5DLQE

Crystal structure of rangtp-exportin 4-eif5a complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
136
Chain Sequence
ATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exportin-4
publication title Structure of the exportin Xpo4 in complex with RanGTP and the hypusine-containing translation factor eIF5A.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 22
structure length 136
sequence length 137
chains with identical sequence F
ec nomenclature
pdb deposition date 2015-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01287 eIF-5a Eukaryotic elongation factor 5A hypusine, DNA-binding OB fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5dlqE01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5dlqE02
3UDXA 4DR4L 4BA1I 1NE3A 1VQ6A 2IY5B 3A0JA 2WAQG 4QQDA 2HIXA 3CCJT 1AE2A 1UEBA 3HOVH 1B70B 2OWOA 1PA6A 4A3IH 1PH8A 5JJLA 4DV1Q 4GOPA 1HJPA 1Q1EA 1NZ9A 2KCTA 3J7ZC 1IXRA 1V43A 4GOPB 4TQUS 4DR1Q 1S72T 4KHPQ 1L2FA 4HIKA 4HIMA 3CD6T 5IWAL 4QIWE 4HJ8A 2MWOA 1Y1VG 3KF8B 3PIPA 2CFMA 4LF6L 1QVFA 4B3TQ 2A8VA 2JA8G 3CCVT 1L0WA 3HOYH 4O2DA 2WB1E 4LF5L 3M4OH 1UE6A 4GN3B 4XTCS 2CQOA 1VQ4T 2I5MX 4O0AA 1KQSS 1HZ9A 1BKBA 3CCQA 1TWHH 1VQHA 2JNGA 4DKAC 1OXSC 3CC4A 5C44H 1EYGA 1YBYA 1SE8A 4GOPC 3S14H 4DV2L 3PO3H 4BY7G 3J81c 4JI0L 3DB4A 1Q82U 2QA4A 4R4OA 4B3ML 5AJ3Q 1YEZA 4MTNA 1U5KA 4IPGA 4X62L 3M3YH 1XMQQ 4JOIA 1VQ5T 1Q12A 5JEAJ 3W5OA 3H3VH 2B3GA 4BY1G 1FGUA 2YU9H 1TWCH 3STBC 1JB7A 1N8RC 3L7ZC 3OYYA 2OTJA 2PNHA 3GO5A 3NENA 1RL2A 2WFWA 2D0OA 4DUZQ 3S1NH 3D0FA 1VQDA 3EBEA 3F2BA 4HJ7A 2R92H 2YV5A 1Q7YC 3M4PA 4P75A 2MI6A 1G291 2Z6KA 5M5XH 1CKMA 1IBML 4IOCA 3JAMi 2UUAQ 3HOWG 5K36G 1TWFH 2VZAA 5IE8A 4DV7L 4UY8C 5C4XH 2MO0A 2F4VQ 3PUXA 1YITT 4C3IH 4C3HH 2UXCQ 4JOIC 4HJ9A 1SSFA 1KAWA 1HNZQ 1M1KC 2IHFA 3K7AH 1X6OA 2JA7G 2ZJPA 4A93H 3CCLT 4JI2L 3UDIA 2IHEA 5FLMH 3SGIA 3TEHB 1HNXQ 3F2DA 1KL9A 2E70A 1J5EQ 3CW2C 4RG1A 1M90U 5IP7H 4JG2A 4WJ4A 4IPCA 3KBGA 2Z6KC 1CSPA 4JC0A 1Y1WH 5IYDH 3MEFA 2YTYA 3F2CA 5IP9H 1J6QA 1CKOA 4BBSG 1Q86U 1PH6A 1AH9A 3CPWS 5FLXc 4DPGA 2AKWB 4C2MH 2NN6I 4IFDJ 4R4QA 2OTLA 2CCZA 2R93H 3CMAT 3CMET 1T9HA 3G71T 4YCUA 4YWLA 3PUYA 5IYBG 5LMUQ 1QZGA 1KC8U 1KD1U 1K8AC 1X56A 1MJCA 3CCMT 1X3EA 3FHWA 2LQ8A 1N33Q 1IYJB 4JV5Q 1E24A 4UP7A 3J81j 4OX9Q 2VS1A 4UP8A 2RHQB 2VUMG 1JE5A 4BXXG 2UXBQ 1KRSA 4NXML 1ASYA 4LF4L 2NVQH 3U4ZA 3RLNA 1X55A 2LXJA 4A3CH 3JAMc 3AFQA 4AQYQ 2K4KA 1PVOA 4B3SQ 3K0XA 3I55A 3CP0A 3TRZA 3RN5A 1KXLA 4X66L 1UE5A 1XPRA 3HOUH 4DNIA 1YHAA 2F3IA 2OQ0A 2G3RA 3PV0A 2VQEQ 4JI1L 5IY0A 4A3FG 3PCOB 3A74A 2KHJA 2PQAA 1K73U 4P71A 3CPFA 4DUYL 4IOAA 2E2IH 3LGFA 2PQAB 1K3RA 2CKZB 2R7ZH 3GTOH 1JJ2S 3TS0A 3S2DH 1AE3A 4OWTB 1VQPT 4KLKA 2ZTEA 4GS3A 3HOXH 4LF8Q 3S16H 4P74A 1XPOA 3S17H 2JEAI 3MXNB 3S1QH 1NPRA 1K83H 1XMOQ 4AH6A 1IBLL 1VQMT 4DAMA 2JEBI 2LXKA 2E2HH 1YJWA 5C3EH 3OTOL 2QEXT 4A3BG 2UXDQ 2UU9Q 2D62A 1YIJA 3H0GG 2E2JH 3T1HQ 1DGSA 4A3KG 1X9NA 4LF7L 4ME3A 1QZHA 1NMFA 1VQ8A 3G48A 1OTCA 2Q2TA 1YHQA 4JBKA 3KDFA 3HOZG 1IBKQ 1O7IA 3PSIA 4JI3L 5FJ8G 3KDFB 4BBRG 4LWCA 1LM0A 2F52A 2NN6G 3K80C 3PO2H 3EIVA 3FKIG 2DO3A 2DUDA 1S3OA 3ZJYC 3A5ZB 1I50H 3CC7A 4QGUA 4A3EG 3ULPA 1VQOT 1PH5A 1PYBA 2Q2IA 1N32Q 1XNQL 4GKKQ 1KHIA 2EXDA 1G51A 4DV0L 4GLAC 4IJHA 3TQYA 3I4NH 3CF5A 4R4IA 4PZ6A 2RCNA 5J3BA 4DV3L 4DV5L 4DR6Q 3PUWA 1XPUA 1C7YA 4DR3Q 1XMQL 4HJ5A 2H5XA 3I4MG 3H3VI 2HHHL 4NXNQ 3KOJA 4BA2I 2K5HA 3RLFA 1OXXK 1HZCA 2YTVA 1P16A 1Y14B 2JA6H 1YI2A 2IX0A 4YWKA 1SN8A 4A3DG 1JT8A 3UDFA 4C3JH 1HR0W 1YJ9T 3CCRT 2WAQE 1W2BS 3GD7A 1IZ6A 4DAYB 3RNUA 1L1OA 1NJIU 1K9MU 3J80E 3CC2T 1FVIA 3AQQA 5HY6A 3I56T 1L1OB 1W3SA 1Y1VH 3U50C 2NZHA 4X64Q 2RF4A 5C0XG 3A5UA 1EFWA 2F4VL 2E8GA 2JA5G 2ASBA 1UE7A 1VQJA 1Z47A 2JA9A 2JJQA 4DV4L 2UUCL 1EIYB 1N34Q 4MNOA 2K52A 4JYAL 5M3FH 2ZM6Q 4A3JH 1VQLA 5BR8L 1A62A 1VQAA 3J7AF 3I7FA 4IFDI 4B3RL 1XNRQ 3M9BA 4R1JA 5M3MG 4DR7L 2B63G 4DR2Q 4PZ8A 3S2HH 4HJAA 1EOVA 1S40A 2XTIA 4LNQA 1BBWA 2N49A 4L5TA 1HR0Q 4OO1I 1L1OC 4GKJL 3PGZA 2BA0A 3KYHC 4BY1H 4K0KL 3G4SA 1JJCB 4YTLA 1YZ6A 1KQSA 2BA1A 4JI5Q 1FJGQ 2GVBA 4A4IA 1EWIA 4YHHL 1XTDA 3UE1A 1VQ7T 1VQKA 2EIFA 4UP9A 1PH2A 3RZOH 2E6ZA 2R7FA 2L3RA 2Q2HA 1NTGA 4LFAL 1N33L 2GVAA 1YJNT 3U58A 1Q7YU 2I0QA 3GTMH 3PIOA 1X3FA 4JI7L 1YHBA 3BZKA 3CCJA 2UUBQ 1I6HH 1PV4A 3DLLA 1N36L 2HT1A 3RN2A 2V1CC 1TWAH 4LF9L 1KIXA 5IAYA 3S1MH 2MO1A 1S72A 1M1KU 3CCET 2HQLA 4FDBA 2ID0A 3U4VA 2MFIA 2KBNA 4JI8L 3CD6A 5IWAQ 5IYCG 1PH9A 2Y0SG 1UE1A 2BH8A 2NVXH 3GTGH 1GKHA 5ELNA 3CCVA 3KLWA 4LUOA 5J26A 3BU2A 4POGA 2VQFL 4AIMA 1VQ4A 3CCST 2MNAA 4GNXA 1VQBA 2IT1A 2XGTA 1OXUA 2JE6I 1LUZA 3W1GA 3GTLH 4YY3L 4GNXB 1I3QH 1JJGA 4KHZA 1XMOL 3LH0A 5FLMG 4DV2Q 2N78A 4JI0Q 3TS2A 2VY3A 5JJKA 5DLQE 2UUAL 2JUFA 1SMXA 1QVGS 1WCMH 1PHJA 2IX1A 1E7ZA 2HIVA 1SR3A 4QQBX 2UU9L 3CXCS 1MKHA 1VQ5A 1PYSB 2VUMH 2JVVA 4BXXH 1VQNT 1E1TA 2NVYH 3M4QA 4JI6Q 3I2ZA 4GN4B 5LMNL 2K50A 4L5SA 1IBKL 3CPWA 4HIDA 4GNXC 5DM7R 2R93G 1YNXA 1UWVA 1KC8C 3CCUT 2A19A 2AWNA 4LFCL 1E22A 2CKKA 2KDSA 2MQHA 1D7QA 4JCVE 1IBMQ 3NBHB 1N32L 3WWVA 4XIGS 4X65L 3T1YQ 4DV7Q 4GKKL 2ALYB 4DV6L 4LFBL 1HNWQ 1YITA 