5DM6V

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
b'MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELARKGEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5dm6V00
3CC2V 3I55V 3CPWU 1VQ5V 1S72V 1NJIW 1VQKV 1YJWV 1YI2V 1QVFU 1VQLV 1Q7YW 3CMAV 1KQSU 1VQ9V 3I56V 3OW2U 1VQ4V 4WCEV 1K73W 1QVGU 1VQNV 2D3OW 3CD6V 3CCEV 5DM6V 3CC4V 4WFBV 3G4SV 1N8RW 2QA4V 1VQMV 3G6EV 2QEXV 1M1KW 3CCJV 1VQ6V 1VQ8V 3CC7V 1VQ7V 2OTLV 1K8AW 2OTJV 3CMEV 3CCQV 1KC8W 3CCVV 1YJ9V 1JJ2U 1YJNV 1YITV 1M90W 1K9MW 3CXCU 4WF9V 4WFAV 1Q82W 1Q81W 1R73A 3CCMV 3CCRV 3CCSV 1VQOV 1YHQV 1KD1W 3CCLV 3G71V 1YIJV 1W2BU 1VQPV 1Q86W 3CCUV
chains in the Genus database with same CATH superfamily
3B8NA 3OTFA 1TUEB 3ABMC 5IDJA 3OD4A 4Z2WA 4CZZA 3K5NA 2F93B 2Y48A 1HWYA 4PDVA 3G6BA 3JAWA 4J9YB 4DR6O 3CYOA 3LUTB 3JASA 4RQEA 4DR3O 3HKEA 1QU7A 3Q4HA 4I4TB 1X59A 3F5TA 1QVFU 4B3TO 2LO1A 3SJCC 2KG7B 4LF7O 1YTFD 2ZNIA 4XDLA 3MD0A 1BQZA 2IH1C 1NBMG 3GVMA 5JJEB 5LHIA 4FMTA 1JR9A 3L9DA 1Q6UA 2HR3A 5KAIZ 1FXKA 1NVPD 2QKCA 3AG3B 3BFRA 1VP7A 3B4SA 4I9WA 1J5EB 5B1NA 3RW0A 1OJHA 1ROPA 5EBWC 4JYCA 1BT8A 4HZ3A 3T4DA 3OUFA 5FNVB 3W7SA 4I5SA 4JTDB 5EYPA 2NR5A 2E5LO 1AR5A 1XHZA 1ORQC 3HKBA 2XUMA 4IT5A 1OCRC 2AZ0A 1BS3A 3ETEA 1NJIW 4B3SB 4UXNA 3B09A 4LNUA 1Z5VA 2ZXWC 3J7AU 1TUBA 4G2KA 1WLEA 1Y76B 2GSMB 1KP2A 1AILA 5KMGB 1UPGA 1I94B 2QWPB 3IC9A 4PA3A 3LNNA 1GN4A 3ASNB 4OPHA 2YIDA 1FS0G 1VQLV 2UUCB 4GKKO 2UU9O 3LSSA 2MK3A 4R6ZA 3SYCA 4CC6A 2UXNA 3E2EA 3SGIA 1DK1A 4K35A 4X65O 3HB3B 1QNMA 4DXWA 1IURA 3CCMV 4DV4O 4AI8A 1VQPV 3E22B 1V54C 4DR6B 4NR1A 1IBKO 5L3GA 4DR3B 3DC6A 5JJNB 2LW1A 4KP4A 3HKDA 4B3TB 3E8GA 5H6QA 1VARA 4LF7B 2ZE7A 4YJ2A 2H94A 2BOBC 3K08A 1PD3A 3T2MA 3EXAA 3OE7G 3UT5B 4ICGA 5LP6A 4DR2O 5HFLA 4QE7A 1IXMA 2QEXV 3WFVA 2A79B 5CA0A 1GM9A 2V1DA 2AHZA 4OPAA 5KHJA 1J95A 2BTQA 1R3IC 2JS3A 4GX5A 1UJWB 3ZHUA 1H8HG 1VF6C 2CTRA 2E5LB 3IAYA 3C3TA 2AHYA 1US6A 1Y74A 3CB2A 3QO8A 4ZI7B 5CN0A 1AR1B 4I7ZB 1SQFA 4X64O 4X1KA 1F4MA 2Q9LA 4LF9O 4UV9A 5B1AB 2ZE6A 2QWNB 5L3DA 4LFCO 2W0FC 1GM8A 2EULA 3VQXA 3AG1B 4KUMA 3SYQA 3CRMA 3OW2U 2DMXA 1JVMA 3FYEB 5BY1A 2ADPA 2QWOB 1YF2A 4Q20A 4PA6A 4LF8O 3ABLB 1YEWA 4GKKB 2WLLB 2UU9B 1BMFG 3GWOA 2WLJA 4I0XB 5KUKA 2YDEA 5JJJB 2UXBO 4QGPA 2QE7G 1YIJV 1LUWA 1UFIA 4YJ3A 3ZMSA 4K8XA 4X65B 5B1BC 4FZ1A 2KB1A 2RN9A 3JSNA 1YJWV 1Q6IA 1NS1A 5LYJB 3SYAA 1OCOC 1VQ4V 1MA1A 4DV4B 1Z5WA 3JAMN 4QE9A 1XOUA 1PKXA 3BHPA 2YSUB 1AROP 3JD4A 1IBKB 2ZIMA 4P2ZA 4I9QA 2Z0AA 4E2LA 3GWKC 3ZRWB 3ASNC 4WFAV 4JI4O 2Q7HA 4IYIA 4NB5A 1FFXA 3CC2V 4ZKIA 3I55V 5ITZB 2P4VA 5B3SB 3MAQA 1WPBA 5B5EZ 1OV9A 1H2SB 3CD6V 3QO5A 4TQFA 2ZD9A 3TXSA 2PGGA 3AG2B 5LOVA 3JAKA 3OEHG 3OGIB 4DR2B 4U3JA 4BW5A 2YC0A 2VWJA 2ZE8A 2GUZA 5LXTA 1XEQA 2JGDB 1QVGU 1WPXA 4LH6A 1KBHA 1P7BA 5A2QN 2P67A 4WFEA 4DV3O 1GRJA 4ZIBA 1HW7A 4PV1B 4WFHA 2ETNA 3HPLC 1TAEA 2RDCA 4X20B 1VQ5V 4X64B 3JCZA 4LF9B 1VIBA 3K5LA 4EB6B 5JH7B 4LFCB 2XT9A 1GM7A 2Y0IA 3ABKB 2EIMB 3ICXA 4LWSB 2A9HA 4GX0A 2XNDG 1R3LC 4WF9V 4PDMA 1NTMH 2HKOA 5IY5B 4FM1A 2A06H 4QIWF 3N2KA 5CB4A 3ETDA 3SYOA 1I0HA 5KA6A 3JATA 4Z1VA 2UXBB 2BSKB 2UUAB 5J2UA 4FK5C 4BIOA 3DGEA 4F4LA 5IJ9B 3FAVB 1JQ0A 4EFBA 5B1AC 5LHGA 2H3OA 3CXCU 1ZUQA 4DYLA 2EINB 1EZJA 3O65A 3KKYA 3DXRA 4JI4B 2IU3A 4JGSA 4I4TA 4X8AA 2R9RB 1M93A 2LW7A 3ABLC 2VS0A 3UM7A 4X1YB 4NXNO 3B40A 4DK1A 1ZTEA 4DR5O 3F7VC 1BE3H 4XDKA 3RYFB 1VF6A 1SF9A 1OCZB 2Q0OC 5E79Z 2Q6AA 5BR8O 4IIJA 1ZL8B 2X6CA 2BCCH 2JS5A 3OUSA 5DM6V 4WFBV 5EBLC 3T1CA 4A5UB 3JALB 4LF4O 2QKAA 1VQ7V 2WA4A 3OR6C 5JCOC 3J81N 1ZX3A 5EZYB 1TGOA 1EFRG 1XBLA 5FNVA 4DV3B 1HNZO 2A0LA 5LBQA 4FLVA 4K8ZA 4MVUA 1CP9A 1GH6A 1Y67A 2R72A 4FJCC 1QHTA 2RQ6A 1DF5A 2OWOA 1Q6HA 3X2QB 1VEWA 3UCSC 2HVJC 2C2AA 2QR4A 1AI4A 1Y76A 3STZC 5GTIZ 4MTGA 3ZJZA 4LFBO 1Y66A 2WLNA 1Q90D 5KMGA 4FLTA 1N0JA 1KKDA 2CTWA 3SJAC 1PL4A 3JARB 2O57A 2Y69B 3TETA 1Q8IA 3ZS8C 3EFFK 1XDCA 2AXTZ 2EIJB 4TUYB 4JYYA 2VQEO 2EIKB 1WP8A 1M56B 3K59A 4CH3A 2ZCEA 3SPHA 3E22A 2JEUA 4DK0A 3PN1A 5LGTA 3L71H 5IY5C 4HAMA 4MVRA 2QWQB 2HP8A 4NXNB 3CCRV 3N2GB 4O2AB 5LMUO 4DR5B 4MVOA 3DSQA 1YI2V 1QQCA 2Q5ZA 1FAFA 3VQWA 4O4JA 2PZSA 1BZKA 1B06A 2N05A 4HBNA 5BR8B 1XI1A 2FTKA 3ABTA 3UT5A 2VQFO 4BW9A 3P32A 2ZR2A 2IBZH 4LF4B 2HG5C 3JSLA 4MTFA 4AHCA 2HHHO 1PNMA 1SETA 3JYCA 4QNHB 3ZMUA 3WG7C 3BCCH 4WBNB 1YDXA 4DUZO 4ZHQB 2B1IA 4NYKA 4UCRA 1MOFA 1OCZC 1KC8W 2HFEC 1THZA 2LJ2A 4DV2O 2IJJA 3NXSA 5CBGA 1SRYA 1I08A 3CJHA 1CPYA 4ZI7A 1XNRO 2A7WA 1JMKC 2W6IG 3BRCA 4J11A 3WB1A 2WLIB 4L8JA 2XOKG 3CXHF 2P5OA 1NR1A 4F6EA 3R66A 1IX9A 4LFBB 4O4IA 3U11A 3BA8A 4FVMA 4BIZA 1R3KC 5LL6Y 4NTWA 1H38A 5H6RA 1WB8A 2DQ0A 2WLLA 4IL6Z 4NXMO 3BEHA 1M9NA 1G8MA 3RYHB 3A2FA 2VQEB 1MNGA 1BGYH 3X2QC 1N36O 3JD0A 3KG2A 1D5NA 4YXWG 3L70H 3OR7C 2GDSA 3TJTA 4JAAA 4JAUA 1KECA 4DRXB 1S3JA 1IXBA 3CCLV 1U97A 1W59A 2QWRB 2F4VO 3FB7C 3RN4A 4NTYA 1B04A 2EZPA 5JCOA 2ZR3A 2AZ2A 2Y69C 4DV0O 5LMUB 1TA8A 5ITZA 1XMQO 2V7QG 3H1IH 4TT3G 3CCJV 2EIJC 1H2LA 1R6NA 1XL4A 2EIKC 3SJBC 4LR3A 1NH2D 1MSDA 3OGCC 2VQFB 4PDLA 3A8TA 4FIPC 1F51A 1F7YA 3AG4C 2ZIOA 4E4EA 4UCTA 1YSCA 2ZDIC 2HHHB 4J80A 4CS2A 1SQQH 3SPJA 2WSSG 4DUZB 1XHXA 3E8HA 1QLNA 4IHJB 1L0LH 2IJHA 3E35A 1NQTA 4DV2B 2Y4TA 3ZHSA 2XHBA 3K57A 5KX5B 1XNRB 4X20A 4TOIA 3S3WA 3HR0A 2FKXA 1I5XA 2AW9A 5J9PC 2ZQMA 1PNKA 4P30A 2AGAA 4EB6A 3ETQA 