5DM6E

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
b'GKQPIAVPSGVTVNAQDGVFKVKGPKGELTVPYNTELTVRQDGDQLLVERPSDAQKHRALHGLTRTLVANAVKGVSDGYTINLELRGVGFRAKLTGKALEMNIGYSHPVIIEPPAGVTFAVPEPTRIDVSGIDKQLVGQVAANVRKVRKPDAYHGKGVRFVGEQIALKAGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5dm6E02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 5dm6E01
4IO9E 1QVGE 4WFNE 1K9MG 1VQNE 5DM6E 3G71E 1QVFE 5HL7E 3CC2E 1YJ9E 3I55E 4WF9E 3CCQE 3CMAE 3CC7E 3CXCE 1VQ9E 3CCSE 1K73G 5GADG 2ZJPE 1VQKE 1N8RG 5AN9B 5JVGE 1VQME 3CCJE 1VQ6E 5H1SI 3CF5E 2ZJQE 1YIJE 3PIPE 5MLCH 1K8AG 2OTLE 1Q86G 1KC8G 1YHQE 1Q81G 1S72E 3CMEE 1W2BE 5GAGG 3CCVE 1VQ8E 1VQ4E 3PIOE 4WCEE 5GAHG 3CCLE 1M1KG 1VQPE 1Q82G 1Q7YG 3CCRE 1VQLE 3CD6E 3J7ZG 1RL6A 3CCUE 5JVHE 4IOCE 4UY8G 3I56E 1KD1G 1YJNE 1KQSE 2CQLA 3OW2E 1VQ7E 3DLLE 5DM7E 1YJWE 4WFAE 2ZJRE 1M90G 1JJ2E 1VQOE 4WFBE 5GAEG 3CPWE 1YITE 2QEXE 1NJIG 3CCEE 1YI2E 3CCME 1VQ5E 4IOAE 2OTJE 3G6EE 2QA4E 4U67E 3CC4E 3G4SE
chains in the Genus database with same CATH superfamily
4IO9E 1QVGE 2OL6O 4WFNE 1K9MG 1VQNE 5DM6E 3G71E 1QVFE 1FJ1E 5HL7E 3CC2E 1YJ9E 3EC5A 3I55E 2G8CO 4WF9E 3CCQE 3CMAE 3CC7E 3CXCE 2OY5O 1VQ9E 3CCSE 1K73G 5GADG 2ZJPE 1VQKE 2OY8A 1N8RG 2OY1O 2AF5A 5AN9B 5JVGE 1VQME 3CCJE 1VQ6E 5H1SI 2FKJA 3CF5E 2ZJQE 1YIJE 3PIPE 5B3MO 5MLCH 1K8AG 2OTLE 5B2AO 2FKGA 1Q86G 1KC8G 2I5ZO 1YHQE 1Q81G 2HKDA 2OL8O 1S72E 3CMEE 5B11O 3IGEA 1W2BE 5GAGG 3CCVE 1VQ8E 2OY7A 1VQ4E 3PIOE 2PI3O 4WCEE 5GAHG 3CCLE 1M1KG 1VQPE 1Q82G 1Q7YG 3CCRE 1VQLE 1RJLC 3CD6E 2I5VO 3J7ZG 1RL6A 3CKFA 3CCUE 5JVHE 4IOCE 4UY8G 3I56E 1KD1G 1YJNE 1KQSE 2CQLA 3IG9A 3OW2E 1VQ7E 3DLLE 1OSPO 5DM7E 1YJWE 4WFAE 2ZJRE 1M90G 1JJ2E 3AUMO 1VQOE 4WFBE 5GAEG 3CPWE 1YITE 2QEXE 1P4PA 1NJIG 3CCEE 1YI2E 3CKGA 3CCME 1VQ5E 4IOAE 2OYBO 2OL7A 2OTJE 3G6EE 2QA4E 4U67E 3CC4E 3G4SE 5B10O
chains in the Genus database with same CATH topology
4IO9E 1QVGE 4WFNE 1K9MG 1VQNE 5DM6E 3G71E 1QVFE 5HL7E 3CC2E 1YJ9E 3I55E 4WF9E 3CCQE 3CMAE 3CC7E 3CXCE 1VQ9E 3CCSE 1K73G 5GADG 2ZJPE 1VQKE 1N8RG 5AN9B 5JVGE 1VQME 3CCJE 1VQ6E 5H1SI 3CF5E 2ZJQE 1YIJE 3PIPE 5MLCH 1K8AG 2OTLE 1Q86G 1KC8G 1YHQE 1Q81G 1S72E 3CMEE 1W2BE 5GAGG 3CCVE 1VQ8E 1VQ4E 3PIOE 4WCEE 5GAHG 3CCLE 1M1KG 1VQPE 1Q82G 1Q7YG 3CCRE 1VQLE 3CD6E 3J7ZG 1RL6A 3CCUE 5JVHE 4IOCE 4UY8G 3I56E 1KD1G 1YJNE 1KQSE 2CQLA 3OW2E 1VQ7E 3DLLE 5DM7E 1YJWE 4WFAE 2ZJRE 1M90G 1JJ2E 1VQOE 4WFBE 5GAEG 3CPWE 1YITE 2QEXE 1NJIG 3CCEE 1YI2E 3CCME 1VQ5E 4IOAE 2OTJE 3G6EE 2QA4E 4U67E 3CC4E 3G4SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IO9 E;  1QVG E;  4WFN E;  1K9M G;  1VQN E;  5DM6 E;  3G71 E;  1QVF E;  5HL7 E;  3CC2 E;  1YJ9 E;  3I55 E;  4WF9 E;  3CCQ E;  3CMA E;  3CC7 E;  3CXC E;  1VQ9 E;  3CCS E;  1K73 G;  5GAD G;  2ZJP E;  1VQK E;  1N8R G;  5AN9 B;  5JVG E;  1VQM E;  3CCJ E;  1VQ6 E;  5H1S I;  3CF5 E;  2ZJQ E;  1YIJ E;  3PIP E;  