5DLQE

Crystal structure of rangtp-exportin 4-eif5a complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
136
Chain Sequence
ATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-4
publication title Structure of the exportin Xpo4 in complex with RanGTP and the hypusine-containing translation factor eIF5A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 22
structure length 136
sequence length 137
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dlqE01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5dlqE02
4JI3L 1E1TA 4AH6A 4OO1I 3CCLT 2ZTEA 1YITA 2V1CC 5DM7R 3J81E 4A4IA 3M4OH 4BBSG 1SSFA 2QA4A 3CAMA 1OXTA 4A3DH 3M9BA 3CCRA 5C3EG 2D0OA 1LUZA 4UPAA 3E9IA 4LF9L 2K5VA 1OTCA 1NTGA 1XNIA 4O2DA 5C4XH 3K8AA 1PH7A 4DR3Q 1HNXL 2FXQA 2NN6I 3UDXA 3KDFB 4DUYQ 4DR1Q 3S2HH 1EWIA 4JC0A 1HJPA 2F3IA 4DUZL 4JI4Q 4JV5L 4YCUA 5FJ8G 3T1YL 5AJ3Q 1VQPT 3LGFA 4DR4Q 3GTQH 2B29A 1HNZQ 1KQSA 4BA2I 2WB1G 2GVBA 1NJIC 1C9OA 2EQSA 1K3RA 4LFAQ 1KRTA 1VQNT 1BKBA 2JNGA 1H95A 1EQRA 3CCVA 2JK8A 4JI1L 4GNXA 4DV2Q 3CMET 1L0WA 3KOJA 1SR3A 1VQHA 4DV7Q 4JYAL 4DAMA 1AE3A 1VQ8T 2Z6KC 1QUQB 3G48A 2VQEQ 3GTGH 4LFBQ 4HIMA 4HJ8A 3CXCS 4LF7Q 4GLAC 4JI0L 1QVGS 3FKIG 3I4NH 1HNWQ 5IE8A 3CMAA 2K5NA 4PZ7A 5M5XH 2UUCL 4NXML 2LXJA 3PO3H 1XNRQ 1G51A 1VQOA 2MFIA 3ER0A 4DR7L 1QVFA 1VQ4A 5C0XI 3I56T 1WOCA 2MQHA 5IP7G 4DV6Q 3G6EA 2E2IH 5JEAJ 2ZJPA 4A3LH 4WJ4A 4A3KG 3S24A 2Q2HA 4KLKA 2LCLA 4HJ7A 5ELOA 2K14A 2UU9Q 2MNAA 4YTLA 5IAYA 2XTIA 4C3IH 3HFZB 4OWXB 4DR5Q 3E0EA 2G3RA 3BZCA 4FDBA 4POFA 1BVSA 2Q2TA 2R7ZH 2CWPA 1J6QA 4C3JH 1VQEA 3B6YA 3RLFA 1K8GA 4B3TL 4JG2A 3W1BA 2RF4A 4UP8A 2E6ZA 1E1OA 4YWKA 4YY3L 3CPWS 1Q7YC 1W2BS 4DV3L 2JVVA 4GOPA 5H1SE 1XMQL 2F4VL 3DB4A 1Z9FA 2RHQB 3HOVG 1PFSA 1NZ9A 3D0FA 1I3QH 1IZ6A 4DV4L 3KBGA 1PH8A 1Q46A 3MEFA 4YHHQ 1KXLA 1YNXA 1MIUA 1X56A 4UP9A 2JEAI 3M3YH 1Q8KA 1PA6A 4POGA 2E5LQ 2GVAA 5M3MH 3G4ST 4LF6Q 3TQYA 5IYBG 3UDIA 4IFDG 4QQBX 1VQKT 1VCIA 1PH6A 4JI2Q 3UE1A 3U4VA 4A3BG 2MWOA 3S1MH 2AWOA 4L5RC 2ZTCA 3NELA 1EQQA 5IP9H 4JI5Q 4JI3Q 2UUBL 2ATWA 1CKNB 3KF6A 3RZOH 1V1QA 3CMEA 4NPSA 3DM3A 2DUDA 1WJJA 2OQKA 2XGTA 4X62L 1VQ8A 2JA8G 2QA4T 4GKKL 3CXCA 5IYDH 1B7YB 3CCRT 3KF8B 2BA0A 4RG1A 5E7NA 4LF9Q 1HNWL 2PMZE 1YHBA 4HJAA 4PZ8A 2HIVA 1HNXQ 3I56A 2N78A 4A3DG 1PH5A 2UUAL 4B3SL 1S3OA 2K75A 4IOAA 4JV5Q 2N8NA 3T1YQ 1K8AU 4A3EH 1XPUA 1Y1WH 1K0RA 1XPRA 1K73U 5C4XG 3HKZG 3BZKA 3KJPA 1D8LA 1KQSS 3UDFA 1TWFH 2IHEA 3PF4A 3TS0A 2NVXH 3ZJYC 4A3CH 3I2ZA 4KI0A 4TVRA 3AQQA 1VQDA 3CPWA 1XMOL 1W2BA 2YTVA 1WFQA 2VL6A 4PZ6A 5IYCH 3CCVT 4JI1Q 2IX0A 1VQCA 4BY7H 1LYLA 1I94L 4JYAQ 1X55A 3F8TA 2ZM6L 4YCWA 4X66L 4ZN1A 3MXNB 3HOUH 1L1OA 4O0AA 5GROA 2A1AA 1UWVA 1CUKA 1WI5A 4JI0Q 4DR6L 4DK3C 4K0KQ 5HY6A 3CMAT 1HZBA 2JEBI 2UUCQ 1VQOT 4A76A 1VQKA 4DV0L 5J3BA 2BA1A 4DR7Q 4LWCA 1K8AC 1VQ4T 4WJ3M 1M1KU 3S17H 1QVFS 3I7FA 4P75A 3ICEA 2ALYB 2CFMA 1K73C 1VQ9A 4GN4B 4C3HH 3PUZA 1VQGA 3HOXH 1S72A 1SE8A 1T9HA 5GAHC 1PH4A 3I4NG 1VQBA 2KCMA 2WP8J 2Z6KA 2MO1A 4CRIA 3M4PA 4R1JA 3H3VI 3PO3G 1PVOA 4QQDA 1V43A 5DLQE 4IOCA 1J5EL 1EFWA 1IBML 4A3LG 4GS3A 3HOWH 3KYHC 1N32L 4X34A 2KENA 4B3TQ 4AYBG 4YY3Q 4IPGA 3J81j 5LMUL 4DV1L 4DV3Q 1XMQQ 2R93H 2F4VQ 5HGQA 1XTDA 4L5QA 2CKZB 3S16H 4JOIC 3A74A 1M90U 4DV4Q 2YTXA 4DV5L 4BY1G 2KVQG 3PIPA 1HH2P 1G6PA 1UE1A 3E9HA 1M1KC 4YWLA 2YU9H 4LNQA 4A93H 2BH2A 2JJQA 1EIFA 3CQZH 2YTYA 4R4IA 2JA6H 3L0OA 3KDFA 3OW2S 1NPPA 4YWMA 3U50C 4QJFA 4PG3A 2UUBQ 3KJOA 2UXCL 3P8BB 4BBRH 2UXDL 3OYYA 4HJ5A 1V9PA 1YJ9A 4X62Q 4GKKQ 1Q7YU 1FGUA 1C7YA 1N34L 1NBWA 3S1QH 4KHPL 1PV4A 3ERSX 2E70A 3CCSA 2ASBA 5ELNA 3PUVA 4K0KL 2UXBL 4LW1A 5IP9G 3S1RH 1CKMA 1YEZA 4P73A 2KBNA 1M90C 3KLWA 2AHOB 2R6GA 1HZAA 4P72A 4B3ML 3PSIA 3PUYA 4X6AH 5IYDG 1SMXA 1TWAH 1E3PA 2LVMA 4LUVA 3STBC 3K7AH 1QUQA 4A3IH 2UUAQ 4B3SQ 2K52A 1OXUA 3HOYH 1LTLA 2AMCB 3M7NA 4IPHA 5LMNL 3M85A 2PQAB 1S40A 1VQIA 2VZAA 3JAMi 1EIYB 1WCMH 2JE6I 4BY1H 5JJLA 1VQ7A 2KHIA 3PCOB 2KHJA 2N3SA 1U0LA 3EN2A 1VS0A 3CD6A 5IT9c 3K81C 1KRSA 1KC8U 3EIVA 1XMOQ 2VUMH 4A3EG 3I4MG 2E8GA 2MWPA 5A2QE 1Q1BA 3FHWA 1Y1WG 4HIDA 3IRBA 1I94Q 3GTPH 4OX9L 1JE5A 3AFPA 3RLOA 2IG0A 3F2BA 4A3CG 2ZM6Q 2L15A 3CCJA 4X66Q 5J26A 1AE2A 1PH1A 2HHHL 4LF4L 4BY7G 5IYCG 3H0GG 4DR6Q 2EIFA 1YIJA 1P8LA 3HKZE 3OTOL 1GO3E 3OW2A 5M3FH 2JQOA 5FLXc 4DV0Q 4DR2Q 1SROA 1A62A 4NXNL 2QGQA 3L7ZC 2OTLT 4L5SA 1VQ9T 1UE7A 1G291 1I50H 2R7DA 1TWGH 1S72T 3HOUG 2IX1A 3CCUA 4JBWA 1XJVA 2JA7G 2NZOA 2OTJA 3CCMA 1Z47A 4HIKA 1KL9A 1KC8C 1UE5A 2JA9A 4A3MH 1J5EQ 4OXPA 4LUZA 1TWHH 1IBMQ 4XTCS 1K83H 1N32Q 1OXSC 3HOXG 3NEMA 5LMUQ 1N8RU 4DV1Q 1HR0L 1CKNA 2VW9A 2I5LX 1YZ6A 2CKKA 4IJHA 1KIXA 2I5HA 3NENA 1GD7A 1YI2A 4LFCL 4DV5Q 3TS2A 3HOWG 2A8VA 1NMGA 4MZ9A 1YHQA 1E7ZA 2R93G 4LF8L 1PH2A 1VQLA 1GKHA 2D0PA 2VY3A 1CKOA 2NVQH 4GKJL 2WFWA 1MJCA 4AYBE 3D31A 3ULLA 4A75A 4JBKA 3U4ZA 3GD7A 5M5YH 2LQ8A 2AKWB 2UXCQ 1JJ2S 2UXDQ 2K50A 5JJKA 1YJ9T 3M4QA 4JOIA 1NPRA 3GDEA 1YJNA 4YCVA 3SGIA 4GOPC 1K9MU 4A3GH 4A93G 3HKSA 1N34Q 1IBLL 4X64L 2JA6G 2RHSB 4KHPQ 5LL6S 1KD1U 4JI8L 1I6HH 1N8RC 3CCST 4DNIA 4A3BH 4UY8C 2UXBQ 5C44H 2NVYH 4BBRG 