5DM6V

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELARKGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5dm6V00
1YITV 1YJ9V 1YHQV 3CCSV 1VQMV 1Q82W 5DM6V 2QEXV 2OTJV 3CC2V 3CCRV 4WCEV 3CXCU 1VQOV 1K73W 1K8AW 1YIJV 3I56V 2D3OW 1R73A 3CD6V 3I55V 1K9MW 1M1KW 3CMEV 1JJ2U 1QVFU 3OW2U 1QVGU 1VQ4V 1S72V 1VQ6V 1Q7YW 1KC8W 3G6EV 4WFBV 1VQ8V 3CCQV 1VQ7V 1KD1W 4WF9V 1M90W 1Q81W 1NJIW 1VQLV 3CCUV 1KQSU 1N8RW 3CC7V 3CCJV 1VQ9V 3G4SV 3CCVV 3CCLV 1YI2V 4WFAV 3G71V 1VQKV 2QA4V 3CCEV 2OTLV 1VQNV 3CPWU 3CMAV 1VQPV 1VQ5V 1YJNV 1Q86W 1YJWV 1W2BU 3CCMV 3CC4V
chains in the Genus database with same CATH superfamily
2Y69C 4B3RB 4D7SA 2ILMA 2Y0PA 3IGAC 4EKWA 4JTCB 4ZIBA 1K73W 1FKAO 1GN3A 5JCOA 3CD6V 1K9MW 3FB8C 3OW2U 4UXNA 2R9AA 3DC6A 4CC5A 1SRYA 4GX2A 1HR0B 2WLJA 5B1AB 2B5UA 1N32B 2DW4A 3R65A 4PJ0Z 1AROP 1IX9A 3ABMC 1XREA 3VQXA 5TISZ 2GHYA 4GT1A 3NR7A 4PI0A 1BZKA 1YJWV 3SDLA 1BMFG 5GTIZ 2XAGA 1S76D 2Z0AA 1QCEA 2ZCEA 3TETA 4X89A 3L72H 2ZE6A 4JI7B 5B66Z 4MW8A 1XL4A 4A5UB 4DR5B 1AJQA 4GX0A 4FM2A 1SQPH 3RBZA 3CPWU 2QTOA 2UXNA 1VQ9V 1UJWB 2R70A 3B09A 4E2LA 1SETA 2EZPA 2CTPA 4J80A 3OTOO 2LP7A 1NS1A 5H6QA 4UVCA 4I4TB 4DV6O 3ABKC 1FS0G 4TUYB 4FPPA 4F6RB 4X62O 5CA3A 3CCQV 1Z5WA 4MVZA 2QM8A 4PELA 3LNMB 2BTQA 4JTDB 4J41A 4CZZA 1MSDA 4WFAV 1HNZB 2ITCC 4TT3G 1YVWA 4FLXA 1Y67A 4MVUA 5KHGA 3BHPA 1YHQV 1QLEB 1S0VA 1VF6C 2UXXA 1WB7A 2ZM6O 4LF5B 5L3EA 5KUMA 4AILC 5ITZA 3JAWB 3QG5A 3N2KB 1V54C 3D36A 2N74A 1FXVA 1GM7A 3TK1A 1IBMO 3CCSV 4ZKIA 4IYHA 3I56V 2F95B 2Q0AA 1O9HA 1OCRB 3G6EV 5BMVB 3H1HH 4R7CA 5KX5B 3HB3B 4O2AA 3DSQA 1SERA 3BCCH 2XUMA 4R8CA 2WLKA 3L70H 4KHPO 3AG2B 4DR2O 3MDSA 3HKDA 3K5NA 4GLXA 1DK1A 4G27B 4UCUA 2D3OW 2CTWA 5KA6A 4JV5B 2V7QG 3H1IH 4YXWG 1OCZC 2LQTA 1WA8A 3IFXA 4YHHO 4ICGA 1Z5VA 1Q6UA 1R1BA 3FD9A 5EZYB 1N34B 4N21A 3LDDA 3D3IA 1VIBA 4LFCB 4IHJA 1P49A 3ZIAG 4LF4O 1R6NA 3RVZA 3QO7A 1Q7YW 4O4IB 5GONA 