5DLOA

S. aureus mazf in complex with substrate analogue
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
114
structure length
114
Chain Sequence
PIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIRTLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate recognition, regulation mechanism and activity regulation of MazF mRNA interferase.
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 114
sequence length 114
ec nomenclature ec 3.1.-.-:
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dloA00
5CQXA 4VUBA 1X75C 4ELZC 5HK3A 1M1FA 4MZMA 5CR2A 1NE8A 2KMTA 3JRZA 2VUBA 2C06A 1UB4A 3VUBA 4ELYC 5HK0A 4MZTA 1VUBA 5DLOA 2MF2A 3G7ZA 4ME7A 5CCAA 5CK9A 5CKFA 4MZPA 3JSCA 5CKBA 5HKCA 4HKEA 5CO7A 5CKEA 4MDXA 3NFCA 3TCJA 4OF1A 5CKDA 5CKHA 5CQYA 3HPWA
chains in the Genus database with same CATH superfamily
3CQTA 2RM4A 2EW3A 3J7AF 3OS2A 2VWFA 2RQUA 3E19A 3QWYA 1O75A 1IGUA 3V7RA 3QXEB 5GAMg 4IKFA 4II1A 1ZX6A 2RQTA 2J6KA 2ESWA 2NUTB 3INZA 1VQ7T 1AWOA 2GQIA 1LCKA 3RDVA 1OZ2A 3M59A 4PJOC 2E6ZA 1DJ7B 1K0SA 2P4RA 2Y90A 2VXEA 2DZ9A 1K8AR 2IIMA 3CCUA 3CC2T 5KYUA 4QKUA 2VXFA 2L8DA 3H41A 5GMKh 3HFNA 2LTOA 4M78G 4FYWB 2D6FA 4FW1A 5KYWB 2EGAA 4PJOD 2MWOA 1PCXA 1XNIA 1K4US 3CCSA 1OZ3A 3QBYA 2RH2A 1UFFA 1CKBA 2DXUA 3NTIA 2JZ2A 3RR6A 3V7CA 4M77A 3U23A 1HYOA 2QTXA 1M9SA 4BY6B 4NL3A 1TXQA 4XU0A 3CPFA 1JRIA 2C0TA 2EQKA 4M75B 2EIFA 3CD6Q 4BDYA 4CI0C 2YHTA 2ECZA 1XJWB 2DD4A 3UT1A 3URGA 3UWNA 2DO3A 1WXUA 2IPOB 3CMAT 1M1FA 3QYGB 1IRXA 1VQ9T 1IB8A 3DB4A 2YUQA 1UECA 4ZNXA 3IQLA 2KI7A 5L23A 1VQ4A 4E2FB 5LJ5j 1S72A 3G7ZA 5CCAA 3M4YA 4MZPA 1YI2A 3PVQA 2DFUA 4C8QE 2VGNA 5GAN5 1LNXA 4DBQA 1WI7A 2C0OA 2QTVA 3JCMd 1ZQ1A 3OYIA 1I4K1 4F7UF 2P4TA 1SEMA 5KYXA 2WACA 3PTAA 2CZ0B 4C0ZA 2QDYB 2OX7A 4AT1B 5GJVB 2ENMA 9ATCB 5EG2A 3UA6A 1QP3A 3FLGA 1YJNQ 2FZCB 1YIJT 5AT1B 3HSBA 5I11A 1R77A 3CPWP 4ATOA 3TCJA 1RL2A 4BUGA 4FT2A 1WHJA 4OMFB 4LDXA 3VJPA 4Z02A 3L2VA 1B3QA 2X4JA 2RHXA 2DX1A 4J7IA 1YWPA 1ZSZC 1OQKA 3I56A 2JTMA 1BI0A 2DL5A 2HSEB 1U3OA 2JS2A 4PJOB 1C0MA 3GLXA 3CCVQ 2CT4A 1TU0B 3UPUA 4EDUA 1PNJA 3E9FA 2RHYA 1YITT 4IUQA 2E1HA 2RHZA 3C12A 1VQ6Q 2K2MA 3T9NA 2YLBA 1WHMA 3LYIA 1NJIR 2G6FX 3HL8A 2DM1A 2O4XB 2FEIA 1VQOT 1BK2A 2ZGWA 1TUCA 2BUDA 5LJ5f 3OYHA 3CCLQ 2BIVA 1UGQB 3QZ9B 3CCJA 4DOWA 4LDWA 3OS1A 3L2RA 2QI2A 1MV0B 2DXCA 2H3JA 1KHCA 4LXCA 2V8KA 2JW4A 4HXJA 3VS7A 3M5AA 1CSKA 4R0KA 4NL2A 3ME9A 2DXTA 5GAOp 3EH1A 3UDCA 4M75G 1XTDA 4M7DG 1W1FA 4D8DA 3CPWA 2XD0A 2EWNA 1LPLA 1X2QA 3FRNA 2OTLT 1VQKT 2DBKA 1EFNA 2OTJQ 1QMCA 1VQPT 3VRZA 1T0JA 3S6WA 3QDRB 3V8KA 4E47A 3VYGA 2RHIA 4QQ6A 1QVPA 2CUDA 3C95A 2YUNA 3RMSA 1ARKA 1NJIC 4A63B 1S1NA 3M9QA 2V8JA 4IIOA 3A8GB 3OYYA 2EGEA 1HD3A 3OW2P 2RI5A 1JBMA 3OMGA 7AT1B 1G3TA 3EGDB 1WPYA 1NJIU 2RPNA 2LX9A 3OYMA 4RUGA 2RB6A 1YNZA 2D9TA 2LRQA 3GBQA 1ACMB 3PE0A 3JB9J 4EMGA 3ZEHA 4OMPA 1TOVA 4EPCA 3SD4A 4RTXA 1N8RR 4M7DE 1ZSZB 2D1XA 2RK1A 3EHQA 3I55A 3RMQA 4QVZA 5I2MA 1MHNA 3E2UA 4FT4A 3A8OB 2KBTA 1G8XA 4PJOG 4WCIA 5KYNA 1C1AA 1MMDA 5D7UA 5GMKe 3CCMA 4KUDK 1H92A 1TH7A 1OOTA 3FC3A 4J83A 4PL6A 1B34A 5ECAA 3OYCA 2P0PA 3L2WA 2KVQG 2PUKB 2P84A 1M2VB 5FLXE 2XKOC 2K5IA 2LQWA 5GAMj 4GY5A 2PNIA 1WDXA 2J6OA 4A54A 2COWA 1IO6A 1SSHA 5FWBA 3G71T 1QQJA 2QDLA 1Y7XA 2JS0A 2ROLA 1FMWA 4DOVA 2FHDA 4MDXA 3OW2A 1X27A 4KGXB 3R6NA 3QSUA 3MCAB 3JV3A 2R5MA 1BKBA 2DTHA 2MOXA 5A0DA 1PD1A 2QA4A 3UATA 3X24B 2KGTA 3SFMA 4CRIA 2FL7A 2M02A 3A8MB 1NE8A 8AT1B 4CC2A 4LD9K 3VS6A 1X69A 1RABB 4BE2A 2CZ1B 2XDPA 2DTIA 2IG0A 2KE9A 2P0QA 1SKUB 3X28B 1KC8C 4JLIA 2NUPB 1VQ5T 3N5BB 3EG1A 5LJ5h 2JTEA 3BFMA 1U5SA 2E12A 1G5VA 4FU6A 4FSXA 3TREA 2KMTA 3JRZA 3CCRT 4MZTA 3GIBA 3PIOA 1VQ7A 1M3AA 1UTIA 2XDDA 1RAIB 1W6XA 2F2WA 4AG1C 4C8QC 1RADB 2MCNA 2E10A 2QEXQ 1X6OA 2MMPA 3QUIA 3C94A 4JRPA 3JAME 3PMTA 2K7AA 2KXCA 1X6BA 5HK3A 2KR3A 2XK0A 4WF2A 1YFNA 4F7UA 2V1QA 1YJ9T 1VQMT 2K2VA 3CBOA 1IGQA 2HCKA 4RTYA 3LW5E 1JO8A 4C8QD 2QYZA 5CKFA 4LN2A 3CCQT 1KFZA 5GMKi 2Y4XA 5HY6A 1AT1B 1N6AA 4FL6A 4RCCA 1RAAB 5KYUB 5KYYB 4KGZB 4UC4A 3ZFJA 4OB0B 1QW1A 2CZ6B 5FRNA 4C8QF 3H0HA 4GLMA 2RJCA 1WJQA 4FIBA 5GAOl 1C6VX 1K0XA 3SB2A 1NPPA 3QYHB 1OULA 2B8AA 3CMAA 3J81E 3HRTA 3BDUA 3GPLA 2DTOA 1NG2A 2DYBA 1YJWQ 4M77B 1ZUKA 2LQ8A 1Q82C 1OV3A 2AHJB 1UB4A 4FYYB 5EC7A 1GCQA 4ZN3A 1MMGA 3QWXX 1YBYA 1NYFA 5GAOm 6AT1B 1WA7A 1R0CB 1VOMA 1M8MA 1X6GA 1P92A 2V1RA 2O2OA 1J3TA 1GCPA 3CCSQ 1W2BP 1ZUYA 2Z0WA 3QZ5B 5GAN2 3JCMb 1HK9A 3AHUA 5LJ3d 2KSSA 1I5LA 1OI1A 4HCZA 5GAN3 2GFUA 3EGUA 2DERA 4FW2A 2MF2A 2EJFA 2WSEE 2DYIA 2HQHA 1NLPC 2HKNA 4HCKA 1QLYA 1Y96A 3PNWC 3M58A 5KYXB 1AD5A 3MEAA 4GLKA 3CD6T 1GXIE 1QCOA 2DVEA 3OYGA 4IUPA 2XG8D 1I8FA 3JCMV 2CZ7B 1VQ4Q 1S72Q 1YITA 2DIQA 1YI2Q 5FROA 3FEOA 1VIFA 2RF0A 3NTHA 4OP0A 4Y91A 2K6DA 3CEYA 2CS7A 1VQOA 1BI2A 1G83A 1ZHIA 3X20B 2LZ6B 2GFAA 2VYTA 2O01E 2M1HA 3TQ7P 5IH2A 1U1TA 2FRWA 3FIFA 5IXBA 4QW2A 2JNGA 3SHWA 2JMAA 3TSWA 4C0FA 2F1LA 5FRMA 2O88A 2I2LA 1K9AA 1YJNT 1VYTA 2KK4A 2RQWA 1RI9A 2A37A 2FPEA 2EGCA 4C92A 5FU6C 1JEGA 1QWFA 2X9HA 1RUWA 2AZSA 3S3OA 3WXMB 2OTLA 3I56Q 1JJ2S 2FPDA 1VQPA 1T0HA 2W10A 3E1SA 1K76A 4M77G 3CCVT 2CP2A 2VC8A 2KT8A 4F16A 2O9VA 1VQ6T 1N9RA 4LDYA 1LVKA 2EKOA 4J9CA 2KYBA 2PU9B 2FZGB 3CCJQ 3H0FA 3LH5A 2EJGA 3CCLT 2CT3A 1AWXA 3EFOA 5LJ5e 4ZGEB 1TWBA 3SWNC 1BYMA 3OSSC 3HHTB 3KXTA 1WXBA 1NLOC 1U1SA 2HKQB 2YT6A 2VVKA 5KYYA 2SEMA 4KH1B 2DE0X 2CSQA 3FJ5A 1EX4A 5M9OA 2LT1A 3TSZA 4MDWA 4J6XA 2E64A 1QVGS 2A28A 2OTJT 4ELZC 1SPKA 4M7AE 2DVJA 2V8IA 1WJSA 2M51A 2JXBA 4OMQA 4BI4A 2EYWA 2LP5A 3H0IA 2ABLA 4OMNA 5A0LA 1F1BB 4X1VA 3QJYA 3CCEA 1YP5A 5GANj 2E4HA 2M16A 1MMNA 1XOVA 2LCCA 1PSEA 3M0SA 4QQGA 1KQSS 2FYKA 4PJNA 2M0YA 3G71A 3RIRA 2L0AA 3GP8A 3CXCS 4GBQA 4BE0A 1HJDA 1K8AC 3BE3A 3VS4A 1RAHB 5KE3A 4LE9A 4DQ2A 2CP3A 1V29B 3L2UA 2YRDA 2PZ1A 2WSCE 4HKEA 1B34B 1SF9A 4D6WA 2JTFA 2KROA 1JJ2A 5FU6B 1AWWA 4M78E 1PWTA 2MK5A 1Y07A 4VUBA 5FWCA 1K8AU 3P8BB 4J6YA 5C0MA 2VUBA 4EIKA 2VV5A 4DBHA 5DM7R 5J3BA 4XTYA 1VQ5A 4IUUA 3CCMQ 1VA7A 2E5QA 4RTZA 1Y57A 4C8QA 4OB2B 3KUFA 1GCQC 4OB3B 5CKBA 2KNBB 5CKDA 5GAN4 3NHNA 5GAMd 3MHXA 1Q95G 1ZUUA 5IHIA 3EGXB 4N4HA 1M8VA 2KYMA 2KY9A 2FZKB 4FSSA 1M1GA 1M5Q1 2LJ0A 3OYKA 3HKSA 1BU1A 1JB0E 2HEQA 3UF4A 3QDFA 3SEMA 5GANf 4NS5A 