5DLQE

Crystal structure of rangtp-exportin 4-eif5a complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
136
Chain Sequence
b'ATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-4
publication title Structure of the exportin Xpo4 in complex with RanGTP and the hypusine-containing translation factor eIF5A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 22
structure length 136
sequence length 137
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dlqE01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5dlqE02
5GROA 4HJ5A 1KRTA 1SLJA 1C7YA 3J7A5 3CCQT 1IBML 3I4MH 4A3BG 1YHBA 4DK3C 2JOYA 3ERSX 4PZ6A 4DV4Q 1JJ2A 2LQ8A 2PMZE 5IYBG 1QVFS 1PHJA 1NE3A 2UU9L 1XNQL 1KXLA 3OTOL 4JV5Q 3NENA 2K5NA 4A3IH 2WAQG 4DAMA 4LFCQ 2IX0A 1WJJA 1IBKL 4IOAA 1SMXA 4JBJA 2K50A 2PQAB 4Y52H 3CMAA 4IJHA 2NVTH 1JB7A 1VQKA 3A0JA 3NELA 3DLLA 1HZAA 4XIGS 3HOXH 2QGQA 4A3KH 1G6PA 2Q2UA 4IPCA 4KI0A 4KHPQ 2F4VL 2K75A 1N8RU 1VQFA 5FLMH 4DV1Q 2KVQG 1E24A 1YJWA 2Y0SE 4HIDA 2B63H 2RF4A 3KJPA 2KENA 3RN5A 1X56A 2JEAI 4DR4L 4QGUA 1S72A 3CCRT 4DNIA 1N34Q 3G71A 2R6GA 4A3LH 4Y7NH 5DLQE 1HH2P 1E1TA 3J80E 3CC2A 3K0XA 1QVGS 5C0XG 2Q2TA 1L2FA 4EX5A 1A0IA 4X62L 1W2BA 5JJKA 4DR1L 3UDIA 2DUDA 4DV2L 1RL2A 1NTGA 1QZHA 3GDEA 1EQRA 1SN8A 3K80C 2B3GA 3LGJA 4JG2A 5IP7G 1GKHA 2OQ0A 3HOWH 1Q82U 1VQMA 1M1GA 1CKNB 4K0KQ 2RCNA 4P72A 4GLAC 4J15A 3PUXA 3PUVA 3PF5A 3PO3G 3CPFA 3TREA 2RHQB 1Z47A 4AYBE 1YJNT 4UP8A 3S1QH 3CCLA 5IWAL 2VUMG 2MI6A 1L0WA 1E7ZA 5GQOA 1VQ7T 4DR3L 4A3FG 1PH4A 1FJGL 4YCWA 5A2QE 4JI7L 5LMNW 4YTLA 1VQ9T 1KQSS 2R7FA 3M85A 3PIPA 1VQ4T 4R4IA 1TXYA 1PFSA 3HKZG 3EBEA 3WWVA 4BA1I 4DV7L 1ASYA 3PCOB 1HZCA 1QUQA 1MKHA 3LGLA 1TWAH 4BBRG 4LF4L 1YITT 2E2IH 4JYAQ 5C0XI 4FDBA 5J3BA 1VQAA 1FGUA 1K3RA 1YI2T 1GO3E 1OTCA 4OONA 1I50H 1KIXA 4A3MH 3CCSA 1CKNA 1XNIA 1KD1U 4QJFA 3S1MH 1Q82C 2NVYH 5M5XH 4LF5Q 4A3IG 4GLVB 2VQEL 1B7YB 2UUBQ 1CUKA 4IJLA 4DV6L 3CPWS 4POGA 5FLXc 4DR2L 4B3SQ 5C44H 2ZJPA 4A93H 2VQFQ 5LMUQ 4UY8C 2I0QA 1XMQL 3I55A 1HZ9A 2PNHA 4GS3A 4JI3L 3HOXG 4A3KG 4IPHA 3DM3A 1KC8U 1P8LA 4C2MH 4TVRA 1I94L 2JA8H 2KHJA 4QY7A 1K0RA 1DGSA 5FLMG 1VQ6T 1LTLA 2Z0SA 3KLWA 4XTCS 4OO1G 3H15A 2VS1A 3FP9A 4R4OA 3U50C 4CRIA 2B63G 4IFDI 3JC66 3CCEA 1LM0A 1WCMH 3CC7A 4JI4Q 3GTGH 1A62A 4A3LG 2JA7H 1Q1EA 3OYYA 3RLNA 3I7FA 3RZOH 3BU2A 1PYBA 1VQCA 2AWOA 4AQYL 4LFBL 1XNRL 2ALYB 2GN5A 2NN6G 1KD1C 5C3EG 4DV3Q 1K8GA 1HNWQ 3JAMi 3KF6B 2K52A 1J5EL 3G4ST 5C4XH 4YCUA 2E8GA 1Q7YU 5GAGC 1TWFH 4POFA 1G51A 5HY6A 3UDXA 3RNUA 3J81E 3J80i 3HOYG 1YHQA 4X64Q 3K7UC 4JI5Q 2GVBA 4DV0L 4HIKA 3FKIH 3CCUA 2K5HA 1KL9A 1CKOA 2OTJT 4BA2I 3W5OA 1SE8A 3RLFA 3S1RH 2ZTDA 4BY1G 3NEMA 2MWPA 3M9BA 3T1HQ 4C3HH 4NXNL 3J7AF 2QEXA 3CCJA 3GO5A 4OO1I 3EIVA 1QVCA 1UWVA 2BA1A 5E7NA 5BR8Q 4DAYB 4APVA 4GLXA 4LNQA 1PH7A 3I4NH 1C0AA 1EQQA 2ASBA 2PI2E 4LWCA 2AHOB 3D0FA 2Q2IA 3BJUA 4LFAQ 1NMGA 3AFPA 3HFZB 2I5MX 3CCQA 4GKJQ 4A93G 2NZOA 2YTVA 5H1SE 4BBSG 2NN6I 1BBWA 5IT9E 2JA5H 4X65Q 2IY5B 1Q7YC 3H0GH 1HNZL 3E0EA 4WJ3M 2ZTEA 4GNXA 3K7AH 3LGFA 1NJIU 4A3MG 1NMFA 3CMET 5JJLA 4ZN1A 1LUZA 2MO1A 3CCMT 5AJ3L 4O2DA 2MQHA 4YWLA 1HNXQ 1A8VA 3PO2G 3CAMA 3UDGA 1PH5A 2LXJA 1NZ9A 2IX1A 2G3RA 2CWPA 4TQUS 5C44G 2NVQH 3H3VH 4DUYQ 2JUFA 1IYJB 3AQQA 2QA4T 3BZKA 4DK6C 2HQLA 4DV4L 1Y1VH 2UXDL 2Z6KA 3W1BA 3RR5A 4EQ5A 5C0XJ 3S2HH 4JV5L 2DO3A 2JQOA 1XJVA 4DR6L 4DR7L 3A5UA 1X65A 3KYHC 3CCRA 1XMOL 4X34A 3UE0A 1IBLQ 1BVSA 3AEVA 1A63A 1WCMG 2UU9Q 1PH8A 2R92H 2JA7G 4A3DH 5GADC 2B29A 2E5LL 3JAME 1N33L 4BXXH 4B3RL 2I5LX 4AIMA 2UXCL 2R93H 3I2ZA 1NJIC 3G48A 3EN2A 3W1GA 2A8VA 2AMCB 3CQZH 2JEBI 4L5SA 5DM7R 5IYCH 4MTNA 2E6ZA 3HOZG 1N34L 3HKZE 1O7IA 3RN2A 1Q1BA 3HKSA 1QUQB 1MIUA 2KCTA 1SFOH 2VZAA 4P71A 1JT8A 2KCMA 5K36G 1I5FA 4LF7L 1K9MU 3P8BB 2MWOA 3I56T 4A76A 2WP8J 1YJNA 4YWMA 2HHHQ 2CQOA 1B70B 5IE8A 2JK8A 3UDFA 3TS0A 3S2DH 1VQ7A 1B8AA 4JI8L 1Y1WH 4HJ8A 1UE1A 3J81i 3PV0A 1VQ9A 4PG3A 1EYGA 1PH2A 4ZN3A 1VQ4A 1YZ6A 5JEAG 5FJ8G 1BBUA 4PZ7A 1PVOA 4K0KL 4A3EH 1WFQA 1YITA 2NZHA 1X6OA 3CC4T 4DV2Q 4JI6Q 1VQDA 2CKKA 1EWIA 1VQGA 1YI2A 3KF8B 1JE5A 1E1OA 1EOVA 4JC0A 3L2PA 2BH2A 2R7ZG 4IFDG 2JA5G 4DUZL 1IZ6A 1CSPA 5IP9H 4GNXC 1TWGH 1N32L 5M5YH 1UE7A 2LCLA 1YJ9T 3KDFA 3E9HA 1Q8KA 3RLOA 3I4MG 4QQBX 4GN4B 2OTLT 1T9HA 3PUYA 3TS2A 1OXXK 3CD6T 3DB4A 1K8AC 1K9MC 1V1QA 1JJ2S 4RG1A 5M3MH 4DR3Q 2UUAQ 4JYAL 1JJCB 1K83H 1FJGQ 4X66L 1VCIA 2JA6H 3OW2A 1Y1VG 1VQ6A 2LSSA 1D7QA 2IHEA 2K14A 2JVVA 3CXCA 1VQNT 2Z6KC 4LF4Q 4GKKL 4LUZA 3VDYA 1X55A 2UUBL 1SROA 3GTQH 1Q12A 2UXBL 2EQSA 3S24A 4P75A 4JI2L 1HR0W 4IOCA 5LMUL 4OX9L 2R92G 5JJIA 1WYDA 3GTPH 2F3IA 5EAYA 2MNAA 3S1NH 3PGZA 4LUVA 4QQDA 3G4SA 1VQ5T 4DV6Q 1N36L 1YHAA 4IPDA 3K8AA 4A4IA 4A3CH 4UPAA 4DR2Q 1X9NA 1E3PA 2OQKA 3HOUH 4GOPA 3A74A 2R7DA 5LMNL 1XMQQ 2MO0A 1SRUA 1PA6A 1NPPA 1QVFA 4JI3Q 4JI4L 3AFQA 5IYBH 1CKMA 1I94Q 4YHHQ 2OTJA 4JI0L 1OXVA 1W2BS 1HNWL 1L1OC 2F52A 2VL6A 4B3TQ 4RG2A 1VS0A 5LL6S 1VQJA 2YTXA 4GNXB 2CWAA 2YTYA 3F8TA 3HOWG 1Z9FA 2IT1A 2ID0A 1XTDA 4QL5A 4JI1Q 5FLXE 3U4ZA 1NY4A 2IHFA 3F2DA 4AQYQ 1UEBA 3HOVH 3PUZA 3T1YQ 4MZ9A 3CF5A 4JI5L 4YWKA 4X64L 