5DM63

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dm6300
5DM63 5DM73 4U673 3PIO3 4WFN3 5JVH3 3PIP3 5JVG3
chains in the Genus database with same CATH superfamily
1N8RC 5KYLA 5M3FH 1B50A 2IT1A 4DKAC 1HZCA 4PG3A 3D4WA 2RDHA 2RSOA 1UE7A 4IQZA 2KJXA 3S1NB 4CJ2C 3I72A 2NZ1D 5M5XB 1QVGA 3BJUA 5AJ3L 1EIHA 4LF7Q 2JQOA 4ID6A 1PRTD 1V8QA 2ZXOA 2WAQB 3TP7A 1N34Q 1STNA 5GQOA 3GTLH 1X65A 2YV5A 2B2UC 1VQ4A 2VQEL 4CKBA 1VQ6A 2UXDL 2OXPA 1E1OA 3JAME 2O5JC 4FXGC 3HKZE 3SHLA 1W2BA 2JA8B 1AZQA 4A93G 4OWTB 1HR0Q 2UUCL 1AW7A 1FNVA 4A3BB 2EYFA 2B3GA 4FF3A 1MJCA 4A3LG 3SK8A 4I65A 2AKWB 5C4JB 1KDBA 1LTSD 4B3ML 4BBSB 4F8MA 1CUKA 3LWUA 5C44B 3CCLA 2ZT9C 1GUWA 2KECA 1K73C 3K5NA 4A3DB 5FLXL 3RMHA 4XTCS 3PSIA 5DM73 4HMJA 4DR7L 4C3JB 1AFPA 4UDUC 3I91A 1JWUD 1XMQL 3PO2H 1LABA 1DOMA 3HKSA 2L1BA 3DMUA 5BR8L 1OTCA 3B6YA 4L5QA 2A6EC 1BR9A 3KFUA 2F4VL 4X65L 1DD2A 2XN9C 3J7ZC 5C4HA 5LMUQ 2SOBA 4E6IA 1PXUA 4A4IA 2XNAC 2ALYB 1JOQA 4DAVA 4N8FA 2F0TA 1EQTA 2JA9A 3A8KE 2EYPA 1QVFA 3I55A 1PH9A 4NXML 2JA7G 3TP8A 5CV6A 5JJIA 3JC66 1ZXTA 3MWYW 2N55A 5IT9L 1G6PA 3QR8A 1GXDC 4JI2Q 1D2BA 1XTCD 2WAQE 1S3OA 1XJVA 4DR4L 4QY7A 4WORA 1K8AC 1S72A 4IPCA 2PQEA 4A3KH 4FF4A 1NMFA 3SK4A 3F2BA 3J81L 4A75A 1JB7A 2L0CA 2FJ2A 1VQKA 4B3MQ 4X64Q 4JI6Q 2JA6B 5ISRA 1Q12A 3UE1A 1EQVA 1G51A 1A0IA 3OTOQ 1XMOQ 3KLSA 3KJPA 4K2KA 3NWSA 3HOYG 1ET6A 2AUJD 4HTHA 3NTHA 2F0SA 1J6QA 2E5LL 2PI2E 1QNKA 4DR1Q 1S40A 2HCIA 2HT1A 1HR0L 4BY1G 2UUCQ 5ELOA 2BA1A 3VDYA 5C3EB 1A3VA 3FRPB 1N32L 2JK8A 2HUGA 3E9IA 3T4AC 2V4DA 1N33L 4JI8Q 2E2HH 2WAQG 4Z9CB 1KABA 3Q24A 2K5DA 1XWEA 2EXDA 3TMEA 2UUAQ 4GKKQ 3J80i 4C3JH 4NB3A 2F0NA 2XGTA 4A3CG 5C4XB 4X66Q 1SYBA 3CCQA 3J80E 1PTOB 3GTPB 4ZUJA 1R4PB 4LF4Q 4DU9A 1TR5A 1L1OB 3G7LA 4QL5A 4GNXC 4KKTA 3A5UA 1XTDA 3CC7A 1MD2D 1K83B 1EL0A 3PUYA 1LLRD 4TQUS 2XSCA 1QVCA 1SYGA 1TS3A 1Y8NB 2YTVA 2KHJA 1X32A 4YIJA 4JI2L 4R4IA 4RAUC 1CQVA 2ICEC 5C4XG 4LF9Q 4Y7NH 2BH8A 4UP7A 3PO3H 1G2TA 5EJWA 1WOCA 1AH9A 3KF6A 1CFMA 2A68C 5C3XA 5CBEE 1OXUA 3NWTA 4TVAB 3ONAB 4NP5A 4RMFA 4G7OC 4OGQC 1G91A 1QG7A 1RL2A 2SEBD 3CQZH 3L9AX 1CZWA 1NR4A 1HNXQ 3PUVA 4KHPL 3S2DB 1STGA 1I4QA 1CA5A 5C6AA 3R3OA 4JI0Q 3NBHB 4ME3A 2F0MA 3FPUB 2B63B 3K0XA 1S5BD 4RKLA 2L5TA 2R7FA 5ELNA 1LTBD 4BBSH 4DV6L 1VQFA 3TP5A 3S16B 5JOBA 3WDNA 3M4QA 3NP8A 4KN7C 2QA4A 3GTGB 2PZTA 3S15H 1OXXK 1DONA 2IJ0A 2SNMA 3U50C 4X64L 2PNRC 1I4RA 1PRTF 4K2LA 1SR3A 1CHPD 1GHJA 2PZWA 4LMQD 4KLKA 3D6WA 3I4NH 2F0FA 2QEXA 4HJ8A 2WV6D 4QMGA 4L5RC 3W3AA 1PRTC 4RH6A 3GV3A 5BN4A 2F0LA 3TS0A 2JA5B 3KOJA 2RSNA 2PZUA 2VB2X 4H0LC 3PIP3 5DEHA 4JI4L 2TMPA 4ZCKA 3S2HB 2ES2A 1Q1EA 5C5MA 3VR3A 1PZKD 2PNHA 3GV6A 2JA8H 4POFA 5FK9C 4XYQA 3GTQB 1RIPA 4CHTB 2LKVA 1SNQA 1B8AA 1CTMA 2Z8LA 2KHSA 1TWGB 3Q6SA 1Y1WB 4MIUA 3I3CA 4YWMA 1C48A 5H1SE 3NBIA 1CM9A 3EN2A 4KKUA 3AFQA 1BUVT 3CCRA 1EQRA 4BXXH 3TZDA 1NE3A 3E6ZX 3VA5A 4RGNA 1PRTB 4AQYL 4DUYQ 4YWKA 1DYQA 1JJGA 4Q0FA 2ZJRA 4LF8Q 1HHVA 4QJFA 4A3DH 5FLXc 1EQQA 2Y0SG 2WKDA 3NK9A 4C3HH 3OW2A 5M3FG 1Q86C 3KF8A 1LO5D 2G5DA 3NQTA 4RWSC 1F2LA 3PV0A 1Y8OB 2EJGC 1N36Q 3VYUA 1SXTA 4JW0A 1EZ8A 3FKIG 4KMUC 4AYBE 4BBRG 4F87A 3UDIA 2ICIA 3PQIA 3T51B 3TSSA 3F2UA 4JI7L 3PGZA 2AMCB 1GUTA 2ZTCA 1CT1D 4P71A 3KK7A 1AEXA 2K1BA 4GS3A 1EYGA 3BDCA 3MA2B 3RUZA 3HOWB 2R93G 4P2CB 1E2ZA 2EZVA 4OL7A 2L12A 3TREA 2GN5A 3OYYA 4MZ9A 3M4YA 1Z7TA 4DPGA 2IWHA 4A3CH 4RG1A 4R8IA 3GTJH 1MHWC 3S1MB 3R2TA 1HXYD 3EBEA 1HTLD 1Q90A 2LS01 2RF4A 3RR5A 2EDGA 3A0JA 4A3MG 1N33Q 2QW7A 4DGZA 1GOZA 1ZKOA 2K5WA 4NXMQ 4K6LA 1VQPA 4JI1L 5IGEA 3RLFA 3BZCA 5COYA 3L0OA 4C2MB 1EY8A 3QOJA 1UEAB 4GKKL 3MVVA 2D5DA 2WKCA 1EEFD 1C0AA 5FO9B 3HOYH 4IUUA 5EBCA 2EXZA 1I5FA 2I5MX 2NVQB 3J7YW 4KY7A 2F0GA 1ILPA 4IUPA 1NY4A 1EIGA 2N78A 2F3VA 1C8CA 5GROA 2EE1A 4DR5Q 2F1MA 3MXNA 3STBC 5M5WB 2AWNA 5BR8Q 3S1QB 1R9TH 1WFQA 2NVXH 4GOPC 1TS4A 1PFNA 5IYCH 5IYDH 4A93B 1B9NA 3VR2A 4J1MA 1HNWL 4R4TA 5M3FB 3D6CA 1JR0D 1F77A 1QJOA 1DGSA 3CMEA 1N32Q 2QILA 4J8QA 3D0FA 3K8AA 1I94Q 4IFDH 4A3JG 3JAML 1BCPF 2VL6A 4JV5L 1KTKA 1U0LA 1ESFA 4K8IA 4IOAA 4DUZL 2UUAL 3I4NB 2PW7A 3OOCA 4JI1Q 4HIDA 1B2TA 3VYRA 3MFYA 1BDOA 3GTLB 2L11A 4ODGA 2K6AA 3LWEA 1MBYA 4ZKCB 5IWAL 4RHRA 3I4MH 4P73A 4C56C 5M5YH 1PH2A 2A74C 4ZQ3A 1PV4A 1MSHA 1T5EA 4AQYQ 4BBSG 4PMBA 1RJTA 4XQQA 2NZHA 4NPSA 4K5WA 3L2PA 2OQ0A 1G2SA 1L2FA 5E4XA 1JOOA 4LF6L 2KCCA 2BA0A 4WJ3M 1PMRA 2V1CC 4P75A 2K14A 4DNIA 4DXGA 1CKNA 1O7LA 2PCFB 4JVZA 1SE8A 1KRSA 4C1NI 4BXXG 3RNUA 2ZJQA 1F9QA 3CPFA 1TY0A 3S16H 1V43A 1W6JA 5EPJA 1OO9B 4KN4C 1FNWA 1D1IA 2DNEA 4GLAC 3PIO3 4LFCQ 1PTOC 2A73B 1HNZQ 2N88A 1VQDA 3D4RA 1HH2P 5JEAH 1O80A 1R9TB 1CQFA 3CPWA 2FMMA 1JJ2A 4DV2Q 1JCKB 2CQOA 4RA8A 2KUMA 1PHJA 4OWXB 2AQ3B 1KAWA 4F88A 3HRZC 4IUVA 5J22A 4BY7B 4YHHQ 4HEDA 4ZYSA 3F2CA 3BG3A 1A8VA 1XX8A 1GO3E 3SE0A 5JEAJ 4KTAA 2R7ZH 4UAIA 3VR5A 2IW3A 1YEZA 4X3UA 1L0XB 2F0PA 3M7NA 5AFWA 2B2TC 1SNMA 1GUNA 2WINB 1T9HA 1A63A 1A6XA 2B29A 2FXQA 2GVBA 4LF6Q 1H9SB 2DJGC 2A6ED 1YITA 2AQ1B 1AE2A 1STBA 5D3IB 4QCLA 4X3SA 1MI2A 3K0YA 1PH6A 1H9SA 5KIXA 4A3GB 1KLGD 3CCJA 3W5OA 1B9MA 1U5KA 4A3DG 2NTSA 2RVLA 4UY8C 1VQ7A 1HFGA 1BO0A 4A3FH 5JJLA 1KDAA 5C44G 2HIXA 4DK6C 1I6VC 2CH4W 3DEOA 1KIXA 4CKEA 3HKZB 1VF5C 3HFZB 4A3EH 4C3HG 3KDFA 1K8GA 2JEAI 2HCCA 1SMYD 3LGJA 1IBML 2R7DA 2RBMA 5I4DA 2F4IA 4KJOA 4YWLA 1SE2A 1RCVD 3ULPA 4MTKA 4A76A 2C9OA 1V1PA 2MJ8A 5C3EG 4K5XA 3CD6A 5C44H 3OSOA 3G6JB 4FVMA 4LUZA 5IGGA 4HJ5A 1LACA 4I7AA 5ELDA 1B3QA 4GN4B 4IFDJ 3M4OH 3GTKB 2C5CA 2F3WA 3A7LA 1TKWB 5EPLA 5GADC 3DXJC 2BOSA 3T16A 3NBHA 2QDBA 4A3MH 1QNUA 4EQ5A 3ZYYX 1HRJA 1FNUA 1W6KA 2CWAA 3G48A 3HS0C 1D5MC 4YY3L 3A5ZB 4WJ4A 1D1KA 1Y1VG 4BWGB 3SK5A 2NB0A 3GO5A 3QJYA 2JA5H 1I50H 3GP7A 5CV7A 4IO9A 3E0JA 4LJZC 2E2IB 1MSGA 1E2VA 2CKZB 3LX0A 4F7XA 2CW0C 1PH4A 4BY1B 2ID0A 1WCMH 2PO4A 3Q22A 3M7GA 3BVZA 1TXYA 1FGBD 1X3QA 4C3JG 1WTVA 1A62A 4A3LH 2KQ3A 1KNAA 2WP8J 5FO8B 2VZAA 2RHQB 1N9WA 2KHIA 2NTTA 2Z4IA 3ULLA 3X3MA 4LW1A 2EPBA 1PH1A 3D8GA 1IXRA 5E1FA 1VCIA 4BBRH 5I2YA 4XDXA 1SYDA 4KY6A 5CYUA 3A56A 1ML0D 3R2IA 4OX9Q 5L37A 2EYLA 3IFTA 3IAYA 4LAAA 1WTQA 3BYTB 4IJLA 3DHQA 1VQCA 3H0GB 1S5DD 2R3ZA 1P8LA 3H3VI 2VY3A 3EQLC 5LL6X 3MAQA 1U4LA 1Y1VB 2A6HD 1KHIA 2NZOA 4JI7Q 1GM5A 1HUMA 2N49A 2DUDA 4NW2A 4KK7A 4B3TL 2IPKD 5C0XH 3I56A 5FOBB 1PYSB 2CWPA 3SK6A 1GVPA 5JJKA 4GLVB 3GTOB 1RD9D 4FXDA 4OONA 3MEFA 1XPRA 3F2DA 3I4MG 4FNFA 3H91A 3CCSA 1QB5D 1CK1A 1SRUA 4A3KG 3HOWG 1LT4D 4FDBA 2AHOB 2K4KA 1VQLA 5BN3A 2F0WA 4APVA 2C35B 3K81C 2OTJA 1J8IA 2NN6I 1Y69U 5HGTA 4AYBG 4C3IG 3E5SA 1FJGL 2FFKB 5HGQA 3RD4A 4DR5L 1EUJA 3MXGA 1SAPA 2Y0SE 1S5FD 2R93B 3KDFB 4X62L 2MO1A 2B2VA 5IYCG 5IYDG 3AEVA 2K5HA 3FVQA 3D31A 3T1YL 2WACA 1HTPA 2K50A 3P75A 1PZJD 4KD4A 1CHQD 1CZGA 1HJPA 3AYHB 1ICWA 1V1OA 3TBIB 1WCMG 1A3UA 2MO0A 2RCFA 1M4VA 1K28A 2EJFC 4HIOA 1ONLA 2EYJA 3V2TA 1S5CD 1I6HH 5IP7H 4XXEA 1KL9A 5IGBA 1C9OA 1TWHB 4U673 1CKMA 2H5XA 3EA6A 3FPPA 2NVXB 4DA2A 3CXCA 4LF5Q 1J9OA 1MGSA 3G4SA 4LF4L 4EQOA 4HSPA 4KY5A 4K14A 5CV8A 2XTIA 3TDQA 4CDDC 4IPGA 1VQJA 2UU9L 4TKOB 1JB3A 2N8NA 3T1HL 4A3KB 1SFOB 2CH4A 1VQ5A 5JVH3 3VA7A 4DR1L 3I8ZA 2D62A 4JI3Q 4HN7A 2UXBL 1FGUA 1H9MA 3E0EA 1JWMD 4A3IH 4DAMA 2BH2A 2PW5A 1UAPA 3MFGA 5IWAQ 2HDLA 1B3AA 4KJNA 5I6YA 2E2HB 1TIID 2YYZA 1JWSD 3KJOA 4H13C 4ZUIA 3Q0AA 4DV5L 4JOIC 4LF5L 2KA7A 3SXHA 5C3EH 1IYUA 5DM63 4J6HA 4EVOA 1NMGA 2PMZE 3CCEA 3D4DA 3GTPH 1KXLA 3AMUA 1RKNA 3GDEA 2BDNA 2WB1E 1YHBA 1FL0A 1F2ZA 4QQBX 4S3SA 2BCOA 5KNCA 4DAYA 2DY8A 1M8AA 2QEJC 2ZJPA 4G7HC 5C0XJ 5IGFA 4M1UB 3GD7A 3D3RA 3K5OA 1TU2B 2KEEA 3H94A 3RZDH 4FO2A 1ENAA 1HA6A 5J3BA 3M3YH 2K52A 1YJNA 5I6WA 4U68A 5FLMG 2YU9H 4X62Q 1I4XA 1SYCA 4N8X1 5DLQE 5T1IA 1I4GA 3K58A 4JI8L 1KLUD 2EVBA 1U4RA 4A3MB 4LFAL 2A69C 3M9BA 1HNZL 4JBMA 2K5VA 1ENCA 1PA6A 2I07B 2Q2UA 4IUNA 4L6TB 2X6GA 1BXTA 1GUOA 1Q46A 2M9VA 2CQAA 3HG9A 3OWFA 2Z9HA 1W3SA 5KRUA 2Z0SA 2VQEQ 2F0JA 2FHTA 2HD3A 4ALPA 2J7ZA 2MHVA 1QCBD 