4B3MQ 3I55A 4AIMA 1Q81U 4DR2L 4IFDI 1EUJA 4IFDJ 2A19A 2OTLA 3K7UC 1VQ6A 2N49A 4ME3A 1GM5A 4JI7L 3UE0A 5C0XJ 4DK6C 5LMNQ 3RLNA 3J80i 1IBKL 3GTOH 1RL2A 1IYJB 4KHZA 3RR5A 4JI6L 4QL5A 3T1HL 1VQJA 1SFOH 1C0AA 2QEXA 1VQ7T 1Y14B 2HQLA 5IWAL 1N36L 5M5WH 3H3VH 1HZCA 3CD6T 3L2PA 4A3IG 3J80c 3PO2H 1TXYA 3HOYG 1K9MC 3A0JA 4MNOA 2L3RA 3LH0A 5C0XG 2I0QA 2JA5H 1GVPA 3CC4A 1KD1C 3A5UA 4OX9Q 3GO5A 3G71A 3EBEA 1WCMG 4IO9A 3U58A 3HOZH 1WYDA 4BXXH 1VQAA 1JT8A 3CCJT 1RIPA 4A3JH 3KFUA 4QGUA 2R7ZG 2HHHQ 4ALPA 4OWWB 3S14H 4LF4Q 3DLLA 1Q81C 3CP0A 1JMCA 1YIJT 2LSSA 3OTOQ 4UP7A 2Q2UA 4Y52H 1N33Q 3GTMH 2R7FA 1B70B 1VQMA 2B63H 1D7QA 1TWCH 2MO0A 4NXNQ 4TVAB 5GAEC 1EYGA 4R4CA 3J81i 4JCVE 1JJ2A 4RG2A 4IPCA 4APVA 2HIXA 5JJIA 3CCEA 4QY7A 3CCUT 3PUXA 1JJCB 5M3MG 2D62A 1PH9A 1YJWA 1W3SA 1PHJA 2MI6A 2I5MX 2OTJT 3CCMT 5M3FG 1PYSB 3J81c 3VDYA 5GQOA 3AYHB 4GN5A 4X65L 4GNXB 2IY5B 1FJGL 1QZHA 3LGLA 1L1OC 1IXRA 3PGZA 4JBJA 4B3RL 1MKHA 1X3GA 1QZGA 1VQ5A 4AQYL 1HR0Q 2K5HA 2ZJRA 2Y0SG 5IT9E 1SN8A 3I4OA 3RN2A 2OCEA 1MJEA 4LF5L 5BR8L 2VUMG 1E22A 1P16A 2ID0A 4A3MG 1YI2T 3JAME 1X3FA 1Y1VH 4LFCQ 3CC2T 3S2DH 3F2DA 1X6OA 1AH9A 5C4JH 1YHQT 2R92H 4A3FH 3PV0A 5EAYA 4LF8Q 2YYZA 1YHAA 1VQLT 3W5OA 4OONA 1XNQL 3JC66 1NMFA 2VQFL 3K0XA 3CCQA 1BBWA 1HZ9A 5FLMH 2ZJQA 4GKJQ 2YV5A 4EQ5A 4R4TA 4P71A 3JAMc 5FLXE 1QVCA 4GLVB 1DGSA 2LXKA 1OXXK 2VS1A 4R4OA 4C2MH 4BBSH 4TQUS 3GTKH 3CC7A 1YVCA 4NB3A 2PQAA 1YJNT 2PI2E 4EX5A 5C3EH 4HJ9A 1IBLQ 4X64Q 2HT1A 5GAGC 4HIOA 1ASZA 4JI8Q 4DPGA 3J7ZC 4GOPB 1I5FA 2DO3A 3CF5A 2AWNA 3FP9A 1X54A 3CCLA 1JB7A 1N33L 3UDGA 4ZN3A 1Q86U 3I55T 3Q8DA 2E2HH 2IT1A 1PYBA 5IY0A 3F1ZA 4A3GG 3STBD 5FJ8H 4IPDA 2JOYA 1OXVA 4JI7Q 1VQ6T 3BU2A 3NBHB 5JEAG 3A5ZB 3PF5A 4DR3L 5C44G 1X3EA 4GNXC 1ASYA 3CW2C 1IBKQ 4DUYL 4JI6Q 1Q82U 4DR1L 3J7AF 1YBYA 1X9NA 3T1HQ 4JI4L 2QEXT 5GADC 3KF6B 4PMWA 2WAQE 3TREA 3ULJA 1VQPA 5IWAQ 5AJ3L 1N36Q 4JBMA 4DR4L 2C35B 3AFQA 1HNZL 4DAYB 2OWOA 1FL0A 1CSQA 1KAWA 2VNUD 2IHFA 3CC4T 3TEHB 3G71T 4RMFA 1FVIA 3RN5A 4LFAL 1JJGA 1VQNA 4R4QA 2NZHA 1LM0A 3CC2A 4OO1G 3FKIH 2GN5A 1X65A 2BH8A 1Q86C 1E24A 2OQ0A 1A0IA 3PUWA 4DV2L 3PO2G 1A8VA 2XHCA 2F52A 4DV7L 2JA5G 1YITT 5LMNW 5IP7H 2VQEL 4LFBL 1XPOA 1VQMT 1NY4A 1VQFA 2CCZA 3HOZG 4A3KH 1UE6A 1QVGA 3H15A 3RZDH 1R9TH 1O7IA 4A3JG 4LF7L 4BXXG 1A63A 2EXDA 1KHIA 1Q82C 2NN6G 1BBUA 2PNHA 4J15A 3CCET 1XNRL 2Q2IA 1YJWT 3LGJA 4BA1I 4DV6L 3K80C 4GN3B 4LUOA 1PH3A 2B63G 4DUZQ 2CWAA 1NE3A 4GLXA 1UEBA 4XIGS 4X65Q 3PIOA 2WAQG 4OWTB 1U5KA 1FJGQ 2KCTA 3I4MH 4B3RQ 2UU9L 2PI2A 2E2JH 3W1GA 4DKAC 3AEVA 1VQ5T 3RNUA 4AQYQ 2ZTDA 4Y7NH 3ULPA 3HOVH 4P74A 1L1OB 4DR5L 4LF5Q 3J80E 5BR8Q 3F2CA 2ES2A 3GTLH 3TRZA 3H0GH 2B3GA 3S15H 2JUFA 3S1NH 2DGYA 1M1GA 4IJLA 4MTNA 5IYBH 3GTJH 1IL2A 3J7A5 2KDSA 1XNQQ 1Q1EA 5K36G 1SRUA 2VQFQ 2H5XA 3CCQT 2RCNA 4YHHL 3CPFA 1Y1VG 1Q12A 2K4KA 1EOVA 2CQOA 3BJUA 2NVTH 1CSPA 2E5LL 1N9WA 3WWVA 2WB1E 3G4SA 4L5TA 4LF6L 1SLJA 4NXMQ 2JA7H 2Y0SE 4H02A 2JA8H 2R92G 4QIWE 3CC7T 1B8AA 4A3FG 3DB3A 4JI2L 1HR0W 1NJIU 3G6ET 2Z0SA 1L2FA 4JI5L 5FLMG
chains in the Genus database with same CATH superfamily
1E1TA 3DUZA 2KYBA 2B2YC 4AH6A 4OO1I 1SF9A 3CCLT 2ZTEA 1YITA 2V1CC 3M4OH 1A2TA 5LJ3j 2FRWA 1DOMA 5C3EG 3GTGB 1OTCA 1QNKA 4ZLTF 5HK3A 3RD4A 3K8AA 3UDXA 1U06A 3EROA 2M02A 2RK2A 3GF5A 3JCMh 2HCIA 5KYLA 1WNLA 4Z8AA 2F3IA 2AUJD 2XIWA 1X43A 3QZ9B 3GTKB 2VWFA 3JCMg 4A53A 5KIXA 5FJ8G 1WGSA 3T1YL 4XQ3A 3LGFA 4I7AA 2DXUA 4OELB 1HNZQ 1A15A 2QQ9A 3UF4A 3IL8A 2PPBC 1SJHD 1JBMA 1V76A 5KYNA 3G4SQ 4LFAQ 3NMZC 1VQNT 2JNGA 2ECZA 4C3IB 3KUFA 2JM9A 3H0HA 2JK8A 1M3AA 4RTUA 2EGCA 1ZA2B 2ZZDA 3EFOA 1LTTD 4FNFA 4DV2Q 2QDYB 5C3XA 4OB2B 1VQ8T 3G48A 4LFBQ 4KY6A 4JZ4A 1TS4A 4AFQC 1YITQ 1TIID 4WTOB 4JI0L 1QVGS 2H8HA 3I4NH 2PQWA 2VUBA 1HNWQ 4TRDA 2UUCL 3CBPA 3PO3H 1KIKA 4L5GA 3M3YB 1XNRQ 5JVH3 1QVFA 2I46A 2KOLA 1W1FA 2M2LA 1WOCA 2MQHA 4L5RC 1S5DD 4DV6Q 4A3LH 1M2VA 1XXGA 3ZL7C 2K03A 3OIPA 3S24A 4A3KG 1YWPA 4HJ7A 3A7LA 1ZA1B 3S1MB 4NMZA 2UU9Q 3BY7A 1Y57A 2RI2A 2JP1A 3TCJA 3V8KA 2V8KA 1Y8PB 2E3HA 2G3RA 3E0EA 4RWSC 4ZK9B 3E3XA 1VQ5Q 2R7ZH 2CWPA 1YWOA 1J6QA 3GQBA 3RLFA 4B3TL 4AFZC 1ARKA 4UP8A 4YWKA 5NUCA 3MPUB 1HCZA 4FYXB 3ASKA 1I1JA 3VYTA 1XMQL 3H09A 2VXFA 1CFMA 3KK7A 3HOVG 1YP5A 1NZ9A 1PFSA 4ME7A 3OBWA 3D0FA 4DA2A 1TKWB 3MEFA 5DM63 3U23A 3QO3A 2KT1A 3OYCA 3IFDA 4H44C 2EQUA 4UP9A 1ENAA 5KYIA 1I07A 1PHTA 2HZYA 3NBHA 4DNTB 3FB9A 2JN4A 5JVG3 1VCIA 2P4TA 4JI2Q 3UE1A 3U4VA 2FPEA 3CC7Q 1LTRD 3Q24A 1EQQA 4JI5Q 1KAAA 4JI3Q 4MMKA 1CKNB 5CKBA 2D6FA 2CHBD 2KHSA 2K3XA 4NPSA 2DM1A 1WJJA 2OQKA 2C0TA 3VS0A 3H0GB 2LQNA 2QA4T 2PZUA 3S1NB 2GNCA 3MTSA 2KRMA 2CP2A 4RG1A 4U673 1XMOL 5CKHA 2ZXOA 4MMLA 1WYXA 1EZZB 1OU8A 1YHBA 2HIVA 2WKCA 4HJAA 1KFZA 4C1NI 5GJVB 4XU0A 2JA7B 1BCPC 1PH5A 1LT3D 2F0FA 3SEMA 1ICFB 2B2YA 1SPKA 3S17B 5D3IB 1EYAA 3D4RA 5EG2A 4MIUA 1K73U 3MWYW 2QQBA 5C4XG 2QKIC 2VV5A 2OT2A 3HKZG 3S9WA 1SEMA 1ESFA 1TWFH 3KJPA 4LDVA 1J3TA 2P0QA 5KYYA 1B53A 3EG2A 4A3DB 1TS3A 1VQDA 4GLKA 3AQQA 2KE9A 1W2BA 2ZXPA 1WFQA 2VL6A 4PK4A 4PZ6A 3CCVT 4JI1Q 2IX0A 4F88A 4G7ZC 4FYDA 3P7JA 1EOTA 2KRSA 3QSUA 4JYAQ 2R93B 