5KHKA 4UVAA 1Q81W 5BXZA 2DN9A 1VQOV 2P06A 4JAVA 5KUMA 4LWSA 1WNSA 3F5WC 1F23A 3OFNG 4FFBB 1QLEB 2M7WA 4JI7O 3FKSG 4MTOA 3VQVA 1S76D 1Q5OA 1N8RW 4NXMB 1NR7A 1V55B 4HNAB 1KYOF 2LQTA 3LDEA 4W4KA 3APQA 2XAGA 1IDSA 1N36B 1HNWO 1BHBA 4NVPA 5IJ9A 3FAVA 3CPWU 4RQFA 4TV9B 2D2CB 1QBZA 1H8EG 4ZOLB 2IM9A 1K3EA 1XUQA 4NTXA 3W7WA 3OMIB 1AP6A 1RFYA 3M99B 2R9AA 5K1PA 4X9QA 2F4VB 4JPRA 1XQ8A 4XDJA 2DOSA 5KHIA 1CXZB 4X66O 4EKWA 3E89A 3S3XA 4DV0B 1NTKH 1XMQB 1S0VA 3JD3A 3EHBB 1IBMO 4JI3O 3RYFA 1L0NH 1XMOB 2OYQA 4UFZA 1H2NA 1BHAA 2X6BA 4D7SA 3U10A 2E75B 2Y4UA 3R65A 1ZL8A 3NR7A 3B77A 2YS8A 2IJKA 2ZNJA 3D3IA 4MVZA 4PI2A 2JEXA 1ZWIC 1KD1W 1PP9H 4ASUG 3G71V 4CBCA 5BZBA 4GZRB 3AG3C 4CS4A 2UXDO 1EN4A 1PNLA 4UCSA 2QSAA 1RP3B 4RAIA 2K1EA 4LF5O 4K3AA 3OM3B 3K04A 2DYSB 3ZHRA 1FKAO 1R1BA 2GTSA 1K97A 3W7TA 4YIOA 1KB9F 5FL7G 1BQ0A 2UUAO 2OIEA 1IZ3A 4F6RB 4QJFB 4MW8A 1JX9A 4JV5O 1GK9A 4D6TH 4WCEV 3ML0A 1VMGA 3JCUZ 3RGBA 2GBOA 5JVDA 4JI7B 4GYCB 1SS3A 3WB0A 1YHQV 3CS5A 3TXQA 4RO2A 2YXHA 2ARHA 1AVMA 4DV6O 1LNQA 1HNWB 3WU2Z 2VRZA 2YI8A 3U0ZA 3JD2A 2CDYA 4UB8Z 2XTAA 1FXKB 1AJPA 4D7TA 4P9OA 3WB2A 4O2BB 1W0JG 2Q68A 1GN3A 3H1JH 2ITCC 2ZDIA 1QLEC 4X62B 3E86A 5FLXN 4X66B 1KQSU 1AP5A 5EYPB 3N2GA 1V55C 4O2AA 1IBMB 1EN5A 3HKBB 3APOA 4JI3B 3AK1A 2XAJA 1MZEA 3H1KH 1F4NA 4MT8A 2OIGA 3CEIA 3G67A 1TUBB 1FYJA 4H44B 4WFGA 5BMVB 1VQ9V 5LA6A 4N23A 2JRIA 2WWWA 2UXDB 1M1KW 4WBNA 4ZHQA 3CSXA 3C90A 4LF5B 2CH7B 3IGAC 1AJNA 5EIBC 1KUQA 4KL1A 2WPDG 3ZHQA 1SQVH 4JI8O 3O9OA 4L87A 5LHHA 2YIBA 1YTFB 1HP8A 1P49A 2WLIA 2Q0AA 4JV5B 4JF3A 3UO2A 3K0DA 4DUYO 3AG1C 2B5UA 1K92A 2PF4E 3CHXA 1IVSA 2Q69A 3IC7A 4DV1O 1TVKB 2EILB 1VQNV 2IU0A 3K58A 5IJ0B 2DYSC 4DV7O 4DW1A 1H2MA 4DV6B 1Y4MA 4FLYA 5L3EA 2KG7A 2IW5A 4JASA 1AB3A 4TV8B 4B7KA 4LCUC 5C8YB 4JI6O 1W2BU 1Q86W 2ITDC 3C3SA 2DW4A 4FZ0A 2QM8A 5CA0B 1N33O 1XILA 4DRXA 5A9GA 1WJZA 4B3RO 3CWBH 5CA1B 3AEIA 3CC4V 3FB8C 2F43G 4JZ2A 2WAMA 3SPGA 2JK5C 5IYCO 4B08A 4AQYB 1NKDA 1PL0A 2JJ2G 3QTCA 3L74H 4J9ZB 5B3SC 4FPPA 4QPKA 3FFQA 4KXRA 4GCZA 2D3OW 3ABMB 3AG2C 3BY6A 4B3MO 2OCCB 2OTJV 3F7YC 2F1MA 2E3CA 1ZSPA 3L73H 3LDDA 5EIBD 2EX3A 2NLJC 5EC1C 1R6TA 3ZMTA 2F23A 4UCOA 4NKGB 3I5DA 4PDRA 4IHJA 4QPJA 2NN4A 4DR7O 2CAZC 2WLMA 1FD9A 2P22C 4PI0A 2XAFA 1IBLB 1U96A 4OX9O 5LGNA 4JI8B 2QTSA 5J2TB 4MVQA 3RYIB 1RSOB 1P4RA 3RVYA 2PI5A 2ZT9B 1T5EA 2HJDA 1ENVA 1SA0B 4DUYB 3ABKC 2EIMC 4JI5O 2Q4PA 1AR4A 1I5YA 3ZMVA 1FJGO 2RNBA 2WLHA 4DV1B 4BWAA 1CEZA 2Q8VA 4DV7B 3OMAB 3E83A 2X6AA 4HNAA 1WP7A 3LSQA 1D2DA 3OMNB 1OCRB 4KFMA 1NT2B 3JAKB 4LF6O 1W0KG 4I50B 4JI6B 1M4UA 4GX1A 1OHHG 3T1YO 2BTOA 3QF7A 1K5QA 4TV9A 3QNEA 2PUSA 1S5LZ 4ZOLA 1N33B 5KLVH 2GUZB 3K3WA 4B3RB 1BCCH 1SQPH 2EINC 5LXTB 4J10A 4CH6A 2Q7EA 3ZRSA 1N34O 5IWAO 3BABA 3AK2A 1PPJH 2ZE5A 1JOYA 3MHHC 1K73W 1O9GA 2OCHA 3H1LH 4J7KA 2DQ3A 2EJRA 1GMGA 2JIZG 4HYOA 3RT3C 1K4DC 4BAYA 2X0LA 3ZIAG 2ZM6O 4FM2A 4JTCB 1R73A 1AJQA 4B3MB 2YXLA 2YIAA 3ZCCA 1ZLZA 2DE0X 1I7FA 2PYJA 4G28B 2A3QA 4FLWA 5K1XA 4UCUA 3RYCB 5JQGB 1WA8B 4X89A 2E76B 3THOA 3N2KB 2LP7A 5B1OA 4DR7B 3CCSV 5IYDO 3CRQA 3GB7C 2EZOA 2Q67A 4OX9B 4I0XA 3KCXA 1JFFB 4I55B 2OCCC 1GAXA 1KP3A 3A0BZ 4F6RA 3QO7A 4X88A 1NTZH 2G38A 3P3PA 3CC7V 2R9IA 3OTOO 5LYJA 3DXRB 4JI5B 3SJQC 3K79A 1MG1A 3K5MA 3TK1A 1G1XB 1FJGB 1FPOA 4Z1MG 3J80N 5IYZB 1QCEA 2OT5A 3ZRWA 1OZ0A 2X7RB 2HEPA 5FPOA 1QR9A 3ETGA 2FYUH 3AK3A 3H9VA 2JDIG 4LF6B 1DLBA 4YY3B 3RVZA 5H9CA 4IIJB 1Y6XA 3A0HZ 3BA9A 2B9ZA 3T1YB 3K9AA 1XMOO 3FD9A 4GLXA 5CBFA 1M56C 3HKCB 4CH4A 3RWRD 2ADQB 3LSUA 4O2BA 1GTOA 2BOCC 4CH5A 3K9SA 1N34B 2QTOA 5IWAB 3ZX6A 3ZHTA 5GW7A 4YIPA 2JGDA 1FFTB 2KKWA 3QVNA 1XNQO 2ODMA 4B7EA 5LMNO 1NI8A 3ASOB 4GKJO 3CP1A 2KQXA 2CTQA 2N04A 1LUVA 2ZM6B 4P9PA 2XAQA 5B1BB 4EEQA 2F95B 1HR0O 1OCOB 3QG5A 4FLUA 4U7OA 5BMVA 1N0NA 3CRAA 2CUGA 4IGGA 3IJ4A 3L75H 1COWG 3CX5F 5JH7A 2R70A 4YHHO 1KU9A 4ABMA 3KCYA 4UUJC 1VQKV 3MDSA 2CH7A 3DC5A 3EVKA 4FM0A 2QJ1A 1EZVH 2RMKB 4O4HB 1RM1B 2P4KA 1B6QA 3RFRA 4R8CA 2UXCO 1Q43A 2ILMA 3W7UA 4PA4A 1URFA 2Y0PA 3VOUA 2V4DA 2BSKA 4TWKA 5HFMA 4G27B 3E8BA 5D5QA 1M57B 2UXXA 4GX2A 3CE2A 1SC5B 3OTOB 3ZEDA 1JCHA 3OAAG 3CMAV 1K33A 3D36C 4DW0A 5C93A 1X4TA 4X1IB 4RWUA 1XREA 3K06A 2H8PC 2KSDA 2QA4V 1TVKA 2DWDC 4X62O 1QR8A 5IJ0A 5GONB 1BSMA 3TCUA 1PV0A 3K03A 4O4JB 4JI1O 2CGOA 4X1YA 4O4LB 2CK3G 2Z3YA 2W6JG 1Q3EA 4JI2O 5JWPA 1R6KA 3A0RA 1XL6A 1NZ6A 1SQXH 4TV8A 5TISZ 4DO2A 4N21A 5H2FZ 5C8YA 2P7TC 4H33A 2WA3A 1JA8A 2YEVB 4U3FH 1MSWD 1FXHA 5CA1A 1SERA 2N74A 1G4YB 4JI0O 3JALA 1AI7A 3N27A 3RBZA 3P3NA 5IYBO 2LFRA 1XNQB 5EBMC 5LMNB 5EZYA 4GKJB 1P84F 3FYIB 2GHYA 1H2KA 2YUAA 1YVWA 3CJHB 2GV9A 2ATKC 1KMIZ 3VBBA 1HR0B 4LH7A 1GKFA 1P7GA 2CTPA 2MW2B 4RUEA 4MSWC 4O4IB 2YXYA 3JAWB 5L3FA 5B66Z 4YHHB 2CGNA 2PY5A 4JZGA 5F2VO 1O9HA 3JASB 5EK0A 3AG7A 3G4SV 3G6EV 3HKEB 3Q4HB 3ASOC 2JJ1G 3SDLA 1K9MW 4W4LA 2YIBD 5KHHA 2UXCB 3JARA 1A32A 1E1RG 1GO3F 5AG2A 1SQBH 3BVOA 2YI9A 2XAHA 5J2TA 3D8CA 4TUYA 3RYIA 1RSOA 3H1HH 5KHGA 1D5AA 2RCVA 4PHZA 4KHPO 5GTHZ 4TSFG 1SA0A 3CRRA 1SQGA 1N4CA 4K0KO 1DF4A 3ZMZA 2LGWA 4PD4F 2DYRB 3K5OA 2ZINA 2LFSA 1LR1A 3OT7A 4LBEC 1K5SA 2DWEC 3ZBHA 2EBOA 1RM1C 1Q7YW 2PTMA 4JYBA 4JI1B 3B8MA 4JI2B 4H0LB 4AQYO 1K34A 4AILC 1EM1A 2FL4A 3ZRVA 1M5IA 1M57C 2M6YA 4I50A 3JD1A 4TQDA 4H13B 4CS3A 4LNUB 4RUFA 3LDCA 1JPXA 1YZBA 2FMLA 3MHSC 4JI0B 3H01A 1WN7A 