5DLOA

S. aureus mazf in complex with substrate analogue
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
PIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate recognition, regulation mechanism and activity regulation of MazF mRNA interferase.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 35
structure length 114
sequence length 114
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dloA00
5CR2A 4HKEA 3JSCA 2C06A 4MZTA 5CQYA 5CK9A 1VUBA 3JRZA 3NFCA 5HKCA 4ME7A 5CKBA 1X75C 1UB4A 5CO7A 3VUBA 5CKDA 4MDXA 5HK0A 5CKEA 4VUBA 4MZMA 5CKHA 5HK3A 4MZPA 3HPWA 2VUBA 5CCAA 2MF2A 4OF1A 1M1FA 3TCJA 2KMTA 4ELYC 4ELZC 3G7ZA 1NE8A 5CQXA 5CKFA 5DLOA
chains in the Genus database with same CATH superfamily
1M5Q1 4L5GA 3I55A 2LMJA 1VYTA 2J6FA 4O5VA 3OYIA 2WACA 1O75A 3CBPA 1PC0A 1W6XA 1VQ5A 5CKBA 1VQNQ 2JOYA 1SRMA 3SFMA 4KGZB 3JB9F 2E5KA 2PVDB 2QQAA 4IURA 3JCMe 1V76A 2MF2A 3M5AA 1X69A 2GF7A 1RAGB 4RTXA 1KQSS 5GAN5 1YHQQ 1W2BS 2BUDA 4HCBA 1VQ6A 4IUVA 5CQYA 1SF9A 3A8MB 1V29B 5IH2A 4RTTA 3M0QA 1MV3A 5L23A 1OYXA 2E41A 4M75B 5DY9A 1G5VA 2QA4Q 3E9FA 2HQEA 3MP1A 2MAMA 2EKHA 2RH2A 1YJWA 1NBEB 1VQPA 4OMMA 3CC2Q 2QGFB 4M7AD 5C6SA 1VQ9T 3OYMA 5IAYA 1WJSA 1D1CA 5KE3A 3CCVQ 2HDAA 1AT1B 3JCMX 4IUPA 2O88A 1VQLT 2QTXA 3JCMW 4PK4A 1AVZC 4OMPA 1CKAA 1S72T 3OS1A 2VGMA 2KVQG 1UHCA 2K7AA 2K79A 3HRTA 1YI2A 5GAOr 4C8QG 1N27A 1O9SA 1AD5A 4C0DB 3X26B 2M0OA 2ROTA 5I2MA 1E6GA 3I56Q 5LJ5f 2AZSA 3PNWC 2GTOA 3VKIA 2QG9B 1T3SA 3MCAB 1Q86C 3V8JA 1IB8A 1NLOC 2D8HA 4PLIA 4M77E 5FROA 3RR6A 1M1KC 4BB7A 4M78G 2RQVA 4FYVB 1M90R 4J6YA 4F17A 1XJWB 4IIMA 3QDFA 2DF6A 1QVFA 1RUWA 3R6NA 2K3BA 4PL6A 4L6V5 1VQPQ 2PQWA 3BY7A 1JXOA 2K5IA 1UGPB 4GY5A 1WHGA 1GBRA 3G1JA 1KQ2A 4C5GA 2LVMA 1T3LA 5LJ5e 2X9HA 1I81A 3TSWA 2RQUA 3KFVA 2YUOA 8AT1B 3EG9B 1M8MA 3EFSA 1UGRB 1MHNA 5GJVB 4HVUA 5CKHA 2LX7A 3EFOA 5IXFA 4KBMB 3J81E 2DZCA 1UECA 3P8HA 1IRXA 4GLMA 1Q7YR 5CQXA 4J9IA 1NM7A 1AWOA 3OW2A 3VS0A 1FMVA 2RMOA 3DKMA 4ME7A 2P0QA 5KH6A 3QJ6A 3RBBB 1M3AA 3PVLA 2QI2A 3CBOA 4BUGA 3GP8A 1K4US 3G7ZA 2DE0X 1FWZA 4BDYA 4HVWA 5HY6A 4LE9A 3L2VA 2KSSA 2X4YA 1KQ1A 3OB9A 1Q7YU 4JJDA 4C5EA 2QEXA 4JUVA 3OSVA 3I5SA 2LJ3A 1YCYA 4FM4B 1G3WA 5IT9E 2HQHA 3PMIA 4PFPA 2PU9B 4M7DE 3RERA 1QVPA 2ZGWA 3CMEQ 1WA7A 1RAEB 3MJXA 2DNUA 1SPKA 3E9GA 4M77D 2Y4XA 3G71T 2PVGB 3CCUQ 2L8DA 1K9MU 2QQSA 1ZSZB 1HJDA 3EGXB 2FRWA 3MKDA 3M4GA 2DRMA 2ED0A 4HT9A 2LQNA 4QT7A 1OX9A 1SKUB 3QG1A 1VQ4T 1W4SA 4ZN1A 1D0ZA 4FYWB 1JU5C 3LWHA 5LJ3h 4C8QB 3M53A 4RG2A 2YLCA 3OBWA 2BZ8A 4M7AA 3JB9J 2RA2A 3FLGA 5GMKh 3RUXA 3KXTA 1VQMT 3CCSA 4JDSA 4M7AB 1D1BA 2COWA 2ZPEB 3OYNA 3MHXA 2NUPB 3M0SA 2HNIA 3HP9A 4LD9K 5GAN4 1ZA2B 4J6XA 2FPFA 3A1PA 3JCMP 5GANd 3M0UA 3CCVT 2VXEA 3E19A 3NPFA 1PCXA 1RI0A 1PD1A 2MWOA 4X9CA 3JCMb 1K76A 1WQWA 2JVVA 4OVAA 2CYZB 1C6VX 3EFRA 3PFSA 2RK1A 4ZNXA 3CD6A 5GJWB 5KYWA 1WNLA 2CP5A 1X2KA 3WVDB 5KYWB 2P84A 1D1AA 2K4YA 3CCJQ 9ATCB 2R5AA 1S72A 3I56A 1ZLMA 2ECZA 1K73C 4ZGEB 1N9SA 3CCMA 2JS2A 2DBKA 2RHXA 4E7ZA 1NPRA 4XU1A 2JMCA 1J3TA 3IQLA 3PE0A 4CI0C 3OYDA 2AHJB 4N0AA 4E7KA 4AG2C 4KT0E 2O4XB 4M7AE 1OX8A 3SWNC 2CH4W 4M78A 2ZPHB 4C0DC 2VB6A 4C0GA 1IHWA 3TU4K 2KROA 3RESA 1VQOQ 3CCEQ 5LJ5j 5IHNA 1QCNA 5LL6S 3CCQA 3V8LA 5DLQE 4J8OA 4RCCA 1JO8A 2DL7A 2M51A 2LCSA 2E64A 3PMTA 2C0IA 3EH2A 1KQSA 2MCNA 4M77A 4EMKA 3X25B 3VU3C 4X1VA 4WCIA 2LT1A 1R0CB 2D9TA 2E12A 5LJ3f 4XK8E 5I21A 1X27A 1WYXA 4KH1B 1PNJA 4N4IA 1YIJT 2QQBA 4PLLA 3T9NA 2AT1B 1X01A 5HK3A 4MZPA 4PJOD 3ZL7C 2F5TX 2D0QB 4XTYA 2OTJT 3H8ZA 2ZPIB 2LNVA 2VKNA 3CCRT 2HKQB 4AMCA 4R56A 2O9SA 4C92A 1M2VB 3N5BB 3QDRB 2KYMA 3JV3A 3UDCA 2EYXA 4ZTFA 1VQMA 3RMSA 1WX6A 1RLQC 5FLXE 2K2MA 1Q82R 1UGVA 1NYFA 2A0FB 5FRNA 4M7DG 5A0GA 1YIJQ 2CZ1B 2DA9A 4QKUA 3HFOA 1K73U 1M27C 2ZZDA 2R58A 1LOJA 4LDUA 3A8LB 2GBQA 3VS3A 4FU6A 3JCMV 4KUIA 3HTRA 5FU7C 3VS4A 4A4FA 4A53A 3M55A 1OEBA 3FIFA 3QKJA 5FW9A 1K8AU 3OYAA 1GCPA 2O2OA 3CCET 3HSBA 3QXEB 2CUBA 3SD4A 1M30A 1K9AA 3VV0A 1X75C 1M3CA 2HMAA 5GAN3 2YRCA 1K73R 3CXCP 3CCJT 3H0FA 2CUDA 1YITQ 2QEXT 1K0SA 3GNGA 4F7UG 3M0PA 4JPBW 4CC2A 4M75E 1U1SA 4MMKA 1T0HA 4J7FA 5GANh 3AT1B 2GCXA 2FVUA 1I0CA 1IGQA 3JSCA 1OQKA 5I22A 4LDXA 1TWBA 1KD1R 1RAHB 3GNFB 5GAN6 2DIQA 2F1LA 1PHTA 2RNAA 1WQ7A 1QKXA 3DB4A 1I1JA 4M78E 4GLKA 2VUBA 4B9WA 5CCAA 1M1FA 4FSSA 1H3ZA 1D0XA 1WFWA 3ZEHA 3OW2S 4A63B 4BY6C 3V7CA 4M77C 3S3MA 1Y96A 4M7DD 4ZTJA 2DILA 2YLBA 4CC7A 1HD3A 4XTXA 1D3BA 4A4HA 3ME9A 1GCQC 1I07A 1Z9QA 2ZPBB 1W2BP 4AFSC 2F2VA 3D7SB 4FT4A 1VQOT 1OZ3A 5GAOp 1X43A 2X4WA 2K9GA 3X24B 3WXMB 3CXCA 4XTVA 1Y57A 2A7YA 4C92D 1QWFA 5KCHA 1VQ7A 3EHQA 2AZVA 2LRQA 2FRYA 1Q82C 2EVRA 1WHKA 4FYXB 5LJ5h 1TOVA 3VUBA 1VQ7T 1GL5A 3CCJA 3PGGA 4LUDA 1FYNA 4OMOA 2GNCA 3CCMT 2RQRA 1TG0A 4MDWA 5J39A 4DBHA 1Q7YC 4XTZA 2EQKA 4DQ2A 4OP0A 3GPLA 3BE3A 1Y07A 3SHWA 4J83A 4EIKA 4DOVA 3UT1A 1PSEA 4PFOA 1TUDA 1UB4A 3V8KA 2EYQA 2LQ8A 4ZGJB 4E7LA 2X35A 3NHNA 2NUTB 2X4JA 2YRDA 4C8QA 3OYFA 1K0XA 4HA8A 2PUOB 3CC7Q 1B34B 4OMFB 2MOXA 4PJOB 1RAFB 2LX9A 2HQXA 2LJ1A 2LQWA 1XOVA 4RTVA 1OPKA 4JRQA 2ZAEA 3QZ9B 4M7AC 3M4YA 1UTIA 3QHSA 3L2RA 1KD1C 4C92E 4DBFA 4X9DA 1PKTA 4V2SA 4XU2A 5GAMh 3VS5A 1C1AA 5LJ3d 3WVEB 1AEYA 1VUBA 4QW2A 2FO0A 3UPUA 1VQKQ 3DB3A 2V8JA 2M02A 3MEAA 4E7SA 5FU6C 1YITA 2CH4A 2H3JA 2DVEA 2CSQA 4DOWA 2FYKA 1G83A 2L2PA 2PUKB 4M78B 2ROLA 1N8RC 1M9SA 3QIIA 1AWJA 3CC4Q 1W70A 3OYCA 1YHQA 4CRIA 1VQLA 1RADB 3OS0A 5HKCA 1WZOA 2EJFA 1QVGP 3PVQA 4WTOB 2RN8A 5KYYA 7AT1B 4PJLA 2KK4A 2KRSA 2LCLA 3CCLT 1NE8A 3OMCA 3C95A 1ZSZA 2DL4A 2AIRB 3A8GB 1OV3A 4JS5A 2VV5A 3EFOB 2FG0A 2DZ9A 4C92C 3FEOA 4J9EA 3EG9A 2DEUA 1H8KA 2MMPA 1UJYA 2Y4YA 2JM9A 2PNIA 4E7JA 1SEMA 4L59A 1KC8U 3QWYA 2DKGA 2BE7D 3MEUA 3FJPA 4WF2A 4HKEA 2DXUA 3HRSA 3M59A 3PTAA 1BKBA 4E7IA 4M75G 1BCMA 4FYYB 5GAOm 1MV0B 1VA7A 4KRTA 4J6WA 4JJBA 1BK2A 2SRCA 1MMNA 5GMKm 1ZHIA 2OTLA 2ED1A 2EYZA 1ZQ1A 3H0IA 1YJ9Q 4F04B 1NJIU 1MMGA 1PRMC 2ABLA 3Q1JA 5DM7R 2KAFA 2JTFA 2HSEB 2A37A 1D0YA 1KIKA 1Z9ZA 4O6JA 1AZGB 1MNEA 3C0CA 1XNIA 1X6GA 1R8OB 1SSHA 1M1KR 1U3OA 4IKFA 2JXBA 4FIBA 4N4HA 3H0HA 1H3HA 4PFZA 2F69A 5CKEA 4N0AC 2EBPA 2VWFA 1PRLC 2KXCA 3H9NA 2LQKA 2JS0A 2MYSA 3CCLA 3NTKA 3QZ5B 1X6OA 5A0DA 4MDXA 3VUZA 1HYOA 4CC3A 5LJ3e 1YWOA 4XTWA 3M54A 