A;  4M75 D;  2VKN A;  2RF0 A;  3FB9 A;  2ATC B;  1VQ8 A;  1MND A;  1OU9 A;  2D0Q B;  2ECZ A;  2R57 A;  1VQ5 T;  3H6Z A;  4LDW A;  3VV0 A;  3WVD B;  5GAM j;  4J5Y A;  1VQP Q;  4N4I A;  2KT8 A;  3QPH A;  2QGF B;  1T3S A;  5IHK A;  4PLI A;  3CCR A;  3L2R A;  4QQG A;  2SEM A;  5CAI A;  1W1F A;  4J9F A;  3H8Z A;  1Q81 C;  2JTF A;  5J39 A;  2HBP A;  4M7D D;  1VQ7 T;  4M77 C;  2QEX A;  1VQM A;  1N27 A;  1VQ6 Q;  1OZ2 A;  3G4S A;  2C0T A;  5HK3 A;  2L8D A;  3N5B B;  3H41 A;  4LD9 K;  1ZSZ A;  5KE3 A;  2EW3 A;  2JOY A;  3NTI A;  1AWX A;  3JB9 G;  2HQE A;  1X6O A;  3BE3 A;  5GMK l;  1R0B G;  2R5A A;  3PFS A;  4R56 A;  3J7A F;  2K3Y A;  2GNC A;  4M75 G;  4X9C A;  2YUQ A;  5KYY B;  2A37 A;  2BE9 B;  3GLX A;  1WJQ A;  3CCQ Q;  3QZ9 B;  2YRC A;  2LQ8 A;  2LT4 A;  2CSQ A;  2O31 A;  2B8A A;  4C5G A;  3LLR A;  4XTU A;  4E7S A;  5I22 A;  1VUB A;  4C5I A;  4BY6 C;  1WFW A;  2VUB A;  4PL6 A;  1BI1 A;  2K79 A;  4M7A G;  2KNB B;  2V8K A;  3JRZ A;  3QSU A;  2K7A A;  2X9H A;  3CPF A;  4EMK A;  4PJO F;  1KQS S;  4FSX A;  1JQQ A;  1BK2 A;  1K73 R;  4AFU C;  2EJF A;  3CCU A;  2CDT A;  3FRN A;  2COZ A;  3CQT A;  1BB9 A;  5D6W A;  4QT7 A;  2CKK A;  3SEM A;  2RPN A;  5FU6 C;  1HJD A;  4IUP A;  1OEB A;  4Z8A A;  1NG2 A;  3CD6 A;  1W2B S;  3OSS C;  4C8Q B;  4RCC A;  1M30 A;  2P0Q A;  2BZX A;  3OS2 A;  1D3B A;  1JJ2 P;  2L5Q A;  4LDV A;  1YJW A;  4E47 A;  2CT4 A;  4JRQ A;  2PNI A;  1SSF A;  4OB3 B;  2DRM A;  1QVF A;  1UFF A;  5CQX A;  2QAS A;  3QJY A;  4HXJ A;  2DVE A;  4D6W A;  4XU1 A;  1PCX A;  2O2O A;  1QLY A;  2DBM A;  4D8D A;  1NEG A;  1FX7 A;  1WHL A;  1G2B A;  3CCE A;  2LCS A;  1GBQ A;  1SRM A;  3G71 A;  2OTJ Q;  4DBQ A;  1UGV A;  1KFZ A;  1V1C A;  1G83 A;  4IIO A;  1G3W A;  1JU5 C;  1WQ7 A;  1NPP A;  1ZA2 B;  3ZEH A;  1AOJ A;  3OQ5 A;  4C8Q F;  2FL7 A;  2LJ0 A;  1XOV A;  3DB3 A;  4OB2 B;  1OX8 A;  1T3L A;  2AZS A;  3VS5 A;  1JEG A;  1HD3 A;  4LD6 A;  2F5T X;  1NBE B;  2MK5 A;  1I4K 1;  2I0N A;  3BDL A;  3QWY A;  1YIT Q;  4J8O A;  1I07 A;  3REA B;  3CCR T;  2FPF A;  3OYK A;  1K0X A;  4M4Z A;  4CC4 B;  5GAO l;  2AT1 B;  3CMA A;  3OB9 A;  3CEY A;  4HCB A;  4C8Q E;  5AYF A;  4C0G A;  2EYY A;  2EYZ A;  1JJ2 A;  3CCQ A;  1VQ8 T;  2ABL A;  4PJO G;  1NJI R;  3OW2 S;  1ZUY A;  3KXT A;  1PSF A;  1KD1 R;  1UUE A;  2FZK B;  2KEA A;  2DD4 A;  5GJV B;  3EHR A;  4PJO C;  3J80 E;  2DZC A;  2MF2 A;  3TVT A;  4C92 E;  4OMP A;  1SPK A;  1YIJ A;  1ZQ1 A;  3MP1 A;  2HKQ B;  1R77 A;  1VQP A;  5CIU A;  1TXQ A;  4XU2 A;  4M7A B;  2V1Q A;  1QKW A;  2DA9 A;  1S72 T;  2LJ1 A;  3CBP A;  3S3M A;  2NWM A;  2E12 A;  1K73 U;  1Q86 U;  4M78 D;  3CC7 A;  2M1H A;  3OBW A;  3G71 T;  3UA6 A;  4KRT A;  4C92 G;  3OYG A;  1YCS B;  1VQK Q;  3EG0 A;  5L8R E;  4B6M A;  1LNX A;  2EVR A;  2JTM A;  3CBM A;  2W10 A;  3X26 B;  1GFC A;  2ZAE A;  3VUB A;  2JS0 A;  2IVW A;  4M75 B;  2DER A;  3HKS A;  3URG A;  1RL2 A;  3CCM A;  4ATO