1LT3D 5IP9G 4BS9A 2VQFQ 1M1KC 1H95A 1Q8IA 1IKMA 5LMNL 5D14A 1NAPA 3KF6B 4B08A 4L5TA 4X65Q 3TS2A 2O2LD 2IL8A 3HGBA 4JK1C 5IGDA 1PVOA 3K57A 5C4ZA 2EY2A 4PNYA 3I4MB 4DV3L 5LMNQ 4QIWB 1IBKL 5FJ8H 1VQEA 3L3OC 3PO2G 5CORA 4OWWB 3MXNB 2DN8A 1B44D 3OMCA 3MXUA 2VUMG 4G4KA 1VDZA 1YBYA 4RKBA 4QGUA 1SROA 1IKLA 5E7NA 3URYA 2KEDA 2F0DA 2IX1A 3E3XA 4LNQA 2QF7A 3PMFA 1SDFA 4CJ1B 3KBXA 1QE6A 1LTGD 4GZYC 3N52A 1KDCA 2ZTDA 2QCPX 1KRTA 3MHBA 4A3GG 2H1EA 1EFID 1ET9A 1N36L 2OTLA 3A8IE 3NXWA 4LF7L 3S2HH 1ESRA 3I70A 4B3RQ 3NQIA 3DWPA 2VUMB 1DZ1A 2JE6I 4WRDA 2J4XA 4LFAQ 3NTIA 2PQAB 1WTRA 1K8OA 2B2TA 2LSSA 3K7AB 4OO1H 3HOVB 1OXSC 4ZAIA 3HOWH 4UPAA 1E0BA 3H6MA 4RHSA 3BDOA 4O1NA 4C3IH 1ZYRD 3JAMi 4OHJA 1DOKA 5JVG3 2HHHQ 3FEWX 3GTGH 3M4OB 4DF7A 1FYCA 3SGIA 1JICA 3NE5B 1TWFB 5IIFA 1E1TA 1T5XD 3EFXD 1UE1A 1PFMA 2BE5C 4P74A 5EPKA 1NJIC 4I7ZC 4CGYB 4YCVA 2B8FA 5J1ZA 4JYAL 2F0UA 1GHKA 1WYDA 2SNSA 2I0QA 1GUSA 1M90C 5C4JH 3N6RA 3V05A 2O4XA 4BA1I 3DEPA 1VMPA 1YHAA 3H3VC 3VR4A 3J80c 2UXCL 3KYHC 4TSSA 3SDZA 3M85A 1PLFA 4A3EB 3HOZB 4K0KL 3RZOB 2Q8TA 4DV1L 2DNCA 1YNND 1S4ZA 5AJ3Q 5TSSA 3VYTA 1DM0B 3I73A 4OO1I 3ER0A 1E22A 4H44C 3PUWA 5M3MB 2E8GA 4GKJQ 1EYDA 4G57A 4DXFA 1V9PA 3J7A5 1ASZA 3EROA 1K3BC 5I2XA 4DV7Q 1DJRD 3FDTA 4R4OA 2JA6H 1XXGA 3W1BA 2XWBB 2OT2A 1EY6A 4C3HB 1J5EL 3S1RH 1TVXA 3TN2A 1H9RA 2EYMA 5CV5A 2GVAA 2IX3A 4A3EG 1K8MA 1MJEA 1BVSA 3JAMc 4KI0A 2YTYA 1SEBD 1WTWA 5F2DA 2BDOA 5FKAC 2L55A 1WD0A 2HQLA 5JAVA 3WOEA 2H4OA 1EYCA 3PIOA 2KBNA 2EY5A 2ZTEA 3HOXB 5JPNC 4A3IG 1DOLA 1ENFA 4GNXA 4DR7Q 2E74C 1X55A 4DR6Q 4KD3A 2KOLA 1PFSA 2AUKA 1I50B 3S1NH 4EX5A 4LWCA 4L63B 1UWVA 1Y1WH 3HOVG 1AE3A 1LYLA 1AN8A 3S9WA 4NKLA 3NUCA 4JG2A 2B63G 3LNNA 2IY5B 4OELB 2UU9Q 1NUCA 1HPCA 2K75A 3QB3A 2EOTA 4NDXA 4PZ6A 5G3LF 3NEMA 1JC7A 4DR4Q 4P72A 1TS5A 1JOKA 2FINB 5CGKA 4KHZA 5EBDA 2DGYA 1V1PB 4PZ8A 2VXWA 4C2MH 1SBBB 3WOFA 5IGCA 5IP7G 4POGA 4GN3B 4A3JH 3OHXC 3RZOH 4RGOS 4DNRB 4MNOA 2E2JH 2KENA 1YI2A 1TWCB 1Z47A 3KLRA 4DV2L 1F9PA 2JJQA 2UXBQ 3X3NA 1YNNC 2F52A 1B7YB 3OW7A 4K5VA 5M3MH 1XMQQ 3J81i 1RTOA 3PF5A 1QWYA 3K80C 5ELBA 3NENA 1ASYA 1G6ZA 1YNJC 4A93H 3VYSA 1FVIA 5CMDA 5BN5A 1UNSA 4X3TA 1EYAA 3BDLA 2F0OA 1FJGQ 3CCUA 3J7AV 1II3A 2LMCB 2NWGA 1ICFB 3U9OA 2RDGA 1JMCA 2I46A 1TWHH 2MPMA 2RA4A 3K7AH 3K5LA 5IT9c 4B3SQ 2JA7H 4IUQA 1F9RA 2VB3X 4C3IB 4DUYL 1BBXC 5D3DA 3CU7A 4GLXA 4V190 5KNBA 5IY0A 3PO3B 2PMZB 2XVSA 1IHZA 3ND9A 2ATWA 3CP0A 2B2VC 4HAEA 1BKBA 1XYIA 2KCTA 2F0HA 2CVRA 2QKIC 2K04A 2K5QA 1PTOD 5I9OA 2K33A 1Y14B 3S24A 4N9TA 3F8TA 2EIFA 4WJWA 2NBFA 1TWAB 4EQNA 1E3PA 4MTNA 3CQZB 2K05A 3TEHB 4A3BH 2RHSB 3CC2A 3CMAA 1WD1A 2X6LA 2CFMA 5JPMC 1BBUA 3EVQA 3QOLA 3RN5A 1IBLL 4DR2Q 3HOZH 4MN3A 4XT3B 1XNRQ 2PQAA 1VF7A 1PYBA 5C3WA 5CV9A 5T1GA 2ASBA 2Z6KA 1CKNB 1PH5A 1BF4A 4A3BG 3U4ZA 5IYBH 5M5XH 1IL8A 3TP6A 4K8JA 4ABNA 1HNXL 1YJ9A 2F0KA 4LK1C 1QOHA 1YJWA 1EWHA 4HCEA 2OQKA 2JA5G 4BA2I 1Y1VH 1ZEQX 1TWFH 1B53A 1LM0A 5CV4A 3S1RB 2SDFA 2D2CC 4FF1A 4HJ9A 4OEMB 5EAYA 2F0QA 4B9XA 3M4PA 1SYEA 1BQQT 2OWOA 3PUXA 5EKKA 1I4PA 3DWQA 5LMUL 2J0TD 3HOUG 3HP3A 1WI5A 2XRSD 3FHWA 5IODA 1O7YA 2E2IH 1JORA 3ICEA 4OIKA 4HSVA 2K32A 2AWOA 3OPOA 4IURA 1QZHA 4DV4L 4KV6A 2Z6BA 2NVYH 4DN4M 5GAHC 3NHHA 3O13A 2A69D 2MQHA 1UE6A 1WVLA 1KAAA 3DWAA 5K36H 4ME5A 4DV3Q 4JYAQ 1SYFA 3U58A 2Q2TA 4A3GH 1X3PA 5LL6S 4OO1G 2K28A 4HIMA 4DR2L 3PF4A 3VR6A 5GAGC 3UDGA 4AIMA 3NELA 1ZYRC 2WFWA 4YHHL 3EJIA 4DFAA 3OTOL 5E4WC 1MKHA 2ZXPA 3H0GH 1PZID 3H09A 1RTNA 3AU7A 1PH3A 2JXMB 5GAEC 3PIPA 4GOPA 1VQMA 3DUZA 5K36G 2E76C 3S2DH 2EJMA 1A2TA 4DUZQ 4OX9L 5HURA 4NXNQ 2JA8G 2PPBC 4A3FG 5CBAE 1IYJB 1UE5A 3S14B 5C4XH 2CW0D 4B3RL 3QWNA 1G291 3HOXG 4HMIA 1K83H 3KUPA 1EOTA 1Z6HA 2F0IA 3PCOB 3U9SA 2D0PA 1X54A 1D8LA 2BE5D 2JEBI 4JI0L 3J80L 3PO2B 3HOUH 3GTKH 1BBWA 3ND8A 3HEJA 1UEBA 2NN6H 2GA4B 4DNTB 5FO7B 1CSQA 2D0OA 3OIPA 4A3IB 4CDCC 3F1ZA 2JSOA 4Y7NB 1C7YA 3C1EA 2E2DC 4XQJA 4JBJA 2ENBA 1KC8C 4HJ7A 3HOYB 2F0EA 2B2YC 1QUQB 3WWVA 2E5LQ 4DV0L 1WTHA 4A3JB 2L9HA 3FKIH 4B9WA 4ZLTF 2JA6G 3BU2A 3Q23A 1JT8A 2B8GA 3RLNA 1L1OA 1X56A 3G6EA 2B2WC 2NN6G 3SEBA 4LFCL 3P1HA 3KF8B 1G8ZD 1RODA 3ERQA 5A2QE 3ITPA 1PH7A 4DAPA 2RKSA 2KCMA 1VQ8A 1XNQL 4DV4Q 1VQAA 2CCZA 1SE4A 1WTXA 1ILQA 1IZ6A 2G9DA 3A7AB 5FJ8G 3CRLC 3MXPA 3C46A 3RZDB 2QGQA 5JJZA 1QILA 2RQXA 2NVTB 4DV6Q 4RFBA 4XIGS 5KYIA 2EQSA 3S17H 3IKJA 3MC0B 2L4NA 4X3KA 1K3RA 3KLSX 1SJED 4IALA 3A74A 2A1AA 4RCOA 5ELCA 1YVCA 5DNFA 1LT5D 2K7VA 3R8BA 4K0KQ 1LTTD 3U4VA 5LHY1 3CAMA 1BCPB 1X3FA 5EGTA 1LTID 1B4OA 1XMOL 4DAYB 1HZ9A 2HHHL 1PFBA 5IT9E 3GTMH 3FMCA 3J81j 5M9OA 5IE8A 2EY1A 3DM3A 4ILWA 2O5IC 2JN4A 1D6EC 3I7FA 1HNWQ 1TWGH 2NUCA 4YCUA 2XIWA 1VQOA 1RHPA 2K03A 4M8AA 4OIJA 4H7BA 1EFWA 3I4NG 3S1MH 3STBD 4DK3C 5I9PA 1EWIA 3TZUA 2NYZD 3KLWA 3RN2A 4J15A 1B1ZA 1A15A 3OIQA 2IHEA 1SN8A 2Z6KC 1HQRD 1TS2A 4BBRB 5C0XG 1OXTA 2UUBL 1QZGA 4UP9A 1I3QH 1EY5A 1FD7D 2QDLA 2Q2IA 4A3FB 1JE4A 1H9JA 4O2DA 1YNJD 1TQOA 4DK0A 3I4LA 3NPPA 5M5YB 1F2MA 1SFOH 1TY2A 4UP8A 4HJAA 3L7ZC 1IBLQ 1GUGA 2ZM6Q 4DR3L 2B39A 5ELFA 5IOCA 1UUPA 1D5ZC 4R9WA 2OCEA 1TWCH 1EY0A 5EKLA 3UE0A 1DCZA 1L0YB 1SNDA 3PUZA 1VQHA 3I90A 1HQMC 5KGUA 3HKZG 1HR0W 1MIUA 2M00A 1EU4A 1I6HB 3GTOH 2D9UA 2WIIB 5IP9H 4B3SL 2VW9A 5K5PA 4HR7B 1LTRD 5KNDA 5E3FA 3CRKC 4IOCA 1JE5A 2R92H 3C3LA 1Z9FA 3MEHA 4PQXA 1XNRL 1YNXA 2NVYB 4CDEC 4BY7G 1V1QA 1IBKQ 3HOUB 1GJXA 3R93A 2Z4HA 2PYKA 1O7ZA 1EEID 1F2YA 1IL2A 2EYOA 3M3YB 5DAUA 2YTXA 3W2DA 2VNUD 2R93H 4CKCA 1BNZA 3TQYA 2R61A 2JYOA 1VMCA 3ULJA 3SVMA 4ZRZA 5FLMH 4DR3Q 4JI6L 2Y0SB 2X69A 1HUNA 1TWAH 3P7JA 1N34L 1GD7A 1Q8KA 4HCSA 2EYHA 3H0GG 1L0WA 2Q8IB 4R1JA 1KQSA 4QIWE 3GTJB 1VQ9A 4RGTA 2VS1A 4GOPB 4FF2A 4Y52H 1OXVA 2LFNA 2A5HA 1PH8A 3AB9A 4JC0A 1Y8PB 2HIVA 4H02A 5G3LD 2B2YA 1EIFA 3BZDB 4CBVA 1EY9A 1Q81C 4ULLA 1KD1C 1SLJA 4JI5L 2L15A 3ERSX 2LY7A 2WB1G 4V0BA 1CSPA 3V96A 1IW7D 1CI3M 3IL8A 4NXNL 4O42A 2UXCQ 4B3TQ 4OXPA 1STHA 1XPUA 2A8VA 5LMNW 2F4VQ 4JOIA 2IX0A 3DM1A 2ZXRA 4L5SA 1LTAD 3FP9A 4JPBW 2LXKA 1LT6D 1E2WA 1SNOA 1J5EQ 1VQGA 2NVQH 3TRZA 4JV5Q 3T1HQ 2UXDQ 4ZKBB 2R92B 3T56B 4IPDA 4IFDI 1K9MC 5D65A 4DV7L 2RDFA 2F03A 3H15A 4JI3L 1EY7A 2KVMA 4JI5Q 5JEAG 4JBKA 2DY7A 1DXMA 1YIJA 2WB1B 4DK1A 2JP1A 4LFBL 3IFDA 4L8JA 1U9RA 2MFIA 4ZK9B 5ELEA 4DV1Q 4R8NA 2B2UA 2IHFA 4KHVA 1B70B 3CF5A 1NSNS 1X3EA 2EY6A 1O7IA 2R7ZG 1X6OA 2R6GA 1RF2D 3BYYB 3T1YQ 1JQYD 5CR3A 3S14H 3HZXA 3AFPA 2ZM6L 2NVTH 2LXJA 2F3IA 1R4QB 4IJHA 3HOZG 1WCMB 1K0RA 2MGSA 2E2JB 3CCVA 1EU3A 2YU9B 3W1GA 5NUCA 3MZ5A 1HZAA 2KCNA 4AYBB 1PYWD 1C4QA 1NR2A 5M5WH 5C5LA 2N3SA 4KKSA 1SMXA 4N9PA 1Q82C 3E9HA 2XRQD 5KEEA 1VQBA 1STYA 1STAA 5CC4A 1AP0A 3PO3G 1PTOH 1SNPA 2OF1A 1X9NA 1Q3LA 2AQ2B 3GTMB 1Y1WG 3HOVH 2MUYA 1WJJA 1U4MA 1Q1BA 1NTGA 3BZKA 2Q2HA 4R4QA 4UHVA 1HA5A 3C1FA 2TSSA 3NSWA 1NBWA 2Z1CA 3T13A 1CKOA 3CKIB 3BVGA 1XNQQ 3RLOA 4IFDG 4RCNA 4PMCA 1TT2A 4MHEA 3SR1A 3GTQH 4O0AA 1LTLA 1U4PA 4AH6A 4DV0Q 1WTOA 4X66L 2A19A 3C2PA 1GKHA 4YCWA 4PMWA 1YHQA 1HFNA 4R4CA 2E75C 1I3QB 5C0XI 1EZ6A 1BCPC 1EY4A 4FYDA 3GQBA 3HOXH 4LF8L 3T53B 4HIKA 1H9KA 4C1NK 1SJHD 4EQPA 4IUTA 5J39A 2Q8RE 3FKIB 1Q7YC 1SE3A 1YZ6A 3I4OA 3J81E 3QG1A 4QUFA 3G71A 4QF4A 3OWEB 3P20A 5M3MG 1X3GA 4IPHA 2FMCA 4EGVA 1EOVA 3S1QH 3UI2A 1CA6A 4PZ7A 1SMYC 3A54A 2PI2A 2MNAA 2HDMA 3J81c 2R7ZB 2VUMH 1KNEA 4JBWA 2F0VA 4LFBQ 1BOSA 4XYOA 4JCVE 1NNXA 2R92G 3S15B 1E7ZA 1VQIA 3J7AF 1EIYB 1D5XC 1P16A 3CW2C 2P5ZX 3OMGA 2A68D 3BS1A 1XPOA 4DR6L 2JA7B 4XT1B 1JJCB 4CJ0B 2G9HD 3KBGA 5HY6A 3A55A 3ZJYC 4NMZA 4LUVA 2B63H 1STEA 4KHPQ 1RDPD 3CC4A 4TRDA 4BY7H 3UDFA 1LV9A 1IYVA 1VS0A 1IW7C 2VQFL 2CHBD 1I4HA 2K5NA 3I2ZA 1O78A 3UDXA 3K59A 4JI4Q 3CCMA 2B2WA 1L1OC 4GNXB 1SSOA 4IZ8A 2UUBQ 3AQQA 4GKJL 3QO2A 4FXKC 1HCZA 4XQNA 5EQ0A 1VQNA 2DJFC 3EIVA 1LUZA 3K7UC 1S5ED 2A6HC 3MTSA 3K5MA 1AZPA 4YY3Q 5A35A 1A2UA 2K01A 1SNCA 2MP1A 4X6AH 4QB4A 1E24A 1PDQA 5IYBG 4QUCA 1A3TA 2XWJB 4RGMA 3IRBA 1K0SA 5FLXE 3CHBD 3DLLA 3QIAA 4DV5Q 2M2LA 4K6DA 1HZBA 1QUQA 1BCPD 4CDFC 2OEOA 4PV1C 1WTPA 4WFN3 4LUOA 1IBMQ 4G7ZC 1EWCA 4FP5D 2HQEA 2I5LX 5EKIA 5A2QL 3K6OA 4GN5A 3BVMA 2I5HA 4BY1H 1F9SA 3S17B 4IN3A 3Q8DA 1FR3A 4Q5VA 3H3VH 2RCNA 1PTOF 1D7QA 3NTKA 1I94L 1NCVA 4LF9L 3A8JE