4BB7A 2RJEA 3M0PA 1VQLA 3G1JA 1YHQA 4YTLA 2L2PA 1H3HA 4DBRA 1VQMA 2QA4Q 4J5YA 3KFVA 2JN0A 2L3PA 3CCQA 1VUBA 1QVGA 2DXBA 3G6EA 2ZPIB 3EH2A 3A8HB 1KSWA 4JJNK 5KCOA 1UGPB 4JPBW 2E65A 1KHIA 4JJDA 2RA2A 4F04B 1H3ZA 1G3SA 4F7UB 1QKWA 3MO8A 2G3RA 5CVIA 1WYXA 1I07A 1M90R 1Q81R 1VQ7Q 4N4GA 2YWWA 1YWOA 2K3XA 1M30A 2RJDA 5C6SA 4PFOA 1UE9A 1Z9ZA 1M27C 3M56A 1FMKA 2K57A 2JT4A 2RQVA 2QEXT 2K5LA 2E3IA 4M4ZA 2QQAA 3F70A 3VS0A 1WHHA 4C92C 1GBQA 3NPFA 4K11A 2NYSA 4BACA 4ZTFA 1GL5A 1BIBA 2A3LA 4J9HA 2MIOA 5I2SA 1D1AA 3MPUB 5GAMe 2RNAA 4L6V5 4AG2C 2VKNA 3VUZA 3GOXA 1W70A 2X4XA 3ASKA 1AHJB 2XI9A 5D6YA 4C92D 3LGFA 4FYVB 2NWMA 1OYXA 2WSFE 2DETA 2K4YA 4J9FA 2H3EB 2CP5A 1VQNQ 3JCMJ 4BE1A 2JM9A 1WZOA 3REBB 1Q81C 4AFSC 1Q86R 1BBZA 2AKKA 3CD6A 2J7IA 1X2KA 1UHCA 1WXTA 3OYBA 4C92F 2A36A 4M75E 3FDRA 2DIGA 3KBGA 2OJ2A 5J39A 4E7IA 1M90U 1Q81U 3OYAA 1YJWT 2EYXA 2X4WA 2QK0A 4J7FA 5D6WA 3G4SA 1NYGA 4DEYA 1NBEB 2DLPA 1FWZA 1WHLA 3CC4A 1QVFS 2OAUA 5CKEA 4A4KA 1Y96B 2HBWA 4M7DA 3X26B 3QG1A 2X4YA 5A0GA 2M9UA 1YCSB 1E6HA 3CCST 1E6GA 1BCOA 2A0FB 4LD6A 4D8KA 3V8JA 2EQIA 2DRKA 2YUOA 1FYNA 4C5IA 1G2BA 4B9WA 5I21A 1YJNA 4IUVA 2RQRA 4KRTA 3VKIA 3H8ZA 3OBYA 2DA9A 3MJXA 1Q86C 1XQHA 5KCHA 1PRLC 4CC3A 4F7UG 5GANh 4C5EA 3HPWA 3P8HA 1TSFA 3HRUA 1MMAA 1N8RC 4XU2A 3S3NA 2R57A 3EGXA 2BZXA 2PTKA 2LNHB 4QVCA 3JB9D 1JQQA 4Y28E 1I5OB 1Q86U 3O8VA 3VYHB 1YITQ 4J6WA 3CMEQ 4ANJA 4JRQA 3M0UA 4PJMA 1SRLA 3SWNA 2ZPBB 1VQ4T 1N8RU 1S72T 4PJOE 2KEAA 5IXFA 5GAOn 2HDAA 4DBFA 5GANg 1YI2T 3TVTA 3QIIA 4C92B 2I0NA 1M4ZA 3OS0A 2PVOB 3JB9F 2XHCA 3MP6A 2DMOA 1ZA1B 3DKMA 2EQUA 5GJWB 2FRYA 5GAN7 4XU3A 1VQ8Q 4C5GA 2CP6A 4EMKA 4E7SA 2PVDB 1OPLA 1I1JA 4M7AF 4LUEA 4PJJA 2KRMA 2L3RA 3JCMf 3CC2A 3RERA 2JMCA 2A08A 1UJYA 2F5TX 2RMOA 2ZPFB 5GAOq 1G3YA 4OMLA 3L2ZA 2HL3A 1GFCA 3I56T 3EFOB 3OMCA 4N0AA 1QKXA 2HAXA 1EZZB 2OTJA 3GNFB 4E7LA 4PLLA 3LH0A 3CC7Q 4RTVA 4L5GA 4PNOA 2L89A 4X9DA 3MP1A 1QVFA 2FG0A 2JVVA 2XDBA 3QJ6A 2LVMA 4R56A 5L8RE 1M2OA 4B9XA 2AZVA 2FB7A 2KRNA 4P5NA 8ATCB 3JCMW 1Z9QA 2J6FA 3THKA 4M78F 4PFPA 2E5KA 3QKJA 4IIMA 1NPRA 2F2VA 2FPFA 2QXFA 3LGLA 4JS4A 4QQDA 3CCJT 4JLGA 2ED1A 4A4EA 2EBPA 1VQ9A 1WQ7A 2V26A 1G3WA 2EYYA 3ZL7C 3VS3A 4E6RA 3CCUQ 1K9MR 2DEUA 2C06A 5IN1A 1WX6A 3ER0A 2DPPB 2RN8A 4C5HA 2VGMA 3HTRA 2GF7A 3RKXA 2COZA 3VS5A 3X25B 2FO0A 3PIPA 4KH0B 4IUTA 3ZBDA 2BTTA 2ZPHB 2MYSA 4C0GA 1YIJA 1CKAA 4F17A 1WHGA 3CCEQ 1ZLMA 2YRCA 1ABQA 2EYZA 3SDZA 2ZPEB 3HFOA 4BI3A 1KK7A 1O9SA 4ZGJB 4O6JA 1GFDA 4A4HA 4ZTJA 3PGGA 2QQRA 5LJ5d 2L3QA 3MEUA 3V7SA 4ELYC 1AZEA 1K9MC 1OU8A 5KH6A 1QP2A 4C8QB 2DF6A 2L5QA 2EKHA 3OYEA 2HBPA 2A7YA 4J9IA 1B07A 5CKHA 4HVUA 2O31A 2K9GA 1RAGB 1MGQA 2YRVA 3C0CA 1K9MU 4HVWA 2MI6A 3I9QA 1D1CA 1K1ZA 1AZGB 3A98A 3JCMc 3JB9I 1VQ5Q 1D3BA 1UUEA 2D0NA 4OMMA 4O5VA 3NGPA 2LCSA 1UGRB 1M3BA 4MMLA 3CCMT 3OYFA 5GAN6 3L2QA 2KAFA 2QGFB 3EHRA 4M7DC 2DJQA 1JXOA 1LOJA 1V1CA 4J9DA 2KRSA 3JCMh 1RAEB 4FCYA 2RHUA 1VQKA 3FJPA 1PSFA 4FYXB 1QWEA 3MP8A 2GTJA 1VQLQ 5A2QE 4M7DD 1TS9A 2B86A 1YHQQ 2QQSA 4KBMB 2ZZDA 1ABOA 2F69A 3I5RA 4HCCA 3WVEB 4F14A 3M57A 4ZGDB 4E7ZA 2QA4T 3EFSA 3JCMg 1TTHB 2COYA 2LCLA 1OX8A 3G6EQ 1FX7A 4M75F 1WHKA 4WTOB 4M7DF 2HZYA 3DLLA 1D0ZA 2IVWA 3EG0A 3I5SA 3M0QA 1R0BG 1JJ2P 2NUZA 1YN8A 4RTWA 2DKGA 3OYLA 2K5FA 2HSPA 1MUZA 5DLOA 4LUDA 4Q5WA 2QQBA 3VS2A 2RJFA 4Z8AA 1QCNA 2P0KA 2NLUA 2LNVA 2GGRA 4EMKC 2F2XA 2GBQA 3I35A 2CDTA 1ZA2B 1YJWA 3A8LB 1PRMC 1I0CA 4IURA 4R55A 1KD1R 4C8QG 2DL8A 4M77E 4PK4A 3VRYA 4JJCA 2F5KA 3R6OA 2PVGB 1ZBXA 2W0ZA 1JXMA 2ROTA 2AK5A 2BE9B 2RO0A 1UJ0A 2CH4A 4AFUC 1H641 1SG5A 4CC4B 3OB9A 3M54A 5AYFA 1OX9A 4N0AC 2PUOB 3EG2A 4M7AA 1E7OA 1M1KR 1AVZC 2CGHA 2KDSA 4RMOA 1BIAA 1BI3A 1NEGA 2ZPGB 4QVDA 5LJ3j 1PKTA 2BZ8A 2QASA 3H9NA 3TU4K 2AKLA 3FB9A 4KULA 4PJOF 1YCYA 4XU1A 1QVGP 1VQNT 3L42A 2OI3A 5D6XA 4M7DB 2AIRB 4XQ3A 2AT1B 3DLMA 5IHKA 2CREA 3J80E 3PFSA 2LQKA 3CPWS 4J9GA 3OBWA 4V2SA 3I55Q 2E41A 1MNDA 1KD1C 2DILA 3EG9A 3OY9A 3G4SQ 1KQ2A 2CYZB 3MKDA 3CC4Q 1PKSA 1KQSP 2YUPA 2JM8A 4J9BA 5CO7A 1IXDA 2HQEA 4M78A 2SRCA 5CQYA 3CXCP 2M0OA 4CC7A 4JRIA 1MV3A 1KD1U 4RTTA 3CCRA 1B7TA 1VIEA 1M1KC 2BZYA 4AFQC 2X51A 1BB9A 1VYVA 4ORZA 3TEEA 4A4FA 1KJWA 3SWNB 1BCMA 1PM3A 4AMCA 4JS5A 1HSQA 1WFWA 2D8JA 1M1KU 2LMJA 4XTUA 1YJ9A 3M55A 5LJ3f 5FU7C 1Q7YR 1OPKA 1D0YA 1FXXA 1H8KA 1M3CA 4LDUA 4EMKB 1GRIA 4B6MA 3LLRA 4QT7A 2DL7A 4KT0E 3AT1B 3CMET 2YLCA 1SHGA 2DEQA 1UGSB 4X9CA 1I81A 1NZ9A 4KUIA 4RKUE 4TVRA 3LX7A 1KQSA 3LWIA 3L1AA 1EIFA 4PJLA 3CXCA 5CAIA 2GTOA 2XICA 1VQ8T 2H8HA 3CC2Q 1ZBJA 4E7HA 4HVVA 3Q1JA 1SSFA 4OMOA 1R8OB 2KQWA 2EQMA 5CR2A 2LDMA 3OW2S 1Q7YC 3HP9A 3JCMe 1PHTA 2XIDA 2RD1A 2J06A 1K73R 1V76A 2JOYA 2VASA 4ZN1A 2NUTA 3VS1A 4EMHA 4RCBA 3JB9H 2DAQA 2DL3A 4XTWA 1Q7YU 4MZMA 3CC7T 4OGCA 1AEYA 3MEWA 1PC0A 1M90C 3JSCA 5HKCA 3UA7A 5KYWA 4AFZC 2HL5C 3CMAQ 4PFZA 1VQ9Q 3VU3C 4J8OA 1T3SA 3VV0A 2ZCFB 2CUBA 2J05A 4XAXB 1IREB 3META 2FVUA 3CCUT 4OGEA 2EVRA 4OB1B 3ULRB 2KXDA 2EJ9A 2X35A 2K3BA 1PG5B 1K73C 2MAMA 4M75A 3NMZC 1RAFB 2DZCA 5FU7B 5CQXA 4HT8A 3QO3A 1W4SA 2CSIA 5GAOr 4JZ4A 2LC4A 1A0NB 4BI8B 2DBMA 4Z89A 1LJOA 1YIJQ 1OU9A 1KC8R 1JU5C 2BE7D 2O9SA 1K73U 5CK9A 1U06A 2RK2A 1NM7A 3CCET 2E3HA 1UEBA 2QG9B 3OA6A 1ZSGA 2ZAEA 5LL6S 2OAWA 5GAN8 2EYQA 4M7AC 4HA8A 1QVFP 3QHSA 1IHWA 1D3BB 3EG3A 4M77C 2E70A 3JCMX 1RLPC 4ME7A 5LJ3h 2DD5A 4MMKA 3H6ZA 1WJRA 3CCVA 2YSQA 4JUVA 4OF1A 5HCKA 3QPHA 5GMKl 1AWJA 1N27A 2RI2A 4M7AD 1VQ6A 2CKKA 1VQOQ 3BW1A 4M77D 4OVAA 2L3SA 2X3XD 3VUBA 1WQWA 3CCLA 1Y0MA 2XU8A 2LQNA 2GQVA 5LJ3g 4PJOA 3RKYA 3MEVA 3BDLA 4XTXA 1GBRA 1UG1A 5GMKm 4M78C 2C0IA 4M77F 2GNCA 2YDLA 3EFRA 5GMKj 2CP7A 3EAEA 1KC8U 4F7UE 3CBMA 2O4XA 2OTLQ 1D0XA 1TUGB 1BI1A 3D7SB 1VQKQ 1D09B 4RG2A 1MNEA 1VQPQ 4M78D 5KE2A 3NFCA 1KQ1A 4C0DC 5LJ5g 2LJ3A 1VQLT 4HCBA 4E7KA 4NOYA 4DA4A 5GAMf 1QCFA 2MWPA 1YHQT 1Q82R 4RG8A 3PVLA 2GCXA 4PKCC 4A53A 1U8RA 4RTUA 3RNJA 4Y92A 2Y4YA 1WLPB 1TUDA 2PQWA 3C4SA 3PT9A 2K79A 2QGGA 3G6ET 2CH4W 3M0RA 3M53A 2CP0A 1SRMA 3DB3A 2R5AA 4PLIA 2E6NA 5I22A 2EAYA 1W2BS 5IAYA 1VQNA 1N5ZA 4L59A 1UHFA 3RUXA 4Z88A 1FMVA 1WIEA 1X43A 3BY7A 2MPXC 3NTKA 4A4GA 1SHFA 4M7AB 3EGDA 3OS5A 3RKWA 4JJBA 1RLQC 3GF5A 2YXYA 3M4GA 2EQJA 3JCMQ 5GANd 3PMIA 5DLQE 1RACB 2LT4A 3OYNA 3OQ5A 1IHVA 5CIUA 2HNIA 4C92G 2HQXA 2X3WD 1IZ6A 2DRMA 1Q82U 4BD3A 4HT9A 2XMFA 2JJ9A 3WVDB 5FW9A 1ZSZA 1WGSA 3G71Q 2DL4A 2DK3A 1N9SA 5HK0A 3V8LA 3EG9B 4JZ3A 4JDSA 1RI0A 1OEBA 4XTVA 5DY9A 4M78B 3LWHA 2K3YA 3A5ZB 3OYDA 2D8HA 4J9EA 2EPDA 4FM4B 1TG0A 3OYJA 4DEXA 2ATCB 1M2VA 1T3LA 2LX7A 1UGVA 3O5ZA 1PD0A 5J26A 2HD0A 4C0DB 3I55T 3CMEA 5IHNA 4KGVB 4BY6C 4LNPA 2ED0A 2DJZA 3G4ST 3HRSA 3CC4T 1KG1A 3RBBB 4N4IA 2HMAA 4BDZA 4M75C 3CCRQ 1WNLA 2DNUA 4C92E 2BKDN 4XTZA 2D0QB 3RESA 3CBPA 4XK8E 3S3MA 3JCMP 2QQ9A 3P8DA 1VQ8A 3GNGA 4LDVA 3M0TA 1UDLA 1W2BA 2NUPA 4M75D 1Y71A 1VYUA 2QEXA 4E7JA 2QAZA 5IT9E 5GANe 1YJ9Q 1VQMQ 1X75C 1KIKA 3JB9G 2KT1A 2VB6A 2EFIA 4ESRA 3OSVA 3E9GA 3CCQQ 5GAMh 1D1BA 1X01A 1AOJA 2JUFA 2R58A 5LJ3e 2LJ1A 4M7AG 4X34A 2RI3A 1NEBA 4JRKA 3A1PA 3CC7A 3REAB 1HXDA