A;  2DFU A;  3CC7 Q;  1NLP C;  3QBY A;  2LNH B;  3PIO A;  1PKT A;  4HCZ A;  5LJ5 f;  2CP2 A;  5CKD A;  3JCM P;  3H0H A;  3E2U A;  2EQM A;  4XK8 E;  3EGD B;  1KC8 U;  1O75 A;  4A4F A;  3DB4 A;  5FU7 B;  5GMK i;  1V29 B;  5IT9 E;  1KD1 C;  4JPB W;  2YRD A;  3CCE Q;  1D0Z A;  1U3O A;  1Y57 A;  1WX6 A;  4F7U A;  3HRS A;  1U06 A;  5LJ3 e;  4KGX B;  3LH5 A;  4LXC A;  3OMC A;  5GAN f;  4M7D A;  3OS0 A;  2X35 A;  3MEV A;  3QII A;  2LCL A;  4EMH A;  1RAE B;  2JTE A;  3QG1 A;  2RI2 A;  3CC2 T;  1ZUU A;  3L2W A;  4M7D C;  3VRY A;  1NPR A;  2EGA A;  4R0K A;  1MV3 A;  1K4U S;  1K9M R;  3CXC S;  2PVD B;  2J6O A;  1FMV A;  1RAG B;  1VQN T;  2BIV A;  1TTH B;  1X75 C;  1ZBJ A;  2L2P A;  2M0Y A;  4AFZ C;  1H3H A;  2GF7 A;  1OUL A;  3I55 A;  5KYN A;  2NUT B;  2VC8 A;  4GLM A;  1VQ4 Q;  2KSS A;  3OYY A;  2DO3 A;  1M90 R;  4M77 F;  2IG0 A;  1TUG B;  3I5S A;  1VQN Q;  1WHG A;  1UEB A;  1VQ5 Q;  5KYW B;  2EFI A;  4J6W A;  4NL2 A;  2CH4 W;  1VQP T;  4WTO B;  4LDU A;  2EQJ A;  3V8K A;  4FM4 B;  1Z9Z A;  4FYX B;  4JLI A;  5CQY A;  1JJ2 S;  2F1L A;  2M0O A;  4OGE A;  5DY9 A;  2K5F A;  2K4Y A;  2DKG A;  2EQI A;  1KD1 U;  4XQ3 A;  3SB2 A;  3G4S Q;  2CRE A;  2CGH A;  2E1H A;  4NL3 A;  5KYY A;  4KH0 B;  1NZ9 A;  4OMN A;  2CS7 A;  2F2X A;  4FL6 A;  2RQV A;  1VQM T;  3L42 A;  2KBT A;  2OAU A;  5IAY A;  3NHN A;  3LWI A;  4Y92 A;  2EPD A;  2YUN A;  4CC3 A;  4PFP A;  1N6A A;  3S3O A;  1YJW T;  3OW2 A;  3JCM e;  1XJW B;  2KMT A;  2DL5 A;  1VQ9 A;  3LX7 A;  1Z9Q A;  2XI9 A;  1Y7X A;  4XU0 A;  1LCK A;  3EGD A;  5FRO A;  4E7Z A;  4PJJ A;  2F5K A;  5GAN 5;  2I2L A;  4M78 B;  2CYZ B;  2RQR A;  1GXI E;  3VS4 A;  2M9U A;  4PJM A;  1YCY A;  5AT1 B;  1CSK A;  2L0A A;  3CC4 T;  4J9G A;  3JV3 A;  1D3B B;  3S6W A;  4JDS A;  4RTZ A;  2DEU A;  2V8J A;  2OJ2 A;  4ZNX A;  4M78 F;  1VQO T;  2ZPH B;  3O5Z A;  3RMS A;  1QP3 A;  1YHQ A;  4PFO A;  2CUB A;  2RD1 A;  3JCM V;  2RQT A;  2E3H A;  4HVV A;  4NS5 A;  4J9D A;  2DZ9 A;  2CZ0 B;  3LW5 E;  1VQL Q;  1YJW Q;  2MI6 A;  3OYE A;  2H3E B;  5GAN 8;  1SSH A;  1QP2 A;  1I81 A;  1ZLM A;  3I35 A;  4JJB A;  5KCH A;  1ABO A;  1M2O A;  2HZY A;  2RI3 A;  1U1S A;  2E6N A;  3CCL Q;  1YI2 Q;  4ELZ C;  5KYU A;  5FLX E;  1VQ6 A;  1IRE B;  1JO8 A;  4O5V A;  3NFC A;  3FJP A;  3QHS A;  2JMA A;  2VAS A;  3UWN A;  3EH2 A;  2DEQ A;  4M77 E;  1M8M A;  1G8X A;  4A54 A;  1TS9 A;  4LUD A;  1YWP A;  3CCM Q;  2F2V A;  2M16 A;  5D6X A;  4AFS C;  2DJQ A;  4L5G A;  3M57 A;  2KQW A;  1NJI U;  1C6V X;  1H64 1;  1YIT T;  1BI2 A;  4HVU A;  1QWF A;  2NYS A;  1OI1 A;  2RN8 A;  4C8Q G;  2FHD A;  3MP6 A;  3MET A;  4F7U G;  4ORZ A;  2RA2 A;  1YP5 A;  1TOV A;  3THK A;  1OOT A;  3EG3 A;  1KHC A;  3OYB A;  2LTO A;  4FU6 A;  2DJZ A;  4Y91 A;  2YSQ A;  3LH0 A;  3OYD A;  3CCJ A;  1U8R A;  2DNU A;  4ELY C;  2EQK A;  1M5Q 1;  2KXC A;  1AZE A;  3SDZ A;  4CC2 A;  2A36 A;  3DLL A;  1FYN A;  4CC7 A;  2LQW A;  