chains in the Genus database with same CATH topology
5KYLA 1B50A 2IT1A 3D4WA 2RDHA 2RSOA 4IQZA 2KJXA 3S1NB 4CJ2C 3I72A 2NZ1D 5M5XB 1EIHA 4ID6A 1PRTD 1V8QA 2ZXOA 2WAQB 3TP7A 1STNA 2B2UC 4CKBA 2OXPA 3JAME 2O5JC 4FXGC 3SHLA 2JA8B 1AZQA 1AW7A 1FNVA 4A3BB 2EYFA 4FF3A 3SK8A 4I65A 5C4JB 1KDBA 1LTSD 4BBSB 4F8MA 3LWUA 5C44B 2ZT9C 1GUWA 2KECA 3K5NA 4A3DB 5FLXL 3RMHA 4XTCS 5DM73 4HMJA 4C3JB 1AFPA 4UDUC 3I91A 1JWUD 1LABA 1DOMA 2L1BA 3DMUA 2A6EC 1BR9A 1DD2A 2XN9C 5C4HA 2SOBA 4E6IA 1PXUA 2XNAC 1JOQA 4DAVA 2F0TA 1EQTA 3A8KE 2EYPA 3TP8A 5CV6A 1ZXTA 3MWYW 2N55A 5IT9L 1GXDC 1D2BA 1XTCD 4WORA 4FF4A 2PQEA 3SK4A 3J81L 2L0CA 2FJ2A 2JA6B 5ISRA 1Q12A 1EQVA 3KLSA 4K2KA 3NWSA 1ET6A 2AUJD 4HTHA 3NTHA 2F0SA 1QNKA 2HCIA 2BA1A 5C3EB 1A3VA 3FRPB 2HUGA 3T4AC 2V4DA 4Z9CB 1KABA 3Q24A 2K5DA 1XWEA 3TMEA 2F0NA 5C4XB 1SYBA 3J80E 1PTOB 3GTPB 4ZUJA 1R4PB 4DU9A 1TR5A 3G7LA 4KKTA 1MD2D 1K83B 1EL0A 3PUYA 1LLRD 4TQUS 2XSCA 1SYGA 1TS3A 1Y8NB 1X32A 4YIJA 4RAUC 1CQVA 2ICEC 1G2TA 5EJWA 1CFMA 2A68C 5C3XA 5CBEE 1OXUA 3NWTA 3ONAB 4NP5A 4G7OC 4OGQC 1G91A 1QG7A 2SEBD 3L9AX 1CZWA 1NR4A 3PUVA 3S2DB 1STGA 1CA5A 1I4QA 5C6AA 3R3OA 2F0MA 3FPUB 2B63B 1S5BD 4RKLA 2L5TA 1LTBD 3TP5A 3S16B 5JOBA 3WDNA 3NP8A 4KN7C 3GTGB 2PZTA 1OXXK 1DONA 2IJ0A 2SNMA 2PNRC 1I4RA 1PRTF 4K2LA 1CHPD 1GHJA 2PZWA 4LMQD 3D6WA 2F0FA 2WV6D 4QMGA 3W3AA 1PRTC 4RH6A 3GV3A 5BN4A 2F0LA 2JA5B 2RSNA 2PZUA 2VB2X 4H0LC 3PIP3 5DEHA 2TMPA 3S2HB 1Q1EA 5C5MA 3VR3A 1PZKD 3GV6A 3GTQB 5FK9C 4XYQA 4CHTB 2LKVA 1SNQA 1CTMA 2Z8LA 2KHSA 1TWGB 1Y1WB 3Q6SA 4MIUA 3I3CA 1C48A 3NBIA 1CM9A 4KKUA 1BUVT 3TZDA 3E6ZX 3VA5A 4RGNA 1PRTB 1DYQA 4Q0FA 1HHVA 2WKDA 3NK9A 3KF8A 1LO5D 3NQTA 4RWSC 1F2LA 3PV0A 1Y8OB 2EJGC 3VYUA 1SXTA 1EZ8A 4KMUC 4F87A 2ICIA 3T51B 3TSSA 3F2UA 1GUTA 1CT1D 3KK7A 1AEXA 2K1BA 3BDCA 3MA2B 3RUZA 3HOWB 4P2CB 1E2ZA 2EZVA 4OL7A 2L12A 3M4YA 1Z7TA 2IWHA 4R8IA 3S1MB 3R2TA 1HXYD 1HTLD 1Q90A 2LS01 2EDGA 4DGZA 1GOZA 1ZKOA 2K5WA 4K6LA 5IGEA 3RLFA 5COYA 4C2MB 1EY8A 3QOJA 1UEAB 3MVVA 2D5DA 2WKCA 1EEFD 5FO9B 4IUUA 5EBCA 2EXZA 2NVQB 3J7YW 2F0GA 4KY7A 1ILPA 4IUPA 1EIGA 1C8CA 2F3VA 2EE1A 2F1MA 3MXNA 5M5WB 2AWNA 3S1QB 1TS4A 1PFNA 4A93B 1B9NA 3VR2A 4J1MA 5M3FB 3D6CA 1JR0D 1F77A 1QJOA 2QILA 4J8QA 4IFDH 3JAML 1BCPF 1KTKA 1ESFA 4K8IA 3I4NB 2PW7A 3OOCA 1B2TA 3VYRA 3MFYA 1BDOA 3GTLB 2L11A 4ODGA 2K6AA 3LWEA 1MBYA 4ZKCB 4RHRA 4C56C 2A74C 4ZQ3A 1MSHA 1T5EA 4PMBA 1RJTA 4XQQA 4K5WA 1G2SA 5E4XA 1JOOA 2KCCA 2BA0A 1PMRA 4DXGA 1O7LA 2PCFB 4C1NI 1F9QA 1TY0A 1V43A 1W6JA 5EPJA 1OO9B 4KN4C 1FNWA 1D1IA 2DNEA 3PIO3 1PTOC 2A73B 2N88A 3D4RA 5JEAH 1O80A 1R9TB 1CQFA 2FMMA 1JCKB 4RA8A 2KUMA 2AQ3B 4F88A 3HRZC 4IUVA 5J22A 4BY7B 4HEDA 4ZYSA 3BG3A 1XX8A 3SE0A 5JEAJ 4KTAA 4UAIA 3VR5A 2IW3A 4X3UA 1L0XB 2F0PA 3M7NA 5AFWA 2B2TC 1SNMA 1GUNA 2WINB 1A6XA 1H9SB 2A6ED 2AQ1B 1STBA 5D3IB 4QCLA 4X3SA 1MI2A 3K0YA 1H9SA 5KIXA 4A3GB 1KLGD 1B9MA 2NTSA 2RVLA 1HFGA 1BO0A 1KDAA 1I6VC 3DEOA 4CKEA 3HKZB 1VF5C 4C3HG 2JEAI 2HCCA 1SMYD 2RBMA 5I4DA 2F4IA 4KJOA 1SE2A 1RCVD 2C9OA 1V1PA 2MJ8A 4K5XA 3OSOA 3G6JB 4FVMA 5IGGA 1LACA 5ELDA 4IFDJ 3GTKB 2C5CA 2F3WA 3A7LA 1TKWB 5EPLA 3DXJC 2BOSA 3T16A 3NBHA 2QDBA 1QNUA 1HRJA 3ZYYX 1FNUA 1W6KA 3HS0C 1D5MC 1D1KA 4BWGB 3SK5A 2NB0A 3GO5A 3QJYA 3GP7A 5CV7A 3E0JA 4LJZC 2E2IB 1MSGA 1E2VA 3LX0A 4F7XA 2CW0C 4BY1B 2ID0A 2PO4A 3Q22A 3M7GA 3BVZA 1FGBD 1X3QA 4C3JG 1WTVA 2KQ3A 1KNAA 2WP8J 5FO8B 2NTTA 2Z4IA 3X3MA 2EPBA 3D8GA 5E1FA 1VCIA 5I2YA 4XDXA 1SYDA 4KY6A 5CYUA 3A56A 1ML0D 3R2IA 2EYLA 3IFTA 3IAYA 4LAAA 1WTQA 3BYTB 3DHQA 3H0GB 1S5DD 2R3ZA 5LL6X 3EQLC 3MAQA 1U4LA 1Y1VB 2A6HD 1HUMA 4NW2A 4KK7A 2IPKD 5C0XH 5FOBB 3SK6A 3GTOB 1RD9D 4FXDA 4FNFA 3H91A 1QB5D 1CK1A 1LT4D 5BN3A 2F0WA 1J8IA 2NN6I 1Y69U 5HGTA 4C3IG 3E5SA 2FFKB 3RD4A 3MXGA 1SAPA 1S5FD 2R93B 2B2VA 3FVQA 3D31A 2WACA 1HTPA 3P75A 1PZJD 4KD4A 1CHQD 1CZGA 1ICWA 1V1OA 3TBIB 1A3UA 1M4VA 2EJFC 1ONLA 2EYJA 3V2TA 1S5CD 4XXEA 5IGBA 1TWHB 4U673 3EA6A 3FPPA 2NVXB 4DA2A 1J9OA 1MGSA 4EQOA 4HSPA 4KY5A 4K14A 5CV8A 3TDQA 4TKOB 1JB3A 4A3KB 1SFOB 5JVH3 3VA7A 3I8ZA 2D62A 4HN7A 1H9MA 1JWMD 2PW5A 1UAPA 3MFGA 2HDLA 1B3AA 4KJNA 5I6YA 2E2HB 1TIID 2YYZA 1JWSD 4H13C 4ZUIA 3Q0AA 2KA7A 3SXHA 1IYUA 5DM63 4J6HA 4EVOA 3D4DA 3AMUA 1RKNA 2BDNA 1F2ZA 4S3SA 2BCOA 5KNCA 4DAYA 2DY8A 1M8AA 2QEJC 4G7HC 5C0XJ 5IGFA 4M1UB 3GD7A 3D3RA 3K5OA 1TU2B 2KEEA 3H94A 4FO2A 1ENAA 1HA6A 5I6WA 4U68A 1I4XA 1SYCA 5T1IA 1I4GA 3K58A 1KLUD 2EVBA 4A3MB 1U4RA 2A69C 1ENCA 2I07B 4IUNA 4L6TB 2X6GA 1BXTA 1GUOA 2M9VA 2CQAA 3HG9A 3OWFA 5KRUA 2F0JA 2FHTA 2J7ZA 2MHVA 1QCBD 1LT3D 4BS9A 1Q8IA 1IKMA 5D14A 1NAPA 4B08A 2O2LD 2IL8A 3HGBA 4JK1C 5IGDA 3K57A 5C4ZA 2EY2A 4PNYA 3I4MB 4QIWB 3L3OC 5CORA 2DN8A 1B44D 3OMCA 3MXUA 4G4KA 1VDZA 4RKBA 1IKLA 3URYA 2KEDA 2F0DA 2IX1A 2QF7A 3PMFA 1SDFA 4CJ1B 3KBXA 1QE6A 1LTGD 4GZYC 3N52A 1KDCA 2QCPX 3MHBA 2H1EA 1EFID 1ET9A 3A8IE 3NXWA 1ESRA 3I70A 3NQIA 3DWPA 2VUMB 1DZ1A 2JE6I 4WRDA 2J4XA 3NTIA 1WTRA 1K8OA 2B2TA 3K7AB 4OO1H 3HOVB 1OXSC 4ZAIA 1E0BA 3H6MA 4RHSA 3BDOA 4O1NA 1ZYRD 4OHJA 1DOKA 5JVG3 3FEWX 3M4OB 4DF7A 1FYCA 1JICA 3NE5B 1TWFB 5IIFA 1T5XD 3EFXD 1PFMA 2BE5C 5EPKA 4I7ZC 4CGYB 2B8FA 5J1ZA 2F0UA 1GHKA 2SNSA 1GUSA 3N6RA 3V05A 2O4XA 4BA1I 3DEPA 1VMPA 3H3VC 3VR4A 4TSSA 3SDZA 4A3EB 3M85A 1PLFA 3HOZB 3RZOB 2Q8TA 2DNCA 1YNND 1S4ZA 5TSSA 3VYTA 1DM0B 3I73A 4OO1I 4H44C 3PUWA 5M3MB 1EYDA 4G57A 4DXFA 3EROA 5I2XA 1DJRD 3FDTA 1XXGA 2XWBB 2OT2A 1EY6A 4C3HB 1TVXA 3TN2A 1H9RA 2EYMA 5CV5A 2IX3A 1K8MA 4KI0A 1SEBD 1WTWA 5F2DA 2BDOA 5FKAC 2L55A 1WD0A 5JAVA 3WOEA 2H4OA 1EYCA 2EY5A 3HOXB 5JPNC 1DOLA 1ENFA 2E74C 4KD3A 2KOLA 2AUKA 1I50B 4L63B 1AN8A 3S9WA 4NKLA 3NUCA 3LNNA 1NUCA 1HPCA 3QB3A 2EOTA 4NDXA 5G3LF 1JC7A 1TS5A 1JOKA 2FINB 5CGKA 4KHZA 5EBDA 1V1PB 2VXWA 1SBBB 3WOFA 5IGCA 3OHXC 4RGOS 4DNRB 1TWCB 1Z47A 3KLRA 1F9PA 3X3NA 1YNNC 3OW7A 4K5VA 1RTOA 1QWYA 5ELBA 1G6ZA 1YNJC 3VYSA 5CMDA 5BN5A 1UNSA 4X3TA 1EYAA 3BDLA 2F0OA 3J7AV 1II3A 2LMCB 2NWGA 3U9OA 2RDGA 2I46A 2MPMA 2RA4A 3K5LA 4IUQA 1F9RA 2VB3X 4C3IB 1BBXC 5D3DA 3CU7A 4V190 5KNBA 3PO3B 2PMZB 2XVSA 1IHZA 3ND9A 2B2VC 4HAEA 1XYIA 2F0HA 2CVRA 2QKIC 2K04A 2K5QA 1PTOD 5I9OA 2K33A 4N9TA 4WJWA 2NBFA 1TWAB 4EQNA 3CQZB 2K05A 1WD1A 2X6LA 5JPMC 3EVQA 3QOLA 4MN3A 4XT3B 5C3WA 1VF7A 5CV9A 5T1GA 1BF4A 1IL8A 3TP6A 4K8JA 4ABNA 2F0KA 4LK1C 1QOHA 1EWHA 4HCEA 4BA2I 1ZEQX 1B53A 5CV4A 4FF1A 3S1RB 2SDFA 2D2CC 2F0QA 4B9XA 1SYEA 1BQQT 3PUXA 5EKKA 1I4PA 3DWQA 2J0TD 3HP3A 2XRSD 5IODA 1O7YA 1JORA 4OIKA 4HSVA 2K32A 2AWOA 3OPOA 4IURA 4KV6A 4DN4M 3NHHA 3O13A 2A69D 1WVLA 1KAAA 3DWAA 5K36H 4ME5A 1SYFA 1X3PA 5LL6S 4OO1G 2K28A 3VR6A 1ZYRC 3EJIA 4DFAA 5E4WC 2ZXPA 1PZID 3H09A 1RTNA 3AU7A 2JXMB 3DUZA 5K36G 2E76C 2EJMA 1A2TA 5HURA 2PPBC 5CBAE 3S14B 2CW0D 3QWNA 1G291 4HMIA 3KUPA 1EOTA 1Z6HA 2F0IA 3U9SA 2JEBI 2BE5D 3PO2B 3J80L 3ND8A 3HEJA 2NN6H 2GA4B 4DNTB 5FO7B 3OIPA 4A3IB 2JSOA 4Y7NB 3C1EA 2E2DC 4XQJA 2ENBA 3HOYB 2F0EA 2B2YC 4A3JB 2L9HA 4B9WA 4ZLTF 3Q23A 2B8GA 2B2WC 2NN6G 3SEBA 3P1HA 1G8ZD 1RODA 3ERQA 5A2QE 3ITPA 4DAPA 2RKSA 1SE4A 1WTXA 1ILQA 2G9DA 3A7AB 3CRLC 3MXPA 3C46A 3RZDB 5JJZA 1QILA 2RQXA 2NVTB 4RFBA 4XIGS 5KYIA 3IKJA 3MC0B 2L4NA 4X3KA 3KLSX 1SJED 4IALA 4RCOA 5ELCA 5DNFA 1LT5D 2K7VA 3R8BA 1LTTD 5LHY1 1BCPB 5EGTA 1LTID 1B4OA 1PFBA 5IT9E 3FMCA 5M9OA 2EY1A 4ILWA 2O5IC 1D6EC 2NUCA 2XIWA 1RHPA 2K03A 4M8AA 4OIJA 4H7BA 5I9PA 3TZUA 2NYZD 1B1ZA 1A15A 3OIQA 1HQRD 1TS2A 4BBRB 5C0XG 1OXTA 1EY5A 1FD7D 4A3FB 1JE4A 1H9JA 1YNJD 1TQOA 4DK0A 3I4LA 3NPPA 5M5YB 1F2MA 1TY2A 3L7ZC 1GUGA 2B39A 5ELFA 5IOCA 1UUPA 1D5ZC 4R9WA 1EY0A 5EKLA 1DCZA 1L0YB 1SNDA 3PUZA 3I90A 1HQMC 5KGUA 2M00A 1EU4A 1I6HB 2D9UA 2WIIB 5K5PA 4HR7B 1LTRD 5KNDA 5E3FA 3CRKC 