4BI8B 1R77A 3V7SA 2QYZA 1E6HA 2RO0A 3UA6A 4RTWA 4E47A 3OS2A 1TUCA 1Q95G 4JJCA 2HZYA 2DIGA 3CCRA 2NUTA 3VS1A 1WXTA 3A98A 1S1NA 5LJ3j 4FW2A 2VVKA 2B8AA 2RQWA 2G3RA 3AHUA 1JRIA 1X6BA 2FEIA 2LCCA 2C06A 1VQ8T 1BB9A 3RMQA 5GAMg 2X4XA 4IUQA 4N4GA 4DBRA 2CP3A 4PJOG 2D1XA 5GAMd 2HAXA 5KYYB 3G4SA 3CPWS 2QQRA 1BI3A 1K9MR 1LNXA 2AK5A 5CR2A 2CP6A 5D6WA 3JRZA 2D6FA 5GAMf 2MWPA 1NYGA 1CSKA 2VXFA 4JRPA 1XTDA 5CVIA 3QYGB 4CC4B 2QXFA 1E7OA 3M56A 1PM3A 1I5LA 1WJRA 4HCCA 3V7RA 1VYUA 3LH5A 4JZ4A 2X3XD 5KYUA 2J06A 3GF5A 4PJMA 1VIFA 1M1GA 2CKKA 2XG8D 2HKNA 1GRIA 3TSZA 3NGPA 1UDLA 4PJNA 1RI9A 2V1RA 1G3YA 2K5LA 1RACB 1UHFA 1QVFS 1NG2A 2LTOA 1BIAA 3BFMA 2J05A 3I9QA 5GMKi 2RK2A 2JZ2A 2QDYB 1QMCA 2K3XA 3EGDA 3DLMA 3L2UA 8ATCB 1B34A 1WIEA 2PVOB 1G2BA 4TVRA 4J9BA 1YI2Q 2DLPA 3SB2A 3C94A 3FDRA 1TH7A 2O4XA 2QA4T 2RJFA 2NYSA 1QKWA 2QAZA 1PWTA 2KR3A 3CCVA 4J9GA 1KQSP 4Z02A 2EGAA 1ZUUA 3LWIA 1VYVA 1VQ9Q 2L3PA 1VQ8Q 3M57A 4BACA 2ENMA 3CCEA 2FHDA 1W1FA 5GMKe 2XMFA 2OTLQ 1MNDA 1LCKA 4OMNA 1AZEA 1HXDA 4AFQC 2MIOA 3M58A 2R5MA 2LC4A 3J80E 4F7UB 1YNZA 2CZ0B 3S3OA 1V1CA 3QBYA 3MO8A 4ANJA 2EQJA 1QVFP 5LJ5g 3CC7A 5GANg 3A5ZB 3TREA 3M9QA 2RHIA 4MMLA 4RTZA 1Q81C 2OJ2A 3RIRA 3CC2T 3L2QA 5D7UA 4II1A 2KXDA 1KHIA 2CS7A 3I55T 4M78D 3I35A 1VQ7Q 2DYBA 2XIDA 2K5FA 2AKKA 1IO6A 4LUEA 5GANf 4AT1B 1YJ9A 5HK0A 2V8IA 4OMLA 1OOTA 4MZMA 3ULRB 3UWNA 3HL8A 4LN2A 3FJ5A 2J6OA 3DLLA 4C0FA 3BDUA 1GFCA 4M77F 4NL2A 2RB6A 3EGDB 3CPWP 1BI2A 1D09B 2CZ7B 1ZUYA 2FB7A 2XK0A 3MPUB 1QWEA 3GLXA 3VS7A 2P4RA 3M0TA 4KGXB 3TQ7P 1M8VA 2E65A 2FL7A 1QW1A 3S6WA 4IIOA 2ZPFB 1NZ9A 2E1HA 2XHCA 1AWWA 4OGCA 1ZA1B 1UUEA 2DD5A 4LNPA 3PIPA 3EG3A 4RTYA 2IIMA 3EG0A 2DO3A 1QP3A 2X51A 1SG5A 2BIVA 4BE1A 1PD0A 1I4K1 1SRLA 2DPPB 5DLOA 1GFDA 1RAAB 1AHJB 5IN1A 2FPEA 4C5IA 2YUPA 4JS4A 4HCZA 2IG0A 2AKLA 2JTMA 3OSSC 2RM4A 2YT6A 3FRNA 3MEVA 4OB1B 2NUPA 5ECAA 2A3LA 2EQUA 2DETA 3HFNA 1ZX6A 2WSCE 3GBQA 3GOXA 5GAOq 2VGNA 2ZPGB 3L1AA 4ELYC 2KDSA 2ZCFB 2HCKA 3PIOA 4FSXA 1OPLA 3JB9G 1Q82U 3RNJA 4MZTA 1VOMA 2HEQA 3CC4A 4Q5WA 2GQIA 3CQTA 4J9CA 1VQ6T 4C92F 4XAXB 4J9HA 5IHKA 3CCRQ 1SHGA 1UFFA 2HBWA 2KEAA 2RF0A 1Q81R 2XDPA 2HL3A 3VYGA 1YHQT 2KT1A 4RG8A 1S72Q 3SDZA 1XQHA 1WLPB 3MEWA 1K8AR 4LD6A 2QTVA 2JUFA 2E3IA 2LJ0A 2MK5A 4JRKA 5KYXA 1NEBA 2YDLA 4BE0A 2Z0WA 2F5KA 4IUTA 1QCFA 1BI0A 3OYKA 3CCLQ 2K6DA 1ABOA 2COYA 5A2QE 3HRUA 4J5YA 1YJNQ 4NOYA 3VS6A 6AT1B 4M7AG 4HT8A 1UE9A 1NJIC 2EAYA 3A8OB 1M90C 1SSFA 3NTIA 3H6ZA 3L2WA 1YJWQ 1YBYA 1KC8C 3JCMJ 4EPCA 2GTJA 4EMKC 4M78F 3X28B 4EMKB 3LW5E 1M4ZA 4PNOA 5AYFA 5L8RE 1VQ8A 1VQ5Q 4E7HA 2V1QA 2J6KA 1ARKA 2DL3A 5CIUA 2CT4A 1RAIB 2HL5C 1VQ4Q 1ZUKA 3G4ST 1QVGS 1NJIR 3CCSQ 1IZ6A 3G6EA 3CCQQ 1N5ZA 2RQTA 4M77B 5GAMj 4ATOA 4Z8AA 3THKA 2O31A 4LXCA 3CEYA 2OX7A 1JJ2P 5I2SA 1TTHB 2XICA 1EFNA 4EMHA 3OYLA 2DX1A 1JQQA 2QGGA 3OMGA 3CMEA 3UF4A 4D6WA 4NS5A 2PZ1A 2QDLA 4C8QC 2DL8A 2V8KA 1WDXA 2EKOA 3ASKA 4C0ZA 4LDVA 3CD6Q 5CKFA 2C0TA 4J7IA 5GAN8 2VASA 3VS2A 1N8RU 2EQIA 4A4GA 5M9OA 3LX7A 2FZKB 2JMAA 4A4EA 1RL2A 2K3YA 1LVKA 3OYGA 4D8KA 2RJDA 3META 1H641 2DTIA 2DERA 3EHRA 3L2ZA 4M77G 2EJ9A 3G4SQ 4AFZC 2KMTA 2DXTA 1WXUA 3VJPA 3ER0A 1FXXA 2XDBA 2KT8A 3CBMA 2RI3A 1TSFA 4J9DA 1HK9A 2BZXA 1H92A 3LGLA 1VQ9A 2DTHA 4OB2B 3NFCA 2YUNA 1U5SA 5HCKA 2D8JA 2VYTA 3LH0A 4OB3B 3EH1A 1SHFA 2E70A 4PJJA 1YFNA 2IVWA 2CT3A 1N8RR 2L5QA 1MGQA 4QVZA 5D6XA 4FT2A 1UJ0A 1AOJA 2E4HA 3OYEA 1WXBA 2EGEA 4C92G 3C12A 4EDUA 1Y7XA 4B9XA 3FB9A 2YWWA 3EGXA 2E3HA 4ESRA 2YHTA 2EJGA 4BI4A 1Y0MA 1Q86U 4AFUC 2O9VA 2D0NA 2EQMA 2WSFE 2KGTA 2BTTA 5LJ5d 4JLGA 2QK0A 3QO3A 4DA4A 4FCYA 4M7DB 1OU8A 2XD0A 4JRIA 1JEGA 3QJYA 5FU6B 2MI6A 4AG1C 1NEGA 2NUZA 1PSFA 4RMOA 1IHVA 5IHIA 2MPXC 2RD1A 3URGA 3HKSA 1IXDA 2F2XA 4M75A 1WHJA 1VQMQ 2JJ9A 1OI1A 1UG1A 2CP7A 1VQKT 5AT1B 5A0LA 5GANj 3QWXX 5C0MA 4PJOE 3OW2P 4Y28E 1KK7A 2A28A 4KULA 4A54A 3GIBA 1C0MA 2DXCA 2CDTA 1JXMA 2DFUA 1JJ2A 1YJ9T 2R57A 1BCOA 1D3BB 3J7AF 4M4ZA 5KYNA 1M2VA 2DL5A 4X34A 3CC4T 1VIEA 4HVVA 2SEMA 3FC3A 1YJNT 2EWNA 5GAOn 4GBQA 4F7UA 2IPOB 4BE2A 1TU0B 3QYHB 1BU1A 1GBQA 4PJOC 2OTJA 3JCMc 2C0OA 2E6NA 3CXCS 5GAN7 5IXBA 2J7IA 2XU8A 3OYJA 1M90U 2RHYA 1VQNT 2E10A 3EG2A 3C4SA 4K11A 5FWBA 3JB9I 5J3BA 2KRMA 5FU7B 4YTLA 2HSPA 4EMGA 1K8AC 4XTUA 3LGFA 3X20B 3CCST 2EGCA 2HD0A 1U1TA 4RCBA 3QSUA 2OI3A 2KRNA 4R0KA 1K1ZA 1YJWT 1WPYA 2FZGB 5J26A 4ELZC 3G71A 1OULA 1ABQA 3JB9D 3OY9A 3SWNA 2EYYA 2RI5A 4JLIA 4M7AF 2CZ6B 1YN8A 3G6EQ 1YCSB 1LPLA 2H3EB 3QPHA 4E6RA 1M3BA 1U8RA 2M1HA 4E2FB 4R55A 2A36A 1IREB 2DBMA 2H8HA 5KYUB 3CC7T 1VQ4A 3I55Q 1FMKA 5LJ3g 2DK3A 2QASA 3JCMQ 1GCQA 1WHHA 1YI2T 3I56T 4DBQA 1W2BA 1OZ2A 2KQWA 1EZZB 1KD1U 3OBYA 1M2OA 3F70A 4DEXA 1VQPT 3OYYA 4OB0B 3CCUT 3RDVA 5GAMe 3EGUA 2E6ZA 2XI9A 1MMAA 2JTEA 4QQ6A 4QVCA 1GXIE 4XU0A 1TS9A 1AWXA 3R6OA 2LNHB 4M75C 2HBPA 2QA4A 4C8QE 1KSWA 2RHUA 3RKWA 5EC7A 4C5HA 4M7DF 2LP5A 4PKCC 2I0NA 1B7TA 2A08A 2G6FX 3JCMd 3INZA 2CP2A 4RTUA 2P0PA 1M1KU 3G71Q 4RUGA 3MP8A 1YIJA 3PT9A 1YWPA 1QP2A 5FRMA 1BIBA 3BDLA 3CMET 2ATCB 5GAN2 1ZSZC 2W10A 2L89A 2O01E 1JJ2S 2P0KA 2CGHA 3LLRA 4M75D 2DJZA 1WJQA 2QEXQ 4BDZA 4C8QD 1QVGA 2DTOA 3CD6T 3U23A 3KUFA 2FPDA 1PKSA 1I5OB 1ACMB 3CCQT 2RJCA 1QQJA 4M75F 4VUBA 1UGSB 1Q81U 2DAQA 3M0RA 1F1BB 3OQ5A 3MP6A 1WGSA 1N6AA 1EX4A 4M7DC 3CMAA 3VYHB 3EAEA 1B3QA 3CCUA 2OAUA 3P8DA 3JCMg 3TVTA 3NTHA 3A8HB 4F7UF 5CAIA 3I5RA 2OAWA 3RKYA 2OTLT 4ZN3A 2BZYA 5D6YA 4KGVB 1Y71A 1EIFA 1B07A 2I2LA 1OU9A 2DMOA 4RKUE 4D8DA 2LZ6B 2KYBA 4FL6A 2NLUA 4UC4A 3CPWA 2DRKA 3NMZC 3HHTB 3SWNB 2EIFA 1MMDA 4KH0B 2BKDN 2L3QA 4A4KA 1WHLA 2DEQA 5CO7A 4XQ3A 2M0YA 4Z88A 2EW3A 1BI1A 1NPPA 2BE9B 2YUQA 4HXJA 5GANe 3VRYA 1IGUA 2GFUA 2RPNA 1WHMA 2LT4A 4QQDA 3OS5A 2X3WD 3CCMQ 3KBGA 1YJNA 3EG1A 4NL3A 2Y90A 2KE9A 4B6MA 1K9MC 1X2QA 3CMAQ 4F16A 2JW4A 1JBMA 3OYBA 1N9RA 2K57A 2JT4A 4Y91A 1KC8R 4M78C 2DD4A 4OF1A 3VRZA 4P5NA 4C92B 1VQOA 2RI2A 5GMKl 1VQKA 4JZ3A 3O8VA 2B86A 2DVJA 2CREA 2W0ZA 3CMAT 1FX7A 1TXQA 1MUZA 2CP0A 1HSQA 1KG1A 2WSEE 4FW1A 1LJOA 1ZBXA 4DEYA 3E2UA 3O5ZA 1G8XA 2L0AA 5KYXB 1VQ5T 2K2VA 3ZFJA 1QCOA 3OYHA 2RJEA 2FZCB 3LYIA 3JAME 2RHZA 1ZBJA 1VQLQ 1DJ7B 1P92A 2XKOC 5FWCA 2DXBA 2P4TA 1BBZA 1PG5B 1VQ6Q 2YSQA 2COZA 1FMWA 2KNBB 2EYWA 2EPDA 1YP5A 2L3RA 4C8QF 4Z89A 3HPWA 3ZBDA 1KJWA 3TCJA 1JB0E 1ZSGA 5KCOA 2GFAA 4F7UE 2KI7A 4LDYA 3BW1A 2M9UA 1VQNA 4HCKA 2M16A 3UA7A 5CK9A 4M7DA 4BY6B 2QQ9A 1G3SA 3CPFA 4OMQA 1UGQB 4QQGA 1NLPC 4OGEA 1KFZA 1U06A 4LDWA 2KBTA 4KUDK 3REBB 1UEBA 3JCMh 2DYIA 2DJQA 3S3NA 4PJOA 3OA6A 3TEEA 2JM8A 3SEMA 4JJNK 2E5QA 1WI7A 1QLYA 4Y92A 4IUUA 2PTKA 2YRVA 1T0JA 5GMKj 3REAB 4BD3A 3UATA 1Q86R 2NWMA 5EG2A 1RLPC 4BI3A 1R0BG 5CKDA 3QUIA 4QVDA 1A0NB 2YXYA 2CSIA 2V26A 2L3SA 2GQVA 1RABB 3H41A 2OTJQ 2XDDA 5KE2A 3JB9H 4XU3A 3E1SA 4PJOF 1Y96B 2GGRA 1BYMA 2ESWA 3JCMf 2F2WA 4J9FA 5GAOl 4ORZA 2VC8A 1KHCA 2LDMA 3L42A 3RKXA 2JNGA 3CC2A 5I11A 2JN0A 1YITT 2EFIA 3G6ET 1G3TA 2KY9A 1I8FA 1TUGB 2DM1A 4ZGDB 4F14A 1CKBA 3P8BB