2B29A 1Q46A 1NMGA 2KHIA 3OW2S 1PH1A 4A3CG 2MWPA 3IRBA 2R6GA 4DR6L 1VQ6T 3AYHB 3J80c 4JI4Q 4JBMA 2NZOA 2K75A 4JI2Q 4KI0A 1FL0A 5IT9E 1VQ9A 3Q8DA 4DV1L 3PF5A 1K73C 1GM5A 4A3LG 3ULJA 1C0AA 2LSSA 1C9OA 2R7DA 4DR1L 4KHPL 3S15H 4A3BH 2Z0SA 1YI2T 4Y7NH 3H0GH 1JJ2A 1WI5A 2E5LQ 4A3MG 1E1OA 2JK8A 3RR5A 4HIOA 3HOZH 5E7NA 4B3TL 4X64L 3NEMA 3J7A5 5GAGC 5FJ8H 4Y52H 3W1BA 2LCLA 2LVMA 1VQIA 4ZN1A 3M85A 3CMEA 3G71A 3VDYA 3FKIH 5M5WH 3CCQT 1Q1BA 1VQCA 1VQEA 3CCMA 1N34L 3CC4T 1X54A 1EUJA 1K0RA 1EIFA 4OXPA 1H95A 1VQLT 2CWAA 1B7YB 2QA4T 3H15A 5AJ3L 2RHSB 4LF4Q 4NXMQ 1XNRL 3NELA 3AFPA 2I5LX 1D8LA 4LW1A 2OCEA 4P73A 4PZ7A 3I4OA 4R4CA 1Q81U 1A8VA 3ULLA 5GADC 4DR2L 4YCVA 5GQOA 1PH7A 3KFUA 4TVRA 3JC66 1SRUA 4A3GG 2I5HA 4X66Q 3I4MH 1EQRA 4WJ3M 2QGQA 3KF6A 4JI1Q 3PUZA 3DB3A 2OTJT 1QVCA 4IPHA 4H02A 3GTKH 2IG0A 3KF6B 4JI5L 1FJGL 4IJLA 4DUZL 1A0IA 3FP9A 4A3DH 4OWWB 1B8AA 4PMWA 3S1RH 1VQPA 4POFA 4QY7A 5C4JH 4RG2A 1QVFS 2JQOA 2BH2A 3S24A 2JA8H 3HOVG 2UXCL 3CAMA 4A3IG 2JOYA 1I94Q 1VQMA 1IBLQ 2KENA 1MJEA 1HNZL 2ES2A 2JA5H 2UUBL 3PUVA 1PFSA 2JA6G 4LUVA 2QEXA 2WB1G 2K5VA 3OTOQ 4BY7H 2OQKA 1HNXL 2ATWA 1NJIC 1K9MC 3ER0A 1HH2P 4GLXA 1J5EL 4LF7Q 1W2BA 3GTQH 1VQGA 1CKNA 1VQFA 5M3MH 3KJPA 2B63H 3G6EA 4DR5Q 5C0XJ 3RLOA 3HOYG 1CKNB 5GROA 1PH3A 5JEAG 4JI3Q 4APVA 1SFOH 3P8BB 4DK3C 1NBWA 1WYDA 1U0LA 1GO3E 3LGJA 1VQOA 5C44G 5JJIA 1Q82C 1N8RU 5M3FG 4A3JG 4MZ9A 2VW9A 2OTLT 1XNQQ 3PO3G 3GTJH 3E9HA 5LMUL 4DV0Q 1M1GA 2L15A 1N9WA 4JV5L 1I5FA 5GAHC 3HOWH 4EX5A 1OXVA 1NPPA 4OX9L 1K8GA 4DV5Q 4DV3Q 4DR4Q 3K7UC 1TXYA 2UXBL 2NVTH 3ERSX 4PG3A 3L0OA 4IPDA 3K81C 4ALPA 1VS0A 4J15A 2HHHQ 2KCMA 4AQYL 1RIPA 3GDEA 3UDGA 4B3SL 4JI6L 3I55T 2PMZE 1X65A 1KRTA 2WP8J 1JMCA 2JA7H 4OONA 1EQQA 2R92G 4OWXB 2VQEL 2AHOB 1R9TH 1WFQA 1HZAA 1LTLA 5IT9c 1YJ9A 3CCRA 2K14A 3LGLA 4YWMA 3J80i 5C4XG 3E9IA 5IYCH 3CC2A 4LF6Q 3I56A 3GTPH 3T1YL 2AMCB 4GLVB 4LF5Q 5LL6S 1V1QA 3RZDH 3CQZH 3E0EA 3HKZG 4NPSA 4LF8L 4BBSH 5EAYA 1E3PA 1HNWL 2EQSA 1VCIA 5ELOA 4DV4Q 2UUCQ 4EQ5A 4A93G 4JYAQ 4ZN3A 4JI4L 2ZTDA 4CRIA 2Y0SE 4IFDG 5BR8Q 4QJFA 1M90C 3L2PA 5IYBH 1LYLA 2VL6A 3EN2A 4B3MQ 4B3RQ 1VQ9T 1YJWT 5IP7G 4DR7Q 2UXDL 4X62Q 2N3SA 1K8AU 1YIJT 1Y1WG 4OO1G 5IYDG 3T1HL 3HKZE 1Q86C 1CUKA 2FXQA 4GKJQ 1VQ8T 4L5QA 5IP9G 1YVCA 4X34A 1YHQT 2E5LL 4A75A 4K0KQ 1G6PA 1TWGH 4LUZA 3PF4A 5M5YH 2ZJQA 1NY4A 1KD1C 2ZTCA 3J81E 4YHHQ 1VQ7A 4A3FH 3CC7T 3HKSA 2PI2E 3ICEA 1PH4A 1P8LA 2ZJRA 4X6AH 1WCMG 4NB3A 4LFAQ 1QVGA 2YYZA 1XJVA 1YJNA 5H1SE 4UPAA 4YCWA 3CXCA 1GVPA 1IL2A 1BBUA 4RMFA 4JI7Q 3F1ZA 1SLJA 2A1AA 3AEVA 1X3GA 4R4TA 4DR3L 1N36Q 3CCLA 3HOUG 1WOCA 4LF9Q 2YTXA 1WJJA 4NXNL 4AYBG 3UE0A 1QUQA 1MIUA 3CCEA 2C35B 3BZCA 2AWOA 1QUQB 4A3LH 4JI8Q 1HZBA 4QL5A 2K5NA 2GN5A 2R7ZG 4JBJA 4IO9A 1V9PA 5LMNW 4A3KH 3HOXG 3B6YA 3OW2A 1BVSA 1Z9FA 4AYBE 2VQFQ 4A3MH 3CCSA 4DK6C 4BBRH 3HFZB 2DGYA 3BJUA 5HGQA 3CMAA 5C0XI 2N8NA 4YY3Q 2KVQG 2VNUD 4TVAB 3DM3A 5GAEC 1I94L 4A3EH 5C3EG 1A63A 2ZM6L 3F8TA 5A2QE 4JBWA 2CWPA 1ASZA 2PI2A 1GD7A 1VQNA 2Q2UA 3M7NA 5FLXE 1OXTA 2D0PA 1HR0L 5LMNQ 4DR5L 3G6ET 4A76A 3PO2G 3TREA 1XNIA 4A3GH 3G4ST 3CCUA 4P72A 3J81i 1CSQA 4LFCQ 4L5RC 3D31A 4DUYQ 3KJOA 1VQKT 4GN5A 3STBD 3K8AA 4X65Q 3I4NG 1SROA 2XHCA 4DV6Q 3JAME 4LFBQ 1Q81C 1Q8KA
chains in the Genus database with same CATH superfamily
2YUQA 4JW0A 4DR4L 3CD6Q 1NE3A 1M5Q1 2IW3A 3A0JA 4WORA 4QQDA 1BR9A 1D0XA 4M77D 1AE2A 3HRTA 1D5XC 3C0CA 5JJLA 1PA6A 1YN8A 1PH8A 3E0JA 1CM9A 3MHBA 2A69D 4AYBB 3J7ZC 5EG2A 4M7DG 3VYGA 4GOPB 5CV8A 3UI2A 2KROA 3O13A 4J6YA 4F04B 1YFNA 1VF7A 5CC4A 2MWOA 2F0QA 3PIPA 4ORZA 3J81L 2A8VA 1L0WA 1QOHA 2WB1E 4LF5L 3M4OH 1UE6A 4XTCS 2DBKA 2B2WC 3X3NA 4JS4A 1KQSS 1HZ9A 2XSCA 1BKBA 1TWHH 1VQHA 1QWFA 2Z1CA 3FPUB 1EEID 5C44H 4BY7G 3URGA 5KRUA 4GOPC 3HRZC 2D8JA 2E2HB 3J81c 4JI0L 4M77A 1Q82U 2RD1A 4FO2A 1R77A 1CZGA 3BDOA 3F70A 2E2JB 1O75A 4X62L 4A53A 4PL6A 1J8IA 3TBIB 3EFXD 3W5OA 2DXTA 2B3GA 3E2UA 2KXCA 2VB2X 1LABA 5C6SA 4AFZC 4ZYSA 3DEPA 4BI4A 3BVMA 4IURA 3K5LA 3SHLA 1VDZA 3EBEA 1VQDA 4HJ7A 1LTBD 2YV5A 5CBEE 5I21A 2K5FA 5GAN4 1IBML 1ZYRC 5CKDA 3KLSA 3JAMi 4IOCA 2UUAQ 2DYBA 1TU2B 2MO0A 3TVTA 5GAMj 1MSHA 2F4VQ 1DOKA 2R5MA 1YITT 2EJFC 1YCSB 1VQ8Q 2A5HA 2NUPB 5T1IA 3HRUA 4DEYA 3HOVB 1UGSB 3T16A 2IHFA 5DAUA 4A3IB 4GZYC 2K2VA 2JA7G 2SRCA 4LUDA 5EQ0A 1H641 2KK4A 3VYSA 2O9SA 2K1BA 4IFDH 5KEEA 2GF7A 3P8HA 1SE2A 2EFIA 2ZT9C 2DL4A 1J5EQ 2CZ7B 1Q3LA 3TP7A 1BBXC 4WJ4A 2KHSA 5GAOr 3CCMQ 2ED1A 4OO1H 4ZK9B 5GAN2 5IYDH 5CBAE 2Y90A 4MN3A 5IGGA 1G2TA 3MEFA 2YTYA 3VS0A 1CKOA 1AH9A 1Q86U 1BO0A 1FR3A 2HMAA 1D5MC 3LW5E 3RDVA 1SDFA 3CMET 1JOOA 3G71T 1T9HA 1QZGA 3PUYA 3S14B 1KC8U 1K8AC 3FHWA 1MJCA 1XXGA 4JV5Q 2LQ8A 1HA5A 1E24A 3AB9A 4UP7A 2VS1A 1SMYC 2X35A 2NVQH 4NXML 2ZPIB 4NMZA 2LXJA 1QWEA 3RMSA 1ABOA 5FO8B 5GMKe 5IHNA 4B3SQ 4MZPA 3TRZA 4P5NA 2HCKA 3DLMA 2CVRA 2VQEQ 2VKNA 2DEUA 3D4RA 3VA7A 5IY0A 2QTXA 3A74A 4BWGB 4J83A 4CI0C 3LGFA 2PQAB 2QEXQ 3M0SA 1KFZA 1TU0B 1TWFB 1W70A 1VQPT 4KLKA 4LAAA 1K9AA 4U68A 4C8QE 3KLSX 1C4QA 4P74A 1BDOA 2JEAI 2JMCA 2HZYA 5GANd 3PQIA 2DJZA 2E65A 1EWCA 1XMOQ 1IBLL 1TWAB 1RAGB 4DAMA 1TUGB 4FU6A 1X6GA 2E2HH 2BKDN 1BU1A 