5CB4B 2IH3C 4U3JA 5LXTA 1PD3A 1K5QA 1V9PA 1RPOA 4TWKA 3RFRA 2XOKG 2HEPA 4U7NA 3DC5A 2IJJA 3M8AA 1XMOO 1GAXA 3CCUV 1NVPB 3ZEDA 1Q6IA 2W6JG 3CCVV 1OCOB 3RYIA 4JAAA 1PPJH 1NTZH 4DRXB 2UXBB 3KCXA 2RMKB 3JD2A 1W0KG 1SZXA 1N0NA 3E8GA 3SR2C 2KG7A 3GWKC 4BIZA 1AI7A 5J2TB 5LMUO 3AK1A 1N36B 3UKMA 3B40A 4B3SB 4LF9B 5CMUA 1O9GA 3K79A 5IDJA 3STZC 4O4JA 1M57C 2X7RB 3OD4A 1G1XB 5IY5C 3JSNA 2H8PC 3UT5B 3OE7G 1PNLA 4NXNO 3ZHSA 5EIBD 3TGUH 2F4VB 3JYCA 3ETGA 5LP6A 1FXKC 2Y4TA 4DO2A 2H94A 3WU2Z 4JI5O 3CHXA 5GTHZ 1KU9A 2QM7A 1IDSA 4CS2A 4HAMA 4JI8O 1I5XA 2UXCB 3MHSC 2XTAA 2YSUB 5D5PA 2UXDO 2BOCC 2F23A 5IYZA 5JJNB 4MVQA 4X20A 2Q8VA 1YF2A 4UCTA 2RJZA 1I94O 3VBBA 2WLHA 1A32A 1H2NA 1T5EA 4DR4O 4TV8A 1KQSU 4U3FH 1ZX3A 2VQFB 5J2UB 2ZDIC 1VQ5V 3JD0A 4RQFA 4K35A 2PYJA 2F66C 4XDKA 3CS5A 4EB6A 2XAQA 1WNSA 4QPJA 3H1LH 1YIJV 1DGSA 2EINB 2JS5A 4JYAO 3JASB 4LF8O 2Q5ZA 1M90W 1FJGB 1NTKH 2QKCA 1XI1A 2KKWA 3T4ZA 2DQ0A 4LWSB 5K1PA 4B08A 1OHHG 5GW7A 4LF7B 2LFRA 1XNQO 3KG2A 1K4DC 2B9ZA 1N33B 5LMNO 2HHHB 3APQA 2EBOA 4CH5A 3UO3A 4DV1B 2ITDC 1N8RW 4QE7A 3BA8A 2IU0A 3ETEA 2EIMC 1G8MA 3CC4V 2ZD9A 4MTOA 3JSLA 2O57A 1WN7A 1LUWA 2KSDA 2ADPA 3SJBC 4O4HB 5EBWC 1QVGU 5LOVA 2FYUH 4X65B 3HKBA 2E75B 1Y66A 3OMNB 1I0HA 4FLWA 4J9YB 1Q90D 1L1FA 4YJ2A 3K9SA 4H37A 5IJ9A 2UU9O 1D5AA 4B3MO 1LUVA 1OCRC 1U97A 3J80N 4FVMA 4DUZB 2PYLA 2F1MA 1KP3A 3Q4HB 4J7KA 4YJ3A 2ARHA 3RT3C 4WFEA 4LC1A 3JAMN 1NBMG 2WLIA 5BY1A 1KECA 3SPGA 3H1JH 4MTGA 5CA0B 3OUSA 2ZR2A 2Q7GA 4FLUA 4O4LB 3LUTB 1S72V 1VQ4V 4JAUA 2UUAO 3DTUB 4UCRA 2F43G 4C7UA 3E83A 4QGPA 5D5QA 4W4LA 1BE3H 1R3IC 5A2QN 4IL6Z 2JS3A 3PN1A 1XQ8A 2EJRA 4DV5B 5BR8B 4JF3A 1Q6HA 3MD0A 4IIJB 2BSKA 1QVFU 4DV0B 4X64O 3OT7A 5EK0A 4RQEA 3K0GA 5B1BB 5DN6G 3L71H 3LSSA 1ZL8A 1K4CC 4FFBA 3P32A 2ZE8A 2AHZA 1RSOA 2WWWA 4DXWA 4XDLA 4DV7B 2JEUA 4I7ZB 2WSSG 2P5OA 3HKCA 5EBLC 4AQYO 3J81N 4ABMA 4JI4O 4LBEC 1P4RA 2P7TC 2P06A 1OCOC 