chains in the Genus database with same CATH topology
1M5Q1 3L2UA 5C0MA 3OYAA 4L5GA 4PJOE 3I55A 3GIBA 4Y28E 4KULA 4A54A 1B34A 4O5VA 2DXCA 3CCET 3OYIA 3HSBA 2WACA 3QXEB 1O75A 3SD4A 1JJ2A 2PVOB 3CBPA 1VQ5A 5CKBA 4TVRA 2R57A 1YJ9T 1D3BB 3VV0A 1X75C 3SB2A 3C94A 5GAN3 3J7AF 2JOYA 3CCJT 3FDRA 3SFMA 3JB9F 1TH7A 4X34A 2O4XA 2PVDB 1VIEA 2QQAA 3GNGA 4IURA 2QEXT 3CC4T 3JCMe 4F7UG 2QA4T 2MF2A 2RJFA 4M75E 3FC3A 2EWNA 1U1SA 3M5AA 5GAOn 1YJNT 2GF7A 4MMKA 4J7FA 4F7UA 5GANh 2GCXA 3CCVA 1KQSS 2FVUA 4BE2A 5GAN5 1W2BS 4Z02A 2BUDA 4HCBA 3JSCA 1VQ6A 3LWIA 4IUVA 5CQYA 3QYHB 3M57A 4BACA 3CCEA 4PJOC 2FHDA 3A8MB 4LDXA 1V29B 2OTJA 3GNFB 5GAN6 2DIQA 5GMKe 3JCMc 2E6NA 3CXCS 1WQ7A 1OYXA 5GAN7 2E41A 4M75B 3DB4A 4M78E 5DY9A 1G5VA 4GLKA 1HXDA 3E9FA 2HQEA 2VUBA 3M58A 2XU8A 3MP1A 4B9WA 2MAMA 5CCAA 3OYJA 1M1FA 2R5MA 1H3ZA 2RH2A 1YJWA 2LC4A 1VQPA 3ZEHA 1M90U 3J80E 2RHYA 4F7UB 3OW2S 1YITT 1VQNT 2E10A 4BY6C 3V7CA 2CZ0B 4M7AD 3C4SA 5C6SA 3S3OA 1VQ9T 3QBYA 3OYMA 5IAYA 4M77C 1WJSA 1Y96A 3S3MA 3MO8A 4ZTJA 4M7DD 3JB9I 5KE3A 2YLBA 5J3BA 3JCMX 2EQJA 4IUPA 5FU7B 4XTXA 1D3BA 4YTLA 2QTXA 3ME9A 4A4HA 4EMGA 5LJ5g 3CC7A 3JCMW 4XTUA 2ZPBB 5GANg 3LGFA 3X20B 3A5ZB 3OS1A 1S72T 3CCST 3TREA 2VGMA 4FT4A 3M9QA 1VQOT 2RHIA 1OZ3A 2HD0A 5GAOp 4MMLA 2KVQG 2X4WA 3HRTA 1U1TA 3RIRA 1Q81C 4RCBA 3QSUA 3X24B 3CC2T 3L2QA 3WXMB 1YI2A 1YJWT 1WPYA 3CXCA 4II1A 1KHIA 4XTVA 2CS7A 5J26A 4ELZC 5GAOr 2A7YA 3G71A 4C92D 5KCHA 4C8QG 1VQ7A 3JB9D 3I55T 1N27A 1O9SA 3OY9A 3SWNA 2LRQA 3X26B 4C0DB 2RI5A 4M78D 2M0OA 1Q82C 5I2MA 4JLIA 2XIDA 2K5FA 5LJ5f 5LJ5h 5GANf 4M7AF 3PNWC 3VUBA 3VKIA 5HK0A 1YJ9A 1VQ7T 2CZ6B 2V8IA 3CCJA 3PGGA 4MZMA 3UWNA 3QPHA 3MCAB 1U8RA 3CCMT 2M1HA 3V8JA 4R55A 1Q86C 3HL8A 4MDWA 1IREB 5J39A 4PLIA 3DLLA 1Q7YC 4XTZA 3CC7T 2EQKA 4M77E 5FROA 4DQ2A 4OP0A 4C0FA 1VQ4A 3GPLA 1M1KC 1Y07A 4BB7A 4M78G 3BDUA 5LJ3g 4J83A 2DK3A 4J6YA 3JCMQ 4M77F 4DOVA 3UT1A 1QVFA 4NL2A 1PSEA 1YI2T 2RB6A 3I56T 1BI2A 2CZ7B 4PL6A 1W2BA 1UB4A 3V8KA 2EYQA 1OZ2A 2FB7A 2LQ8A 2KQWA 2PQWA 3BY7A 4L6V5 4ZGJB 2K5IA 4E7LA 2XK0A 1UGPB 2X35A 2X4JA 1KD1U 3OBYA 4GY5A 3F70A 1VQPT 3OYYA 4C8QA 4OB0B 4C5GA 3OYFA 1KQ2A 3CCUT 5GAMe 3GLXA 2PUOB 4HA8A 2LVMA 2E6ZA 2XI9A 1M8VA 2E65A 2FL7A 5LJ5e 3L2RA 1QW1A 3S6WA 1B34B 4OMFB 2ZPFB 4PJOB 4QQ6A 1NZ9A 1I81A 2E1HA 2LX9A 4QVCA 2HQXA 2XHCA 1GXIE 4OGCA 4XU0A 2DD5A 3R6OA 4M75C 3PIPA 1XOVA 3EFSA 1UGRB 2HBPA 1MHNA 4JRQA 3QZ9B 5CKHA 2QA4A 4C8QE 1M90C 4M7AC 3M4YA 2DO3A 1QP3A 2RHUA 3QHSA 2BIVA 4KBMB 2DZCA 3RKWA 3J81E 1I4K1 4BE1A 2XDBA 4C5HA 4C92E 1KD1C 4M7DF 4X9DA 3P8HA 4V2SA 4PKCC 2DPPB 4XU2A 5CQXA 5DLOA 5GAMh 3OW2A 1AHJB 5LJ3d 3JCMd 5IN1A 4C5IA 3WVEB 3INZA 4JS4A 1VUBA 4HCZA 2IG0A 4QW2A 3UPUA 3DKMA 4ME7A 2P0PA 2JTMA 3DB3A 1M1KU 3OSSC 2RM4A 2V8JA 2P0QA 3MP8A 1YIJA 5KH6A 3PT9A 3MEAA 3QJ6A 5FU6C 1QP2A 3FRNA 3MEVA 4OB1B 5FRMA 1BIBA 3BDLA 1YITA 2A3LA 2EQUA 2H3JA 3HFNA 2DVEA 4DOWA 3CMET 2FYKA 2WSCE 5GAN2 4M78B 2PUKB 3GOXA 5GAOq 2VGNA 2QI2A 2ZPGB 2L89A 2O01E 3CBOA 3L1AA 4BUGA 2P0KA 4ELYC 2CGHA 2KDSA 2ZCFB 3LLRA 3GP8A 1N8RC 1M9SA 3G7ZA 3QIIA 1FWZA 3PIOA 4M75D 4BDYA 2DJZA 4FSXA 1WJQA 4BDZA 3JB9G 5HY6A 4C8QD 3L2VA 2KSSA 1Q82U 2X4YA 1KQ1A 4MZTA 4CRIA 3OYCA 1YHQA 1QVGA 2DTOA 3OB9A 1VQLA 1Q7YU 3OS0A 3CD6T 3KUFA 4C5EA 5HKCA 2QEXA 3CC4A 4JUVA 3OSVA 4Q5WA 2EJFA 1YCYA 4FM4B 1G3WA 3CCQT 3PMIA 5IT9E 2RJCA 4M75F 2PU9B 4VUBA 4C92F 4XAXB 1VQ6T 3RERA 1QVPA 4M7DE 2ZGWA 1UGSB 2KK4A 1Q81U 1VQLT 2DAQA 3OQ5A 2LCLA 3MP6A 1WGSA 3E9GA 4M77D 2Y4XA 1N6AA 4M7DC 3CMAA 3CCLT 1NE8A 3VYHB 3G71T 3EAEA 3OMCA 1JJ2S 2PVGB 3C95A 2XDPA 2L8DA 3CCUA 1K9MU 2OAUA 2QQSA 3A8GB 4JS5A 3P8DA 3JCMg 2VV5A 3VYGA 1YHQT 4RG8A 3NTHA 3A8HB 3SDZA 1XQHA 4F7UF 5CAIA 3MEWA 4LD6A 3RKYA 2DZ9A 2JUFA 3FEOA 4C92C 4ZN3A 2OTLT 5D6YA 3M4GA 2MMPA 1Y71A 1EIFA 2Y4YA 4JRKA 4HT9A 4BE0A 2F5KA 2I2LA 4E7JA 4IUTA 4RKUE 1BI0A 3QG1A 3OYKA 1W4SA 1VQ4T 4L59A 1KC8U 2DKGA 4FL6A 4ZN1A 3MEUA 2NLUA 3HRUA 3FJPA 4J5YA 4UC4A 4WF2A 5A2QE 3CPWA 4NOYA 3LWHA 4HKEA 3HHTB 5LJ3h 4C8QB 4M7AG 3M53A 4HT8A 3SWNB 2DXUA 4RG2A 2YLCA 3OBWA 2EIFA 1NJIC 2EAYA 3A8OB 3HRSA 3M59A 1BKBA 1SSFA 2BKDN 3NTIA 3PTAA 4E7IA 3H6ZA 3L2WA 2RA2A 3FLGA 4M75G 3RUXA 5GMKh 3KXTA 3JB9J 1VQMT 4A4KA 2DEQA 3CCSA 4JDSA 5CO7A 4M7AB 1YBYA 4XQ3A 5GAOm 3JCMJ 1KC8C 4EPCA 2ZPEB 4J6WA 3OYNA 3MHXA 1BI1A 4EMKC 5GMKm 1NPPA 1ZHIA 2OTLA 2HNIA 3HP9A 4M78F 3X28B 4LD9K 1ZQ1A 4EMKB 5GAN4 4J6XA 3LW5E 5GANe 3JCMP 1NJIU 1M4ZA 5GANd 4PNOA 5AYFA 5L8RE 2GFUA 1VQ8A 3Q1JA 3CCVT 2VXEA 3E19A 2LT4A 5DM7R 4E7HA 2KAFA 4QQDA 2JTFA 3OS5A 1RI0A 3KBGA 2MWOA 4X9CA 1YJNA 3JCMb 4NL3A 2Y90A 1WQWA 4O6JA 2JVVA 2CYZB 4OVAA 3EFRA 5CIUA 1K9MC 3PFSA 2RK1A 3CD6A 1XNIA 1JBMA 3OYBA 3G4ST 1K8AU 1N9RA 1WNLA 2K57A 4Y91A 1R8OB 1QVGS 3WVDB 4M78C 1IZ6A 2DD4A 4M7AA 4OF1A 4IKFA 2K4YA 3G6EA 4FIBA 4N4HA 2R5AA 4M77B 5GAMj 4ATOA 1S72A 2F69A 5CKEA 4N0AC 3I56A 4P5NA 4C92B 1VQOA 2RI2A 3CEYA 5GMKl 1VQKA 3O8VA 2LQKA 5I2SA 1K73C 4ZGEB 1N9SA 3CCMA 1K8AC 3CCLA 3CMAT 1FX7A 3NTKA 2XICA 2RHXA 3QZ5B 1KG1A 2WSEE 4EMHA 1X6OA 5A0DA 3OYLA 1NPRA 4MDXA 3OMGA 1LJOA 4XU1A 1ZBXA 3VUZA 3CMEA 4CI0C 4D6WA 3OYDA 5LJ3e 2AHJB 4N0AA 4NS5A 4E7KA 4KT0E 1VQ5T 2O4XB 4C8QC 4M7AE 2K2VA 3ZFJA 2V8KA 3SWNC 3OYHA 2EKOA 2RJEA 3ASKA 3LYIA 4C0ZA 4XTWA 3M54A 4LDVA 2RHZA 4M78A 3JAME 2ZPHB 4C0DC 1DJ7B 5CKFA 4BI8B 4J7IA 3V7SA 5GAN8 1P92A 4C0GA 3TU4K 3RESA 2XKOC 2RO0A 2DXBA 5LJ5j 2P4TA 1N8RU 4A4GA 5M9OA 3LX7A 4E47A 5LL6S 4A4EA 3CCQA 1RL2A 2K3YA 3OS2A 3OYGA 3V8LA 5DLQE 2DIGA 2RJDA 4J8OA 3CCRA 3META 4C8QF 2L3RA 1H641 2DTIA 4RCCA 3HPWA 3L2ZA 3ZBDA 4M77G 2EJ9A 