3C3LA 3MEHA 4PQXA 2NVYB 3HOUB 1GJXA 3R93A 2Z4HA 2PYKA 1O7ZA 1EEID 1F2YA 2EYOA 3M3YB 5DAUA 3W2DA 2VNUD 4CKCA 1BNZA 2R61A 2JYOA 1VMCA 3SVMA 4ZRZA 2Y0SB 2X69A 1HUNA 3P7JA 4HCSA 2EYHA 2Q8IB 3GTJB 4RGTA 4FF2A 1OXVA 2LFNA 2A5HA 3AB9A 1Y8PB 5G3LD 2B2YA 3BZDB 4CBVA 1EY9A 4ULLA 2LY7A 4V0BA 3V96A 1IW7D 1CI3M 3IL8A 4O42A 1STHA 2IX0A 3DM1A 2ZXRA 1LTAD 1LT6D 1E2WA 1SNOA 4ZKBB 2R92B 3T56B 4IFDI 5D65A 2F03A 2RDFA 1EY7A 2KVMA 5JEAG 2DY7A 1DXMA 2WB1B 4DK1A 2JP1A 3IFDA 4L8JA 1U9RA 4ZK9B 5ELEA 4R8NA 2B2UA 4KHVA 1NSNS 2EY6A 2R6GA 1RF2D 3BYYB 1JQYD 5CR3A 3HZXA 1R4QB 1WCMB 2MGSA 2E2JB 1EU3A 2YU9B 5NUCA 3MZ5A 2KCNA 4AYBB 1PYWD 1C4QA 1NR2A 5C5LA 4KKSA 4N9PA 2XRQD 5KEEA 1STYA 1STAA 5CC4A 1AP0A 1PTOH 1SNPA 2OF1A 1Q3LA 2AQ2B 3GTMB 2MUYA 1U4MA 1Q1BA 1HA5A 3C1FA 2TSSA 3NSWA 2Z1CA 3T13A 3CKIB 3BVGA 4IFDG 4RCNA 4PMCA 1TT2A 4MHEA 3SR1A 1U4PA 1WTOA 3C2PA 4PMWA 1HFNA 2E75C 1I3QB 5C0XI 1EZ6A 1BCPC 1EY4A 4FYDA 3GQBA 3T53B 1H9KA 4C1NK 1SJHD 4EQPA 4IUTA 5J39A 2Q8RE 3FKIB 1SE3A 3J81E 3QG1A 4QUFA 4QF4A 3OWEB 3P20A 2FMCA 4EGVA 3UI2A 1CA6A 2R7ZB 1SMYC 3A54A 2HDMA 1KNEA 4JBWA 2F0VA 1BOSA 4XYOA 3S15B 3J7AF 1D5XC 3OMGA 2A68D 3BS1A 2JA7B 4XT1B 4CJ0B 2G9HD 3KBGA 3A55A 4NMZA 1STEA 1RDPD 4TRDA 1IYVA 1LV9A 1IW7C 2CHBD 1I4HA 1O78A 3K59A 2B2WA 1SSOA 4IZ8A 3QO2A 4FXKC 1HCZA 4XQNA 5EQ0A 1AZPA 1S5ED 2A6HC 3MTSA 3K5MA 5A35A 1A2UA 2K01A 1SNCA 2MP1A 4QB4A 1PDQA 4QUCA 1A3TA 2XWJB 4RGMA 5FLXE 3CHBD 3QIAA 2M2LA 4K6DA 1BCPD 2OEOA 4PV1C 1WTPA 4WFN3 4G7ZC 1EWCA 4FP5D 2HQEA 5EKIA 5A2QL 3K6OA 3BVMA 1F9SA 3S17B 4IN3A 1FR3A 4Q5VA 1PTOF 3NTKA 1NCVA 3A8JE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM6 3;  5DM7 3;  4U67 3;  3PIO 3;  4WFN 3;  5JVH 3;  3PIP 3;  5JVG 3; 
#chains in the Genus database with same CATH topology
 1N8R C;  5KYL A;  5M3F H;  1B50 A;  2IT1 A;  4DKA C;  1HZC A;  4PG3 A;  3D4W A;  2RDH A;  2RSO A;  1UE7 A;  4IQZ A;  2KJX A;  3S1N B;  4CJ2 C;  3I72 A;  2NZ1 D;  5M5X B;  1QVG A;  3BJU A;  5AJ3 L;  1EIH A;  4LF7 Q;  2JQO A;  4ID6 A;  1PRT D;  1V8Q A;  2ZXO A;  2WAQ B;  3TP7 A;  1N34 Q;  1STN A;  5GQO A;  3GTL H;  1X65 A;  2YV5 A;  2B2U C;  1VQ4 A;  2VQE L;  4CKB A;  1VQ6 A;  2UXD L;  2OXP A;  1E1O A;  3JAM E;  2O5J C;  4FXG C;  3HKZ E;  3SHL A;  1W2B A;  2JA8 B;  1AZQ A;  4A93 G;  4OWT B;  1HR0 Q;  2UUC L;  1AW7 A;  1FNV A;  4A3B B;  2EYF A;  2B3G A;  4FF3 A;  1MJC A;  4A3L G;  3SK8 A;  4I65 A;  2AKW B;  5C4J B;  1KDB A;  1LTS D;  4B3M L;  4BBS B;  4F8M A;  1CUK A;  3LWU A;  5C44 B;  3CCL A;  2ZT9 C;  1GUW A;  2KEC A;  1K73 C;  3K5N A;  4A3D B;  5FLX L;  3RMH A;  4XTC S;  3PSI A;  5DM7 3;  4HMJ A;  4DR7 L;  4C3J B;  1AFP A;  4UDU C;  3I91 A;  1JWU D;  1XMQ L;  3PO2 H;  1LAB A;  1DOM A;  3HKS A;  2L1B A;  3DMU A;  5BR8 L;  1OTC A;  3B6Y A;  4L5Q A;  2A6E C;  1BR9 A;  3KFU A;  2F4V L;  4X65 L;  1DD2 A;  2XN9 C;  3J7Z C;  5C4H A;  5LMU Q;  2SOB A;  4E6I A;  1PXU A;  4A4I A;  2XNA C;  2ALY B;  1JOQ A;  4DAV A;  4N8F A;  2F0T A;  1EQT A;  2JA9 A;  3A8K E;  2EYP A;  1QVF A;  3I55 A;  1PH9 A;  4NXM L;  2JA7 G;  3TP8 A;  5CV6 A;  5JJI A;  3JC6 6;  1ZXT A;  3MWY W;  2N55 A;  5IT9 L;  1G6P A;  3QR8 A;  1GXD C;  4JI2 Q;  1D2B A;  1XTC D;  2WAQ E;  1S3O A;  1XJV A;  4DR4 L;  4QY7 A;  4WOR A;  1K8A C;  1S72 A;  4IPC A;  2PQE A;  4A3K H;  4FF4 A;  1NMF A;  3SK4 A;  3F2B A;  3J81 L;  4A75 A;  1JB7 A;  2L0C A;  2FJ2 A;  1VQK A;  4B3M Q;  4X64 Q;  4JI6 Q;  2JA6 B;  5ISR A;  1Q12 A;  3UE1 A;  1EQV A;  1G51 A;  1A0I A;  3OTO Q;  1XMO Q;  3KLS A;  3KJP A;  4K2K A;  3NWS A;  3HOY G;  1ET6 A;  2AUJ D;  4HTH A;  3NTH A;  2F0S A;  1J6Q A;  2E5L L;  2PI2 E;  1QNK A;  4DR1 Q;  1S40 A;  2HCI A;  2HT1 A;  1HR0 L;  4BY1 G;  2UUC Q;  5ELO A;  2BA1 A;  3VDY A;  5C3E B;  1A3V A;  3FRP B;  1N32 L;  2JK8 A;  2HUG A;  3E9I A;  3T4A C;  2V4D A;  1N33 L;  4JI8 Q;  2E2H H;  2WAQ G;  4Z9C B;  1KAB A;  3Q24 A;  2K5D A;  1XWE A;  2EXD A;  3TME A;  2UUA Q;  4GKK Q;  3J80 i;  4C3J H;  4NB3 A;  2F0N A;  2XGT A;  4A3C G;  5C4X B;  4X66 Q;  1SYB A;  3CCQ A;  3J80 E;  1PTO B;  3GTP B;  4ZUJ A;  1R4P B;  4LF4 Q;  4DU9 A;  1TR5 A;  1L1O B;  3G7L A;  4QL5 A;  4GNX C;  4KKT A;  3A5U A;  1XTD A;  3CC7 A;  1MD2 D;  1K83 B;  1EL0 A;  3PUY A;  1LLR D;  4TQU S;  2XSC A;  1QVC A;  1SYG A;  1TS3 A;  1Y8N B;  2YTV A;  2KHJ A;  1X32 A;  4YIJ A;  4JI2 L;  4R4I A;  4RAU C;  1CQV A;  2ICE C;  5C4X G;  4LF9 Q;  4Y7N H;  2BH8 A;  4UP7 A;  3PO3 H;  1G2T A;  5EJW A;  1WOC A;  1AH9 A;  3KF6 A;  1CFM A;  2A68 C;  5C3X A;  5CBE E;  1OXU A;  3NWT A;  4TVA B;  3ONA B;  4NP5 A;  4RMF A;  4G7O C;  4OGQ C;  1G91 A;  1QG7 A;  1RL2 A;  2SEB D;  3CQZ H;  3L9A X;  1CZW A;  1NR4 A;  1HNX Q;  3PUV A;  4KHP L;  3S2D B;  1STG A;  1I4Q A;  1CA5 A;  5C6A A;  3R3O A;  4JI0 Q;  3NBH B;  4ME3 A;  2F0M A;  3FPU B;  2B63 B;  3K0X A;  1S5B D;  4RKL A;  2L5T A;  2R7F A;  5ELN A;  1LTB D;  4BBS H;  4DV6 L;  1VQF A;  3TP5 A;  3S16 B;  5JOB A;  3WDN A;  3M4Q A;  3NP8 A;  4KN7 C;  2QA4 A;  3GTG B;  2PZT A;  3S15 H;  1OXX K;  1DON A;  2IJ0 A;  2SNM A;  3U50 C;  4X64 L;  2PNR C;  1I4R A;  1PRT F;  4K2L A;  1SR3 A;  1CHP D;  1GHJ A;  2PZW A;  4LMQ D;  4KLK A;  3D6W A;  3I4N H;  2F0F A;  2QEX A;  4HJ8 A;  2WV6 D;  4QMG A;  4L5R C;  3W3A A;  1PRT C;  4RH6 A;  3GV3 A;  5BN4 A;  2F0L A;  3TS0 A;  2JA5 B;  3KOJ A;  2RSN A;  2PZU A;  2VB2 X;  4H0L C;  3PIP 3;  5DEH A;  4JI4 L;  2TMP A;  4ZCK A;  3S2H B;  2ES2 A;  1Q1E A;  5C5M A;  3VR3 A;  1PZK D;  2PNH A;  3GV6 A;  2JA8 H;  4POF A;  5FK9 C;  4XYQ A;  3GTQ B;  1RIP A;  4CHT B;  2LKV A;  1SNQ A;  1B8A A;  1CTM A;  2Z8L A;  2KHS A;  1TWG B;  3Q6S A;  1Y1W B;  4MIU A;  3I3C A;  4YWM A;  1C48 A;  5H1S E;  3NBI A;  1CM9 A;  3EN2 A;  4KKU A;  3AFQ A;  1BUV T;  3CCR A;  1EQR A;  4BXX H;  3TZD A;  1NE3 A;  3E6Z X;  3VA5 A;  4RGN A;  1PRT B;  4AQY L;  4DUY Q;  4YWK A;  1DYQ A;  1JJG A;  4Q0F A;  2ZJR A;  4LF8 Q;  1HHV A;  4QJF A;  4A3D H;  5FLX c;  1EQQ A;  2Y0S G;  2WKD A;  3NK9 A;  4C3H H;  3OW2 A;  5M3F G;  1Q86 C;  3KF8 A;  1LO5 D;  2G5D A;  3NQT A;  4RWS C;  1F2L A;  3PV0 A;  1Y8O B;  2EJG C;  1N36 Q;  3VYU A;  1SXT A;  4JW0 A;  1EZ8 A;  3FKI G;  4KMU C;  4AYB E;  4BBR G;  4F87 A;  3UDI A;  2ICI A;  3PQI A;  3T51 B;  3TSS A;  3F2U A;  4JI7 L;  3PGZ A;  2AMC B;  1GUT A;  2ZTC A;  1CT1 D;  4P71 A;  3KK7 A;  1AEX A;  2K1B A;  4GS3 A;  1EYG A;  3BDC A;  3MA2 B;  3RUZ A;  3HOW B;  2R93 G;  4P2C B;  1E2Z A;  2EZV A;  4OL7 A;  2L12 A;  3TRE A;  2GN5 A;  3OYY A;  4MZ9 A;  3M4Y A;  1Z7T A;  4DPG A;  2IWH A;  4A3C H;  4RG1 A;  4R8I A;  3GTJ H;  1MHW C;  3S1M B;  3R2T A;  1HXY D;  3EBE A;  1HTL D;  1Q90 A;  2LS0 1;  2RF4 A;  3RR5 A;  2EDG A;  3A0J A;  4A3M G;  1N33 Q;  2QW7 A;  4DGZ A;  1GOZ A;  1ZKO A;  2K5W A;  4NXM Q;  4K6L A;  1VQP A;  4JI1 L;  5IGE A;  3RLF A;  3BZC A;  5COY A;  3L0O A;  4C2M B;  1EY8 A;  3QOJ A;  1UEA B;  4GKK L;  3MVV A;  2D5D A;  2WKC A;  1EEF D;  1C0A A;  5FO9 B;  3HOY H;  4IUU A;  5EBC A;  2EXZ A;  1I5F A;  2I5M X;  2NVQ B;  3J7Y W;  4KY7 A;  2F0G A;  1ILP A;  4IUP A;  1NY4 A;  1EIG A;  2N78 A;  2F3V A;  1C8C A;  5GRO A;  2EE1 A;  4DR5 Q;  2F1M A;  3MXN A;  3STB C;  5M5W B;  2AWN A;  5BR8 Q;  3S1Q B;  1R9T H;  1WFQ A;  2NVX H;  4GOP C;  1TS4 A;  1PFN A;  5IYC H;  5IYD H;  4A93 B;  1B9N A;  3VR2 A;  4J1M A;  1HNW L;  4R4T A;  5M3F B;  3D6C A;  1JR0 D;  1F77 A;  1QJO A;  1DGS A;  3CME A;  1N32 Q;  2QIL A;  4J8Q A;  3D0F A;  3K8A A;  1I94 Q;  4IFD H;  4A3J G;  3JAM L;  1BCP F;  2VL6 A;  4JV5 L;  1KTK A;  1U0L A;  1ESF A;  4K8I A;  4IOA A;  4DUZ L;  2UUA L;  3I4N B;  2PW7 A;  3OOC A;  4JI1 Q;  4HID A;  1B2T A;  3VYR A;  3MFY A;  1BDO A;  3GTL B;  2L11 A;  4ODG A;  2K6A A;  3LWE A;  1MBY A;  4ZKC B;  5IWA L;  4RHR A;  3I4M H;  4P73 A;  4C56 C;  5M5Y H;  1PH2 A;  2A74 C;  4ZQ3 A;  1PV4 A;  1MSH A;  1T5E A;  4AQY