2D9TA 4M7AB 4XXEA 1HYOA 3SWNC 4OGCA 4Z89A 2DK3A 3ME9A 2KXCA 3RESA 2A1AA 2ICIA 5GROA 1WI5A 1T0HA 1SEBD 1STBA 2QYZA 4RUGA 1K76A 1VQOT 1VQKA 5J3BA 4JVZA 1FYNA 1VQ4T 4BS9A 3MKDA 2DBMA 3ICEA 3OYMA 4C3HH 2CFMA 1OYXA 1VQ9A 4XTYA 1S72A 1GXIE 3EFSA 3FLGA 4JDSA 4U68A 5IGFA 1VQBA 1TOVA 2ABLA 3EAEA 3HTRA 2MO1A 3M4PA 3OWFA 4HCSA 2HBWA 1DCZA 2X6LA 4IOCA 1BBZA 4D8KA 3QHSA 4OO1H 1JC7A 5E4WC 4X34A 1SNPA 2L3QA 2KENA 3S1QB 5FO9B 3HRUA 3V7RA 2F4VQ 2GA4B 4A4GA 3S16H 2CP6A 2CDTA 2FYKA 1FMKA 2NUPA 4DBRA 4LD9K 4M7DB 2FINB 1PD1A 1TTHB 2YTXA 5COYA 4DV4Q 1RF2D 1TWAB 2K5WA 4BY1G 4ZTFA 1HH2P 4A3IB 4QMGA 1NNXA 3L2ZA 1M1KC 4A93H 2BH2A 4XQNA 1AHJB 5LJ3f 1WTRA 2JA6H 2KCNA 4PLLA 2PU9B 1WCMB 2E6NA 1JQQA 4EMHA 4Z9CB 2PZTA 1VQKQ 2L5QA 5LJ3d 2KROA 3HRZC 3EG1A 4BI8B 5J22A 2UUBQ 2UXCL 3OY9A 4HJ5A 2P0KA 1MI2A 1KQ1A 4GKKQ 4XT3B 4DNRB 1EFID 1WJQA 2F0WA 1C7YA 2ROLA 3P8HA 1TU2B 3A8MB 3QBYA 3PVQA 4BDZA 1QVGP 1CZWA 2E2DC 2F0NA 1I3QB 3KUPA 4M75B 3MEHA 3PUVA 5ELNA 4LW1A 4RHRA 3JCMb 1G83A 1PRTD 5CCAA 3FEWX 3I35A 2XU8A 2AHOB 3J7AV 1R77A 1RAIB 5M3MB 3K58A 4RMOA 1E3PA 5CV4A 3STBC 1AT1B 3JB9D 1QUQA 3NWTA 3M7NA 4KKSA 4C8QC 1SAPA 1SYBA 1WHMA 2KY9A 2K5DA 1E2WA 2M00A 3L9AX 2VZAA 1BI2A 3JAMi 4RKBA 1DYQA 2HSPA 3FMCA 5EKIA 5JJLA 4FYYB 2NUZA 4JUVA 4JJBA 1XWEA 2KHIA 3E6ZX 1U0LA 3M4GA 2EDGA 1Y8OB 2VUMB 2EPDA 1KRSA 3EHQA 5LJ5h 2A6EC 3EIVA 3T4AC 4A3MB 2E8GA 1HFNA 4IIMA 5LJ5g 2JS2A 3IRBA 2QK0A 1JE5A 3V7CA 1BXTA 2HQHA 2XWBB 4J5YA 5M9OA 4TSSA 5G3LD 3TDQA 3RBBB 5GMKi 4F7XA 5LL6X 2CSIA 1PTOB 2NBFA 5CKEA 2IPKD 1NLPC 5JOBA 1RTNA 2EIFA 4BY7G 5KYXB 2R57A 4CBVA 1SROA 3PGGA 3L7ZC 2BZ8A 3X20B 3JCMX 4L5SA 1G291 1I50H 1TWGH 4C8QD 3OA6A 3R6OA 2A6HC 2EYLA 5ELDA 2A73B 4RCCA 2NZOA 5I11A 5FO7B 1Z47A 3SWNA 1M1FA 1KC8C 2A69C 1J5EQ 3VU3C 2JYOA 1LTID 3GP7A 4WFN3 1BCPF 1I6HB 1X69A 2ZPEB 4ZAIA 4DV1Q 4BD3A 1WA7A 2VW9A 2I5LX 2NVYB 2PVOB 1WQWA 2CKKA 1KIXA 3K5OA 2L1BA 5K5PA 1WHGA 1AZGB 1UGPB 2D2CC 2D1XA 1X6GA 2EBPA 3HOWG 2X3WD 1NMGA 1KDAA 4A4HA 2JM8A 5CO7A 2I0NA 1GKHA 4R0KA 1IHWA 3LX0A 1CKOA 2YUNA 4OMOA 1C4QA 2QCPX 4UAIA 4FF1A 4GKJL 1LNXA 4B08A 2QTXA 1FD7D 4JBKA 1OZ2A 2C06A 3GD7A 1GFCA 5M5WB 3T9NA 1Q3LA 4RCBA 1U5SA 1YJ9T 3M4QA 1WJRA 3GDEA 1YJNA 3EGDA 1VIEA 1EY5A 4RHSA 4YCVA 3L3OC 1N34Q 4KHPQ 5FU7B 1UJYA 1Y0MA 4MDWA 1NLOC 1N8RC 1IW7D 4F16A 1ZBJA 2RPNA 1V1PA 4B3MQ 1E6HA 4OMLA 1FNWA 2F0LA 4RGNA 4AIMA 4FU6A 3K5LA 4IFDI 3H41A 5CKDA 3O13A 1VQ6A 2FMMA 2B63B 3MXNA 2E41A 2VASA 1HTPA 2BCOA 3TU4K 4LN2A 1HFGA 2WAQB 1CM9A 3GTOH 1IYJB 1YNJC 4KHZA 3RR5A 2K3BA 1ZXTA 5FRMA 1SFOH 4RCOA 1VQ7T 3FJPA 5KYUB 3L2PA 1L0YB 1G3YA 3PO2H 2KSSA 5GANj 1AZQA 2I0QA 3LH0A 2G9HD 5C6AA 5C0XG 4F7UG 3CC4A 1KD1C 4OHJA 4OX9Q 3G71A 1Q81R 4R8IA 1IB8A 1JT8A 2DERA 1TS5A 1ENCA 4ZNXA 3WOEA 1RIPA 5C6SA 5EPJA 4C8QA 2HL5C 1ZSZB 1YJNQ 4AG1C 2HCKA 1GBRA 2RHZA 1E2ZA 2DY8A 3S2DB 3LW5E 3OTOQ 5KYWA 2Q2UA 2L55A 4Y52H 1VUBA 5GMKl 4X3UA 1O7YA 3GTMH 1VQMA 4M78G 5C4JB 1TWCH 1MSHA 4NXNQ 1KSWA 4QCLA 2ED1A 1CT1D 2XDDA 1XX8A 4IPCA 4APVA 4AFSC 1TG0A 3CCEA 3CCUT 1U8RA 5CBEE 1SHFA 1RI0A 4XAXB 1YJWA 1F9RA 2I5MX 3CXCP 1H9SB 4ZGEB 1STHA 3L2VA 4C2MB 4NOYA 3VDYA 2KYMA 5GQOA 1HXDA 4GN5A 2K3YA 4GLMA 3OSOA 2L3PA 3G6ET 5ISRA 5C3EB 2EYMA 1MGSA 2AKLA 2EYXA 3LGLA 3S6WA 1IXRA 4B3RL 4JW0A 4DXFA 4F14A 1QZGA 4C8QF 2K5HA 1SN8A 1RHPA 2OCEA 2D9UA 5BR8L 1W6XA 2ID0A 2RM4A 4QVCA 2KQ3A 4CKBA 4LFCQ 1HJDA 1STAA 2EFIA 3A8JE 1QCBD 4DK0A 3F2DA 2B2VA 4F8MA 5E3FA 1AH9A 1YHQT 2R92H 5EAYA 3LH5A 4IURA 2YYZA 2LQWA 1PZKD 2RQXA 1IO6A 2XKOC 3JC66 2PW5A 4IUNA 2AZVA 1PG5B 3CPWP 3JV3A 4E7LA 4L59A 1TUGB 4EQ5A 5GAN3 3A7AB 4R4TA 2QI2A 3JAMc 1QVCA 4BBSH 1KTKA 3GTKH 5KNBA 4NB3A 2DXBA 5I2XA 2AHJB 3BDCA 2A3LA 1IBLQ 4X64Q 1WTXA 1TUCA 3F70A 2HUGA 2HAXA 3QOJA 1YJWQ 4HIOA 1SNCA 4M7AE 3M0UA 1OU9A 1JB7A 1H8KA 3GIBA 1N33L 3EG0A 4TKOB 4ZN3A 2O2LD 4ZRZA 4XTXA 3QPHA 5IY0A 4A3GG 4IPDA 2ATCB 4C92D 4FXGC 3BU2A 1GCQA 4A3KB 1GBQA 2LS01 3RZDB 2HSEB 2DA9A 2DETA 5C44G 1X3EA 4GNXC 1BF4A 1IBKQ 4RH6A 2QGGA 1STNA 4FSXA 2RA2A 1VQPA 3OW7A 1I4K1 1QCNA 2C35B 4RKLA 2KXDA 4LAAA 1HNZL 2O5JC 5EJWA 1W4SA 4WORA 3IKJA 1CSQA 1RUWA 4PKCC 4BE2A 2YUQA 3TEHB 5ELEA 2RDGA 4RMFA 4LFAL 1M3BA 2EQKA 1VF5C 4Y7NB 2F0VA 3HOVB 3FKIH 4ULLA 2DMOA 4JLIA 1O75A 2EJGA 1X65A 1YNND 1Q86C 1HUMA 2OQ0A 3QO2A 4NP5A 5I2YA 4DV2L 3DLMA 1M4ZA 2XHCA 1HPCA 2F52A 1YITT 2NTSA 3QIAA 2JA5G 1IKLA 1CI3M 2F0SA 1VQFA 1XPOA 4LFBL 4JZ3A 1PC0A 2O4XB 1QVGA 1R9TH 2WACA 1LT6D 4A3JG 5DAUA 4CHTB 1KHIA 2VGMA 4WJWA 4HN7A 4KD3A 1I8FA 1XNRL 1VYVA 2O31A 3BYYB 3LGJA 2X4WA 1M30A 1QKWA 2RF0A 4DV6L 4LUOA 4DUZQ 4M77D 2CWAA 3URYA 3HOZB 2DL7A 1EY0A 1EQVA 1MMDA 3PIOA 4UC4A 2F1LA 4OWTB 1U5KA 4KMUC 2DEUA 2UU9L 2L5TA 4ZCKA 2L2PA 2O01E 2DE0X 1VQ5T 3QOLA 4DKAC 4BY6B 1VQPQ 2JTEA 1QVFP 4AQYQ 2F2XA 2JMCA 3J80E 5DLOA 1RLQC 2OF1A 2ES2A 3DHQA 2EQJA 3A8KE 3H0GH 5KGUA 1PSFA 3CBOA 1RABB 4OL7A 3S1NH 4EPCA 3I90A 4IFDH 2AT1B 2DJGC 4J1MA 5C4XB 1XNQQ 1Q1EA 2D5DA 5K36G 1ZUYA 1NYGA 3J80L 3CCQT 2EWNA 3ZYYX 1OO9B 3BG3A 1Q12A 4ZUJA 3TP8A 1Z9ZA 3WWVA 3NPFA 2WB1E 1SLJA 4NXMQ 2JA7H 4QIWE 3CC7T 4K2KA 5HK0A 3VS7A 4C92A 4JI2L 3U9OA 3T56B 4JI5L 5FLMG 4JI3L 