1JB0E 2E64A 3TCJA 3PMTA 2KMTA 5LJ3j 2DXTA 5KCOA 1KQSA 4M77A 3VJPA 2B8AA 3ER0A 1FXXA 2GFAA 3VU3C 3X25B 4LDYA 4EMKA 3BW1A 3CBMA 2RI3A 4F7UE 2G3RA 2M9UA 3AHUA 1VQNA 1JRIA 1HK9A 2M16A 2LT1A 2D9TA 2LCCA 2E12A 3LGLA 1VQ8T 5LJ3f 5CK9A 2C06A 1VQ9A 4XK8E 4M7DA 2DTHA 4BY6B 2QQ9A 4OB2B 3RMQA 5I21A 3NFCA 1G3SA 3CPFA 5GAMg 1UGQB 2VYTA 2X4XA 4IUQA 4N4IA 3LH0A 4OB3B 4QQGA 1YIJT 2QQBA 4PLLA 4OGEA 4N4GA 3T9NA 2E70A 4LDWA 2IVWA 4PJOG 4KUDK 5GAMd 1X01A 2HAXA 5HK3A 1UEBA 4MZPA 3JCMh 3G4SA 2QQRA 3CPWS 4PJOD 1BI3A 3S3NA 4PJOA 2L5QA 3TEEA 3OA6A 2F5TX 1LNXA 4JJNK 2D0QB 2E5QA 1MGQA 4QVZA 4XTYA 4FT2A 5D6XA 3H8ZA 2OTJT 2ZPIB 2LNVA 4IUUA 5CR2A 3CCRT 2YRVA 3OYEA 4R56A 4C92A 5D6WA 3N5BB 3JRZA 5GMKj 4BD3A 3QDRB 2D6FA 5GAMf 2MWPA 4C92G 3C12A 4EDUA 1Y7XA 2VXFA 5EG2A 4JRPA 1XTDA 3FB9A 4B9XA 4BI3A 5CKDA 3UDCA 3QUIA 5CVIA 2YHTA 2EJGA 3QYGB 4QVDA 4ZTFA 2QXFA 1VQMA 4BI4A 3RMSA 3M56A 5FLXE 1Q86U 1I5LA 1WJRA 2EQMA 2WSFE 2GQVA 4HCCA 5FRNA 3V7RA 4M7DG 5LJ5d 5A0GA 2XDDA 2CZ1B 3GF5A 5KE2A 3JB9H 1VIFA 4JLGA 3QO3A 4DA4A 4XU3A 3E1SA 4PJOF 1Y96B 1BYMA 4M7DB 3JCMf 3HFOA 1K73U 1M1GA 2CKKA 2ZZDA 2XG8D 4JRIA 3QJYA 5GAOl 2VC8A 2MI6A 5FU6B 2XD0A 2R58A 1KHCA 1LOJA 2LDMA 3L42A 3RKXA 2JNGA 4LDUA 3CC2A 3A8LB 1PSFA 2JN0A 4FU6A 4RMOA 3JCMV 2EFIA 4KUIA 3G6ET 1G3YA 2K5LA 2RD1A 3HKSA 5FU7C 1G3TA 2LTOA 4M75A 3URGA 1QVFS 1BIAA 2KY9A 4A4FA 4A53A 3BFMA 1I8FA 3M55A 2RK2A 2JZ2A 5GMKi 1OI1A 2QDYB 1VQKT 2K3XA 4ZGDB 3FIFA 3QKJA 5A0LA 5GANj 3DLMA 3P8BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CR2 A;  4HKE A;  3JSC A;  2C06 A;  4MZT A;  5CQY A;  5CK9 A;  1VUB A;  3JRZ A;  3NFC A;  5HKC A;  4ME7 A;  5CKB A;  1X75 C;  1UB4 A;  5CO7 A;  3VUB A;  5CKD A;  4MDX A;  5HK0 A;  5CKE A;  4VUB A;  4MZM A;  5CKH A;  5HK3 A;  4MZP A;  3HPW A;  2VUB A;  5CCA A;  2MF2 A;  4OF1 A;  1M1F A;  3TCJ A;  2KMT A;  4ELY C;  4ELZ C;  3G7Z A;  1NE8 A;  5CQX A;  5CKF A;  5DLO A; 
#chains in the Genus database with same CATH topology
 1M5Q 1;  4L5G A;  3I55 A;  2LMJ A;  1VYT A;  2J6F A;  4O5V A;  3OYI A;  2WAC A;  1O75 A;  3CBP A;  1PC0 A;  1W6X A;  1VQ5 A;  5CKB A;  1VQN Q;  2JOY A;  1SRM A;  3SFM A;  4KGZ B;  3JB9 F;  2E5K A;  2PVD B;  2QQA A;  4IUR A;  3JCM e;  1V76 A;  2MF2 A;  3M5A A;  1X69 A;  2GF7 A;  1RAG B;  4RTX A;  1KQS S;  5GAN 5;  1YHQ Q;  1W2B S;  2BUD A;  4HCB A;  1VQ6 A;  4IUV A;  5CQY A;  1SF9 A;  3A8M B;  1V29 B;  5IH2 A;  4RTT A;  3M0Q A;  1MV3 A;  5L23 A;  1OYX A;  2E41 A;  4M75 B;  5DY9 A;  1G5V A;  2QA4 Q;  3E9F A;  2HQE A;  3MP1 A;  2MAM A;  2EKH A;  2RH2 A;  1YJW A;  1NBE B;  1VQP A;  4OMM A;  3CC2 Q;  2QGF B;  4M7A D;  5C6S A;  1VQ9 T;  3OYM A;  5IAY A;  1WJS A;  1D1C A;  5KE3 A;  3CCV Q;  2HDA A;  1AT1 B;  3JCM X;  4IUP A;  2O88 A;  1VQL T;  2QTX A;  3JCM W;  4PK4 A;  1AVZ C;  4OMP A;  1CKA A;  1S72 T;  3OS1 A;  2VGM A;  2KVQ G;  1UHC A;  2K7A A;  2K79 A;  3HRT A;  1YI2 A;  5GAO r;  4C8Q G;  1N27 A;  1O9S A;  1AD5 A;  4C0D B;  3X26 B;  2M0O A;  2ROT A;  5I2M A;  1E6G A;  3I56 Q;  5LJ5 f;  2AZS A;  3PNW C;  2GTO A;  3VKI A;  2QG9 B;  1T3S A;  3MCA B;  1Q86 C;  3V8J A;  1IB8 A;  1NLO C;  2D8H A;  4PLI A;  4M77 E;  5FRO A;  3RR6 A;  1M1K C;  4BB7 A;  4M78 G;  2RQV A;  4FYV B;  1M90 R;  4J6Y A;  4F17 A;  1XJW B;  4IIM A;  3QDF A;  2DF6 A;  1QVF A;  1RUW A;  3R6N A;  2K3B A;  4PL6 A;  4L6V 5;  1VQP Q;  2PQW A;  3BY7 A;  1JXO A;  2K5I A;  1UGP B;  4GY5 A;  1WHG A;  1GBR A;  3G1J A;  1KQ2 A;  4C5G A;  2LVM A;  1T3L A;  5LJ5 e;  2X9H A;  1I81 A;  3TSW A;  2RQU A;  3KFV A;  2YUO A;  8AT1 B;  3EG9 B;  1M8M A;  3EFS A;  1UGR B;  1MHN A;  5GJV B;  4HVU A;  5CKH A;  2LX7 A;  3EFO A;  5IXF A;  4KBM B;  3J81 E;  2DZC A;  1UEC A;  3P8H A;  1IRX A;  4GLM A;  1Q7Y R;  5CQX A;  4J9I A;  1NM7 A;  1AWO A;  3OW2 A;  3VS0 A;  1FMV A;  2RMO A;  3DKM A;  4ME7 A;  2P0Q A;  5KH6 A;  3QJ6 A;  3RBB B;  1M3A A;  3PVL A;  2QI2 A;  3CBO A;  4BUG A;  3GP8 A;  1K4U S;  3G7Z A;  2DE0 X;  1FWZ A;  4BDY A;  4HVW A;  5HY6 A;  4LE9 A;  3L2V A;  2KSS A;  2X4Y A;  1KQ1 A;  3OB9 A;  1Q7Y U;  4JJD A;  4C5E A;  2QEX A;  4JUV A;  3OSV A;  3I5S A;  2LJ3 A;  1YCY A;  4FM4 B;  1G3W A;  5IT9 E;  2HQH A;  3PMI A;  4PFP A;  2PU9 B;  4M7D E;  3RER A;  1QVP A;  2ZGW A;  3CME Q;  1WA7 A;  1RAE B;  3MJX A;  2DNU A;  1SPK A;  3E9G A;  4M77 D;  2Y4X A;  3G71 T;  2PVG B;  3CCU Q;  2L8D A;  1K9M U;  2QQS A;  1ZSZ B;  1HJD A;  3EGX B;  2FRW A;  3MKD A;  3M4G A;  2DRM A;  2ED0 A;  4HT9 A;  2LQN A;  4QT7 A;  1OX9 A;  1SKU B;  3QG1 A;  1VQ4 T;  1W4S A;  4ZN1 A;  1D0Z A;  4FYW B;  1JU5 C;  3LWH A;  5LJ3 h;  4C8Q B;  3M53 A;  4RG2 A;  2YLC A;  3OBW A;  2BZ8 A;  4M7A A;  3JB9 J;  2RA2 A;  3FLG A;  5GMK h;  3RUX A;  3KXT A;  1VQM T;  3CCS A;  4JDS A;  4M7A B;  1D1B A;  2COW A;  2ZPE B;  3OYN A;  3MHX A;  2NUP B;  3M0S A;  2HNI A;  3HP9 A;  4LD9 K;  5GAN 4;  1ZA2 B;  4J6X A;  2FPF A;  3A1P A;  3JCM P;  5GAN d;  3M0U A;  3CCV T;  2VXE A;  3E19 A;  3NPF A;  1PCX A;  1RI0 A;  1PD1 A;  2MWO A;  4X9C A;  3JCM b;  1K76 A;  1WQW A;  2JVV A;  4OVA A;  2CYZ B;  1C6V X;  3EFR A;  3PFS A;  2RK1 A;  4ZNX A;  3CD6 A;  5GJW B;  5KYW A;  1WNL A;  2CP5 A;  1X2K A;  3WVD B;  5KYW B;  2P84 A;  1D1A A;  2K4Y A;  3CCJ Q;  9ATC B;  2R5A A;  1S72 A;  3I56 A;  1ZLM A;  2ECZ A;  1K73 C;  4ZGE B;  1N9S A;  3CCM A;  2JS2 A;  2DBK A;  2RHX A;  4E7Z A;  1NPR A;  4XU1 A;  2JMC A;  1J3T A;  3IQL A;  3PE0 A;  4CI0 C;  3OYD A;  2AHJ B;  4N0A A;  4E7K A;  4AG2 C;  4KT0 E;  2O4X B;  4M7A E;  1OX8 A;  3SWN C;  2CH4 W;  4M78 A;  2ZPH B;  4C0D C;  2VB6 A;  4C0G A;  1IHW A;  3TU4 K;  2KRO A;  3RES A;  1VQO Q;  3CCE Q;  5LJ5 j;  5IHN A;  1QCN A;  5LL6 S;  3CCQ A;  3V8L A;  5DLQ E;  4J8O A;  4RCC A;  1JO8 A;  2DL7 A;  2M51 A;  2LCS A;  2E64 A;  3PMT A;  2C0I A;  3EH2 A;  1KQS A;  2MCN A;  4M77 A;  4EMK A;  3X25 B;  3VU3 C;  4X1V A;  4WCI A;  2LT1 A;  1R0C B;  2D9T A;  2E12 A;  5LJ3 f;  4XK8 E;  5I21 A;  1X27 A;  1WYX A;  4KH1 B;  1PNJ A;  4N4I A;  1YIJ T;  2QQB A;  4PLL A;  3T9N A;  2AT1 B;  1X01 A;  5HK3 A;  4MZP A;  4PJO D;  3ZL7 C;  2F5T X;  2D0Q B;  4XTY A;  2OTJ T;  3H8Z A;  2ZPI B;  2LNV A;  2VKN A;  3CCR T;  2HKQ B;  4AMC A;  4R56 A;  