4FSSA 4BI8B 2UU9Q 2B2YC 1M2VB 1ZBXA 5NUCA 2KRNA 2E2JH 2DIGA 1AWXA 1TKWB 3TZDA 1NMFA 4JBKA 3SB2A 5JJZA 1WGSA 1B34B 1OOTA 2P0PA 4EIKA 3L2RA 4QKUA 4LWCA 1LM0A 3AHUA 2NN6G 2JS0A 3CBPA 1F2LA 2DO3A 4HT9A 1PRTB 4M4ZA 3QWXX 3ULPA 1PH5A 3KBXA 1PYBA 4GKKQ 2GNCA 1AEYA 3VR4A 4DV0L 4IJHA 4D8DA 1WCMB 1LV9A 1TOVA 2A6ED 1M27C 3VS2A 2LMJA 4DV5L 1AFPA 1KDAA 3VRZA 2A36A 1ZHIA 3CCRQ 2HDMA 1C7YA 4DR3Q 1XPUA 1O7YA 2K4YA 2NVYB 1G6ZA 3KOJA 1SJHD 2KA7A 1UTIA 1HZCA 1LTAD 4PFOA 2YTVA 1PRTC 1I4RA 5I2MA 1YI2A 2IX0A 4YWKA 4BDZA 3PMFA 1RAEB 1YP5A 3PIO3 4A3DG 1M8AA 3UDFA 1HR0W 4ZTJA 3TN2A 1A15A 1YJ9T 3S6WA 1X43A 1W2BS 1IZ6A 3JCMg 4NP5A 5GANh 1NJIU 2KEEA 3TP6A 3SFMA 1SSHA 4NDXA 5HY6A 2FEIA 5CO7A 1FNUA 5CQYA 1RDPD 2DBMA 2VGMA 2RF4A 4JS5A 3MXUA 5IGBA 3S16B 3OSSC 2GBQA 2MYSA 4M7DE 1KDBA 2JJQA 4P2CB 2BE7D 1DCZA 3OYAA 2LP5A 5KYUB 2SOBA 5GAN6 2ZM6Q 4M7AA 2V1RA 4F8MA 1A62A 5EKIA 4K6DA 3V7RA 2VASA 3I7FA 2ECZA 3M9BA 1EWHA 1VQ7Q 2Z4HA 2F0GA 3I90A 4XQQA 1B7TA 4PZ8A 4DR2Q 5CQXA 2FZCB 2R57A 4LNQA 3S2HH 2B8FA 1G3WA 2XDPA 1BBWA 3LH5A 2DFUA 1YJNQ 3PGZA 3RKYA 2BA0A 3KYHC 4Z89A 3BDCA 5I2SA 1SNMA 4K0KL 2JS2A 2GQVA 1YZ6A 1PRTF 2GVBA 4RHSA 5GAMf 4YHHL 1VQKA 2HL3A 1SAPA 4IUVA 1OX8A 4XTVA 1PH2A 4OGEA 4IZ8A 2L3RA 4JLIA 3U58A 4HCSA 3PIOA 2FPEA 3IAYA 1K4US 4JI7L 1JE4A 4OMPA 1AZGB 2WAQB 3RN2A 4C92B 1TWAH 2GTJA 1S5FD 1MHNA 3CCSQ 5CAIA 1WHLA 1Y7XA 3M4YA 1M1KU 2E3IA 5CIUA 5IYCG 2CH4W 2FYKA 2YRDA 4M78D 4KGXB 1UE1A 1GCQA 5CV6A 3HS0C 1GBRA 2YWWA 1WTXA 4HCZA 1B3AA 3J7AV 4XTYA 3CCVA 4FCYA 1Y1VB 4LUOA 3BU2A 3JB9J 2K5DA 1VQ4A 1H92A 4C92C 1LVKA 3GTLH 1LUZA 4EGVA 3RNJA 1JJGA 2DY8A 4CC7A 2ZPFB 4MDXA 4JI0Q 5JJKA 5DLQE 3KXTA 1WCMH 4MZMA 2LDMA 1E7ZA 3A8GB 2HIVA 3CXCS 1MKHA 1VQ5A 2JVVA 2ZZDA 4G4KA 2LQNA 1E1TA 2NVYH 2ZXOA 2H3EB 1SNOA 2EE1A 2EYPA 3H94A 2AQ3B 1QILA 2KYBA 4M78A 2EBPA 2PPBC 1FYNA 2A19A 3RIRA 2JXMB 3V7CA 4LFCL 1E22A 2CKKA 5EPLA 1D7QA 3J80L 1IBMQ 2K5IA 5CR2A 3WWVA 3T1YQ 2XMFA 2MK5A 4JJCA 2K5QA 4UC4A 4DV6L 2F69A 5L8RE 3HOWB 1GUTA 4J9GA 3OW2S 4A4FA 2KEAA 1PH1A 2MWPA 1M90R 2F0HA 3A8IE 3OWEB 2NVTB 1I6HB 1EZZB 3J80c 2RDHA 1V8QA 3BDLA 4J9HA 3DEOA 3T13A 2RJCA 3E5SA 3V8LA 5ELBA 3O5ZA 3Q8DA 4A3LG 1K73C 1M4ZA 1S4ZA 1RAFB 2F0DA 2CW0D 1C9OA 1MV0B 1VYVA 2R7DA 3S15H 1YI2T 5GAN3 1U4RA 4HCKA 2L5TA 2CUBA 5KNDA 4HCCA 4EPCA 1QCBD 3NPPA 2E5LQ 2NVXB 3GTGB 1EL0A 3HP9A 3H91A 4A3MG 4HVWA 1E1OA 5JPMC 4IIOA 1R0CB 2JK8A 3RR5A 2LCCA 3EG3A 2HDLA 4EVOA 4HIOA 2A6HD 4X64L 3CQZB 4HVUA 3JCMb 5GAGC 4MDWA 4BBSB 5GANj 1VQIA 1I3QB 3VDYA 2K3BA 3CCQT 2Q8RE 1OYXA 5CR3A 1N34L 3C12A 1EUJA 5I9OA 1H95A 4M77G 3HP3A 5ISRA 3CRKC 2CWAA 1B7YB 2QA4T 1QCNA 1STEA 2RHSB 3HL8A 4NXMQ 5FU6B 3FVQA 2VUMB 2I5LX 4LW1A 2M02A 5GADC 2DILA 3LNNA 2XRQD 1M3CA 4A3GG 1QMCA 1PRLC 3V8JA 2BCOA 1EQRA 4L6V5 4WJ3M 3TP5A 4NS5A 3KF6A 3VJPA 2X6GA 3PUZA 4J9EA 4FW1A 2KAFA 4IJLA 5JOBA 2EPBA 1F9RA 4KHVA 4CJ0B 3T4AC 4A3DH 1TIID 3HFOA 3X28B 3CQTA 4UAIA 5FU6C 1PFBA 3H6ZA 5C4JH 1MD2D 1PXUA 2NWGA 2DJGC 1AWWA 2R58A 3A7AB 1DJ7B 3JB9F 1JT8A 1YNJD 1IBLQ 1HNZL 3PUVA 3I9QA 5IGFA 1WXUA 1GL5A 2PW7A 2JA6G 4LUVA 1HK9A 2PTKA 1AWOA 5FU7B 3CBOA 2ATWA 1PTOD 1E2ZA 1KAAA 4Y7NB 1X32A 5IOCA 1BXTA 2DL8A 3A1PA 4B9WA 4BS9A 3RLOA 2J0TD 1UG1A 5JEAG 3G1JA 3HOZB 4A3MB 2Z8LA 2I2LA 1Y69U 1LT6D 3HTRA 1WJQA 2JSOA 4FP5D 5KYLA 1WYDA 1U0LA 4K2KA 3H8ZA 3V8KA 1VQOA 1Q82C 3FKIB 3M0PA 3GP8A 5M3FG 3PO3G 1N5ZA 1TUCA 4PMCA 4X3TA 1N9SA 5FU7C 1CFMA 2L15A 4DV0Q 1N9WA 1IKMA 4II1A 1LNXA 3HOWH 5K36H 2UXBL 4V2SA 2RH2A 3NPFA 2HQHA 3A55A 4DV5Q 2NVTH 1LLRD 4ALPA 1ZQ1A 2KCMA 1ZSZA 1RIPA 3JB9H 1SYCA 3PE0A 1ZXTA 4ID6A 4AQYL 3AT1B 4N4HA 4JI6L 1GUWA 1C48A 1SMYD 1X65A 2DE0X 2VXWA 3DHQA 5TSSA 1EQQA 2R92G 5A0LA 4KN4C 2GCXA 2OAUA 9ATCB 2PVGB 3GNFB 1HZAA 4LNPA 1LACA 1QB5D 1K1ZA 1A0NB 1EQTA 3J80i 1VA7A 4QUFA 5ELCA 3IL8A 2PVDB 5IYCH 3S1RB 4LF6Q 3GTPH 4C3IG 1NLPC 2OXPA 1V1QA 1HNWL 3CQZH 2D5DA 4LF8L 1V1OA 3VS3A 2JA8B 5EAYA 1EY5A 4BBSH 2DM1A 5ELOA 4A93G 3NUCA 4JI4L 4JVZA 4QJFA 3NE5B 3QYGB 3MTSA 2EGEA 4KKSA 1QLYA 3VYTA 4FNFA 1NM7A 1K8AU 3ND8A 1MUZA 1Y1WG 3M55A 1W4SA 8AT1B 1N8RR 2EQJA 3HKZE 2B63B 1Q86C 2QYZA 1VYUA 4L5QA 2K5LA 4NW2A 4BE2A 4K0KQ 3RUZA 2ZTCA 3J81E 4YHHQ 1HYOA 2XNAC 2EJ9A 3CC7T 3HKSA 4AT1B 2PI2E 1PH4A 5C3XA 4X6AH 4NB3A 1FX7A 1QJOA 2FVUA 3I73A 2X4WA 4YCWA 2LKVA 2D0QB 4M77F 1YI2Q 2EY2A 2SDFA 3VS5A 4JI7Q 1FD7D 1Y96A 3F1ZA 1RF2D 1SLJA 4GY5A 1NNXA 2KCNA 2YRCA 2L0AA 2L3PA 3CCLA 2PZTA 3VYRA 3HOUG 3OYCA 1YCYA 1WJJA 3EH1A 3UE0A 1XWEA 4DK1A 1BBZA 3BFMA 3WVEB 3CCEA 3JCMW 2QK0A 3IQLA 2EPDA 4A3LH 3CCQQ 1AOJA 4QL5A 1NUCA 4JPBW 2F0FA 5GAMe 2RQWA 5GANf 1V9PA 3VS4A 4K14A 1PCXA 2Y0SB 3HOXG 2EQIA 4K11A 4A3MH 2A3LA 4DK6C 4RTXA 4C3HB 5G3LD 4C1NI 4JRKA 2VNUD 4RTWA 3SXHA 1M8VA 3SR1A 5ELDA 1A63A 2X4JA 1TS3A 3MXGA 4M7AG 2J7IA 2RNAA 1A3VA 2CWPA 3E6ZX 3NSWA 1ASZA 1VQKQ 1VQNA 1K0XA 1GUOA 1QP3A 1I07A 2ROLA 3M7NA 2ENMA 1WHKA 2R61A 2D0PA 1HR0L 3L2ZA 2QI2A 4OL7A 2IJ0A 2F2WA 3RD4A 1XNIA 5L37A 4A3GH 3M58A 3G4ST 4C5GA 2YHTA 4M77E 3M53A 2V8JA 2HCCA 4LFCQ 5EBCA 3T9NA 1T5EA 1RABB 2NTTA 3EFRA 4DBHA 2VYTA 1SEBD 4GN5A 3STBD 1GHJA 2LC4A 2AQ2B 5KNBA 3I4NG 3M57A 4DV6Q 2EYLA 1Q81C 2D62A 3U9OA 2FRWA 4ME7A 