chains in the Genus database with same CATH topology
3J81E 3HRTA 5A0GA 2RM4A 1M1KU 3BDUA 3GPLA 2M9UA 4XTUA 1YJ9A 3J7AF 2DTOA 3M55A 4M77B 3CCST 3OS2A 5LJ3f 4LD6A 2LQ8A 5FU7C 1Q82C 3E19A 1O75A 3V8JA 3V7RA 2AHJB 1UB4A 1FXXA 3QXEB 4C5IA 5GAMg 4IKFA 4II1A 4B9WA 5I21A 1YJNA 4ZN3A 4LDUA 4EMKB 4IUVA 1YBYA 3LLRA 3VKIA 3H8ZA 3OBYA 5GAOm 1Q86C 1XQHA 4KT0E 3INZA 1P92A 5KCHA 1VQ7T 4F7UG 3CMET 5GANh 4C5EA 1OZ2A 3HPWA 3HRUA 3M59A 3P8HA 3QZ5B 5GAN2 4PJOC 3JCMb 2E6ZA 1HK9A 1DJ7B 1N8RC 2Y90A 3AHUA 4XU2A 2KSSA 2VXEA 2YLCA 5LJ3d 3S3NA 1I5LA 1OI1A 2DEQA 2DZ9A 1UGSB 2R57A 4HCZA 3CCUA 3CC2T 4X9CA 5GAN3 2GFUA 1I81A 2VXFA 4QVCA 2L8DA 3JB9D 4Y28E 1NZ9A 2MF2A 4KUIA 4RKUE 4TVRA 3HFNA 2LTOA 3LX7A 4M78G 5GMKh 1Q86U 2EJFA 2WSEE 2D6FA 1KQSA 3O8VA 3VYHB 4J6WA 3LWIA 4PJOD 3L1AA 1EIFA 4JRQA 2MWOA 3CXCA 3SWNA 5CAIA 2ZPBB 1VQ4T 1N8RU 1S72T 4PJOE 1Y96A 1XNIA 3PNWC 2XICA 5GAOn 3CCSA 1YI2T 1VQ8T 5GANg 1OZ3A 3M58A 3QIIA 4C92B 3MEAA 3QBYA 4GLKA 2RH2A 4E7HA 3CD6T 3Q1JA 2DXUA 1M4ZA 3OS0A 1SSFA 1GXIE 3NTIA 2JZ2A 1R8OB 3V7CA 2DVEA 3V8LA 3OYGA 2KQWA 2EQMA 4IUPA 2PVOB 2LDMA 2QTXA 4M77A 2XG8D 1I8FA 5CR2A 3JB9F 2XHCA 1M9SA 3MP6A 3JCMV 3OW2S 2CZ7B 4BY6B 3DKMA 1Q7YC 2EQUA 3HP9A 3JCMe 4NL3A 2XIDA 5GAN7 4XU0A 3CPFA 1YITA 1JRIA 2DIQA 2RD1A 2EQKA 4XU3A 2JOYA 4C5GA 4EMKA 2PVDB 4M75B 5FROA 3FEOA 1VIFA 2EIFA 3NTHA 4ZN1A 4BDYA 4CI0C 4OP0A 2YHTA 4EMHA 4M7AF 4RCBA 2DD4A 4Y91A 3UT1A 2L3RA 3JCMf 3CEYA 3URGA 2CS7A 2DAQA 3UWNA 1VQOA 3CC2A 3JB9H 3RERA 1BI2A 2DO3A 1ZHIA 4XTWA 1Q7YU 3CMAT 1M1FA 3QYGB 3X20B 2F5TX 1VQ9T 4MZMA 3CC7T 3DB4A 4OGCA 2GFAA 2VYTA 2O01E 2ZPFB 2M1HA 5GAOq 1G3YA 3MEWA 3L2ZA 1U1TA 3FIFA 4QW2A 2JNGA 5LJ5j 1VQ4A 3G7ZA 1S72A 5CCAA 3I56T 1M90C 4C0FA 3M4YA 4MZPA 3JSCA 1YI2A 5HKCA 5FRMA 2I2LA 3OMCA 4N0AA 4C8QE 2HAXA 2VGNA 5GAN5 3GNFB 4E7LA 4PLLA 1YJNT 1LNXA 2OTJA 3LH0A 3JCMd 1ZQ1A 2KK4A 3OYIA 1I4K1 4F7UF 4L5GA 2P4TA 4PNOA 2L89A 3VU3C 4J8OA 4X9DA 3MP1A 2WACA 4C92A 3PTAA 1QVFA 2CZ0B 3VV0A 2JVVA 2ZCFB 5FU6C 4C0ZA 2XDBA 3QJ6A 2LVMA 2QDYB 4R56A 5L8RE 4XAXB 4B9XA 3S3OA 1IREB 3WXMB 2OTLA 5EG2A 2FB7A 4P5NA 3META 3JCMW 1JJ2S 2FVUA 1QP3A 3FLGA 3CCUT 4OGEA 4OB1B 1YIJT 4M78F 1VQPA 3QKJA 2EJ9A 1NPRA 2QXFA 2X35A 3HSBA 4ATOA 3TCJA 1K73C 2MAMA 3LGLA 1RL2A 3E1SA 4QQDA 4BUGA 4M75A 4JLGA 3CCJT 4JS4A 4A4EA 4FT2A 2DZCA 4OMFB 4M77G 5FU7B 3CCVT 5CQXA 1VQ9A 4LDXA 4HT8A 1WQ7A 3VJPA 4Z02A 3QO3A 3L2VA 1G3WA 1W4SA 2RHXA 2X4JA 2VC8A 5GAOr 2LC4A 4BI8B 4J7IA 1VQ6T 1N9RA 1LJOA 2C06A 3I56A 4LDYA 2JTMA 2EKOA 5IN1A 1BI0A 3ER0A 2DPPB 1K73U 2PU9B 4C5HA 5CK9A 4PJOB 2VGMA 4BE2A 3GLXA 2EJGA 3CCLT 2RK2A 3UPUA 4EDUA 3E9FA 2GF7A 2RHYA 3CCET 5LJ5e 1YITT 4ZGEB 4IUQA 3SWNC 2E1HA 3RKXA 1BYMA 3OSSC 2RHZA 3C12A 3X25B 3PIPA 1UEBA 3HHTB 3KXTA 4IUTA 3OA6A 3T9NA 3ZBDA 2YLBA 5LL6S 1U1SA 5GAN8 2EYQA 3LYIA 2ZPHB 3HL8A 3OYKA 2O4XB 4HA8A 4C0GA 3QHSA 2ZGWA 1VQOT 1YIJA 4M7AC 2BUDA 1D3BB 4M77C 5LJ5f 3OYHA 2E70A 3JCMX 2BIVA 1UGQB 3QZ9B 4ME7A 5LJ3h 3CCJA 2DD5A 4MMKA 3H6ZA 5M9OA 1WJRA 3CCVA 4DOWA 2LT1A 3SDZA 2ZPEB 3HFOA 4LDWA 4BI3A 4JUVA 1O9SA 4MDWA 4OF1A 3OS1A 3L2RA 2QI2A 3QPHA 4ZGJB 4O6JA 4J6XA 5GMKl 2E64A 2DXCA 2RI2A 1N27A 2H3JA 4M7AD 1VQ6A 1QVGS 2CKKA 2OTJT 1KHCA 4ELZC 3BW1A 4M77D 4A4HA 4ZTJA 2V8KA 4M7AE 3PGGA 3M5AA 2QQRA 2V8IA 1WJSA 4OVAA 4NL2A 3ME9A 4BI4A 5LJ5d 3V7SA 3MEUA 2DXTA 3VUBA 4ELYC 5GAOp 1WQWA 1K9MC 5KH6A 3CCLA 5A0LA 2XU8A 3UDCA 1QP2A 4M75G 4C8QB 1XTDA 4M7DG 2L5QA 3QJYA 2GQVA 3CPWA 2XD0A 2EWNA 5LJ3g 3OYEA 3FRNA 3CCEA 5GANj 2OTLT 4PJOA 1VQKT 2HBPA 2M16A 2A7YA 3RKYA 1XOVA 3MEVA 5CKHA 3BDLA 4XTXA 2LCCA 1PSEA 1VQPT 4QQGA 3S6WA 3QDRB 5GMKm 4M78C 4M77F 3V8KA 4E47A 1MGQA 3VYGA 2RHIA 2YRVA 4QQ6A 1KQSS 1K9MU 3EFRA 1QVPA 2MI6A 2FYKA 5GMKj 3G71A 3RIRA 3EAEA 4BE0A 3GP8A 3CXCS 4F7UE 1KC8U 3CBMA 3C95A 3RMSA 1K8AC 2O4XA 3JCMc 3JB9I 1NJIC 1BI1A 5KE3A 1D3BA 4DQ2A 3M9QA 4O5VA 1V29B 4RG2A 3L2UA 2V8JA 1UGRB 2WSCE 4HKEA 1B34B 3A8GB 4M78D 4MMLA 3NFCA 1KQ1A 3OYYA 5KE2A 4C0DC 4D6WA 2JTFA 5LJ5g 3CCMT 1JJ2A 3OYFA 5FU6B 5GAN6 1VQLT 4HCBA 3L2QA 4M78E 2KAFA 2RI5A 1JBMA 3OMGA 1Y07A 1G3TA 4NOYA 4VUBA 5GAMf 4E7KA 4DA4A 2MWPA 4M7DC 1YHQT 1K8AU 1WPYA 1NJIU 3P8BB 1LOJA 2LX9A 4RG8A 4J6YA 5C0MA 2GCXA 4PKCC 3OYMA 2VUBA 2RB6A 4A53A 2D9TA 2LRQA 2VV5A 3JCMh 5DM7R 1U8RA 5J3BA 4XTYA 1VQ5A 2RHUA 1VQKA 2Y4YA 1PSFA 3FJPA 4IUUA 3JB9J 2E5QA 2PQWA 3MP8A 3C4SA 3PT9A 4EMGA 4C8QA 4OB2B 3ZEHA 3KUFA 4OB3B 5CKBA 5A2QE 4EPCA 3G6ET 4M7DD 5CKDA 3SD4A 5GAN4 2QQSA 3M53A 4KBMB 5GAMd 2ZZDA 4M7DE 2F69A 3MHXA 3DB3A 2R5AA 2RK1A 4N4HA 4HCCA 1M8VA 2KY9A 3WVEB 4PLIA 2E6NA 3I55A 1M1GA 1M5Q1 3M57A 4QVZA 1MHNA 4FT4A 5I2MA 2EAYA 3A8OB 3HKSA 3EFSA 4ZGDB 2QA4T 1W2BS 5IAYA 1VQNA 1JB0E 4L59A 4PJOG 3JCMg 2LCLA 3RUXA 5GANf 5GMKe 3CCMA 4NS5A 4KUDK 4BB7A 2RJEA 1FX7A 1TH7A 4M75F 1VQLA 3BY7A 4M7DF 3FC3A 4J83A 4PL6A 3DLLA 1B34A 1YHQA 3NTKA 2IVWA 4YTLA 4A4GA 4M7AB 1VQMA 3OYCA 2P0PA 4J5YA 2KVQG 2PUKB 2DKGA 3L2WA 3OS5A 5FLXE 3RKWA 2XKOC 3OYLA 2K5IA 5GAMj 4GY5A 3GF5A 2JN0A 3M4GA 4A54A 2EQJA 2K5FA 3JCMQ 3CCQA 5GANd 1VUBA 3PMIA 5DLQE 5DLOA 1QVGA 2DXBA 4Q5WA 2QQBA 3G6EA 2ZPIB 3G71T 2LT4A 1Y7XA 3OYNA 2RJFA 3OQ5A 3A8HB 4DOVA 2FHDA 2P0KA 4MDXA 5CIUA 2HNIA 3RMQA 3OW2A 4JJNK 5KCOA 1UGPB 2NLUA 4C92G 2HQXA 2LNVA 3QSUA 3MCAB 2E65A 1IZ6A 1KHIA 2R5MA 1BKBA 2DTHA 4EMKC 4BD3A 1Q82U 4HT9A 2RA2A 5A0DA 1H3ZA 1G3SA 2QA4A 3WVDB 3X24B 3A8LB 4F7UB 1YJWA 3SFMA 4CRIA 2FL7A 3MO8A 4IURA 3A8MB 4R55A 1WGSA 1NE8A 2G3RA 5CVIA 2DK3A 4LD9K 4C8QG 1N9SA 4M77E 5HK0A 2F5KA 2CZ1B 2XDPA 