3JCM b;  4PJO A;  3HTR A;  1G5V A;  2MMP A;  3PTA A;  1D0Y A;  3E9G A;  2H8H A;  4GY5 A;  2DIL A;  1JXM A;  2X4X A;  2K3B A;  2JNG A;  1D1A A;  3JB9 H;  2A0F B;  3ULR B;  1UE9 A;  4RTX A;  1K1Z A;  2QQS A;  1Q7Y R;  1QW1 A;  3MCA B;  3LYI A;  1S1N A;  1GBR A;  1WLP B;  3EH1 A;  4DQ2 A;  2X3X D;  1AT1 B;  1LOJ A;  2IIM A;  2K57 A;  3PVL A;  4E7I A;  5GAO m;  3JCM W;  1IHV A;  2K5I A;  3VS0 A;  1VQK A;  2EIF A;  2YDL A;  1SHG A;  1Y96 B;  3CCS Q;  1Q82 C;  4DBH A;  5IH2 A;  2JN0 A;  3VS6 A;  2EYX A;  2ZGW A;  2DE0 X;  3Q1J A;  2LX7 A;  1AD5 A;  1YJN T;  2HMA A;  2MWP A;  3U23 A;  2LCC A;  3CD6 T;  2PUO B;  3P8H A;  3G71 Q;  4UC4 A;  5FU6 B;  1RAA B;  4EMK B;  4EMK C;  3FIF A;  2D8J A;  3C4S A;  2DET A;  2DIG A;  3PMI A;  1W2B A;  1C1A A;  2NUP B;  4JJC A;  4AT1 B;  3DKM A;  9ATC B;  3BY7 A;  3HP9 A;  2VVK A;  1M90 C;  2LT1 A;  1D09 B;  2KAF A;  5LJ3 d;  3RR6 A;  2JMC A;  1QCO A;  2AKK A;  4ESR A;  2KT1 A;  3PE0 A;  5GAN g;  1VQM Q;  3A98 A;  4IUV A;  4LN2 A;  3CCJ T;  3NMZ C;  2CZ6 B;  1X01 A;  2DMO A;  2VWF A;  2CH4 A;  2JZ2 A;  2F69 A;  1BI3 A;  1ZA1 B;  1M27 C;  2AKL A;  4C0Z A;  2VV5 A;  1JBM A;  4BI8 B;  2H3J A;  5CO7 A;  4V2S A;  1BYM A;  1IO6 A;  1FXX A;  2RO0 A;  2X51 A;  4EMG A;  1OX9 A;  3H0I A;  1IHW A;  1ZSZ B;  1CKB A;  1ZSZ C;  4M78 E;  4JZ3 A;  1OQK A;  1Q82 U;  1AWW A;  3GF5 A;  4CI0 C;  2X4W A;  3OSV A;  1TH7 A;  3M0T A;  2E64 A;  3HHT B;  3JCM J;  2XDB A;  5GAN 4;  1N8R R;  3GP8 A;  5FWB A;  2D8H A;  4GLK A;  2LRQ A;  1WJS A;  1G3Y A;  1B34 B;  1GCQ C;  3CC2 A;  2RJC A;  4OMQ A;  5GMK j;  1MMD A;  4PJL A;  2O4X B;  3QXE B;  2FG0 A;  3CC4 A;  4PJN A;  4M78 G;  4EDU A;  4HCC A;  1VQ4 T;  3VUZ A;  3QWX X;  1H92 A;  3I56 T;  2KVQ G;  3VRZ A;  4BD3 A;  2DL4 A;  2RQW A;  1KSW A;  4C92 A;  1KC8 R;  3E1S A;  5CKH A;  3M5A A;  1VYU A;  1B07 A;  1UG1 A;  4E6R A;  1I1J A;  1WHJ A;  2LVM A;  1YWO A;  2L89 A;  4GBQ A;  2M51 A;  1TSF A;  4OMF B;  1K8A U;  2KYM A;  3CPW S;  2OX7 A;  1YIT A;  2QI2 A;  4AG2 C;  2D0N A;  3ZFJ A;  2E65 A;  1MV0 B;  1BI0 A;  3JB9 F;  4PKC C;  1M9S A;  3FDR A;  1I5L A;  1TWB A;  1X6B A;  4A53 A;  3IQL A;  2KK4 A;  1C0M A;  1M2V A;  1QCN A;  1NM7 A;  4Y28 E;  4CRI A;  4EIK A;  2GFA A;  3E9F A;  5GAM f;  2GBQ A;  3CME T;  2FB7 A;  5GMK m;  1KJW A;  2JM8 A;  3M4Y A;  5J26 A;  5GMK h;  4FIB A;  1HK9 A;  5CKF A;  2BTT A;  3EFO A;  1V76 A;  3H9N A;  3SWN C;  4C92 D;  1K8A R;  3CCV T;  1PNJ A;  3FC3 A;  2E5Q A;  1WYX A;  3M0U A;  2QA4 T;  1W70 A;  1YFN A;  2V8I A;  2HAX A;  2COW A;  3T9N A;  4IUQ A;  2G6F X;  3RKX A;  1N9S A;  4C92 F;  1SHF A;  2J7I A;  1A0N B;  2OAW A;  3TSZ A;  2RJD A;  1IXD A;  1SKU B;  1AEY A;  4M78 A;  3MHX A;  5C0M A;  1VQK T;  4ZTJ A;  3PGG A;  4Z89 A;  1Q86 R;  1X43 A;  1TU0 B;  3OS1 A;  3GPL A;  3V7S A;  4R55 A;  1LVK A;  1WHK A;  4F7U F;  4ZTF A;  4F7U E;  2QAZ A;  1P92 A;  5KH6 A;  3WXM B;  3QJ6 A;  3L2Q A;  