1MHNA 3AMUA 5EGTA 3X3NA 5IHKA 2DILA 3PIP3 1E0BA 5DM7R 3J81E 2VB2X 4Z88A 3ZBDA 2AQ1B 4A3DH 3M9BA 3BVGA 3E9IA 3I55Q 1A3VA 4CDEC 4KJOA 1XNIA 2YRVA 5GANf 1FX7A 1JXMA 2KJXA 2NN6I 4J9BA 4DR1Q 3VYUA 1YCYA 5M5XB 1TSFA 3QYHB 5GANd 4JC0A 4N8FA 2RDHA 1E6GA 2QAZA 5AJ3Q 5GANe 4PJOA 3DEPA 3NTKA 4C0FA 2EOTA 1ACMB 3SE0A 2WB1G 2GVBA 1NJIC 2EQSA 4HMIA 1QKXA 1SKUB 3META 5D6XA 1HSQA 1BCMA 2E76C 1KRTA 1BKBA 1EQRA 4M7AC 4JI1L 4GNXA 5CR3A 4BY1B 2MUYA 4JYAL 1QP3A 1SR3A 1AE3A 1ICWA 1N6AA 4M77A 5GMKm 2Z6KC 7AT1B 1AWJA 1DJ7B 5A0DA 3AU7A 1WFWA 3A8LB 4GLAC 2F03A 3ZEHA 1J8IA 3TBIB 1NBEB 3CMAA 4FXKC 4O5VA 3MP6A 2RCFA 1M8VA 2G5DA 2GGRA 3ER0A 2EY6A 3REAB 4RFBA 2RH2A 5C5MA 4MDXA 2E2IH 2ZJPA 1R4QB 3ONAB 2OAWA 2LCLA 4C1NK 5ELOA 3I3CA 2K14A 4YY3L 3X28B 2MNAA 5IAYA 2DNUA 3HFZB 1Y8NB 4X9DA 2Q2TA 1QVPA 4C3JH 3B6YA 3HFNA 5GAOm 4JG2A 3W1BA 2RF4A 4Y92A 2E6ZA 4C5GA 1Q7YC 2LRQA 4M7DC 4GOPA 2F4VL 2NWGA 4NL3A 3TQ7P 4JS4A 5H1SE 2RHQB 3HOVH 5KNCA 1I3QH 1IZ6A 2JTMA 2K33A 4DV4L 3E2UA 3KBGA 2A7YA 5DY9A 1Q46A 3TP6A 4DA4A 1MIUA 1B50A 2ESWA 2XVSA 5JAVA 3QDFA 3V2TA 1CSKA 2EYZA 1KDBA 1NG2A 5M3MH 3EVQA 3TQYA 1R8OB 1VQKT 1GFDA 2DEQA 4C56C 1H641 4XTVA 1WVLA 5AYFA 2NVXB 5IP9H 3R93A 2UUBL 2W0ZA 1KC8R 2VB6A 1QQJA 1M27C 3L2RA 5EPLA 2XGTA 1RAEB 3EGUA 4DAYA 2JA8G 4GKKL 5IYDH 4M75C 3CXCA 3HFOA 1B7YB 3CCRT 2AZSA 2F0JA 3KF8B 1EY6A 4LF9Q 1EL0A 4QF4A 2EVRA 3QXEB 3LLRA 4M7DD 1I6VC 1F2ZA 4ABNA 1HNXQ 5I22A 2EQIA 4RTVA 2RSNA 3OYAA 4JV5Q 1UUEA 5D7UA 4A3EH 1IRXA 2JXBA 3NTHA 1Y1WH 1AFPA 4KUDK 4RTYA 1D8LA 3PF4A 3WOFA 3VS6A 3I73A 3TS0A 3OYIA 5C4ZA 2FEIA 3SXHA 4TVRA 2FHTA 3PTAA 5CBAE 3CPWA 2F69A 2YWWA 2K32A 2CGHA 4DBHA 3HOWB 1ABOA 1GL5A 2IX3A 4LK1C 2KCCA 4NDXA 1X55A 2WSFE 3BW1A 1UFFA 2OI3A 4M75D 4ANJA 1PTOC 2Z4IA 3A54A 4ZN1A 3F8TA 1Q90A 3NXWA 3HOUH 1L1OA 3QB3A 4O0AA 3S2HB 5CMDA 4AFUC 4PL6A 4K0KQ 2A28A 4V2SA 4CDDC 1HZBA 2GBQA 3EGXA 1YN8A 4A76A 5ELFA 4DR7Q 4XT1B 4WJ3M 2WKDA 2BIVA 4P75A 4K5XA 1CA6A 2DTHA 1K73C 3HOXH 3CQZB 3PUZA 1PFMA 1SE8A 3EG9A 3C95A 1T9HA 5GAHC 1PH4A 1OPLA 3I4NG 2Z6KA 3PO3G 1ABQA 4CRIA 2GQVA 4OEMB 1V43A 2EGEA 1J5EL 1QWYA 1EFWA 2M0YA 2PZWA 1RCVD 4A3LG 2LT1A 5IGEA 3PVLA 4R8NA 2JW4A 4AYBG 1QWEA 2KAFA 3J81j 2V4DA 4DV1L 4DV3Q 2ENMA 2KT8A 2L8DA 4WCIA 3S1RB 4JOIC 3A74A 3TSSA 2EPBA 1VMPA 3QDRB 2NN6H 4E6RA 2E3IA 5IGCA 1G6PA 2YU9H 2FHDA 4M7AF 1BO0A 5LHY1 3RDVA 2GF7A 1V1CA 4E7SA 3DMUA 4F7UB 1AVZC 3KDFA 2DF6A 3OW2S 1NPPA 4M7DA 2MCNA 4QJFA 1U1TA 4J8OA 3QG1A 3P8BB 4BBRH 3NGPA 1WJSA 2JZ2A 1V9PA 4X62Q 1Q7YU 1FGUA 1I4HA 2KECA 2WINB 4ZUIA 1EY8A 1LABA 1N34L 4KHPL 1M90R 3ERSX 1CKAA 4M78B 3ITPA 2E70A 3QUIA 4K6DA 1VOMA 2DD5A 2ASBA 2GFUA 3MFYA 2PCFB 4P73A 3A8HB 2KBNA 4B3ML 4KD4A 4FVMA 1HZAA 2PO4A 4P72A 1Q8IA 4HVWA 1ZX6A 1MBYA 1CHPD 4B3SQ 2RB6A 3K7AH 2EYWA 1D3BA 1OXUA 3HOYH 1LTLA 3P8DA 2J06A 2AMCB 1D2BA 4HEDA 2V1QA 4L6V5 3Q1JA 2PQAB 4PV1C 4JPBW 4M75A 1VQIA 3TZUA 1S40A 3RZOB 2BDNA 4M7DF 1X6BA 1U4PA 1ZQ1A 2KHJA 4F04B 3EN2A 4OMPA 4CC3A 1WTQA 4ZYSA 3CD6A 2QW7A 5IT9c 1K0XA 3I4MG 2MWPA 5A2QE 1Q1BA 3FHWA 1PD0A 1I5LA 1I94Q 4OX9L 3VYGA 1HTLD 2IG0A 2LMCB 1ZUKA 3V8LA 1X3QA 2P5ZX 2Q8RE 3RLOA 2ZM6Q 2MK5A 1JB0E 3SD4A 3CCJA 1TT2A 4X66Q 5J26A 4HCKA 2CH4W 3VRZA 1FNUA 1SNMA 4CKEA 5E4XA 1IYUA 3M4YA 1YIJA 3HKZE 4J7FA 5A2QL 1LCKA 3OTOL 3MZ5A 3SEBA 5KH6A 4A63B 1GO3E 2JQOA 5FLXc 4NXNL 4A54A 2CP7A 2QGQA 3NQIA 4M75F 3H8ZA 2NYSA 1D1IA 2NVQB 4PJMA 1QG7A 5GMKh 3D8GA 4JBWA 2EJMA 1KHCA 1TQOA 1NM7A 3CCMA 4NW2A 1EY7A 5JPMC 4DGZA 2IW3A 3OOCA 4HIKA 5M5YB 1TY0A 1IBMQ 4XTCS 4C3HG 2X3XD 4N4IA 3KXTA 2QXFA 1AWWA 3JB9G 1B1ZA 2B2TA 2X4JA 5LMUQ 3L2QA 4L63B 1H3HA 3D3RA 5C44B 2RHYA 3OSVA 4IJHA 2PNRC 3NENA 2J6FA 3LWIA 1AD5A 3MEWA 2X4YA 3O8VA 1GD7A 4LFCL 3IFTA 1HUNA 4DV5Q 5F2DA 1RAHB 3CCJQ 1E7ZA 1SYFA 1ET9A 1X01A 1VQLA 3H0IA 5IXFA 5EC7A 5FU6B 2VY3A 4BDYA 1B2TA 3GV6A 1RKNA 4IZ8A 1PTOF 1Y07A 3ULLA 3IQLA 2DTIA 1UE9A 2LQ8A 1QCFA 2AKWB 4WRDA 1JJ2S 2UXDQ 3C46A 4JOIA 3SGIA 4FO2A 5IGDA 4A93G 2A0FB 1SXTA 2JA5B 2F2WA 3HKSA 1IBLL 2JA6G 4X64L 2E10A 3CCST 1KLUD 2ED0A 3BFMA 4UY8C 4AMCA 1Q95G 3S14B 4C8QG 2P84A 4DR2L 4N0AC 1Q81U 1BCPD 2QF7A 4IFDJ 1JU5C 1EUJA 2F0PA 4I65A 4C0GA 1YFNA 4EMGA 5I21A 3D4DA 3K7UC 1GM5A 3HPWA 5FWBA 3NTIA 4QKUA 4B9WA 2K1BA 2B2WC 5GAN8 2IWHA 1IBKL 4KH0B 3OS0A 4BE1A 1UEAB 4PJLA 2SNMA 3QZ5B 2F5KA 2F4IA 2QEXA 1K9MR 3MHBA 3Q0AA 4EMKC 1HZCA 1UGSB 4G7OC 4OB1B 2XMFA 3UI2A 4NS5A 2HDLA 1T5XD 1V1OA 1GVPA 3UDCA 3HOZH 3U58A 4E6IA 4BXXH 1VQAA 1Y7XA 1ILQA 1BI1A 2HHHQ 4KV6A 2VYTA 1AOJA 2MAMA 3AT1B 3CP0A 3BYTB 5BN5A 2RMOA 2PMZB 2LZ6B 3MFGA 4QB4A 1EYGA 1EFNA 1CKBA 3OYLA 4RG2A 2Z4HA 2HIXA 5JJIA 3PUXA 3TSZA 2DYBA 1PRMC 1VQ9Q 5LJ3e 3HP9A 3P75A 2FB7A 2YUPA 3PMTA 1S72Q 1PHJA 2XG8D 2OTJT 2CT3A 4R9WA 1PYSB 3GTPB 2AK5A 1IGQA 4K8IA 1NJIR 1S5BD 4RTTA 4BY6C 3EFOB 4JBJA 2QEXQ 4D6WA 4ZGJB 1PCXA 1X3GA 1JOQA 4AQYL 2DRKA 2H3EB 1CQVA 2C9OA 2Y0SG 3RN2A 2YXYA 5M3FB 1YI2T 3JAME 1X3FA 1Y1VH 2VC8A 2EGAA 4A3FH 4LF8Q 2J6OA 2MYSA 1M2VB 2KR3A 3E1SA 4HMJA 2WB1B 1XNQL 1I4PA 1BBWA 3MXUA 4QIWB 3QJ6A 1N9SA 1H92A 1AWXA 2YV5A 3JAML 1G3SA 2HQEA 4P71A 4DAPA 4GLVB 1K83B 1DGSA 4O6JA 4R4OA 4WF2A 2DX1A 5FWCA 