2O9S A;  4C92 A;  1M2V B;  3N5B B;  3QDR B;  2KYM A;  3JV3 A;  3UDC A;  2EYX A;  4ZTF A;  1VQM A;  3RMS A;  1WX6 A;  1RLQ C;  5FLX E;  2K2M A;  1Q82 R;  1UGV A;  1NYF A;  2A0F B;  5FRN A;  4M7D G;  5A0G A;  1YIJ Q;  2CZ1 B;  2DA9 A;  4QKU A;  3HFO A;  1K73 U;  1M27 C;  2ZZD A;  2R58 A;  1LOJ A;  4LDU A;  3A8L B;  2GBQ A;  3VS3 A;  4FU6 A;  3JCM V;  4KUI A;  3HTR A;  5FU7 C;  3VS4 A;  4A4F A;  4A53 A;  3M55 A;  1OEB A;  3FIF A;  3QKJ A;  5FW9 A;  1K8A U;  3OYA A;  1GCP A;  2O2O A;  3CCE T;  3HSB A;  3QXE B;  2CUB A;  3SD4 A;  1M30 A;  1K9A A;  3VV0 A;  1X75 C;  1M3C A;  2HMA A;  5GAN 3;  2YRC A;  1K73 R;  3CXC P;  3CCJ T;  3H0F A;  2CUD A;  1YIT Q;  2QEX T;  1K0S A;  3GNG A;  4F7U G;  3M0P A;  4JPB W;  4CC2 A;  4M75 E;  1U1S A;  4MMK A;  1T0H A;  4J7F A;  5GAN h;  3AT1 B;  2GCX A;  2FVU A;  1I0C A;  1IGQ A;  3JSC A;  1OQK A;  5I22 A;  4LDX A;  1TWB A;  1KD1 R;  1RAH B;  3GNF B;  5GAN 6;  2DIQ A;  2F1L A;  1PHT A;  2RNA A;  1WQ7 A;  1QKX A;  3DB4 A;  1I1J A;  4M78 E;  4GLK A;  2VUB A;  4B9W A;  5CCA A;  1M1F A;  4FSS A;  1H3Z A;  1D0X A;  1WFW A;  3ZEH A;  3OW2 S;  4A63 B;  4BY6 C;  3V7C A;  4M77 C;  3S3M A;  1Y96 A;  4M7D D;  4ZTJ A;  2DIL A;  2YLB A;  4CC7 A;  1HD3 A;  4XTX A;  1D3B A;  4A4H A;  3ME9 A;  1GCQ C;  1I07 A;  1Z9Q A;  2ZPB B;  1W2B P;  4AFS C;  2F2V A;  3D7S B;  4FT4 A;  1VQO T;  1OZ3 A;  5GAO p;  1X43 A;  2X4W A;  2K9G A;  3X24 B;  3WXM B;  3CXC A;  4XTV A;  1Y57 A;  2A7Y A;  4C92 D;  1QWF A;  5KCH A;  1VQ7 A;  3EHQ A;  2AZV A;  2LRQ A;  2FRY A;  1Q82 C;  2EVR A;  1WHK A;  4FYX B;  5LJ5 h;  1TOV A;  3VUB A;  1VQ7 T;  1GL5 A;  3CCJ A;  3PGG A;  4LUD A;  1FYN A;  4OMO A;  2GNC A;  3CCM T;  2RQR A;  1TG0 A;  4MDW A;  5J39 A;  4DBH A;  1Q7Y C;  4XTZ A;  2EQK A;  4DQ2 A;  4OP0 A;  3GPL A;  3BE3 A;  1Y07 A;  3SHW A;  4J83 A;  4EIK A;  4DOV A;  3UT1 A;  1PSE A;  4PFO A;  1TUD A;  1UB4 A;  3V8K A;  2EYQ A;  2LQ8 A;  4ZGJ B;  4E7L A;  2X35 A;  3NHN A;  2NUT B;  2X4J A;  2YRD A;  4C8Q A;  3OYF A;  1K0X A;  4HA8 A;  2PUO B;  3CC7 Q;  1B34 B;  4OMF B;  2MOX A;  4PJO B;  1RAF B;  2LX9 A;  2HQX A;  2LJ1 A;  2LQW A;  1XOV A;  4RTV A;  1OPK A;  4JRQ A;  2ZAE A;  3QZ9 B;  4M7A C;  3M4Y A;  1UTI A;  3QHS A;  3L2R A;  1KD1 C;  4C92 E;  4DBF A;  4X9D A;  1PKT A;  4V2S A;  4XU2 A;  5GAM h;  3VS5 A;  1C1A A;  5LJ3 d;  3WVE B;  1AEY A;  1VUB A;  4QW2 A;  2FO0 A;  3UPU A;  1VQK Q;  3DB3 A;  2V8J A;  2M02 A;  3MEA A;  4E7S A;  5FU6 C;  1YIT A;  2CH4 A;  2H3J A;  2DVE A;  2CSQ A;  4DOW A;  2FYK A;  1G83 A;  2L2P A;  2PUK B;  4M78 B;  2ROL A;  1N8R C;  1M9S A;  3QII A;  1AWJ A;  3CC4 Q;  1W70 A;  3OYC A;  1YHQ A;  4CRI A;  1VQL A;  1RAD B;  3OS0 A;  5HKC A;  1WZO A;  2EJF A;  1QVG P;  3PVQ A;  4WTO B;  2RN8 A;  5KYY A;  7AT1 B;  4PJL A;  2KK4 A;  2KRS A;  2LCL A;  3CCL T;  1NE8 A;  3OMC A;  3C95 A;  1ZSZ A;  2DL4 A;  2AIR B;  3A8G B;  1OV3 A;  4JS5 A;  2VV5 A;  3EFO B;  2FG0 A;  2DZ9 A;  4C92 C;  3FEO A;  4J9E A;  3EG9 A;  2DEU A;  1H8K A;  2MMP A;  1UJY A;  2Y4Y A;  2JM9 A;  2PNI A;  4E7J A;  1SEM A;  4L59 A;  1KC8 U;  3QWY A;  2DKG A;  2BE7 D;  3MEU A;  3FJP A;  4WF2 A;  4HKE A;  2DXU A;  3HRS A;  3M59 A;  3PTA A;  1BKB A;  4E7I A;  4M75 G;  1BCM A;  4FYY B;  5GAO m;  1MV0 B;  1VA7 A;  4KRT A;  4J6W A;  4JJB A;  1BK2 A;  2SRC A;  1MMN A;  5GMK m;  1ZHI A;  2OTL A;  2ED1 A;  2EYZ A;  1ZQ1 A;  3H0I A;  1YJ9 Q;  4F04 B;  1NJI U;  1MMG A;  1PRM C;  2ABL A;  3Q1J A;  5DM7 R;  2KAF A;  2JTF A;  2HSE B;  2A37 A;  1D0Y A;  1KIK A;  1Z9Z A;  4O6J A;  1AZG B;  1MNE A;  3C0C A;  1XNI A;  1X6G A;  1R8O B;  1SSH A;  1M1K R;  1U3O A;  4IKF A;  2JXB A;  4FIB A;  4N4H A;  3H0H A;  1H3H A;  4PFZ A;  2F69 A;  5CKE A;  4N0A C;  2EBP A;  2VWF A;  1PRL C;  2KXC A;  3H9N A;  2LQK A;  2JS0 A;  2MYS A;  3CCL A;  3NTK A;  3QZ5 B;  1X6O A;  5A0D A;  4MDX A;  3VUZ A;  1HYO A;  4CC3 A;  5LJ3 e;  1YWO A;  4XTW A;  3M54 A;  4BI8 B;  1R77 A;  3V7S A;  2QYZ A;  1E6H A;  2RO0 A;  3UA6 A;  4RTW A;  4E47 A;  3OS2 A;  1TUC A;  1Q95 G;  4JJC A;  2HZY A;  2DIG A;  3CCR A;  2NUT A;  3VS1 A;  1WXT A;  3A98 A;  1S1N A;  5LJ3 j;  4FW2 A;  2VVK A;  2B8A A;  2RQW A;  2G3R A;  3AHU A;  1JRI A;  1X6B A;  2FEI A;  2LCC A;  2C06 A;  1VQ8 T;  1BB9 A;  3RMQ A;  5GAM g;  2X4X A;  4IUQ A;  4N4G A;  4DBR A;  2CP3 A;  4PJO G;  2D1X A;  5GAM d;  2HAX A;  5KYY B;  3G4S A;  3CPW S;  2QQR A;  1BI3 A;  1K9M R;  1LNX A;  2AK5 A;  5CR2 A;  2CP6 A;  5D6W A;  3JRZ A;  2D6F A;  5GAM f;  2MWP A;  1NYG A;  1CSK A;  2VXF A;  4JRP A;  1XTD A;  5CVI A;  3QYG B;  4CC4 B;  2QXF A;  1E7O A;  3M56 A;  1PM3 A;  1I5L A;  1WJR A;  4HCC A;  3V7R A;  1VYU A;  3LH5 A;  4JZ4 A;  2X3X D;  5KYU A;  2J06 A;  3GF5 A;  4PJM A;  1VIF A;  1M1G A;  2CKK A;  2XG8 D;  2HKN A;  1GRI A;  3TSZ A;  3NGP A;  1UDL A;  4PJN A;  1RI9 A;  2V1R A;  1G3Y A;  2K5L A;  1RAC B;  1UHF A;  1QVF S;  1NG2 A;  2LTO A;  1BIA A;  3BFM A;  2J05 A;  3I9Q A;  5GMK i;  2RK2 A;  2JZ2 A;  2QDY B;  1QMC A;  2K3X A;  3EGD A;  3DLM A;  3L2U A;  8ATC B;  1B34 A;  1WIE A;  2PVO B;  1G2B A;  4TVR A;  4J9B A;  1YI2 Q;  2DLP A;  3SB2 A;  3C94 A;  3FDR A;  1TH7 A;  2O4X A;  2QA4 T;  2RJF A;  2NYS A;  1QKW A;  2QAZ A;  1PWT A;  2KR3 A;  3CCV A;  4J9G A;  1KQS P;  4Z02 A;  2EGA A;  1ZUU A;  3LWI A;  1VYV A;  1VQ9 Q;  2L3P A;  1VQ8 Q;  3M57 A;  4BAC A;  2ENM A;  3CCE A;  2FHD A;  1W1F A;  5GMK e;  2XMF A;  2OTL Q;  1MND A;  1LCK A;  4OMN A;  1AZE A;  1HXD A;  4AFQ C;  2MIO A;  3M58 A;  2R5M A;  2LC4 A;  3J80 E;  4F7U B;  1YNZ A;  2CZ0 B;  3S3O A;  1V1C A;  3QBY A;  3MO8 A;  4ANJ A;  2EQJ A;  1QVF P;  5LJ5 g;  3CC7 A;  5GAN g;  3A5Z B;  3TRE A;  3M9Q A;  2RHI A;  4MML A;  4RTZ A;  1Q81 C;  2OJ2 A;  3RIR A;  3CC2 T;  3L2Q A;  5D7U A;  4II1 A;  2KXD A;  1KHI A;  2CS7 A;  3I55 T;  4M78 D;  3I35 A;  1VQ7 Q;  2DYB A;  2XID A;  2K5F A;  2AKK A;  1IO6 A;  4LUE A;  5GAN f;  4AT1 B;  1YJ9 A;  5HK0 A;  2V8I A;  4OML A;  1OOT A;  4MZM A;  3ULR B;  3UWN A;  3HL8 A;  4LN2 A;  3FJ5 A;  2J6O A;  3DLL A;  4C0F A;  3BDU A;  1GFC A;  4M77 F;  4NL2 A;  2RB6 A;  3EGD B;  3CPW P;  1BI2 A;  1D09 B;  2CZ7 B;  1ZUY A;  2FB7 A;  2XK0 A;  