2DX1A 2JM8A 3H0FA 2IY5B 3N5BB 1IO6A 3VYHB 4MTKA 3QSUA 2OWOA 1STNA 3CCVQ 2WSCE 1EU4A 1Q1EA 4R8IA 2X3XD 1VQ4Q 3E9FA 1S72T 1L2FA 4KUIA 4IUUA 2VV5A 1F2YA 4HIMA 1GXDC 3KF8A 3CD6T 2IPKD 4Y28E 5IWAL 1AWJA 4M75B 2CFMA 1OULA 3HOXB 5JEAH 1VQ5Q 1EY4A 4GN3B 4O0AA 2I5MX 1TS2A 2NUTB 4QCLA 3ULRB 4DKAC 1JWSD 3CC4A 1OXSC 2HBWA 1GHKA 2DPPB 3EG9A 1IGQA 2Q8TA 2QQSA 4Q5WA 3PO3H 2P4TA 3OIPA 1F9QA 4C92D 1YEZA 2JT4A 4MTNA 1U5KA 2N88A 1SSOA 4IPGA 1XMQQ 4M75C 1STAA 4XU0A 4JOIA 3JV3A 1DOMA 1AVZC 2M0YA 1ENCA 1P92A 4RFBA 1FGUA 4DA2A 1TWCH 4ESRA 2K04A 5KYYA 4M78G 1SE3A 3L7ZC 3MPUB 2OTJA 2F0MA 1EIHA 5KCOA 1SYEA 3S1NH 4PFPA 2R92H 3F2BA 2BZXA 3QG1A 3M4PA 2Z6KA 1G291 1UHCA 1S5ED 3EFOA 1OV3A 4F7UA 1OI1A 1V1CA 3A98A 4QVZA 2HAXA 3PUXA 4PK4A 4C3IH 4C3HH 1JCKB 4FF2A 3L2VA 1SSFA 5GMKl 4HJ9A 2MPXC 4LXCA 2WINB 4IUPA 4WFN3 1M1KC 1HNZQ 4DEXA 3K7AH 1X6OA 1UGRB 2HD3A 2DLPA 3CCLT 5A2QL 4R56A 4R0KA 1MI2A 3KUPA 4JI2L 1WQWA 2F0SA 5D14A 1Y07A 2WB1B 3CC7Q 1ONLA 5E4XA 5FLXL 4OIKA 3VR6A 1M90U 2KNBB 3WVDB 1B9NA 1STBA 2QEJC 2HBPA 3KBGA 1X69A 3UT1A 4M75F 1CSPA 4IPCA 1TXQA 1Y1WH 2RHXA 4OGQC 3CBMA 2EDGA 2I0NA 2A73B 5FRNA 5LHY1 1A6XA 2Z4IA 1PH6A 3CPWS 5FLXc 3M4OB 2G9DA 4OF1A 2AKWB 2QTVA 2QQAA 1RAAB 1PFNA 3ASKA 4L5GA 4QQ6A 2OTLA 1D5ZC 2LS01 4N8X1 5C44B 3JAML 1RCVD 5IYBG 3GLXA 1KD1U 3CCMT 1RJTA 4M7AF 3QWYA 1V29B 5A0DA 2FB7A 3J81j 2UXBQ 3ZBDA 1WQ7A 1T0HA 1KRSA 1ASYA 1M9SA 5GMKi 3QZ5B 4FT4A 1BOSA 2DD4A 1CHPD 3AFQA 3JAMc 4AQYQ 2EAYA 3GV6A 2EYXA 4KH0B 1Z6HA 2MHVA 4C8QG 3L2QA 4DNIA 1KJWA 3K58A 3OYGA 3HOUH 2HD0A 1YHAA 2OQ0A 2FO0A 5FKAC 4H13C 3WOEA 1VF5C 2KHJA 2JYOA 2MAMA 1K73U 4P71A 1KK7A 3ME9A 3GTOH 1JJ2S 2K01A 2HKQB 2XI9A 1MGQA 4KT0E 3BYYB 2ZTEA 1BIAA 1JO8A 3SWNB 3MXNA 3HOXH 4LF8Q 2BE5D 3RKXA 2RJFA 1NPRA 1JXMA 4LE9A 2BE9B 3E1SA 4Z8AA 4CBVA 4DU9A 5IIFA 2Q8IB 2KT1A 3MP8A 3PT9A 1YJWA 1GXIE 3CRLC 4A3BG 2QEXT 2E41A 1YIJA 2RDGA 4X1VA 4HTHA 1DGSA 4LF7L 1YNNC 3G48A 3Q23A 1YHQA 3KDFA 3SWNC 3NFCA 4J8OA 2XD0A 4IN3A 5I6YA 4JI3L 3SGIA 4BBRG 5LJ3g 2DA9A 2X51A 1WD1A 2F52A 1ZUKA 2FFKB 3ZJYC 5LL6X 1I50H 3A7LA 1E2WA 1HUMA 2KXDA 4PLIA 5DEHA 1SG5A 1N32Q 5CKHA 4F17A 2GQIA 4EQOA 4G57A 1G51A 1S72Q 4OHJA 1FGBD 2MUYA 3I4NH 3CF5A 2NVQB 2KVMA 4R4IA 1UGQB 4PZ6A 4DV3L 2FHDA 4XU3A 4HMIA 4Y92A 4HJ5A 1PWTA 1VMCA 1HPCA 3I4MG 4BA2I 4DBRA 2EYZA 5IXBA 1VMPA 2HNIA 3ZYYX 2LJ1A 4C8QB 4KK7A 2CT4A 4O6JA 3SVMA 1SN8A 2LJ3A 4A93H 1Z7TA 3RNUA 3CCRT 3H09A 1L1OA 4DGZA 2MCNA 4TRDA 3J80E 3NMZC 1DJRD 1FVIA 3A5UA 4JDSA 2NZHA 4PJNA 2LZ6B 3I8ZA 5EPJA 1VQJA 2JA9A 1EZ8A 2UUCL 2K03A 4MNOA 4C8QC 2QKIC 1G8XA 1KNEA 3J7AF 4K8IA 4ZKBB 4IFDI 2WACA 5M3MG 2CP3A 4K6LA 4A3BB 3QJ6A 4LDXA 4E6RA 1YWOA 3I3CA 4L5TA 1HR0Q 3CKIB 4OO1I 4JRQA 2CP5A 1ARKA 1EY9A 4NL3A 1U3OA 2BZYA 3RERA 2F0TA 2D6FA 3K80C 1JJCB 2BA1A 3NTKA 1KQSA 4K5XA 2VVKA 1I1JA 4A4IA 1WHHA 1EWIA 1WTQA 1ZUUA 3CCLQ 1VQ7T 4HSPA 1GOZA 2CP6A 2EIFA 4A4KA 1QNUA 1C0MA 2P5ZX 3RZOH 2AKLA 2E6ZA 3CCEQ 2O2OA 1N33L 4N0AC 2D0NA 2GTOA 4ZRZA 1OX9A 1YJNT 1PRMC 2HL5C 1Q7YU 1HQMC 4OMLA 1O80A 3GTMH 4M78E 3OS0A 3GF5A 3CCJA 3OYKA 2UUBQ 3RR6A 1RAIB 1TY2A 2COWA 5I4DA 2JTEA 2HKNA 4EMKB 2L3QA 2FJ2A 1K9MR 2V1CC 3NHHA 4LF9L 4V0BA 2DRMA 3I4MB 2O4XA 3I70A 1PD0A 4C8QF 2MO1A 4ZUIA 4PJOD 4DXFA 3META 3C46A 2WSEE 2Y4XA 3MCAB 5KYXA 4M7DB 3LYIA 5IWAQ 4N8FA 2F0NA 1PH9A 1G2BA 2DTOA 4BD3A 2BH8A 1AD5A 2QXFA 5ELNA 2PNIA 3KLWA 3TP8A 4OMMA 2KJXA 1VQNQ 2OEOA 3CCST 2IT1A 1LOJA 4EMKC 3C4SA 1OXUA 2YUOA 3W1GA 1EOTA 4GNXB 4X9DA 4XQJA 4E7HA 5D7UA 2J6FA 4Z88A 5FLMG 1A3UA 4O42A 4BY7B 4M7DC 5HK3A 1SMXA 4JJDA 1QVGS 2DETA 2DY7A 2KGTA 2F0OA 3S2HB 1B2TA 2YXYA 4CDFC 3S1QB 3UA6A 4PJOA 5M3MB 3QR8A 4H7BA 3HHTB 3VUBA 3MEUA 4GN4B 4DOWA 2FHTA 2FMMA 2K50A 1IBKL 3GPLA 4FVMA 1SFOB 2K7AA 3QHSA 4ELZC 3JCMc 1U4MA 2R3ZA 4GNXC 1HNXQ 2R93G 1YNXA 1OO9B 5LJ5d 2AWNA 4KN7C 5D6YA 5IHIA 1I5LA 1AZEA 1PYWD 2O5JC 4OMNA 3QZ9B 4AMCA 3JCMX 3NBHB 3DWPA 5KYWB 4X65L 1BCPD 4JRIA 1UUPA 4LFBL 3NTIA 2B29A 1Q46A 2KHIA 1QKWA 1X27A 1SEMA 1W6KA 3IRBA 2R6GA 4A3CG 1WYXA 4DR6L 3KUFA 5CV5A 1X2QA 2NZOA 3UWNA 3CHBD 4JI2Q 1PMRA 3G7LA 1FL0A 3C1FA 4DV1L 1KHCA 1M8MA 1VQ9A 2JA7B 2DL7A 3BDUA 4M7DF 1MGSA 4I7AA 1C0AA 3EGDA 3OYLA 4DR1L 4KHPL 1H9SB 2P0QA 4A3BH 3CC4Q 1PLFA 4J7FA 3K6OA 4HAEA 1G83A 2MJ8A 4XQ3A 3VV0A 1XYIA 2E5QA 3NXWA 3GTLB 3M85A 1HCZA 4CJ1B 3TDQA 3A8MB 4K5VA 1Q1BA 1VQCA 2BUDA 1LPLA 1VQEA 3E19A 3X25B 1X54A 1M3AA 1EU3A 2PCFB 2KY9A 4OXPA 2OTJQ 4J6HA 1RUWA 2O2LD 3U9SA 3H15A 3ERQA 3FIFA 1XNRL 2MF2A 1JU5C 2B2VA 2A68C 4LDWA 3G6JB 1D8LA 4KY6A 4R4CA 4CC2A 1Q81U 1A8VA 5LJ5h 5GQOA 4PLLA 1QKXA 4TVRA 2RCFA 4G7OC 1PG5B 4XDXA 3OQ5A 3VUZA 3I4MH 1UJYA 3OBYA 1PTOH 5DM73 2IG0A 1LTRD 1K76A 4JI5L 1FJGL 3EGXB 3LX0A 1UGPB 4DUZL 4XXEA 3FP9A 1X3QA 1AW7A 3GOXA 1EY7A 2G6FX 3DMUA 1VUBA 4PKCC 4F7UG 3UDCA 1QVFS 4DFAA 2DN8A 1G91A 1I94Q 1D1KA 2IX3A 1VQMA 1RACB 2KENA 1MJEA 4ZQ3A 2ATCB 2ZPHB 4DN4M 5KCHA 5FO7B 5LJ3e 1N6AA 4BY7H 1T3SA 2J6OA 2OQKA 1MBYA 1HNXL 2BDNA 5HCKA 2OTLQ 2XN9C 4C3JG 4LF7Q 3ER0A 3S15B 3GTQH 1AEXA 3S1QH 1W2BA 5M3MH 1CKNA 3VRYA 3OA6A 4CHTB 5HKCA 3G6EA 1KQ1A 4DNRB 4DR5Q 4BE0A 3HOYG 4J9CA 4JI3Q 4X3UA 2RDFA 3MP1A 1FYCA 2GFAA 4C1NK 4QVDA 1SFOH 