2QTVA 1YVCA 4N4GA 1A6XA 2DLPA 3UT1A 1CQFA 3SVMA 5GAGC 4JI8Q 4DPGA 3J7ZC 1RODA 2K9GA 2DO3A 4GY5A 2ZPGB 1JO8A 2AWNA 4J9DA 3CCLA 3BVMA 2K5LA 8AT1B 1D6EC 3OB9A 3I55T 2E2HH 1BQQT 1PYBA 3STBD 2WSEE 2O9SA 2IPOB 4JI7Q 1RAFB 1R0BG 2FVUA 3NBHB 2DL8A 1STYA 3PF5A 1I5OB 1ASYA 3CW2C 1BIAA 3CBMA 1O9SA 4JI6Q 1Q82U 4DR1L 1YBYA 1X9NA 1MMNA 2FZKB 5GAMj 4OF1A 1TH7A 1WQ7A 4ID6A 3ULJA 5IWAQ 1N36Q 5AJ3L 1GUSA 2A6ED 3OMGA 4A4FA 2KBTA 4FW2A 4JJCA 1PMRA 3BDLA 5IHIA 4LE9A 1KAWA 2VNUD 3A8GB 4AG2C 2NB0A 1VQNA 4R4QA 2NZHA 1OEBA 3HEJA 3VR2A 3CC2A 4C0ZA 2B2WA 4XDXA 2BH8A 3PO2G 1A0IA 4KHVA 5CV7A 1Z6HA 1A8VA 5EBCA 3OS1A 2Z8LA 4KN4C 5LMNW 2FZCB 1EY4A 2V26A 5IP7H 1X3PA 1NY4A 4EMKA 1A63A 1O7IA 2B86A 2IJ0A 2ZPFB 5ECAA 3SK6A 2PNHA 4PLIA 4F7UE 2A6HD 4KKTA 1BBXC 4JRIA 2Q2IA 5KYYB 2HMAA 4PJOE 1JWMD 4BA1I 1LTSD 1T3LA 2A69D 4GN3B 4KN7C 2JA8B 1WHJA 1NE3A 2E75C 1UEBA 4XIGS 3GV3A 2QEJC 5IIFA 1WTPA 4C92G 4OMNA 2E2JH 2BZYA 4M78E 1B4OA 4JJNK 3M4OB 4C5EA 2A74C 2P0PA 1K0SA 4CJ1B 5CVIA 4C0DB 2O2OA 4FW1A 4M77E 3TRZA 2RQUA 2FJ2A 2EYFA 1EY9A 2JUFA 2P4RA 3ND9A 5IYBH 3GTJH 3CC2Q 3J7A5 1NEBA 3VR3A 2VQFQ 2DN8A 1B34A 2DIGA 4CDFC 3CPFA 1H9KA 4CGYB 1CSPA 4EQOA 1C8CA 2DXCA 2B2UC 2L11A 1WHKA 2R92G 4PJOG 5CV9A 2EZVA 1HR0W 1E7OA 3A5UA 3EBEA 4IO9A 4N8X1 1RAAB 1QWFA 4J8QA 1WD1A 2D8JA 1RJTA 4A4IA 4RGOS 4BBSG 2NUPB 2QA4A 3CAMA 4ME5A 1Y96A 4RGTA 1V29B 2YHTA 4HSVA 2X4XA 2Y90A 2D0OA 1LUZA 4UPAA 4LF9L 3MHXA 4GZYC 1C0MA 1G3TA 4M77G 3CKIB 2C0IA 3L2UA 1PH7A 4DEXA 1VQ6Q 1SYCA 1YNJD 2FXQA 4DR3Q 1HNXL 3I4NB 3S2HH 3EQLC 1EWIA 1HJPA 4XYOA 2K2VA 4JI4Q 3E0JA 1FWZA 4JV5L 4RTZA 4FCYA 1OV3A 4DR4Q 1A3TA 2HQXA 3MEUA 2B29A 4BA2I 4RTWA 2NUTA 4DXGA 4PFPA 1I4XA 3NFCA 1K3RA 4X9CA 1U4RA 5DNFA 4PNOA 1EIGA 3CC4Q 3G71Q 3CCVA 1SNDA 2R58A 3HRTA 1BI3A 2K6DA 1EEFD 2K7VA 2CUDA 2EE1A 1VQHA 1X32A 2XSCA 2CSQA 3KOJA 3MCAB 3TZDA 4DF7A 2OJ2A 1QUQB 3A55A 2VQEQ 4FF4A 3GTGH 3LYIA 1UHCA 1WI7A 3W2DA 2SEBD 2ZGWA 5LJ3g 2EJFC 2QA4Q 2CZ6B 4GBQA 1VQMQ 3A1PA 2AUKA 3FKIG 2DKGA 4G4KA 5IE8A 4PZ7A 1K3BC 2K5NA 3NK9A 4OGQC 1T5EA 2LXJA 1BK2A 1G51A 1VQOA 1QLYA 4DR7L 5KE3A 2MGSA 3NUCA 2SEMA 3PMIA 1VQ4A 1DJRD 3CCEQ 1ZEQX 1U3OA 4KJNA 1C48A 3VRYA 4EQNA 3OMCA 1GHJA 1FXXA 1RDPD 2RDFA 1MV3A 3NHNA 4ZTJA 5DEHA 5IGGA 4BACA 4C3IH 4Q5WA 2KI7A 4OWXB 3E9FA 4DR5Q 2E1HA 1BVSA 2LX9A 1VQEA 5BN3A 1K8GA 1I4QA 2CH4A 3F2UA 4A3BG 1E1OA 3Q6SA 2DPPB 4DV3L 1W2BS 3DB4A 4KTAA 1MV0B 4QVDA 2NTTA 3CCVQ 4YIJA 2M1HA 3M5AA 4OB0B 5GAOn 1KNAA 4DOWA 1KXLA 1YNXA 3M3YH 3TEEA 1VYUA 2JT4A 3CEYA 4H0LC 1PA6A 4POGA 1WPYA 4KGVB 3G4ST 1BOSA 2DY7A 4HTHA 5CGKA 1MGQA 3I4MB 4IFDG 1PH6A 1MNEA 3S1MH 1TWFB 3NE5B 2CS7A 2ZTCA 5CQYA 3UATA 3M59A 3OIQA 3M0RA 1VQ4Q 3KF6A 2H4OA 3RZOH 1OOTA 3CMEA 4N4HA 2RKSA 3DM3A 1S5FD 4M78C 4X62L 2CW0C 1G6ZA 4J83A 2QDLA 3JRZA 5IH2A 4QVZA 5GAMf 5FK9C 5E7NA 4EQPA 1HNWL 2PMZE 2QASA 3OYKA 2K5FA 3LWHA 2B2UA 3MP1A 4K11A 2C5CA 5GAMd 2NVTB 2EY1A 3BVZA 1EU4A 3I56A 2DNCA 2V8IA 4DQ2A 5CV6A 5GAMe 2CZ1B 3I4LA 2CUBA 4A3DG 1PRTB 4B3SL 1L0XB 2K75A 2LY7A 4X3KA 3T16A 2N8NA 1XPUA 1K8AU 1B3QA 3ND8A 3R8BA 1K0RA 4DBFA 4C3HB 4HA8A 1CZGA 1XPRA 1C1AA 5D3DA 1WZOA 1LOJA 2MHVA 1KQSS 3UDFA 4A3CH 3ZJYC 2GCXA 4XTZA 4ATOA 1H9MA 1S5CD 4MN3A 2HNIA 5C0MA 4N9PA 2YTVA 1PWTA 1PFBA 2RVLA 5IYCH 2K28A 1V1PB 1VQCA 1I94L 1IREB 2D0NA 4R56A 3OS2A 3HKZB 4R55A 2ZM6L 3CMEQ 2MPMA 4X66L 1WLPB 3KLSX 3MXNB 1TS9A 3S16B 2LT4A 1A0NB 4DK3C 2HDAA 1SSOA 2R5MA 5HY6A 4IUUA 2MP1A 2NYZD 1BUVT 3GTQB 2BA1A 4LWCA 4XYQA 5FOBB 3I9QA 3I7FA 3S17H 4A93B 3RKWA 4PNYA 2ALYB 2CQAA 2JA6B 2XDBA 3I56Q 1VA7A 3VYHB 1KDCA 4HR7B 2RO0A 3H3VI 1B9MA 1YNZA 1JE4A 4QQDA 2F2VA 3M0TA 4M7DG 4KKUA 4II1A 4PFOA 3JCMf 4C8QB 5IOCA 1IBML 2EYOA 1JEGA 2BZXA 3PE0A 2KVMA 4GS3A 3KYHC 3MJXA 3NSWA 2NUCA 3NWSA 1D1KA 4RAUC 5KYWB 3JCMd 1QILA 4KBMB 2EYHA 5CR2A 3HS0C 5LMUL 2R93H 3OYNA 5HGQA 3K5MA 1XTDA 4L5QA 2EW3A 2CKZB 2RJFA 3JCMJ 3L2WA 1M1KR 3BZDB 1M90U 1BU1A 2BKDN 3RMHA 4DV5L 2MMPA 3C0CA 4C3JG 4HCEA 2PTKA 2E5KA 5FU6C 3PIPA 5GAN4 3E9HA 2KEDA 4LNQA 4JRQA 2JJQA 1ZSGA 1EIFA 2YTYA 3C12A 3L0OA 1QCOA 3FDRA 5J39A 4M75G 1GRIA 3U50C 1PSEA 1O7ZA 5LJ5j 2RJCA 5HURA 2XDPA 3UA7A 1G91A 4PG3A 3H0FA 2UXDL 3OYYA 4RKUE 3D4WA 1YJ9A 4M1UB 1PDQA 5D6WA 3S1QH 4ILWA 2X51A 4E7KA 1PV4A 2HBPA 1OX9A 4PQXA 2B39A 3OPOA 5IP9G 3Q23A 2I07B 4KGZB 1CKMA 1YEZA 1ZYRC 3RUZA 3KLWA 4N9TA 4X6AH 4EDUA 1M3CA 1QB5D 1GUOA 5IYDG 2DJQA 1TWAH 3C2PA 4LUVA 2LVMA 2UUAQ 4E7ZA 1LT4D 3VA7A 4CC4B 4A3IH 2K52A 3T13A 3UPUA 1SYGA 3P1HA 1KQ2A 2E74C 5J1ZA 1DZ1A 4BB7A 4LDUA 2E64A 2COZA 1OQKA 5A0LA 1I50B 1B7TA 1TWGB 4IALA 1EIYB 1WCMH 2JE6I 4V190 1D1AA 1VQ7A 4VUBA 3PCOB 2X35A 2ZPBB 2Y0SB 1NR4A 1VS0A 3K81C 4M7AD 1M9SA 2HL3A 4A3EG 1Y1WG 4C5HA 2BE5C 4HIDA 1T3SA 1MHWC 3TSWA 3GTPH 3AFPA 4F7UF 4HCBA 4DOVA 2LTOA 3WXMB 2L15A 2YRCA 1SMYC 1B9NA 2VB3X 2HHHL 3QWNA 4DR6Q 1ZYRD 4X3TA 1JXOA 4O42A 2RJEA 3IAYA 1STEA 2XRQD 5M3FH 4DV0Q 3A8IE 3CMAQ 4M78F 3SR1A 2LJ0A 4H7BA 1D0XA 3D7SB 4B9XA 3HOUG 1VQ9T 1A3UA 2R7DA 1S72T 2CT4A 2IX1A 3CCUA 3DWAA 4MZTA 2HD3A 4BY7B 1EEID 5GAN2 3VR5A 4OMQA 1BNZA 2QILA 3VA5A 1KL9A 2VUMH 2RQVA 4A3MH 4OXPA 2Z6BA 4LUZA 1ILPA 2FL7A 1K83H 1N32Q 1OXSC 