5FPOA 1TUBB 2AW9A 3VQWA 4NXMB 4JYYA 4I0XB 4RUEA 1IXMA 3B77A 4KXRA 4JI6O 2BTQB 2EILC 4FJCC 2K1EA 2E5LB 1SQQH 3K5OA 3W7XA 3B8NA 2Q68A 4X1YA 2R9RB 5LL6Y 4DV4B 4GKJB 2VWKA 5B3SB 3CC7V 4LFAB 1NU1H 3ZN0A 3KKYA 2PY5A 4DR3O 2YXYA 4FM0A 1GN2A 4RUFA 1YJNV 1M56B 5ITZB 4G2KA 2A9HA 4FM1A 2BCCH 2OCCC 4TQFA 4HBNA 4TV9A 4LR3A 3P3PA 1JJ2U 5LBQA 3FX7A 3STLC 3SYOA 1F4NA 3TCUA 1AJPA 5JVDB 2OCHA 4ZOLB 1Y76A 2JDIG 1K3EA 2YEVB 2NR5A 1M93A 4PA4A 3ZRWA 3BVOA 5EBMC 4BIUA 1M57B 2ODMA 3F5WC 5JH7A 4XDJA 5IY5B 4B3RO 2FL4A 2B1GA 1K33A 3RYCA 1SZTA 3HKDB 2H3OA 2QR4A 3F7VC 1HR0O 1Q81W 1Q5OA 4AI8A 3G4SV 1QQCA 1M5IA 4HNAA 4B3TB 3G6BA 3P3NA 2PI5A 1HWYA 4N23A 1CXZB 4NVPA 4I9WA 3D3QA 1HNWB 3FFQA 5FL7G 1U96A 5KMGA 1VQ7V 4LFBB 1XNRB 1QBZA 2PGGA 4K8XA 3D8CA 1NH2B 4LF6B 4JI7O 1S5HC 4DR5O 2JJ1G 2IW5A 4D6TH 3WFVA 3EHBB 5GONB 2RQ6A 1WJZA 5DM6V 3BEHA 1BSMA 5JJEB 3H01A 1P84F 4I9QA 3LSUA 2K9PA 2WLLA 3F7YC 2WA3A 4GX5A 3M99B 2JIZG 1JFFB 4JI0B 5L3BA 1ENVA 1X59A 1IBLB 3HR0A 4I5SA 4I55B 2ZNIA 4Q20A 4MVOA 1HNXB 1HNZO 4PA6A 4K0KB 4JYBA 4L8JA 1KUQA 2KB1A 1MSWD 4J10A 1FAFA 4JASA 3M7MX 2YC0A 3H1KH 4LF5O 3S3WA 4FLYA 1H2SB 2JGDA 1PKXA 2WLMA 4JTAB 2AGAA 1JOYA 4NTXA 1HP8A 2ZQMA 2CH7B 4MTFA 4O4JB 5CA1A 3CXCU 4H44B 1K8AW 2EIMB 5IT9N 1RM1C 4I50A 3ZBHA 1WPXA 5C8YB 1S77D 1YDXA 2YICA 1I5YA 2EZOA 2V4DA 1XILA 3X2QB 1Y74B 1AVMA 3OTOB 2DOSA 1J95A 2IJIA 2KQXA 3ZHVA 5KHIA 2OIEA 1MOFA 4DK0A 2NN4A 4KFMA 3JD4A 5K1XA 1AR4A 5IYZB 5CBHA 3RYHA 5LYJA 2GUZA 2Q69A 3N2GA 1SA0A 4EFEA 4BW5A 2ZXWB 4E4EA 5JQGA 3G71V 1MMMA 3CRQA 4OX9B 4G28B 4XBFA 2GTAA 3FAVA 4TOIA 2Q7HA 1TVKA 1MABG 4LFCO 2C2AA 2JVDA 2ZM6B 2QDOA 4Z2WA 4CH4A 5B1BC 5LHHA 5E79Z 1G4YB 1PP9H 1MA1A 4MT8A 1FFXB 2EIJC 3PJSK 3DXRA 3JALA 1GN6A 1H2GA 4DYLA 1FXKA 4GZRB 3IAYA 3OR7C 2Q9LA 3JAKA 3RYFB 1ORQC 2W0FC 4CBCA 1D5NA 2ZINA 1VQ8V 4X9QA 4FZ0A 2QGNA 1R6KA 2X6AA 1JCHA 1VEWA 4H13B 3K5LA 3ZMUA 3WB0A 4KHPB 1GN4A 2HFEC 2HLDG 