3MPU B;  1QWE A;  3GLX A;  3VS7 A;  2P4R A;  3M0T A;  4KGX B;  3TQ7 P;  1M8V A;  2E65 A;  2FL7 A;  1QW1 A;  3S6W A;  4IIO A;  2ZPF B;  1NZ9 A;  2E1H A;  2XHC A;  1AWW A;  4OGC A;  1ZA1 B;  1UUE A;  2DD5 A;  4LNP A;  3PIP A;  3EG3 A;  4RTY A;  2IIM A;  3EG0 A;  2DO3 A;  1QP3 A;  2X51 A;  1SG5 A;  2BIV A;  4BE1 A;  1PD0 A;  1I4K 1;  1SRL A;  2DPP B;  5DLO A;  1GFD A;  1RAA B;  1AHJ B;  5IN1 A;  2FPE A;  4C5I A;  2YUP A;  4JS4 A;  4HCZ A;  2IG0 A;  2AKL A;  2JTM A;  3OSS C;  2RM4 A;  2YT6 A;  3FRN A;  3MEV A;  4OB1 B;  2NUP A;  5ECA A;  2A3L A;  2EQU A;  2DET A;  3HFN A;  1ZX6 A;  2WSC E;  3GBQ A;  3GOX A;  5GAO q;  2VGN A;  2ZPG B;  3L1A A;  4ELY C;  2KDS A;  2ZCF B;  2HCK A;  3PIO A;  4FSX A;  1OPL A;  3JB9 G;  1Q82 U;  3RNJ A;  4MZT A;  1VOM A;  2HEQ A;  3CC4 A;  4Q5W A;  2GQI A;  3CQT A;  4J9C A;  1VQ6 T;  4C92 F;  4XAX B;  4J9H A;  5IHK A;  3CCR Q;  1SHG A;  1UFF A;  2HBW A;  2KEA A;  2RF0 A;  1Q81 R;  2XDP A;  2HL3 A;  3VYG A;  1YHQ T;  2KT1 A;  4RG8 A;  1S72 Q;  3SDZ A;  1XQH A;  1WLP B;  3MEW A;  1K8A R;  4LD6 A;  2QTV A;  2JUF A;  2E3I A;  2LJ0 A;  2MK5 A;  4JRK A;  5KYX A;  1NEB A;  2YDL A;  4BE0 A;  2Z0W A;  2F5K A;  4IUT A;  1QCF A;  1BI0 A;  3OYK A;  3CCL Q;  2K6D A;  1ABO A;  2COY A;  5A2Q E;  3HRU A;  4J5Y A;  1YJN Q;  4NOY A;  3VS6 A;  6AT1 B;  4M7A G;  4HT8 A;  1UE9 A;  1NJI C;  2EAY A;  3A8O B;  1M90 C;  1SSF A;  3NTI A;  3H6Z A;  3L2W A;  1YJW Q;  1YBY A;  1KC8 C;  3JCM J;  4EPC A;  2GTJ A;  4EMK C;  4M78 F;  3X28 B;  4EMK B;  3LW5 E;  1M4Z A;  4PNO A;  5AYF A;  5L8R E;  1VQ8 A;  1VQ5 Q;  4E7H A;  2V1Q A;  2J6K A;  1ARK A;  2DL3 A;  5CIU A;  2CT4 A;  1RAI B;  2HL5 C;  1VQ4 Q;  1ZUK A;  3G4S T;  1QVG S;  1NJI R;  3CCS Q;  1IZ6 A;  3G6E A;  3CCQ Q;  1N5Z A;  2RQT A;  4M77 B;  5GAM j;  4ATO A;  4Z8A A;  3THK A;  2O31 A;  4LXC A;  3CEY A;  2OX7 A;  1JJ2 P;  5I2S A;  1TTH B;  2XIC A;  1EFN A;  4EMH A;  3OYL A;  2DX1 A;  1JQQ A;  2QGG A;  3OMG A;  3CME A;  3UF4 A;  4D6W A;  4NS5 A;  2PZ1 A;  2QDL A;  4C8Q C;  2DL8 A;  2V8K A;  1WDX A;  2EKO A;  3ASK A;  4C0Z A;  4LDV A;  3CD6 Q;  5CKF A;  2C0T A;  4J7I A;  5GAN 8;  2VAS A;  3VS2 A;  1N8R U;  2EQI A;  4A4G A;  5M9O A;  3LX7 A;  2FZK B;  2JMA A;  4A4E A;  1RL2 A;  2K3Y A;  1LVK A;  3OYG A;  4D8K A;  2RJD A;  3MET A;  1H64 1;  2DTI A;  2DER A;  3EHR A;  3L2Z A;  4M77 G;  2EJ9 A;  3G4S Q;  4AFZ C;  2KMT A;  2DXT A;  1WXU A;  3VJP A;  3ER0 A;  1FXX A;  2XDB A;  2KT8 A;  3CBM A;  2RI3 A;  1TSF A;  4J9D A;  1HK9 A;  2BZX A;  1H92 A;  3LGL A;  1VQ9 A;  2DTH A;  4OB2 B;  3NFC A;  2YUN A;  1U5S A;  5HCK A;  2D8J A;  2VYT A;  3LH0 A;  4OB3 B;  3EH1 A;  1SHF A;  2E70 A;  4PJJ A;  1YFN A;  2IVW A;  2CT3 A;  1N8R R;  2L5Q A;  1MGQ A;  4QVZ A;  5D6X A;  4FT2 A;  1UJ0 A;  1AOJ A;  2E4H A;  3OYE A;  1WXB A;  2EGE A;  4C92 G;  3C12 A;  4EDU A;  1Y7X A;  4B9X A;  3FB9 A;  2YWW A;  3EGX A;  2E3H A;  4ESR A;  2YHT A;  2EJG A;  4BI4 A;  1Y0M A;  1Q86 U;  4AFU C;  2O9V A;  2D0N A;  2EQM A;  2WSF E;  2KGT A;  2BTT A;  5LJ5 d;  4JLG A;  2QK0 A;  3QO3 A;  4DA4 A;  4FCY A;  4M7D B;  1OU8 A;  2XD0 A;  4JRI A;  1JEG A;  3QJY A;  5FU6 B;  2MI6 A;  4AG1 C;  1NEG A;  2NUZ A;  1PSF A;  4RMO A;  1IHV A;  5IHI A;  2MPX C;  2RD1 A;  3URG A;  3HKS A;  1IXD A;  2F2X A;  4M75 A;  1WHJ A;  1VQM Q;  2JJ9 A;  1OI1 A;  1UG1 A;  2CP7 A;  1VQK T;  5AT1 B;  5A0L A;  5GAN j;  3QWX X;  5C0M A;  4PJO E;  3OW2 P;  4Y28 E;  1KK7 A;  2A28 A;  4KUL A;  4A54 A;  3GIB A;  1C0M A;  2DXC A;  2CDT A;  1JXM A;  2DFU A;  1JJ2 A;  1YJ9 T;  2R57 A;  1BCO A;  1D3B B;  3J7A F;  4M4Z A;  5KYN A;  1M2V A;  2DL5 A;  4X34 A;  3CC4 T;  1VIE A;  4HVV A;  2SEM A;  3FC3 A;  1YJN T;  2EWN A;  5GAO n;  4GBQ A;  4F7U A;  2IPO B;  4BE2 A;  1TU0 B;  3QYH B;  1BU1 A;  1GBQ A;  4PJO C;  2OTJ A;  3JCM c;  2C0O A;  2E6N A;  3CXC S;  5GAN 7;  5IXB A;  2J7I A;  2XU8 A;  3OYJ A;  1M90 U;  2RHY A;  1VQN T;  2E10 A;  3EG2 A;  3C4S A;  4K11 A;  5FWB A;  3JB9 I;  5J3B A;  2KRM A;  5FU7 B;  4YTL A;  2HSP A;  4EMG A;  1K8A C;  4XTU A;  3LGF A;  3X20 B;  3CCS T;  2EGC A;  2HD0 A;  1U1T A;  4RCB A;  3QSU A;  2OI3 A;  2KRN A;  4R0K A;  1K1Z A;  1YJW T;  1WPY A;  2FZG B;  5J26 A;  4ELZ C;  3G71 A;  1OUL A;  1ABQ A;  3JB9 D;  3OY9 A;  3SWN A;  2EYY A;  2RI5 A;  4JLI A;  4M7A F;  2CZ6 B;  1YN8 A;  3G6E Q;  1YCS B;  1LPL A;  2H3E B;  3QPH A;  4E6R A;  1M3B A;  1U8R A;  2M1H A;  4E2F B;  4R55 A;  2A36 A;  1IRE B;  2DBM A;  2H8H A;  5KYU B;  3CC7 T;  1VQ4 A;  3I55 Q;  1FMK A;  5LJ3 g;  2DK3 A;  2QAS A;  3JCM Q;  1GCQ A;  1WHH A;  1YI2 T;  3I56 T;  4DBQ A;  1W2B A;  1OZ2 A;  2KQW A;  1EZZ B;  1KD1 U;  3OBY A;  1M2O A;  3F70 A;  4DEX A;  1VQP T;  3OYY A;  4OB0 B;  3CCU T;  3RDV A;  5GAM e;  3EGU A;  2E6Z A;  2XI9 A;  1MMA A;  2JTE A;  4QQ6 A;  4QVC A;  1GXI E;  4XU0 A;  1TS9 A;  1AWX A;  3R6O A;  2LNH B;  4M75 C;  2HBP A;  2QA4 A;  4C8Q E;  1KSW A;  2RHU A;  3RKW A;  5EC7 A;  4C5H A;  4M7D F;  2LP5 A;  4PKC C;  2I0N A;  1B7T A;  2A08 A;  2G6F X;  3JCM d;  3INZ A;  2CP2 A;  4RTU A;  2P0P A;  1M1K U;  3G71 Q;  4RUG A;  3MP8 A;  1YIJ A;  3PT9 A;  1YWP A;  1QP2 A;  5FRM A;  1BIB A;  3BDL A;  3CME T;  2ATC B;  5GAN 2;  1ZSZ C;  2W10 A;  2L89 A;  2O01 E;  1JJ2 S;  2P0K A;  2CGH A;  3LLR A;  4M75 D;  2DJZ A;  1WJQ A;  2QEX Q;  4BDZ A;  4C8Q D;  1QVG A;  2DTO A;  3CD6 T;  3U23 A;  3KUF A;  2FPD A;  1PKS A;  1I5O B;  1ACM B;  3CCQ T;  2RJC A;  1QQJ A;  4M75 F;  4VUB A;  1UGS B;  1Q81 U;  2DAQ A;  3M0R A;  1F1B B;  3OQ5 A;  3MP6 A;  1WGS A;  1N6A A;  1EX4 A;  4M7D C;  3CMA A;  3VYH B;  3EAE A;  1B3Q A;  3CCU A;  2OAU A;  3P8D A;  3JCM g;  3TVT A;  3NTH A;  3A8H B;  4F7U F;  5CAI A;  3I5R A;  2OAW A;  3RKY A;  2OTL T;  4ZN3 A;  2BZY A;  5D6Y A;  4KGV B;  1Y71 A;  1EIF A;  1B07 A;  2I2L A;  1OU9 A;  2DMO A;  4RKU E;  4D8D A;  2LZ6 B;  2KYB A;  4FL6 A;  2NLU A;  4UC4 A;  3CPW A;  2DRK A;  3NMZ C;  3HHT B;  3SWN B;  2EIF A;  1MMD A;  4KH0 B;  2BKD N;  2L3Q A;  4A4K A;  1WHL A;  2DEQ A;  5CO7 A;  4XQ3 A;  2M0Y A;  4Z88 A;  2EW3 A;  1BI1 A;  1NPP A;  2BE9 B;  2YUQ A;  4HXJ A;  5GAN e;  3VRY A;  1IGU A;  2GFU A;  2RPN A;  1WHM A;  