4ZQ3A 3HOXG 4B6MA 1GUWA 3NEMA 4FL6A 1LT5D 1CKNA 5I2SA 2ZT9C 2L89A 3VS4A 1YZ6A 2LNHB 2O9VA 3UA6A 1PTOH 3INZA 2K79A 2FMCA 5KRUA 3TS2A 3OHXC 1U4LA 1AP0A 2FPFA 2VXEA 4MZ9A 2A8VA 2Q8IB 1KQSP 1SSHA 4HKEA 1YHQA 2QDBA 4LF8L 4Q0FA 1UGQB 2D0PA 3GTOB 2WFWA 5L37A 4AYBE 3D31A 1SFOB 2CZ0B 4A75A 1CK1A 3U4ZA 2DXTA 1ML0D 1N8RR 1GUTA 5JJKA 2K50A 3M56A 3PO2B 1NPRA 5TSSA 1UECA 3O5ZA 1K9MU 1OX8A 3CCUQ 4UDUC 1I6HH 1F2MA 4JI8L 3SK8A 4DNIA 5JEAH 2UXBQ 1F1BB 2NVYH 3QWYA 4IIOA 4BE0A 2BE9B 4BBRG 1T0JA 1JB3A 2JMAA 3VKIA 4RGMA 1NE8A 2GQIA 2CZ7B 4J6WA 2OTLA 4M7AA 4ME3A 4JI7L 3GTMB 3WDNA 1TWCB 3DWQA 5C0XJ 2F0TA 1YCSB 3EH1A 4DK6C 5LMNQ 3RLNA 4FT4A 4C92B 4OMFB 2BDOA 2RHUA 2LJ3A 4JK1C 4JI6L 1G5VA 3FEOA 5HKCA 2YRDA 3HRSA 1KD1R 5IWAL 5M5WH 1WD0A 1N36L 1NCVA 3H3VH 3J80c 2RQRA 3HOYG 4IUVA 3A0JA 3VR6A 4M4ZA 1VMCA 3JB9I 1PTOD 3G7LA 2KEAA 4K14A 1WTVA 2L0CA 1QNUA 2RQTA 3NPPA 3TP7A 4OWWB 4ALPA 2R7ZG 2A36A 4KRTA 4LF4Q 3DLLA 1Q81C 3M57A 5AT1B 1EZ6A 1JOKA 1N33Q 5GAN5 2R7FA 2B63H 2R92B 1RACB 1F9PA 2MO0A 4PJOB 4O1NA 3H3VC 4TVAB 5GAEC 1D7QA 2J05A 4R4CA 2RHIA 1I4RA 4JCVE 2R5AA 1I81A 3A56A 3DXJC 3VYRA 4XQJA 5FKAC 2DVEA 4QY7A 4J9EA 5FU7C 2OTLQ 1JJCB 3GPLA 2EQMA 2QGFB 1DM0B 1PH9A 2MI6A 4BBSB 4DEYA 1LPLA 1IXDA 3J81c 5EQ0A 1RADB 2C0OA 2DIQA 4GNXB 2O88A 4LDXA 1QZHA 4Z02A 3PGZA 3LNNA 5GANh 4CC2A 4M77B 1VQ5A 1GUGA 4C0DC 3EHRA 5GANg 1HR0Q 2N88A 1E2VA 1K8MA 1F2LA 2DD4A 1E22A 2DZCA 5BN4A 1G2TA 3CC2T 3S2DH 5LJ5f 2WIIB 2SOBA 1X6OA 2JTFA 3TP5A 5C4JH 2JN0A 4HVUA 4QUCA 2B8AA 3JCMV 3W5OA 4E7HA 1HQRD 5LJ5d 4OONA 4RA8A 4Y28E 4IN3A 4EGVA 2VQFL 3K0XA 3CCQA 2W10A 4RTXA 1HZ9A 2ZJQA 5LJ5e 3H6MA 1TR5A 3V8JA 3VUZA 2GFAA 1TWHB 1M4VA 3E9GA 3JCMW 2VS1A 1S4ZA 4C2MH 1O78A 3CC7A 3MO8A 1ZSZC 1GXDC 4EX5A 1YJNT 5C3EH 2R61A 1XTCD 4F17A 1TVXA 4K5VA 4LMQD 3AB9A 3VR4A 4KGXB 3N52A 5GJWB 4GOPB 3MVVA 3CF5A 3FP9A 5FO8B 2FG0A 3D6WA 2LDMA 3FKIB 4JS5A 3S3NA 1SJED 3HP3A 2L0AA 1GJXA 3GBQA 1R4PB 3F1ZA 3ERQA 3RNJA 5FJ8H 1QJOA 5I2MA 1VQ6T 2K5IA 2RQWA 3DEOA 3T53B 1JR0D 5A35A 1R9TB 1LACA 2ZXRA 4DR3L 3URGA 3CRLC 2EY5A 2KUMA 2DAQA 4JLGA 3J7AF 5KYXA 3T1HQ 4JI4L 4ESRA 2YDLA 2YLBA 3UWNA 1KABA 5I9PA 4A3GB 1QOHA 3M54A 3TREA 2F0UA 2SRCA 3VS3A 4PMWA 4JBMA 4DR4L 1PXUA 4E47A 4EIKA 4LDWA 2L9HA 4DAYB 1EYCA 5L23A 4C8QE 3CCQQ 5E1FA 1FL0A 2OWOA 4A3BB 3CD6Q 2I2LA 3GP8A 3TMEA 3CC4T 1Q86R 3BE3A 3G71T 3SK4A 2XICA 4KY7A 2IVWA 1LM0A 4OO1G 3FPUB 2GN5A 4DBQA 1FGBD 5KCHA 1KJWA 1SE4A 3PUWA 2F0OA 1XOVA 2QQRA 1PKTA 3NBIA 3EFRA 2VQEL 2CCZA 1VQMT 1YIJQ 3HOZG 3X3MA 4A3KH 4BXXG 3RZDH 5CAIA 1DOLA 2EXDA 1Q82C 1MMGA 2KQWA 1BBUA 4J15A 2ZAEA 3CCET 3RKXA 3OYEA 3FRPB 3NQTA 1YJWT 2COYA 2F0IA 4P2CB 4HSPA 5CV8A 2OX7A 2K5QA 4GLXA 3VJPA 4X65Q 1VF7A 3CCMQ 1SHGA 4A3JB 1FJGQ 3I4MH 1XJWB 1GHKA 2PI2A 2DL5A 3W1GA 3AEVA 4LXCA 1D0YA 3K6OA 2ZTDA 4Y7NH 5CQXA 1HXYD 2L3SA 3R2IA 3K0YA 1AWOA 1PM3A 1WXUA 1L1OB 3I91A 4P74A 4DR5L 4LF5Q 1SBBB 3F2CA 3DKMA 2K4YA 3EGXB 1B44D 3I8ZA 2B3GA 1M2OA 2EYQA 4BI4A 1AZEA 1UG1A 3GNFB 1BR9A 1F2YA 3JCMP 3PFSA 2KDSA 2F3VA 3I70A 1UAPA 1SRUA 2F0EA 2H5XA 5C5LA 2J4XA 2ZPHB 2RCNA 3EG9B 4A4KA 1VQLQ 2KEEA 1Y1VG 3BJUA 1SRLA 1EOVA 3SHLA 2NVTH 1KG1A 1M5Q1 1STGA 4XU2A 2XIDA 1I0CA 2Y0SE 3OWEB 3D6CA 4A3FG 2DBKA 3SFMA 1RAGB 2MJ8A 2PQEA 3DB3A 1FNVA 1XYIA 2X6GA 2Z0SA 1ZUUA 1L2FA 3NP8A 4CDCC 3M53A 2PW7A 5CYUA 3RIRA 9ATCB 2HKQB 3JB9H 2RNAA 3I5RA 4OP0A 2F1MA 5KEEA 5KYUA 3QKJA 1HRJA 2KA7A 1SSFA 3OW2P 1OXTA 4ZGDB 3CCRA 1G8ZD 4FYWB 4H13C 1ZKOA 3VV0A 2K04A 1Z7TA 2K5VA 3QR8A 4CKCA 2Z1CA 1NTGA 3PNWC 4O2DA 4ZKBB 5C4XH 1ZSZA 1PRTC 1F77A 3RUXA 3KDFB 4DUYQ 2VGNA 3RMQA 1EIHA 2LX7A 4KUIA 4AT1B 4DUZL 2E12A 2J7IA 2PNIA 1X2QA 4KULA 4YCUA 2OAUA 5IN1A 1VQPT 1TY2A 2E2IB 1M8MA 1CTMA 2EAYA 2L12A 1KLGD 3GTQH 1KQSA 1D09B 3V05A 1C9OA 3REBB 3CU7A 2DVJA 2M16A 1K28A 1LVKA 1UB4A 1H95A 1JWSD 1H9SA 1O80A 2GTJA 1M8AA 2GTOA 1BCOA 1LTBD 5CKFA 4QQGA 1EYDA 2LJ1A 3MP8A 1BDOA 4V0BA 4XQQA 4C3JB 3CMET 1L0WA 3CQTA 1SE2A 1D5XC 4DV7Q 4XTUA 4DAMA 3H91A 4K8JA 4HCCA 4IUPA 1D3BB 4HIMA 2LNVA 4HJ8A 3CXCS 4LF7Q 3G6JB 2G6FX 3L42A 1KK7A 2MIOA 4FM4B 4X1VA 3CCRQ 5M5XH 3CRKC 4NXML 2MFIA 4EVOA 1R0CB 2CP0A 5C0XI 4FT2A 3I56T 5IP7G 1ZBXA 2HD0A 3G6EA 5JEAJ 2FZGB 4WJ4A 2F0GA 4J9GA 3U9SA 2Q2HA 4KLKA 1BB9A 1IHZA 4KH1B 4DAVA 2OXPA 4K5WA 4YTLA 2XTIA 3A8OB 1F9QA 1PZID 1JWUD 4XU1A 1Q7YR 3WVDB 3BZCA 5IHNA 4FDBA 4POFA 1N9RA 1K9AA 3VUBA 4BY1H 3G1JA 2O5IC 2PVDB 3SHWA 3CPWS 2RK1A 2JVVA 1U9RA 1ZLMA 3BDUA 4LD6A 1A2UA 4J9CA 1ONLA 1Z9FA 3FC3A 4LUDA 1OPKA 2BOSA 2EKOA 2J0TD 2A5HA 1PH8A 4YHHQ 1WXBA 4C92E 1X56A 2JEAI 5GAN7 3E19A 1Q8KA 2Z0WA 1UGRB 1PLFA 2GVAA 2E5LQ 3K57A 4N0AA 4A3EB 1QW1A 4LF6Q 1C6VX 2DFUA 3FRNA 3BDOA 3UDIA 5IYBG 1PKSA 1Y1WB 4CC7A 4QQBX 2A08A 2B8FA 1UDLA 1W6KA 4QUFA 2AIRB 2MWOA 3MEVA 2AWOA 1IKMA 1WIEA 3QWXX 3NELA 2M0OA 2RHXA 2EXZA 2ATWA 5EBDA 1V1QA 3GTLB 3G6EQ 1IL8A 2DUDA 2EVBA 1D1CA 1RLPC 2B2VC 1VQ8A 5I9OA 3S15B 4PFZA 5ELBA 4HVVA 3CCLQ 5DM73 5FW9A 2BA0A 1IW7C 3G7ZA 1D0ZA 4JJDA 4DN4M 1PRLC 1JJ2P 1SNOA 3HOUB 4PZ8A 2RN8A 4L8JA 1LLRD 1AW7A 4LUEA 1D1BA 4C5IA 3FPPA 4F87A 2HEQA 2N78A 1HHVA 4K6LA 5CORA 2V8JA 2XRSD 4FP5D 2UUAL 3RERA 1S3OA 4IOAA 