5DNFA 5GAOp 2PZ1A 1NBWA 4GLKA 1GO3E 3LGJA 3LWHA 3NK9A 3BS1A 2B2UC 4A3JG 3EFSA 4JZ4A 1UECA 1L0XB 4MMKA 4J6XA 4BB7A 1HUNA 2JMAA 2JTFA 4XK8E 1FNWA 1NPPA 4OX9L 4DR4Q 4C5IA 1RODA 4DV3Q 3K7UC 1TXYA 2B2TC 2AUKA 3L0OA 2F3WA 3K81C 4RCCA 4HCBA 2KQ3A 4A4HA 1GUSA 1KQ2A 2HQXA 1NR2A 1QCOA 2PMZE 2WP8J 2F03A 2JA7H 3D7SB 5C5LA 4OEMB 1LTLA 3A8OB 3EROA 2IVWA 1WD0A 5C4XG 1V1PA 2O01E 1YJWQ 3CC2A 2O31A 1LTID 1CA5A 3I56A 1GJXA 1TH7A 4GLVB 4H0LC 4OB1B 5FW9A 1YIJQ 5C4JB 3OYMA 4LF5Q 4A3FG 4NPSA 3EQLC 3HKZG 2EQSA 2K2MA 2DVJA 5J39A 3EG1A 1VCIA 3LWEA 2UUCQ 5GAMg 4J1MA 2EJGC 2RSOA 2ZTDA 4DAVA 4KD3A 1M90C 2MIOA 3HG9A 2FPFA 1LYLA 2K7VA 1NEGA 4X3KA 1VQ9T 5I6WA 4ZCKA 4X62Q 5IP9G 4E7SA 2HSPA 1YVCA 1G6PA 3HOYB 1G3YA 2FPDA 2ROTA 1LT3D 1GUNA 1KD1C 1ABQA 1WDXA 5E3FA 2RSNA 4LUEA 4PJMA 2QDYB 1SXTA 3MVVA 4JLGA 1HSQA 3DXJC 2YYZA 1XJVA 3F2UA 2AZSA 1NR4A 4CC4B 1I8FA 5BN4A 3CXCA 1ENFA 2LQKA 2XK0A 4RGMA 2HEQA 1X3GA 1RTOA 4R4TA 1UHFA 4HMJA 3NGPA 4LF9Q 1QUQA 5LJ5j 3BZCA 4LDYA 1NG2A 2EY5A 1UUEA 1UFFA 2EKHA 4E7LA 1F2ZA 2F0WA 2K05A 1HRJA 1IYUA 3FRPB 3FJPA 3OYNA 3MKDA 5LMNW 5M5XB 3K59A 1A2TA 3T51B 3T53B 3GTPB 1PKTA 3MJXA 4ANJA 3OW2A 4LDVA 4ZTFA 2P4RA 1E2VA 1QE6A 1IW7C 2HDAA 2NN6H 1K8MA 4TVAB 2CP7A 3S1NB 5IXFA 2XDBA 1D3BB 5D6WA 2CUDA 2RK1A 3JCMQ 2PNRC 5A2QE 4JBWA 4BE1A 3Q6SA 4NKLA 4Z9CB 4CDEC 2B86A 1A2UA 1GD7A 3OIQA 5GJVB 4CKBA 2Q2UA 5FLXE 5CKBA 2A74C 4DBQA 2LMCB 2EXZA 1RLQC 2ZPBB 1I4HA 3G6ET 3MWYW 3PO2G 4HEDA 1L0YB 4KUDK 3QIAA 3CCUA 1RADB 3CCJQ 1CSQA 2CZ0B 3D31A 4NL2A 2QDBA 2ZCFB 3KJOA 1VQKT 1ILPA 1MMNA 1WZOA 3R2TA 5GAOn 4X65Q 2SEMA 4KH1B 4LFBQ 1BF4A 3QIIA 3JAME 2EQUA 2N8NA 4XYQA 1HTLD 1VQ6A 2KCCA 2IPOB 2B2WA 2HIXA 2CDTA 1U8RA 1ZYRD 1UEBA 3JB9I 1B70B 4XU1A 3Q0AA 4DV1Q 4GOPA 1HJPA 2KCTA 4XTZA 1V43A 4F7UE 4DR1Q 3OS2A 2H3JA 4KHPQ 1F9SA 2RI5A 5E4WC 4HKEA 4L59A 4QIWE 4C92E 3S2DB 1BI3A 4BI3A 3UA7A 3CCVT 3HGBA 3HOYH 4O2DA 1BB9A 1EY0A 2CQOA 4J9DA 1VQ4T 4DA4A 4LN2A 3VR3A 1K83B 2WSFE 1B4OA 1PNJA 1SE8A 3MP6A 3PGGA 3DB4A 4R4OA 4B3ML 3L2UA 2OF1A 4M77B 1IHWA 2RA2A 2WV6D 4IUTA 3WDNA 3QDFA 3M3YH 3KFVA 2EJFA 3TCJA 1ZUYA 4PJOG 1VQ5T 1K28A 4M8AA 5JEAJ 2C0OA 1W6XA 1OQKA 1BI2A 4DOVA 4KTAA 1MSGA 4B08A 3H3VH 3PNWC 3SD4A 1Y8NB 2XWJB 1I6VC 3X3MA 1AZQA 4XT1B 1N8RC 2D2CC 4A3GB 2OX7A 1NYGA 2DVEA 3OYYA 3GO5A 3NWSA 1RL2A 3EG2A 2WFWA 2D0OA 1SF9A 2VGNA 4DUZQ 3D0FA 2DRKA 1G3SA 1Q7YC 2QG9B 2E2DC 4BY6B 1G2SA 4O1NA 1CKMA 5M5XH 1VQ9Q 4M77C 4KKUA 5M9OA 1UE9A 1UAPA 5IE8A 1KSWA 5C4XH 2RN8A 1D0ZA 1KIKA 2A69C 2NUPA 1BI0A 5KGUA 1KAWA 4B9XA 4AFUC 2F5TX 1CI3M 1NEBA 2L11A 4Y91A 3RMQA 2ZJPA 5AT1B 4U673 3UDIA 2H4OA 2IHEA 2AHJB 4PFZA 2PU9B 4IIMA 2O88A 2JXBA 2K79A 1NSNS 1KL9A 1SNQA 2E70A 4BY6C 2JA6B 3OYFA 4RG1A 1VYTA 2A28A 3EHQA 3LX7A 1SYFA 3M9QA 4JC0A 2N55A 1TSFA 1W1FA 1KNAA 1XTCD 2EOTA 1Q82R 5IP9H 1J6QA 5CVIA 3ZEHA 2DYIA 1U4PA 4DPGA 4C2MH 3JRZA 5I11A 3R3OA 4R4QA 2QILA 2JTMA 5M3FB 2IIMA 1FWZA 2DXCA 5D6XA 4UY8C 3PO3B 1X2KA 1X3EA 2EYMA 2EYJA 3QPHA 1QNKA 3M56A 4XAXB 4OX9Q 2OI3A 4OVAA 1JE5A 3ZL7C 5LJ5f 3K5NA 1B1ZA 1B9MA 2M16A 4O5VA 1PVOA 2NWMA 2JW4A 3K0XA 3I55A 2AT1B 1TWCB 4KGVB 4K5WA 3MXPA 3NWTA 4R8NA 1XPRA 3S3MA 2KUMA 5EKKA 2Z9HA 2F3IA 2RKSA 2RI3A 3PV0A 4RHRA 2EYOA 5KE2A 1CQFA 2X4YA 2AKKA 2M51A 2B2YA 1VQMQ 2PQAA 3PCOB 5T1GA 1DM0B 4CGYB 2R92B 3CPFA 4DUYL 4IOAA 3R6NA 4FYWB 1K3RA 2LX9A 1PRTD 2XRSD 1MV3A 3S2DH 1AE3A 5AYFA 4C3IB 5IHKA 2F2XA 3QJYA 3G6EQ 1K83H 3K7AB 2BZ8A 4C5EA 1H9RA 4A93B 2YRVA 4E7IA 2XWBB 3S1MB 2ZGWA 1M2VA 1RKNA 3QKJA 4RTTA 3N6RA 2DTHA 1HD3A 3H0GG 3VU3C 4A3KG 2QDLA 1X9NA 1E6HA 1Y1WB 2Q2TA 1VQ8A 1B34A 3RLFA 4LK1C 3VS1A 1EYCA 1KC8R 2TMPA 1QQJA 1O7IA 3PSIA 2OAWA 2EW3A 5FJ8G 2L1BA 3KLRA 2KMTA 2QQ9A 2VUBA 1I4K1 1WI7A 1ZLMA 2DF6A 2M9UA 3RKWA 1JC7A 2DUDA 3A54A 3EIVA 4QGUA 4IFDJ 4A3EG 3JCMd 1VQOT 2Q2IA 1WHGA 1UDLA 4JJNK 1HTPA 1KLGD 1ZKOA 1XNQL 1IYVA 3N52A 2CH4A 1KHIA 1H9KA 3NP8A 1ACMB 2K3YA 4GLAC 3TQYA 3BYTB 1IREB 2V8IA 4FF4A 1HXDA 3Q1JA 2NYSA 2RCNA 5J3BA 3PUWA 3QOJA 3CU7A 1KQSP 3PVQA 3JCMP 3H0HA 1B44D 3CC2Q 3WOFA 2K5HA 4XTXA 3HOUB 1OXXK 5CV4A 1CKAA 1HHVA 2RJDA 1Y14B 2JA6H 1SPKA 1XOVA 1TTHB 2J06A 4DAYA 4ZKCB 1E7OA 3CEYA 4S3SA 4WTOB 3GD7A 3A8JE 3GTOB 1SJED 1DZ1A 1I5OB 2D8HA 4X64Q 2PUOB 2UUAL 4RH6A 3U50C 5C0XG 2FZKB 1EFWA 2F4VL 2JA5G 5KYUA 1HQRD 1UE7A 5GAN8 5AFWA 4DV4L 1MMGA 1EIYB 4IKFA 1N34Q 4CKEA 3GP7A 4QB4A 5M3FH 1SKUB 4JYAL 3VKIA 4LD9K 5BR8L 1VQAA 2EJMA 4M7AB 4RMOA 4B3RL 1BK2A 4A3DB 2J6KA 1BUVT 1R8OB 1Q8IA 5GAOl 4HJAA 1EOVA 1Y57A 1JWMD 1S40A 1JOQA 3H0GB 5FK9C 1PSFA 3DWQA 3BY7A 3JCMh 1WXBA 2VWFA 1N27A 2P0KA 1LO5D 4GKJL 3EGUA 4J6WA 1ESRA 4DAYB 1AZPA 4F14A 1SHGA 4PQXA 3OW7A 1WXTA 1BNZA 4YTLA 1I50B 2A6EC 4FW2A 4FXGC 5EGTA 1BQQT 3UE1A 4OB3B 5M5WB 1O7ZA 2FRYA 4CC3A 3BG3A 4AG1C 4PJOE 3S3OA 4M7AC 4UP9A 1JQQA 2R7FA 2Z0WA 1CZWA 2OJ2A 3I4NB 2Y4YA 4A4GA 4E7JA 2E4HA 1JWUD 1X3FA 2G5DA 2DXBA 1ZA2B 4C92A 3V2TA 3DLLA 2HT1A 1OZ2A 4A54A 1NJIR 2EJGA 1O7LA 3S1MH 2RVLA 3SHWA 3CCET 1II3A 2RQXA 2ID0A 3U4VA 3M59A 4DBFA 2MFIA 5KNCA 2KBNA 3Q24A 2H8HA 3GBQA 1GKHA 2KSSA 3IFTA 1WPYA 3K5OA 5J26A 1AN8A 1EEFD 4MIUA 1ET6A 4POGA 4AIMA 3DKMA 1CT1D 1JQYD 2MNAA 2XGTA 1IKLA 2NBFA 4Q5VA 4YY3L 