1S40A 1J5EQ 1VQLT 1HR0Q 2MFIA 2WFWA 3IRBA 5ELOA 4DKAC 2VW9A 1PH6A 3GTKH 3TRZA 1VQOA 5IT9c 1PH9A 5M3FH 2WAQE 2UUCL 3PIOA 2ES2A 1SR3A 1YBYA 2AWNA 4O0AA 3CMEA 1X3FA 1QVGA 1AE3A 3E9IA 5GAEC 4DV0Q 4DR5L 4NXML 3CCMA 4YY3L 5J26A 1C9OA 1HZBA 4DV5Q 5BR8L 1VQOT 3FHWA 2D62A 3G6ET 1YIJT 4HJ7A 1G291 3RZDH 4PMWA 3L0OA 4GN5A 2ZM6L 1PH1A 4LFAL 4A3GG 1Q86U 4NXNQ 4NPSA 2QA4A 3M3YH 4LF6Q 2YV5A 4X65L 3PF4A 1OXTA 2ZTCA 5IY0A 2JA6G 3ICEA 1KRSA 4YCVA 3STBC 4JBKA 3F2CA 2OCEA 5IAYA 4LF9Q 1VQHA 2KBNA 3GD7A 2E2JH 3KOJA 1VQPA 1HNXL 1WI5A 2V1CC 4GN3B 2VUMH 3JAMc 1L1OB 2JA8G 4B3MQ 4DUYL 1KQSA 3CP0A 3U4VA 4LFCL 4LUOA 5ELNA 1KAWA 2WB1G 1IBMQ 4P74A 1VQPT 1V43A 4MNOA 3J80c 3CCVT 4A3GH 2L15A 1XNQQ 3OTOQ 1X54A 3MEFA 1YEZA 4C3IH 3HOUG 1EIYB 2JJQA 4GOPC 1AE2A 1Q86C 2FXQA 1IBKQ 1IBLL 4KHPL 4R4QA 1K73U 2UXDQ 2I5HA 4DV1L 3S16H 3GTMH 2EIFA 3MXNB 5JEAJ 4C3JH 5C4XG 4QIWE 3I56A 4DR4Q 3CPWA 4DR6Q 4RMFA 4DR7Q 1XMOQ 1OXSC 4OWWB 1TWCH 1ASZA 3GTLH 2F4VQ 3KFUA 4JCVE 1IL2A 2YYZA 1L1OA 3FKIG 2E5LQ 4IFDJ 3KDFB 1N33Q 4B3RQ 4H02A 3AYHB 2UXCQ 1K8AU 2A1AA 3HOVG 1KHIA 3LH0A 3CC4A 1MJCA 3CMAT 4HIMA 1VQKT 1BKBA 1TWHH 5M3FG 1IXRA 2ZJRA 2HHHL 2L3RA 3NBHB 2PI2A 1Y14B 3K81C 3UE1A 3I4NG 3S17H 4X62Q 2N49A 4DR1Q 2CCZA 3J81j 4PZ8A 4LW1A 2JE6I 2LVMA 1FL0A 1YJ9A 4LF7Q 1YJWT 5C3EH 3ZJYC 1K73C 1UE5A 1YNXA 3F1ZA 4KLKA 5IYDH 4JOIC 2OTLA 2D0PA 3CD6A 2PQAA 1S72T 3H0GG 4JI6L 3G71T 4OXPA 4JI8Q 1EIFA 3GTOH 4WJ4A 2CFMA 2N8NA 4L5RC 3CC2T 4ME3A 3HOYH 3M7NA 1I6HH 4OWXB 4LF8L 3S14H 3ULJA 3ULLA 1VQNA 5IWAQ 4GOPB 4A3JH 4BY1H 2GVAA 3TQYA 2Y0SG 2CKZB 1D8LA 1N8RC 3A5ZB 1XPUA 4JI7Q 2BH8A 1RIPA 1U5KA 4DUZQ 1VQMT 4DV7Q 1LYLA 1XPOA 1VQIA 2HIXA 3KBGA 1MJEA 2UUAL 1EFWA 1N32Q 4LF5L 4IPGA 1VQ5A 4AH6A 3KJOA 3U58A 2VNUD 4BY7H 1VQBA 2RHSB 4A75A 4B3SL 3F2BA 1QZGA 2K4KA 1M1KU 1HJPA 4OWTB 2VQFL 1Q46A 2JNGA 3CCLT 2C35B 4HJ9A 2IG0A 2DGYA 2KHIA 1W3SA 4KHZA 4HJAA 4BBSH 4A3DG 1JJGA 4X66Q 2E2HH 3BZCA 4BXXG 3SGIA 2VQEQ 2R93G 2HT1A 1M90U 2Q2HA 2NVXH 4UP9A 1JMCA 2JA9A 3J81c 2ATWA 4A3BH 5M5WH 5IYCG 1PV4A 4GKKQ 1NBWA 2K5VA 3Q8DA 4TVAB 4R4CA 2UXBQ 4AYBG 2N3SA 4JI2Q 2LXKA 3CCST 4OX9Q 4P73A 2AKWB 2H5XA 3H3VI 2XTIA 2KDSA 4DV3L 1VQLA 4JBMA 4L5TA 4YHHL 1E22A 1GD7A 1N36Q 2YU9H 1J6QA 3I4OA 4LF8Q 2N78A 1U0LA 1Y1WG 1S3OA 1VQ8A 3M4PA 2XGTA 5LMNQ 1GM5A 4LFBQ 4B3TL 2E70A 1OXUA 3I55T 1XNRQ 1M1KC 2A19A 2BA0A 2EXDA 3M4QA 4JI0Q 3ER0A 1CSQA 3D31A 4JI1L 4A3EG 1R9TH 3M4OH 1Q81U 3G6EA 1YIJA 3T1YL 1M90C 1VQ8T 5IYDG 3T1HL 1HR0L 2OWOA 4HIOA 2XHCA 3CCET 1PYSB 3CC7T 3STBD 2HIVA 4JOIA 2WB1E 5IP9G 3HOZH 2ZJQA 4L5QA 1H95A 3CW2C 3B6YA 1PH3A 1UE6A 3PSIA 4DV5L 5C4JH 3J7ZC 1V9PA 4A3JG 4GKJL 1KC8C 3PO2H 5M3MG 5IP7H 1P16A 4ALPA 3DB3A 3PUWA 1XPRA 2UUCQ 3GTJH 1WOCA 3ULPA 1VQEA 4NXMQ 1YHQT 1X3EA 1X3GA 3OW2S 4DR5Q 3CCUT 2VY3A 4YY3Q 5GAHC 3PO3H 4LF6L 4IO9A 1GVPA 1EUJA 4R4TA 5FJ8H 1AH9A 1SSFA 3CXCS 1N9WA 3CCVA 2D0OA 1HNZQ 4BY7G 2ZM6Q 1Q81C 3KF6A 4UP7A 4A3FH 4LF9L 1NPRA 4DPGA 5HGQA 2QEXT 3CCJT 1I3QH 1YVCA 2R7ZH 5AJ3Q 3L7ZC 4NB3A 3S15H 3TEHB 4JBWA 4BBRH 4A3CG 4B3ML 4X6AH 4R1JA 1FVIA
chains in the Genus database with same CATH superfamily
3DLMA 2RH2A 5GAMg 1C7YA 4CBVA 4BDYA 1SNPA 2QXFA 3J7A5 4A3BG 2KQ3A 4PZ6A 4RA8A 4BUGA 3OW7A 1QVFS 1OZ3A 2RHIA 3M55A 4IQZA 5C3XA 1C6VX 4DN4M 3OTOL 1PHJA 5KYYB 2EQUA 3H41A 1M8MA 5ECAA 2BKDN 2WAQG 1D0XA 4GLKA 3Q6SA 1G3YA 5CGKA 1WJJA 2BE7D 4LFCQ 1SMXA 1SYGA 2HL5C 2K50A 1VQ9Q 4Y52H 2EYQA 1VQ4Q 4O1NA 2E4HA 1OPLA 1SAPA 4EPCA 4XIGS 1RF2D 3HOXH 3CCLQ 3R2TA 2J4XA 2A68C 1ZBXA 1WTXA 1YI2Q 1NEBA 1K76A 1MBYA 4Z89A 4OB3B 3QDRB 4C8QA 1E24A 1YJWA 2WSFE 2NTTA 3DKMA 1Q82R 3FRPB 2RQXA 3RN5A 4DR4L 2DD5A 3CCRT 2R6GA 4M7AD 4EMHA 5CBEE 1QVGS 3NTKA 4EX5A 1A0IA 3MKDA 1B7TA 3UDIA 2ROTA 1PFBA 1QQJA 3IFTA 5DLOA 1SN8A 4RH6A 3LGJA 4M78D 2SDFA 1TS4A 2K3XA 1H8KA 1PWTA 2GF7A 4HT8A 4M7AC 5GAMj 1CKNB 2M02A 2F1MA 2DRMA 4IIOA 3RR6A 4P72A 3RKYA 4J15A 3T53B 2L0CA 2OAWA 1WTOA 3S15B 2J6FA 3CPFA 3TREA 3PVQA 3OYJA 1JWUD 1Z47A 4AYBE 4EIKA 3OQ5A 3C4SA 1YJNT 4BBRB 5IWAL 2LNVA 1E7ZA 4M78C 4BBRH 3M56A 3INZA 1PH4A 1BI3A 1JORA 5A2QE 2KSSA 1KQSS 2M1HA 2R7FA 1MUZA 4E7SA 3EBEA 3FJ5A 1ASYA 4C3JB 1TWAH 4BBRG 3RUZA 1LTTD 3BW1A 4A54A 2B2WA 3A8IE 1WQWA 2E2IH 5J3BA 1HXDA 2JZ2A 1FGUA 4OONA 1GBRA 1R0BG 1J9OA 2ESWA 1I50H 4F8MA 3RIRA 3M9QA 2C9OA 1TR5A 4DAVA 1YHQQ 1Q82C 3OYMA 4FF2A 4D8KA 2J05A 2KXCA 2NVYH 1UGRB 1JWSD 3RD4A 4C3JG 2JXMB 3SHLA 5M5XH 5EJWA 4DV6L 4X9CA 4B3SQ 1LTRD 1TS2A 1XMQL 2QGFB 3I55A 4OP0A 4GS3A 3HOXG 4GKJL 4JRIA 4M77A 2DVEA 3F2UA 3DM3A 1KC8U 1P8LA 4KV6A 4RGTA 4FYYB 1HPCA 1JC7A 1LTLA 2Z0SA 4FW2A 4XTCS 5I9PA 4R4OA 2A08A 5CC4A 1I1JA 2VB3X 3CCEA 4ZGEB 2VGNA 3DEOA 5GANd 1BCPF 2L2PA 2JA7H 5KE2A 1Q1EA 1MMNA 3QZ5B 1RODA 1VQCA 4LFBL 3LX0A 3ONAB 2ALYB 3M0RA 2GN5A 4DV3Q 1HNWQ 2QA4Q 4KY6A 1J5EL 2K52A 2LX9A 1R4PB 3RKWA 1JE4A 4BY1B 2E8GA 3LYIA 4X3TA 1RAEB 4NL3A 4POFA 4KJNA 1G51A 1STEA 3UDXA 1PSFA 2EY5A 4X64Q 4JI5Q 3K7UC 4BE0A 2EVRA 4H13C 1HUMA 1CKOA 3W5OA 2PUOB 1R77A 3A98A 1V8QA 2ZTDA 3KK7A 3OIQA 3D6CA 4BY1G 2CW0C 4JZ3A 3NEMA 4DAPA 2MWPA 4ZGDB 2HDMA 2YDLA 4CC3A 1TT2A 1ILQA 4KHVA 2E2IB 1I8FA 2EJFC 1UWVA 1V76A 1C0AA 