1GN2A 1L8DA 5IT9N 1VQ8V 4J42A 1HNXO 2NNUA 3BPZA 3E8FA 4UV8A 4Q6GA 4PELA 3I56V 1N32O 1IBLO 3T1HO 4FLZA 2PI4A 1YCIA 5E1AC 3FB5C 4UVCA 1Z2GA 3RYCA 5JQGA 1WA8A 5IE9A 3W7XA 3STLC 4CC5A 3TGUH 3D36A 4LF8B 4JTAB 1NU1H 4EFEA 5H5NA 3HKDB 1WB7A 3CRCA 1MABG 3SR2C 2JVDA 4YJ2B 1NVPB 2P90A 4PJ0Z 2E74B 1SZXA 2LGQA 4OGQB 3OEEG 1HDJA 1OCCB 1K8AW 1JFFA 1EN6A 3RYHA 3VQYA 4BR6A 3M7MX 4I55A 1YJ9V 1K4CC 3FB6C 4UVBA 2DJVA 3SPIA 4KHPB 2HJFC 5LP6B 2Q73A 4K0KB 1G6UA 1NH2B 1E79G 4MVSA 3UKMA 3CCEV 3WG7B 2BTQB 1VF5B 5IYZA 2QM7A 3KZIZ 2HLDG 5KAFZ 5DECA 4PA9A 4WFFA 4LFAO 2RJZA 1SZTA 2P6JA 5FPRA 1K7DA 1V9PA 4R7CA 1RPRA 3ABUA 1Y74B 2BE3A 2IH3C 2QM4A 5EC2C 1FXKC 3PJSK 4X1KB 1S5JA 3HKCA 4R50A 2QKSA 4PA7A 4DR4O 2ZKOA 5LGUA 4FFKA 3CCQV 2DYRC 1DGSA 1MMMA 2QDOA 4C7UA 3P30A 2CE4A 4DR1O 5CBHA 1S5HC 4DV5O 3UO3A 4LC1A 4BIUA 2B1GA 1HNXB 4JYAO 1JJOA 4MVMA 2UUBO 3FX7A 3G80A 4YJ3B 1YXBA 1EBOA 2OTLV 5D5PA 5L3BA 1N32B 1M90W 3T1HB 1MZFA 4J7JA 5KX5A 4MTXA 1Q82W 1S72V 4MW3A 5JVDB 1RPOA 2XASA 3ZRXA 4LP8A 4ZBMA 4MS2A 3SYPA 4FFBA 1FFXB 1JJ2U 2L6LA 1YITV 4O4HA 2JGUA 2L35A 4UCVA 3ZN1A 1SESA 2Z5UA 3CCUV 5KA5A 1DTOA 4IYHA 1E1QG 1WAZA 3UQ8A 1GN6A 1VF7A 2HVKC 5LOVB 4YY3O 5CMUA 1H2GA 2IJIA 3AG4B 4U3JB 4UB6Z 3T4ZA 4XBFA 1L1FA 1VQMV 2YICA 3ZN0A 1VQ6V 2ZXWB 1FXVA 3DTUB 5CA3A 4H37A 1YJNV 2Q7GA 1AI5A 4X1IA 1J5EO 4J7ZA 1B3QA 2VWKA 3SPCA 2WLKA 2EILC 3L72H 5GONA 1SKVA 5DEDA 3IFXA 4O4LA 4LFAB 3K0GA 1OCCC 3M8AA 2K9PA 1AI6A 1KKCA 2FB5A 5LP6C 4B3SO 3ZHVA 3LNMB 4U7NA 5LA6B 5DN6G 2GTAA 4DR4B 2YEVA 4OXSA 1BL8A 1PM9A 3B2EE 1R3JC 2F66C 1V54B 5L3CA 2QGNA 4FLXA 1ZAUA 4DR1B 1HNZB 1I94O 3D3QA 4GUNA 2EJ7A 1S77D 4DV5B 4GT1A 3BAAA 4JYAB 3CMEV 5CB4B 3CCVV 4J41A 2PYLA 3JATB 2UUCO 2UUBB 2W0XA 5J2UB
chains in the Genus database with same CATH topology
2A0LA 3B8NA 5LBQA 1JCHA 1TUEB 3ABMC 5IDJA 3OAAG 3CMAV 1KQSU 1K33A 1CP9A 4MVUA 4CZZA 4FJCC 5C93A 1V55C 2Y48A 1DF5A 3K06A 2H8PC 2QA4V 1HWYA 4PDVA 3X2QB 4J9YB 2XAJA 2DWDC 1QR8A 3CYOA 3LUTB 3TCUA 4RQEA 2HVJC 2C2AA 3K03A 1AI4A 1F4NA 4MT8A 3STZC 2CK3G 4MTGA 2Z3YA 2W6JG 3ZJZA 1Y66A 2WLNA 4WFGA 1R6KA 1QVFU 3A0RA 1XL6A 1VQ9V 1KKDA 4N23A 4DO2A 4N21A 1YTFD 2P7TC 4H33A 4XDLA 3MD0A 2WWWA 2IH1C 1NBMG 2YEVB 1M1KW 2Y69B 3TETA 5LHIA 4FMTA 3EFFK 1MSWD 1FXHA 2EIJB 3IGAC 1AJNA 2HR3A 1SERA 1G4YB 1FXKA 2WPDG 1AI7A 1NVPD 2EIKB 3RBZA 5IYBO 2LFRA 5EBMC 1M56B 3AG3B 4I9WA 3FYIB 2GHYA 3SPHA 5B1NA 4L87A 5LHHA 3RW0A 1ROPA 5EBWC 1YTFB 4JYCA 3T4DA 2JEUA 4HZ3A 2WLIA 3OUFA 5LGTA 4JF3A 3W7SA 2ATKC 4I5SA 5IY5C 3K0DA 3VBBA 4JTDB 4HAMA 4MVRA 1GKFA 1ORQC 3CCRV 3AG1C 4RUEA 2B5UA 1OCRC 4MSWC 1K92A 4MVOA 3ETEA 1NJIW 1YI2V 2Q69A 3IC7A 5L3FA 4UXNA 2EILB 1VQNV 2IU0A 2DYSC 2ZXWC 5EK0A 3G4SV 4G2KA 1WLEA 3G6EV 1Y4MA 2GSMB 2FTKA 5L3EA 3ABTA 1KP2A 3ASOC 2JJ1G 2IW5A 4JASA 1K9MW 3P32A 4PA3A 4LCUC 2ZR2A 1E1RG 1GO3F 2HG5C 1W2BU 1Q86W 3ASNB 2ITDC 2DW4A 4MTFA 2XAHA 1PNMA 1SETA 3JYCA 4QNHB 1FS0G 3ZMUA 2QM8A 1VQLV 3WG7C 3LSSA 2MK3A 4R6ZA 3SYCA 3E2EA 2UXNA 2B1IA 3AEIA 3CC4V 3FB8C 2F43G 2WAMA 1MOFA 4TSFG 1OCZC 3HB3B 3SPGA 1KC8W 4DXWA 2HFEC 2JK5C 5IYCO 1THZA 1DF4A 1NKDA 1PL0A 2JJ2G 2IJJA 3NXSA 3ZMZA 4J9ZB 3CCMV 5CBGA 5B3SC 1SRYA 1CPYA 2DYRB 1VQPV 2LFSA 1V54C 4FPPA 2W6IG 4QPKA 4LBEC 1K5SA 2DWEC 2EBOA 1RM1C 2WLIB 4GCZA 1Q7YW 5L3GA 2XOKG 4JYBA 1NR1A 3B8MA 2D3OW 3ABMB 3AG2C 1K34A 3BY6A 4KP4A 4BIZA 2OCCB 3E8GA 5H6QA 3ZRVA 2OTJV 1R3KC 3F7YC 1M57C 2H94A 2BOBC 1H38A 3K08A 3LDDA 3JD1A 5H6RA 1PD3A 2NLJC 3T2MA 5EC1C 2DQ0A 3ZMTA 4RUFA 3LDCA 2WLLA 1JPXA 3OE7G 3BEHA 1M9NA 1G8MA 4PDRA 4QPJA 3MHSC 5HFLA 4QE7A 3X2QC 1IXMA 3H01A 3JD0A 3KG2A 2WLMA 2QEXV 2XAFA 3WFVA 1VQ8V 2A79B 4YXWG 1GM9A 2V1DA 2AHZA 1J95A 3OR7C 5LGNA 4MVQA 4JAUA 1KECA 1R3IC 1S3JA 2NNUA 1P4RA 3RVYA 3CCLV 4GX5A 2PI5A 1UJWB 1H8HG 3E8FA 1ENVA 3FB7C 4UV8A 4PELA 3I56V 2EZPA 2ZR3A 3ABKC 2EIMC 2Y69C 2PI4A 1I5YA 3ZMVA 5E1AC 2V7QG 2AHYA 3FB5C 4TT3G 2WLHA 3CCJV 2EIJC 4UVCA 3QO8A 5CN0A 1AR1B 1CEZA 1R6NA 3W7XA 1XL4A 1F4MA 2EIKC 3STLC 4UV9A 3OMAB 5B1AB 3D36A 3E83A 4JTAB 2X6AA 1NH2D 5L3DA 3LSQA 2W0FC 1GM8A 3OGCC 3OMNB 3AG1B 4KUMA 4PDLA 4FIPC 1F51A 1OCRB 4KFMA 3SYQA 1MABG 1W0KG 3AG4C 3OW2U 1NVPB 2P90A 1YSCA 4GX1A 1JVMA 3FYEB 1OHHG 2ZDIC 4Q20A 1K5QA 4PA6A 3OEEG 3QNEA 3SPJA 1OCCB 3ABLB 1K8AW 2WSSG 3K3WA 2WLLB 1YJ9V 1BMFG 2EINC 2WLJA 3GWOA 5KUKA 1K4CC 3E8HA 3ZRSA 3FB6C 1QLNA 4UVBA 2QE7G 3SPIA 2IJHA 2HJFC 1YIJV 3ZMSA 5B1BC 2KB1A 1YJWV 3E35A 1NQTA 1NH2B 1E79G 4MVSA 3SYAA 3UKMA 1OCOC 1VQ4V 3MHHC 1K73W 1JOYA 3CCEV 3WG7B 4QE9A 1PKXA 2DQ3A 2EJRA 2QM7A 1AROP 2YSUB 1GMGA 2JIZG 3JD4A 4HYOA 1I5XA 5J9PC 4P2ZA 1K4DC 4BAYA 2ZQMA 1PNKA 2X0LA 4E2LA 2HLDG 4P30A 3ZRWB 3ZIAG 4UVAA 3ASNC 4WFAV 4PA9A 4WFFA 1Q81W 4JTCB 1R73A 1VQOV 1AJQA 4JAVA 5KUMA 3CC2V 1SZTA 3ZCCA 4ZKIA 2P6JA 3I55V 3F5WC 5B3SB 1F23A 3OFNG 1K7DA 4G28B 4R7CA 1RPRA 3ABUA 1QLEB 2M7WA 3CD6V 2IH3C 3QO5A 3FKSG 5EC2C 4MTOA 2ZD9A 1FXKC 3PJSK 1S76D 4R50A 1N8RW 2QKSA 4PA7A 4X89A 3AG2B 1NR7A 1V55B 3OEHG 3LDEA 5LGUA 3CCQV 2XAGA 2DYRC 2LP7A 5B1OA 1BHBA 4BW5A 3CCSV 5IYDO 3P30A 5CBHA 1S5HC 3GB7C 3CPWU 4RQFA 2EZOA 4LC1A 2Q67A 4BIUA 1QBZA 1H8EG 2B1GA 1K3EA 1QVGU 1WPXA 3W7WA 2OCCC 1KP3A 3OMIB 1P7BA 3M99B 2P67A 4WFEA 3QO7A 4JPRA 4X88A 4MVMA 4XDJA 3CC7V 2OTLV 1EBOA 2R9IA 5L3BA 1M90W 4WFHA 4EKWA 3E89A 3SJQC 3HPLC 3K79A 1MG1A 3TK1A 4MTXA 4Z1MG 1Q82W 1S0VA 3JD3A 3EHBB 1QCEA 1VQ5V 1S72V 