5GAM d;  1WZO A;  4QW2 A;  3RBB B;  1HXD A;  3JSC A;  4KT0 E;  4N0A A;  1E6H A;  1BCM A;  2YLB A;  2YUP A;  3G6E Q;  2HD0 A;  2ED1 A;  1OPK A;  4B9W A;  4HCK A;  2DYI A;  4N0A C;  5GAN h;  2YXY A;  4HT8 A;  3A8H B;  4X9D A;  1M4Z A;  2DF6 A;  4QVC A;  3JCM g;  3L2V A;  2CZ7 B;  3VYG A;  2DRK A;  2X4J A;  2V26 A;  1X2K A;  8ATC B;  4M7D F;  2WSE E;  2C0O A;  1OZ3 A;  3REB B;  1IB8 A;  3ZL7 C;  1M1K U;  2MPX C;  3CCR Q;  2JT4 A;  4QKU A;  5HCK A;  3UAT A;  2KRN A;  3TQ7 P;  3CCM T;  3SWN A;  2P4T A;  2ZZD A;  4DBF A;  3MEU A;  4J9I A;  2HBW A;  1GCQ A;  4L6V 5;  3VS7 A;  2KXD A;  5KYX A;  1KQS A;  2QEX Q;  1WNL A;  3GBQ A;  3M0P A;  2CP6 A;  1WHH A;  1WI7 A;  5IXB A;  2ZPI B;  2EBP A;  2ESW A;  2LC4 A;  1J3T A;  4FSS A;  3L2U A;  3GNF B;  2HDA A;  2OTJ A;  3SFM A;  4E7J A;  1YN8 A;  2P0K A;  3BW1 A;  4JS5 A;  3CCJ Q;  1ZBX A;  3S3N A;  5KYU B;  1H3Z A;  1UGQ B;  1UHC A;  4P5N A;  2ROL A;  2DK3 A;  3A8G B;  2L3P A;  3LGF A;  4RKU E;  2KRO A;  4J9H A;  5GAN j;  4Q5W A;  3RKY A;  4FT2 A;  1QVP A;  1Q86 C;  2EAY A;  3LWH A;  2LZ6 B;  2XU8 A;  3G6E A;  5GAM h;  1MMN A;  4QVD A;  3QZ5 B;  3CCE T;  2PQW A;  3HRU A;  3M56 A;  1MMG A;  2COY A;  2CP5 A;  3TCJ A;  1VIF A;  4WCI A;  2CP3 A;  2LX9 A;  3M4G A;  1Q7Y C;  5IHI A;  3JB9 D;  4C92 B;  3VYH B;  2ZPF B;  4C92 C;  2FZG B;  1YJN Q;  4FW1 A;  5ECA A;  3I5R A;  3E19 A;  5GAO n;  1RAF B;  4KGZ B;  1D1C A;  2PU9 B;  3CC7 T;  5FRM A;  1KG1 A;  5DLQ E;  3X20 B;  3TEE A;  2KRM A;  3VS1 A;  2QK0 A;  3CCU Q;  4AG1 C;  1M1F A;  3UA7 A;  1W4S A;  2DXT A;  2SRC A;  3TRE A;  3OS5 A;  4M75 A;  1B7T A;  1CKA A;  2KI7 A;  3OYN A;  3M53 A;  3HRT A;  2DL7 A;  2EWN A;  6AT1 B;  1XTD A;  1QVG P;  3AHU A;  1O9S A;  4LUE A;  1QQJ A;  5CR2 A;  3CCV Q;  3JB9 I;  3F70 A;  2BE7 D;  1LJO A;  5IXF A;  4BDZ A;  3M55 A;  1Q81 R;  3M9Q A;  4QVZ A;  1EZZ B;  2GCX A;  1RLQ C;  4HVW A;  3R6O A;  3ER0 A;  3PVQ A;  2HSP A;  2ROT A;  2A28 A;  3CPW A;  4FCY A;  1KC8 C;  3LGL A;  3EG9 A;  2RJE A;  1TG0 A;  4MML A;  3V7R A;  3OW2 P;  2M02 A;  3OMG A;  1M8V A;  3EG9 B;  4L59 A;  4RCB A;  3HPW A;  3CMA Q;  4JRK A;  1M1G A;  3OYL A;  2R58 A;  1IZ6 A;  5DM7 R;  3A1P A;  3BDU A;  1M1K R;  2HEQ A;  1I5O B;  1Q81 U;  4M7D E;  4M77 A;  4O6J A;  2HCK A;  2VGM A;  3X25 B;  2EYW A;  1PC0 A;  2OTL T;  2QDL A;  5CKE A;  2EYQ A;  1VQ6 T;  7AT1 B;  4EPC A;  1UEC A;  1UTI A;  3OYM A;  2RMO A;  2L3S A;  2PUK B;  3C95 A;  1VQ9 T;  1Y96 A;  1RAI B;  3CME A;  2MWO A;  2HNI A;  2E70 A;  1SF9 A;  2KDS A;  1GL5 A;  2FO0 A;  2QYZ A;  2YRV A;  3L1A A;  4DA4 A;  3ME9 A;  4TVR A;  2JJ9 A;  4A4E A;  2RQU A;  3TU4 K;  5LJ3 h;  3HL8 A;  2QDY B;  5EG2 A;  2QQA A;  2R5M A;  2MIO A;  1N5Z A;  2GTO A;  2QTV A;  1JB0 E;  4BUG A;  1VYT A;  2O88 A;  3RNJ A;  3ASK A;  4IUT A;  4BDY A;  4OB1 B;  1VQ4 A;  3CBO A;  4XTW A;  4F7U B;  3CCL T;  1YI2 T;  4PJO B;  1JRI A;  1EIF A;  2HKN A;  1VIE