1AN8A 1PYWD 4PJJA 3T1YQ 2O4XA 3H6ZA 2XD0A 3THKA 3HOXB 2CP3A 3FVQA 3BZKA 3M55A 3KBXA 2IHEA 1WTOA 1H9RA 2NVXH 1UHFA 1NUCA 2LQKA 3I2ZA 4KI0A 1S5ED 3C1EA 1JMCA 4BY7H 4PJNA 4HT8A 1I4GA 1LYLA 1VQNQ 3R3OA 1K8OA 1ZHIA 1GCQC 3C1FA 1MUZA 1OI1A 2LKVA 3V7SA 1RD9D 2KK4A 4YCWA 3MAQA 1JORA 2LFNA 1UWVA 1VQ8Q 1CUKA 3H94A 4JI0Q 4DR6L 3C94A 1D5MC 1F9SA 4I7ZC 3PMFA 2E5QA 4LDYA 3CMAT 1K73R 2JEBI 2UUCQ 5FRNA 4DV0L 4OB3B 1K8AC 4KK7A 2YU9B 1M1KU 1QVFS 4G57A 1Y71A 3E5SA 1WTHA 4G7HC 2F0MA 4GN4B 1NEGA 1VQGA 1BIBA 1DOKA 1AZPA 2EJGC 2KCMA 2WP8J 2V1RA 4R1JA 1PVOA 3OS5A 2F0DA 4KT0E 4JRPA 4P5NA 5DLQE 4J9HA 1PRTF 1Z9QA 4BBRB 4DU9A 3AHUA 2F0KA 4DFAA 3KFVA 3HOWH 1N32L 4FIBA 1WTWA 4B3TQ 1X75C 3JCMc 4YY3Q 4IPGA 3JB9F 1XMQQ 4MZPA 3FDTA 5CC4A 4C3IG 3PO3B 2KNBB 3MA2B 3TVTA 4NL2A 4J6XA 2KVQG 1RI9A 1H9JA 2F5TX 3FJ5A 4E7JA 3K7AB 3PQIA 1UE1A 4AYBB 1CHQD 4YWLA 2R3ZA 3HOYB 4OVAA 4J7IA 4R4IA 3CQZH 1AEXA 1G2BA 3VS1A 2Z9HA 4FXDA 3M7GA 4YWMA 4JRKA 2VXWA 5KE2A 5G3LF 3HSBA 2R7ZB 3KJOA 1IHVA 1SE3A 2K01A 1AEYA 5LJ3h 3ULPA 1NBWA 1J9OA 3OYFA 2J7ZA 3QIIA 3HZXA 2PVGB 2RI3A 2LMJA 1JQYD 3CCSA 3LWUA 4K0KL 2UXBL 2IL8A 3S1RH 3OYDA 3OBYA 4J6HA 2EYYA 6AT1B 1OZ3A 1M90C 2R6GA 3PSIA 3PUYA 2OEOA 1SMXA 1MMAA 2NWMA 2RBMA 1G2SA 3Q22A 4C92C 5GAOl 3T51B 1UJ0A 5GMKj 4IPHA 1EQTA 4CJ2C 1BCPB 4PMCA 3M85A 5C0XH 5LMNL 8ATCB 2AQ3B 2TMPA 1UGVA 2AQ2B 2J6KA 2ZCFB 2N3SA 4LJZC 5I6WA 2JXMB 1XMOQ 1KC8U 5JPNC 4KY5A 1LV9A 1SG5A 3X25B 2FFKB 3P20A 1B07A 1FR3A 1U1SA 2QQSA 1KNEA 5D14A 3F2BA 4A3CG 1LTGD 3H9NA 2CREA 3QJYA 1AE2A 3M0PA 1LTAD 1HD3A 1PH1A 1JICA 4LF4L 1SRMA 2G9DA 5GAOq 1YNNC 5IYCG 3H0GG 1HK9A 1GOZA 4PJOC 1P8LA 4ORZA 3SWNB 1VDZA 3GOXA 2EY2A 4NKLA 2VVKA 3CCSQ 3DWPA 3OW2A 5D65A 4DR2Q 5C4HA 1A62A 4A4EA 2DJFC 3JB9J 1VQOQ 2OTLT 4ODGA 4ZKCB 1UE7A 4MTKA 2ROTA 1XJVA 2NZ1D 3SK5A 2JA7G 2M9UA 2F3WA 2OTJA 3PT9A 1UE5A 1LO5D 4PMBA 2JA9A 2X9HA 1TWHH 4M77C 1K1ZA 3FIFA 3JCMQ 3HGBA 3NHHA 1ENFA 3M0QA 2Q8TA 1TUDA 3MXPA 1N8RU 2DYIA 2A68C 1VYTA 1HR0L 3S3OA 2N55A 4EMKB 2Y4YA 1V8QA 1K4US 5CIUA 3M9QA 1W6JA 2I5HA 1TXQA 1SDFA 1YI2A 1P92A 3KF8A 1B3AA 4OIKA 3PIO3 2DZ9A 3EGDB 4PJOD 2R93G 4M7AG 4M7DE 1G3WA 1RTOA 1PH2A 4IKFA 2XK0A 2K05A 2HKNA 1Q82R 1ESRA 2NVQH 4HCZA 3A98A 1MJCA 4BUGA 3GNGA 4IUTA 1S1NA 5M5YH 2UXCQ 5EKLA 4M78D 2BUDA 2CW0D 4IUQA 4GOPC 4A3GH 4RG8A 5JJZA 2KMTA 1JJGA 1HQMC 4FSSA 2LCSA 5KCOA 3I5SA 1GUNA 2RHSB 2E4HA 1KD1U 5EPKA 2M51A 2ZPIB 2A37A 2OTJQ 4A3BH 4XTWA 2JJ9A 5C44H 1IGUA 3EFXD 2K6AA 2A68D 3I55A 5IGBA 1B34B 5L8RE 4M75E 3BS1A 4FF2A 4HT9A 2A19A 2N49A 1TS2A 3UE0A 3LX7A 2KGTA 2M9VA 4CI0C 1PFNA 4UHVA 5CV5A 3J80i 1W70A 3C3LA 1YI2Q 3OYBA 1RL2A 3MC0B 3SDZA 4QL5A 3T1HL 1VQJA 1C0AA 2DJZA 2EJFA 3C4SA 1Y14B 2PUKB 2HQLA 5CK9A 3X24B 3CD6T 4A3IG 1N5ZA 1TXYA 1K9MC 2JA5H 4MNOA 2L3RA 1Y96B 3JCMe 3GO5A 3RKYA 1WCMG 5KNDA 1WYDA 4S3SA 1HA6A 2XNAC 3CCJT 4A3JH 4ELZC 3K5NA 4QGUA 3KFUA 3RR6A 3S14H 2RD1A 5HGTA 4RCNA 2CVRA 1Y1VB 1YIJT 2LSSA 4HXJA 4UP7A 3OYHA 1BYMA 4L6TB 1B70B 2XI9A 4A3FB 1NSNS 2DRMA 3M58A 1PNJA 3J81i 3KLRA 1JJ2A 2NUTB 3R2TA 2RJDA 1X27A 3JSCA 4K2LA 1TWBA 2ICEC 1WX6A 5HCKA 2D62A 2EYPA 2RA4A 1W3SA 5M3MG 3J81L 1PZJD 1HA5A 3CCMT 5M3FG 1XQHA 2EKHA 4X3SA 5GAN6 2QG9B 2VKNA 4D8DA 3AYHB 4F7UA 4X65L 1UUPA 4Q5VA 2IY5B 2WV6D 1FJGL 1L1OC 3WVEB 1MKHA 4C92F 1G8XA 2DTOA 2LC4A 2H3JA 2YSQA 1NAPA 4OIJA 2RI5A 1EZ8A 3N5BB 2ZJRA 5IT9E 1MJEA 3I4OA 4LF5L 5K36H 1Y69U 3TN2A 2VUMG 1P16A 3S3MA 4A3MG 2E2HB 4FF3A 2MPXC 4Y91A 2F0QA 4ELYC 1WDXA 1QMCA 4M78A 2CP5A 4DK1A 1ET6A 3PV0A 3OYJA 2DNEA 1YHAA 1VQLT 2LP5A 1GCPA 4M8AA 1NMFA 1U4MA 5IT9L 2PZ1A 1TU0B 3LWEA 5FLMH 2K2MA 4GKJQ 1W2BP 1N27A 2HDMA 4OMMA 1OULA 5T1IA 5FLXE 4QT7A 2LXKA 1OXXK 4XU3A 5IXBA 2QQAA 4TQUS 1WHHA 1II3A 2PQAA 4PJOF 2PI2E 1UTIA 4HJ9A 3HHTB 1JOOA 1CA5A 2HT1A 1YJ9Q 1EWCA 4HAEA 1ASZA 2BTTA 2LCCA 1DXMA 1I5FA 5ELCA 2XN9C 1X54A 4E2FB 2MOXA 2BE7D 2X69A 5FLXL 3UDGA 2FRYA 1Q86U 5AFWA 2K57A 3Q8DA 2IT1A 1FMVA 2B8GA 3DM1A 1NR2A 1FMWA 2JOYA 1OXVA 2DL3A 3GLXA 3VS2A 5GMKe 2AKKA 1SYEA 5EKKA 5C3WA 1JCKB 4M77F 5JEAG 3OQ5A 3ZFJA 3A5ZB 1JRIA 3VS5A 4DUYL 1EU3A 1WXTA 4XK8E 1O7LA 4IQZA 3K59A 5T1GA 2QEXT 1EWHA 1WHLA 5GADC 2NLUA 4QQ6A 2L4NA 2WAQE 3KF6B 1IYVA 2IIMA 3ULRB 3AFQA 3J7YW 1VQ7Q 5I4DA 2BE5D 4FYVB 2IHFA 1D5ZC 3EJIA 4MHEA 2PYKA 3MXGA 2E2JB 3RN5A 1FVIA 2KRNA 1SMYD 3I72A 2HCCA 2F0HA 2JS0A 5IODA 2SDFA 2JSOA 1E24A 1MSGA 2Y4XA 2H1EA 4DV7L 3OSSC 2COWA 1SYDA 3SB2A 3GTJB 1UE6A 3H15A 1BI0A 4LF7L 4CJ0B 1EX4A 1LJOA 3QYGB 2K7AA 1H3ZA 3VYSA 3RMSA 5GAOr 1X2KA 4J9FA 2NN6G 3HG9A 2PUOB 3KLSA 5GAOp 2TSSA 1MNDA 2CYZB 4J6YA 1FYCA 5FROA 3EA6A 3M0SA 3K80C 1PH3A 2B63G 5GAMh 2WSCE 2WAQG 3V96A 5GAMg 2YUOA 2KCTA 4B3RQ 1VIFA 2MF2A 2YLCA 2YT6A 3RNUA 1QP2A 2E65A 3CHBD 3MEAA 4J9IA 5BR8Q 3GTLH 2D0QB 1UNSA 4E7IA 3S15H 2DGYA 1M1GA 4IJLA 3EG3A 4MTNA 1IL2A 1NYFA 2ENBA 1DONA 3OYGA 4BWGB 1YHQQ 3W3AA 2D8HA 3HL8A 2XWJB 2SNSA 4YHHL 4OGEA 1MD2D 3L1AA 3X26B 4BI3A 2EJ9A 1K8AR 2CQOA 2K4KA 2E5LL 1N9WA 2RSOA 3R6NA 3G4SA 4L5TA 4LF6L 2FPDA 3EH2A 1SNQA 2JA8H 4H02A 2B2TC 1DD2A 2EYJA 1B8AA 1QE6A 5I6YA 3N6RA 2DL4A 5D6YA 5A0GA 4LNPA 4MZMA 1NJIU 5LL6S 2FO0A 4QW2A