3R6OA 2DTIA 2PVGB 1ZBXA 2IG0A 1RI0A 4JDSA 2P0QA 4N4GA 3X28B 2RO0A 4XTVA 2K3XA 1KC8C 4JLIA 5DY9A 4M78B 1H641 2RJDA 5C6SA 1VQ5T 3N5BB 5LJ5h 3OB9A 2K3YA 3LWHA 3M54A 5AYFA 3M56A 3BFMA 2K57A 4N0AC 2PUOB 3A5ZB 2E12A 3OYDA 4M7AA 1G5VA 4FU6A 4FSXA 2QEXT 2K5LA 4FM4B 3OYJA 3TREA 2CGHA 2KDSA 4RMOA 2QQAA 3F70A 1BIAA 2KMTA 1BI3A 2ZPGB 3JRZA 4QVDA 5LJ3j 4C92C 3CCRT 4BACA 4ZTFA 1BIBA 4MZTA 3TU4K 2A3LA 5J26A 2HD0A 4C0DB 5I2SA 3I55T 4KULA 3FB9A 4PJOF 3PIOA 3GIBA 1VQ7A 1YCYA 5GAMe 3CMEA 2XDDA 4XU1A 4L6V5 1VQNT 3L42A 4BY6C 5D6XA 4M7DB 3VUZA 3GOXA 4XQ3A 3DLMA 2DJZA 4C8QC 3G4ST 2E10A 2X4XA 3HRSA 3ASKA 3CC4T 1AHJB 2XI9A 1X6OA 2MMPA 3QUIA 5D6YA 3C94A 4JRPA 1KG1A 3JAME 4N4IA 3LGFA 3PMTA 4C92D 3PFSA 3J80E 4BDZA 4M75C 5HK3A 2LQKA 1OYXA 2WSFE 1WNLA 3CPWS 4F7UA 2XK0A 3OBWA 4WF2A 4V2SA 4C92E 2BKDN 4XTZA 2E41A 1YJ9T 2K4YA 2K2VA 3CBOA 2D0QB 1VQMT 1KD1C 3RESA 3CBPA 4XK8E 3LW5E 3JCMJ 4BE1A 4C8QD 3OY9A 3S3MA 3JCMP 2QQ9A 3P8DA 1Q81C 2CYZB 1VQ8A 1KQ2A 3GNGA 4LDVA 5CKFA 3CCQT 5GMKi 1W2BA 5CO7A 2Y4XA 2HQEA 3CD6A 4M75D 4M78A 1Y71A 2QEXA 5CQYA 3OYBA 4E7JA 5HY6A 4C92F 5IT9E 2M0OA 4M75E 3FDRA 1N6AA 4FL6A 2DIGA 4JRIA 5GANe 3KBGA 4RCCA 1KD1U 1X75C 3CCRA 3JB9G 4UC4A 1VIEA 3ZFJA 5J39A 4E7IA 2EFIA 4OB0B 1M1KC 1M90U 1QW1A 2CZ6B 1Q81U 5FRNA 3OYAA 1YJWT 3OSVA 3E9GA 5GAMh 4C8QF 2X4WA 1X01A 2JUFA 2RJCA 1WJQA 2R58A 4J7FA 3TEEA 4A4FA 5D6WA 3G4SA 4FIBA 3SWNB 5GAOl 5LJ3e 1FWZA 3CC4A 1QVFS 2OAUA 5CKEA 4X34A 4A4KA 1Y96B 2RI3A 4M7AG 3SB2A 1NPPA 3QYHB 4JRKA 4M7DA 3X26B 2B8AA 3CMAA 3QG1A 4JS5A 2X4YA 3CC7A 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQX A;  4VUB A;  1X75 C;  4ELZ C;  5HK3 A;  1M1F A;  4MZM A;  5CR2 A;  1NE8 A;  2KMT A;  3JRZ A;  2VUB A;  2C06 A;  1UB4 A;  3VUB A;  4ELY C;  5HK0 A;  4MZT A;  1VUB A;  5DLO A;  2MF2 A;  3G7Z A;  4ME7 A;  5CCA A;  5CK9 A;  5CKF A;  4MZP A;  3JSC A;  5CKB A;  5HKC A;  4HKE A;  5CO7 A;  5CKE A;  4MDX A;  3NFC A;  3TCJ A;  4OF1 A;  5CKD A;  5CKH A;  5CQY A;  3HPW A; 
#chains in the Genus database with same CATH topology
 3CQT A;  2RM4 A;  2EW3 A;  3J7A F;  3OS2 A;  2VWF A;  2RQU A;  3E19 A;  3QWY A;  1O75 A;  1IGU A;  3V7R A;  3QXE B;  5GAM g;  4IKF A;  4II1 A;  1ZX6 A;  2RQT A;  2J6K A;  2ESW A;  2NUT B;  3INZ A;  1VQ7 T;  1AWO A;  2GQI A;  1LCK A;  3RDV A;  1OZ2 A;  3M59 A;  4PJO C;  2E6Z A;  1DJ7 B;  1K0S A;  2P4R A;  2Y90 A;  2VXE A;  2DZ9 A;  1K8A R;  2IIM A;  3CCU A;  3CC2 T;  5KYU A;  4QKU A;  2VXF A;  2L8D A;  3H41 A;  5GMK h;  3HFN A;  2LTO A;  4M78 G;  4FYW B;  2D6F A;  4FW1 A;  5KYW B;  2EGA A;  4PJO D;  2MWO A;  1PCX A;  1XNI A;  1K4U S;  3CCS A;  1OZ3 A;  3QBY A;  2RH2 A;  1UFF A;  1CKB A;  2DXU A;  3NTI A;  2JZ2 A;  3RR6 A;  3V7C A;  4M77 A;  3U23 A;  1HYO A;  2QTX A;  1M9S A;  4BY6 B;  4NL3 A;  1TXQ A;  4XU0 A;  3CPF A;  1JRI A;  2C0T A;  2EQK A;  4M75 B;  2EIF A;  3CD6 Q;  4BDY A;  4CI0 C;  2YHT A;  2ECZ A;  1XJW B;  2DD4 A;  3UT1 A;  3URG A;  3UWN A;  2DO3 A;  1WXU A;  2IPO B;  3CMA T;  1M1F A;  3QYG B;  1IRX A;  1VQ9 T;  1IB8 A;  3DB4 A;  2YUQ A;  1UEC A;  4ZNX A;  3IQL A;  2KI7 A;  5L23 A;  1VQ4 A;  4E2F B;  5LJ5 j;  1S72 A;  3G7Z A;  5CCA A;  3M4Y A;  4MZP A;  1YI2 A;  3PVQ A;  2DFU A;  4C8Q E;  2VGN A;  5GAN 5;  1LNX A;  4DBQ A;  1WI7 A;  2C0O A;  2QTV A;  3JCM d;  1ZQ1 A;  3OYI A;  1I4K 1;  4F7U F;  2P4T A;  1SEM A;  5KYX A;  2WAC A;  3PTA A;  2CZ0 B;  4C0Z A;  2QDY B;  2OX7 A;  4AT1 B;  5GJV B;  2ENM A;  9ATC B;  5EG2 A;  3UA6 A;  1QP3 A;  3FLG A;  1YJN Q;  2FZC B;  1YIJ T;  5AT1 B;  3HSB A;  5I11 A;  1R77 A;  3CPW P;  4ATO A;  3TCJ A;  1RL2 A;  4BUG A;  4FT2 A;  1WHJ A;  4OMF B;  4LDX A;  3VJP A;  4Z02 A;  3L2V A;  1B3Q A;  2X4J A;  2RHX A;  2DX1 A;  4J7I A;  1YWP A;  1ZSZ C;  1OQK A;  3I56 A;  2JTM A;  1BI0 A;  2DL5 A;  2HSE B;  1U3O A;  2JS2 A;  4PJO B;  1C0M A;  3GLX A;  3CCV Q;  2CT4 A;  1TU0 B;  3UPU A;  4EDU A;  1PNJ A;  3E9F A;  2RHY A;  1YIT T;  4IUQ A;  2E1H A;  2RHZ A;  3C12 A;  1VQ6 Q;  2K2M A;  3T9N A;  2YLB A;  1WHM A;  3LYI A;  1NJI R;  2G6F X;  3HL8 A;  2DM1 A;  2O4X B;  2FEI A;  1VQO T;  1BK2 A;  2ZGW A;  1TUC A;  2BUD A;  5LJ5 f;  3OYH A;  3CCL Q;  2BIV A;  1UGQ B;  3QZ9 B;  3CCJ A;  4DOW A;  4LDW A;  3OS1 A;  3L2R A;  2QI2 A;  1MV0 B;  2DXC A;  2H3J A;  1KHC A;  4LXC A;  2V8K A;  2JW4 A;  4HXJ A;  3VS7 A;  3M5A A;  1CSK A;  4R0K A;  4NL2 A;  3ME9 A;  2DXT A;  5GAO p;  3EH1 A;  3UDC A;  4M75 G;  1XTD A;  4M7D G;  1W1F A;  4D8D A;  3CPW A;  2XD0 A;  2EWN A;  1LPL A;  1X2Q A;  3FRN A;  2OTL T;  1VQK T;  2DBK A;  1EFN A;  2OTJ Q;  1QMC A;  1VQP T;  3VRZ A;  1T0J A;  3S6W A;  3QDR B;  3V8K A;  4E47 A;  3VYG A;  2RHI A;  4QQ6 A;  1QVP A;  2CUD A;  3C95 A;  2YUN A;  3RMS A;  1ARK A;  1NJI C;  4A63 B;  1S1N A;  3M9Q A;  2V8J A;  4IIO A;  3A8G B;  3OYY A;  2EGE A;  1HD3 A;  3OW2 P;  2RI5 A;  1JBM A;  3OMG A;  7AT1 B;  1G3T A;  3EGD B;  1WPY A;  1NJI U;  2RPN A;  2LX9 A;  3OYM A;  4RUG A;  2RB6 A;  1YNZ A;  2D9T A;  2LRQ A;  3GBQ A;  1ACM B;  3PE0 A;  3JB9 J;  4EMG A;  3ZEH A;  4OMP A;  1TOV A;  4EPC A;  3SD4 A;  4RTX A;  1N8R R;  4M7D E;  1ZSZ B;  2D1X A;  2RK1 A;  3EHQ A;  3I55 A;  3RMQ A;  4QVZ A;  5I2M A;  1MHN A;  3E2U A;  4FT4 A;  3A8O B;  2KBT A;  1G8X A;  4PJO G;  4WCI A;  5KYN A;  1C1A A;  1MMD A;  5D7U A;  5GMK e;  3CCM A;  4KUD K;  1H92 A;  1TH7 A;  1OOT A;  3FC3 A;  4J83 A;  4PL6 A;  1B34 A;  5ECA A;  3OYC A;  2P0P A;  3L2W A;  2KVQ G;  2PUK B;  2P84 A;  1M2V B;  5FLX E;  2XKO C;  2K5I A;  2LQW A;  5GAM j;  4GY5 A;  2PNI A;  1WDX A;  2J6O A;  4A54 A;  2COW A;  1IO6 A;  1SSH A;  5FWB A;  3G71 T;  1QQJ A;  2QDL A;  1Y7X A;  2JS0 A;  2ROL A;  1FMW A;  4DOV A;  2FHD A;  4MDX A;  3OW2 A;  1X27 A;  4KGX B;  3R6N A;  3QSU A;  3MCA B;  3JV3 A;  2R5M A;  1BKB A;  2DTH A;  2MOX A;  5A0D A;  1PD1 A;  2QA4 A;  3UAT A;  3X24 B;  2KGT A;  3SFM A;  4CRI A;  2FL7 A;  2M02 A;  3A8M B;  1NE8 A;  8AT1 B;  4CC2 A;  4LD9 K;  3VS6 A;  1X69 A;  1RAB B;  4BE2 A;  2CZ1 B;  2XDP A;  2DTI A;  2IG0 A;  2KE9 A;  2P0Q A;  1SKU B;  3X28 B;  1KC8 C;  4JLI A;  2NUP B;  1VQ5 T;  3N5B B;  3EG1 A;  5LJ5 h;  2JTE A;  3BFM A;  1U5S A;  2E12 A;  1G5V A;  4FU6 A;  4FSX A;  3TRE A;  2KMT A;  