3T1YO 2Q0OC 3ZN1A 2L6LA 5LGTA 1XBLA 1IURA 5B3SC 1N36O 2CDYA 3K03A 3OGIB 4NB5A 4B3SO 1UFIA 2XASA 2ZDIA 4LF9O 4JZ2A 4OPAA 1M56C 1VQKV 5LHGA 2P22C 1K5SA 3AG3C 1BGYH 1VMGA 4LF4B 1BCCH 4R50A 1BHBA 2EILB 1M1KW 4PDLA 4X66B 3CRAA 3GVMA 2ZE7A 5IJ9B 3K04A 2IU3A 3ZMSA 4ZI7B 3C3TA 1OJHA 5IYDO 1OV9A 1R3JC 1SQXH 2UXCO 5IJ0B 4TUYA 4F6RA 4X1IB 4LH6A 4JGSA 4IT5A 3ZMZA 1XMOB 2YIDA 2ETNA 3ABTA 3EVKA 2OCCB 4J11A 2LGQA 2OT5A 1KB9F 5H9CA 1VQLV 2CTRA 3CJHB 5CN0A 5KHKA 2Y48A 3LDCA 1K34A 2M6YA 4DR7B 2X0LA 1F7YA 1AILA 3E22B 3B8MA 3T4DA 3K58A 1F23A 3GWOA 4GKKB 5LMUB 4UB8Z 4ZHQB 4DK1A 4CH6A 3N2KA 3AK3A 3SYPA 3ZS8C 4Z1MG 3HKEA 5DEDA 1YZBA 2A0LA 1XHZA 1PL4A 3OEEG 3SPIA 2QSAA 4YIOA 2CGNA 2XAJA 5BMVA 3A2FA 4P30A 1GMGA 4PDVA 1AI6A 5KX5A 4UCVA 3TXQA 1JJOA 1JR9A 4TQDA 3ZHQA 2EIKB 2XAHA 3THOA 4JI3O 5HFLA 5B5EZ 3W7WA 4X1KB 2YI9A 3BY6A 1WB8A 1N33O 2HHHO 1LR1A 2VS0A 5CBGA 2GSMB 2UUCO 3JCZA 5HFMA 3ZCCA 4KP4A 2X6BA 1GO3F 2EX3A 4LNUB 5JJJB 1PNMA 2WAMA 4DR4B 1VARA 3RVYA 5EZYA 1ZSPA 4BAYA 4GX1A 2AZ0A 3A0HZ 3JATB 3T2MA 1SQVH 2D2CB 3JARB 1J5EB 4FLZA 3A0BZ 4WFHA 4O4IA 3DGEA 4EEQA 4PA3A 4K8ZA 5CB4A 4JYAB 5EIBC 1RP3B 4LF8B 4DUZO 2HR3A 2Q4PA 1KMIZ 1KD1W 2BE3A 4UCSA 3JD3A 1L0NH 2P90A 1WPBA 1NI8A 5B1OA 4TV9B 3E8BA 3X2QC 3OTFA 3CEIA 2LGWA 2JK5C 3OEHG 2E76B 3W7TA 3MAQA 1B6QA 3UCSC 4DR1O 2YUAA 1WLEA 1VQMV 1Q82W 5IYBO 5LA6B 4D7TA 1NR1A 3RWRD 3ZRWB 5L3GA 4J9ZB 3AG4B 3QO8A 4RWUA 3SYQA 4DRXA 1COWG 2CK3G 1RM1B 1EFRG 1S3JA 3K08A 2ZXWC 4NTWA 2VQEB 3SGIA 1K92A 3ABLB 2DE0X 3QO5A 3GB7C 2Y0IA 1ROPA 5J2TA 4JYCA 2E74B 2QKSA 2QWPB 3KCYA 1QR8A 4QPKA 3E35A 2PZSA 2AHYA 1TGOA 2W0XA 2ZE5A 3UT5A 4BIOA 2DQ3A 4FFKA 2YIBA 2F93B 1YXBA 4F6EA 4O2BA 2HP8A 2AZ2A 4L87A 4EFBA 2ZIOA 2UU9B 1H2KA 4B3MB 3L74H 4YY3B 1OZ0A 3ZRVA 3ZRXA 1YCIA 1ZAUA 1X4TA 1SESA 5LHIA 4PDRA 3BFRA 2XT9A 1DF5A 1Q8IA 1GKFA 2WLLB 2EIJB 3TXSA 3CMAV 2UUBO 1W2BU 1THZA 4HYOA 1NKDA 2NNUA 5EC1C 4JI2B 2Q7EA 