3I72A 5FLXL 4JVZA 2ASBA 5A35A 5EPJA 2DJFC 3UI2A 2LKVA 2DL8A 3M58A 5FRNA 2PZUA 5IODA 3U9OA 1NMGA 5M5XB 2EYJA 3HFZB 2X9HA 2CP7A 4LD9K 2P4RA 1ICWA 2JA5H 1VQAA 4UHVA 2KEDA 3BVMA 3H0GH 3V8LA 4PJOF 4WJ3M 2DLPA 1V1PA 3T16A 3LGFA 4A4FA 1NJIU 2Q8TA 1NMFA 1SNQA 4AMCA 1ENFA 4Z8AA 1YNNC 4WF2A 1FYCA 3HTRA 1XQHA 3P8DA 1EY9A 1SE4A 4XYQA 4PKCC 5IGCA 1PCXA 2EYYA 2NVQH 1DOMA 3AQQA 1OYXA 1YFNA 1CHPD 2JA7B 1Y1VH 3E1SA 1NBEB 5CKBA 3RR5A 1R9TB 1WHLA 2EW3A 2K03A 3K0YA 4RGOS 5FWCA 1ZSGA 4XTWA 1B2TA 3KFVA 1X65A 2B2TA 3CCRA 2L12A 2RQUA 1WNLA 2ZCFB 1FMKA 4O42A 1IBLQ 2OT2A 1PRLC 2JA7G 2F0GA 2B29A 2F0KA 2E5LL 1LPLA 4BXXH 1D1AA 2R93H 4AIMA 1AHJB 2HSPA 2CH4W 4LNPA 1PD0A 1RABB 4B6MA 1QP3A 2K32A 5C4JB 1S4ZA 4L5SA 3PO2B 3JCMg 5FU6C 2JSOA 4F88A 2QG9B 1IW7D 4OMPA 5KYWA 3HRTA 1HTLD 1S5CD 2JT4A 5BN3A 1MIUA 4XU3A 4KUDK 2KCMA 1I5FA 1VQ6Q 1VA7A 3FRNA 1PFNA 3PO2G 2MWOA 3I56T 2PMZB 4DR4Q 1YJNA 3P75A 4ZRZA 2DJGC 2B8GA 5IE8A 3S9WA 3TS0A 3QZ9B 3VV0A 3EFOA 2HCCA 3A8HB 2ZAEA 3PV0A 2R7ZB 4H0LC 2JA5B 1EYGA 4PG3A 4PJNA 2C5CA 3AB9A 4FYXB 2NUPB 2GFAA 1PVOA 2KXDA 3TQ7P 1SYDA 1UB4A 1X6OA 4JI6Q 1EX4A 1VQDA 2RDFA 1F9RA 4BS9A 1NYGA 1VQGA 2JTFA 2RVLA 3HG9A 1JE5A 4NDXA 4HCSA 2M16A 1O80A 2R7ZG 2JA5G 1CQVA 4IFDG 1IZ6A 1RI0A 1MGQA 2NVQB 3T4AC 5M5YH 2L8DA 2KT8A 4EQNA 3L3OC 5D6YA 4QQBX 1QILA 2DMOA 4RCNA 3TS2A 1QP2A 2CYZB 1TUCA 3CD6T 1JJ2S 2UUAQ 3BZDB 1JJCB 4M7AE 4X66L 5LJ5d 1A3TA 2RJDA 1Y1VG 1KDAA 2GQVA 2LSSA 3TEEA 1PSEA 4XT3B 2Z0WA 3REBB 5G3LD 2CT4A 2I2LA 1ZYRC 2MP1A 3VYSA 2F0UA 4JJBA 3VDYA 1PFMA 3BDCA 3R8BA 4GKKL 4BY6B 3EG9B 2NBFA 3ERQA 4Y7NB 3NK9A 2EQSA 3S24A 4JI7Q 1A6XA 4M78E 4JI2L 1M4ZA 2DTIA 1SSOA 1WTPA 3CKIB 2P84A 1CK1A 4MZPA 1WYDA 1TY2A 2MNAA 2EYZA 2XDBA 5CCAA 4QQDA 1K1ZA 1M3CA 3R3OA 4IPDA 2HDAA 2WSEE 4OMMA 4DV6Q 2JW4A 4LXCA 1E3PA 2OQKA 4GZYC 1XMQQ 2MOXA 3TZDA 2KUMA 3HOWB 2OX7A 1NPPA 1GRIA 4JI4L 5IYBH 2B8AA 4FF1A 4JI0L 2L11A 4ZNXA 4WORA 4JS5A 2F52A 3I9QA 2VL6A 4Q5WA 4RG2A 5LL6S 2YTXA 4GNXB 3S1QB 3HOWG 1VQPQ 5FO7B 4LN2A 4Y92A 3NMZC 4FCYA 1C4QA 2ID0A 4QL5A 5FLXE 2IHFA 6AT1B 2HQXA 1QWYA 1LABA 1X2KA 2RO0A 3OYIA 5KYLA 5I2XA 3CF5A 2AUKA 1J5EQ 1VQLT 2TSSA 4QMGA 3IRBA 3JCMc 5ELOA 2BE5D 3CHBD 3A8LB 4DF7A 4FW1A 1KLUD 5M5YB 2NWMA 2PNRC 2WAQE 1WIEA 4OMQA 2UUCL 2KVMA 3MA2B 4GY5A 1YBYA 2HD0A 3V7RA 4WJWA 3JCMX 5ELFA 1U4RA 2OXPA 1WI7A 3OYNA 2RI3A 2C0OA 3LWHA 2D62A 3FHWA 1X75C 1DXMA 1ET9A 3MP6A 3L0OA 1Q86U 3U23A 3THKA 2AUJD 3JCMh 2AIRB 2DIQA 4C0DB 3M3YH 4LF6Q 4MMKA 2VWFA 2O9VA 1EYDA 4JBKA 5GMKj 2OCEA 1ZQ1A 4J8QA 4LF9Q 3RESA 2WB1B 4EQPA 3HL8A 2A73B 5T1IA 3OMGA 2EVBA 1UHFA 1WI5A 3OYKA 4XQQA 1W1FA 4O6JA 4DA2A 4FM4B 1S72Q 5CR3A 3G71Q 4DUYL 4B3MQ 2QKIC 2KCCA 1YCSB 3U4VA 2E64A 2YXYA 4LUOA 5ELNA 1VUBA 2WB1G 3FVQA 5JJZA 1JQQA 1BI1A 4JLIA 4L8JA 4MNOA 5GAMf 2X3WD 1Q3LA 1X6BA 4RFBA 3I5SA 1YEZA 2JJQA 1HA6A 3NQIA 3FKIB 4R4QA 2I5HA 2RJEA 1UAPA 1V1OA 5JEAJ 3UPUA 1TSFA 2FPFA 3I56A 3CPWA 5IGEA 2LJ0A 1HNZQ 4M7DC 2MPXC 1Y57A 1ASZA 3GTLH 5FRMA 3META 1JWMD 3KFUA 1D3BB 5ISRA 2XVSA 3FKIG 5FOBB 2E5LQ 3WVDB 3I4NB 4C0GA 1KHIA 2RQRA 3LH0A 4FF3A 1NUCA 3NUCA 4E7LA 5IOCA 1VQKT 1BKBA 2QQAA 2ZPHB 4NW2A 3NBHB 3I4NG 4C5EA 3EA6A 4DR1Q 2BDOA 3M3YB 1FL0A 2NUZA 3CCSQ 1JOQA 1YNJD 3ZJYC 1UE5A 1ZX6A 4JOIC 3PNWC 3CD6A 1PM3A 1EIFA 4WCIA 3V7CA 4IUPA 5IGFA 1SXTA 3CC2T 1PTOH 3J80L 5I6YA 2DXBA 4OEMB 5A0LA 5L23A 1VYTA 3HOYH 5GMKh 3S14H 3S2HB 2E10A 2BCOA 4OMLA 4A3JH 2DETA 1JJ2P 1YNJC 4ZUIA 3TQYA 1RAHB 2OAUA 4CJ2C 2A69C 1H9KA 1KDCA 4OIJA 1N8RC 4LDYA 3A5ZB 1UDLA 3K5LA 4KBMB 1VQ8Q 3CPWP 2RA2A 1PRMC 2RB6A 1KQ2A 3QSUA 4M7AF 4JPBW 2XSCA 3URYA 3CC7Q 5KYXA 4DV7Q 1XPOA 1WD0A 1M8VA 1WHGA 4AH6A 3KJOA 1M9SA 5D14A 4F7UF 4EMKA 1M2VA 4L6V5 5GAOm 1C8CA 1HJPA 4OWTB 5DAUA 3CCLT 4A93H 4A3DG 2J7IA 4M78F 1NCVA 4X66Q 4AYBB 3BZCA 3MEHA 2F3VA 2E2HH 3GTLB 2HT1A 2IVWA 4OF1A 2FZGB 1M90U 4NOYA 1PNJA 2MIOA 3CCUQ 1KDBA 4GKKQ 4QQGA 5IYCG 2MJ8A 3S2DB 1U8RA 2K5VA 3Q8DA 4R4CA 5GAN6 4AYBG 4JI2Q 2FPDA 5I22A 3Q1JA 2YWWA 4WRDA 1TU0B 2CUBA 4IKFA 3CRLC 5CMDA 1X43A 1VQLA 1D1CA 1B9MA 1ZSZA 1LCKA 2ZXOA 2JJ9A 1DZ1A 2FZKB 5I9OA 1E6GA 3MEWA 3LW5E 5HCKA 3CCVQ 2K5QA 2N55A 4OMOA 3EGXB 3M4PA 2XGTA 2Q8IB 1TG0A 2E70A 4PJMA 4Z88A 3CCQQ 1M1KC 1XNRQ 2EXDA 3OS1A 5C4HA 5GAN5 4JI0Q 1PTOB 3HS0C 1Q81U 3OBWA 1FMWA 4J9FA 3VS3A 1GUWA 3L1AA 3S14B 2LCSA 1AWWA 3QO2A 3T1HL 1HR0L 1OX8A 4K11A 4X3KA 1WA7A 4A3JB 5M3MB 2YSQA 4J6XA 2KYMA 1S5DD 3STBD 4JOIA 5IP9G 2CZ1B 5ELBA 4L5QA 2KR3A 2RHUA 3CW2C 2EJGC 2KBTA 2HMAA 5GANg 4RG8A 3PSIA 5LL6X 4DV5L 3J7ZC 4A3JG 3TCJA 1ZUKA 1P16A 1PRTD 2Z4HA 3PUWA 4A63B 5M3MG 2UUCQ 3GTJH 3ULPA 1VQEA 4KUIA 2ICEC 4D6WA 1WHKA 1YHQT 1X3EA 5I2YA 2ROLA 2VY3A 3W2DA 5GAHC 4XQNA 2KECA 2SRCA 5FJ8H 1OV3A 3CXCS 1RHPA 1TTHB 1K73R 2V4DA 3VS7A 1IKMA 1ESFA 3N6RA 1PRTC 3S1MB 4FYVB 5AJ3Q 3EROA 3C1FA 2KMTA 4KT0E 1TUDA 4CC2A 5KYUB 3ZYYX 4N4IA 3QDFA 4F14A 3L2RA 4R1JA 1TS3A 1YHAA 5GROA 4ELYC 4HJ5A 1SLJA 1T3LA 1IBML 3ERSX 4DV4Q 2B8FA 1BI0A 5IT9L 2PMZE 4IZ8A 2UU9L 1KXLA 1NE3A 1XNQL 2X4WA 3HEJA 1BCOA 4JV5Q 3QO3A 2ZPIB 2BOSA 4XQ3A 4DAMA 1IHWA 1IBKL 5KCHA 2O2LD 2PQAB 1JRIA 2D0QB 2X4JA 1S5FD 1JCKB 3V7SA 4IJHA 5CYUA 2NVTH 