4MW3A 2OT5A 3ZRWA 3JCZA 1OZ0A 1RPOA 2XASA 1BHAA 3ZRXA 2X7RB 2X6BA 4LP8A 1QR9A 3ETGA 1GM7A 4ZBMA 4MS2A 3ABKB 2EIMB 3SYPA 3R65A 2JDIG 1DLBA 3RVZA 2A9HA 3B77A 5H9CA 1JJ2U 2IJKA 4MVZA 3D3IA 4GX0A 1YITV 2XNDG 1R3LC 3K9AA 4WF9V 2JEXA 4PDMA 1ZWIC 2HKOA 5IY5B 1KD1W 3ZN1A 4ASUG 5CBFA 3G71V 1M56C 1SESA 2Z5UA 4CBCA 5BZBA 4QIWF 5KA5A 3CCUV 1DTOA 3AG3C 1E1QG 3ETDA 3SYOA 5KA6A 1PNLA 1GTOA 2BOCC 2HVKC 4RAIA 2K1EA 5CMUA 1H2GA 2QTOA 2IJIA 3AG4B 4FK5C 3OM3B 3T4ZA 4XBFA 1L1FA 3K04A 1VQMV 2DYSB 3ZN0A 1VQ6V 3DGEA 2ZXWB 5GW7A 1FXVA 4F4LA 1JQ0A 3DTUB 5CA3A 1FFTB 5B1AC 5LHGA 4H37A 1YJNV 1K97A 1AI5A 3W7TA 3CXCU 3ASOB 2EINB 1EZJA 5FL7G 3SPCA 3CP1A 2WLKA 2EILC 4QJFB 4MW8A 1JX9A 4P9PA 2XAQA 1GK9A 5B1BB 2IU3A 4JGSA 4WCEV 3IFXA 4X8AA 2R9RB 3ML0A 3K0GA 1OCCC 3ABLC 1OCOB 3UM7A 1AI6A 4U7OA 3F7VC 4XDKA 1COWG 3LNMB 4U7NA 1OCZB 5DN6G 1YHQV 2YEVA 4OXSA 1BL8A 2Q6AA 4UUJC 4RO2A 1R3JC 1VQKV 1LNQA 2X6CA 1V54B 5L3CA 3OUSA 5DM6V 1RM1B 3JD2A 1B6QA 4WFBV 4R8CA 5EBLC 1S77D 3T1CA 4GT1A 1FXKB 3W7UA 4PA4A 1VQ7V 3OR6C 3VOUA 3CMEV 3CCVV 1AJPA 4P9OA 4TWKA 5HFMA 4G27B 1W0JG 3E8BA 2Q68A 1M57B 2UXXA 4GX2A 1EFRG 2ITCC 2ZDIA 1QLEC 3E86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC2 V;  3I55 V;  3CPW U;  1VQ5 V;  1S72 V;  1NJI W;  1VQK V;  1YJW V;  1YI2 V;  1QVF U;  1VQL V;  1Q7Y W;  3CMA V;  1KQS U;  1VQ9 V;  3I56 V;  3OW2 U;  1VQ4 V;  4WCE V;  1K73 W;  1QVG U;  1VQN V;  2D3O W;  3CD6 V;  3CCE V;  5DM6 V;  3CC4 V;  4WFB V;  3G4S V;  1N8R W;  2QA4 V;  1VQM V;  3G6E V;  2QEX V;  1M1K W;  3CCJ V;  1VQ6 V;  1VQ8 V;  3CC7 V;  1VQ7 V;  2OTL V;  1K8A W;  2OTJ V;  3CME V;  3CCQ V;  1KC8 W;  3CCV V;  1YJ9 V;  1JJ2 U;  1YJN V;  1YIT V;  1M90 W;  1K9M W;  3CXC U;  4WF9 V;  4WFA V;  1Q82 W;  1Q81 W;  1R73 A;  3CCM V;  3CCR V;  3CCS V;  1VQO V;  1YHQ V;  1KD1 W;  3CCL V;  3G71 V;  1YIJ V;  1W2B U;  1VQP V;  1Q86 W;  3CCU V; 
#chains in the Genus database with same CATH topology
 3B8N A;  3OTF A;  1TUE B;  3ABM C;  5IDJ A;  3OD4 A;  4Z2W A;  4CZZ A;  3K5N A;  2F93 B;  2Y48 A;  1HWY A;  4PDV A;  3G6B A;  3JAW A;  4J9Y B;  4DR6 O;  3CYO A;  3LUT B;  3JAS A;  4RQE A;  4DR3 O;  3HKE A;  1QU7 A;  3Q4H A;  4I4T B;  1X59 A;  3F5T A;  1QVF U;  4B3T O;  2LO1 A;  3SJC C;  2KG7 B;  4LF7 O;  1YTF D;  2ZNI A;  4XDL A;  3MD0 A;  1BQZ A;  2IH1 C;  1NBM G;  3GVM A;  5JJE B;  5LHI A;  4FMT A;  1JR9 A;  3L9D A;  1Q6U A;  2HR3 A;  5KAI Z;  1FXK A;  1NVP D;  2QKC A;  3AG3 B;  3BFR A;  1VP7 A;  3B4S A;  4I9W A;  1J5E B;  5B1N A;  3RW0 A;  1OJH A;  1ROP A;  5EBW C;  4JYC A;  1BT8 A;  4HZ3 A;  3T4D A;  3OUF A;  5FNV B;  3W7S A;  4I5S A;  4JTD B;  5EYP A;  2NR5 A;  2E5L O;  1AR5 A;  1XHZ A;  1ORQ C;  3HKB A;  2XUM A;  4IT5 A;  1OCR C;  2AZ0 A;  1BS3 A;  3ETE A;  1NJI W;  4B3S B;  4UXN A;  3B09 A;  4LNU A;  1Z5V A;  2ZXW C;  3J7A U;  1TUB A;  4G2K A;  1WLE A;  1Y76 B;  2GSM B;  1KP2 A;  1AIL A;  5KMG B;  1UPG A;  1I94 B;  2QWP B;  3IC9 A;  4PA3 A;  3LNN A;  1GN4 A;  3ASN B;  4OPH A;  2YID A;  1FS0 G;  1VQL V;  2UUC B;  4GKK O;  2UU9 O;  3LSS A;  2MK3 A;  4R6Z A;  3SYC A;  4CC6 A;  2UXN A;  3E2E A;  3SGI A;  1DK1 A;  4K35 A;  4X65 O;  3HB3 B;  1QNM A;  4DXW A;  1IUR A;  3CCM V;  4DV4 O;  4AI8 A;  1VQP V;  3E22 B;  1V54 C;  4DR6 B;  4NR1 A;  1IBK O;  5L3G A;  4DR3 B;  3DC6 A;  5JJN B;  2LW1 A;  4KP4 A;  3HKD A;  4B3T B;  3E8G A;  5H6Q A;  1VAR A;  4LF7 B;  2ZE7 A;  4YJ2 A;  2H94 A;  2BOB C;  3K08 A;  1PD3 A;  3T2M A;  3EXA A;  3OE7 G;  3UT5 B;  4ICG A;  5LP6 A;  4DR2 O;  5HFL A;  4QE7 A;  1IXM A;  2QEX V;  3WFV A;  2A79 B;  5CA0 A;  1GM9 A;  2V1D A;  2AHZ A;  4OPA A;  5KHJ A;  1J95 A;  2BTQ A;  1R3I C;  2JS3 A;  4GX5 A;  1UJW B;  3ZHU A;  1H8H G;  1VF6 C;  2CTR A;  2E5L B;  3IAY A;  3C3T A;  2AHY A;  1US6 A;  1Y74 A;  3CB2 A;  3QO8 A;  4ZI7 B;  5CN0 A;  1AR1 B;  4I7Z B;  1SQF A;  4X64 O;  4X1K A;  1F4M A;  2Q9L A;  4LF9 O;  4UV9 A;  5B1A B;  2ZE6 A;  2QWN B;  5L3D A;  4LFC O;  2W0F C;  1GM8 A;  2EUL A;  3VQX A;  3AG1 B;  4KUM A;  3SYQ A;  3CRM A;  3OW2 U;  2DMX A;  1JVM A;  3FYE B;  5BY1 A;  2ADP A;  2QWO B;  1YF2 A;  4Q20 A;  4PA6 A;  4LF8 O;  3ABL B;  1YEW A;  4GKK B;  2WLL B;  2UU9 B;  1BMF G;  3GWO A;  2WLJ A;  4I0X B;  5KUK A;  2YDE A;  5JJJ B;  2UXB O;  4QGP A;  2QE7 G;  1YIJ V;  1LUW A;  1UFI A;  4YJ3 A;  3ZMS A;  4K8X A;  4X65 B;  5B1B C;  4FZ1 A;  2KB1 A;  2RN9 A;  3JSN A;  1YJW V;  1Q6I A;  1NS1 A;  5LYJ B;  3SYA A;  1OCO C;  1VQ4 V;  1MA1 A;  4DV4 B;  1Z5W A;  3JAM N;  4QE9 A;  1XOU A;  1PKX A;  3BHP A;  2YSU B;  1ARO P;  3JD4 A;  1IBK B;  2ZIM A;  4P2Z A;  4I9Q A;  2Z0A A;  4E2L A;  3GWK C;  3ZRW B;  3ASN C;  4WFA V;  4JI4 O;  2Q7H A;  4IYI A;  4NB5 A;  1FFX A;  3CC2 V;  4ZKI A;  3I55 V;  5ITZ B;  2P4V A;  5B3S B;  3MAQ A;  1WPB A;  5B5E Z;  1OV9 A;  1H2S B;  3CD6 V;  3QO5 A;  4TQF A;  2ZD9 A;  3TXS A;  2PGG A;  3AG2 B;  5LOV A;  3JAK A;  3OEH G;  3OGI B;  4DR2 B;  4U3J A;  4BW5 A;  2YC0 A;  2VWJ A;  2ZE8 A;  2GUZ A;  5LXT A;  1XEQ A;  2JGD B;  1QVG U;  1WPX A;  4LH6 A;  1KBH A;  1P7B A;  5A2Q N;  2P67 A;  4WFE A;  4DV3 O;  1GRJ A;  4ZIB A;  1HW7 A;  4PV1 B;  4WFH A;  2ETN A;  3HPL C;  1TAE A;  2RDC A;  4X20 B;  1VQ5 V;  4X64 B;  3JCZ A;  4LF9 B;  1VIB A;  3K5L A;  4EB6 B;  5JH7 B;  4LFC B;  2XT9 A;  1GM7 A;  2Y0I