3JRZ A;  3CCR T;  4MZT A;  3GIB A;  3PIO A;  1VQ7 A;  1M3A A;  1UTI A;  2XDD A;  1RAI B;  1W6X A;  2F2W A;  4AG1 C;  4C8Q C;  1RAD B;  2MCN A;  2E10 A;  2QEX Q;  1X6O A;  2MMP A;  3QUI A;  3C94 A;  4JRP A;  3JAM E;  3PMT A;  2K7A A;  2KXC A;  1X6B A;  5HK3 A;  2KR3 A;  2XK0 A;  4WF2 A;  1YFN A;  4F7U A;  2V1Q A;  1YJ9 T;  1VQM T;  2K2V A;  3CBO A;  1IGQ A;  2HCK A;  4RTY A;  3LW5 E;  1JO8 A;  4C8Q D;  2QYZ A;  5CKF A;  4LN2 A;  3CCQ T;  1KFZ A;  5GMK i;  2Y4X A;  5HY6 A;  1AT1 B;  1N6A A;  4FL6 A;  4RCC A;  1RAA B;  5KYU B;  5KYY B;  4KGZ B;  4UC4 A;  3ZFJ A;  4OB0 B;  1QW1 A;  2CZ6 B;  5FRN A;  4C8Q F;  3H0H A;  4GLM A;  2RJC A;  1WJQ A;  4FIB A;  5GAO l;  1C6V X;  1K0X A;  3SB2 A;  1NPP A;  3QYH B;  1OUL A;  2B8A A;  3CMA A;  3J81 E;  3HRT A;  3BDU A;  3GPL A;  2DTO A;  1NG2 A;  2DYB A;  1YJW Q;  4M77 B;  1ZUK A;  2LQ8 A;  1Q82 C;  1OV3 A;  2AHJ B;  1UB4 A;  4FYY B;  5EC7 A;  1GCQ A;  4ZN3 A;  1MMG A;  3QWX X;  1YBY A;  1NYF A;  5GAO m;  6AT1 B;  1WA7 A;  1R0C B;  1VOM A;  1M8M A;  1X6G A;  1P92 A;  2V1R A;  2O2O A;  1J3T A;  1GCP A;  3CCS Q;  1W2B P;  1ZUY A;  2Z0W A;  3QZ5 B;  5GAN 2;  3JCM b;  1HK9 A;  3AHU A;  5LJ3 d;  2KSS A;  1I5L A;  1OI1 A;  4HCZ A;  5GAN 3;  2GFU A;  3EGU A;  2DER A;  4FW2 A;  2MF2 A;  2EJF A;  2WSE E;  2DYI A;  2HQH A;  1NLP C;  2HKN A;  4HCK A;  1QLY A;  1Y96 A;  3PNW C;  3M58 A;  5KYX B;  1AD5 A;  3MEA A;  4GLK A;  3CD6 T;  1GXI E;  1QCO A;  2DVE A;  3OYG A;  4IUP A;  2XG8 D;  1I8F A;  3JCM V;  2CZ7 B;  1VQ4 Q;  1S72 Q;  1YIT A;  2DIQ A;  1YI2 Q;  5FRO A;  3FEO A;  1VIF A;  2RF0 A;  3NTH A;  4OP0 A;  4Y91 A;  2K6D A;  3CEY A;  2CS7 A;  1VQO A;  1BI2 A;  1G83 A;  1ZHI A;  3X20 B;  2LZ6 B;  2GFA A;  2VYT A;  2O01 E;  2M1H A;  3TQ7 P;  5IH2 A;  1U1T A;  2FRW A;  3FIF A;  5IXB A;  4QW2 A;  2JNG A;  3SHW A;  2JMA A;  3TSW A;  4C0F A;  2F1L A;  5FRM A;  2O88 A;  2I2L A;  1K9A A;  1YJN T;  1VYT A;  2KK4 A;  2RQW A;  1RI9 A;  2A37 A;  2FPE A;  2EGC A;  4C92 A;  5FU6 C;  1JEG A;  1QWF A;  2X9H A;  1RUW A;  2AZS A;  3S3O A;  3WXM B;  2OTL A;  3I56 Q;  1JJ2 S;  2FPD A;  1VQP A;  1T0H A;  2W10 A;  3E1S A;  1K76 A;  4M77 G;  3CCV T;  2CP2 A;  2VC8 A;  2KT8 A;  4F16 A;  2O9V A;  1VQ6 T;  1N9R A;  4LDY A;  1LVK A;  2EKO A;  4J9C A;  2KYB A;  2PU9 B;  2FZG B;  3CCJ Q;  3H0F A;  3LH5 A;  2EJG A;  3CCL T;  2CT3 A;  1AWX A;  3EFO A;  5LJ5 e;  4ZGE B;  1TWB A;  3SWN C;  1BYM A;  3OSS C;  3HHT B;  3KXT A;  1WXB A;  1NLO C;  1U1S A;  2HKQ B;  2YT6 A;  2VVK A;  5KYY A;  2SEM A;  4KH1 B;  2DE0 X;  2CSQ A;  3FJ5 A;  1EX4 A;  5M9O A;  2LT1 A;  3TSZ A;  4MDW A;  4J6X A;  2E64 A;  1QVG S;  2A28 A;  2OTJ T;  4ELZ C;  1SPK A;  4M7A E;  2DVJ A;  2V8I A;  1WJS A;  2M51 A;  2JXB A;  4OMQ A;  4BI4 A;  2EYW A;  2LP5 A;  3H0I A;  2ABL A;  4OMN A;  5A0L A;  1F1B B;  4X1V A;  3QJY A;  3CCE A;  1YP5 A;  5GAN j;  2E4H A;  2M16 A;  1MMN A;  1XOV A;  2LCC A;  1PSE A;  3M0S A;  4QQG A;  1KQS S;  2FYK A;  4PJN A;  2M0Y A;  3G71 A;  3RIR A;  2L0A A;  3GP8 A;  3CXC S;  4GBQ A;  4BE0 A;  1HJD A;  1K8A C;  3BE3 A;  3VS4 A;  1RAH B;  5KE3 A;  4LE9 A;  4DQ2 A;  2CP3 A;  1V29 B;  3L2U A;  2YRD A;  2PZ1 A;  2WSC E;  4HKE A;  1B34 B;  1SF9 A;  4D6W A;  2JTF A;  2KRO A;  1JJ2 A;  5FU6 B;  1AWW A;  4M78 E;  1PWT A;  2MK5 A;  1Y07 A;  4VUB A;  5FWC A;  1K8A U;  3P8B B;  4J6Y A;  5C0M A;  2VUB A;  4EIK A;  2VV5 A;  4DBH A;  5DM7 R;  5J3B A;  4XTY A;  1VQ5 A;  4IUU A;  3CCM Q;  1VA7 A;  2E5Q A;  4RTZ A;  1Y57 A;  4C8Q A;  4OB2 B;  3KUF A;  1GCQ C;  4OB3 B;  5CKB A;  2KNB B;  5CKD A;  5GAN 4;  3NHN A;  5GAM d;  3MHX A;  1Q95 G;  1ZUU A;  5IHI A;  3EGX B;  4N4H A;  1M8V A;  2KYM A;  2KY9 A;  2FZK B;  4FSS A;  1M1G A;  1M5Q 1;  2LJ0 A;  3OYK A;  3HKS A;  1BU1 A;  1JB0 E;  2HEQ A;  3UF4 A;  3QDF A;  3SEM A;  5GAN f;  4NS5 A;  4BB7 A;  2RJE A;  3M0P A;  1VQL A;  3G1J A;  1YHQ A;  4YTL A;  2L2P A;  1H3H A;  4DBR A;  1VQM A;  2QA4 Q;  4J5Y A;  3KFV A;  2JN0 A;  2L3P A;  3CCQ A;  1VUB A;  1QVG A;  2DXB A;  3G6E A;  2ZPI B;  3EH2 A;  3A8H B;  1KSW A;  4JJN K;  5KCO A;  1UGP B;  4JPB W;  2E65 A;  1KHI A;  4JJD A;  2RA2 A;  4F04 B;  1H3Z A;  1G3S A;  4F7U B;  1QKW A;  3MO8 A;  2G3R A;  5CVI A;  1WYX A;  1I07 A;  1M90 R;  1Q81 R;  1VQ7 Q;  4N4G A;  2YWW A;  1YWO A;  2K3X A;  1M30 A;  2RJD A;  5C6S A;  4PFO A;  1UE9 A;  1Z9Z A;  1M27 C;  3M56 A;  1FMK A;  2K57 A;  2JT4 A;  2RQV A;  2QEX T;  2K5L A;  2E3I A;  4M4Z A;  2QQA A;  3F70 A;  3VS0 A;  1WHH A;  4C92 C;  1GBQ A;  3NPF A;  4K11 A;  2NYS A;  4BAC A;  4ZTF A;  1GL5 A;  1BIB A;  2A3L A;  4J9H A;  2MIO A;  5I2S A;  1D1A A;  3MPU B;  5GAM e;  2RNA A;  4L6V 5;  4AG2 C;  2VKN A;  3VUZ A;  3GOX A;  1W70 A;  2X4X A;  3ASK A;  1AHJ B;  2XI9 A;  5D6Y A;  4C92 D;  3LGF A;  4FYV B;  2NWM A;  1OYX A;  2WSF E;  2DET A;  2K4Y A;  4J9F A;  2H3E B;  2CP5 A;  1VQN Q;  3JCM J;  4BE1 A;  2JM9 A;  1WZO A;  3REB B;  1Q81 C;  4AFS C;  1Q86 R;  1BBZ A;  2AKK A;  3CD6 A;  2J7I A;  1X2K A;  1UHC A;  1WXT A;  3OYB A;  4C92 F;  2A36 A;  4M75 E;  3FDR A;  2DIG A;  3KBG A;  2OJ2 A;  5J39 A;  4E7I A;  1M90 U;  1Q81 U;  3OYA A;  1YJW T;  2EYX A;  2X4W A;  2QK0 A;  4J7F A;  5D6W A;  3G4S A;  1NYG A;  4DEY A;  1NBE B;  2DLP A;  1FWZ A;  1WHL A;  3CC4 A;  1QVF S;  2OAU A;  5CKE A;  4A4K A;  1Y96 B;  2HBW A;  4M7D A;  3X26 B;  3QG1 A;  2X4Y A;  5A0G A;  2M9U A;  1YCS B;  1E6H A;  3CCS T;  1E6G A;  1BCO A;  2A0F B;  4LD6 A;  4D8K A;  3V8J A;  2EQI A;  2DRK A;  2YUO A;  1FYN A;  4C5I A;  1G2B A;  4B9W A;  5I21 A;  1YJN A;  4IUV A;  2RQR A;  4KRT A;  3VKI A;  3H8Z A;  3OBY A;  2DA9 A;  3MJX A;  1Q86 C;  1XQH A;  5KCH A;  1PRL C;  4CC3 A;  4F7U G;  5GAN h;  4C5E A;  3HPW A;  3P8H A;  1TSF A;  3HRU A;  1MMA A;  1N8R C;  4XU2 A;  3S3N A;  2R57 A;  3EGX A;  2BZX A;  2PTK A;  2LNH B;  4QVC A;  3JB9 D;  1JQQ A;  4Y28 E;  1I5O B;  1Q86 U;  3O8V A;  3VYH B;  1YIT Q;  4J6W A;  3CME Q;  4ANJ A;  4JRQ A;  3M0U A;  4PJM A;  1SRL A;  3SWN A;  2ZPB B;  1VQ4 T;  1N8R U;  1S72 T;  4PJO E;  2KEA A;  5IXF A;  5GAO n;  2HDA A;  4DBF A;  5GAN g;  1YI2 T;  3TVT A;  3QII A;  4C92 B;  2I0N A;  1M4Z A;  3OS0 A;  2PVO B;  3JB9 F;  2XHC