1VQKA 2JP1A 3DLLA 1XJWB 1HZAA 5GANj 1ZUUA 1STNA 2Q2UA 2XRSD 1D1BA 2CP5A 4C5GA 3KBXA 2AQ2B 3O5ZA 2F4VL 2ECZA 5EBDA 1N8RU 5FU7B 5EPLA 1SYCA 1RLPC 4Z02A 2O4XA 3QIIA 3RZDB 4LUDA 2B63H 2VYTA 3KJPA 2JEAI 3K6OA 4A3LH 4A53A 1SYFA 4TRDA 4DNIA 5LHY1 1N34Q 4V190 1HH2P 1J3TA 1E1TA 3EQLC 1BYMA 2V8JA 2DYBA 3J80E 3CC2A 1HFGA 1IB8A 2RK1A 4C0ZA 1G83A 4DK1A 2Q2TA 1L2FA 1SKUB 2RSNA 1PD1A 1RACB 4J6HA 4X62L 5JJKA 1PTOD 1NTGA 1M5Q1 2Y4YA 2L9HA 1PYWD 1X2QA 4M7DE 1BDOA 2B3GA 4JG2A 2K9GA 2QQRA 1GKHA 1CA6A 2EJGA 1QWFA 1M1GA 2BZXA 3D7SB 3A8MB 2VUMB 2DL3A 4EDUA 3GPLA 4K0KQ 2DL4A 3SK8A 3SXHA 2QASA 2QILA 5AYFA 3PF5A 4Q0FA 5EG2A 2CP6A 1VYUA 2QTVA 2OI3A 2RHQB 2BIVA 2JYOA 1FXXA 4VUBA 4F7XA 3CCLA 2Z9HA 2VUMG 3PTAA 4NMZA 1VQ7T 5GAMe 3FC3A 2EY2A 5GQOA 1AVZC 1B3QA 5CV4A 1WXTA 1X27A 5FO8B 3A8GB 1FJGL 2K57A 1JXMA 2LMJA 1AEYA 3M85A 1XXGA 2K05A 3OMCA 1WYXA 1PFSA 1TXYA 4R4IA 1M4VA 4K5XA 5HGTA 1HZCA 1VDZA 8AT1B 1EZ8A 1ZEQX 4LF4L 3VYGA 4JYAQ 2OTJQ 5C0XI 1ARKA 4C3IG 1KC8R 4GBQA 3MCAB 1Y7XA 2DXUA 2DZ9A 1ENCA 1F77A 1GO3E 1ICFB 1TWCB 3CEYA 3QKJA 3UATA 1KAAA 2KOLA 2TMPA 4DBFA 1KD1U 3S1MH 3OYGA 4CDEC 2ICIA 2B2YA 1MV0B 2UUBQ 2O5JC 1X69A 1G91A 4DR2L 3HP3A 4FYWB 4N8X1 1WXUA 4BI4A 5GANh 2JMAA 1M3AA 1TWHB 5CV8A 5LMUQ 2I0QA 2B63B 2H4OA 3S17B 4C2MH 4KK7A 4PNOA 3S3NA 2HD3A 3C46A 4IURA 1SBBB 4DNRB 1K0RA 1DGSA 1VQ6T 4N4HA 5C3EB 4M7AB 4OO1G 4C8QC 3PMFA 2B63G 3GBQA 4CRIA 3CCMQ 3DUZA 5JPNC 1LM0A 4IFDI 4FNFA 2ENMA 5LJ5g 5FO9B 5IHIA 4A3LG 4J9CA 2J6OA 3BU2A 1PYBA 3QOJA 4AQYL 2SNMA 2KAFA 5C3EG 4M7AG 4G4KA 1Y96B 4M78B 3UDCA 2D8JA 3JAMi 3G4ST 2NUCA 4YCUA 1Q7YU 3GLXA 1TWFH 4AFSC 2ABLA 1WFWA 4OGEA 5HY6A 4C0FA 1RD9D 1LLRD 5T1GA 3J80i 1B34A 1YHQA 2GFUA 5FW9A 2HDLA 4DV0L 1UUEA 2K5HA 4M78G 1WHJA 4HCKA 4BA2I 2F0EA 3FEWX 3OWFA 2CZ7B 1RLQC 3UT1A 4BY7B 3T1HQ 1NJIR 2NUTA 2LQWA 2DX1A 4BBSB 3FDRA 4JRPA 4ABNA 3GO5A 2RHZA 1QVCA 5E7NA 3CXCP 3MFYA 4APVA 1PH7A 4LNQA 1EQQA 5GAOp 3P7JA 3JB9H 4H7BA 3I5RA 1T0JA 4CC4B 5EBCA 4A3BB 2I5MX 3PMIA 3SD4A 4BE2A 2NN6I 3HPWA 5IT9E 5H1SE 4BBSG 4X65Q 2IY5B 2K01A 2B2WC 1HNZL 3E0EA 2XU8A 5CO7A 1TS9A 1GFDA 2ZTEA 4ATOA 3IKJA 2H8HA 5LJ5j 2QQ9A 4M77D 4ZN1A 2DFUA 1X01A 3QR8A 4O2DA 2M9VA 3UDGA 1PH5A 2A68D 2LXJA 5IGDA 3D4WA 1SF9A 4J7FA 5EKLA 3LX7A 3K57A 4ESRA 1IYJB 4DK6C 4IUUA 4N0AA 4C92A 3BZKA 2HQLA 2X4XA 4DEYA 1UGQB 2A6EC 4HCBA 2Z6KA 1SHFA 1FNVA 4M77C 3D3RA 1I4RA 3JRZA 2DO3A 3NSWA 1EEFD 1ONLA 4DR6L 3PE0A 5CR2A 1JR0D 4DR7L 2DNCA 1XMOL 4K8JA 4X34A 2A28A 2BZYA 2FZCB 1BVSA 3UE0A 3AEVA 1EWHA 3E0JA 2UU9Q 5HK0A 2K33A 3HOZB 3C95A 1N33L 4B3RL 2UXCL 1E7OA 1NJIC 1IGQA 3G48A 3EN2A 2JTMA 3X28B 3KUPA 2A8VA 4PL6A 2A6HC 1IREB 4I7ZC 5C6SA 2RJFA 2JTEA 2JEBI 3CQZH 4M1UB 1HRJA 1I5OB 2E6ZA 1S1NA 1P92A 3HOZG 1O7IA 3A8KE 1QUQB 2R3ZA 3O8VA 2KCTA 1SFOH 2VZAA 1JT8A 1GHKA 2YHTA 2IPOB 1K9MU 3P8BB 4A76A 2WP8J 2ZT9C 4HVUA 4R8NA 4YWMA 1B70B 1VQ5Q 1I6VC 3UDFA 2HHHQ 4DBHA 2XIDA 1VQ7A 1IXDA 2SEMA 1STBA 4XQJA 4HJ8A 2CDTA 2HCKA 2DXTA 4RHRA 5D6XA 3VRYA 1YZ6A 1PH2A 5JEAG 2IX3A 1BBUA 2RJCA 2I0NA 3TDQA 1WXBA 3JB9G 1A0NB 1WFQA 2NZHA 2CKKA 4DKAC 1ABQA 4KGVB 1WQ7A 2L3SA 4Z9CB 1CZGA 4UAIA 4DUZL 1NLOC 5LJ5h 4C56C 2EY6A 1IYVA 1S5ED 3HZXA 4EGVA 2YLBA 1N32L 5IH2A 3SHWA 2CGHA 3IQLA 3KDFA 3QOLA 1VF5C 1O75A 4JJCA 2OTLT 1WHMA 2E41A 1K8AC 3HOXB 5C4ZA 1FJGQ 1VCIA 1CSKA 3OW2A 5FU6B 5A0DA 3QWYA 1VQ6A 1AWOA 1E2WA 1TS5A 1H9SA 5DNFA 4LF4Q 2KT1A 3ND9A 1VQOQ 3V05A 3G6EQ 2W10A 3CQZB 3BDUA 4HCZA 1PKTA 2B2TC 2XN9C 1HR0W 3VR5A 1YNZA 3OS2A 1U4PA 5JJIA 4DOVA 2HSEB 2BUDA 1II3A 4M75A 2F3IA 3N5BB 1UGVA 2F1LA 3G4SA 4LUVA 2FEIA 3L2VA 1N36L 4A3CH 4A4IA 1SFOB 4UPAA 4DR2Q 1GHJA 2GQIA 3A74A 2R7DA 4GOPA 1T5XD 1VF7A 1AZPA 2MO0A 3MZ5A 1PA6A 2DVJA 1QVFA 2QGGA 2P4TA 2ED0A 4RUGA 2F0OA 2CW0D 5AT1B 2KRMA 2F0SA 1NG2A 1OXVA 4LUEA 3OYLA 2E12A 3GOXA 1W2BS 4OGCA 4QCLA 1L1OC 3EFRA 1VS0A 1VQJA 2LQKA 3QG1A 3E9GA 4KH1B 3NQTA 2AQ3B 2M00A 4GLMA 3H3VC 1XTDA 2HBWA 4KGXB 4JI1Q 1BCMA 1NY4A 4AQYQ 2K3YA 4K5VA 1UEBA 2PYKA 1I4HA 1LT4D 4MZ9A 4YWKA 3I70A 3QIAA 1HA5A 5GAN8 2MFIA 3V8KA 4V2SA 4MMLA 1TWAB 1JB0E 1F2LA 2ATCB 2DKGA 3OW2P 4C8QE 1EU4A 2HUGA 2H1EA 2F2VA 1LTBD 3JB9D 3G1JA 1ENAA 1I50B 1YNND 2WV6D 2DNEA 2X69A 1X3FA 1QVGA 4DV0Q 2GA4B 1AP0A 2NVYB 4YY3L 5J26A 5C0XH 5CAIA 3I90A 1HCZA 5BR8L 4QKUA 3SWNA 3HFOA 2GTJA 1YIJT 1G2BA 2ENBA 2MF2A 2RMOA 3EH2A 1LNXA 1F9SA 4J6YA 4LFAL 3VS2A 4NPSA 1E0BA 1NR2A 3C12A 2CP0A 2FRYA 4ID6A 5GJVB 4E7KA 2KCNA 5IY0A 1GUTA 1QVFP 3K58A 2DD4A 4LDXA 4BDZA 4F04B 4F7UA 1STYA 2KBNA 3DWQA 2E2JH 1ET6A 3KOJA 4RGMA 1VQPA 1OPKA 3A54A 1KK7A 3BYYB 3QWNA 1BBZA 1HNXL 2DY7A 1B9NA 4PNYA 2C0IA 1OO9B 2F0IA 2J0TD 1GJXA 2P0PA 2RQVA 1KQSA 3VU3C 1AZEA 3CP0A 3PVLA 3J7YW 4FSXA 1U4LA 3TP7A 3CCVT 4OIKA 2L15A 2G9DA 3OTOQ 1X54A 1PRTF 1EIYB 1BIAA 1Q86C 2FXQA 1W6KA 4KHPL 4IIMA 2EQMA 3S6WA 5LJ3f 3PFSA 3W3AA 4WTOB 5COYA 3S16H 4QIWE 1QVGP 4DR6Q 1VQNQ 3ZBDA 2K5DA 4KN4C 1FR3A 4RMFA 1XMOQ 4OWWB 4DR7Q 2B2UA 2K28A 2RSOA 4TKOB 2ZGWA 4JCVE 1L1OA 2F0FA 2MYSA 1N33Q 4B3RQ 2UXCQ 1CZWA 1HUNA 1SNOA 1QCNA 1C0MA 1AWJA 1K8AU 2A1AA 1RAAB 4M77E 1STGA 3VR4A 2LQNA 3H0GB 3OSVA 2L3RA 2PI2A 1Y14B 1KNAA 2K7AA 2HZYA 4NKLA 