A;  3ABK B;  2EIM B;  3ICX A;  4LWS B;  2A9H A;  4GX0 A;  2XND G;  1R3L C;  4WF9 V;  4PDM A;  1NTM H;  2HKO A;  5IY5 B;  4FM1 A;  2A06 H;  4QIW F;  3N2K A;  5CB4 A;  3ETD A;  3SYO A;  1I0H A;  5KA6 A;  3JAT A;  4Z1V A;  2UXB B;  2BSK B;  2UUA B;  5J2U A;  4FK5 C;  4BIO A;  3DGE A;  4F4L A;  5IJ9 B;  3FAV B;  1JQ0 A;  4EFB A;  5B1A C;  5LHG A;  2H3O A;  3CXC U;  1ZUQ A;  4DYL A;  2EIN B;  1EZJ A;  3O65 A;  3KKY A;  3DXR A;  4JI4 B;  2IU3 A;  4JGS A;  4I4T A;  4X8A A;  2R9R B;  1M93 A;  2LW7 A;  3ABL C;  2VS0 A;  3UM7 A;  4X1Y B;  4NXN O;  3B40 A;  4DK1 A;  1ZTE A;  4DR5 O;  3F7V C;  1BE3 H;  4XDK A;  3RYF B;  1VF6 A;  1SF9 A;  1OCZ B;  2Q0O C;  5E79 Z;  2Q6A A;  5BR8 O;  4IIJ A;  1ZL8 B;  2X6C A;  2BCC H;  2JS5 A;  3OUS A;  5DM6 V;  4WFB V;  5EBL C;  3T1C A;  4A5U B;  3JAL B;  4LF4 O;  2QKA A;  1VQ7 V;  2WA4 A;  3OR6 C;  5JCO C;  3J81 N;  1ZX3 A;  5EZY B;  1TGO A;  1EFR G;  1XBL A;  5FNV A;  4DV3 B;  1HNZ O;  2A0L A;  5LBQ A;  4FLV A;  4K8Z A;  4MVU A;  1CP9 A;  1GH6 A;  1Y67 A;  2R72 A;  4FJC C;  1QHT A;  2RQ6 A;  1DF5 A;  2OWO A;  1Q6H A;  3X2Q B;  1VEW A;  3UCS C;  2HVJ C;  2C2A A;  2QR4 A;  1AI4 A;  1Y76 A;  3STZ C;  5GTI Z;  4MTG A;  3ZJZ A;  4LFB O;  1Y66 A;  2WLN A;  1Q90 D;  5KMG A;  4FLT A;  1N0J A;  1KKD A;  2CTW A;  3SJA C;  1PL4 A;  3JAR B;  2O57 A;  2Y69 B;  3TET A;  1Q8I A;  3ZS8 C;  3EFF K;  1XDC A;  2AXT Z;  2EIJ B;  4TUY B;  4JYY A;  2VQE O;  2EIK B;  1WP8 A;  1M56 B;  3K59 A;  4CH3 A;  2ZCE A;  3SPH A;  3E22 A;  2JEU A;  4DK0 A;  3PN1 A;  5LGT A;  3L71 H;  5IY5 C;  4HAM A;  4MVR A;  2QWQ B;  2HP8 A;  4NXN B;  3CCR V;  3N2G B;  4O2A B;  5LMU O;  4DR5 B;  4MVO A;  3DSQ A;  1YI2 V;  1QQC A;  2Q5Z A;  1FAF A;  3VQW A;  4O4J A;  2PZS A;  1BZK A;  1B06 A;  2N05 A;  4HBN A;  5BR8 B;  1XI1 A;  2FTK A;  3ABT A;  3UT5 A;  2VQF O;  4BW9 A;  3P32 A;  2ZR2 A;  2IBZ H;  4LF4 B;  2HG5 C;  3JSL A;  4MTF A;  4AHC A;  2HHH O;  1PNM A;  1SET A;  3JYC A;  4QNH B;  3ZMU A;  3WG7 C;  3BCC H;  4WBN B;  1YDX A;  4DUZ O;  4ZHQ B;  2B1I A;  4NYK A;  4UCR A;  1MOF A;  1OCZ C;  1KC8 W;  2HFE C;  1THZ A;  2LJ2 A;  4DV2 O;  2IJJ A;  3NXS A;  5CBG A;  1SRY A;  1I08 A;  3CJH A;  1CPY A;  4ZI7 A;  1XNR O;  2A7W A;  1JMK C;  2W6I G;  3BRC A;  4J11 A;  3WB1 A;  2WLI B;  4L8J A;  2XOK G;  3CXH F;  2P5O A;  1NR1 A;  4F6E A;  3R66 A;  1IX9 A;  4LFB B;  4O4I A;  3U11 A;  3BA8 A;  4FVM A;  4BIZ A;  1R3K C;  5LL6 Y;  4NTW A;  1H38 A;  5H6R A;  1WB8 A;  2DQ0 A;  2WLL A;  4IL6 Z;  4NXM O;  3BEH A;  1M9N A;  1G8M A;  3RYH B;  3A2F A;  2VQE B;  1MNG A;  1BGY H;  3X2Q C;  1N36 O;  3JD0 A;  3KG2 A;  1D5N A;  4YXW G;  3L70 H;  3OR7 C;  2GDS A;  3TJT A;  4JAA A;  4JAU A;  1KEC A;  4DRX B;  1S3J A;  1IXB A;  3CCL V;  1U97 A;  1W59 A;  2QWR B;  2F4V O;  3FB7 C;  3RN4 A;  4NTY A;  1B04 A;  2EZP A;  5JCO A;  2ZR3 A;  2AZ2 A;  2Y69 C;  4DV0 O;  5LMU B;  1TA8 A;  5ITZ A;  1XMQ O;  2V7Q G;  3H1I H;  4TT3 G;  3CCJ V;  2EIJ C;  1H2L A;  1R6N A;  1XL4 A;  2EIK C;  3SJB C;  4LR3 A;  1NH2 D;  1MSD A;  3OGC C;  2VQF B;  4PDL A;  3A8T A;  4FIP C;  1F51 A;  1F7Y A;  3AG4 C;  2ZIO A;  4E4E A;  4UCT A;  1YSC A;  2ZDI C;  2HHH B;  4J80 A;  4CS2 A;  1SQQ H;  3SPJ A;  2WSS G;  4DUZ B;  1XHX A;  3E8H A;  1QLN A;  4IHJ B;  1L0L H;  2IJH A;  3E35 A;  1NQT A;  4DV2 B;  2Y4T A;  3ZHS A;  2XHB A;  3K57 A;  5KX5 B;  1XNR B;  4X20 A;  4TOI A;  3S3W A;  3HR0 A;  2FKX A;  1I5X A;  2AW9 A;  5J9P C;  2ZQM A;  1PNK A;  4P30 A;  2AGA A;  4EB6 A;  3ETQ A;  5KHK A;  4UVA A;  1Q81 W;  5BXZ A;  2DN9 A;  1VQO V;  2P06 A;  4JAV A;  5KUM A;  4LWS A;  1WNS A;  3F5W C;  1F23 A;  3OFN G;  4FFB B;  1QLE B;  2M7W A;  4JI7 O;  3FKS G;  4MTO A;  3VQV A;  1S76 D;  1Q5O A;  1N8R W;  4NXM B;  1NR7 A;  1V55 B;  4HNA B;  1KYO F;  2LQT A;  3LDE A;  4W4K A;  3APQ A;  2XAG A;  1IDS A;  1N36 B;  1HNW O;  1BHB A;  4NVP A;  5IJ9 A;  3FAV A;  3CPW U;  4RQF A;  4TV9 B;  2D2C B;  1QBZ A;  1H8E G;  4ZOL B;  2IM9 A;  1K3E A;  1XUQ A;  4NTX A;  3W7W A;  3OMI B;  1AP6 A;  1RFY A;  3M99 B;  2R9A A;  5K1P A;  4X9Q A;  2F4V B;  4JPR A;  1XQ8 A;  4XDJ A;  2DOS A;  5KHI A;  1CXZ B;  4X66 O;  4EKW A;  3E89 A;  3S3X A;  4DV0 B;  1NTK H;  1XMQ B;  1S0V A;  3JD3 A;  3EHB B;  1IBM O;  4JI3 O;  3RYF A;  1L0N H;  1XMO B;  2OYQ A;  4UFZ A;  1H2N A;  1BHA A;  2X6B A;  4D7S A;  3U10 A;  2E75 B;  2Y4U A;  3R65 A;  1ZL8 A;  3NR7 A;  3B77 A;  2YS8 A;  2IJK A;  2ZNJ A;  3D3I A;  4MVZ A;  4PI2 A;  2JEX A;  1ZWI C;  1KD1 W;  1PP9 H;  4ASU G;  3G71 V;  4CBC A;  5BZB A;  4GZR B;  3AG3 C;  4CS4 A;  2UXD O;  1EN4 A;  1PNL A;  4UCS A;  2QSA A;  1RP3 B;  4RAI A;  2K1E A;  4LF5 O;  4K3A A;  3OM3 B;  3K04 A;  2DYS B;  3ZHR A;  1FKA O;  1R1B A;  2GTS A;  1K97 A;  3W7T A;  4YIO A;  1KB9 F;  5FL7 G;  1BQ0 A;  2UUA O;  2OIE A;  1IZ3 A;  4F6R B;  4QJF B;  4MW8 A;  1JX9 A;  4JV5 O;  1GK9 A;  4D6T H;  4WCE V;  3ML0 A;  1VMG A;  3JCU Z;  3RGB A;  2GBO A;  5JVD A;  4JI7 B;  4GYC B;  1SS3 A;  3WB0 A;  1YHQ V;  3CS5 A;  3TXQ A;  4RO2 A;  2YXH A;  2ARH A;  1AVM A;  4DV6 O;  1LNQ A;  1HNW B;  3WU2 Z;  2VRZ A;  2YI8 A;  3U0Z A;  3JD2 A;  2CDY A;  4UB8 Z;  2XTA A;  1FXK B;  1AJP A;  4D7T A;  4P9O A;  3WB2 A;  4O2B B;  1W0J G;  2Q68 A;  1GN3 A;  3H1J H;  2ITC C;  2ZDI A;  1QLE