Q;  4BBS G;  4PMB A;  1RJT A;  4XQQ A;  2NZH A;  4NPS A;  4K5W A;  3L2P A;  2OQ0 A;  1G2S A;  1L2F A;  5E4X A;  1JOO A;  4LF6 L;  2KCC A;  2BA0 A;  4WJ3 M;  1PMR A;  2V1C C;  4P75 A;  2K14 A;  4DNI A;  4DXG A;  1CKN A;  1O7L A;  2PCF B;  4JVZ A;  1SE8 A;  1KRS A;  4C1N I;  4BXX G;  3RNU A;  2ZJQ A;  1F9Q A;  3CPF A;  1TY0 A;  3S16 H;  1V43 A;  1W6J A;  5EPJ A;  1OO9 B;  4KN4 C;  1FNW A;  1D1I A;  2DNE A;  4GLA C;  3PIO 3;  4LFC Q;  1PTO C;  2A73 B;  1HNZ Q;  2N88 A;  1VQD A;  3D4R A;  1HH2 P;  5JEA H;  1O80 A;  1R9T B;  1CQF A;  3CPW A;  2FMM A;  1JJ2 A;  4DV2 Q;  1JCK B;  2CQO A;  4RA8 A;  2KUM A;  1PHJ A;  4OWX B;  2AQ3 B;  1KAW A;  4F88 A;  3HRZ C;  4IUV A;  5J22 A;  4BY7 B;  4YHH Q;  4HED A;  4ZYS A;  3F2C A;  3BG3 A;  1A8V A;  1XX8 A;  1GO3 E;  3SE0 A;  5JEA J;  4KTA A;  2R7Z H;  4UAI A;  3VR5 A;  2IW3 A;  1YEZ A;  4X3U A;  1L0X B;  2F0P A;  3M7N A;  5AFW A;  2B2T C;  1SNM A;  1GUN A;  2WIN B;  1T9H A;  1A63 A;  1A6X A;  2B29 A;  2FXQ A;  2GVB A;  4LF6 Q;  1H9S B;  2DJG C;  2A6E D;  1YIT A;  2AQ1 B;  1AE2 A;  1STB A;  5D3I B;  4QCL A;  4X3S A;  1MI2 A;  3K0Y A;  1PH6 A;  1H9S A;  5KIX A;  4A3G B;  1KLG D;  3CCJ A;  3W5O A;  1B9M A;  1U5K A;  4A3D G;  2NTS A;  2RVL A;  4UY8 C;  1VQ7 A;  1HFG A;  1BO0 A;  4A3F H;  5JJL A;  1KDA A;  5C44 G;  2HIX A;  4DK6 C;  1I6V C;  2CH4 W;  3DEO A;  1KIX A;  4CKE A;  3HKZ B;  1VF5 C;  3HFZ B;  4A3E H;  4C3H G;  3KDF A;  1K8G A;  2JEA I;  2HCC A;  1SMY D;  3LGJ A;  1IBM L;  2R7D A;  2RBM A;  5I4D A;  2F4I A;  4KJO A;  4YWL A;  1SE2 A;  1RCV D;  3ULP A;  4MTK A;  4A76 A;  2C9O A;  1V1P A;  2MJ8 A;  5C3E G;  4K5X A;  3CD6 A;  5C44 H;  3OSO A;  3G6J B;  4FVM A;  4LUZ A;  5IGG A;  4HJ5 A;  1LAC A;  4I7A A;  5ELD A;  1B3Q A;  4GN4 B;  4IFD J;  3M4O H;  3GTK B;  2C5C A;  2F3W A;  3A7L A;  1TKW B;  5EPL A;  5GAD C;  3DXJ C;  2BOS A;  3T16 A;  3NBH A;  2QDB A;  4A3M H;  1QNU A;  4EQ5 A;  3ZYY X;  1HRJ A;  1FNU A;  1W6K A;  2CWA A;  3G48 A;  3HS0 C;  1D5M C;  4YY3 L;  3A5Z B;  4WJ4 A;  1D1K A;  1Y1V G;  4BWG B;  3SK5 A;  2NB0 A;  3GO5 A;  3QJY A;  2JA5 H;  1I50 H;  3GP7 A;  5CV7 A;  4IO9 A;  3E0J A;  4LJZ C;  2E2I B;  1MSG A;  1E2V A;  2CKZ B;  3LX0 A;  4F7X A;  2CW0 C;  1PH4 A;  4BY1 B;  2ID0 A;  1WCM H;  2PO4 A;  3Q22 A;  3M7G A;  3BVZ A;  1TXY A;  1FGB D;  1X3Q A;  4C3J G;  1WTV A;  1A62 A;  4A3L H;  2KQ3 A;  1KNA A;  2WP8 J;  5FO8 B;  2VZA A;  2RHQ B;  1N9W A;  2KHI A;  2NTT A;  2Z4I A;  3ULL A;  3X3M A;  4LW1 A;  2EPB A;  1PH1 A;  3D8G A;  1IXR A;  5E1F A;  1VCI A;  4BBR H;  5I2Y A;  4XDX A;  1SYD A;  4KY6 A;  5CYU A;  3A56 A;  1ML0 D;  3R2I A;  4OX9 Q;  5L37 A;  2EYL A;  3IFT A;  3IAY A;  4LAA A;  1WTQ A;  3BYT B;  4IJL A;  3DHQ A;  1VQC A;  3H0G B;  1S5D D;  2R3Z A;  1P8L A;  3H3V I;  2VY3 A;  3EQL C;  5LL6 X;  3MAQ A;  1U4L A;  1Y1V B;  2A6H D;  1KHI A;  2NZO A;  4JI7 Q;  1GM5 A;  1HUM A;  2N49 A;  2DUD A;  4NW2 A;  4KK7 A;  4B3T L;  2IPK D;  5C0X H;  3I56 A;  5FOB B;  1PYS B;  2CWP A;  3SK6 A;  1GVP A;  5JJK A;  4GLV B;  3GTO B;  1RD9 D;  4FXD A;  4OON A;  3MEF A;  1XPR A;  3F2D A;  3I4M G;  4FNF A;  3H91 A;  3CCS A;  1QB5 D;  1CK1 A;  1SRU A;  4A3K G;  3HOW G;  1LT4 D;  4FDB A;  2AHO B;  2K4K A;  1VQL A;  5BN3 A;  2F0W A;  4APV A;  2C35 B;  3K81 C;  2OTJ A;  1J8I A;  2NN6 I;  1Y69 U;  5HGT A;  4AYB G;  4C3I G;  3E5S A;  1FJG L;  2FFK B;  5HGQ A;  3RD4 A;  4DR5 L;  1EUJ A;  3MXG A;  1SAP A;  2Y0S E;  1S5F D;  2R93 B;  3KDF B;  4X62 L;  2MO1 A;  2B2V A;  5IYC G;  5IYD G;  3AEV A;  2K5H A;  3FVQ A;  3D31 A;  3T1Y L;  2WAC A;  1HTP A;  2K50 A;  3P75 A;  1PZJ D;  4KD4 A;  1CHQ D;  1CZG A;  1HJP A;  3AYH B;  1ICW A;  1V1O A;  3TBI B;  1WCM G;  1A3U A;  2MO0 A;  2RCF A;  1M4V A;  1K28 A;  2EJF C;  4HIO A;  1ONL A;  2EYJ A;  3V2T A;  1S5C D;  1I6H H;  5IP7 H;  4XXE A;  1KL9 A;  5IGB A;  1C9O A;  1TWH B;  4U67 3;  1CKM A;  2H5X A;  3EA6 A;  3FPP A;  2NVX B;  4DA2 A;  3CXC A;  4LF5 Q;  1J9O A;  1MGS A;  3G4S A;  4LF4 L;  4EQO A;  4HSP A;  4KY5 A;  4K14 A;  5CV8 A;  2XTI A;  3TDQ A;  4CDD C;  4IPG A;  1VQJ A;  2UU9 L;  4TKO B;  1JB3 A;  2N8N A;  3T1H L;  4A3K B;  1SFO B;  2CH4 A;  1VQ5 A;  5JVH 3;  3VA7 A;  4DR1 L;  3I8Z A;  2D62 A;  4JI3 Q;  4HN7 A;  2UXB L;  1FGU A;  1H9M A;  3E0E A;  1JWM D;  4A3I H;  4DAM A;  2BH2 A;  2PW5 A;  1UAP A;  3MFG A;  5IWA Q;  2HDL A;  1B3A A;  4KJN A;  5I6Y A;  2E2H B;  1TII D;  2YYZ A;  1JWS D;  3KJO A;  4H13 C;  4ZUI A;  3Q0A A;  4DV5 L;  4JOI C;  4LF5 L;  2KA7 A;  3SXH A;  5C3E H;  1IYU A;  5DM6 3;  4J6H A;  4EVO A;  1NMG A;  2PMZ E;  3CCE A;  3D4D A;  3GTP H;  1KXL A;  3AMU A;  1RKN A;  3GDE A;  2BDN A;  2WB1 E;  1YHB A;  1FL0 A;  1F2Z A;  4QQB X;  4S3S A;  2BCO A;  5KNC A;  4DAY A;  2DY8 A;  1M8A A;  2QEJ C;  2ZJP A;  4G7H C;  5C0X J;  5IGF A;  4M1U B;  3GD7 A;  3D3R A;  3K5O A;  1TU2 B;  2KEE A;  3H94 A;  3RZD H;  4FO2 A;  1ENA A;  1HA6 A;  5J3B A;  3M3Y H;  2K52 A;  1YJN A;  5I6W A;  4U68 A;  5FLM G;  2YU9 H;  4X62 Q;  1I4X A;  1SYC A;  4N8X 1;  5DLQ E;  5T1I A;  1I4G A;  3K58 A;  4JI8 L;  1KLU D;  2EVB A;  1U4R A;  4A3M B;  4LFA L;  2A69 C;  3M9B A;  1HNZ L;  4JBM A;  2K5V A;  1ENC A;  1PA6 A;  2I07 B;  2Q2U A;  4IUN A;  4L6T B;  2X6G A;  1BXT A;  1GUO A;  1Q46 A;  2M9V A;  2CQA A;  3HG9 A;  3OWF A;  2Z9H A;  1W3S A;  5KRU A;  2Z0S A;  2VQE Q;  2F0J A;  2FHT A;  2HD3 A;  4ALP A;  2J7Z A;  2MHV A;  1QCB D;  1LT3 D;  5IP9 G;  4BS9 A;  2VQF Q;  1M1K C;  1H95 A;  1Q8I A;  1IKM A;  5LMN L;  5D14 A;  1NAP A;  3KF6 B;  4B08 A;  4L5T A;  4X65 Q;  3TS2 A;  2O2L D;  2IL8 A;  3HGB A;  4JK1 C;  5IGD A;  1PVO A;  3K57 A;  5C4Z A;  2EY2 A;  4PNY A;  3I4M B;  4DV3 L;  5LMN Q;  4QIW B;  1IBK L;  5FJ8 H;  1VQE A;  3L3O C;  3PO2 G;  5COR A;  4OWW B;  3MXN B;  2DN8 A;  1B44 D;  3OMC A;  3MXU A;  2VUM G;  4G4K A;  1VDZ A;  1YBY A;  4RKB A;  4QGU A;  1SRO A;  1IKL A;  5E7N A;  3URY A;  2KED A;  2F0D A;  2IX1 A;  3E3X A;  4LNQ A;  2QF7 A;  3PMF A;  1SDF A;  4CJ1 B;  3KBX A;  1QE6 A;  1LTG D;  4GZY C;  3N52 A;  1KDC A;  2ZTD A;  2QCP X;  1KRT A;  3MHB A;  4A3G G;  2H1E A;  1EFI D;  1ET9 A;  1N36 L;  2OTL A;  3A8I E;  3NXW A;  4LF7 L;  3S2H H;  1ESR A;  3I70 A;  4B3R Q;  3NQI A;  3DWP A;  2VUM B;  1DZ1 A;  2JE6 I;  4WRD A;  2J4X A;  4LFA Q;  3NTI A;  2PQA B;  1WTR A;  1K8O A;  2B2T A;  2LSS A;  3K7A B;  4OO1 H;  3HOV B;  1OXS C;  4ZAI A;  3HOW H;  4UPA A;  1E0B A;  3H6M A;  4RHS A;  3BDO A;  4O1N A;  4C3I H;  1ZYR D;  3JAM i;  4OHJ A;  1DOK A;  5JVG 3;  2HHH Q;  3FEW X;  3GTG H;  3M4O B;  4DF7 A;  1FYC A;  3SGI A;  1JIC A;  3NE5 B;  1TWF B;  5IIF A;  1E1T A;  1T5X D;  3EFX D;  1UE1 A;  1PFM A;  2BE5 C;  4P74 A;  5EPK A;  1NJI C;  4I7Z C;  4CGY B;  4YCV A;  2B8F A;  5J1Z A;  4JYA L;  2F0U A;  1GHK A;  1WYD A;  2SNS A;  2I0Q A;  1GUS A;  1M90 C;  5C4J H;  3N6R A;  3V05 A;  2O4X A;  4BA1 I;  3DEP A;  1VMP A;  1YHA A;  3H3V C;  3VR4 A;  3J80 c;  2UXC L;  3KYH C;  4TSS A;  3SDZ A;  3M85 A;  1PLF A;  4A3E B;  3HOZ B;  4K0K L;  3RZO B;  2Q8T A;  4DV1 L;  2DNC A;  1YNN D;  1S4Z A;  5AJ3 Q;  5TSS A;  3VYT A;  1DM0 B;  3I73 A;  4OO1 I;  3ER0 A;  1E22 A;  4H44 C;  3PUW A;  5M3M B;  2E8G A;  4GKJ Q;  1EYD A;  4G57 A;  4DXF A;  1V9P A;  3J7A 5;  1ASZ A;  3ERO A;  1K3B C;  5I2X A;  4DV7 Q;  1DJR D;  3FDT A;  4R4O A;  2JA6 H;  1XXG A;  3W1B A;  2XWB B;  2OT2 A;  1EY6 A;  4C3H B;  1J5E L;  3S1R H;  1TVX A;  3TN2 A;  1H9R A;  2EYM A;  5CV5 A;  2GVA A;  2IX3 A;  4A3E G;  1K8M A;  1MJE A;  1BVS A;  3JAM c;  4KI0 A;  2YTY A;  1SEB D;  1WTW A;  5F2D A;  2BDO A;  5FKA C;  2L55 A;  1WD0 A;  2HQL A;  5JAV A;  3WOE A;  2H4O A;  1EYC A;  3PIO A;  2KBN A;  2EY5 A;  2ZTE A;  3HOX B;  5JPN C;  4A3I G;  1DOL A;  1ENF A;  4GNX A;  4DR7 Q;  2E74 C;  1X55 A;  4DR6 Q;  4KD3 A;  2KOL A;  1PFS A;  2AUK A;  1I50 B;  