4KHZA 1D1IA 3SK8A 1XMOL 3UPUA 1AT1B 1G8ZD 2N78A 3FEWX 1KDCA 4PV1C 2PQEA 1IW7D 2JUFA 3CCUQ 3JB9D 2IX1A 5FWCA 4DF7A 1D1BA 2UU9L 1JEGA 5D3IB 1GFCA 4G7HC 2L8DA 4F7XA 1VQNT 1OPLA 2P84A 3ONAB 1GCQC 3PFSA 4JI6Q 1BCMA 3I2ZA 4GBQA 1U1SA 2K3XA 2C06A 3C1EA 5LMNL 3CPWA 4L5SA 4HIDA 3S3NA 2SEBD 1Y71A 5DM7R 1LTSD 4M78B 3M5AA 4EMGA 1NBEB 1DOLA 1JB3A 3IFDA 4N9PA 1PDQA 3FLGA 3RZOB 4JCVE 4PJLA 1SE4A 3W2DA 4GKKL 4XIGS 3GTMB 1HNWQ 1M1KR 1YITA 1T0JA 1ESFA 4DQ2A 1J3TA 1UJ0A 1SYGA 1LTTD 1WIEA 3NBIA 3QB3A 3BVZA 4JI4Q 5CV9A 4JBMA 1IHZA 2K75A 1CK1A 3OPOA 2CS7A 3TMEA 4M78C 2DL5A 3PF5A 1HFGA 2KRMA 2C0TA 4FYXB 4XTUA 1E6GA 1VQOQ 2K5WA 5D65A 3FMCA 2Z0SA 2C5CA 5JVH3 4Z02A 2CSIA 2KT8A 3H0GH 2F2VA 1JJ2A 1WI5A 2QF7A 1H9MA 1SNCA 1WFWA 4B3TL 3RZDB 3NEMA 2EY1A 3J7A5 5FJ8H 4Y52H 3W1BA 3K57A 2LVMA 3SEBA 2ESWA 4ZN1A 3CMEA 3G71A 4RWSC 5M5WH 5FROA 1WLPB 1G3TA 2K57A 1W2BP 3CC4T 3RBBB 1EIFA 3JCMV 4KD4A 5AJ3L 4NXNQ 5DY9A 3NELA 2EYQA 1O78A 3AFPA 4QUCA 5EBDA 3MA2B 4IQZA 4DR2L 3KFUA 2YSQA 3JC66 1SRUA 1PHTA 5JPNC 4HVVA 1U06A 5C6AA 4M78F 4DXGA 2QGQA 4CKCA 2EGCA 1FMKA 3DB3A 2OTJT 1QVCA 1SNDA 3GTKH 1PM3A 3KF6B 2F1LA 2DAQA 4ABNA 1HA6A 3I91A 1NYFA 4OWWB 2LQWA 1D09B 1VQPA 5CYUA 2E12A 2F3VA 3HZXA 2L9HA 2JQOA 2BH2A 2CW0C 5C0XH 1ICFB 3HOVG 2UXCL 3CAMA 5LJ5e 2JOYA 5EKLA 1CTMA 4A3IG 3UF4A 2ES2A 2JA5H 3EAEA 2LY7A 1NCVA 1PFSA 4X9CA 1OEBA 1OU9A 2C0IA 2CGHA 2K5VA 3LWIA 2L89A 3X24B 2A6HC 1K9MC 3BZDB 1HH2P 3KJPA 4OMFB 5GAN5 2LFNA 5GANe 2E64A 1IRXA 1PH3A 4A63B 4C56C 2EWNA 4C5HA 4ELYC 3P8BB 4E7ZA 3ZFJA 2VXEA 4BBRB 2CP0A 3MO8A 3SK5A 3TZUA 3C3LA 2QQRA 1N8RU 4CJ2C 3I55Q 2OTLT 3H9NA 2VW9A 1XNQQ 2EYWA 3EG0A 1NLOC 2HSEB 2FINB 3E9HA 3GTJH 1EQVA 5LMUL 3SDZA 1M1GA 4R9WA 1K8OA 1MMDA 1ZX6A 5KYIA 1DONA 1QP2A 4QMGA 3TSZA 3ERSX 4MMLA 4PG3A 1YNZA 3INZA 1VIFA 2SNSA 1EIGA 1VS0A 4J15A 5IT9L 1QCFA 3GDEA 1PTOB 1ZSZB 2M1HA 2L55A 1KRTA 3BVGA 4OONA 3OYJA 5COYA 2XDDA 3CXCP 1BYMA 5CV7A 1R9TH 5IT9c 1GRIA 1PC0A 4J7IA 1YJ9A 3LGLA 1Q90A 2K14A 4YWMA 1RI9A 1ZSGA 1YNJC 1TQOA 5GAOm 2ZAEA 2AMCB 3T1YL 2MP1A 3RZDH 4C0FA 2PW5A 2FL7A 3OS1A 4PNOA 4DV4Q 2EYHA 1PTOC 3M0UA 1ZSZC 4EQ5A 4FM4B 4JYAQ 2YDLA 4CRIA 5BR8Q 1EFID 1Q95G 4KULA 3EN2A 2VL6A 5IYBH 5L23A 1H9JA 4B3RQ 1YJWT 2RA4A 5IP7G 3QOLA 2UXDL 4NOYA 3OSOA 3MAQA 2LNVA 3OW2P 1YIJT 3GTQB 3T1HL 3HPWA 2X69A 3H41A 2FXQA 5A0GA 4GKJQ 4FYDA 2W10A 2E5LL 2QGGA 1YHQT 5FRMA 1GFDA 2NUCA 5GMKm 1TWGH 3T56B 4RA8A 2DMOA 4JZ3A 2V26A 1OU8A 4JJBA 4QW2A 1FMWA 3D4DA 1WCMG 1Z9ZA 1QVGA 2L5QA 4OMQA 4KBMB 1OZ3A 2PMZB 2G9HD 4C0DB 2A08A 2B39A 3JSCA 2D9TA 2F0JA 1Y96B 4FSXA 3UATA 1PTOF 1WOCA 2YTXA 2YU9B 4NXNL 1F9PA 1IB8A 3P20A 3BW1A 1MIUA 2RQRA 2LTOA 2C35B 4WRDA 2WKCA 3K0YA 5I2XA 1PFMA 2RM4A 3L42A 2J4XA 3MHXA 1HZBA 2R7ZG 4RTZA 1G5VA 4IO9A 3M4GA 1WJRA 3HRSA 4C0ZA 4C0DC 3B6YA 3VS6A 5EPKA 4AYBE 1JORA 3L1AA 1K8AR 4BBRH 2DGYA 4JK1C 3CMAA 4YY3Q 2KVQG 1F2MA 4HSVA 3L3OC 4Q0FA 5C3EG 1EFNA 1PZJD 2D9UA 2EKOA 1F1BB 4I7ZC 4RTVA 4WJWA 1EY8A 1PKSA 5FWBA 2BOSA 3R8BA 2DJQA 1FXXA 5HGTA 4KRTA 3JCMf 1RTNA 2ZPEB 1OXTA 2V1QA 4J8QA 1TG0A 4BACA 5LMNQ 2LNHB 3TREA 3RMHA 2W0ZA 4FIBA 4M75D 3J81i 4KJOA 4QF4A 3OOCA 4L5RC 2R93B 1R0BG 2LT4A 2RK2A 1H3ZA 2CREA 1B07A 1SROA 2XHCA 3KK7A 4WF2A 3UDXA 4BA1I 2QAZA 2DK3A 3OBWA 2WAQG 4ZGDB 4C92G 4M7AD 1IHVA 3CCJT 3HOVH 3W3AA 3TU4K 4A3IH 4E6IA 1NZ9A 3EHRA 2QCPX 1IXRA 1T5XD 4TQUS 1WX6A 2RHZA 4RKBA 1R4PB 2FMCA 4HIKA 3HSBA 1K3BC 4M75A 2E2IB 3VA5A 2R7ZB 3TEHB 4FT2A 4HJ8A 1WTHA 1Y1VG 5KYNA 3KF8B 3GNGA 4LF6L 1QVFA 4B3TQ 2NUTA 3S17B 5I2YA 1U9RA 1D0YA 2ICIA 3CCQA 2L2PA 3R93A 1GBQA 2JNGA 1JB0E 1RI0A 1EYGA 1YBYA 4ZGJB 2YUPA 4DV2L 3S14H 1TUDA 2XKOC 4RCBA 4ZGEB 2QA4A 1ET9A 4A4EA 2JN4A 3EG9B 2H1EA 2MPMA 2CQAA 5AJ3Q 1LT4D 1TS9A 4J9FA 4FYVB 1Q12A 1WJSA 4PMBA 4BY1G 4F87A 4N4IA 2YU9H 3STBC 2PO4A 1YITQ 1JB7A 3MZ5A 2V4DA 3SK4A 4OMOA 2XU8A 4M1UB 1U4LA 1QWYA 2JP1A 4HXJA 2PNHA 3NENA 5KYYB 5A35A 1S5BD 1SRLA 4P75A 3QO2A 2MI6A 5G3LF 2X9HA 3HOWG 8ATCB 5K36G 4OIJA 1TWFH 2VZAA 2VC8A 4DV7L 4FXDA 3WXMB 2R5AA 5CK9A 1CA6A 3EFOB 4F7UB 3AMUA 2UXCQ 4JOIC 3SK6A 3LWUA 3JB9G 1YHQQ 3MEAA 2GGRA 1KLUD 1FMVA 2JM9A 4QIWB 4CDDC 1ILQA 5J22A 2EGAA 4KV6A 2DZCA 1R4QB 5FLMH 1X75C 3X26B 3F2DA 1JRIA 3CMEQ 2O5IC 3G71Q 3CW2C 3HEJA 5IP7H 4JG2A 4C3JB 2Z6KC 3A8LB 4F88A 3FC3A 2RJEA 5GMKh 5KE3A 4RTUA 3F2CA 3X20B 4I65A 4BBSG 2HUGA 1WHJA 1YNND 2NN6I 2M9VA 1BCOA 3M0QA 2SNMA 2CZ6B 3CMAT 2ZXPA 2CCZA 4YWLA 2R93H 4YCUA 2YUNA 3S9WA 4WCIA 5K5PA 5LMUQ 1X56A 1Y8OB 4A3JB 1N33Q 1IYJB 3QYHB 2RI2A 4UP8A 2RHQB 2VUMG 4VUBA 4EQPA 4BXXG 3M3YB 4LF4L 4EQNA 3U4ZA 2A7YA 3RLNA 1RLPC 1X55A 3OYBA 4A3CH 3EJIA 1I4GA 2K4KA 2RF0A 2TSSA 3CP0A 1VQPQ 3J7YW 3V05A 2HCIA 3RN5A 2MMPA 4X66L 3C95A 1UE5A 4BY1B 4V190 1DD2A 1KXLA 2G3RA 2RHYA 4X3SA 4JI1L 2IL8A 4N9TA 1JBMA 5EJWA 2FG0A 3SE0A 1TY0A 3MFYA 2E2IH 1I4QA 2CKZB 2R7ZH 2ED0A 5LJ3d 5D3DA 4J9IA 3SWNA 3TS0A 5C4XB 2LX7A 4F7UF 4OWTB 4GS3A 4QVCA 3H3VC 3S16H 1XPOA 3S17H 3LLRA 3TSWA 1TR5A 3MXNB 1SBBB 3HKZB 1JXOA 1TWBA 4C92F 2DIQA 2AUJD 1VQMT 3TSSA 4AH6A 2AZVA 2K9GA 2JEBI 2LXKA 1WTRA 4C0GA 2PZWA 3U23A 2QGFB 5C3EH 3OTOL 2UXDQ 3RUXA 1MNEA 4E7KA 4IUNA 2COZA 3T1HQ 4MHEA 2E76C 4ME3A 2EVRA 