2E5LO 4J7JA 2UUAB 4J7ZA 1F4MA 4PDMA 1VQ6V 5J2UA 4UUJC 1AR1B 4FLTA 4DV3O 4DV4O 2HG5C 4GKJO 3OUFA 2W6IG 4LFAO 3O9OA 2RNBA 2QWQB 1XMQB 3LDEA 4MSWC 3JASA 5EYPA 4QE9A 1L0LH 3K06A 5IE9A 4X8AA 5FNVA 1XHXA 1M9NA 4GCZA 1FD9A 2QE7G 2Z3YA 2A06H 4DR6B 3AK2A 4H0LB 3I5DA 3CXHF 3OGCC 4CC6A 3CC2V 1AI5A 4JI4B 3AG3B 1IBKB 4DUYB 4MTXA 2XNDG 4DV2B 3G80A 5IWAO 4O4HA 5E1AC 2Z5UA 4PD4F 2ZKOA 4Q6GA 3ML0A 3AG1C 3N2GB 4O2AB 4OPHA 4PA9A 1XOUA 3SPJA 4F4LA 1PM9A 4KUMA 1QLNA 1P7BA 3L9DA 2EULA 4PI2A 4WBNA 1HNWO 1Q43A 1W0JG 3AEIA 4IGGA 1N32O 2GV9A 3O65A 4MVMA 1ZUQA 1PNKA 2ZR3A 3IC7A 1H8HG 1WA8B 1KP2A 4LP8A 1VF6A 1US6A 2EIKC 5DECA 1QR9A 3C90A 2R72A 4JI1B 2QWNB 1EN6A 1GTOA 3CX5F 1PL0A 3CRMA 4IHJB 1IBLO 1CEZA 1L8DA 5KUKA 1XEQA 5CA0A 5L3DA 4O4LA 1HNXO 3WG7C 2FTKA 4U3JB 5LXTB 4K0KO 3E8FA 1ZTEA 2OTJV 2M7WA 4NR1A 1NTMH 4UFZA 3T1HB 2ZNJA 3RN4A 2A3QA 3ZHTA 4WFGA 2FMLA 2FB5A 2FKXA 4MVSA 4IIJA 2DJVA 2ATKC 1R6TA 4CH3A 1SQGA 3OR6C 3APOA 5LGNA 3RGBA 3TJTA 2DN9A 3RYIB 2X6CA 3CRCA 3CE2A 1OCCC 3OMAB 3W7SA 2DYSC 2L35A 2VRZA 2DMXA 2DYRC 2KG7B 4PHZA 2QTSA 1DF4A 4W4KA 1IXBA 4UVBA 4QNHB 2VWJA 3KZIZ 3L75H 5C93A 3T1CA 1IVSA 3BABA 3CCRV 1HDJA 3AG4C 3A8TA 1YTFD 1JVMA 1TUBA 4MW3A 2BTOA 5F2VO 2JEXA 3CYOA 3ZX6A 1ZWIC 1JQ0A 1FPOA 4TSFG 4WFBV 4I0XA 3FB5C 5LP6B 2PUSA 3ABLC 1MZFA 4BW9A 3ASOB 3RW0A 2A7WA 1VF5B 3FKSG 3K9AA 2PF4E 2YDEA 3G67A 1WP7A 4OX9O 1PV0A 1FFTB 4DV6B 1RPRA 1NR7A 4X62B 3K57A 2PI4A 2HKOA 1B06A 5JCOC 5KHJA 4JV5O 4X20B 1EZVH 2BOBC 1CPYA 1VQNV 3HKEB 3HPLC 1XL6A 4TV8B 3JD1A 1YJ9V 1N34O 2RCVA 1P7GA 5B1NA 3ASNC 5JVDA 2QWRB 4ZOLA 3ZHUA 2YEVA 1AB3A 4EB6B 1F51A 1KKDA 3OAAG 3JCUZ 3CCJV 1IBMB 3IC9A 3EXAA 2Q67A 4QJFB 2QJ1A 3UQ8A 3MHHC 4YIPA 1K7DA 4PA7A 2QKAA 3H9VA 5FLXN 1FXHA 3UO2A 2Y4UA 2CGOA 3ABUA 3WB1A 2ZT9B 3SPCA 2V1DA 5H6RA 4DR2B 3VQYA 1TUEB 1Q86W 2UXBO 5J9PC 3ZMVA 1NH2D 1K97A 1URFA 4JAVA 1GK9A 2LJ2A 1R73A 3B4SA 3CMEV 1H38A 1SQFA 1AR5A 4X66O 