A;  3MP6 A;  2DMO A;  1ZA1 B;  3DKM A;  2EQU A;  5GJW B;  2FRY A;  5GAN 7;  4XU3 A;  1VQ8 Q;  4C5G A;  2CP6 A;  4EMK A;  4E7S A;  2PVD B;  1OPL A;  1I1J A;  4M7A F;  4LUE A;  4PJJ A;  2KRM A;  2L3R A;  3JCM f;  3CC2 A;  3RER A;  2JMC A;  2A08 A;  1UJY A;  2F5T X;  2RMO A;  2ZPF B;  5GAO q;  1G3Y A;  4OML A;  3L2Z A;  2HL3 A;  1GFC A;  3I56 T;  3EFO B;  3OMC A;  4N0A A;  1QKX A;  2HAX A;  1EZZ B;  2OTJ A;  3GNF B;  4E7L A;  4PLL A;  3LH0 A;  3CC7 Q;  4RTV A;  4L5G A;  4PNO A;  2L89 A;  4X9D A;  3MP1 A;  1QVF A;  2FG0 A;  2JVV A;  2XDB A;  3QJ6 A;  2LVM A;  4R56 A;  5L8R E;  1M2O A;  4B9X A;  2AZV A;  2FB7 A;  2KRN A;  4P5N A;  8ATC B;  3JCM W;  1Z9Q A;  2J6F A;  3THK A;  4M78 F;  4PFP A;  2E5K A;  3QKJ A;  4IIM A;  1NPR A;  2F2V A;  2FPF A;  2QXF A;  3LGL A;  4JS4 A;  4QQD A;  3CCJ T;  4JLG A;  2ED1 A;  4A4E A;  2EBP A;  1VQ9 A;  1WQ7 A;  2V26 A;  1G3W A;  2EYY A;  3ZL7 C;  3VS3 A;  4E6R A;  3CCU Q;  1K9M R;  2DEU A;  2C06 A;  5IN1 A;  1WX6 A;  3ER0 A;  2DPP B;  2RN8 A;  4C5H A;  2VGM A;  3HTR A;  2GF7 A;  3RKX A;  2COZ A;  3VS5 A;  3X25 B;  2FO0 A;  3PIP A;  4KH0 B;  4IUT A;  3ZBD A;  2BTT A;  2ZPH B;  2MYS A;  4C0G A;  1YIJ A;  1CKA A;  4F17 A;  1WHG A;  3CCE Q;  1ZLM A;  2YRC A;  1ABQ A;  2EYZ A;  3SDZ A;  2ZPE B;  3HFO A;  4BI3 A;  1KK7 A;  1O9S A;  4ZGJ B;  4O6J A;  1GFD A;  4A4H A;  4ZTJ A;  3PGG A;  2QQR A;  5LJ5 d;  2L3Q A;  3MEU A;  3V7S A;  4ELY C;  1AZE A;  1K9M C;  1OU8 A;  5KH6 A;  1QP2 A;  4C8Q B;  2DF6 A;  2L5Q A;  2EKH A;  3OYE A;  2HBP A;  2A7Y A;  4J9I A;  1B07 A;  5CKH A;  4HVU A;  2O31 A;  2K9G A;  1RAG B;  1MGQ A;  2YRV A;  3C0C A;  1K9M U;  4HVW A;  2MI6 A;  3I9Q A;  1D1C A;  1K1Z A;  1AZG B;  3A98 A;  3JCM c;  3JB9 I;  1VQ5 Q;  1D3B A;  1UUE A;  2D0N A;  4OMM A;  4O5V A;  3NGP A;  2LCS A;  1UGR B;  1M3B A;  4MML A;  3CCM T;  3OYF A;  5GAN 6;  3L2Q A;  2KAF A;  2QGF B;  3EHR A;  4M7D C;  2DJQ A;  1JXO A;  1LOJ A;  1V1C A;  4J9D A;  2KRS A;  3JCM h;  1RAE B;  4FCY A;  2RHU A;  1VQK A;  3FJP A;  1PSF A;  4FYX B;  1QWE A;  3MP8 A;  2GTJ A;  1VQL Q;  5A2Q E;  4M7D D;  1TS9 A;  2B86 A;  1YHQ Q;  2QQS A;  4KBM B;  2ZZD A;  1ABO A;  2F69 A;  3I5R A;  4HCC A;  3WVE B;  4F14 A;  3M57 A;  4ZGD B;  4E7Z A;  2QA4 T;  3EFS A;  3JCM g;  1TTH B;  2COY A;  2LCL A;  1OX8 A;  3G6E Q;  1FX7 A;  4M75 F;  1WHK A;  4WTO B;  4M7D F;  2HZY A;  3DLL A;  1D0Z A;  2IVW A;  3EG0 A;  3I5S A;  3M0Q A;  1R0B G;  1JJ2 P;  2NUZ A;  1YN8 A;  4RTW A;  2DKG A;  3OYL A;  2K5F A;  2HSP A;  1MUZ A;  5DLO A;  4LUD A;  4Q5W A;  2QQB A;  3VS2 A;  2RJF A;  4Z8A A;  1QCN A;  2P0K A;  2NLU A;  2LNV A;  2GGR A;  4EMK C;  2F2X A;  2GBQ A;  3I35 A;  2CDT A;  1ZA2 B;  1YJW A;  3A8L B;  1PRM C;  1I0C A;  4IUR A;  4R55 A;  1KD1 R;  4C8Q G;  2DL8 A;  4M77 E;  4PK4 A;  3VRY A;  4JJC A;  2F5K A;  3R6O A;  2PVG B;  1ZBX A;  2W0Z A;  1JXM A;  2ROT A;  2AK5 A;  2BE9 B;  2RO0 A;  1UJ0 A;  2CH4 A;  4AFU C;  1H64 1;  1SG5 A;  4CC4 B;  3OB9 A;  3M54 A;  5AYF A;  1OX9 A;  4N0A C;  2PUO B;  3EG2 A;  4M7A A;  1E7O A;  1M1K R;  1AVZ C;  2CGH A;  2KDS A;  4RMO A;  1BIA A;  1BI3 A;  1NEG A;  2ZPG B;  4QVD A;  5LJ3 j;  1PKT A;  2BZ8 A;  2QAS A;  3H9N A;  3TU4 K;  2AKL A;  3FB9 A;  4KUL A;  4PJO F;  1YCY A;  4XU1 A;  1QVG P;  1VQN T;  3L42 A;  2OI3 A;  5D6X A;  4M7D B;  2AIR B;  4XQ3 A;  2AT1 B;  3DLM A;  5IHK A;  2CRE A;  3J80 E;  3PFS A;  2LQK A;  3CPW S;  4J9G A;  3OBW A;  4V2S A;  3I55 Q;  2E41 A;  1MND A;  1KD1 C;  2DIL A;  3EG9 A;  3OY9 A;  3G4S Q;  1KQ2 A;  2CYZ B;  3MKD A;  3CC4 Q;  1PKS A;  1KQS P;  2YUP A;  2JM8 A;  4J9B A;  5CO7 A;  1IXD A;  2HQE A;  4M78 A;  2SRC A;  5CQY A;  3CXC P;  2M0O A;  4CC7 A;  4JRI A;  1MV3 A;  1KD1 U;  4RTT A;  3CCR A;  1B7T A;  1VIE A;  1M1K C;  2BZY A;  4AFQ C;  2X51 A;  1BB9 A;  1VYV A;  4ORZ A;  3TEE A;  4A4F A;  1KJW A;  3SWN B;  1BCM A;  1PM3 A;  4AMC A;  4JS5 A;  1HSQ A;  1WFW A;  2D8J A;  1M1K U;  2LMJ A;  4XTU A;  1YJ9 A;  3M55 A;  5LJ3 f;  5FU7 C;  1Q7Y R;  1OPK A;  1D0Y A;  1FXX A;  1H8K A;  1M3C A;  4LDU A;  4EMK B;  1GRI A;  4B6M A;  3LLR A;  4QT7 A;  2DL7 A;  4KT0 E;  3AT1 B;  3CME T;  2YLC A;  1SHG A;  2DEQ A;  1UGS B;  4X9C A;  1I81 A;  1NZ9 A;  4KUI A;  4RKU E;  4TVR A;  3LX7 A;  1KQS A;  3LWI A;  3L1A A;  1EIF A;  4PJL A;  3CXC A;  5CAI A;  2GTO A;  2XIC A;  1VQ8 T;  2H8H A;  3CC2 Q;  1ZBJ A;  4E7H A;  4HVV A;  3Q1J A;  1SSF A;  4OMO A;  1R8O B;  2KQW A;  2EQM A;  5CR2 A;  2LDM A;  3OW2 S;  1Q7Y C;  3HP9 A;  3JCM e;  1PHT A;  2XID A;  2RD1 A;  2J06 A;  1K73 R;  1V76 A;  2JOY A;  2VAS A;  4ZN1 A;  2NUT A;  3VS1 A;  4EMH A;  4RCB A;  3JB9 H;  2DAQ A;  2DL3 A;  4XTW A;  1Q7Y U;  4MZM A;  3CC7 T;  4OGC A;  1AEY A;  3MEW A;  1PC0 A;  1M90 C;  3JSC A;  5HKC A;  3UA7 A;  5KYW A;  4AFZ C;  2HL5 C;  3CMA Q;  4PFZ A;  1VQ9 Q;  3VU3 C;  4J8O A;  1T3S A;  3VV0 A;  2ZCF B;  2CUB A;  2J05 A;  4XAX B;  1IRE B;  3MET A;  2FVU A;  3CCU T;  4OGE A;  2EVR A;  4OB1 B;  3ULR B;  2KXD A;  2EJ9 A;  2X35 A;  2K3B A;  1PG5 B;  1K73 C;  2MAM A;  4M75 A;  3NMZ C;  1RAF B;  2DZC A;  5FU7 B;  5CQX A;  4HT8 A;  3QO3 A;  1W4S A;  2CSI A;  5GAO r;  4JZ4 A;  2LC4 A;  1A0N B;  4BI8 B;  2DBM A;  4Z89 A;  1LJO A;  1YIJ Q;  1OU9 A;  1KC8 R;  1JU5 C;  2BE7 D;  2O9S A;  1K73 U;  5CK9 A;  1U06 A;  2RK2 A;  1NM7 A;  3CCE T;  2E3H A;  1UEB A;  2QG9 B;  3OA6 A;  1ZSG A;  2ZAE A;  5LL6 S;  2OAW A;  5GAN 8;  2EYQ A;  4M7A C;  4HA8 A;  1QVF P;  3QHS A;  1IHW A;  1D3B B;  3EG3 A;  4M77 C;  2E70 A;  3JCM X;  1RLP C;  4ME7 A;  5LJ3 h;  2DD5 A;  4MMK A;  3H6Z A;  1WJR A;  3CCV A;  2YSQ A;  4JUV A;  4OF1 A;  5HCK A;  3QPH A;  5GMK l;  1AWJ A;  1N27 A;  2RI2 A;  4M7A D;  1VQ6 A;  2CKK A;  1VQO Q;  3BW1 A;  4M77 D;  4OVA A;  2L3S A;  2X3X D;  3VUB A;  1WQW A;  3CCL A;  1Y0M A;  2XU8 A;  2LQN A;  2GQV A;  5LJ3 g;  4PJO A;  3RKY A;  3MEV A;  3BDL A;  4XTX A;  1GBR A;  1UG1 A;  5GMK m;  4M78 C;  2C0I A;  4M77 F;  2GNC A;  2YDL A;  3EFR A;  5GMK j;  2CP7 A;  3EAE A;  1KC8 U;  4F7U E;  3CBM A;  2O4X A;  2OTL Q;  1D0X A;  1TUG B;  1BI1 A;  3D7S B;  1VQK Q;  1D09 B;  4RG2 A;  1MNE A;  1VQP Q;  4M78 D;  5KE2 A;  3NFC A;  1KQ1 A;  4C0D