3S1N H;  4EX5 A;  4LWC A;  4L63 B;  1UWV A;  1Y1W H;  3HOV G;  1AE3 A;  1LYL A;  1AN8 A;  3S9W A;  4NKL A;  3NUC A;  4JG2 A;  2B63 G;  3LNN A;  2IY5 B;  4OEL B;  2UU9 Q;  1NUC A;  1HPC A;  2K75 A;  3QB3 A;  2EOT A;  4NDX A;  4PZ6 A;  5G3L F;  3NEM A;  1JC7 A;  4DR4 Q;  4P72 A;  1TS5 A;  1JOK A;  2FIN B;  5CGK A;  4KHZ A;  5EBD A;  2DGY A;  1V1P B;  4PZ8 A;  2VXW A;  4C2M H;  1SBB B;  3WOF A;  5IGC A;  5IP7 G;  4POG A;  4GN3 B;  4A3J H;  3OHX C;  3RZO H;  4RGO S;  4DNR B;  4MNO A;  2E2J H;  2KEN A;  1YI2 A;  1TWC B;  1Z47 A;  3KLR A;  4DV2 L;  1F9P A;  2JJQ A;  2UXB Q;  3X3N A;  1YNN C;  2F52 A;  1B7Y B;  3OW7 A;  4K5V A;  5M3M H;  1XMQ Q;  3J81 i;  1RTO A;  3PF5 A;  1QWY A;  3K80 C;  5ELB A;  3NEN A;  1ASY A;  1G6Z A;  1YNJ C;  4A93 H;  3VYS A;  1FVI A;  5CMD A;  5BN5 A;  1UNS A;  4X3T A;  1EYA A;  3BDL A;  2F0O A;  1FJG Q;  3CCU A;  3J7A V;  1II3 A;  2LMC B;  2NWG A;  1ICF B;  3U9O A;  2RDG A;  1JMC A;  2I46 A;  1TWH H;  2MPM A;  2RA4 A;  3K7A H;  3K5L A;  5IT9 c;  4B3S Q;  2JA7 H;  4IUQ A;  1F9R A;  2VB3 X;  4C3I B;  4DUY L;  1BBX C;  5D3D A;  3CU7 A;  4GLX A;  4V19 0;  5KNB A;  5IY0 A;  3PO3 B;  2PMZ B;  2XVS A;  1IHZ A;  3ND9 A;  2ATW A;  3CP0 A;  2B2V C;  4HAE A;  1BKB A;  1XYI A;  2KCT A;  2F0H A;  2CVR A;  2QKI C;  2K04 A;  2K5Q A;  1PTO D;  5I9O A;  2K33 A;  1Y14 B;  3S24 A;  4N9T A;  3F8T A;  2EIF A;  4WJW A;  2NBF A;  1TWA B;  4EQN A;  1E3P A;  4MTN A;  3CQZ B;  2K05 A;  3TEH B;  4A3B H;  2RHS B;  3CC2 A;  3CMA A;  1WD1 A;  2X6L A;  2CFM A;  5JPM C;  1BBU A;  3EVQ A;  3QOL A;  3RN5 A;  1IBL L;  4DR2 Q;  3HOZ H;  4MN3 A;  4XT3 B;  1XNR Q;  2PQA A;  1VF7 A;  1PYB A;  5C3W A;  5CV9 A;  5T1G A;  2ASB A;  2Z6K A;  1CKN B;  1PH5 A;  1BF4 A;  4A3B G;  3U4Z A;  5IYB H;  5M5X H;  1IL8 A;  3TP6 A;  4K8J A;  4ABN A;  1HNX L;  1YJ9 A;  2F0K A;  4LK1 C;  1QOH A;  1YJW A;  1EWH A;  4HCE A;  2OQK A;  2JA5 G;  4BA2 I;  1Y1V H;  1ZEQ X;  1TWF H;  1B53 A;  1LM0 A;  5CV4 A;  3S1R B;  2SDF A;  2D2C C;  4FF1 A;  4HJ9 A;  4OEM B;  5EAY A;  2F0Q A;  4B9X A;  3M4P A;  1SYE A;  1BQQ T;  2OWO A;  3PUX A;  5EKK A;  1I4P A;  3DWQ A;  5LMU L;  2J0T D;  3HOU G;  3HP3 A;  1WI5 A;  2XRS D;  3FHW A;  5IOD A;  1O7Y A;  2E2I H;  1JOR A;  3ICE A;  4OIK A;  4HSV A;  2K32 A;  2AWO A;  3OPO A;  4IUR A;  1QZH A;  4DV4 L;  4KV6 A;  2Z6B A;  2NVY H;  4DN4 M;  5GAH C;  3NHH A;  3O13 A;  2A69 D;  2MQH A;  1UE6 A;  1WVL A;  1KAA A;  3DWA A;  5K36 H;  4ME5 A;  4DV3 Q;  4JYA Q;  1SYF A;  3U58 A;  2Q2T A;  4A3G H;  1X3P A;  5LL6 S;  4OO1 G;  2K28 A;  4HIM A;  4DR2 L;  3PF4 A;  3VR6 A;  5GAG C;  3UDG A;  4AIM A;  3NEL A;  1ZYR C;  2WFW A;  4YHH L;  3EJI A;  4DFA A;  3OTO L;  5E4W C;  1MKH A;  2ZXP A;  3H0G H;  1PZI D;  3H09 A;  1RTN A;  3AU7 A;  1PH3 A;  2JXM B;  5GAE C;  3PIP A;  4GOP A;  1VQM A;  3DUZ A;  5K36 G;  2E76 C;  3S2D H;  2EJM A;  1A2T A;  4DUZ Q;  4OX9 L;  5HUR A;  4NXN Q;  2JA8 G;  2PPB C;  4A3F G;  5CBA E;  1IYJ B;  1UE5 A;  3S14 B;  5C4X H;  2CW0 D;  4B3R L;  3QWN A;  1G29 1;  3HOX G;  4HMI A;  1K83 H;  3KUP A;  1EOT A;  1Z6H A;  2F0I A;  3PCO B;  3U9S A;  2D0P A;  1X54 A;  1D8L A;  2BE5 D;  2JEB I;  4JI0 L;  3J80 L;  3PO2 B;  3HOU H;  3GTK H;  1BBW A;  3ND8 A;  3HEJ A;  1UEB A;  2NN6 H;  2GA4 B;  4DNT B;  5FO7 B;  1CSQ A;  2D0O A;  3OIP A;  4A3I B;  4CDC C;  3F1Z A;  2JSO A;  4Y7N B;  1C7Y A;  3C1E A;  2E2D C;  4XQJ A;  4JBJ A;  2ENB A;  1KC8 C;  4HJ7 A;  3HOY B;  2F0E A;  2B2Y C;  1QUQ B;  3WWV A;  2E5L Q;  4DV0 L;  1WTH A;  4A3J B;  2L9H A;  3FKI H;  4B9W A;  4ZLT F;  2JA6 G;  3BU2 A;  3Q23 A;  1JT8 A;  2B8G A;  3RLN A;  1L1O A;  1X56 A;  3G6E A;  2B2W C;  2NN6 G;  3SEB A;  4LFC L;  3P1H A;  3KF8 B;  1G8Z D;  1ROD A;  3ERQ A;  5A2Q E;  3ITP A;  1PH7 A;  4DAP A;  2RKS A;  2KCM A;  1VQ8 A;  1XNQ L;  4DV4 Q;  1VQA A;  2CCZ A;  1SE4 A;  1WTX A;  1ILQ A;  1IZ6 A;  2G9D A;  3A7A B;  5FJ8 G;  3CRL C;  3MXP A;  3C46 A;  3RZD B;  2QGQ A;  5JJZ A;  1QIL A;  2RQX A;  2NVT B;  4DV6 Q;  4RFB A;  4XIG S;  5KYI A;  2EQS A;  3S17 H;  3IKJ A;  3MC0 B;  2L4N A;  4X3K A;  1K3R A;  3KLS X;  1SJE D;  4IAL A;  3A74 A;  2A1A A;  4RCO A;  5ELC A;  1YVC A;  5DNF A;  1LT5 D;  2K7V A;  3R8B A;  4K0K Q;  1LTT D;  3U4V A;  5LHY 1;  3CAM A;  1BCP B;  1X3F A;  5EGT A;  1LTI D;  1B4O A;  1XMO L;  4DAY B;  1HZ9 A;  2HHH L;  1PFB A;  5IT9 E;  3GTM H;  3FMC A;  3J81 j;  5M9O A;  5IE8 A;  2EY1 A;  3DM3 A;  4ILW A;  2O5I C;  2JN4 A;  1D6E C;  3I7F A;  1HNW Q;  1TWG H;  2NUC A;  4YCU A;  2XIW A;  1VQO A;  1RHP A;  2K03 A;  4M8A A;  4OIJ A;  4H7B A;  1EFW A;  3I4N G;  3S1M H;  3STB D;  4DK3 C;  5I9P A;  1EWI A;  3TZU A;  2NYZ D;  3KLW A;  3RN2 A;  4J15 A;  1B1Z A;  1A15 A;  3OIQ A;  2IHE A;  1SN8 A;  2Z6K C;  1HQR D;  1TS2 A;  4BBR B;  5C0X G;  1OXT A;  2UUB L;  1QZG A;  4UP9 A;  1I3Q H;  1EY5 A;  1FD7 D;  2QDL A;  2Q2I A;  4A3F B;  1JE4 A;  1H9J A;  4O2D A;  1YNJ D;  1TQO A;  4DK0 A;  3I4L A;  3NPP A;  5M5Y B;  1F2M A;  1SFO H;  1TY2 A;  4UP8 A;  4HJA A;  3L7Z C;  1IBL Q;  1GUG A;  2ZM6 Q;  4DR3 L;  2B39 A;  5ELF A;  5IOC A;  1UUP A;  1D5Z C;  4R9W A;  2OCE A;  1TWC H;  1EY0 A;  5EKL A;  3UE0 A;  1DCZ A;  1L0Y B;  1SND A;  3PUZ A;  1VQH A;  3I90 A;  1HQM C;  5KGU A;  3HKZ G;  1HR0 W;  1MIU A;  2M00 A;  1EU4 A;  1I6H B;  3GTO H;  2D9U A;  2WII B;  5IP9 H;  4B3S L;  2VW9 A;  5K5P A;  4HR7 B;  1LTR D;  5KND A;  5E3F A;  3CRK C;  4IOC A;  1JE5 A;  2R92 H;  3C3L A;  1Z9F A;  3MEH A;  4PQX A;  1XNR L;  1YNX A;  2NVY B;  4CDE C;  4BY7 G;  1V1Q A;  1IBK Q;  3HOU B;  1GJX A;  3R93 A;  2Z4H A;  2PYK A;  1O7Z A;  1EEI D;  1F2Y A;  1IL2 A;  2EYO A;  3M3Y B;  5DAU A;  2YTX A;  3W2D A;  2VNU D;  2R93 H;  4CKC A;  1BNZ A;  3TQY A;  2R61 A;  2JYO A;  1VMC A;  3ULJ A;  3SVM A;  4ZRZ A;  5FLM H;  4DR3 Q;  4JI6 L;  2Y0S B;  2X69 A;  1HUN A;  1TWA H;  3P7J A;  1N34 L;  1GD7 A;  1Q8K A;  4HCS A;  2EYH A;  3H0G G;  1L0W A;  2Q8I B;  4R1J A;  1KQS A;  4QIW E;  3GTJ B;  1VQ9 A;  4RGT A;  2VS1 A;  4GOP B;  4FF2 A;  4Y52 H;  1OXV A;  2LFN A;  2A5H A;  1PH8 A;  3AB9 A;  4JC0 A;  1Y8P B;  2HIV A;  4H02 A;  5G3L D;  2B2Y A;  1EIF A;  3BZD B;  4CBV A;  1EY9 A;  1Q81 C;  4ULL A;  1KD1 C;  1SLJ A;  4JI5 L;  2L15 A;  3ERS X;  2LY7 A;  2WB1 G;  4V0B A;  1CSP A;  3V96 A;  1IW7 D;  1CI3 M;  3IL8 A;  4NXN L;  4O42 A;  2UXC Q;  4B3T Q;  4OXP A;  1STH A;  1XPU A;  2A8V A;  5LMN W;  2F4V Q;  4JOI A;  2IX0 A;  3DM1 A;  2ZXR A;  4L5S A;  1LTA D;  3FP9 A;  4JPB W;  2LXK A;  1LT6 D;  1E2W A;  1SNO A;  1J5E Q;  1VQG A;  2NVQ H;  3TRZ A;  4JV5 Q;  3T1H Q;  2UXD Q;  4ZKB B;  2R92 B;  3T56 B;  4IPD A;  4IFD I;  1K9M C;  5D65 A;  4DV7 L;  2RDF A;  2F03 A;  3H15 A;  4JI3 L;  1EY7 A;  2KVM A;  4JI5 Q;  5JEA G;  4JBK A;  2DY7 A;  1DXM A;  1YIJ A;  2WB1 B;  4DK1 A;  2JP1 A;  4LFB L;  3IFD A;  4L8J A;  1U9R A;  2MFI A;  4ZK9 B;  5ELE A;  4DV1 Q;  4R8N A;  2B2U A;  2IHF A;  4KHV A;  1B70 B;  3CF5 A;  1NSN S;  1X3E A;  2EY6 A;  1O7I A;  2R7Z G;  1X6O A;  2R6G A;  1RF2 D;  3BYY B;  3T1Y Q;  1JQY D;  5CR3 A;  3S14 H;  3HZX A;  3AFP A;  2ZM6 L;  2NVT H;  2LXJ A;  2F3I A;  1R4Q B;  4IJH A;  3HOZ G;  1WCM B;  1K0R A;  2MGS A;  2E2J B;  3CCV A;  1EU3 A;  2YU9 B;  3W1G A;  5NUC A;  3MZ5 A;  1HZA A;  2KCN A;  4AYB B;  1PYW D;  1C4Q A;  1NR2 A;  5M5W H;  5C5L A;  2N3S A;  4KKS A;  1SMX A;  4N9P A;  1Q82 C;  3E9H A;  2XRQ D;  5KEE A;  1VQB A;  1STY A;  1STA A;  5CC4 A;  1AP0 A;  3PO3 G;  1PTO H;  1SNP A;  2OF1 A;  1X9N A;  1Q3L A;  2AQ2 B;  3GTM B;  1Y1W G;  3HOV H;  2MUY A;  1WJJ A;  1U4M A;  1Q1B A;  1NTG A;  3BZK A;  2Q2H A;  4R4Q A;  4UHV A;  1HA5 A;  3C1F A;  2TSS A;  3NSW A;  1NBW A;  2Z1C A;  3T13 A;  1CKO A;  3CKI B;  3BVG A;  1XNQ Q;  3RLO A;  4IFD G;  4RCN A;  4PMC A;  1TT2 A;  4MHE A;  3SR1 A;  3GTQ H;  4O0A A;  1LTL A;  1U4P A;  