A;  4OGC A;  2RHZ A;  2IPO B;  1WDX A;  3C12 A;  4BY6 B;  2VB6 A;  2ZPB B;  1MHN A;  3NTK A;  1HYO A;  4HT9 A;  1UDL A;  1FMK A;  4KUL A;  1OU8 A;  3QUI A;  2QXF A;  5I2M A;  4XU3 A;  2ZPG B;  3HFO A;  1Q82 R;  2O01 E;  3EFR A;  5HK0 A;  2CSI A;  4JS4 A;  2BZY A;  2DLP A;  3EG2 A;  4MZM A;  3MO8 A;  3M58 A;  2DL3 A;  5CKB A;  4DBR A;  2QQR A;  5A0D A;  4C8Q A;  3G7Z A;  3RUX A;  4KGV B;  1MUZ A;  3G1J A;  1YNZ A;  1N8R U;  2HL5 C;  4KBM B;  1YBY A;  5KYX B;  5LJ3 j;  1IRX A;  5A0G A;  2RJF A;  4E2F B;  1Q7Y U;  1X6G A;  1S72 Q;  4RMO A;  3NGP A;  1QWE A;  4OVA A;  4IUU A;  4RTV A;  1GCP A;  1SG5 A;  2AZV A;  4OP0 A;  4KUD K;  1PD0 A;  5GAN 2;  3OY9 A;  3VKI A;  5GAM e;  2K2M A;  2AHJ B;  4OML A;  2HQX A;  3P8B B;  2VYT A;  1QVF S;  4E7H A;  1IGU A;  3EAE A;  2OTL A;  2KY9 A;  3I56 A;  2GGR A;  4M7A F;  3MEW A;  2JUF A;  2CT3 A;  4FYY B;  4MZT A;  3PT9 A;  1VQ8 Q;  5LJ3 g;  2K2V A;  3JCM h;  2ED0 A;  5LJ5 j;  1WXT A;  2QGG A;  1ABQ A;  1Q95 G;  3JCM d;  3R6N A;  2JXB A;  3M0R A;  4II1 A;  2OI3 A;  2B86 A;  5M9O A;  3G4S T;  4M77 D;  4JJN K;  4JRP A;  1N9R A;  3TSW A;  1E6G A;  1K9M C;  4QQ6 A;  1OYX A;  3JB9 J;  5GJW B;  2QEX T;  1I8F A;  3C94 A;  2BKD N;  2RHU A;  2W0Z A;  5LJ5 g;  2XIC A;  5GAN 7;  4IIM A;  5LJ5 d;  1HSQ A; 
#chains in the Genus database with same CATH homology
 2GF7 A;  4XTZ A;  3SWN C;  4C92 D;  3I55 A;  2XG8 D;  2VC8 A;  4M7A E;  2A3L A;  2KSS A;  3OYY A;  3CCV T;  1YJ9 A;  3QYG B;  2DO3 A;  4XTY A;  4M77 F;  3WVE B;  3M54 A;  4JUV A;  3FC3 A;  2IG0 A;  2LNV A;  3PIP A;  3CCV A;  4HKE A;  2E5Q A;  5GAN 6;  1WPY A;  2QA4 T;  3JAM E;  1UEB A;  4RG2 A;  1RI0 A;  5C6S A;  1VQL A;  2V8I A;  2EFI A;  2HAX A;  4J6W A;  4C8Q D;  3GNG A;  4NL2 A;  3T9N A;  2RM4 A;  4IUQ A;  4C92 F;  3RKX A;  1N9S A;  1VQP T;  2JVV A;  3QDR B;  5GAN e;  4LDU A;  2RK1 A;  2EQJ A;  2RJD A;  3V8K A;  4FM4 B;  4M78 A;  2DXC A;  2G3R A;  4C5E A;  4BE0 A;  3MHX A;  1YIJ A;  4JLI A;  5C0M A;  1BIA A;  3INZ A;  3MP8 A;  1DJ7 B;  5CQY A;  4ZTJ A;  1VQK T;  3OYC A;  4ZGD B;  3PGG A;  1UGP B;  2VGN A;  3OS1 A;  1JJ2 S;  5LJ5 h;  3GPL A;  1QVG A;  4FT4 A;  2WSF E;  2M0O A;  4OGE A;  5DY9 A;  3V7S A;  4R55 A;  2K5F A;  4F7U F;  4ZTF A;  4M77 B;  4F7U E;  2L3R A;  1P92 A;  2K4Y A;  5KH6 A;  2DKG A;  3X24 B;  2XHC A;  2CZ1 B;  5GAM g;  3WXM B;  3QJ6 A;  4PJO D;  1KD1 U;  4M7D G;  4XQ3 A;  3V8J A;  5GAM d;  3L2Q A;  3SB2 A;  1ZHI A;  3A8L B;  5D6Y A;  5A0L A;  3SD4 A;  2GFU A;  4M7A A;  4M7A D;  4WF2 A;  2CGH A;  2E1H A;  4NL3 A;  3ZBD A;  4J83 A;  1NZ9 A;  1M90 U;  1UB4 A;  2FYK A;  4QW2 A;  4RG8 A;  2CS7 A;  4BAC A;  2E41 A;  4FL6 A;  1M1K C;  1HXD A;  3JSC A;  4J6Y A;  3FLG A;  4ZGE B;  1VQM T;  4KT0 E;  3L42 A;  2OAU A;  4N0A A;  2E6Z A;  5IAY A;  3LWI A;  2A7Y A;  2E10 A;  4X34 A;  2YLB A;  4M7A C;  4J6X A;  2HD0 A;  5CCA A;  1N6A A;  3CCS T;  1NE8 A;  4B9W A;  3S3O A;  3FEO