C;  4X62 B;  3E86 A;  5FLX N;  4X66 B;  1KQS U;  1AP5 A;  5EYP B;  3N2G A;  1V55 C;  4O2A A;  1IBM B;  1EN5 A;  3HKB B;  3APO A;  4JI3 B;  3AK1 A;  2XAJ A;  1MZE A;  3H1K H;  1F4N A;  4MT8 A;  2OIG A;  3CEI A;  3G67 A;  1TUB B;  1FYJ A;  4H44 B;  4WFG A;  5BMV B;  1VQ9 V;  5LA6 A;  4N23 A;  2JRI A;  2WWW A;  2UXD B;  1M1K W;  4WBN A;  4ZHQ A;  3CSX A;  3C90 A;  4LF5 B;  2CH7 B;  3IGA C;  1AJN A;  5EIB C;  1KUQ A;  4KL1 A;  2WPD G;  3ZHQ A;  1SQV H;  4JI8 O;  3O9O A;  4L87 A;  5LHH A;  2YIB A;  1YTF B;  1HP8 A;  1P49 A;  2WLI A;  2Q0A A;  4JV5 B;  4JF3 A;  3UO2 A;  3K0D A;  4DUY O;  3AG1 C;  2B5U A;  1K92 A;  2PF4 E;  3CHX A;  1IVS A;  2Q69 A;  3IC7 A;  4DV1 O;  1TVK B;  2EIL B;  1VQN V;  2IU0 A;  3K58 A;  5IJ0 B;  2DYS C;  4DV7 O;  4DW1 A;  1H2M A;  4DV6 B;  1Y4M A;  4FLY A;  5L3E A;  2KG7 A;  2IW5 A;  4JAS A;  1AB3 A;  4TV8 B;  4B7K A;  4LCU C;  5C8Y B;  4JI6 O;  1W2B U;  1Q86 W;  2ITD C;  3C3S A;  2DW4 A;  4FZ0 A;  2QM8 A;  5CA0 B;  1N33 O;  1XIL A;  4DRX A;  5A9G A;  1WJZ A;  4B3R O;  3CWB H;  5CA1 B;  3AEI A;  3CC4 V;  3FB8 C;  2F43 G;  4JZ2 A;  2WAM A;  3SPG A;  2JK5 C;  5IYC O;  4B08 A;  4AQY B;  1NKD A;  1PL0 A;  2JJ2 G;  3QTC A;  3L74 H;  4J9Z B;  5B3S C;  4FPP A;  4QPK A;  3FFQ A;  4KXR A;  4GCZ A;  2D3O W;  3ABM B;  3AG2 C;  3BY6 A;  4B3M O;  2OCC B;  2OTJ V;  3F7Y C;  2F1M A;  2E3C A;  1ZSP A;  3L73 H;  3LDD A;  5EIB D;  2EX3 A;  2NLJ C;  5EC1 C;  1R6T A;  3ZMT A;  2F23 A;  4UCO A;  4NKG B;  3I5D A;  4PDR A;  4IHJ A;  4QPJ A;  2NN4 A;  4DR7 O;  2CAZ C;  2WLM A;  1FD9 A;  2P22 C;  4PI0 A;  2XAF A;  1IBL B;  1U96 A;  4OX9 O;  5LGN A;  4JI8 B;  2QTS A;  5J2T B;  4MVQ A;  3RYI B;  1RSO B;  1P4R A;  3RVY A;  2PI5 A;  2ZT9 B;  1T5E A;  2HJD A;  1ENV A;  1SA0 B;  4DUY B;  3ABK C;  2EIM C;  4JI5 O;  2Q4P A;  1AR4 A;  1I5Y A;  3ZMV A;  1FJG O;  2RNB A;  2WLH A;  4DV1 B;  4BWA A;  1CEZ A;  2Q8V A;  4DV7 B;  3OMA B;  3E83 A;  2X6A A;  4HNA A;  1WP7 A;  3LSQ A;  1D2D A;  3OMN B;  1OCR B;  4KFM A;  1NT2 B;  3JAK B;  4LF6 O;  1W0K G;  4I50 B;  4JI6 B;  1M4U A;  4GX1 A;  1OHH G;  3T1Y O;  2BTO A;  3QF7 A;  1K5Q A;  4TV9 A;  3QNE A;  2PUS A;  1S5L Z;  4ZOL A;  1N33 B;  5KLV H;  2GUZ B;  3K3W A;  4B3R B;  1BCC H;  1SQP H;  2EIN C;  5LXT B;  4J10 A;  4CH6 A;  2Q7E A;  3ZRS A;  1N34 O;  5IWA O;  3BAB A;  3AK2 A;  1PPJ H;  2ZE5 A;  1JOY A;  3MHH C;  1K73 W;  1O9G A;  2OCH A;  3H1L H;  4J7K A;  2DQ3 A;  2EJR A;  1GMG A;  2JIZ G;  4HYO A;  3RT3 C;  1K4D C;  4BAY A;  2X0L A;  3ZIA G;  2ZM6 O;  4FM2 A;  4JTC B;  1R73 A;  1AJQ A;  4B3M B;  2YXL A;  2YIA A;  3ZCC A;  1ZLZ A;  2DE0 X;  1I7F A;  2PYJ A;  4G28 B;  2A3Q A;  4FLW A;  5K1X A;  4UCU A;  3RYC B;  5JQG B;  1WA8 B;  4X89 A;  2E76 B;  3THO A;  3N2K B;  2LP7 A;  5B1O A;  4DR7 B;  3CCS V;  5IYD O;  3CRQ A;  3GB7 C;  2EZO A;  2Q67 A;  4OX9 B;  4I0X A;  3KCX A;  1JFF B;  4I55 B;  2OCC C;  1GAX A;  1KP3 A;  3A0B Z;  4F6R A;  3QO7 A;  4X88 A;  1NTZ H;  2G38 A;  3P3P A;  3CC7 V;  2R9I A;  3OTO O;  5LYJ A;  3DXR B;  4JI5 B;  3SJQ C;  3K79 A;  1MG1 A;  3K5M A;  3TK1 A;  1G1X B;  1FJG B;  1FPO A;  4Z1M G;  3J80 N;  5IYZ B;  1QCE A;  2OT5 A;  3ZRW A;  1OZ0 A;  2X7R B;  2HEP A;  5FPO A;  1QR9 A;  3ETG A;  2FYU H;  3AK3 A;  3H9V A;  2JDI G;  4LF6 B;  1DLB A;  4YY3 B;  3RVZ A;  5H9C A;  4IIJ B;  1Y6X A;  3A0H Z;  3BA9 A;  2B9Z A;  3T1Y B;  3K9A A;  1XMO O;  3FD9 A;  4GLX A;  5CBF A;  1M56 C;  3HKC B;  4CH4 A;  3RWR D;  2ADQ B;  3LSU A;  4O2B A;  1GTO A;  2BOC C;  4CH5 A;  3K9S A;  1N34 B;  2QTO A;  5IWA B;  3ZX6 A;  3ZHT A;  5GW7 A;  4YIP A;  2JGD A;  1FFT B;  2KKW A;  3QVN A;  1XNQ O;  2ODM A;  4B7E A;  5LMN O;  1NI8 A;  3ASO B;  4GKJ O;  3CP1 A;  2KQX A;  2CTQ A;  2N04 A;  1LUV A;  2ZM6 B;  4P9P A;  2XAQ A;  5B1B B;  4EEQ A;  2F95 B;  1HR0 O;  1OCO B;  3QG5 A;  4FLU A;  4U7O A;  5BMV A;  1N0N A;  3CRA A;  2CUG A;  4IGG A;  3IJ4 A;  3L75 H;  1COW G;  3CX5 F;  5JH7 A;  2R70 A;  4YHH O;  1KU9 A;  4ABM A;  3KCY A;  4UUJ C;  1VQK V;  3MDS A;  2CH7 A;  3DC5 A;  3EVK A;  4FM0 A;  2QJ1 A;  1EZV H;  2RMK B;  4O4H B;  1RM1 B;  2P4K A;  1B6Q A;  3RFR A;  4R8C A;  2UXC O;  1Q43 A;  2ILM A;  3W7U A;  4PA4 A;  1URF A;  2Y0P A;  3VOU A;  2V4D A;  2BSK A;  4TWK A;  5HFM A;  4G27 B;  3E8B A;  5D5Q A;  1M57 B;  2UXX A;  4GX2 A;  3CE2 A;  1SC5 B;  3OTO B;  3ZED A;  1JCH A;  3OAA G;  3CMA V;  1K33 A;  3D36 C;  4DW0 A;  5C93 A;  1X4T A;  4X1I B;  4RWU A;  1XRE A;  3K06 A;  2H8P C;  2KSD A;  2QA4 V;  1TVK A;  2DWD C;  4X62 O;  1QR8 A;  5IJ0 A;  5GON B;  1BSM A;  3TCU A;  1PV0 A;  3K03 A;  4O4J B;  4JI1 O;  2CGO A;  4X1Y A;  4O4L B;  2CK3 G;  2Z3Y A;  2W6J G;  1Q3E A;  4JI2 O;  5JWP A;  1R6K A;  3A0R A;  1XL6 A;  1NZ6 A;  1SQX H;  4TV8 A;  5TIS Z;  4DO2 A;  4N21 A;  5H2F Z;  5C8Y A;  2P7T C;  4H33 A;  2WA3 A;  1JA8 A;  2YEV B;  4U3F H;  1MSW D;  1FXH A;  5CA1 A;  1SER A;  2N74 A;  1G4Y B;  4JI0 O;  3JAL A;  1AI7 A;  3N27 A;  3RBZ A;  3P3N A;  5IYB O;  2LFR A;  1XNQ B;  5EBM C;  5LMN B;  5EZY A;  4GKJ B;  1P84 F;  3FYI B;  2GHY A;  1H2K A;  2YUA A;  1YVW A;  3CJH B;  2GV9 A;  2ATK C;  1KMI Z;  3VBB A;  1HR0 B;  4LH7 A;  1GKF A;  1P7G A;  2CTP A;  2MW2 B;  4RUE A;  4MSW C;  4O4I B;  2YXY A;  3JAW B;  5L3F A;  5B66 Z;  4YHH B;  2CGN