1NT2B 1Z2GA 2WA4A 3A0RA 1AJNA 1I7FA 1S5JA 4YHHB 2GTSA 3SYCA 5LOVB 3CWBH 3S3XA 4JZGA 1QU7A 1SF9A 3HKBB 2LFSA 2OIGA 2YXHA 3N27A 3D36C 3F5TA 1JFFA 1GH6A 1V55C 1IZ3A 1XUQA 3LNNA 3E86A 2HVJC 3LSQA 4YJ2B 2F4VO 3SPHA 4I55A 1GRJA 3CRRA 3SJQC 4CS4A 4OXSA 1S5LZ 4OGQB 5L3FA 4RO2A 5KLVH 1JMKC 1MNGA 3CCLV 3E89A 3FB6C 4PV1B 5L3CA 4I4TA 3T1YB 4DR7O 4YJ3B 1WAZA 3K3WA 1EBOA 2LO1A 4GKKO 2WLNA 5H5NA 2WLIB 1H2MA 3U11A 1G6UA 2IBZH 2N05A 1BS3A 2CH7A 2WPDG 2IJKA 1CP9A 4FLVA 4UV8A 2VQFO 3J7AU 4KL1A 4AHCA 1BHAA 4WFFA 4UVAA 4O2BB 3AG1B 5C8YA 4MS2A 2CAZC 3JAWA 3QVNA 4UCOA 3ZHRA 3ZMTA 1D2DA 1Y74A 2HJDA 2BSKB 1FJGO 3NXSA 3K59A 4NTYA 3CSXA 4JPRA 4GYCB 4NXNB 4UV9A 1GM8A 1YITV 1ZL8B 2LW7A 4FFBB 5B1AC 3QNEA 3VOUA 2P67A 3CB2A 4JI5B 4LF7O 1E1RG 1RSOB 1YEWA 2CUGA 4JI8B 2GDSA 5H2FZ 3EFFK 1BL8A 3HKCB 4DV1O 3CCEV 4GUNA 2UXDB 1J5EO 4ASUG 3R66A 1FFXA 4NYKA 3WG7B 2OWOA 1I94B 2Y69B 3I55V 2OYQA 1Y4MA 5EYPB 3ETDA 3SJAC 5JWPA 4X65O 3VQVA 4X1YB 1NZ6A 1W59A 4DW0A 3BPZA 3AG7A 5FNVB 1B3QA 3ABMB 3RYFA 1E1QG 1AP5A 4FK5C 3B2EE 2QWOB 4JI3B 5LP6C 2PTMA 2R9IA 4FZ1A 3ASOC 3UM7A 1OCCB 1HW7A 4B7KA 1UPGA 2UUCB 2DYSB 3ICXA 1N4CA 2IJHA 2VQEO 1B04A 2OTLV 1JX9A 3U10A 1H2LA 2DYRB 1QLEC 3OMIB 2RDCA 1Q3EA 2A79B 1Y76B 2QEXV 1LNQA 1VQOV 2AXTZ 1Y6XA 4FMTA 3OM3B 2G38A 2YI8A 1NVPD 1XNQB 3QF7A 5CBFA 5EC2C 2YIAA 2QM4A 5JH7B 3ABKB 5LMNB 1KYOF 3RYCB 2XAFA 3K5MA 4WBNB 2XHBA 4IYIA 3OFNG 4DV5O 5BR8O 1QHTA 3C3SA 4ZI7A 1EN4A 4YY3O 2MW2B 1E79G 1H8EG 4HNAB 3E2EA 4DW1A 4DV0O 1AP6A 5IJ0A 4WF9V 4X1IA 2ADQB 3AG2C 2YIBD 4BWAA 5AG2A 3FB7C 2CTQA 4DR1B 5KMGB 2JRIA 2DWEC 2EJ7A 2LW1A 1V54B 3ZJZA 4JI2O 4DV7O 3CJHA 3E8HA 3ASNB 4ZBMA 4HZ3A 1SS3A 2NLJC 4R6ZA 2HJFC 2Q73A 3E22A 3IJ4A 1JA8A 3FYEB 4NXMO 1DTOA 3BA9A 2CE4A 4P2ZA 4ZHQA 1BT8A 5BZBA 1XMQO 5BXZA 1NJIW 2N04A 1R3KC 5LGUA 5FPRA 3ETQA 4WCEV 5KHHA 1BQ0A 4K3AA 5A9GA 1WP8A 1KC8W 1TA8A 4H33A 2P6JA 1QNMA 2GBOA 2P4KA 4P9OA 1OCZB 4U7OA 