A;  4N0A C;  2RB6 A;  3JCM e;  5GAN h;  2LDM A;  3GOX A;  3OW2 A;  1KQ2 A;  4HT8 A;  4C0F A;  3A8H B;  4X9D A;  1M4Z A;  2KMT A;  4M75 D;  4QVC A;  3JCM g;  3L2V A;  3OYF A;  2CZ7 B;  4IUR A;  3VYG A;  3OA6 A;  3G6E T;  1VQ9 A;  1KHI A;  3LX7 A;  3FB9 A;  2X4J A;  1VQ8 A;  2XI9 A;  1Y7X A;  4ZN3 A;  4XU0 A;  5LL6 S;  2D0Q B;  5FRO A;  4M7D F;  2R57 A;  1VQ5 T;  2WSE E;  3H6Z A;  4LDW A;  3VV0 A;  3WVD B;  5GAM j;  1S72 A;  2F5K A;  4M78 C;  4E7L A;  1OZ3 A;  4J5Y A;  2I2L A;  2X4Y A;  2CYZ B;  3MEA A;  4M78 B;  3QPH A;  4N4I A;  5GAN 5;  1M1K U;  2C06 A;  1GXI E;  2M9U A;  1YCY A;  4PLI A;  3CCR A;  3L2R A;  3VU3 C;  3CC4 T;  4QQG A;  1YI2 A;  3CCL A;  5CAI A;  1D3B B;  3H8Z A;  3SWN B;  4N4G A;  3S6W A;  1Q81 C;  3CCM T;  4JDS A;  3SWN A;  4BE1 A;  2P4T A;  2JTF A;  2ZZD A;  5J39 A;  3MEU A;  2HBP A;  4M7D D;  2YLC A;  2V8J A;  5A2Q E;  3UDC A;  3VJP A;  1VQ7 T;  4L6V 5;  4M77 C;  2QEX A;  4M78 F;  4A4H A;  2ZPH B;  1VQO T;  2FVU A;  1YJW T;  1VQM A;  1KQS A;  1B34 A;  1WNL A;  1YJ9 T;  1Y71 A;  2QQB A;  3RMS A;  1QP3 A;  1N27 A;  1YHQ A;  1OZ2 A;  4Z02 A;  2RD1 A;  3JCM V;  3G4S A;  3KUF A;  5HK3 A;  2L8D A;  2ZPI B;  2LC4 A;  4B9X A;  3N5B B;  3A8O B;  4NS5 A;  3OYH A;  3L2U A;  3GNF B;  3RKW A;  2OTJ A;  3SFM A;  3CCQ T;  4LD9 K;  2DXB A;  4E7J A;  2P0K A;  3BW1 A;  4JS5 A;  1ZBX A;  5KE3 A;  3S3N A;  2DZ9 A;  5GAO r;  1H3Z A;  1UGQ B;  2CZ0 B;  4P5N A;  2JOY A;  2WAC A;  3LW5 E;  2DK3 A;  3A8G B;  3NTI A;  3LGF A;  4RKU E;  2MI6 A;  3OYE A;  3JB9 G;  5GAN 8;  1QP2 A;  2HQE A;  4Q5W A;  4OB0 B;  3RKY A;  5GAN j;  1X6O A;  1I81 A;  5GMK l;  4FT2 A;  2R5A A;  3PFS A;  4R56 A;  3J7A F;  2K3Y A;  1QVP A;  2RI5 A;  4M75 G;  1Q86 C;  4M7D B;  3KBG A;  2EAY A;  1VQ5 A;  4X9C A;  5KCH A;  2XDP A;  3LWH A;  4M7D A;  1VQ6 T;  3OS0 A;  2XU8 A;  5KE2 A;  2RI3 A;  3GLX A;  3G6E A;  1U1S A;  5GAM h;  2E6N A;  1WJQ A;  4QVD A;  3QZ5 B;  3CCE T;  3OBY A;  3QZ9 B;  2PQW A;  2LQ8 A;  3HRU A;  5FLX E;  4ELZ C;  3M56 A;  1VQ6 A;  2LT4 A;  4C5G A;  1K9M U;  2B8A A;  1IRE B;  1G3T A;  3EFS A;  3LLR A;  4O5V A;  3TCJ A;  3OYJ A;  4XTU A;  1VIF A;  3NFC A;  3FJP A;  3QHS A;  5GAN 3;  1VUB A;  2LX9 A;  4C5I A;  3M4G A;  4BY6 C;  2RHX A;  1Q7Y C;  3UWN A;  1KQ1 A;  2DEQ A;  4BI3 A;  2VUB A;  4PL6 A;  1BI1 A;  3JB9 D;  1WJR A;  4M77 E;  3VYH B;  4A54 A;  2ZPF B;  4C92 B;  4C92 C;  4M7A G;  2V8K A;  3JRZ A;  3QSU A;  3JCM Q;  3CPF A;  3JCM X;  3E19 A;  5GAO n;  4EMK A;  5GAN d;  2XK0 A;  4PJO F;  2PU9 B;  1KQS S;  2M16 A;  4FSX A;  3CC7 T;  5D6X A;  5FRM A;  4VUB A;  1KG1 A;  2EJ9 A;  5DLQ E;  3X20 B;  4ME7 A;  4L5G A;  3TEE A;  4OF1 A;  3J81 E;  3M57 A;  3A8M B;  2EJF A;  2KQW A;  3CCU A;  1NJI U;  1H64 1;  4JRI A;  1YIT T;  1M1F A;  3FRN A;  2DTH A;  1W4S A;  1BI2 A;  2DXT A;  5D6W A;  3JCM c;  2CKK A;  3TRE A;  1VQN T;  3OS5 A;  2XD0 A;  4M75 A;  1OI1 A;  5FU6 C;  4IUP A;  