4AH6 A;  4DV0 Q;  1WTO A;  4X66 L;  2A19 A;  3C2P A;  1GKH A;  4YCW A;  4PMW A;  1YHQ A;  1HFN A;  4R4C A;  2E75 C;  1I3Q B;  5C0X I;  1EZ6 A;  1BCP C;  1EY4 A;  4FYD A;  3GQB A;  3HOX H;  4LF8 L;  3T53 B;  4HIK A;  1H9K A;  4C1N K;  1SJH D;  4EQP A;  4IUT A;  5J39 A;  2Q8R E;  3FKI B;  1Q7Y C;  1SE3 A;  1YZ6 A;  3I4O A;  3J81 E;  3QG1 A;  4QUF A;  3G71 A;  4QF4 A;  3OWE B;  3P20 A;  5M3M G;  1X3G A;  4IPH A;  2FMC A;  4EGV A;  1EOV A;  3S1Q H;  3UI2 A;  1CA6 A;  4PZ7 A;  1SMY C;  3A54 A;  2PI2 A;  2MNA A;  2HDM A;  3J81 c;  2R7Z B;  2VUM H;  1KNE A;  4JBW A;  2F0V A;  4LFB Q;  1BOS A;  4XYO A;  4JCV E;  1NNX A;  2R92 G;  3S15 B;  1E7Z A;  1VQI A;  3J7A F;  1EIY B;  1D5X C;  1P16 A;  3CW2 C;  2P5Z X;  3OMG A;  2A68 D;  3BS1 A;  1XPO A;  4DR6 L;  2JA7 B;  4XT1 B;  1JJC B;  4CJ0 B;  2G9H D;  3KBG A;  5HY6 A;  3A55 A;  3ZJY C;  4NMZ A;  4LUV A;  2B63 H;  1STE A;  4KHP Q;  1RDP D;  3CC4 A;  4TRD A;  4BY7 H;  3UDF A;  1LV9 A;  1IYV A;  1VS0 A;  1IW7 C;  2VQF L;  2CHB D;  1I4H A;  2K5N A;  3I2Z A;  1O78 A;  3UDX A;  3K59 A;  4JI4 Q;  3CCM A;  2B2W A;  1L1O C;  4GNX B;  1SSO A;  4IZ8 A;  2UUB Q;  3AQQ A;  4GKJ L;  3QO2 A;  4FXK C;  1HCZ A;  4XQN A;  5EQ0 A;  1VQN A;  2DJF C;  3EIV A;  1LUZ A;  3K7U C;  1S5E D;  2A6H C;  3MTS A;  3K5M A;  1AZP A;  4YY3 Q;  5A35 A;  1A2U A;  2K01 A;  1SNC A;  2MP1 A;  4X6A H;  4QB4 A;  1E24 A;  1PDQ A;  5IYB G;  4QUC A;  1A3T A;  2XWJ B;  4RGM A;  3IRB A;  1K0S A;  5FLX E;  3CHB D;  3DLL A;  3QIA A;  4DV5 Q;  2M2L A;  4K6D A;  1HZB A;  1QUQ A;  1BCP D;  4CDF C;  2OEO A;  4PV1 C;  1WTP A;  4WFN 3;  4LUO A;  1IBM Q;  4G7Z C;  1EWC A;  4FP5 D;  2HQE A;  2I5L X;  5EKI A;  5A2Q L;  3K6O A;  4GN5 A;  3BVM A;  2I5H A;  4BY1 H;  1F9S A;  3S17 B;  4IN3 A;  3Q8D A;  1FR3 A;  4Q5V A;  3H3V H;  2RCN A;  1PTO F;  1D7Q A;  3NTK A;  1I94 L;  1NCV A;  4LF9 L;  3A8J E; 
#chains in the Genus database with same CATH homology
 5KYL A;  1B50 A;  2IT1 A;  3D4W A;  2RDH A;  2RSO A;  4IQZ A;  2KJX A;  3S1N B;  4CJ2 C;  3I72 A;  2NZ1 D;  5M5X B;  1EIH A;  4ID6 A;  1PRT D;  1V8Q A;  2ZXO A;  2WAQ B;  3TP7 A;  1STN A;  2B2U C;  4CKB A;  2OXP A;  3JAM E;  2O5J C;  4FXG C;  3SHL A;  2JA8 B;  1AZQ A;  1AW7 A;  1FNV A;  4A3B B;  2EYF A;  4FF3 A;  3SK8 A;  4I65 A;  5C4J B;  1KDB A;  1LTS D;  4BBS B;  4F8M A;  3LWU A;  5C44 B;  2ZT9 C;  1GUW A;  2KEC A;  3K5N A;  4A3D B;  5FLX L;  3RMH A;  4XTC S;  5DM7 3;  4HMJ A;  4C3J B;  1AFP A;  4UDU C;  3I91 A;  1JWU D;  1LAB A;  1DOM A;  2L1B A;  3DMU A;  2A6E C;  1BR9 A;  1DD2 A;  2XN9 C;  5C4H A;  2SOB A;  4E6I A;  1PXU A;  2XNA C;  1JOQ A;  4DAV A;  2F0T A;  1EQT A;  3A8K E;  2EYP A;  3TP8 A;  5CV6 A;  1ZXT A;  3MWY W;  2N55 A;  5IT9 L;  1GXD C;  1D2B A;  1XTC D;  4WOR A;  4FF4 A;  2PQE A;  3SK4 A;  3J81 L;  2L0C A;  2FJ2 A;  2JA6 B;  5ISR A;  1Q12 A;  1EQV A;  3KLS A;  4K2K A;  3NWS A;  1ET6 A;  2AUJ D;  4HTH A;  3NTH A;  2F0S A;  1QNK A;  2HCI A;  2BA1 A;  5C3E B;  1A3V A;  3FRP B;  2HUG A;  3T4A C;  2V4D A;  4Z9C B;  1KAB A;  3Q24 A;  2K5D A;  1XWE A;  3TME A;  2F0N A;  5C4X B;  1SYB A;  3J80 E;  1PTO B;  3GTP B;  4ZUJ A;  1R4P B;  4DU9 A;  1TR5 A;  3G7L A;  4KKT A;  1MD2 D;  1K83 B;  1EL0 A;  3PUY A;  1LLR D;  4TQU S;  2XSC A;  1SYG A;  1TS3 A;  1Y8N B;  1X32 A;  4YIJ A;  4RAU C;  1CQV A;  2ICE C;  1G2T A;  5EJW A;  1CFM A;  2A68 C;  5C3X A;  5CBE E;  1OXU A;  3NWT A;  3ONA B;  4NP5 A;  4G7O C;  4OGQ C;  1G91 A;  1QG7 A;  2SEB D;  3L9A X;  1CZW A;  1NR4 A;  3PUV A;  3S2D B;  1STG A;  1CA5 A;  1I4Q A;  5C6A A;  3R3O A;  2F0M A;  3FPU B;  2B63 B;  1S5B D;  4RKL A;  2L5T A;  1LTB D;  3TP5 A;  3S16 B;  5JOB A;  3WDN A;  3NP8 A;  4KN7 C;  3GTG B;  2PZT A;  1OXX K;  1DON A;  2IJ0 A;  2SNM A;  2PNR C;  1I4R A;  1PRT F;  4K2L A;  1CHP D;  1GHJ A;  2PZW A;  4LMQ D;  3D6W A;  2F0F A;  2WV6 D;  4QMG A;  3W3A A;  1PRT C;  4RH6 A;  3GV3 A;  5BN4 A;  2F0L A;  2JA5 B;  2RSN A;  2PZU A;  2VB2 X;  4H0L C;  3PIP 3;  5DEH A;  2TMP A;  3S2H B;  1Q1E A;  5C5M A;  3VR3 A;  1PZK D;  3GV6 A;  3GTQ B;  5FK9 C;  4XYQ A;  4CHT B;  2LKV A;  1SNQ A;  1CTM A;  2Z8L A;  2KHS A;  1TWG B;  1Y1W B;  3Q6S A;  4MIU A;  3I3C A;  1C48 A;  3NBI A;  1CM9 A;  4KKU A;  1BUV T;  3TZD A;  3E6Z X;  3VA5 A;  4RGN A;  1PRT B;  1DYQ A;  4Q0F A;  1HHV A;  2WKD A;  3NK9 A;  3KF8 A;  1LO5 D;  3NQT A;  4RWS C;  1F2L A;  3PV0 A;  1Y8O B;  2EJG C;  3VYU A;  1SXT A;  1EZ8 A;  4KMU C;  4F87 A;  2ICI A;  3T51 B;  3TSS A;  3F2U A;  1GUT A;  1CT1 D;  3KK7 A;  1AEX A;  2K1B A;  3BDC A;  3MA2 B;  3RUZ A;  3HOW B;  4P2C B;  1E2Z A;  2EZV A;  4OL7 A;  2L12 A;  3M4Y A;  1Z7T A;  2IWH A;  4R8I A;  3S1M B;  3R2T A;  1HXY D;  1HTL D;  1Q90 A;  2LS0 1;  2EDG A;  4DGZ A;  1GOZ A;  1ZKO A;  2K5W A;  4K6L A;  5IGE A;  3RLF A;  5COY A;  4C2M B;  1EY8 A;  3QOJ A;  1UEA B;  3MVV A;  2D5D A;  2WKC A;  1EEF D;  5FO9 B;  4IUU A;  5EBC A;  2EXZ A;  2NVQ B;  3J7Y W;  2F0G A;  4KY7 A;  1ILP A;  4IUP A;  1EIG A;  1C8C A;  2F3V A;  2EE1 A;  2F1M A;  3MXN A;  5M5W B;  2AWN A;  3S1Q B;  1TS4 A;  1PFN A;  4A93 B;  1B9N A;  3VR2 A;  4J1M A;  5M3F B;  3D6C A;  1JR0 D;  1F77 A;  1QJO A;  2QIL A;  4J8Q A;  4IFD H;  3JAM L;  1BCP F;  1KTK A;  1ESF A;  4K8I A;  3I4N B;  2PW7 A;  3OOC A;  1B2T A;  3VYR A;  3MFY A;  1BDO A;  3GTL B;  2L11 A;  4ODG A;  2K6A A;  3LWE A;  1MBY A;  4ZKC B;  4RHR A;  4C56 C;  2A74 C;  4ZQ3 A;  1MSH A;  1T5E A;  4PMB A;  1RJT A;  4XQQ A;  4K5W A;  1G2S A;  5E4X A;  1JOO A;  2KCC A;  2BA0 A;  1PMR A;  4DXG A;  1O7L A;  2PCF B;  4C1N I;  1F9Q A;  1TY0 A;  1V43 A;  1W6J A;  5EPJ A;  1OO9 B;  4KN4 C;  1FNW A;  1D1I A;  2DNE A;  3PIO 3;  1PTO C;  2A73 B;  2N88 A;  3D4R A;  5JEA H;  1O80 A;  1R9T B;  1CQF A;  2FMM A;  1JCK B;  4RA8 A;  2KUM A;  2AQ3 B;  4F88 A;  3HRZ C;  4IUV A;  5J22 A;  4BY7 B;  4HED A;  4ZYS A;  3BG3 A;  1XX8 A;  3SE0 A;  5JEA J;  4KTA A;  4UAI A;  3VR5 A;  2IW3 A;  4X3U A;  1L0X B;  2F0P A;  3M7N A;  5AFW A;  2B2T C;  1SNM A;  1GUN A;  2WIN B;  1A6X A;  1H9S B;  2A6E D;  2AQ1 B;  1STB A;  5D3I B;  4QCL A;  4X3S A;  1MI2 A;  3K0Y A;  1H9S A;  5KIX A;  4A3G B;  1KLG D;  1B9M A;  2NTS A;  2RVL A;  1HFG A;  1BO0 A;  1KDA A;  1I6V C;  3DEO A;  4CKE A;  3HKZ B;  1VF5 C;  4C3H G;  2JEA I;  2HCC A;  1SMY D;  2RBM A;  5I4D A;  2F4I A;  4KJO A;  1SE2 A;  1RCV D;  2C9O A;  1V1P A;  2MJ8 A;  4K5X A;  3OSO A;  3G6J B;  4FVM A;  5IGG A;  1LAC A;  5ELD A;  4IFD J;  3GTK B;  2C5C A;  2F3W A;  3A7L A;  1TKW B;  5EPL A;  3DXJ C;  2BOS A;  3T16 A;  3NBH A;  2QDB A;  1QNU A;  1HRJ A;  3ZYY X;  1FNU A;  1W6K A;  3HS0 C;  1D5M C;  1D1K A;  4BWG B;  3SK5 A;  2NB0 A;  3GO5 A;  3QJY A;  3GP7 A;  5CV7 A;  3E0J A;  4LJZ C;  2E2I B;  1MSG A;  1E2V A;  3LX0 A;  4F7X A;  2CW0 C;  4BY1 B;  2ID0 A;  2PO4 A;  3Q22 A;  3M7G A;  3BVZ A;  1FGB D;  1X3Q A;  4C3J G;  1WTV A;  2KQ3 A;  1KNA A;  2WP8 J;  5FO8 B;  2NTT A;  2Z4I A;  3X3M A;  2EPB A;  3D8G A;  5E1F A;  1VCI A;  5I2Y A;  4XDX A;  1SYD A;  4KY6 A;  5CYU A;  3A56 A;  1ML0 D;  3R2I A;  2EYL A;  3IFT A;  3IAY A;  4LAA A;  1WTQ A;  3BYT B;  3DHQ A;  3H0G B;  1S5D D;  2R3Z A;  5LL6 X;  3EQL C;  3MAQ A;  1U4L A;  1Y1V B;  2A6H D;  1HUM A;  4NW2 A;  4KK7 A;  2IPK D;  5C0X H;  5FOB B;  3SK6 A;  3GTO B;  1RD9 D;  4FXD A;  4FNF A;  3H91 A;  1QB5 D;  1CK1 A;  1LT4 D;  5BN3 A;  2F0W A;  1J8I A;  2NN6 I;  1Y69 U;  5HGT A;  4C3I G;  3E5S A;  2FFK B;  3RD4 A;  3MXG A;  1SAP A;  1S5F D;  2R93 B;  2B2V A;  3FVQ A;  3D31 A;  2WAC A;  1HTP A;  3P75 A;  1PZJ D;  4KD4 A;  1CHQ D;  1CZG A;  1ICW A;  1V1O A;  3TBI B;  1A3U A;  1M4V A;  2EJF C;  1ONL A;  2EYJ A;  3V2T A;  1S5C D;  4XXE A;  5IGB A;  1TWH B;  4U67 3;  3EA6 A;  3FPP A;  2NVX B;  4DA2 A;  1J9O A;  1MGS A;  4EQO A;  4HSP A;  4KY5 A;  4K14 A;  5CV8 A;  3TDQ A;  4TKO B;  1JB3 