1DJRD 2N49A 2DILA 3J81j 1WTHA 2LVMA 3DMUA 4C1NK 3RBBB 3GIBA 3MWYW 4KLKA 3Q0AA 3EGDB 4LDUA 1KQSP 2OTLA 4XTXA 3H0GG 4G7HC 2KGTA 5FKAC 2EPDA 1ZUYA 1Y1VB 2DY8A 1ZYRD 2L55A 4B9XA 4YIJA 4LF8L 1HYOA 2EGAA 2FPEA 3I55Q 1G8ZD 1NNXA 3ULLA 3NPFA 5KH6A 5IWAQ 5D7UA 4FVMA 1WJRA 3E19A 2ZXPA 4IALA 3GNGA 2BH8A 1RIPA 3OHXC 4DUZQ 2L5QA 1VQMT 2GCXA 5I6WA 3CCEQ 2VC8A 1LYLA 1VQIA 2HIXA 2KEEA 3NPPA 2FHDA 4M7DB 3LNNA 1MJEA 1N32Q 2KJXA 4A3DB 4LF5L 2R93B 3U58A 2RN8A 1QCOA 2L89A 1IO6A 5DM63 3C2PA 1OZ2A 1PTOF 3F2BA 2VQFL 1Q46A 1OULA 2DGYA 1F9QA 3QYHB 3I8ZA 1OQKA 3SVMA 4M7DG 4BXXG 4MHEA 4XTYA 3SGIA 2R93G 1EIHA 3REAB 2F03A 2NVXH 1YWOA 2QTXA 4DOWA 5CV6A 4N9PA 3J81c 3OS5A 3EGUA 1E6HA 3D4RA 5IGBA 2QDLA 1ZA2B 1PV4A 2EFIA 3JCMP 3E3XA 2PPBC 5FWBA 2E5QA 3H3VI 2XTIA 1X3PA 3H91A 4OHJA 3N52A 4YHHL 4KN7C 2ED1A 1E22A 1N36Q 2YU9H 4OMFB 2FINB 2V8KA 2N78A 3SFMA 1LTGD 1VQ8A 3IAYA 4LFBQ 4B3TL 1OXUA 4KULA 3E9FA 2RDHA 5CIUA 2HCIA 1QLYA 2NYZD 3M4QA 2A3LA 5CV7A 3D31A 4JZ4A 3QJYA 5A0GA 1IYUA 1ACMB 1S5BD 3M4OH 1YIJA 4R9WA 3T1YL 1M90C 3R6NA 1RJTA 3P20A 1UGSB 2VXWA 3OB9A 2IIMA 1HJDA 4KY7A 1Y0MA 5KYNA 4M4ZA 1DM0B 3CMAQ 5CKEA 3DB3A 1XPRA 1I4K1 2EQIA 4RTWA 4J9BA 2E3HA 3CCRQ 5FROA 1FGBD 5GAMd 1K3BC 1X3GA 2O31A 4YY3Q 3CBOA 3K59A 5ELEA 4J5YA 5I11A 2EE1A 2SNSA 1N9WA 1B50A 3CCVA 4FU6A 3TZUA 1JICA 1PDQA 1Q81C 4UP7A 2D6FA 1F2ZA 4EMKC 3CCJT 1I3QH 3MAQA 1RAGB 4BWGB 2DJQA 4NP5A 1H641 4NB3A 3BY7A 5JPMC 1LACA 4M7DD 4DK0A 2YUPA 5KGUA 4OB2B 5L8RE 2AQ1B 4X6AH 4ULLA 5GMKm 3I4MH 4JUVA 2WACA 1YHBA 2YU9B 2JOYA 1N8RR 4OL7A 5EGTA 1JJ2A 2XWJB 5IYBG 1YJNQ 3NENA 1U06A 2K5NA 4A3IH 2LRQA 2PQEA 2M9UA 5CQYA 2K1BA 2H3EB 3JB9J 2IX0A 1HD3A 1B44D 3GTKB 4IOAA 4JJDA 3IFDA 1AWXA 1GL5A 1A2UA 3P1HA 1JB7A 1ZSZC 3A0JA 3NELA 1UNSA 4BB7A 1VYVA 3URGA 3VUZA 4CJ0B 1MMDA 1TY0A 1G6PA 1LVKA 2YUOA 4KHPQ 3VA7A 4L63B 1U4MA 3A55A 2FRWA 2KQWA 1G5VA 2KVQG 1D1IA 3E6ZX 3BYTB 4M77F 3M7GA 5F2DA 4CKCA 4CJ1B 4PLIA 2RF4A 2AKKA 2KENA 1JB3A 3CRKC 3U9SA 4V0BA 1CHQD 5EC7A 2LJ1A 2PVGB 5DLQE 2HQEA 3K0XA 3WVEB 2R5AA 3JAML 2E1HA 2A69D 1PRTB 2LX7A 3M4GA 2GTOA 1M27C 5HK3A 1G8XA 1JU5C 1PKSA 2DAQA 4B08A 2RM4A 3K80C 3FB9A 2RCFA 2OQ0A 4ILWA 1VQMA 1GBQA 1M1KR 1LTSD 1I3QB 1NLPC 4QVZA 1NR4A 2RCNA 4GLAC 3PUXA 2DEQA 1UJYA 4CKBA 1KD1R 2XWBB 2YUQA 3A8OB 1I07A 4ZQ3A 1XWEA 1MSHA 5GAOq 3OYAA 4JI7L 4YTLA 1LT6D 1VQ9T 2XRQD 3MPUB 4FP5D 3PIPA 3RUXA 1VQ4T 4ODGA 3WWVA 4LF8Q 4K2LA 5D3DA 4BA1I 1O78A 2VVKA 3PCOB 4A3IB 1JJGA 4IUNA 5LJ3e 4LJZC 2I07B 1K3RA 1YI2T 2EYMA 1OTCA 4E7ZA 2DXCA 1KIXA 3O13A 2H3JA 4QJFA 4E6RA 2AKLA 2A36A 2FB7A 4A3IG 4LF5Q 4GLVB 2K2VA 3R2IA 1CKAA 1B7YB 2VQEL 1YWPA 2VB6A 2YT6A 1EWCA 2FG0A 1AOJA 1EY4A 5C44H 2ZJPA 2VQFQ 4R56A 1NM7A 2Z1CA 3BS1A 4FO2A 2K14A 2QEXQ 5GAN7 4JI3L 1B34B 1BCPC 3PT9A 4J1MA 2CQAA 3TBIB 1D0YA 4TVRA 3E2UA 4AFUC 1Q7YR 4HR7B 4QY7A 2JA8H 1BR9A 3KLWA 3WXMB 3H15A 3FP9A 3U50C 1KIKA 1BO0A 2F0PA 1WCMH 4JI4Q 3GTGH 4F17A 2GNCA 3EFSA 1A62A 1QG7A 2YRVA 1Y8OB 1WLPB 1RAIB 3VYHB 3EH1A 3I7FA 3RZOH 1WPYA 2L1BA 2G5DA 1Z6HA 3V2TA 1SSHA 3HOYB 4DBRA 3TRZA 1KD1C 1K8GA 3KF6B 1ZBJA 4RTZA 2QDBA 2XDDA 1MHWC 2F0WA 3MFGA 3SEMA 1D1KA 3OWEB 1ABOA 2OEOA 5C4XH 3QBYA 2CREA 3E5SA 4BACA 3C0CA 1AT1B 3HOYG 2COYA 1N9RA 3EG9A 3M53A 2GVBA 3BVZA 4HIKA 1ZHIA 5K36H 1KL9A 2K2MA 3OYFA 1SE8A 1EYCA 2B2VC 3RLFA 1MV3A 3T56B 3G7LA 2PNIA 1L0YB 4N8FA 1PZKD 4KH0B 1EEID 4RHSA 4C3HH 4MDWA 4NXNL 4A93B 2GBQA 3CCJA 2E5KA 1OOTA 1Y8PB 5CV9A 2BTTA 3EIVA 2E2HB 2BA1A 3QUIA 4PJOC 1WHHA 3FPUB 4LWCA 2AHOB 3D0FA 4C5HA 2Q2IA 3VYTA 1O9SA 4C3IB 4A93G 4C1NI 4QW2A 3TN2A 1Q7YC 2PVDB 1MNEA 2ZPBB 5C44B 3TMEA 5GJWB 4DQ2A 4C8QB 2HBPA 3K7AH 4GNXA 2N88A 5JJLA 1F2MA 4OB0B 1LUZA 4DXGA 2MQHA 4HVWA 1A8VA 4PLLA 2B2YC 2IL8A 2F0DA 1SNCA 3GV6A 4FT2A 4KTAA 3WOFA 2EWNA 5KRUA 2IX1A 1I4GA 2G3RA 4TQUS 5C44G 3H3VH 5D6WA 4MZMA 4C8QG 3JB9F 4F87A 4DUYQ 1WCMB 2QK0A 2QA4T 5BN4A 4DAYA 3X20B 2DF6A 3R6OA 2UXDL 4RTUA 1EQTA 1XX8A 2PW5A 5C0XJ 4AG1C 4RGNA 2Y4XA 2JQOA 3NTHA 2J06A 4NL2A 1YITQ 1SEBD 3KYHC 4DBQA 5CV5A 3A5UA 4QF4A 2DPPB 1RTNA 1A63A 1WCMG 2L5TA 1QOHA 2EGCA 2EY1A 2F0HA 5GADC 4HMJA 3JAME 1T5EA 1EIGA 3MJXA 4AT1B 4XU2A 4A4EA 5I2SA 3I2ZA 2CP3A 5DY9A 3JCMf 1SJHD 2EDGA 3OYBA 3M59A 3DEPA 3HP9A 4BE1A 2AMCB 4ZCKA 5DM7R 3SK5A 4HKEA 2EYFA 4C5IA 4E7HA 1CT1D 4MTNA 5J22A 3GTJB 3GF5A 3QYGB 5D65A 3HKZE 4JK1C 2PO4A 3RN2A 1Q1BA 2OJ2A 4P71A 1D5ZC 4HEDA 5K36G 3X25B 1U1SA 1SDFA 3C1EA 5C5LA 2XD0A 5KEEA 3RKXA 1N27A 2B2VA 1Y1WH 4K14A 4KD4A 4QIWB 1UE1A 1AFPA 5GAOl 5C0MA 4JJNK 2B86A 4LDWA 4P5NA 1VQ9A 3PQIA 2CUDA 4ZN3A 2D8HA 1VQ4A 1QNUA 5FJ8G 3K7AB 4P2CB 1JOOA 2WSCE 2DBKA 4A3EH 4PJOA 5IHKA 3EVQA 1TOVA 4PFPA 2VV5A 3BDLA 4M77B 1YI2A 1EOVA 1KLGD 4HXJA 4FXGC 3GQBA 2JXBA 1CSPA 1I4PA 1TU2B 5C6AA 2F2WA 1FX7A 1D3BA 4C92D 2K5IA 1TWGH 1UTIA 1FNWA 1Z9ZA 1UE7A 2G9HD 3FDTA 1Q8IA 2NWGA 1ZKOA 3E9HA 2NVTB 1TXQA 4M77G 1KQ1A 1WJSA 1N9SA 3M57A 5M9OA 1VQLQ 1LT5D 1K9MC 1CA5A 1E2VA 2MHVA 3HFNA 2RBMA 1K83H 3H94A 3G6JB 1WTVA 4C8QD 3KXTA 3NBHA 4N0AC 2Y90A 4C92C 2WIIB 3NFCA 1N6AA 2JVVA 4RTYA 3CXCA 1VQNT 2EGEA 1KJWA 2KEAA 1AN8A 1RDPD 2EKOA 2Z6KC 3ND8A 3RMHA 1X55A 1XYIA 4XU0A 3KF8A 2XMFA 1Q12A 