2ZCF B;  3OYN A;  3OYA A;  3CD6 A;  3M53 A;  4C8Q G;  3HRT A;  3OSS C;  4C8Q B;  1W2B S;  2EWN A;  2FHD A;  3MP6 A;  3MET A;  1XTD A;  2P0Q A;  2RA2 A;  4RCC A;  4F7U G;  3AHU A;  4A4K A;  2Y90 A;  3OS2 A;  1KHC A;  1O9S A;  1UGR B;  3OYB A;  1YHQ T;  2LTO A;  5CR2 A;  4FU6 A;  1D3B A;  4M75 F;  3JB9 I;  3F70 A;  2DJZ A;  4HA8 A;  4Y91 A;  1LJO A;  3CMA T;  4BDZ A;  3RIR A;  3LH0 A;  3M55 A;  3M9Q A;  3OYD A;  3CCJ A;  1U8R A;  1BIB A;  4QVZ A;  4ELY C;  2L5Q A;  2DIQ A;  3QO3 A;  2GCX A;  4LDV A;  1YJW A;  2EQK A;  1M5Q 1;  3R6O A;  4E47 A;  4JRQ A;  4BB7 A;  4IKF A;  3ER0 A;  1SSF A;  3SDZ A;  2DTO A;  4MZP A;  4OB3 B;  1QVF A;  5CQX A;  3DLL A;  3QJY A;  1YIJ T;  2DVE A;  4D6W A;  3JCM b;  1K73 C;  4PJO A;  3CPW A;  3L2Z A;  1G5V A;  2MMP A;  4XU1 A;  1KC8 C;  1U1T A;  2D6F A;  3LGL A;  3PTA A;  3PNW C;  1Y07 A;  3E9G A;  4NOY A;  4PNO A;  2LQK A;  2RJE A;  4GY5 A;  4MML A;  3V7R A;  2OTJ T;  1QVG S;  2X4X A;  3OMG A;  1M8V A;  2JNG A;  3JB9 H;  4L59 A;  4RCB A;  1FX7 A;  3HPW A;  4E7K A;  4JRK A;  4DOW A;  1M1G A;  3NTH A;  4DOV A;  3CCE A;  2QQS A;  3OYL A;  5LJ3 f;  2R58 A;  5GAO q;  3G71 A;  1QW1 A;  3MCA B;  3LYI A;  4M75 E;  1IZ6 A;  5DM7 R;  3CXC A;  2RHY A;  3BDU A;  1VQ7 A;  4C0D B;  3O8V A;  4DQ2 A;  1G3W A;  3V7C A;  1N8R C;  1Q81 U;  3CCU T;  3I55 T;  4M7D E;  1WQ7 A;  1NPP A;  1XQH A;  2Y4Y A;  5I2S A;  1LOJ A;  3PMT A;  3ZEH A;  4C5H A;  3OQ5 A;  4C8Q F;  2FL7 A;  4M77 A;  1XOV A;  3DB3 A;  4O6J A;  4C8Q C;  2K57 A;  4OB2 B;  3X25 B;  2VGM A;  4E7I A;  2O4X A;  3UPU A;  5GAO m;  2YHT A;  2DAQ A;  2K5I A;  3M59 A;  3JCM W;  1VQK A;  2EIF A;  4A4G A;  2OTL T;  3CCS A;  5CKE A;  2EYQ A;  1Y96 B;  5CVI A;  2QA4 A;  1K8A C;  2XKO C;  5LJ5 e;  1WGS A;  4LD6 A;  2GQV A;  2F5T X;  1Q82 C;  5GAO p;  2JN0 A;  4EPC A;  3OYM A;  2ZGW A;  1I4K 1;  2PUK B;  3C95 A;  3DLM A;  3GIB A;  1VQ9 T;  1Y96 A;  3Q1J A;  3CME A;  4N4H A;  1YJN T;  4PJO E;  2XDD A;  2DXU A;  2MWP A;  2LCC A;  3BDL A;  3QKJ A;  2NLU A;  2MWO A;  3CD6 T;  2HNI A;  2PUO B;  2E70 A;  2D9T A;  2DPP B;  3P8H A;  4J8O A;  3V8L A;  4UC4 A;  2KDS A;  5FU6 B;  5DLO A;  2YRV A;  3L1A A;  5FU7 C;  4EMK B;  3CCR T;  2RH2 A;  4DA4 A;  4EMK C;  3FIF A;  3ME9 A;  3C4S A;  2P0P A;  2DIG A;  3PMI A;  3OYK A;  1W2B A;  4TVR A;  2K3X A;  3DKM A;  4A4E A;  5KCO A;  3BY7 A;  5GAO l;  4QQD A;  3CMA A;  2RK2 A;  5LJ3 h;  3TU4 K;  3HL8 A;  3CEY A;  3HP9 A;  3OB9 A;  1M90 C;  2LT1 A;  2KAF A;  3JCM f;  5AYF A;  2QDY B;  2RHI A;  4C0G A;  4C8Q E;  4HCB A;  5EG2 A;  5LJ3 d;  3CCQ A;  1JJ2 A;  2QQA A;  1VQ8 T;  2R5M A;  4PJO G;  1NJI C;  5FRN A;  3OW2 S;  1JB0 E;  4BUG A;  5GAN g;  4M77 G;  4IUV A;  3CCJ T;  3ASK A;  2MAM A;  3KXT A;  4MMK A;  2CZ6 B;  4IUT A;  4OB1 B;  4BDY A;  1X01 A;  1PSF A;  4BE2 A;  3CBO A;  1VQ4 A;  4XTW A;  4F7U B;  3CCL T;  1YI2 T;  2ZPE B;  3BFM A;  4PJO B;  2JZ2 A;  2K5L A;  1EIF A;  