5MLC H;  1K8A G;  2OTL E;  1Q86 G;  1KC8 G;  1YHQ E;  1Q81 G;  1S72 E;  3CME E;  1W2B E;  5GAG G;  3CCV E;  1VQ8 E;  1VQ4 E;  3PIO E;  4WCE E;  5GAH G;  3CCL E;  1M1K G;  1VQP E;  1Q82 G;  1Q7Y G;  3CCR E;  1VQL E;  3CD6 E;  3J7Z G;  1RL6 A;  3CCU E;  5JVH E;  4IOC E;  4UY8 G;  3I56 E;  1KD1 G;  1YJN E;  1KQS E;  2CQL A;  3OW2 E;  1VQ7 E;  3DLL E;  5DM7 E;  1YJW E;  4WFA E;  2ZJR E;  1M90 G;  1JJ2 E;  1VQO E;  4WFB E;  5GAE G;  3CPW E;  1YIT E;  2QEX E;  1NJI G;  3CCE E;  1YI2 E;  3CCM E;  1VQ5 E;  4IOA E;  2OTJ E;  3G6E E;  2QA4 E;  4U67 E;  3CC4 E;  3G4S E; 
#chains in the Genus database with same CATH topology
 4IO9 E;  1QVG E;  2OL6 O;  4WFN E;  1K9M G;  1VQN E;  5DM6 E;  3G71 E;  1QVF E;  1FJ1 E;  5HL7 E;  3CC2 E;  1YJ9 E;  3EC5 A;  3I55 E;  2G8C O;  4WF9 E;  3CCQ E;  3CMA E;  3CC7 E;  3CXC E;  2OY5 O;  1VQ9 E;  3CCS E;  1K73 G;  5GAD G;  2ZJP E;  1VQK E;  2OY8 A;  1N8R G;  2OY1 O;  2AF5 A;  5AN9 B;  5JVG E;  1VQM E;  3CCJ E;  1VQ6 E;  5H1S I;  2FKJ A;  3CF5 E;  2ZJQ E;  1YIJ E;  3PIP E;  5B3M O;  5MLC H;  1K8A G;  2OTL E;  5B2A O;  2FKG A;  1Q86 G;  1KC8 G;  2I5Z O;  1YHQ E;  1Q81 G;  2HKD A;  2OL8 O;  1S72 E;  3CME E;  5B11 O;  3IGE A;  1W2B E;  5GAG G;  3CCV E;  1VQ8 E;  2OY7 A;  1VQ4 E;  3PIO E;  2PI3 O;  4WCE E;  5GAH G;  3CCL E;  1M1K G;  1VQP E;  1Q82 G;  1Q7Y G;  3CCR E;  1VQL E;  1RJL C;  3CD6 E;  2I5V O;  3J7Z G;  1RL6 A;  3CKF A;  3CCU E;  5JVH E;  4IOC E;  4UY8 G;  3I56 E;  1KD1 G;  1YJN E;  1KQS E;  2CQL A;  3IG9 A;  3OW2 E;  1VQ7 E;  3DLL E;  1OSP O;  5DM7 E;  1YJW E;  4WFA E;  2ZJR E;  1M90 G;  1JJ2 E;  3AUM O;  1VQO E;  4WFB E;  5GAE G;  3CPW E;  1YIT E;  2QEX E;  1P4P A;  1NJI G;  3CCE E;  1YI2 E;  3CKG A;  3CCM E;  1VQ5 E;  4IOA E;  2OYB O;  2OL7 A;  2OTJ E;  3G6E E;  2QA4 E;  4U67 E;  3CC4 E;  3G4S E;  5B10 O; 
#chains in the Genus database with same CATH homology
 4IO9 E;  1QVG E;  4WFN E;  1K9M G;  1VQN E;  5DM6 E;  3G71 E;  1QVF E;  5HL7 E;  3CC2 E;  1YJ9 E;  3I55 E;  4WF9 E;  3CCQ E;  3CMA E;  3CC7 E;  3CXC E;  1VQ9 E;  3CCS E;  1K73 G;  5GAD G;  2ZJP E;  1VQK E;  1N8R G;  5AN9 B;  5JVG E;  1VQM E;  3CCJ E;  1VQ6 E;  5H1S I;  3CF5 E;  2ZJQ E;  1YIJ E;  3PIP E;  5MLC H;  1K8A G;  2OTL E;  1Q86 G;  1KC8 G;  1YHQ E;  1Q81 G;  1S72 E;  3CME E;  1W2B E;  5GAG G;  3CCV E;  1VQ8 E;  1VQ4 E;  3PIO E;  4WCE E;  5GAH G;  3CCL E;  1M1K G;  1VQP E;  1Q82 G;  1Q7Y G;  3CCR E;  1VQL E;  3CD6 E;  3J7Z G;  1RL6 A;  3CCU E;  5JVH E;  4IOC E;  4UY8 G;  3I56 E;  1KD1 G;  1YJN E;  1KQS E;  2CQL A;  3OW2 E;  1VQ7 E;  3DLL E;  5DM7 E;  1YJW E;  4WFA E;  2ZJR E;  1M90 G;  1JJ2 E;  1VQO E;  4WFB E;  5GAE G;  3CPW E;  1YIT E;  2QEX E;  1NJI G;  3CCE E;  1YI2 E;  3CCM E;  1VQ5 E;  4IOA E;  2OTJ E;  3G6E E;  2QA4 E;  4U67 E;  3CC4 E;  3G4S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...