1QZHA 4C8QD 1OTCA 1D1AA 4OGCA 1KD1R 1IBKQ 3HOZG 4ULLA 3KDFB 4LD6A 4JRPA 4FF1A 4EMHA 4MZTA 4C2MB 3FKIG 1S3OA 3A5ZB 3CC7A 4ZAIA 3E3XA 2DL3A 5GJWB 2L0CA 2EXDA 4FXKC 3A56A 3REAB 2K32A 5C3EB 3MFGA 2Z6BA 4DR6Q 1YJ9Q 1K73R 4BUGA 1XMQL 1WTOA 2EYFA 2H5XA 3H3VI 2E1HA 2XIDA 4KGZB 1XX8A 1WVLA 1V76A 1ML0D 2WIIB 2HHHL 1EX4A 3FEOA 3D8GA 2E5KA 4UHVA 4C8QA 2DNEA 3JCMJ 3OY9A 5LJ3h 2PZUA 4ILWA 1HFNA 1P16A 2OT2A 2ENBA 2YT6A 2B8AA 2VXFA 1OPKA 2BE5C 4C3JH 2K33A 2WAQE 5CKEA 4ODGA 1K9MU 5DLOA 1RHPA 3CC2T 3AQQA 2JA8G 3I56T 1L1OB 1W3SA 1Y1VH 2EY6A 5JAVA 3P8DA 4ME5A 2E8GA 4DAPA 2ASBA 2DERA 2XG8D 1Z47A 4D6WA 4JUVA 7AT1B 2K52A 4UDUC 1I4XA 4A3JH 3GQBA 5GAOq 4YIJA 1VQLA 4J9BA 5I22A 1QVPA 1EZ6A 2LRQA 4N0AA 4XU2A 1DYQA 1XNRQ 2DXUA 1X6BA 4R1JA 2K28A 4DR7L 2M2LA 2B63G 2CSQA 3OYDA 4FYYB 2XTIA 3GIBA 4XTWA 2N49A 1L1OC 4M7DD 1PZKD 3OMGA 2L4NA 2MGSA 1YWPA 4BY1H 3G4SA 3PO2B 1SHFA 1I81A 1JR0D 4QT7A 1CHQD 1CQVA 2NZ1D 5GMKj 5JVG3 5HURA 1GCPA 2EVBA 4JI5Q 1FJGQ 2KQWA 1XTDA 2PQWA 2F5KA 1BIBA 2F1MA 4TKOB 4LFAL 2Q2HA 1NTGA 2GVAA 2KOLA 2I0QA 4RTYA 3CPWP 3EA6A 3E9GA 2CHBD 1YHBA 3BZKA 4EMKA 2AK5A 1I6HH 2KRSA 5GAN7 3JCMe 3D4WA 1PV4A 1N36L 5FO9B 5IODA 1EY6A 1KIXA 3R2IA 1B3QA 5IAYA 2F0VA 4M7DA 1S72A 2HQLA 4FDBA 3CMAQ 4RCNA 2O4XB 4E2FB 1GUGA 4JI8L 3CD6A 5KYXB 2GA4B 4KY5A 2J05A 2Y0SG 2CZ1B 4K8JA 3M54A 2M0OA 1M1FA 2O9VA 5F2DA 3I4LA 2NVXH 1I0CA 2RHIA 3OB9A 3GTGH 4AFSC 3VR2A 1ENAA 4C3HG 4HT8A 2VQFL 4GNXA 3P75A 1LCKA 2KBTA 1VQBA 3L2WA 2BDOA 2JE6I 2RPNA 1SYDA 1I3QH 1JICA 3Q22A 4ZNXA 1H8KA 5IN1A 4RAUC 3LH0A 4DV2Q 3TS2A 3PTAA 2VY3A 1XQHA 1JJ2P 4PJJA 1PHJA 4QQBX 3MEHA 4D8KA 1SR3A 1PYSB 2RB6A 2VUMH 1BI1A 1STGA 4BXXH 1TS5A 3M4QA 2AQ1B 5FOBB 4PJOB 4RGOS 2PVOB 4QQGA 1X3PA 3EH2A 1UB4A 2A68D 1Q7YR 4XYOA 1D6EC 1UWVA 1KC8C 3CCUT 4KMUC 4ATOA 3C94A 3NBHA 3OYIA 2KDSA 1D1CA 5KYWA 3FRNA 1I4PA 2MQHA 3G7ZA 1N32L 2E6NA 3ITPA 4DV7Q 2ALYB 4OB0B 1IL8A 3VR5A 3BE3A 5BN3A 5DM63 2F4IA 1NMGA 2KYMA 2ICEC 4PJOC 5CKFA 1TS4A 1Y0MA 2AIRB 2DNUA 5KH6A 1VQ6T 3AYHB 4L63B 3OYEA 3K5MA 4KI0A 5IT9E 1EYAA 3URYA 1Q86R 2F0IA 1GM5A 3ULJA 1H9SA 1Y8PB 3P7JA 4KKTA 2LSSA 1B53A 4H44C 4B6MA 4XT3B 3QDRB 1KTKA 3EGDB 4Y7NH 5LJ3j 3PMIA 4M75G 5LJ5g 1H3HA 2RBMA 2BIVA 3RESA 3I72A 2RQTA 2QA4Q 3SEMA 2RQVA 1C1AA 3HOZH 2KE9A 2BTTA 5E7NA 5CGKA 2KEDA 2LCLA 2X3WD 1UGVA 2QQBA 1IGUA 1BCPB 1D2BA 3FKIH 4HN7A 3V96A 1QG7A 3H6MA 3REBB 3CCMA 5GANg 4IUQA 1K0RA 1STYA 2JN0A 2B8GA 2EQMA 1VQLT 1TT2A 2F0EA 3D6CA 2IWHA 4LF4Q 2DJFC 4RGTA 4RG8A 3OMCA 5ELFA 4PZ7A 4P73A 2OCEA 3I4OA 4PJOF 3ULLA 1PH7A 4YCVA 6AT1B 2XIWA 4OP0A 3NTHA 3I56Q 4RKLA 2I5HA 3H0IA 4X66Q 2M00A 3AU7A 3M0TA 4LDUA 5M5YB 4R55A 3I35A 1BCPC 3OHXC 4JI1Q 3EGXA 1WTVA 2COYA 1U5SA 1WTPA 4IPHA 4H02A 4RGNA 2RO0A 3PO2H 2YLCA 4A3FB 1A0IA 2XVSA 2V8KA 1B8AA 4PMWA 1E0BA 3S1RH 2NLUA 1PZID 4POFA 1J9OA 4QY7A 1TVXA 4ZUJA 1C8CA 4RG2A 2B2VC 4AFQC 2JA8H 3S24A 5IGCA 4DNTB 2B2UA 2X6LA 4DK0A 2LCSA 2DNCA 2UUBL 4TSSA 4J5YA 3NQIA 5IH2A 2LJ0A 3M0RA 1ZA1B 2E3HA 3QBYA 2QEXA 1ZEQX 4EDUA 2J7ZA 2WB1G 3OTOQ 3FB9A 5IGDA 1KABA 2QW7A 2A0FB 2LT1A 1NJIC 4GLXA 2B2TA 1J5EL 2QASA 1VQGA 1VQFA 3EVQA 4FF3A 2B63H 4A3KB 5C0XJ 3OWFA 2PUKB 1CKNB 5GROA 1KG1A 4XQNA 1LTGD 1IXDA 1XJWB 4RUGA 1SNPA 2JZ2A 1S1NA 2E75C 4APVA 1VOMA 4DK3C 5CORA 2K6DA 2EQKA 2EYYA 1BCPF 5C44G 5JJIA 4KY7A 1Z9QA 1Q81R 4MZ9A 2VB6A 3IKJA 1CSKA 1HXYD 1JOKA 2WKDA 3M7GA 4A3EB 1UNSA 5C4HA 4JV5L 1RAHB 4HA8A 1EYDA 1I5FA 3FPPA 5GAHC 4EX5A 1OXVA 1U1TA 1MHWC 1FNVA 1K8GA 4LJZC 2ZXRA 1F77A 5GAMd 4IPDA 3QXEB 2C9OA 4LMQD 2HHHQ 3R6OA 2RQUA 3TEEA 3UDGA 4B3SL 3I55T 1JMCA 4N4GA 1B50A 1QVGP 4AG2C 2F0UA 2PYKA 1QW1A 2AHOB 3DM1A 4HCEA 4OWXB 2NB0A 2VQEL 3GTKB 1WFQA 1M2OA 2CYZB 1STHA 4KJNA 4ZLTF 3CCRA 3NQTA 5ECAA 3NHNA 3PMTA 3E9IA 1V1PB 2CT3A 2GFUA 5LL6S 3A8KE 5J1ZA 4OELB 3E0EA 1T3LA 1E3PA 3C2PA 1S5DD 2D1XA 2CP2A 3VYUA 2JA5B 1PD1A 4ZN3A 4FL6A 2Y0SE 1C6VX 4IFDG 3OSVA 2DTIA 3L2PA 4B3MQ 3OYHA 3D3RA 5C3WA 4DR7Q 1DXMA 5CCAA 3PVLA 1N9RA 2N3SA 3ND9A 2RHUA 4OO1G 5IYDG 2E74C 4L6TB 1CUKA 1VQ8T 5E1FA 4X34A 4A75A 5HK0A 3HFNA 1A3TA 4LUZA 3PF4A 5ELEA 5M5YH 3VS7A 1VQ6Q 1LT5D 1NY4A 2ZJQA 5EC7A 1VQ7A 1TWHB 2NTSA 4A3FH 1SYBA 3ICEA 4E47A 3GTJB 5GAMh 1P8LA 2ZJRA 3MEWA 1WA7A 2I46A 3V7SA 2NUZA 1MMAA 1AHJB 2VB3X 4LFAQ 4G7ZC 1YJNA 3O8VA 2ABLA 4UPAA 5H1SE 1GVPA 1IL2A 1M3BA 1BBUA 2F0LA 4RMFA 3FDTA 2A1AA 2I07B 3AEVA 1O9SA 3I5SA 3QUIA 4DR3L 2E10A 2ZPGB 4BDYA 1N36Q 2KECA 5LJ3f 4RCOA 1ICWA 4AYBG 3I5RA 3QO3A 2MOXA 1WTWA 1HJDA 3P1HA 2AWOA 1QUQB 3QWNA 1VIEA 3A8HB 4IALA 3FDRA 1R9TB 1M30A 4JI8Q 4CDCC 2K5NA 1LJOA 2GN5A 4HR7B 4JBJA 2A37A 2NYZD 1WHMA 1VQLQ 2KR3A 2YLBA 4A3KH 1MNDA 4RKUE 1UEAB 2L12A 3MEVA 1Z9FA 1BVSA 5C0MA 1M4VA 2VQFQ 2EZVA 3CCSA 1AP0A 1K0SA 2JJ9A 3THKA 3HFZB 3BJUA 2DEQA 4PNYA 2F0PA 5C4ZA 1D3BA 5HGQA 5IGEA 5C0XI 2DZ9A 3DUZA 3DM3A 4F16A 4K2LA 5GAEC 1I94L 4A3EH 4M75E 2ZM6L 3G4SQ 3PIP3 2RMOA 3F8TA 2HQEA 1QVFP 2PI2A 3MC0B 4GLMA 5BN5A 1W6JA 4OB2B 1WNLA 4DR5L 4A76A 1TWGB 5KIXA 1RD9D 2L3SA 2K6AA 1PSEA 4M7AE 1S5CD 4P72A 5C5MA 1CKBA 2KI7A 1SRMA 4DUYQ 1NE8A 1X01A 2DD5A 1NAPA 4L8JA 2X4XA 5I9PA 3D6WA 3DWAA 2XICA 3TQ7P 2DKGA 3K8AA 5CMDA 2F0KA 3GV3A 1ZBJA 2FZGB 3FJ5A 3L9AX 1Q8KA 3OS5A