C;  5LJ5 g;  2LJ3 A;  1VQL T;  4HCB A;  4E7K A;  4NOY A;  4DA4 A;  5GAM f;  1QCF A;  2MWP A;  1YHQ T;  1Q82 R;  4RG8 A;  3PVL A;  2GCX A;  4PKC C;  4A53 A;  1U8R A;  4RTU A;  3RNJ A;  4Y92 A;  2Y4Y A;  1WLP B;  1TUD A;  2PQW A;  3C4S A;  3PT9 A;  2K79 A;  2QGG A;  3G6E T;  2CH4 W;  3M0R A;  3M53 A;  2CP0 A;  1SRM A;  3DB3 A;  2R5A A;  4PLI A;  2E6N A;  5I22 A;  2EAY A;  1W2B S;  5IAY A;  1VQN A;  1N5Z A;  4L59 A;  1UHF A;  3RUX A;  4Z88 A;  1FMV A;  1WIE A;  1X43 A;  3BY7 A;  2MPX C;  3NTK A;  4A4G A;  1SHF A;  4M7A B;  3EGD A;  3OS5 A;  3RKW A;  4JJB A;  1RLQ C;  3GF5 A;  2YXY A;  3M4G A;  2EQJ A;  3JCM Q;  5GAN d;  3PMI A;  5DLQ E;  1RAC B;  2LT4 A;  3OYN A;  3OQ5 A;  1IHV A;  5CIU A;  2HNI A;  4C92 G;  2HQX A;  2X3W D;  1IZ6 A;  2DRM A;  1Q82 U;  4BD3 A;  4HT9 A;  2XMF A;  2JJ9 A;  3WVD B;  5FW9 A;  1ZSZ A;  1WGS A;  3G71 Q;  2DL4 A;  2DK3 A;  1N9S A;  5HK0 A;  3V8L A;  3EG9 B;  4JZ3 A;  4JDS A;  1RI0 A;  1OEB A;  4XTV A;  5DY9 A;  4M78 B;  3LWH A;  2K3Y A;  3A5Z B;  3OYD A;  2D8H A;  4J9E A;  2EPD A;  4FM4 B;  1TG0 A;  3OYJ A;  4DEX A;  2ATC B;  1M2V A;  1T3L A;  2LX7 A;  1UGV A;  3O5Z A;  1PD0 A;  5J26 A;  2HD0 A;  4C0D B;  3I55 T;  3CME A;  5IHN A;  4KGV B;  4BY6 C;  4LNP A;  2ED0 A;  2DJZ A;  3G4S T;  3HRS A;  3CC4 T;  1KG1 A;  3RBB B;  4N4I A;  2HMA A;  4BDZ A;  4M75 C;  3CCR Q;  1WNL A;  2DNU A;  4C92 E;  2BKD N;  4XTZ A;  2D0Q B;  3RES A;  3CBP A;  4XK8 E;  3S3M A;  3JCM P;  2QQ9 A;  3P8D A;  1VQ8 A;  3GNG A;  4LDV A;  3M0T A;  1UDL A;  1W2B A;  2NUP A;  4M75 D;  1Y71 A;  1VYU A;  2QEX A;  4E7J A;  2QAZ A;  5IT9 E;  5GAN e;  1YJ9 Q;  1VQM Q;  1X75 C;  1KIK A;  3JB9 G;  2KT1 A;  2VB6 A;  2EFI A;  4ESR A;  3OSV A;  3E9G A;  3CCQ Q;  5GAM h;  1D1B A;  1X01 A;  1AOJ A;  2JUF A;  2R58 A;  5LJ3 e;  2LJ1 A;  4M7A G;  4X34 A;  2RI3 A;  1NEB A;  4JRK A;  3A1P A;  3CC7 A;  3REA B;  1HXD A; 
#chains in the Genus database with same CATH homology
 3J81 E;  3HRT A;  5A0G A;  2RM4 A;  1M1K U;  3BDU A;  3GPL A;  2M9U A;  4XTU A;  1YJ9 A;  3J7A F;  2DTO A;  3M55 A;  4M77 B;  3CCS T;  3OS2 A;  5LJ3 f;  4LD6 A;  2LQ8 A;  5FU7 C;  1Q82 C;  3E19 A;  1O75 A;  3V8J A;  3V7R A;  2AHJ B;  1UB4 A;  1FXX A;  3QXE B;  4C5I A;  5GAM g;  4IKF A;  4II1 A;  4B9W A;  5I21 A;  1YJN A;  4ZN3 A;  4LDU A;  4EMK B;  4IUV A;  1YBY A;  3LLR A;  3VKI A;  3H8Z A;  3OBY A;  5GAO m;  1Q86 C;  1XQH A;  4KT0 E;  3INZ A;  1P92 A;  5KCH A;  1VQ7 T;  4F7U G;  3CME T;  5GAN h;  4C5E A;  1OZ2 A;  3HPW A;  3HRU A;  3M59 A;  3P8H A;  3QZ5 B;  5GAN 2;  4PJO C;  3JCM b;  2E6Z A;  1HK9 A;  1DJ7 B;  1N8R C;  2Y90 A;  3AHU A;  4XU2 A;  2KSS A;  2VXE A;  2YLC A;  5LJ3 d;  3S3N A;  1I5L A;  1OI1 A;  2DEQ A;  2DZ9 A;  1UGS B;  2R57 A;  4HCZ A;  3CCU A;  3CC2 T;  4X9C A;  5GAN 3;  2GFU A;  1I81 A;  2VXF A;  4QVC A;  2L8D A;  3JB9 D;  4Y28 E;  1NZ9 A;  2MF2 A;  4KUI A;  4RKU E;  4TVR A;  3HFN A;  2LTO A;  3LX7 A;  4M78 G;  5GMK h;  1Q86 U;  2EJF A;  2WSE E;  2D6F A;  1KQS A;  3O8V A;  3VYH B;  4J6W A;  3LWI A;  4PJO D;  3L1A A;  1EIF A;  4JRQ A;  2MWO A;  3CXC A;  3SWN A;  5CAI A;  2ZPB B;  1VQ4 T;  1N8R U;  1S72 T;  4PJO E;  1Y96 A;  1XNI A;  3PNW C;  2XIC A;  5GAO n;  3CCS A;  1YI2 T;  1VQ8 T;  5GAN g;  1OZ3 A;  3M58 A;  3QII A;  4C92 B;  3MEA A;  3QBY A;  4GLK A;  2RH2 A;  4E7H A;  3CD6 T;  3Q1J A;  2DXU A;  1M4Z A;  3OS0 A;  1SSF A;  1GXI E;  3NTI A;  2JZ2 A;  1R8O B;  3V7C A;  2DVE A;  3V8L A;  3OYG A;  2KQW A;  2EQM A;  4IUP A;  2PVO B;  2LDM A;  2QTX A;  4M77 A;  2XG8 D;  1I8F A;  5CR2 A;  3JB9 F;  2XHC A;  1M9S A;  3MP6 A;  3JCM V;  3OW2 S;  2CZ7 B;  4BY6 B;  3DKM A;  1Q7Y C;  2EQU A;  3HP9 A;  3JCM e;  4NL3 A;  2XID A;  5GAN 7;  4XU0 A;  3CPF A;  1YIT A;  1JRI A;  2DIQ A;  2RD1 A;  2EQK A;  4XU3 A;  2JOY A;  4C5G A;  4EMK A;  2PVD B;  4M75 B;  5FRO A;  3FEO A;  1VIF A;  2EIF A;  3NTH A;  4ZN1 A;  4BDY A;  4CI0 C;  4OP0 A;  2YHT A;  4EMH A;  4M7A F;  4RCB A;  2DD4 A;  4Y91 A;  3UT1 A;  2L3R A;  3JCM f;  3CEY A;  3URG A;  2CS7 A;  2DAQ A;  3UWN A;  1VQO A;  3CC2 A;  3JB9 H;  3RER A;  1BI2 A;  2DO3 A;  1ZHI A;  4XTW A;  1Q7Y U;  3CMA T;  1M1F A;  3QYG B;  3X20 B;  2F5T X;  1VQ9 T;  4MZM A;  3CC7 T;  3DB4 A;  4OGC A;  2GFA A;  2VYT A;  2O01 E;  2ZPF B;  2M1H A;  5GAO q;  1G3Y A;  3MEW A;  3L2Z A;  1U1T A;  3FIF A;  4QW2 A;  2JNG A;  5LJ5 j;  1VQ4 A;  3G7Z A;  1S72 A;  5CCA A;  3I56 T;  1M90 C;  4C0F A;  3M4Y A;  4MZP A;  3JSC A;  1YI2 A;  5HKC A;  5FRM A;  2I2L A;  3OMC A;  4N0A A;  4C8Q E;  2HAX A;  2VGN A;  5GAN 5;  3GNF B;  4E7L A;  4PLL A;  1YJN T;  1LNX A;  2OTJ A;  3LH0 A;  3JCM d;  1ZQ1 A;  2KK4 A;  3OYI A;  1I4K 1;  4F7U F;  4L5G A;  2P4T A;  4PNO A;  2L89 A;  3VU3 C;  4J8O A;  4X9D A;  3MP1 A;  2WAC A;  4C92 A;  3PTA A;  1QVF A;  2CZ0 B;  3VV0 A;  2JVV A;  2ZCF B;  5FU6 C;  4C0Z A;  2XDB A;  3QJ6 A;  2LVM A;  2QDY B;  4R56 A;  5L8R E;  4XAX B;  4B9X A;  3S3O A;  1IRE B;  3WXM B;  2OTL A;  5EG2 A;  2FB7 A;  4P5N A;  3MET A;  3JCM W;  1JJ2 S;  2FVU A;  1QP3 A;  3FLG A;  3CCU T;  4OGE A;  4OB1 B;  1YIJ T;  4M78 F;  1VQP A;  3QKJ A;  2EJ9 A;  1NPR A;  2QXF A;  2X35 A;  3HSB A;  4ATO A;  3TCJ A;  1K73 C;  2MAM A;  3LGL A;  1RL2 A;  3E1S A;  4QQD A;  4BUG A;  4M75 A;  4JLG A;  3CCJ T;  4JS4 A;  4A4E A;  4FT2 A;  2DZC A;  4OMF B;  4M77 G;  5FU7 B;  3CCV T;  5CQX A;  1VQ9 A;  4LDX A;  4HT8 A;  1WQ7 A;  3VJP A;  4Z02 A;  3QO3 A;  3L2V A;  1G3W A;  1W4S A;  2RHX A;  2X4J A;  2VC8 A;  5GAO r;  2LC4 A;  4BI8 B;  4J7I A;  1VQ6 T;  1N9R A;  1LJO A;  2C06 A;  3I56 A;  4LDY A;  2JTM A;  2EKO A;  5IN1 A;  1BI0 A;  3ER0 A;  2DPP B;  1K73 U;  2PU9 B;  4C5H A;  5CK9 A;  4PJO B;  2VGM A;  4BE2 A;  3GLX A;  2EJG A;  3CCL T;  2RK2 A;  3UPU A;  4EDU A;  3E9F A;  2GF7 A;  2RHY A;  3CCE T;  5LJ5 e;  1YIT T;  4ZGE B;  4IUQ A;  3SWN C;  2E1H A;  3RKX A;  1BYM A;  3OSS C;  2RHZ A;  3C12 A;  3X25 B;  3PIP A;  1UEB A;  3HHT B;  3KXT A;  4IUT A;  3OA6 A;  3T9N A;  3ZBD A;  2YLB A;  5LL6 S;  1U1S A;  5GAN 8;  2EYQ A;  3LYI A;  2ZPH B;  3HL8 A;  3OYK A;  2O4X B;  4HA8 A;  4C0G A;  3QHS A;  2ZGW A;  1VQO T;  1YIJ A;  4M7A C;  2BUD A;  1D3B B;  4M77 C;  5LJ5 