A;  4A3K B;  1SFO B;  5JVH 3;  3VA7 A;  3I8Z A;  2D62 A;  4HN7 A;  1H9M A;  1JWM D;  2PW5 A;  1UAP A;  3MFG A;  2HDL A;  1B3A A;  4KJN A;  5I6Y A;  2E2H B;  1TII D;  2YYZ A;  1JWS D;  4H13 C;  4ZUI A;  3Q0A A;  2KA7 A;  3SXH A;  1IYU A;  5DM6 3;  4J6H A;  4EVO A;  3D4D A;  3AMU A;  1RKN A;  2BDN A;  1F2Z A;  4S3S A;  2BCO A;  5KNC A;  4DAY A;  2DY8 A;  1M8A A;  2QEJ C;  4G7H C;  5C0X J;  5IGF A;  4M1U B;  3GD7 A;  3D3R A;  3K5O A;  1TU2 B;  2KEE A;  3H94 A;  4FO2 A;  1ENA A;  1HA6 A;  5I6W A;  4U68 A;  1I4X A;  1SYC A;  5T1I A;  1I4G A;  3K58 A;  1KLU D;  2EVB A;  4A3M B;  1U4R A;  2A69 C;  1ENC A;  2I07 B;  4IUN A;  4L6T B;  2X6G A;  1BXT A;  1GUO A;  2M9V A;  2CQA A;  3HG9 A;  3OWF A;  5KRU A;  2F0J A;  2FHT A;  2J7Z A;  2MHV A;  1QCB D;  1LT3 D;  4BS9 A;  1Q8I A;  1IKM A;  5D14 A;  1NAP A;  4B08 A;  2O2L D;  2IL8 A;  3HGB A;  4JK1 C;  5IGD A;  3K57 A;  5C4Z A;  2EY2 A;  4PNY A;  3I4M B;  4QIW B;  3L3O C;  5COR A;  2DN8 A;  1B44 D;  3OMC A;  3MXU A;  4G4K A;  1VDZ A;  4RKB A;  1IKL A;  3URY A;  2KED A;  2F0D A;  2IX1 A;  2QF7 A;  3PMF A;  1SDF A;  4CJ1 B;  3KBX A;  1QE6 A;  1LTG D;  4GZY C;  3N52 A;  1KDC A;  2QCP X;  3MHB A;  2H1E A;  1EFI D;  1ET9 A;  3A8I E;  3NXW A;  1ESR A;  3I70 A;  3NQI A;  3DWP A;  2VUM B;  1DZ1 A;  2JE6 I;  4WRD A;  2J4X A;  3NTI A;  1WTR A;  1K8O A;  2B2T A;  3K7A B;  4OO1 H;  3HOV B;  1OXS C;  4ZAI A;  1E0B A;  3H6M A;  4RHS A;  3BDO A;  4O1N A;  1ZYR D;  4OHJ A;  1DOK A;  5JVG 3;  3FEW X;  3M4O B;  4DF7 A;  1FYC A;  1JIC A;  3NE5 B;  1TWF B;  5IIF A;  1T5X D;  3EFX D;  1PFM A;  2BE5 C;  5EPK A;  4I7Z C;  4CGY B;  2B8F A;  5J1Z A;  2F0U A;  1GHK A;  2SNS A;  1GUS A;  3N6R A;  3V05 A;  2O4X A;  4BA1 I;  3DEP A;  1VMP A;  3H3V C;  3VR4 A;  4TSS A;  3SDZ A;  4A3E B;  3M85 A;  1PLF A;  3HOZ B;  3RZO B;  2Q8T A;  2DNC A;  1YNN D;  1S4Z A;  5TSS A;  3VYT A;  1DM0 B;  3I73 A;  4OO1 I;  4H44 C;  3PUW A;  5M3M B;  1EYD A;  4G57 A;  4DXF A;  3ERO A;  5I2X A;  1DJR D;  3FDT A;  1XXG A;  2XWB B;  2OT2 A;  1EY6 A;  4C3H B;  1TVX A;  3TN2 A;  1H9R A;  2EYM A;  5CV5 A;  2IX3 A;  1K8M A;  4KI0 A;  1SEB D;  1WTW A;  5F2D A;  2BDO A;  5FKA C;  2L55 A;  1WD0 A;  5JAV A;  3WOE A;  2H4O A;  1EYC A;  2EY5 A;  3HOX B;  5JPN C;  1DOL A;  1ENF A;  2E74 C;  4KD3 A;  2KOL A;  2AUK A;  1I50 B;  4L63 B;  1AN8 A;  3S9W A;  4NKL A;  3NUC A;  3LNN A;  1NUC A;  1HPC A;  3QB3 A;  2EOT A;  4NDX A;  5G3L F;  1JC7 A;  1TS5 A;  1JOK A;  2FIN B;  5CGK A;  4KHZ A;  5EBD A;  1V1P B;  2VXW A;  1SBB B;  3WOF A;  5IGC A;  3OHX C;  4RGO S;  4DNR B;  1TWC B;  1Z47 A;  3KLR A;  1F9P A;  3X3N A;  1YNN C;  3OW7 A;  4K5V A;  1RTO A;  1QWY A;  5ELB A;  1G6Z A;  1YNJ C;  3VYS A;  5CMD A;  5BN5 A;  1UNS A;  4X3T A;  1EYA A;  3BDL A;  2F0O A;  3J7A V;  1II3 A;  2LMC B;  2NWG A;  3U9O A;  2RDG A;  2I46 A;  2MPM A;  2RA4 A;  3K5L A;  4IUQ A;  1F9R A;  2VB3 X;  4C3I B;  1BBX C;  5D3D A;  3CU7 A;  4V19 0;  5KNB A;  3PO3 B;  2PMZ B;  2XVS A;  1IHZ A;  3ND9 A;  2B2V C;  4HAE A;  1XYI A;  2F0H A;  2CVR A;  2QKI C;  2K04 A;  2K5Q A;  1PTO D;  5I9O A;  2K33 A;  4N9T A;  4WJW A;  2NBF A;  1TWA B;  4EQN A;  3CQZ B;  2K05 A;  1WD1 A;  2X6L A;  5JPM C;  3EVQ A;  3QOL A;  4MN3 A;  4XT3 B;  5C3W A;  1VF7 A;  5CV9 A;  5T1G A;  1BF4 A;  1IL8 A;  3TP6 A;  4K8J A;  4ABN A;  2F0K A;  4LK1 C;  1QOH A;  1EWH A;  4HCE A;  4BA2 I;  1ZEQ X;  1B53 A;  5CV4 A;  4FF1 A;  3S1R B;  2SDF A;  2D2C C;  2F0Q A;  4B9X A;  1SYE A;  1BQQ T;  3PUX A;  5EKK A;  1I4P A;  3DWQ A;  2J0T D;  3HP3 A;  2XRS D;  5IOD A;  1O7Y A;  1JOR A;  4OIK A;  4HSV A;  2K32 A;  2AWO A;  3OPO A;  4IUR A;  4KV6 A;  4DN4 M;  3NHH A;  3O13 A;  2A69 D;  1WVL A;  1KAA A;  3DWA A;  5K36 H;  4ME5 A;  1SYF A;  1X3P A;  5LL6 S;  4OO1 G;  2K28 A;  3VR6 A;  1ZYR C;  3EJI A;  4DFA A;  5E4W C;  2ZXP A;  1PZI D;  3H09 A;  1RTN A;  3AU7 A;  2JXM B;  3DUZ A;  5K36 G;  2E76 C;  2EJM A;  1A2T A;  5HUR A;  2PPB C;  5CBA E;  3S14 B;  2CW0 D;  3QWN A;  1G29 1;  4HMI A;  3KUP A;  1EOT A;  1Z6H A;  2F0I A;  3U9S A;  2JEB I;  2BE5 D;  3PO2 B;  3J80 L;  3ND8 A;  3HEJ A;  2NN6 H;  2GA4 B;  4DNT B;  5FO7 B;  3OIP A;  4A3I B;  2JSO A;  4Y7N B;  3C1E A;  2E2D C;  4XQJ A;  2ENB A;  3HOY B;  2F0E A;  2B2Y C;  4A3J B;  2L9H A;  4B9W A;  4ZLT F;  3Q23 A;  2B8G A;  2B2W C;  2NN6 G;  3SEB A;  3P1H A;  1G8Z D;  1ROD A;  3ERQ A;  5A2Q E;  3ITP A;  4DAP A;  2RKS A;  1SE4 A;  1WTX A;  1ILQ A;  2G9D A;  3A7A B;  3CRL C;  3MXP A;  3C46 A;  3RZD B;  5JJZ A;  1QIL A;  2RQX A;  2NVT B;  4RFB A;  4XIG S;  5KYI A;  3IKJ A;  3MC0 B;  2L4N A;  4X3K A;  3KLS X;  1SJE D;  4IAL A;  4RCO A;  5ELC A;  5DNF A;  1LT5 D;  2K7V A;  3R8B A;  1LTT D;  5LHY 1;  1BCP B;  5EGT A;  1LTI D;  1B4O A;  1PFB A;  5IT9 E;  3FMC A;  5M9O A;  2EY1 A;  4ILW A;  2O5I C;  1D6E C;  2NUC A;  2XIW A;  1RHP A;  2K03 A;  4M8A A;  4OIJ A;  4H7B A;  5I9P A;  3TZU A;  2NYZ D;  1B1Z A;  1A15 A;  3OIQ A;  1HQR D;  1TS2 A;  4BBR B;  5C0X G;  1OXT A;  1EY5 A;  1FD7 D;  4A3F B;  1JE4 A;  1H9J A;  1YNJ D;  1TQO A;  4DK0 A;  3I4L A;  3NPP A;  5M5Y B;  1F2M A;  1TY2 A;  3L7Z C;  1GUG A;  2B39 A;  5ELF A;  5IOC A;  1UUP A;  1D5Z C;  4R9W A;  1EY0 A;  5EKL A;  1DCZ A;  1L0Y B;  1SND A;  3PUZ A;  3I90 A;  1HQM C;  5KGU A;  2M00 A;  1EU4 A;  1I6H B;  2D9U A;  2WII B;  5K5P A;  4HR7 B;  1LTR D;  5KND A;  5E3F A;  3CRK C;  3C3L A;  3MEH A;  4PQX A;  2NVY B;  3HOU B;  1GJX A;  3R93 A;  2Z4H A;  2PYK A;  1O7Z A;  1EEI D;  1F2Y A;  2EYO A;  3M3Y B;  5DAU A;  3W2D A;  2VNU D;  4CKC A;  1BNZ A;  2R61 A;  2JYO A;  1VMC A;  3SVM A;  4ZRZ A;  2Y0S B;  2X69 A;  1HUN A;  3P7J A;  4HCS A;  2EYH A;  2Q8I B;  3GTJ B;  4RGT A;  4FF2 A;  1OXV A;  2LFN A;  2A5H A;  3AB9 A;  1Y8P B;  5G3L D;  2B2Y A;  3BZD B;  4CBV A;  1EY9 A;  4ULL A;  2LY7 A;  4V0B A;  3V96 A;  1IW7 D;  1CI3 M;  3IL8 A;  4O42 A;  1STH A;  2IX0 A;  3DM1 A;  2ZXR A;  1LTA D;  1LT6 D;  1E2W A;  1SNO A;  4ZKB B;  2R92 B;  3T56 B;  4IFD I;  5D65 A;  2F03 A;  2RDF A;  1EY7 A;  2KVM A;  5JEA G;  2DY7 A;  1DXM A;  2WB1 B;  4DK1 A;  2JP1 A;  3IFD A;  4L8J A;  1U9R A;  4ZK9 B;  5ELE A;  4R8N A;  2B2U A;  4KHV A;  1NSN S;  2EY6 A;  2R6G A;  1RF2 D;  3BYY B;  1JQY D;  5CR3 A;  3HZX A;  1R4Q B;  1WCM B;  2MGS A;  2E2J B;  1EU3 A;  2YU9 B;  5NUC A;  3MZ5 A;  2KCN A;  4AYB B;  1PYW D;  1C4Q A;  1NR2 A;  5C5L A;  4KKS A;  4N9P A;  2XRQ D;  5KEE A;  1STY A;  1STA A;  5CC4 A;  1AP0 A;  1PTO H;  1SNP A;  2OF1 A;  1Q3L A;  2AQ2 B;  3GTM B;  2MUY A;  1U4M A;  1Q1B A;  1HA5 A;  3C1F A;  2TSS A;  3NSW A;  2Z1C A;  3T13 A;  3CKI B;  3BVG A;  4IFD G;  4RCN A;  4PMC A;  1TT2 A;  4MHE A;  3SR1 A;  1U4P A;  1WTO A;  3C2P A;  4PMW A;  1HFN A;  2E75 C;  1I3Q B;  5C0X I;  1EZ6 A;  1BCP C;  1EY4 A;  4FYD A;  3GQB A;  3T53 B;  1H9K A;  4C1N K;  1SJH D;  4EQP A;  4IUT A;  5J39 A;  2Q8R E;  3FKI B;  1SE3 A;  3J81 E;  3QG1 A;  4QUF A;  4QF4 A;  3OWE B;  3P20 A;  2FMC A;  4EGV A;  3UI2 A;  1CA6 A;  2R7Z B;  1SMY C;  3A54 A;  2HDM A;  1KNE A;  4JBW A;  2F0V A;  1BOS A;  4XYO A;  3S15 B;  3J7A F;  1D5X C;  3OMG A;  2A68 D;  3BS1 A;  2JA7 B;  4XT1 B;  4CJ0 B;  2G9H D;  3KBG A;  3A55 A;  4NMZ A;  1STE A;  1RDP D;  4TRD A;  1IYV A;  1LV9 A;  1IW7 C;  2CHB D;  1I4H A;  1O78 A;  3K59 A;  2B2W A;  1SSO A;  4IZ8 A;  3QO2 A;  4FXK C;  1HCZ A;  4XQN A;  5EQ0 A;  1AZP A;  1S5E D;  2A6H C;  3MTS A;  3K5M A;  5A35 A;  1A2U A;  2K01 A;  1SNC A;  2MP1 A;  4QB4 A;  1PDQ A;  4QUC A;  1A3T A;  2XWJ B;  4RGM A;  5FLX E;  3CHB D;  3QIA A;  2M2L A;  4K6D A;  1BCP D;  2OEO A;  4PV1 C;  1WTP A;  4WFN 3;  4G7Z C;  1EWC A;  4FP5 D;  2HQE A;  5EKI A;  5A2Q L;  3K6O A;  3BVM A;  1F9S A;  3S17 B;  4IN3 A;  1FR3 A;  4Q5V A;  1PTO F;  3NTK A;  1NCV A;  3A8J E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...