2LT4 A;  4QQD A;  3OS5 A;  2X3W D;  3CCM Q;  3KBG A;  1YJN A;  3EG1 A;  4NL3 A;  2Y90 A;  2KE9 A;  4B6M A;  1K9M C;  1X2Q A;  3CMA Q;  4F16 A;  2JW4 A;  1JBM A;  3OYB A;  1N9R A;  2K57 A;  2JT4 A;  4Y91 A;  1KC8 R;  4M78 C;  2DD4 A;  4OF1 A;  3VRZ A;  4P5N A;  4C92 B;  1VQO A;  2RI2 A;  5GMK l;  1VQK A;  4JZ3 A;  3O8V A;  2B86 A;  2DVJ A;  2CRE A;  2W0Z A;  3CMA T;  1FX7 A;  1TXQ A;  1MUZ A;  2CP0 A;  1HSQ A;  1KG1 A;  2WSE E;  4FW1 A;  1LJO A;  1ZBX A;  4DEY A;  3E2U A;  3O5Z A;  1G8X A;  2L0A A;  5KYX B;  1VQ5 T;  2K2V A;  3ZFJ A;  1QCO A;  3OYH A;  2RJE A;  2FZC B;  3LYI A;  3JAM E;  2RHZ A;  1ZBJ A;  1VQL Q;  1DJ7 B;  1P92 A;  2XKO C;  5FWC A;  2DXB A;  2P4T A;  1BBZ A;  1PG5 B;  1VQ6 Q;  2YSQ A;  2COZ A;  1FMW A;  2KNB B;  2EYW A;  2EPD A;  1YP5 A;  2L3R A;  4C8Q F;  4Z89 A;  3HPW A;  3ZBD A;  1KJW A;  3TCJ A;  1JB0 E;  1ZSG A;  5KCO A;  2GFA A;  4F7U E;  2KI7 A;  4LDY A;  3BW1 A;  2M9U A;  1VQN A;  4HCK A;  2M16 A;  3UA7 A;  5CK9 A;  4M7D A;  4BY6 B;  2QQ9 A;  1G3S A;  3CPF A;  4OMQ A;  1UGQ B;  4QQG A;  1NLP C;  4OGE A;  1KFZ A;  1U06 A;  4LDW A;  2KBT A;  4KUD K;  3REB B;  1UEB A;  3JCM h;  2DYI A;  2DJQ A;  3S3N A;  4PJO A;  3OA6 A;  3TEE A;  2JM8 A;  3SEM A;  4JJN K;  2E5Q A;  1WI7 A;  1QLY A;  4Y92 A;  4IUU A;  2PTK A;  2YRV A;  1T0J A;  5GMK j;  3REA B;  4BD3 A;  3UAT A;  1Q86 R;  2NWM A;  5EG2 A;  1RLP C;  4BI3 A;  1R0B G;  5CKD A;  3QUI A;  4QVD A;  1A0N B;  2YXY A;  2CSI A;  2V26 A;  2L3S A;  2GQV A;  1RAB B;  3H41 A;  2OTJ Q;  2XDD A;  5KE2 A;  3JB9 H;  4XU3 A;  3E1S A;  4PJO F;  1Y96 B;  2GGR A;  1BYM A;  2ESW A;  3JCM f;  2F2W A;  4J9F A;  5GAO l;  4ORZ A;  2VC8 A;  1KHC A;  2LDM A;  3L42 A;  3RKX A;  2JNG A;  3CC2 A;  5I11 A;  2JN0 A;  1YIT T;  2EFI A;  3G6E T;  1G3T A;  2KY9 A;  1I8F A;  1TUG B;  2DM1 A;  4ZGD B;  4F14 A;  1CKB A;  3P8B B; 
#chains in the Genus database with same CATH homology
 1M5Q 1;  3L2U A;  5C0M A;  3OYA A;  4L5G A;  4PJO E;  3I55 A;  3GIB A;  4Y28 E;  4KUL A;  4A54 A;  1B34 A;  4O5V A;  2DXC A;  3CCE T;  3OYI A;  3HSB A;  2WAC A;  3QXE B;  1O75 A;  3SD4 A;  1JJ2 A;  2PVO B;  3CBP A;  1VQ5 A;  5CKB A;  4TVR A;  2R57 A;  1YJ9 T;  1D3B B;  3VV0 A;  1X75 C;  3SB2 A;  3C94 A;  5GAN 3;  3J7A F;  2JOY A;  3CCJ T;  3FDR A;  3SFM A;  3JB9 F;  1TH7 A;  4X34 A;  2O4X A;  2PVD B;  1VIE A;  2QQA A;  3GNG A;  4IUR A;  2QEX T;  3CC4 T;  3JCM e;  4F7U G;  2QA4 T;  2MF2 A;  2RJF A;  4M75 E;  3FC3 A;  2EWN A;  1U1S A;  3M5A A;  5GAO n;  1YJN T;  2GF7 A;  4MMK A;  4J7F A;  4F7U A;  5GAN h;  2GCX A;  3CCV A;  1KQS S;  2FVU A;  4BE2 A;  5GAN 5;  1W2B S;  4Z02 A;  2BUD A;  4HCB A;  3JSC A;  1VQ6 A;  3LWI A;  4IUV A;  5CQY A;  3QYH B;  3M57 A;  4BAC A;  3CCE A;  4PJO C;  2FHD A;  3A8M B;  4LDX A;  1V29 B;  2OTJ A;  3GNF B;  5GAN 6;  2DIQ A;  5GMK e;  3JCM c;  2E6N A;  3CXC S;  1WQ7 A;  1OYX A;  5GAN 7;  2E41 A;  4M75 B;  3DB4 A;  4M78 E;  5DY9 A;  1G5V A;  4GLK A;  1HXD A;  3E9F A;  2HQE A;  2VUB A;  3M58 A;  2XU8 A;  3MP1 A;  4B9W A;  2MAM A;  5CCA A;  3OYJ A;  1M1F A;  2R5M A;  1H3Z A;  2RH2 A;  1YJW A;  2LC4 A;  1VQP A;  3ZEH A;  1M90 U;  3J80 E;  2RHY A;  4F7U B;  3OW2 S;  1YIT T;  1VQN T;  2E10 A;  4BY6 C;  3V7C A;  2CZ0 B;  4M7A D;  3C4S A;  5C6S A;  3S3O A;  1VQ9 T;  3QBY A;  3OYM A;  5IAY A;  4M77 C;  1WJS A;  1Y96 A;  3S3M A;  3MO8 A;  4ZTJ A;  4M7D D;  3JB9 I;  5KE3 A;  2YLB A;  5J3B A;  3JCM X;  2EQJ A;  4IUP A;  5FU7 B;  4XTX A;  1D3B A;  4YTL A;  2QTX A;  3ME9 A;  4A4H A;  4EMG A;  5LJ5 g;  3CC7 A;  3JCM W;  4XTU A;  2ZPB B;  5GAN g;  3LGF A;  3X20 B;  3A5Z B;  3OS1 A;  1S72 T;  3CCS T;  3TRE A;  2VGM A;  4FT4 A;  3M9Q A;  1VQO T;  2RHI A;  1OZ3 A;  2HD0 A;  5GAO p;  4MML A;  2KVQ G;  2X4W A;  3HRT A;  1U1T A;  3RIR A;  1Q81 C;  4RCB A;  3QSU A;  3X24 B;  3CC2 T;  3L2Q A;  3WXM B;  1YI2 A;  1YJW T;  1WPY A;  3CXC A;  4II1 A;  1KHI A;  4XTV A;  2CS7 A;  5J26 A;  4ELZ C;  5GAO r;  2A7Y A;  3G71 A;  4C92 D;  5KCH A;  4C8Q G;  1VQ7 A;  3JB9 D;  3I55 T;  1N27 A;  1O9S A;  3OY9 A;  3SWN A;  2LRQ A;  3X26 B;  4C0D B;  2RI5 A;  4M78 D;  2M0O A;  1Q82 C;  5I2M A;  4JLI A;  2XID A;  2K5F A;  5LJ5 f;  5LJ5 h;  5GAN f;  4M7A F;  3PNW C;  3VUB A;  3VKI A;  5HK0 A;  1YJ9 A;  1VQ7 T;  2CZ6 B;  2V8I A;  3CCJ A;  3PGG A;  4MZM A;  3UWN A;  3QPH A;  3MCA B;  1U8R A;  3CCM T;  2M1H A;  3V8J A;  4R55 A;  1Q86 C;  3HL8 A;  4MDW A;  1IRE B;  5J39 A;  4PLI A;  3DLL A;  1Q7Y C;  4XTZ A;  3CC7 T;  2EQK A;  4M77 E;  5FRO A;  4DQ2 A;  4OP0 A;  4C0F A;  1VQ4 A;  3GPL A;  1M1K C;  1Y07 A;  4BB7 A;  4M78 G;  3BDU A;  5LJ3 g;  4J83 A;  2DK3 A;  4J6Y A;  3JCM Q;  4M77 F;  4DOV A;  3UT1 A;  1QVF A;  4NL2 A;  1PSE A;  1YI2 T;  2RB6 A;  3I56 T;  1BI2 A;  2CZ7 B;  4PL6 A;  1W2B A;  1UB4 A;  3V8K A;  2EYQ A;  1OZ2 A;  2FB7 A;  2LQ8 A;  2KQW A;  2PQW A;  3BY7 A;  4L6V 5;  4ZGJ B;  2K5I A;  4E7L A;  2XK0 A;  1UGP B;  2X35 A;  2X4J A;  1KD1 U;  3OBY A;  4GY5 A;  3F70 A;  1VQP T;  3OYY A;  4C8Q A;  4OB0 B;  4C5G A;  3OYF A;  1KQ2 A;  3CCU T;  5GAM e;  3GLX A;  2PUO B;  4HA8 A;  2LVM A;  2E6Z A;  2XI9 A;  1M8V A;  2E65 A;  2FL7 A;  5LJ5 e;  3L2R A;  1QW1 A;  3S6W A;  1B34 B;  4OMF B;  2ZPF B;  4PJO B;  4QQ6 A;  1NZ9 A;  1I81 A;  2E1H A;  2LX9 A;  4QVC A;  2HQX A;  2XHC A;  1GXI E;  4OGC A;  4XU0 A;  2DD5 A;  3R6O A;  4M75 C;  3PIP A;  1XOV A;  3EFS A;  1UGR B;  2HBP A;  1MHN A;  4JRQ A;  3QZ9 B;  5CKH A;  2QA4 A;  4C8Q E;  1M90 C;  4M7A C;  3M4Y A;  2DO3 A;  1QP3 A;  2RHU A;  3QHS A;  2BIV A;  4KBM B;  2DZC A;  3RKW A;  3J81 E;  1I4K 1;  4BE1 A;  2XDB A;  4C5H A;  4C92 E;  1KD1 C;  4M7D F;  4X9D A;  3P8H A;  4V2S A;  4PKC C;  2DPP B;  4XU2 A;  5CQX A;  5DLO A;  5GAM h;  3OW2 A;  1AHJ B;  5LJ3 d;  3JCM d;  5IN1 A;  4C5I A;  3WVE B;  3INZ A;  4JS4 A;  1VUB A;  4HCZ A;  2IG0 A;  4QW2 A;  3UPU A;  3DKM A;  4ME7 A;  2P0P A;  2JTM A;  3DB3 A;  1M1K U;  3OSS C;  2RM4 A;  2V8J A;  2P0Q A;  3MP8 A;  1YIJ A;  5KH6 A;  3PT9 A;  3MEA A;  3QJ6 A;  5FU6 C;  1QP2 A;  3FRN A;  3MEV A;  4OB1 B;  5FRM A;  1BIB A;  3BDL A;  1YIT A;  2A3L A;  2EQU A;  2H3J A;  3HFN A;  2DVE A;  4DOW A;  3CME T;  2FYK