f;  3OYH A;  2E70 A;  3JCM X;  2BIV A;  1UGQ B;  3QZ9 B;  4ME7 A;  5LJ3 h;  3CCJ A;  2DD5 A;  4MMK A;  3H6Z A;  5M9O A;  1WJR A;  3CCV A;  4DOW A;  2LT1 A;  3SDZ A;  2ZPE B;  3HFO A;  4LDW A;  4BI3 A;  4JUV A;  1O9S A;  4MDW A;  4OF1 A;  3OS1 A;  3L2R A;  2QI2 A;  3QPH A;  4ZGJ B;  4O6J A;  4J6X A;  5GMK l;  2E64 A;  2DXC A;  2RI2 A;  1N27 A;  2H3J A;  4M7A D;  1VQ6 A;  1QVG S;  2CKK A;  2OTJ T;  1KHC A;  4ELZ C;  3BW1 A;  4M77 D;  4A4H A;  4ZTJ A;  2V8K A;  4M7A E;  3PGG A;  3M5A A;  2QQR A;  2V8I A;  1WJS A;  4OVA A;  4NL2 A;  3ME9 A;  4BI4 A;  5LJ5 d;  3V7S A;  3MEU A;  2DXT A;  3VUB A;  4ELY C;  5GAO p;  1WQW A;  1K9M C;  5KH6 A;  3CCL A;  5A0L A;  2XU8 A;  3UDC A;  1QP2 A;  4M75 G;  4C8Q B;  1XTD A;  4M7D G;  2L5Q A;  3QJY A;  2GQV A;  3CPW A;  2XD0 A;  2EWN A;  5LJ3 g;  3OYE A;  3FRN A;  3CCE A;  5GAN j;  2OTL T;  4PJO A;  1VQK T;  2HBP A;  2M16 A;  2A7Y A;  3RKY A;  1XOV A;  3MEV A;  5CKH A;  3BDL A;  4XTX A;  2LCC A;  1PSE A;  1VQP T;  4QQG A;  3S6W A;  3QDR B;  5GMK m;  4M78 C;  4M77 F;  3V8K A;  4E47 A;  1MGQ A;  3VYG A;  2RHI A;  2YRV A;  4QQ6 A;  1KQS S;  1K9M U;  3EFR A;  1QVP A;  2MI6 A;  2FYK A;  5GMK j;  3G71 A;  3RIR A;  3EAE A;  4BE0 A;  3GP8 A;  3CXC S;  4F7U E;  1KC8 U;  3CBM A;  3C95 A;  3RMS A;  1K8A C;  2O4X A;  3JCM c;  3JB9 I;  1NJI C;  1BI1 A;  5KE3 A;  1D3B A;  4DQ2 A;  3M9Q A;  4O5V A;  1V29 B;  4RG2 A;  3L2U A;  2V8J A;  1UGR B;  2WSC E;  4HKE A;  1B34 B;  3A8G B;  4M78 D;  4MML A;  3NFC A;  1KQ1 A;  3OYY A;  5KE2 A;  4C0D C;  4D6W A;  2JTF A;  5LJ5 g;  3CCM T;  1JJ2 A;  3OYF A;  5FU6 B;  5GAN 6;  1VQL T;  4HCB A;  3L2Q A;  4M78 E;  2KAF A;  2RI5 A;  1JBM A;  3OMG A;  1Y07 A;  1G3T A;  4NOY A;  4VUB A;  5GAM f;  4E7K A;  4DA4 A;  2MWP A;  4M7D C;  1YHQ T;  1K8A U;  1WPY A;  1NJI U;  3P8B B;  1LOJ A;  2LX9 A;  4RG8 A;  4J6Y A;  5C0M A;  2GCX A;  4PKC C;  3OYM A;  2VUB A;  2RB6 A;  4A53 A;  2D9T A;  2LRQ A;  2VV5 A;  3JCM h;  5DM7 R;  1U8R A;  5J3B A;  4XTY A;  1VQ5 A;  2RHU A;  1VQK A;  2Y4Y A;  1PSF A;  3FJP A;  4IUU A;  3JB9 J;  2E5Q A;  2PQW A;  3MP8 A;  3C4S A;  3PT9 A;  4EMG A;  4C8Q A;  4OB2 B;  3ZEH A;  3KUF A;  4OB3 B;  5CKB A;  5A2Q E;  4EPC A;  3G6E T;  4M7D D;  5CKD A;  3SD4 A;  5GAN 4;  2QQS A;  3M53 A;  4KBM B;  5GAM d;  2ZZD A;  4M7D E;  2F69 A;  3MHX A;  3DB3 A;  2R5A A;  2RK1 A;  4N4H A;  4HCC A;  1M8V A;  2KY9 A;  3WVE B;  4PLI A;  2E6N A;  3I55 A;  1M1G A;  1M5Q 1;  3M57 A;  4QVZ A;  1MHN A;  4FT4 A;  5I2M A;  2EAY A;  3A8O B;  3HKS A;  3EFS A;  4ZGD B;  2QA4 T;  1W2B S;  5IAY A;  1VQN A;  1JB0 E;  4L59 A;  4PJO G;  3JCM g;  2LCL A;  3RUX A;  5GAN f;  5GMK e;  3CCM A;  4NS5 A;  4KUD K;  4BB7 A;  2RJE A;  1FX7 A;  1TH7 A;  4M75 F;  1VQL A;  3BY7 A;  4M7D F;  3FC3 A;  4J83 A;  4PL6 A;  3DLL A;  1B34 A;  1YHQ A;  3NTK A;  2IVW A;  4YTL A;  4A4G A;  4M7A B;  1VQM A;  3OYC A;  2P0P A;  4J5Y A;  2KVQ G;  2PUK B;  2DKG A;  3L2W A;  3OS5 A;  5FLX E;  3RKW A;  2XKO C;  3OYL A;  2K5I A;  5GAM j;  4GY5 A;  3GF5 A;  2JN0 A;  3M4G A;  4A54 A;  2EQJ A;  2K5F A;  3JCM Q;  3CCQ A;  5GAN d;  1VUB A;  3PMI A;  5DLQ E;  5DLO A;  1QVG A;  2DXB A;  4Q5W A;  2QQB A;  3G6E A;  2ZPI B;  3G71 T;  2LT4 A;  1Y7X A;  3OYN A;  2RJF A;  3OQ5 A;  3A8H B;  4DOV A;  2FHD A;  2P0K A;  4MDX A;  5CIU A;  2HNI A;  3RMQ A;  3OW2 A;  4JJN K;  5KCO A;  1UGP B;  2NLU A;  4C92 G;  2HQX A;  2LNV A;  3QSU A;  3MCA B;  2E65 A;  1IZ6 A;  1KHI A;  2R5M A;  1BKB A;  2DTH A;  4EMK C;  4BD3 A;  1Q82 U;  4HT9 A;  2RA2 A;  5A0D A;  1H3Z A;  1G3S A;  2QA4 A;  3WVD B;  3X24 B;  3A8L B;  4F7U B;  1YJW A;  3SFM A;  4CRI A;  2FL7 A;  3MO8 A;  4IUR A;  3A8M B;  4R55 A;  1WGS A;  1NE8 A;  2G3R A;  5CVI A;  2DK3 A;  4LD9 K;  4C8Q G;  1N9S A;  4M77 E;  5HK0 A;  2F5K A;  2CZ1 B;  2XDP A;  3R6O A;  2DTI A;  2PVG B;  1ZBX A;  2IG0 A;  1RI0 A;  4JDS A;  2P0Q A;  4N4G A;  3X28 B;  2RO0 A;  4XTV A;  2K3X A;  1KC8 C;  4JLI A;  5DY9 A;  4M78 B;  1H64 1;  2RJD A;  5C6S A;  1VQ5 T;  3N5B B;  5LJ5 h;  3OB9 A;  2K3Y A;  3LWH A;  3M54 A;  5AYF A;  3M56 A;  3BFM A;  2K57 A;  4N0A C;  2PUO B;  3A5Z B;  2E12 A;  3OYD A;  4M7A A;  1G5V A;  4FU6 A;  4FSX A;  2QEX T;  2K5L A;  4FM4 B;  3OYJ A;  3TRE A;  2CGH A;  2KDS A;  4RMO A;  2QQA A;  3F70 A;  1BIA A;  2KMT A;  1BI3 A;  2ZPG B;  3JRZ A;  4QVD A;  5LJ3 j;  4C92 C;  3CCR T;  4BAC A;  4ZTF A;  1BIB A;  4MZT A;  3TU4 K;  2A3L A;  5J26 A;  2HD0 A;  4C0D B;  5I2S A;  3I55 T;  4KUL A;  3FB9 A;  4PJO F;  3PIO A;  3GIB A;  1VQ7 A;  1YCY A;  5GAM e;  3CME A;  2XDD A;  4XU1 A;  4L6V 5;  1VQN T;  3L42 A;  4BY6 C;  5D6X A;  4M7D B;  3VUZ A;  3GOX A;  4XQ3 A;  3DLM A;  2DJZ A;  4C8Q C;  3G4S T;  2E10 A;  2X4X A;  3HRS A;  3ASK A;  3CC4 T;  1AHJ B;  2XI9 A;  1X6O A;  2MMP A;  3QUI A;  5D6Y A;  3C94 A;  4JRP A;  1KG1 A;  3JAM E;  4N4I A;  3LGF A;  3PMT A;  4C92 D;  3PFS A;  3J80 E;  4BDZ A;  4M75 C;  5HK3 A;  2LQK A;  1OYX A;  2WSF E;  1WNL A;  3CPW S;  4F7U A;  2XK0 A;  3OBW A;  4WF2 A;  4V2S A;  4C92 E;  2BKD N;  4XTZ A;  2E41 A;  1YJ9 T;  2K4Y A;  2K2V A;  3CBO A;  2D0Q B;  1VQM T;  1KD1 C;  3RES A;  3CBP A;  4XK8 E;  3LW5 E;  3JCM J;  4BE1 A;  4C8Q D;  3OY9 A;  3S3M A;  3JCM P;  2QQ9 A;  3P8D A;  1Q81 C;  2CYZ B;  1VQ8 A;  1KQ2 A;  3GNG A;  4LDV A;  5CKF A;  3CCQ T;  5GMK i;  1W2B A;  5CO7 A;  2Y4X A;  2HQE A;  3CD6 A;  4M75 D;  4M78 A;  1Y71 A;  2QEX A;  5CQY A;  3OYB A;  4E7J A;  5HY6 A;  4C92 F;  5IT9 E;  2M0O A;  4M75 E;  3FDR A;  1N6A A;  4FL6 A;  2DIG A;  4JRI A;  5GAN e;  3KBG A;  4RCC A;  1KD1 U;  1X75 C;  3CCR A;  3JB9 G;  4UC4 A;  1VIE A;  3ZFJ A;  5J39 A;  4E7I A;  2EFI A;  4OB0 B;  1M1K C;  1M90 U;  1QW1 A;  2CZ6 B;  1Q81 U;  5FRN A;  3OYA A;  1YJW T;  3OSV A;  3E9G A;  5GAM h;  4C8Q F;  2X4W A;  1X01 A;  2JUF A;  2RJC A;  1WJQ A;  2R58 A;  4J7F A;  3TEE A;  4A4F A;  5D6W A;  3G4S A;  4FIB A;  3SWN B;  5GAO l;  5LJ3 e;  1FWZ A;  3CC4 A;  1QVF S;  2OAU A;  5CKE A;  4X34 A;  4A4K A;  1Y96 B;  2RI3 A;  4M7A G;  3SB2 A;  1NPP A;  3QYH B;  4JRK A;  4M7D A;  3X26 B;  2B8A A;  3CMA A;  3QG1 A;  4JS5 A;  2X4Y A;  3CC7 A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...