A;  2PY5 A;  4JZG A;  5F2V O;  1O9H A;  3JAS B;  5EK0 A;  3AG7 A;  3G4S V;  3G6E V;  3HKE B;  3Q4H B;  3ASO C;  2JJ1 G;  3SDL A;  1K9M W;  4W4L A;  2YIB D;  5KHH A;  2UXC B;  3JAR A;  1A32 A;  1E1R G;  1GO3 F;  5AG2 A;  1SQB H;  3BVO A;  2YI9 A;  2XAH A;  5J2T A;  3D8C A;  4TUY A;  3RYI A;  1RSO A;  3H1H H;  5KHG A;  1D5A A;  2RCV A;  4PHZ A;  4KHP O;  5GTH Z;  4TSF G;  1SA0 A;  3CRR A;  1SQG A;  1N4C A;  4K0K O;  1DF4 A;  3ZMZ A;  2LGW A;  4PD4 F;  2DYR B;  3K5O A;  2ZIN A;  2LFS A;  1LR1 A;  3OT7 A;  4LBE C;  1K5S A;  2DWE C;  3ZBH A;  2EBO A;  1RM1 C;  1Q7Y W;  2PTM A;  4JYB A;  4JI1 B;  3B8M A;  4JI2 B;  4H0L B;  4AQY O;  1K34 A;  4AIL C;  1EM1 A;  2FL4 A;  3ZRV A;  1M5I A;  1M57 C;  2M6Y A;  4I50 A;  3JD1 A;  4TQD A;  4H13 B;  4CS3 A;  4LNU B;  4RUF A;  3LDC A;  1JPX A;  1YZB A;  2FML A;  3MHS C;  4JI0 B;  3H01 A;  1WN7 A;  1GN2 A;  1L8D A;  5IT9 N;  1VQ8 V;  4J42 A;  1HNX O;  2NNU A;  3BPZ A;  3E8F A;  4UV8 A;  4Q6G A;  4PEL A;  3I56 V;  1N32 O;  1IBL O;  3T1H O;  4FLZ A;  2PI4 A;  1YCI A;  5E1A C;  3FB5 C;  4UVC A;  1Z2G A;  3RYC A;  5JQG A;  1WA8 A;  5IE9 A;  3W7X A;  3STL C;  4CC5 A;  3TGU H;  3D36 A;  4LF8 B;  4JTA B;  1NU1 H;  4EFE A;  5H5N A;  3HKD B;  1WB7 A;  3CRC A;  1MAB G;  3SR2 C;  2JVD A;  4YJ2 B;  1NVP B;  2P90 A;  4PJ0 Z;  2E74 B;  1SZX A;  2LGQ A;  4OGQ B;  3OEE G;  1HDJ A;  1OCC B;  1K8A W;  1JFF A;  1EN6 A;  3RYH A;  3VQY A;  4BR6 A;  3M7M X;  4I55 A;  1YJ9 V;  1K4C C;  3FB6 C;  4UVB A;  2DJV A;  3SPI A;  4KHP B;  2HJF C;  5LP6 B;  2Q73 A;  4K0K B;  1G6U A;  1NH2 B;  1E79 G;  4MVS A;  3UKM A;  3CCE V;  3WG7 B;  2BTQ B;  1VF5 B;  5IYZ A;  2QM7 A;  3KZI Z;  2HLD G;  5KAF Z;  5DEC A;  4PA9 A;  4WFF A;  4LFA O;  2RJZ A;  1SZT A;  2P6J A;  5FPR A;  1K7D A;  1V9P A;  4R7C A;  1RPR A;  3ABU A;  1Y74 B;  2BE3 A;  2IH3 C;  2QM4 A;  5EC2 C;  1FXK C;  3PJS K;  4X1K B;  1S5J A;  3HKC A;  4R50 A;  2QKS A;  4PA7 A;  4DR4 O;  2ZKO A;  5LGU A;  4FFK A;  3CCQ V;  2DYR C;  1DGS A;  1MMM A;  2QDO A;  4C7U A;  3P30 A;  2CE4 A;  4DR1 O;  5CBH A;  1S5H C;  4DV5 O;  3UO3 A;  4LC1 A;  4BIU A;  2B1G A;  1HNX B;  4JYA O;  1JJO A;  4MVM A;  2UUB O;  3FX7 A;  3G80 A;  4YJ3 B;  1YXB A;  1EBO A;  2OTL V;  5D5P A;  5L3B A;  1N32 B;  1M90 W;  3T1H B;  1MZF A;  4J7J A;  5KX5 A;  4MTX A;  1Q82 W;  1S72 V;  4MW3 A;  5JVD B;  1RPO A;  2XAS A;  3ZRX A;  4LP8 A;  4ZBM A;  4MS2 A;  3SYP A;  4FFB A;  1FFX B;  1JJ2 U;  2L6L A;  1YIT V;  4O4H A;  2JGU A;  2L35 A;  4UCV A;  3ZN1 A;  1SES A;  2Z5U A;  3CCU V;  5KA5 A;  1DTO A;  4IYH A;  1E1Q G;  1WAZ A;  3UQ8 A;  1GN6 A;  1VF7 A;  2HVK C;  5LOV B;  4YY3 O;  5CMU A;  1H2G A;  2IJI A;  3AG4 B;  4U3J B;  4UB6 Z;  3T4Z A;  4XBF A;  1L1F A;  1VQM V;  2YIC A;  3ZN0 A;  1VQ6 V;  2ZXW B;  1FXV A;  3DTU B;  5CA3 A;  4H37 A;  1YJN V;  2Q7G A;  1AI5 A;  4X1I A;  1J5E O;  4J7Z A;  1B3Q A;  2VWK A;  3SPC A;  2WLK A;  2EIL C;  3L72 H;  5GON A;  1SKV A;  5DED A;  3IFX A;  4O4L A;  4LFA B;  3K0G A;  1OCC C;  3M8A A;  2K9P A;  1AI6 A;  1KKC A;  2FB5 A;  5LP6 C;  4B3S O;  3ZHV A;  3LNM B;  4U7N A;  5LA6 B;  5DN6 G;  2GTA A;  4DR4 B;  2YEV A;  4OXS A;  1BL8 A;  1PM9 A;  3B2E E;  1R3J C;  2F66 C;  1V54 B;  5L3C A;  2QGN A;  4FLX A;  1ZAU A;  4DR1 B;  1HNZ B;  1I94 O;  3D3Q A;  4GUN A;  2EJ7 A;  1S77 D;  4DV5 B;  4GT1 A;  3BAA A;  4JYA B;  3CME V;  5CB4 B;  3CCV V;  4J41 A;  2PYL A;  3JAT B;  2UUC O;  2UUB B;  2W0X A;  5J2U B; 
#chains in the Genus database with same CATH homology
 2A0L A;  3B8N A;  5LBQ A;  1JCH A;  1TUE B;  3ABM C;  5IDJ A;  3OAA G;  3CMA V;  1KQS U;  1K33 A;  1CP9 A;  4MVU A;  4CZZ A;  4FJC C;  5C93 A;  1V55 C;  2Y48 A;  1DF5 A;  3K06 A;  2H8P C;  2QA4 V;  1HWY A;  4PDV A;  3X2Q B;  4J9Y B;  2XAJ A;  2DWD C;  1QR8 A;  3CYO A;  3LUT B;  3TCU A;  4RQE A;  2HVJ C;  2C2A A;  3K03 A;  1AI4 A;  1F4N A;  4MT8 A;  3STZ C;  2CK3 G;  4MTG A;  2Z3Y A;  2W6J G;  3ZJZ A;  1Y66 A;  2WLN A;  4WFG A;  1R6K A;  1QVF U;  3A0R A;  1XL6 A;  1VQ9 V;  1KKD A;  4N23 A;  4DO2 A;  4N21 A;  1YTF D;  2P7T C;  4H33 A;  4XDL A;  3MD0 A;  2WWW A;  2IH1 C;  1NBM G;  2YEV B;  1M1K W;  2Y69 B;  3TET A;  5LHI A;  4FMT A;  3EFF K;  1MSW D;  1FXH A;  2EIJ B;  3IGA C;  1AJN A;  2HR3 A;  1SER A;  1G4Y B;  1FXK A;  2WPD G;  1AI7 A;  1NVP D;  2EIK B;  3RBZ A;  5IYB O;  2LFR A;  5EBM C;  1M56 B;  3AG3 B;  4I9W A;  3FYI B;  2GHY A;  3SPH A;  5B1N A;  4L87 A;  5LHH A;  3RW0 A;  1ROP A;  5EBW C;  1YTF B;  4JYC A;  3T4D A;  2JEU A;  4HZ3 A;  2WLI A;  3OUF A;  5LGT A;  4JF3 A;  3W7S A;  2ATK C;  4I5S A;  5IY5 C;  3K0D A;  3VBB A;  4JTD B;  4HAM A;  4MVR A;  1GKF A;  1ORQ C;  3CCR V;  3AG1 C;  4RUE A;  2B5U A;  1OCR C;  4MSW C;  1K92 A;  4MVO A;  3ETE A;  1NJI W;  1YI2 V;  2Q69 A;  3IC7 A;  5L3F A;  4UXN A;  2EIL B;  1VQN V;  2IU0 A;  2DYS C;  2ZXW C;  5EK0 A;  3G4S V;  4G2K A;  1WLE A;  3G6E V;  1Y4M A;  2GSM B;  2FTK A;  5L3E A;  3ABT A;  1KP2 A;  3ASO C;  2JJ1 G;  2IW5 A;  4JAS A;  1K9M W;  3P32 A;  4PA3 A;  4LCU C;  2ZR2 A;  1E1R G;  1GO3 F;  2HG5 C;  1W2B U;  1Q86 W;  3ASN B;  2ITD C;  2DW4 A;  4MTF A;  2XAH A;  1PNM A;  1SET A;  3JYC A;  4QNH B;  1FS0 G;  3ZMU A;  2QM8 A;  1VQL V;  3WG7 C;  3LSS A;  2MK3 A;  4R6Z A;  3SYC A;  3E2E A;  2UXN A;  2B1I