chains in the Genus database with same CATH topology
1E1TA 4AH6A 4OO1I 3CCLT 2ZTEA 1YITA 2V1CC 3M4OH 5LJ3j 5C3EG 1OTCA 5HK3A 3K8AA 3UDXA 3GF5A 2RK2A 3JCMh 1WNLA 2F3IA 3QZ9B 3JCMg 4A53A 5FJ8G 3T1YL 1WGSA 4XQ3A 3LGFA 2DXUA 1HNZQ 2QQ9A 1JBMA 4LFAQ 1VQNT 2JNGA 3KUFA 2JK8A 2ZZDA 4DV2Q 2QDYB 4OB2B 1VQ8T 3G48A 4LFBQ 4JI0L 1QVGS 3I4NH 2PQWA 2VUBA 1HNWQ 2UUCL 3CBPA 3PO3H 4L5GA 1XNRQ 1QVFA 4L5RC 1WOCA 2MQHA 4DV6Q 4A3LH 4A3KG 3S24A 4HJ7A 2UU9Q 3BY7A 2RI2A 3TCJA 3V8KA 2V8KA 3E0EA 2G3RA 2R7ZH 2CWPA 1J6QA 3RLFA 4B3TL 4UP8A 4YWKA 4YY3L 4IFDJ 1XMQL 3ASKA 2VXFA 3HOVG 1PFSA 1NZ9A 3D0FA 4ME7A 3OBWA 3MEFA 3QO3A 3OYCA 4UP9A 2EQUA 3FB9A 1VCIA 2P4TA 4JI2Q 3UE1A 3U4VA 1EQQA 4JI5Q 4JI3Q 4MMKA 1CKNB 5CKBA 2D6FA 2K3XA 4NPSA 1WJJA 2OQKA 2QA4T 4RG1A 5CKHA 4MMLA 1YHBA 4HJAA 2HIVA 4XU0A 1PH5A 5EG2A 1K73U 2QQBA 5C4XG 3HKZG 2VV5A 3KJPA 1TWFH 4LDVA 2P0QA 3AQQA 1VQDA 4GLKA 1XMOL 1W2BA 1WFQA 2VL6A 4PZ6A 3CCVT 4JI1Q 2IX0A 3QSUA 4JYAQ 2D9TA 4M7AB 3SWNC 4OGCA 2DK3A 3ME9A 3RESA 2A1AA 5GROA 1WI5A 1VQOT 1VQKA 5J3BA 1VQ4T 3ICEA 3OYMA 4C3HH 2CFMA 1OYXA 1VQ9A 4XTYA 1S72A 1GXIE 3EFSA 3FLGA 4JDSA 1VQBA 3EAEA 2MO1A 3M4PA 4IOCA 3QHSA 4X34A 2KENA 3HRUA 3V7RA 2F4VQ 4A4GA 3S16H 2FYKA 4M7DB 4LD9K 4DV4Q 2YTXA 4BY1G 4ZTFA 1HH2P 3L2ZA 1M1KC 4A93H 2BH2A 1AHJB 5LJ3f 2JA6H 4PLLA 2PU9B 2E6NA 4EMHA 2L5QA 5LJ3d 2UUBQ 4BI8B 2UXCL 3OY9A 4HJ5A 2P0KA 1KQ1A 4GKKQ 1WJQA 1C7YA 3P8HA 3A8MB 3QBYA 4BDZA 4M75B 5ELNA 3PUVA 4LW1A 3JCMb 5CCAA 2XU8A 2AHOB 4RMOA 1E3PA 3STBC 3JB9D 1QUQA 4C8QC 2KY9A 2VZAA 1BI2A 3JAMi 5JJLA 4JUVA 2KHIA 1U0LA 3M4GA 1KRSA 3EIVA 5LJ5h 2E8GA 5LJ5g 3IRBA 1JE5A 3V7CA 4J5YA 5M9OA 5GMKi 5CKEA 4BY7G 2EIFA 2R57A 1SROA 3PGGA 3L7ZC 3X20B 4L5SA 3JCMX 1G291 1I50H 1TWGH 4C8QD 3OA6A 3R6OA 4RCCA 2NZOA 1Z47A 3SWNA 1M1FA 1KC8C 1J5EQ 3VU3C 2ZPEB 4DV1Q 4BD3A 2VW9A 2I5LX 2PVOB 1WQWA 2CKKA 1KIXA 1UGPB 3HOWG 1NMGA 4A4HA 5CO7A 1GKHA 1CKOA 4GKJL 1LNXA 2QTXA 4JBKA 1OZ2A 2C06A 3GD7A 3T9NA 4RCBA 1YJ9T 3M4QA 1WJRA 3GDEA 1YJNA 4YCVA 1VIEA 1N34Q 4KHPQ 5FU7B 4MDWA 1N8RC 4B3MQ 4AIMA 4FU6A 4IFDI 5CKDA 1VQ6A 2E41A 3TU4K 3GTOH 1IYJB 4KHZA 3RR5A 5FRMA 1SFOH 1VQ7T 3FJPA 3L2PA 1G3YA 3PO2H 2KSSA 5GANj 2I0QA 3LH0A 5C0XG 4F7UG 3CC4A 1KD1C 4OX9Q 3G71A 1JT8A 1RIPA 5C6SA 4C8QA 2RHZA 3LW5E 3OTOQ 2Q2UA 4Y52H 1VUBA 5GMKl 3GTMH 1VQMA 4M78G 1TWCH 4NXNQ 2XDDA 4IPCA 4APVA 3CCEA 3CCUT 1U8RA 1RI0A 4XAXB 1YJWA 2I5MX 4ZGEB 3L2VA 4NOYA 3VDYA 5GQOA 1HXDA 4GN5A 2K3YA 3LGLA 4B3RL 3S6WA 1IXRA 1QZGA 4C8QF 2K5HA 1SN8A 2OCEA 5BR8L 2ID0A 2RM4A 4QVCA 4LFCQ 2EFIA 3F2DA 1AH9A 1YHQT 2R92H 5EAYA 4IURA 2YYZA 2XKOC 3JC66 4E7LA 4L59A 4EQ5A 5GAN3 4R4TA 2QI2A 3JAMc 1QVCA 4BBSH 3GTKH 4NB3A 2DXBA 2AHJB 2A3LA 1IBLQ 4X64Q 3F70A 4HIOA 2HAXA 4M7AE 1JB7A 3GIBA 1N33L 4ZN3A 4XTXA 3QPHA 5IY0A 4A3GG 4IPDA 4C92D 3BU2A 5C44G 1X3EA 4GNXC 1IBKQ 4FSXA 2RA2A 1VQPA 1I4K1 2C35B 1HNZL 1W4SA 1CSQA 4PKCC 4BE2A 3TEHB 4RMFA 4LFAL 2EQKA 3FKIH 4JLIA 1O75A 2EJGA 1X65A 2OQ0A 1Q86C 4DV2L 3DLMA 1M4ZA 2XHCA 2F52A 2JA5G 1YITT 4LFBL 1XPOA 1VQFA 1R9TH 2O4XB 1QVGA 2WACA 4A3JG 1KHIA 2VGMA 1I8FA 1XNRL 3LGJA 2X4WA 4DV6L 4LUOA 4DUZQ 4M77D 2CWAA 3PIOA 4UC4A 4OWTB 1U5KA 2UU9L 4DKAC 2O01E 1VQ5T 4AQYQ 4BY6B 3J80E 5DLOA 2ES2A 2EQJA 3H0GH 1PSFA 3CBOA 3S1NH 4EPCA 1XNQQ 1Q1EA 5K36G 3CCQT 2EWNA 1Q12A 3WWVA 2WB1E 1SLJA 4NXMQ 2JA7H 4QIWE 3CC7T 5HK0A 4JI2L 4C92A 4JI5L 5FLMG 4JI3L 1MHNA 5DM7R 3J81E 3ZBDA 4A3DH 3M9BA 3E9IA 1XNIA 2YRVA 5GANf 1FX7A 2NN6I 4DR1Q 1YCYA 3QYHB 4JC0A 5GANd 5AJ3Q 5GANe 4PJOA 3NTKA 4C0FA 2WB1G 2GVBA 1NJIC 2EQSA 3META 5D6XA 1KRTA 1BKBA 1EQRA 4M7AC 4JI1L 4GNXA 4JYAL 1QP3A 1SR3A 1AE3A 2Z6KC 1N6AA 4M77A 5GMKm 1DJ7B 5A0DA 3A8LB 4GLAC 3ZEHA 3CMAA 4O5VA 3MP6A 1M8VA 3ER0A 2RH2A 4MDXA 2E2IH 2ZJPA 2LCLA 5ELOA 2K14A 3X28B 2MNAA 5IAYA 3HFZB 4X9DA 2Q2TA 1QVPA 4C3JH 3B6YA 3HFNA 5GAOm 4JG2A 3W1BA 2RF4A 2E6ZA 4C5GA 1Q7YC 2LRQA 4M7DC 4GOPA 2F4VL 5H1SE 4NL3A 4JS4A 2RHQB 1I3QH 1IZ6A 2JTMA 4DV4L 3KBGA 2A7YA 5DY9A 1Q46A 4DA4A 1MIUA 5M3MH 3TQYA 1R8OB 1VQKT 2DEQA 1H641 4XTVA 5AYFA 5IP9H 2UUBL 3L2RA 2XGTA 2JA8G 4GKKL 5IYDH 4M75C 3CXCA 3HFOA 1B7YB 3CCRT 3KF8B 4LF9Q 3QXEB 4M7DD 3LLRA 1HNXQ 3OYAA 4JV5Q 4A3EH 1Y1WH 3NTHA 4KUDK 1D8LA 3PF4A 3TS0A 3OYIA 4TVRA 3PTAA 3CPWA 2F69A 2CGHA 1X55A 2WSFE 3BW1A 4M75D 3F8TA 4ZN1A 3HOUH 1L1OA 4O0AA 4PL6A 4K0KQ 4V2SA 1HZBA 4A76A 4DR7Q 4WJ3M 2BIVA 4P75A 2DTHA 1K73C 3HOXH 3PUZA 1SE8A 1T9HA 3C95A 5GAHC 1PH4A 3I4NG 2Z6KA 3PO3G 4CRIA 2GQVA 1V43A 1J5EL 1EFWA 4A3LG 2LT1A 4AYBG 2KAFA 3J81j 4DV1L 4DV3Q 2L8DA 4JOIC 3A74A 3QDRB 1G6PA 2YU9H 2FHDA 4M7AF 2GF7A 4F7UB 3KDFA 3OW2S 1NPPA 4M7DA 4QJFA 1U1TA 4J8OA 3QG1A 3P8BB 4BBRH 1WJSA 2JZ2A 1V9PA 4X62Q 1Q7YU 1FGUA 1N34L 4KHPL 3ERSX 4M78B 2E70A 3QUIA 2DD5A 2ASBA 2GFUA 4P73A 3A8HB 2KBNA 4B3ML 4P72A 1HZAA 4B3SQ 2RB6A 3K7AH 1D3BA 1OXUA 3HOYH 1LTLA 3P8DA 2AMCB 4L6V5 3Q1JA 2PQAB 1S40A 1VQIA 4M75A 4M7DF 1ZQ1A 2KHJA 3EN2A 3CD6A 5IT9c 3I4MG 2MWPA 5A2QE 1Q1BA 3FHWA 1I5LA 1I94Q 4OX9L 3VYGA 3RLOA 2IG0A 3V8LA 2ZM6Q 1JB0E 3SD4A 3CCJA 4X66Q 5J26A 3M4YA 1YIJA 3HKZE 4J7FA 3OTOL 5KH6A 1GO3E 2JQOA 5FLXc 4NXNL 4A54A 2QGQA 4M75F 3H8ZA 5GMKh 4JBWA 1KHCA 3CCMA 4HIKA 1IBMQ 4XTCS