1JRI A;  2DD4 A;  2F69 A;  4LDX A;  1BI3 A;  4PJO C;  1PSE A;  1VIE A;  4OGC A;  2RHZ A;  3J80 E;  1BKB A;  3UT1 A;  2DZC A;  2MF2 A;  4C0Z A;  3C12 A;  4C92 E;  4BY6 B;  2VV5 A;  1JBM A;  3HFN A;  4ZN1 A;  4BI8 B;  1ZQ1 A;  1MHN A;  2ZPB B;  2H3J A;  2QTX A;  3MP1 A;  5CO7 A;  4YTL A;  3NTK A;  2EKO A;  5GMK e;  4V2S A;  1VQP A;  2EQU A;  4HT9 A;  5CIU A;  4KUL A;  4XU2 A;  1BYM A;  3QUI A;  2QXF A;  5I2M A;  4M7A B;  1FXX A;  2RO0 A;  2ZPG B;  4XU3 A;  3HFO A;  4EMG A;  3HSB A;  1S72 T;  3CBP A;  4JLG A;  2O01 E;  3EFR A;  5HK0 A;  3S3M A;  2VXF A;  2E12 A;  3RES A;  4JS4 A;  1K73 U;  4M78 E;  1Q82 U;  1Q86 U;  4MZM A;  4M78 D;  3CC7 A;  3MO8 A;  2XDB A;  2M1H A;  3OBW A;  5CK9 A;  3M58 A;  3G71 T;  2QQ9 A;  4C92 G;  3GF5 A;  5CKB A;  4CI0 C;  3OYG A;  5IN1 A;  2X4W A;  3OSV A;  1TH7 A;  4KUI A;  2E64 A;  2QQR A;  3P8D A;  3HHT B;  5A0D A;  5L8R E;  4C8Q A;  1LNX A;  2JTM A;  3CBM A;  3X26 B;  5GAN 4;  3GP8 A;  3JCM J;  3G7Z A;  3RUX A;  1UGS B;  4MDW A;  3VUB A;  4GLK A;  2IVW A;  2VXE A;  2LRQ A;  1WJS A;  1G3Y A;  4KBM B;  1B34 B;  4M75 B;  1N8R U;  1YBY A;  3HKS A;  3URG A;  3CC2 A;  5LJ3 j;  2RJC A;  1RL2 A;  5A0G A;  2RJF A;  5GMK j;  3CCM A;  2Y4X A;  3RMQ A;  1Q7Y U;  4ATO A;  2O4X B;  4RMO A;  3QXE B;  1YJN A;  3QBY A;  3CC4 A;  3QYH B;  4M78 G;  4OVA A;  1MGQ A;  4IUU A;  3PIO A;  4HCZ A;  4EDU A;  5LJ5 f;  4XTV A;  4HCC A;  1VQ4 T;  3VUZ A;  3I56 T;  5CKD A;  3JCM P;  2KVQ G;  4OP0 A;  4BD3 A;  4C92 A;  4KUD K;  5GAN 2;  3E1S A;  5CKH A;  3OYI A;  2EQM A;  4XK8 E;  3M5A A;  3OY9 A;  3VKI A;  1KC8 U;  5GAM e;  1O75 A;  1R8O B;  4ZGJ B;  4A4F A;  4XAX B;  2PVG B;  2AHJ B;  3DB4 A;  5FU7 B;  5GMK i;  2HQX A;  2PVO B;  3P8B B;  1V29 B;  2LVM A;  2VYT A;  1G3S A;  4BI4 A;  5IT9 E;  1QVF S;  2L89 A;  1KD1 C;  4J7I A;  4OMF B;  1K8A U;  4E7H A;  3CPW S;  3EAE A;  1WQW A;  2KY9 A;  3I56 A;  2OTL A;  1YIT A;  2QI2 A;  3RER A;  4M7A F;  4F7U A;  3ZFJ A;  3MEW A;  3HRS A;  5LJ3 e;  1FWZ A;  2E65 A;  2JUF A;  5HY6 A;  3OMC A;  5GAN f;  4MZT A;  1BI0 A;  3PT9 A;  3JB9 F;  5LJ3 g;  2K2V A;  5J3B A;  3JCM h;  4PKC C;  1M9S A;  2X35 A;  3FDR A;  3MEV A;  3QII A;  2LCL A;  4XTX A;  4EMH A;  5LJ5 j;  1I5L A;  1VQN A;  1AHJ B;  3QG1 A;  4A53 A;  3JCM d;  2KK4 A;  2RI2 A;  3CC2 T;  3L2W A;  2WSC E;  4M7D C;  4II1 A;  4J7F A;  3A5Z B;  1NPR A;  4LDY A;  4C0D C;  1VQO A;  4Y28 E;  4PLL A;  4CRI A;  3CXC S;  1VQL T;  2PVD B;  5M9O A;  2GFA A;  3E9F A;  3G4S T;  2BUD A;  5GAM f;  2XID A;  4M77 D;  4JJN K;  4JRP A;  1N9R A;  3CME T;  2FB7 A;  2DD5 A;  3X28 B;  5HKC A;  4QQ6 A;  4M75 C;  2BIV A;  1OYX A;  5GMK m;  3JB9 J;  1K9M C;  4MDX A;  1X75 C;  2QEX T;  1I8F A;  3C94 A;  2BKD N;  3M4Y A;  5I21 A;  2DTI A;  5J26 A;  2EJG A;  2RHU A;  5GMK h;  4FIB A;  1HK9 A;  5CKF A;  2XIC A;  1XNI A;  5LJ5 g;  5GAN 7;  5LJ5 d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...