3A7LA 2LCCA 1SHGA 4J7IA 4HAEA 2F0NA 4IOCA 2IWHA 2E6NA 4RKBA 3GTPH 3CMEQ 3MEUA 3S1NH 1MNDA 2LJ3A 1F2YA 4R0KA 2K5WA 3K8AA 2CH4A 1X9NA 2AZSA 2V1RA 2V8IA 2MK5A 3HOUH 3VR6A 1PG5B 5LMNL 4BD3A 5KE3A 1GUGA 4JI3Q 4KKUA 3AFQA 1CKMA 5NUCA 5IGGA 3EG3A 1EFID 1GUNA 2J7ZA 2Z4IA 3MEVA 1HNWL 2DM1A 3CQTA 3ZEHA 1CI3M 2CT3A 1UHCA 1SMYD 1V1PB 2CWAA 3F8TA 3MXPA 3MC0B 4M8AA 2AT1B 3NWTA 3HOVH 5J39A 3H0FA 2AHJB 3RNJA 1STAA 1KG1A 4JW0A 2GGRA 4JI5L 4X64L 1HR0Q 4OVAA 3HHTB 2WFWA 1TWGB 1VQOA 5IT9c 4PJJA 2DZCA 1TIID 5M3FH 3PIOA 2EXZA 4PJLA 1SMYC 3X3NA 2K7VA 4HSVA 3TP6A 1AD5A 2AWNA 3FLGA 1RCVD 1TH7A 2BE9B 1AE3A 3E9IA 4H44C 5GAEC 4NXML 1X6GA 2EYWA 5IXFA 1C9OA 1HZBA 4DV5Q 2F3WA 2PTKA 4J9DA 3TSSA 5DM73 3JV3A 1D0ZA 5GAN4 4CKEA 1UUPA 4PMWA 3K5MA 1PH1A 2ZM6L 1B07A 2F4IA 2A6ED 4NXNQ 5CORA 2Q8RE 2K6AA 3M0SA 2QA4A 1V29B 1VQKQ 3EGXA 2YV5A 3NP8A 2DA9A 2RQTA 3SDZA 5LJ3h 3VKIA 4C2MB 3Q23A 1OU8A 2R61A 3F70A 4M75D 4YCVA 1EY8A 2YRDA 1VQHA 4PV1C 3S1NB 3CC4Q 1QWEA 4ZYSA 1TQOA 1G2SA 5KYWB 4D8DA 1B1ZA 4FXKC 3AHUA 4GN3B 2CZ0B 3HOUB 3LWIA 1L1OB 4J9HA 3IL8A 4PMCA 2A6HD 2SOBA 2PCFB 4XDXA 3CC2Q 3BVGA 3GV3A 4RCCA 1HXYD 4M75C 1YJ9Q 1VQPT 1V43A 1T0HA 4MTKA 4E47A 4LK1C 4P74A 3EFOB 4A3GH 5JVG3 1XNQQ 2F69A 1TWFB 4RMOA 3MEFA 3HOUG 1K8AR 1BBXC 1H3ZA 4GOPC 1IBLL 1IBKQ 1K73U 1WTRA 2UXDQ 1M1FA 4RKLA 2JN4A 4DV1L 3GTMH 1LJOA 2QCPX 1A15A 3X26B 1AZQA 3M4YA 4C3JH 3HOVB 3S3OA 1K8OA 1GFCA 1LT3D 1NYFA 4LAAA 1JBMA 2F4VQ 5M3FB 1G3SA 1MGSA 1IL2A 4IN3A 2FL7A 2WKDA 4H02A 3AYHB 3HOVG 3GNFB 3FPPA 1W70A 4M7DF 5KYUA 5KYIA 3CMAT 2F0QA 2A7YA 4HIMA 5M3FG 3MXGA 2B39A 1SPKA 2VGMA 4II1A 4X62Q 4PFZA 2CCZA 4E7JA 2BDNA 4IUTA 2COWA 1BF4A 1GXDC 1AEXA 3MXNA 1SRLA 1SYEA 1SJED 5IYDH 1OU9A 1YNXA 2E3IA 1WJQA 3F1ZA 2D0PA 3H0IA 2ZZDA 1D09B 3SWNC 2PQAA 2DE0X 2XKOC 1S72T 4JI6L 3G71T 1NEGA 4WJ4A 2DJZA 2FJ2A 3GTOH 2CFMA 2DYIA 3JCMV 3M7NA 3SK6A 2KNBB 1I6HH 2DIGA 3G7ZA 1PC0A 1VQNA 2KRNA 4HCEA 4BY1H 1D8LA 4JRQA 1T3SA 1QCFA 1QE6A 2C0TA 1U5KA 4A3GB 3KBGA 2UUAL 3TSZA 2K5LA 1KTKA 1QJOA 4QUCA 1V1CA 4DFAA 1EFWA 4IPGA 2VNUD 3OIPA 4KRTA 1RAFB 3EHRA 2RHSB 3GTMB 2D9UA 1IBMQ 4A4GA 1FD7D 2K4KA 1TKWB 3Q22A 3JCMe 1H92A 4HJ9A 1QZGA 2JNGA 2RF0A 2C35B 4AFZC 2IG0A 1IHVA 2WKCA 1JQYD 1DOKA 2LZ6B 1W3SA 3UF4A 3T13A 4HJAA 3S3MA 2BZ8A 2DERA 1IKLA 1QCBD 3NWSA 4U673 2D5DA 3BDOA 1GUSA 2Q2HA 1EL0A 4UP9A 1JMCA 2ATWA 5M5WH 2EYHA 2DTHA 4JS4A 5CK9A 2N3SA 2B2UC 3CCST 4P73A 3VS1A 5FK9C 2H5XA 2KK4A 3EG0A 4LDVA 5CKDA 2KDSA 4C92E 4JBMA 4L5TA 3VUBA 1YCYA 1GD7A 1J6QA 2NLUA 3I4OA 1U0LA 4PQXA 4DGZA 1S3OA 5LMNQ 4EMGA 1EZZB 4F16A 2L3PA 2A19A 3ZL7C 2EZVA 4ZKBB 1Q86R 5BN5A 2QQSA 2M0YA 3GTOB 1AZGB 4HN7A 1CSQA 1U1TA 4HA8A 1R9TH 1I6HB 4B9WA 1PXUA 2HAXA 1YP5A 1VQ8T 1FNUA 1MD2D 5IYDG 1TWBA 1BUVT 1IHZA 1PYSB 4MN3A 4L59A 2C06A 3CC7T 1MI2A 1K9AA 1QKXA 1CM9A 5KNCA 1BI2A 2VUBA 5GAMh 4K5WA 5GANf 1FWZA 2ZJQA 4PK4A 4J8OA 2PW7A 2ZPEB 1H95A 3B6YA 1UGPB 4ME5A 1UE6A 4EVOA 1PH3A 3HRUA 5C4JH 1V9PA 5KIXA 4Q5VA 3PO2H 2RNAA 4M7AA 5CVIA 3ZFJA 3I4LA 3CBMA 3NXWA 5IP7H 4ALPA 3KUFA 5HURA 1BOSA 2QW7A 4R8IA 2R57A 1GCQC 1DCZA 4G7ZC 3J81L 5E3FA 4NXMQ 1TVXA 2F0JA 3NHHA 1M8AA 3CCUT 3PO3H 4LF6L 4R4TA 1EUJA 4QUFA 2W0ZA 1SSFA 1YJWQ 1SYBA 1F9PA 2D0OA 2JS2A 4CDFC 1Y96A 4M78A 3H0HA 1VIEA 1A2TA 1PLFA 2ZM6Q 4A3FH 3TP5A 1NPRA 2X4YA 4DPGA 4LF9L 1D5XC 5M5WB 2QEXT 2VB2X 5LJ3d 4J9EA 2R7ZH 1FMVA 4IFDH 5GMKe 3VS0A 1PZID 2LT1A 3L7ZC 2E65A 3TEHB 2R5MA 4G57A 4JBWA 3SB2A 3LWUA 4B3ML 4A3CG 3QB3A 2QEJC 3AT1B 1I0CA 1KRTA 3H8ZA 3CCQT 1VOMA 2K6DA 4DK3C 2M51A 5GAOr 2LQ8A 5KNBA 4DXFA 1CTMA 2XNAC 1VQ7Q 1RADB 3JSCA 1K0SA 4K8IA 2SEBD 2K04A 3OYCA 4JBJA 3SEBA 3CMAA 2A74C 2PVOB 3MP8A 3VRZA 1UE9A 1ML0D 2KHSA 2QGQA 4A3KH 2KE9A 4IPCA 4RCOA 3MO8A 1O7LA 4KI0A 2Z8LA 2K75A 3RDVA 1VQFA 5FLMH 4DV1Q 2Y0SE 1MHNA 4JRKA 3OYHA 4HIDA 4M75E 2P0KA 1X56A 4QGUA 1S72A 1I81A 4Y28E 3G71A 4Y7NH 5KYXB 4XAXB 1Q95G 2D2CC 2DTOA 2PQWA 4ZK9B 3OSOA 1TUGB 3RMSA 4ZAIA 5KYYA 2NN6H 5C0XG 3FIFA 2HEQA 4EMKB 2CS7A 1M2VB 1W2BA 5DEHA 4DR1L 2F2XA 1HFNA 2XK0A 3M0QA 2DUDA 4DV2L 1RL2A 3PO3B 1QZHA 2E2JB 3GDEA 3MP1A 1EQRA 1U3OA 5IP7G 4R55A 1Q82U 3HOWH 4A3FB 2IJ0A 4ZLTF 2MMPA 3ITPA 2JM9A 3QXEB 2O5IC 4KKSA 4ZKCB 4HSPA 4QT7A 3PUVA 3PO3G 3PMTA 1IW7C 3HKZB 4HTHA 1GCQA 3KLRA 1M90R 1KHCA 4ZTFA 3OA6A 4IUVA 2EJFA 4UP8A 4IUQA 5C3WA 3G4SQ 2MI6A 1L0WA 4A3FG 1U5SA 4DR3L 3S1QH 4FL6A 4YCWA 1ZSZB 5LMNW 5I2MA 2QYZA 3EFXD 4DV7L 4J9IA 5IHNA 1RKNA 3HKZG 3S16B 1QUQA 3D6WA 1MKHA 3LGLA 3ME9A 3I91A 3H6ZA 1YITT 4E2FB 1KABA 4FDBA 3VR3A 3UA6A 2MAMA 1E2ZA 1I4QA 2KI7A 3EHQA 4A3MH 3CCSA 1A3UA 1CKNA 1XNIA 1DJ7B 1W6XA 1SE3A 1Y07A 1GUOA 2PZTA 2FMCA 4A3KB 1UECA 3D8GA 2MPMA 2PZ1A 3VS6A 1CUKA 4IJLA 5E1FA 3WDNA 2EQJA 3CPWS 4UC4A 4POGA 1ILPA 5FLXc 1LO5D 3OSSC 1G3TA 1Q81R 4UY8C 4F7UE 1W2BP 3HRZC 4FF4A 4G7OC 2RK2A 2VKNA 1HZ9A 2PNHA 4MIUA 1CKBA 1G2TA 4A3KG 4IPHA 4DEXA 1I94L 2X3XD 2KYBA 2KHJA 1PZJD 5FLMG 2G6FX 3QJ6A 4C92F 2VXFA 1SNDA 5LJ5f 2LP5A 2F0TA 4LMQD 2DN8A 2VS1A 4OB1B 1CQFA 3JC66 3CC7A 3Q24A 1K4US 2EYOA 3L9AX 2JMCA 3OYYA 2FMMA 2Z6BA 3RLNA 3FJPA 1HK9A 2AWOA 2NYSA 4RCBA 3A7AB 3V8JA 1XNRL 3RERA 2NN6G 4RTTA 3C94A 4C8QF 2DL7A 