3FYIB 1VQPV 4DR6O 1MG1A 5KAFZ 4P9PA 4X1KA 2JGDB 1EM1A 1SC5B 4X64B 3K0DA 1IBKO 4DUYO 5CA1B 4DV2O 4LWSA 1YTFB 2Q6AA 5IYCO 1N0JA 2UUBB 2YS8A 4I50B 4LNUA 2MK3A 4MVRA 1SKVA 3CCMV 2RN9A 4LH7A 4B7EA 3P30A 1FYJA 3L73H 1RFYA 1VP7A 3JATA 4AQYB 3WB2A 1V55B 2IH1C 4DV3B 3JARA 4X88A 4FIPC 5KA5A 3SYAA 1SQBH 1GM9A 1YSCA 1JPXA 3RYHB 4JI6B 5LYJB 2GUZB 3BAAA 1AI4A 4B3TO 1SA0B 5KAIZ 3BRCA 5JQGB 1BQZA 2JJ2G 2E3CA 4JI1O 1XDCA 4QIWF 3FAVB 3U0ZA 4RAIA 1TVKB 4LFBO 1XNRO 2JGUA 4J42A 4DR3B 4LF6O 5LA6A 4BR6A 1DLBA 2DWDC 1EZJA 3SJCC 1R3LC 2IM9A 1YI2V 3DXRB 4NKGB 3JALB 3QTCA 1KBHA 1ZLZA 2B1IA 2ZIMA 4CS3A 3CP1A 4LCUC 3Q4HA 3ZRSA 3T1HO 1FXKB 1EN5A 1VF7A 2YXLA 1NQTA 5IWAB 4JI0O 4UB6Z 2HVKC 3JAKB 3W7UA 2P4VA 1I08A 1M4UA 1TAEA 1KKCA 4Z1VA 1MZEA 2QA4V 2EINC
chains in the Genus database with same CATH topology
2XAJA 4QJFB 3MD0A 2Y69C 4P30A 3MHHC 3IGAC 4EKWA 1GMGA 1K7DA 1AI6A 4JTCB 4PDVA 1K73W 4PA7A 3CD6V 1K9MW 3FB8C 1QVFU 2EIKB 3OW2U 4UXNA 2XAHA 1SRYA 4GX2A 5EK0A 2WLJA 1FXHA 2B5UA 5B1AB 5HFLA 3W7WA 4RQEA 2DW4A 3R65A 3K0GA 5B1BB 5DN6G 3ABUA 3BY6A 1AROP 3ABMC 3LSSA 5CBGA 3SPCA 2GSMB 2V1DA 1K4CC 5H6RA 3P32A 3JCZA 2GHYA 2AHZA 4GT1A 1TUEB 1Q86W 1YJWV 2WWWA 5HFMA 4DXWA 4XDLA 5J9PC 1BMFG 3ZCCA 4KP4A 2XAGA 3ZMVA 2X6BA 1GO3F 1NH2D 1K97A 4JAVA 1GK9A 2JEUA 1R73A 1S76D 1QCEA 2WSSG 3CMEV 1PNMA 5EBLC 2WAMA 1H38A 3TETA 3RVYA 4X89A 4LBEC 3A0RA 1P4RA 4BAYA 1AJNA 2P7TC 4GX1A 1OCOC 4MW8A 1XL4A 1AJQA 4GX0A 3T2MA 3SYCA 3RBZA 3CPWU 2QTOA 2UXNA 2LFSA 4RUEA 1IXMA 3B77A 1UJWB 4E2LA 1VQ9V 4WFHA 1SETA 2EILC 2EZPA 4FJCC 3DGEA 4PA3A 2K1EA 1V55C 2LP7A 3E86A 2HVJC 3LSQA 3W7XA 5H6QA 3B8NA 4UVCA 2Q68A 3ABKC 1FS0G 3SPHA 4FPPA 2R9RB 2HR3A 3SJQC 5CA3A 3CCQV 4OXSA 1KD1W 4MVZA 3JD3A 2P90A 5B3SB 2QM8A 5B1OA 5L3FA 3E8BA 4PELA 3LNMB 4RO2A 3CC7V 3X2QC 4JTDB 3ZN0A 3CCLV 3E89A 4CZZA 2JK5C 4WFAV 3FB6C 2ITCC 5L3CA 4TT3G 4RUFA 3OEHG 3W7TA 1YJNV 1B6QA 1M56B 1WLEA 4MVUA 