A;  2WSC E;  5GAN 2;  4M78 B;  2PUK B;  3GOX A;  5GAO q;  2VGN A;  2QI2 A;  2ZPG B;  2L89 A;  2O01 E;  3CBO A;  3L1A A;  4BUG A;  2P0K A;  4ELY C;  2CGH A;  2KDS A;  2ZCF B;  3LLR A;  3GP8 A;  1N8R C;  1M9S A;  3G7Z A;  3QII A;  1FWZ A;  3PIO A;  4M75 D;  4BDY A;  2DJZ A;  4FSX A;  1WJQ A;  4BDZ A;  3JB9 G;  5HY6 A;  4C8Q D;  3L2V A;  2KSS A;  1Q82 U;  2X4Y A;  1KQ1 A;  4MZT A;  4CRI A;  3OYC A;  1YHQ A;  1QVG A;  2DTO A;  3OB9 A;  1VQL A;  1Q7Y U;  3OS0 A;  3CD6 T;  3KUF A;  4C5E A;  5HKC A;  2QEX A;  3CC4 A;  4JUV A;  3OSV A;  4Q5W A;  2EJF A;  1YCY A;  4FM4 B;  1G3W A;  3CCQ T;  3PMI A;  5IT9 E;  2RJC A;  4M75 F;  2PU9 B;  4VUB A;  4C92 F;  4XAX B;  1VQ6 T;  3RER A;  1QVP A;  4M7D E;  2ZGW A;  1UGS B;  2KK4 A;  1Q81 U;  1VQL T;  2DAQ A;  3OQ5 A;  2LCL A;  3MP6 A;  1WGS A;  3E9G A;  4M77 D;  2Y4X A;  1N6A A;  4M7D C;  3CMA A;  3CCL T;  1NE8 A;  3VYH B;  3G71 T;  3EAE A;  3OMC A;  1JJ2 S;  2PVG B;  3C95 A;  2XDP A;  2L8D A;  3CCU A;  1K9M U;  2OAU A;  2QQS A;  3A8G B;  4JS5 A;  3P8D A;  3JCM g;  2VV5 A;  3VYG A;  1YHQ T;  4RG8 A;  3NTH A;  3A8H B;  3SDZ A;  1XQH A;  4F7U F;  5CAI A;  3MEW A;  4LD6 A;  3RKY A;  2DZ9 A;  2JUF A;  3FEO A;  4C92 C;  4ZN3 A;  2OTL T;  5D6Y A;  3M4G A;  2MMP A;  1Y71 A;  1EIF A;  2Y4Y A;  4JRK A;  4HT9 A;  4BE0 A;  2F5K A;  2I2L A;  4E7J A;  4IUT A;  4RKU E;  1BI0 A;  3QG1 A;  3OYK A;  1W4S A;  1VQ4 T;  4L59 A;  1KC8 U;  2DKG A;  4FL6 A;  4ZN1 A;  3MEU A;  2NLU A;  3HRU A;  3FJP A;  4J5Y A;  4UC4 A;  4WF2 A;  5A2Q E;  3CPW A;  4NOY A;  3LWH A;  4HKE A;  3HHT B;  5LJ3 h;  4C8Q B;  4M7A G;  3M53 A;  4HT8 A;  3SWN B;  2DXU A;  4RG2 A;  2YLC A;  3OBW A;  2EIF A;  1NJI C;  2EAY A;  3A8O B;  3HRS A;  3M59 A;  1BKB A;  1SSF A;  2BKD N;  3NTI A;  3PTA A;  4E7I A;  3H6Z A;  3L2W A;  2RA2 A;  3FLG A;  4M75 G;  3RUX A;  5GMK h;  3KXT A;  3JB9 J;  1VQM T;  4A4K A;  2DEQ A;  3CCS A;  4JDS A;  5CO7 A;  4M7A B;  1YBY A;  4XQ3 A;  5GAO m;  3JCM J;  1KC8 C;  4EPC A;  2ZPE B;  4J6W A;  3OYN A;  3MHX A;  1BI1 A;  4EMK C;  5GMK m;  1NPP A;  1ZHI A;  2OTL A;  2HNI A;  3HP9 A;  4M78 F;  3X28 B;  4LD9 K;  1ZQ1 A;  4EMK B;  5GAN 4;  4J6X A;  3LW5 E;  5GAN e;  3JCM P;  1NJI U;  1M4Z A;  5GAN d;  4PNO A;  5AYF A;  5L8R E;  2GFU A;  1VQ8 A;  3Q1J A;  3CCV T;  2VXE A;  3E19 A;  2LT4 A;  5DM7 R;  4E7H A;  2KAF A;  4QQD A;  2JTF A;  3OS5 A;  1RI0 A;  3KBG A;  2MWO A;  4X9C A;  1YJN A;  3JCM b;  4NL3 A;  2Y90 A;  1WQW A;  4O6J A;  2JVV A;  2CYZ B;  4OVA A;  3EFR A;  5CIU A;  1K9M C;  3PFS A;  2RK1 A;  3CD6 A;  1XNI A;  1JBM A;  3OYB A;  3G4S T;  1K8A U;  1N9R A;  1WNL A;  2K57 A;  4Y91 A;  1R8O B;  1QVG S;  3WVD B;  4M78 C;  1IZ6 A;  2DD4 A;  4M7A A;  4OF1 A;  4IKF A;  2K4Y A;  3G6E A;  4FIB A;  4N4H A;  2R5A A;  4M77 B;  5GAM j;  4ATO A;  1S72 A;  2F69 A;  5CKE A;  4N0A C;  3I56 A;  4P5N A;  4C92 B;  1VQO A;  2RI2 A;  3CEY A;  5GMK l;  1VQK A;  3O8V A;  2LQK A;  5I2S A;  1K73 C;  4ZGE B;  1N9S A;  3CCM A;  1K8A C;  3CCL A;  3CMA T;  1FX7 A;  3NTK A;  2XIC A;  2RHX A;  3QZ5 B;  1KG1 A;  2WSE E;  4EMH A;  1X6O A;  5A0D A;  3OYL A;  1NPR A;  4MDX A;  3OMG A;  1LJO A;  4XU1 A;  1ZBX A;  3VUZ A;  3CME A;  4CI0 C;  4D6W A;  3OYD A;  5LJ3 e;  2AHJ B;  4N0A A;  4NS5 A;  4E7K A;  4KT0 E;  1VQ5 T;  2O4X B;  4C8Q C;  4M7A E;  2K2V A;  3ZFJ A;  2V8K A;  3SWN C;  3OYH A;  2EKO A;  2RJE A;  3ASK A;  3LYI A;  4C0Z A;  4XTW A;  3M54 A;  4LDV A;  2RHZ A;  4M78 A;  3JAM E;  2ZPH B;  4C0D C;  1DJ7 B;  5CKF A;  4BI8 B;  4J7I A;  3V7S A;  5GAN 8;  1P92 A;  4C0G A;  3TU4 K;  3RES A;  2XKO C;  2RO0 A;  2DXB A;  5LJ5 j;  2P4T A;  1N8R U;  4A4G A;  5M9O A;  3LX7 A;  4E47 A;  5LL6 S;  4A4E A;  3CCQ A;  1RL2 A;  2K3Y A;  3OS2 A;  3OYG A;  3V8L A;  5DLQ E;  2DIG A;  2RJD A;  4J8O A;  3CCR A;  3MET A;  4C8Q F;  2L3R A;  1H64 1;  2DTI A;  4RCC A;  3HPW A;  3L2Z A;  3ZBD A;  4M77 G;  2EJ9 A;  1JB0 E;  2E64 A;  3TCJ A;  3PMT A;  2KMT A;  5LJ3 j;  2DXT A;  5KCO A;  1KQS A;  4M77 A;  3VJP A;  2B8A A;  3ER0 A;  1FXX A;  2GFA A;  3VU3 C;  3X25 B;  4LDY A;  4EMK A;  3BW1 A;  3CBM A;  2RI3 A;  4F7U E;  2G3R A;  2M9U A;  3AHU A;  1VQN A;  1JRI A;  1HK9 A;  2M16 A;  2LT1 A;  2D9T A;  2LCC A;  2E12 A;  3LGL A;  1VQ8 T;  5LJ3 f;  5CK9 A;  2C06 A;  1VQ9 A;  4XK8 E;  4M7D A;  2DTH A;  4BY6 B;  2QQ9 A;  4OB2 B;  3RMQ A;  5I21 A;  3NFC A;  1G3S A;  3CPF A;  5GAM g;  1UGQ B;  2VYT A;  2X4X A;  4IUQ A;  4N4I A;  3LH0 A;  4OB3 B;  4QQG A;  1YIJ T;  2QQB A;  4PLL A;  4OGE A;  4N4G A;  3T9N A;  2E70 A;  4LDW A;  2IVW A;  4PJO G;  4KUD K;  5GAM d;  1X01 A;  2HAX A;  5HK3 A;  1UEB A;  4MZP A;  3JCM h;  3G4S A;  2QQR A;  3CPW S;  4PJO D;  1BI3 A;  3S3N A;  4PJO A;  2L5Q A;  3TEE A;  3OA6 A;  2F5T X;  1LNX A;  4JJN K;  2D0Q B;  2E5Q A;  1MGQ A;  4QVZ A;  4XTY A;  4FT2 A;  5D6X A;  3H8Z A;  2OTJ T;  2ZPI B;  2LNV A;  4IUU A;  5CR2 A;  3CCR T;  2YRV A;  3OYE A;  4R56 A;  4C92 A;  5D6W A;  3N5B B;  3JRZ A;  5GMK j;  4BD3 A;  3QDR B;  2D6F A;  5GAM f;  2MWP A;  4C92 G;  3C12 A;  4EDU A;  1Y7X A;  2VXF A;  5EG2 A;  4JRP A;  1XTD A;  3FB9 A;  4B9X A;  4BI3 A;  5CKD A;  3UDC A;  3QUI A;  5CVI A;  2YHT A;  2EJG A;  3QYG B;  4QVD A;  4ZTF A;  2QXF A;  1VQM A;  4BI4 A;  3RMS A;  3M56 A;  5FLX E;  1Q86 U;  1I5L A;  1WJR A;  2EQM A;  2WSF E;  2GQV A;  4HCC A;  5FRN A;  3V7R A;  4M7D G;  5LJ5 d;  5A0G A;  2XDD A;  2CZ1 B;  3GF5 A;  5KE2 A;  3JB9 H;  1VIF A;  4JLG A;  3QO3 A;  4DA4 A;  4XU3 A;  3E1S A;  4PJO F;  1Y96 B;  1BYM A;  4M7D B;  3JCM f;  3HFO A;  1K73 U;  1M1G A;  2CKK A;  2ZZD A;  2XG8 D;  4JRI A;  3QJY A;  5GAO l;  2VC8 A;  2MI6 A;  5FU6 B;  2XD0 A;  2R58 A;  1KHC A;  1LOJ A;  2LDM A;  3L42 A;  3RKX A;  2JNG A;  4LDU A;  3CC2 A;  3A8L B;  1PSF A;  2JN0 A;  4FU6 A;  4RMO A;  3JCM V;  2EFI A;  4KUI A;  3G6E T;  1G3Y A;  2K5L A;  2RD1 A;  3HKS A;  5FU7 C;  1G3T A;  2LTO A;  4M75 A;  3URG A;  1QVF S;  1BIA A;  2KY9 A;  4A4F A;  4A53 A;  3BFM A;  1I8F A;  3M55 A;  2RK2 A;  2JZ2 A;  5GMK i;  1OI1 A;  2QDY B;  1VQK T;  2K3X A;  4ZGD B;  3FIF A;  3QKJ A;  5A0L A;  5GAN j;  3DLM A;  3P8B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...