chains in the Genus database with same CATH topology
4DR4L 1NE3A 1M5Q1 3A0JA 4QQDA 1AE2A 4M77D 3HRTA 5JJLA 1PA6A 1PH8A 3J7ZC 5EG2A 4M7DG 3VYGA 4GOPB 4J6YA 2MWOA 3PIPA 2A8VA 1L0WA 2WB1E 4LF5L 3M4OH 1UE6A 4XTCS 4JS4A 1KQSS 1HZ9A 1BKBA 1TWHH 1VQHA 5C44H 4BY7G 3URGA 4GOPC 3J81c 4JI0L 4M77A 1Q82U 2RD1A 3F70A 1O75A 4X62L 4A53A 4PL6A 3W5OA 2DXTA 2B3GA 5C6SA 4BI4A 4IURA 3EBEA 1VQDA 4HJ7A 2YV5A 5I21A 2K5FA 5GAN4 1IBML 4IOCA 5CKDA 3JAMi 2UUAQ 2MO0A 2F4VQ 5GAMj 2R5MA 1YITT 3HRUA 1UGSB 2IHFA 2K2VA 2JA7G 1H641 2KK4A 2GF7A 3P8HA 2EFIA 1J5EQ 2CZ7B 4WJ4A 5GAOr 5IYDH 5GAN2 2Y90A 3MEFA 2YTYA 1CKOA 1AH9A 1Q86U 3LW5E 3CMET 1T9HA 3G71T 1QZGA 3PUYA 1KC8U 1K8AC 3FHWA 1MJCA 4JV5Q 2LQ8A 1E24A 4UP7A 2VS1A 2X35A 2NVQH 4NXML 2ZPIB 2LXJA 3RMSA 5GMKe 4B3SQ 4MZPA 3TRZA 4P5NA 3DLMA 2VQEQ 5IY0A 2QTXA 3A74A 4J83A 4CI0C 3LGFA 2PQAB 1VQPT 4KLKA 4C8QE 4P74A 2JEAI 5GANd 1XMOQ 2DJZA 2E65A 1IBLL 4DAMA 4FU6A 2E2HH 2BKDN 4BI8B 2UU9Q 1ZBXA 2E2JH 2DIGA 1NMFA 4JBKA 3SB2A 1WGSA 1B34B 2P0PA 3L2RA 4LWCA 1LM0A 3AHUA 2NN6G 3CBPA 2DO3A 4HT9A 3ULPA 1PH5A 1PYBA 4GKKQ 4DV0L 4IJHA 4DV5L 1ZHIA 1XPUA 1C7YA 4DR3Q 2K4YA 3KOJA 1HZCA 2YTVA 5I2MA 1YI2A 2IX0A 4YWKA 4BDZA 4A3DG 3UDFA 1HR0W 4ZTJA 1YJ9T 3S6WA 1W2BS 4DAYB 1IZ6A 3JCMg 5GANh 1NJIU 3SFMA 5HY6A 5CO7A 5CQYA 2VGMA 2RF4A 4JS5A 3OSSC 4M7DE 2JJQA 3OYAA 5GAN6 2ZM6Q 4M7AA 1A62A 3V7RA 3I7FA 3M9BA 4DR2Q 4PZ8A 3S2HH 5CQXA 2R57A 4LNQA 1G3WA 2XDPA 1BBWA 3PGZA 3RKYA 2BA0A 3KYHC 5I2SA 4K0KL 1YZ6A 2GQVA 2GVBA 5GAMf 4YHHL 1VQKA 4IUVA 4XTVA 1PH2A 4OGEA 2L3RA 4JLIA 3U58A 3PIOA 4JI7L 3RN2A 4C92B 1TWAH 1MHNA 5CAIA 1Y7XA 3M4YA 1M1KU 5CIUA 5IYCG 1UE1A 2FYKA 4M78D 4HCZA 4XTYA 3CCVA 4LUOA 3BU2A 3JB9J 1VQ4A 4C92C 3GTLH 1LUZA 1JJGA 2ZPFB 4MDXA 4JI0Q 5JJKA 5DLQE 3KXTA 1WCMH 4MZMA 2LDMA 1E7ZA 3A8GB 2HIVA 3CXCS 1MKHA 1VQ5A 2JVVA 2ZZDA 1E1TA 2NVYH 4M78A 2A19A 3RIRA 3V7CA 4LFCL 1E22A 2CKKA 1D7QA 1IBMQ 2K5IA 5CR2A 3WWVA 3T1YQ 4UC4A 4DV6L 2F69A 5L8RE 1PH1A 3OW2S 4A4FA 2MWPA 3J80c 3BDLA 2RJCA 3V8LA 3Q8DA 4A3LG 1K73C 1M4ZA 1C9OA 2R7DA 3S15H 1YI2T 5GAN3 4HCCA 4EPCA 2E5LQ 3HP9A 4A3MG 1E1OA 2JK8A 3RR5A 2LCCA 4HIOA 4X64L 3JCMb 5GAGC 4MDWA 5GANj 1VQIA 3VDYA 3CCQT 1N34L 1OYXA 3C12A 1EUJA 1H95A 4M77G 2CWAA 1B7YB 2QA4T 4NXMQ 2RHSB 3HL8A 5FU6B 2I5LX 4LW1A 5GADC 4A3GG 3V8JA 1EQRA 4L6V5 4WJ3M 4NS5A 3KF6A 3VJPA 3PUZA 2KAFA 4IJLA 4A3DH 3HFOA 3X28B 5FU6C 3H6ZA 5C4JH 2R58A 1JT8A 1DJ7B 3JB9F 1IBLQ 1HNZL 3PUVA 2JA6G 4LUVA 1HK9A 5FU7B 3CBOA 2ATWA 4B9WA 3RLOA 5JEAG 2I2LA 1WJQA 1WYDA 1U0LA 3H8ZA 3V8KA 1VQOA 1Q82C 5M3FG 3GP8A 3PO3G 1N9SA 5FU7C 4DV0Q 2L15A 1N9WA 4II1A 1LNXA 3HOWH 2UXBL 4V2SA 2RH2A 4DV5Q 2NVTH 4ALPA 1ZQ1A 2KCMA 4AQYL 1RIPA 3JB9H 4JI6L 4N4HA 1X65A 1EQQA 2R92G 5A0LA 2GCXA 2OAUA 2PVGB 3GNFB 1HZAA 3J80i 5IYCH 2PVDB 4LF6Q 3GTPH 1V1QA 1HNWL 3CQZH 4LF8L 4BBSH 5EAYA 5ELOA 4A93G 4JI4L 4QJFA 3QYGB 1K8AU 1Y1WG 3M55A 1W4SA 3HKZE 2EQJA 1Q86C 4L5QA 2K5LA 4BE2A 4K0KQ 2ZTCA 3J81E 4YHHQ 2EJ9A 3CC7T 3HKSA 2PI2E 1PH4A 4X6AH 4NB3A 1FX7A 2FVUA 2X4WA 4YCWA 2D0QB 4M77F 4JI7Q 1Y96A 3F1ZA 1SLJA 4GY5A 3CCLA 3HOUG 3OYCA 1YCYA 1WJJA 3UE0A 3BFMA 3CCEA 3WVEB 3JCMW 4A3LH 4QL5A 5GAMe 5GANf 1V9PA 3HOXG 4A3MH 2A3LA 4DK6C 4JRKA 2VNUD 1M8VA 1A63A 2X4JA 4M7AG 2CWPA 1ASZA 1VQNA 1QP3A 3M7NA 2D0PA 1HR0L 3L2ZA 2QI2A 1XNIA 4A3GH 3M58A 3G4ST 4C5GA 2YHTA 4M77E 3M53A 2V8JA 4LFCQ 3T9NA 3EFRA 2VYTA 4GN5A 3STBD 2LC4A 3I4NG 3M57A 4DV6Q 1Q81C 2D62A 4ME7A 2IY5B 3N5BB 3VYHB 3QSUA 2OWOA 2WSCE 1Q1EA 3E9FA 1S72T 1L2FA 4KUIA 4IUUA 2VV5A 4HIMA 3CD6T 5IWAL 4Y28E 4M75B 2CFMA 4GN3B 4O0AA 2I5MX 4DKAC 1OXSC 3CC4A 2DPPB 3PO3H 2QQSA 4Q5WA 2P4TA 4C92D 1YEZA 4MTNA 1U5KA 4IPGA 1XMQQ 4M75C 4XU0A 4JOIA 1P92A 1FGUA 1TWCH 4M78G 3L7ZC 2OTJA 5KCOA 3S1NH 2R92H 3F2BA 3QG1A 3M4PA 2Z6KA 1G291 4F7UA 1OI1A 4QVZA 2HAXA 3PUXA 4C3IH 4C3HH 3L2VA 1SSFA 5GMKl 4HJ9A 1HNZQ 4IUPA 1M1KC 3K7AH 1X6OA 1UGRB 4A93H 3CCLT 4JI2L 4R56A 1WQWA 1Y07A 1M90U 3WVDB 4IPCA 2HBPA 3KBGA 3UT1A 1CSPA 4M75F 1Y1WH 2RHXA 3CBMA 5FRNA 1PH6A 3CPWS 5FLXc 4OF1A 2AKWB 2QQAA 4IFDJ 3ASKA 4L5GA 4QQ6A 2OTLA 5IYBG 3GLXA 1KD1U 3CCMT 4M7AF 1V29B 5A0DA 2FB7A 3J81j 2UXBQ 3ZBDA 1WQ7A 1KRSA 1ASYA 1M9SA 5GMKi 3QZ5B 4FT4A 2DD4A 3JAMc 3AFQA 4AQYQ 2EAYA 4C8QG 3L2QA 4DNIA 3HOUH 3OYGA 2HD0A 1YHAA 2OQ0A 2KHJA 2MAMA 1K73U 4P71A 3ME9A 3GTOH 1JJ2S 2XI9A 1MGQA 4KT0E 2ZTEA 1BIAA 3SWNB 3HOXH 4LF8Q 3RKXA 2RJFA 1NPRA 3E1SA 3MP8A 3PT9A 1YJWA 1GXIE 4A3BG 2QEXT 2E41A 1YIJA 1DGSA 4LF7L 3G48A 1YHQA 3KDFA 3SWNC 3NFCA 4J8OA 2XD0A 4JI3L 4BBRG 5LJ3g 2F52A 3ZJYC 1I50H 4PLIA 1N32Q 5CKHA 1G51A 3I4NH 3CF5A 4R4IA 1UGQB 4PZ6A 4DV3L 2FHDA 4XU3A 4HJ5A 3I4MG 4BA2I 2HNIA 4C8QB 4O6JA 1SN8A 3RNUA 3CCRT 1L1OA 3J80E 1FVIA 3A5UA 4JDSA 2NZHA 1VQJA 2JA9A 2UUCL 4MNOA 4C8QC 3J7AF 4IFDI 2WACA 5M3MG 3QJ6A 4LDXA 4L5TA 1HR0Q 4OO1I 4JRQA 4NL3A 3RERA 2D6FA 1JJCB 2BA1A 3NTKA 1KQSA 4A4IA 1EWIA 1VQ7T 2EIFA 4A4KA 3RZOH 2E6ZA 1N33L 4N0AC 1YJNT 3GTMH 1Q7YU 4M78E 3OS0A 3GF5A 3CCJA 3OYKA 2UUBQ 4EMKB 2V1CC 4LF9L 2O4XA 4C8QF 2MO1A 4PJOD 3META 2WSEE 2Y4XA 3MCAB 4M7DB 3LYIA 5IWAQ 1PH9A 2DTOA 4BD3A 2BH8A 2QXFA 5ELNA 3KLWA 3CCST 2IT1A 1LOJA 4EMKC 3C4SA 1OXUA 3W1GA 4GNXB 4X9DA