A;  3AEI A;  3CC4 V;  3FB8 C;  2F43 G;  2WAM A;  1MOF A;  4TSF G;  1OCZ C;  3HB3 B;  3SPG A;  1KC8 W;  4DXW A;  2HFE C;  2JK5 C;  5IYC O;  1THZ A;  1DF4 A;  1NKD A;  1PL0 A;  2JJ2 G;  2IJJ A;  3NXS A;  3ZMZ A;  4J9Z B;  3CCM V;  5CBG A;  5B3S C;  1SRY A;  1CPY A;  2DYR B;  1VQP V;  2LFS A;  1V54 C;  4FPP A;  2W6I G;  4QPK A;  4LBE C;  1K5S A;  2DWE C;  2EBO A;  1RM1 C;  2WLI B;  4GCZ A;  1Q7Y W;  5L3G A;  2XOK G;  4JYB A;  1NR1 A;  3B8M A;  2D3O W;  3ABM B;  3AG2 C;  1K34 A;  3BY6 A;  4KP4 A;  4BIZ A;  2OCC B;  3E8G A;  5H6Q A;  3ZRV A;  2OTJ V;  1R3K C;  3F7Y C;  1M57 C;  2H94 A;  2BOB C;  1H38 A;  3K08 A;  3LDD A;  3JD1 A;  5H6R A;  1PD3 A;  2NLJ C;  3T2M A;  5EC1 C;  2DQ0 A;  3ZMT A;  4RUF A;  3LDC A;  2WLL A;  1JPX A;  3OE7 G;  3BEH A;  1M9N A;  1G8M A;  4PDR A;  4QPJ A;  3MHS C;  5HFL A;  4QE7 A;  3X2Q C;  1IXM A;  3H01 A;  3JD0 A;  3KG2 A;  2WLM A;  2QEX V;  2XAF A;  3WFV A;  1VQ8 V;  2A79 B;  4YXW G;  1GM9 A;  2V1D A;  2AHZ A;  1J95 A;  3OR7 C;  5LGN A;  4MVQ A;  4JAU A;  1KEC A;  1R3I C;  1S3J A;  2NNU A;  1P4R A;  3RVY A;  3CCL V;  4GX5 A;  2PI5 A;  1UJW B;  1H8H G;  3E8F A;  1ENV A;  3FB7 C;  4UV8 A;  4PEL A;  3I56 V;  2EZP A;  2ZR3 A;  3ABK C;  2EIM C;  2Y69 C;  2PI4 A;  1I5Y A;  3ZMV A;  5E1A C;  2V7Q G;  2AHY A;  3FB5 C;  4TT3 G;  2WLH A;  3CCJ V;  2EIJ C;  4UVC A;  3QO8 A;  5CN0 A;  1AR1 B;  1CEZ A;  1R6N A;  3W7X A;  1XL4 A;  1F4M A;  2EIK C;  3STL C;  4UV9 A;  3OMA B;  5B1A B;  3D36 A;  3E83 A;  4JTA B;  2X6A A;  1NH2 D;  5L3D A;  3LSQ A;  2W0F C;  1GM8 A;  3OGC C;  3OMN B;  3AG1 B;  4KUM A;  4PDL A;  4FIP C;  1F51 A;  1OCR B;  4KFM A;  3SYQ A;  1MAB G;  1W0K G;  3AG4 C;  3OW2 U;  1NVP B;  2P90 A;  1YSC A;  4GX1 A;  1JVM A;  3FYE B;  1OHH G;  2ZDI C;  4Q20 A;  1K5Q A;  4PA6 A;  3OEE G;  3QNE A;  3SPJ A;  1OCC B;  3ABL B;  1K8A W;  2WSS G;  3K3W A;  2WLL B;  1YJ9 V;  1BMF G;  2EIN C;  2WLJ A;  3GWO A;  5KUK A;  1K4C C;  3E8H A;  3ZRS A;  3FB6 C;  1QLN A;  4UVB A;  2QE7 G;  3SPI A;  2IJH A;  2HJF C;  1YIJ V;  3ZMS A;  5B1B C;  2KB1 A;  1YJW V;  3E35 A;  1NQT A;  1NH2 B;  1E79 G;  4MVS A;  3SYA A;  3UKM A;  1OCO C;  1VQ4 V;  3MHH C;  1K73 W;  1JOY A;  3CCE V;  3WG7 B;  4QE9 A;  1PKX A;  2DQ3 A;  2EJR A;  2QM7 A;  1ARO P;  2YSU B;  1GMG A;  2JIZ G;  3JD4 A;  4HYO A;  1I5X A;  5J9P C;  4P2Z A;  1K4D C;  4BAY A;  2ZQM A;  1PNK A;  2X0L A;  4E2L A;  2HLD G;  4P30 A;  3ZRW B;  3ZIA G;  4UVA A;  3ASN C;  4WFA V;  4PA9 A;  4WFF A;  1Q81 W;  4JTC B;  1R73 A;  1VQO V;  1AJQ A;  4JAV A;  5KUM A;  3CC2 V;  1SZT A;  3ZCC A;  4ZKI A;  2P6J A;  3I55 V;  3F5W C;  5B3S B;  1F23 A;  3OFN G;  1K7D A;  4G28 B;  4R7C A;  1RPR A;  3ABU A;  1QLE B;  2M7W A;  3CD6 V;  2IH3 C;  3QO5 A;  3FKS G;  5EC2 C;  4MTO A;  2ZD9 A;  1FXK C;  3PJS K;  1S76 D;  4R50 A;  1N8R W;  2QKS A;  4PA7 A;  4X89 A;  3AG2 B;  1NR7 A;  1V55 B;  3OEH G;  3LDE A;  5LGU A;  3CCQ V;  2XAG A;  2DYR C;  2LP7 A;  5B1O A;  1BHB A;  4BW5 A;  3CCS V;  5IYD O;  3P30 A;  5CBH A;  1S5H C;  3GB7 C;  3CPW U;  4RQF A;  2EZO A;  4LC1 A;  2Q67 A;  4BIU A;  1QBZ A;  1H8E G;  2B1G A;  1K3E A;  1QVG U;  1WPX A;  3W7W A;  2OCC C;  1KP3 A;  3OMI B;  1P7B A;  3M99 B;  2P67 A;  4WFE A;  3QO7 A;  4JPR A;  4X88 A;  4MVM A;  4XDJ A;  3CC7 V;  2OTL V;  1EBO A;  2R9I A;  5L3B A;  1M90 W;  4WFH A;  4EKW A;  3E89 A;  3SJQ C;  3HPL C;  3K79 A;  1MG1 A;  3TK1 A;  4MTX A;  4Z1M G;  1Q82 W;  1S0V A;  3JD3 A;  3EHB B;  1QCE A;  1VQ5 V;  1S72 V;  4MW3 A;  2OT5 A;  3ZRW A;  3JCZ A;  1OZ0 A;  1RPO A;  2XAS A;  1BHA A;  3ZRX A;  2X7R B;  2X6B A;  4LP8 A;  1QR9 A;  3ETG A;  1GM7 A;  4ZBM A;  4MS2 A;  3ABK B;  2EIM B;  3SYP A;  3R65 A;  2JDI G;  1DLB A;  3RVZ A;  2A9H A;  3B77 A;  5H9C A;  1JJ2 U;  2IJK A;  4MVZ A;  3D3I A;  4GX0 A;  1YIT V;  2XND G;  1R3L C;  3K9A A;  4WF9 V;  2JEX A;  4PDM A;  1ZWI C;  2HKO A;  5IY5 B;  1KD1 W;  3ZN1 A;  4ASU G;  5CBF A;  3G71 V;  1M56 C;  1SES A;  2Z5U A;  4CBC A;  5BZB A;  4QIW F;  5KA5 A;  3CCU V;  1DTO A;  3AG3 C;  1E1Q G;  3ETD A;  3SYO A;  5KA6 A;  1PNL A;  1GTO A;  2BOC C;  2HVK C;  4RAI A;  2K1E A;  5CMU A;  1H2G A;  2QTO A;  2IJI A;  3AG4 B;  4FK5 C;  3OM3 B;  3T4Z A;  4XBF A;  1L1F A;  3K04 A;  1VQM V;  2DYS B;  3ZN0 A;  1VQ6 V;  3DGE A;  2ZXW B;  5GW7 A;  1FXV A;  4F4L A;  1JQ0 A;  3DTU B;  5CA3 A;  1FFT B;  5B1A C;  5LHG A;  4H37 A;  1YJN V;  1K97 A;  1AI5 A;  3W7T A;  3CXC U;  3ASO B;  2EIN B;  1EZJ A;  5FL7 G;  3SPC A;  3CP1 A;  2WLK A;  2EIL C;  4QJF B;  4MW8 A;  1JX9 A;  4P9P A;  2XAQ A;  1GK9 A;  5B1B B;  2IU3 A;  4JGS A;  4WCE V;  3IFX A;  4X8A A;  2R9R B;  3ML0 A;  3K0G A;  1OCC C;  3ABL C;  1OCO B;  3UM7 A;  1AI6 A;  4U7O A;  3F7V C;  4XDK A;  1COW G;  3LNM B;  4U7N A;  1OCZ B;  5DN6 G;  1YHQ V;  2YEV A;  4OXS A;  1BL8 A;  2Q6A A;  4UUJ C;  4RO2 A;  1R3J C;  1VQK V;  1LNQ A;  2X6C A;  1V54 B;  5L3C A;  3OUS A;  5DM6 V;  1RM1 B;  3JD2 A;  1B6Q A;  4WFB V;  4R8C A;  5EBL C;  1S77 D;  3T1C A;  4GT1 A;  1FXK B;  3W7U A;  4PA4 A;  1VQ7 V;  3OR6 C;  3VOU A;  3CME V;  3CCV V;  1AJP A;  4P9O A;  4TWK A;  5HFM A;  4G27 B;  1W0J G;  3E8B A;  2Q68 A;  1M57 B;  2UXX A;  4GX2 A;  1EFR G;  2ITC C;  2ZDI A;  1QLE C;  3E86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...