5GAGC 4O5VA 1D2BA 2NZ1D 3TSWA 3RNUA 1I4XA 3J81E 2EYXA 3FKIH 3CCUA 5J1ZA 2X51A 2OTJT 1LOJA 3S1RH 2AZVA 5E4WC 1EQVA 2LY7A 3M9BA 2RI5A 1ZLMA 2FVUA 1J8IA 4X3SA 3J7AF 2QEXA 1D5MC 4DA4A 1VMPA 4OO1I 4J83A 4GLXA 1EY6A 5BR8Q 4DAYB 3I4NH 2R58A 4KMUC 4A3MB 4DU9A 2PI2E 3DWAA 1AW7A 2O9SA 3BJUA 4UDUC 3H9NA 4LFAQ 2NVXB 1WVLA 4NS5A 1BCPB 3AFPA 3KLSA 3CCQA 1IRXA 2WINB 2NZOA 2YTVA 5EQ0A 4GKJQ 2COZA 1BBWA 1LTID 2BE5C 1WD1A 4HCCA 3OYEA 4E6IA 3JCMJ 4A3MG 2O4XB 3CMET 3SE0A 1BNZA 2YUNA 2MO1A 3CCMT 5AJ3L 4YWLA 3MTSA 4S3SA 3UA7A 1X3QA 3BG3A 1IGUA 2V26A 4KKTA 1HNXQ 3CAMA 1UFFA 1NZ9A 3BFMA 4X3UA 3NBIA 1BB9A 1M3BA 2CWPA 2DK3A 4JLGA 4X9DA 2NTSA 2JUFA 5EKKA 4DV4L 3VA5A 3MXUA 4FYDA 2L3QA 1QVPA 2X35A 2P5ZX 2E2DC 5C5MA 3W1BA 4EQ5A 3S2HH 3M4OB 1B3AA 4JV5L 1XJVA 1FYNA 2F5TX 2DEUA 3JCMQ 1PH6A 3QHSA 1B53A 2K4YA 4CI0C 3VJPA 1PH8A 2OTLQ 1C1AA 2M0OA 1UG1A 5IN1A 2R92H 4A3DH 1ZXTA 4ELZC 1YN8A 2I5LX 4U68A 4X1VA 3AMUA 2F5KA 2XI9A 3W1GA 1Q90A 4I65A 4CDDC 2O01E 4M75F 5GANe 1XOVA 4PJOB 1EY7A 3S1RB 2RKSA 5IYCH 1LTAD 3TP8A 1DOLA 1WX6A 1R4QB 1N34L 3CU7A 1JOKA 4N4GA 1BIBA 2X6GA 3FMCA 3HKSA 4OELB 1WZOA 4BY6C 5D3IB 3VYRA 4LF7L 1RI9A 4PJOG 3OS0A 2IW3A 2KROA 3PIP3 2CQOA 3S2DH 2JK8A 4JDSA 1B8AA 1R8OB 2EJ9A 4JI8L 1HSQA 2FYKA 3J81i 3I35A 1DONA 1R0CB 4BI3A 2JM8A 3NE5B 3MEAA 3H09A 2KRSA 4FT4A 3UWNA 4PZ7A 1QW1A 4K0KL 3X24B 1H9RA 4RKUE 1YITA 2L0AA 4FSSA 3CC4T 1VMCA 4DV2Q 3GTKH 3CBPA 3M0UA 3I4MB 1EWIA 3KF8B 3L2PA 1E1OA 4JC0A 2EBPA 4KGZB 5E4XA 2BH2A 2O88A 2JN0A 3KLSX 5IP9H 4GNXC 3EG1A 2VXEA 2LCLA 5CKHA 1YJ9T 1QNKA 3AU7A 2XIWA 1Q8KA 3RLOA 3I4MG 1GOZA 3HRSA 4GN4B 1BCPD 1T9HA 3PUYA 4PFOA 1OXXK 4RTVA 5KCOA 2HNIA 3DB4A 1V1QA 4RG1A 5M3MH 4DR3Q 4JYAL 4ANJA 2RHXA 1Z9QA 3GP7A 2JA6H 3MHXA 5GAOn 1L0XB 1BU1A 2RI2A 2R92B 1MMAA 1RUWA 2NUPA 1D7QA 3LH5A 4CC7A 2IHEA 4CDCC 1QKWA 2LDMA 2DNUA 4LUZA 1GCPA 3I73A 2UUBL 1EZ6A 1SROA 4HT9A 3GTQH 1G6ZA 3EGDA 1M30A 1YIJQ 2UXBL 3OPOA 3JB9I 4P75A 1DD2A 5LMUL 4OX9L 2R92G 3T9NA 2I46A 1NSNS 2OF1A 1BK2A 1W4SA 5EAYA 3PGZA 1VQ5T 2NUTB 1M2OA 4C0DC 4Y91A 1SRUA 1X32A 1I94Q 4XTUA 4YHHQ 1EU3A 1I5LA 5TSSA 2OTJA 1BQQT 1K8MA 4M7DA 1UJ0A 4B3TQ 2LTOA 2E74C 1WTQA 4LE9A 4AFQC 4PJOD 2YTYA 1Z9FA 2IT1A 3A8JE 2DL5A 3OBYA 3F2DA 3U4ZA 1UEAB 2DRKA 4FIBA 2F0VA 3PUZA 3T1YQ 1S40A 3QPHA 5CBAE 2AK5A 4RAUC 5GAN3 2VW9A 1JEGA 3TU4K 1PH9A 5EKIA 1O7ZA 2M2LA 3A1PA 4C92B 1ESRA 1H9MA 3DXJC 4XT1B 1U9RA 1NE8A 1N5ZA 3H6MA 2ES2A 3EJIA 4A4KA 5GMKl 3JCMW 1SR3A 4O0AA 2CSIA 3CMEA 1W6JA 1BXTA 3VYUA 1G3WA 4DR5L 3CCMA 2JA6B 1VQOT 1RTOA 1Y71A 1EOTA 3G6ET 3RZDH 4HJ7A 1G291 1EY5A 2NB0A 9ATCB 3I56Q 4C92G 4GN5A 4CHTB 4A3GG 5CQXA 8ATCB 5GMKi 1XTCD 3NTIA 3GTQB 3NHNA 4X65L 3PF4A 1OXTA 2K5FA 2ZTCA 2JA8B 2JA6G 3T51B 3ICEA 2L4NA 1KRSA 1EY0A 3STBC 3F2CA 2D9TA 5IAYA 2KY9A 1D6EC 3GD7A 2IPKD 2LNHB 3GTGB 5LJ5e 3QWXX 2V1CC 2EPBA 2VUMH 3RZOB 2FHTA 3WOEA 2LS01 3JCMd 3JAMc 2JA8G 2RDGA 1HQMC 1OEBA 4LFCL 1KAWA 5IIFA 1SG5A 1PHTA 2QDYB 4XK8E 1K28A 5C4XB 4ORZA 2F0MA 3VR2A 3J80c 2MGSA 2JS0A 2F0LA 3CD6Q 4C3IH 3L2WA 1K9MR 1ZA1B 2EQKA 1AE2A 5GAN2 4L5GA 2KA7A 4J9GA 2FFKB 4XU1A 2ZXRA 2YRCA 5K5PA 1VQMQ 2MCNA 2EIFA 3MXNB 4A4HA 5C4XG 2HKNA 2A5HA 5I4DA 5LJ3g 1OXSC 4C3HB 1TWCH 4QB4A 1Z7TA 1HQRD 3M54A 2YYZA 4IFDJ 4EQOA 1OX9A 2RQWA 3KDFB 2K3BA 1NAPA 2EKHA 3EG2A 1SE2A 2XICA 3CC4A 1MJCA 5ELCA 3RMQA 1KSWA 4C3HG 1VIFA 4OO1H 4E7IA 1TWHH 4XTZA 1IXRA 2ZJRA 2HHHL 3S17H 3K81C 3MVVA 3UE1A 2EYPA 3J7AV 1WGSA 4MDXA 3DM1A 5JVH3 1H9SB 2CHBD 3ASKA 4PZ8A 4LW1A 2PU9B 1SEMA 4RTXA 2JE6I 5ELDA 1YJ9A 4LF7Q 1YJWT 5C3EH 3PGGA 1K73C 3LLRA 4WFN3 5I21A 2Y0SB 4OXPA 2P0QA 4JI8Q 2QI2A 2LC4A 4M75B 2E75C 3NGPA 2N8NA 1O7YA 3A56A 5AFWA 1EYAA 4L5RC 4ME3A 5CKFA 4XYOA 4OWXB 3ULRB 4CGYB 3OY9A 3ULJA 4OMNA 4KD3A 4GOPB 2D0NA 2GVAA 2Y0SG 2CKZB 1SRMA 3JCMb 3L2UA 2RD1A 1XPUA 4M75G 4BI8B 1PTOC 4ME7A 2EAYA 1HTPA 2HL3A 3M0TA 2CVRA 4KY5A 5JOBA 5LJ3j 3BE3A 3VS4A 1EFNA 1WTWA 3GP8A 1VQ5A 2FO0A 3P8HA 1KNEA 2X6LA 2K79A 2CSQA 1Y8NB 2QF7A 3D4DA 1VQBA 2V1QA 4BY7H 1K0XA 4A75A 4B3SL 1M1KU 2RPNA 1DYQA 1QB5D 4BBSH 2KHIA 3FEOA 4KHZA 2EYLA 1JO8A 5KNDA 1HHVA 2HKQB 1A3VA 2VQEQ 2YLCA 5A2QL 4XXEA 2CP2A 1MSGA 2JA9A 4I7AA 4A3BH 2CZ6B 1H3HA 1NBWA 4TVAB 3TVTA 3C3LA 3OOCA 2UXBQ 1Y1WB 4QVDA 2DBMA 2LFNA 2EJMA 2LXKA 3SR1A 3DHQA 4N9TA 4OX9Q 3M5AA 4PMBA 2AKWB 4AG2C 3PIO3 3SWNB 5HKCA 3CCJQ 1Y69U 7AT1B 4HMIA 4DV3L 2HQHA 1PMRA 4ZGJB 4A3EB 1WDXA 2EOTA 3MHBA 3R93A 2PZWA 1Y1WG 1KFZA 4ZUJA 2QAZA 4QQ6A 1QMCA 1GM5A 4QVCA 2LT4A 4ZTJA 3I55T 2BA0A 4DNTB 3L42A 4F7UB 2E76C 3ER0A 4JI1L 5JAVA 4A3EG 3G6EA 4XTVA 2J6KA 2OWOA 4HIOA 2XHCA 3CCET 3L2QA 1IL8A 1H9JA 5G3LF 2A0FB 2HIVA 1K83B 1SNMA 4F7UG 2WB1E 3DWPA 3HOZH 1C48A 3I3CA 4FXDA 5EPKA 2ZPFB 3HGBA 3SK4A 4MZTA 1CFMA 2RHYA 4J6WA 2XDPA 1KC8C 3OYDA 5FU7C 3EAEA 4RWSC 5L37A 4K2KA 1WOCA 3L2ZA 2RA4A 4K6LA 1OI1A 3K5NA 4DR5Q 3OW2S 3GTPB 1AH9A 2A37A 4OGQC 2LMCB 1GVPA 3M0PA 3HSBA 3V96A 3X3MA 5JEAH 2ZPGB 4IO9A 4K6DA 3LWEA 1F1BB 4L6TB 4BY7G 2D1XA 4KJOA 3KF6A 1JXOA 2O2OA 2XG8D 1B4OA 1GXIE 5HGQA 4PJOE 2MUYA 4HVVA 1YVCA 1MMGA 4TSSA 2VASA 3S15H 1STHA 2PUKB 2QQBA 3VS5A 5IXBA 2WAQB 1LV9A 4LD6A 3K5OA 1FVIA
chains in the Genus database with same CATH topology
3DLMA 2RH2A 5GAMg 1C7YA 3J7A5 4BDYA 2QXFA 4A3BG 4PZ6A 4BUGA 1QVFS 1OZ3A 2RHIA 3M55A 1PHJA 3OTOL 2EQUA 2BKDN 2WAQG 4GLKA 4LFCQ 1G3YA 1WJJA 1SMXA 2K50A 4Y52H 2EYQA 4EPCA 4XIGS 3HOXH 1ZBXA 4OB3B 3QDRB 4C8QA 1E24A 1YJWA 2WSFE 3DKMA 3RN5A 4DR4L 2DD5A 3CCRT 2R6GA 4M7AD 4EMHA 1QVGS 3NTKA 4EX5A 1A0IA 3UDIA 5DLOA 1SN8A 3LGJA 4M78D 2K3XA 4HT8A 2GF7A 4M7AC 5GAMj 1CKNB 4P72A 3RKYA 4J15A 3CPFA 3TREA 3OYJA 1Z47A 4AYBE 3OQ5A 3C4SA 1YJNT 5IWAL 2LNVA 1E7ZA 4M78C 3M56A 3INZA 1PH4A 1BI3A 5A2QE 2KSSA 1KQSS 2M1HA 2R7FA 3EBEA 1ASYA 1TWAH 4BBRG 2E2IH 3BW1A 4A54A 1WQWA 5J3BA 1HXDA 2JZ2A 1FGUA 4OONA 1I50H 3RIRA 3M9QA 1Q82C 3OYMA 2NVYH 5M5XH 1UGRB 4DV6L 4X9CA 4B3SQ 1XMQL 3I55A 4OP0A 4GS3A 3HOXG 4JRIA 4M77A 2DVEA 3DM3A 1KC8U 1P8LA 1LTLA 2Z0SA 4XTCS 4R4OA 3CCEA 4ZGEB 2VGNA 5GANd 2JA7H 5KE2A 1Q1EA 3QZ5B 1VQCA 4LFBL 2ALYB 2GN5A 4DV3Q 1HNWQ 1J5EL 2K52A 2LX9A 3RKWA 2E8GA 3LYIA 4NL3A 4POFA 1G51A 3UDXA 1PSFA 4X64Q 4JI5Q 3K7UC 4BE0A 1CKOA 3W5OA 2PUOB 2ZTDA 4BY1G 3NEMA 2MWPA 4ZGDB 1I8FA 1UWVA 1C0AA 2ASBA 3M58A 5FRNA 1NMGA 3HFZB 4LD9K 2JA5H 4WJ3M 3H0GH 3V8LA 4PJOF 1NJIU 3LGFA 4A4FA 1NMFA 4WF2A 1XQHA 3P8DA 4PKCC 2NVQH 3AQQA 1OYXA 1Y1VH 3E1SA 5CKBA 3RR5A 4XTWA 1X65A 3CCRA 1WNLA 2ZCFB 1IBLQ 2JA7G 2B29A 2E5LL 4BXXH 2R93H 4AIMA 1AHJB 1QP3A 4L5SA 3JCMg 5FU6C 3HRTA 1MIUA 4XU3A 4KUDK 2KCMA 1I5FA 3FRNA 3PO2G 2MWOA 3I56T 4DR4Q 1YJNA 5IE8A 3TS0A 3QZ9B 3VV0A 3A8HB 3PV0A 1EYGA 4PG3A 1PVOA 2GFAA 1UB4A 1X6OA 4JI6Q 1VQDA 1VQGA 2JTFA 1JE5A 2M16A 2R7ZG 4IFDG 2JA5G 1IZ6A 1RI0A 1MGQA 5M5YH 2L8DA 5D6YA 4QQBX 3TS2A 1QP2A 2CYZB 3CD6T 1JJ2S 2UUAQ 1JJCB 4M7AE 4LD6A 4X66L 5LJ5d 2RJDA 1Y1VG 2GQVA 2LSSA 3TEEA 1PSEA 2I2LA 4GKKL 3VDYA 4BY6B 2EQSA 3S24A 4M78E 4JI2L 1M4ZA 2DTIA 1WYDA 4MZPA 2MNAA 2XDBA 5CCAA 4QQDA 4DV6Q 4IPDA 2WSEE 1E3PA 2OQKA 1XMQQ 1NPPA 4JI4L 5IYBH 2B8AA 4JI0L 4JS5A 2F52A 2VL6A 4Q5WA 4RG2A 5LL6S 2YTXA 4GNXB 3HOWG 2ID0A 4QL5A 5FLXE 2IHFA 2HQXA 2RO0A 3OYIA 3CF5A 1J5EQ 1VQLT 3GTKH 4DKAC 3IRBA 3JCMc 5ELOA 3A8LB 2WAQE 2UUCL 4GY5A 1YBYA 2HD0A 3V7RA 3JCMX 3OYNA 2RI3A 3LWHA 3FHWA 2D62A 1X75C 3MP6A 3L0OA 1Q86U 3JCMh 2DIQA 4C0DB 3M3YH 4LF6Q 4MMKA 4JBKA 5GMKj 2OCEA 1ZQ1A 4LF9Q 3RESA 3HL8A 3OMGA 1WI5A 3OYKA 4O6JA 4FM4B 4B3MQ 4DUYL 3U4VA 2E64A 4LUOA 5ELNA 1VUBA 2WB1G 1BI1A 4JLIA 4MNOA 5GAMf 1YEZA 2JJQA 4R4QA 2I5HA 2RJEA 5JEAJ 3UPUA 3I56A 3CPWA 4M7DC 1ASZA 3GTLH 5FRMA 3META 3KFUA 1D3BB 3FKIG 2E5LQ 3WVDB 4C0GA 1KHIA 3LH0A 4E7LA 1VQKT 1BKBA 2QQAA 2ZPHB 3NBHB 3I4NG 4C5EA 4DR1Q 1FL0A 3ZJYC 1UE5A 4JOIC 3PNWC 3CD6A 3V7CA 1EIFA 4IUPA 3CC2T 3HOYH 2DXBA 5A0LA 5GMKh 3S14H 2E10A 4A3JH 3TQYA 2OAUA 1N8RC 4LDYA 3A5ZB 4KBMB 2RA2A 2RB6A 1KQ2A 3QSUA 4M7AF 4DV7Q 1XPOA 1M8VA 4AH6A 3KJOA 1M9SA 4F7UF 4EMKA 4L6V5 5GAOm 1HJPA 4OWTB 4A93H 3CCLT 4A3DG 4M78F 4X66Q 2E2HH 3BZCA 2HT1A 2IVWA 4OF1A 1M90U 4NOYA 4GKKQ 4QQGA 5IYCG 1U8RA 2K5VA 3Q8DA 4R4CA 5GAN6 4AYBG 4JI2Q 3Q1JA 4IKFA 1VQLA 3MEWA 3LW5E 3M4PA 2XGTA 2E70A 1XNRQ 1M1KC 2EXDA 3OS1A 5GAN5 4JI0Q 1Q81U 3OBWA 3L1AA 3T1HL 1HR0L 4J6XA 3STBD 4JOIA 5IP9G 2CZ1B 4L5QA 2RHUA 3CW2C 5GANg 4RG8A 3PSIA 4DV5L 3J7ZC 4A3JG 3TCJA 5M3MG 1P16A 2UUCQ 3PUWA 3GTJH 3ULPA 1VQEA 4KUIA 4D6WA 1YHQT 1X3EA 2VY3A 5GAHC 5FJ8H 3CXCS 5AJ3Q 2KMTA 4KT0E 4N4IA 3L2RA 4R1JA 1YHAA 5GROA 4ELYC 4HJ5A 1SLJA 1IBML 3ERSX 4DV4Q 1BI0A 2PMZE 2UU9L 1KXLA 1NE3A 1XNQL 2X4WA 4JV5Q 3QO3A 2ZPIB 4DAMA 4XQ3A 1IBKL 5KCHA 2PQAB 1JRIA 2D0QB 2X4JA 4IJHA 2NVTH 3V7SA 1VQKA 3DLLA 1HZAA 5GANj 2Q2UA 4C5GA 2F4VL 1N8RU 5FU7B 4Z02A 2O4XA 3QIIA 2B63H 2VYTA 3KJPA 2JEAI 4A3LH 4A53A 4DNIA 1N34Q 1HH2P 1E1TA 1BYMA 2V8JA 3J80E 3CC2A 2RK1A 4C0ZA 2Q2TA 1L2FA 4X62L 5JJKA 1NTGA 1M5Q1 2Y4YA 4M7DE 2B3GA 4JG2A 2QQRA 1GKHA 2EJGA 1M1GA 3A8MB 4EDUA 3GPLA 4K0KQ 5AYFA 3PF5A 5EG2A 2RHQB 2BIVA 1FXXA 4VUBA 3CCLA 2VUMG 3PTAA 5GQOA 1VQ7T 5GAMe 3FC3A 1FJGL 3A8GB 2K57A 3M85A 4R4IA 3OMCA 1TXYA 1PFSA 1HZCA 4LF4L 3VYGA 4JYAQ 5C0XI 1VQAA 3MCAB 1Y7XA 2DXUA 2DZ9A 1GO3E 3CEYA 3QKJA 1KD1U 3S1MH 3OYGA 2UUBQ 4DR2L 4BI4A 5GANh 5LMUQ 2I0QA 4C2MH 4PNOA 3S3NA 4IURA 1K0RA 1DGSA 1VQ6T 4N4HA 4M7AB 4OO1G 4C8QC 2B63G 4CRIA 4IFDI 1LM0A 5LJ5g 4A3LG 3BU2A 1PYBA 4AQYL 2KAFA 5C3EG 4M7AG 1Y96B 4M78B 3UDCA 3JAMi 3G4ST 4YCUA 1Q7YU 3GLXA 1TWFH 4OGEA 5HY6A 4C0FA 3J80i 1B34A 1YHQA 2GFUA 4DV0L 2K5HA 4M78G 4BA2I 2CZ7B 3UT1A 3T1HQ 3FDRA 4JRPA 3GO5A 2RHZA 1QVCA 5E7NA 4APVA 4LNQA 1PH7A 1EQQA 5GAOp 3JB9H 2I5MX 3PMIA 3SD4A 4BE2A 2NN6I 3HPWA 5IT9E 5H1SE 4BBSG 4X65Q 2IY5B 1HNZL 3E0EA 2XU8A 5CO7A 2ZTEA 4ATOA 5LJ5j 2QQ9A 4M77D 4ZN1A 1X01A 4O2DA 3UDGA 1PH5A 2LXJA 4J7FA 3LX7A 1IYJB 4DK6C 4IUUA 4N0AA 4C92A 3BZKA 2HQLA 2X4XA 1UGQB 4HCBA 2Z6KA 4M77C 3JRZA 2DO3A 4DR6L 5CR2A 4DR7L 1XMOL 4X34A 3UE0A 1BVSA 3AEVA 2UU9Q 5HK0A 3C95A 1N33L 4B3RL 2UXCL 1NJIC 3G48A 3EN2A 2JTMA 3X28B 2A8VA 4PL6A 1IREB 5C6SA 2RJFA 2JEBI 3CQZH 2E6ZA 1P92A 3HOZG 1O7IA 1QUQB 3O8VA 2KCTA 1SFOH 2VZAA 1JT8A 2YHTA 1K9MU 3P8BB 4A76A 2WP8J 4YWMA 2HHHQ 1B70B 3UDFA 2XIDA 1VQ7A 4HJ8A 2DXTA 1PH2A 5D6XA 1YZ6A 5JEAG 1BBUA 2RJCA 3JB9G 1WFQA 2NZHA 2CKKA 1WQ7A 4DUZL 5LJ5h 2YLBA 1N32L 2CGHA 3KDFA 1O75A 2OTLT 2E41A