3K3WA 1VQMV 1YHQV 4G2KA 2A9HA 5IYBO 1Q82W 1QLEB 2OCCC 1S0VA 1EBOA 2UXXA 1NR1A 3ZRWB 5L3GA 2WLNA 1JJ2U 4J9ZB 5LBQA 2WLIB 3AG4B 3QO8A 3STLC 3SYOA 1F4NA 3SYQA 5L3EA 5KUMA 1COWG 2CK3G 1RM1B 1EFRG 1S3JA 3K08A 3TCUA 1AJPA 2ZXWC 2WPDG 2JDIG 2IJKA 1CP9A 1K92A 3ABLB 3QO5A 2YEVB 1K3EA 1V54C 3D36A 3GB7C 4PA4A 4UV8A 1ROPA 1FXVA 1GM7A 4JYCA 5EBMC 3TK1A 3ZRWA 4BIUA 4WFFA 1BHAA 1M57B 3F5WC 3CCSV 4UVAA 2QKSA 4XDJA 5IY5B 4ZKIA 3I56V 3AG1B 1QR8A 2B1GA 4QPKA 1K33A 4MS2A 3E35A 1OCRB 1SZTA 3ZMTA 2AHYA 3G6EV 3F7VC 4R7CA 1Q81W 3HB3B 2DQ3A 3NXSA 1SERA 3G4SV 4R8CA 2WLKA 4JPRA 4L87A 3AG2B 4UV9A 1GM8A 1YITV 2PI5A 1HWYA 4N23A 1OZ0A 3ZRVA 4G27B 5B1AC 2D3OW 3QNEA 3VOUA 4I9WA 3ZRXA 2P67A 1E1RG 5KA6A 2V7QG 5FL7G 1SESA 4YXWG 1VQ7V 5LHIA 1QBZA 1NH2B 1OCZC 4PDRA 3IFXA 1S5HC 1BL8A 3EFFK 1DF5A 2JJ1G 1GKFA 2WLLB 2IW5A 2EIJB 3CCEV 3WFVA 3CMAV 3EHBB 4N21A 1W2BU 1THZA 3LDDA 4HYOA 4ASUG 5DM6V 1NKDA 3D3IA 2NNUA 3BEHA 5EC1C 3WG7B 3H01A 3ZIAG 2Y69B 3I55V 1F4MA 1R6NA 4PDMA 3RVZA 1Y4MA 3QO7A 1VQ6V 2WLLA 3F7YC 4GX5A 1Q7YW 3M99B 2JIZG 4UUJC 3ETDA 1ENVA 5L3BA 1AR1B 2HG5C 2IH3C 4I5SA 3OUFA 2W6IG 4Q20A 4MVOA 3ABMB 1PD3A 3LDEA 1E1QG 1K5QA 4PA6A 1RPOA 4TWKA 4JYBA 4MSWC 2XOKG 4QE9A 4FK5C 4U7NA 2IJJA 2KB1A 1MSWD 3K06A 2R9IA 4X8AA 4JASA 3ASOC 1M9NA 4GCZA 3UM7A 2QE7G 1OCCB 2Z3YA 3CCUV 1NVPB 2DYSB 2IJHA 2W6JG 3CCVV 1OCOB 2OTLV 1JX9A 1PKXA 2WLMA 2DYRB 4JTAB 1QLEC 1JOYA 3OGCC 3OMIB 3JD2A 1W0KG 2A79B 2ZQMA 4MTFA 2QEXV 3E8GA 1LNQA 3CC2V 3CXCU 1AI5A 1VQOV 1K8AW 2EIMB 4FMTA 3OM3B 1NVPD 4BIZA 1AI7A 1RM1C 5CBFA 3AG3B 5EC2C 4MTXA 2XNDG 3UKMA 3ABKB 5CMUA 1WPXA 3K79A 5IDJA 3STZC 2XAFA 1M57C 2X7RB 1S77D 1I5YA 2EZOA 5E1AC 2Z5UA 5IY5C 2H8PC 3X2QB 3ML0A 3AG1C 3OE7G 3OFNG 1PNLA 4PA9A 3SPJA 3JYCA 3ETGA 1J95A 4F4LA 1FXKC 2IJIA 4DO2A 4KUMA 1QLNA 1MOFA 1P7BA 2H94A 1E79G 1H8EG 3JD4A 4KFMA 3E2EA 5CBHA 1W0JG 3AEIA 4WF9V 2QM7A 2Q69A 4HAMA 3AG2C 4MVMA 1PNKA 1I5XA 3FB7C 2ZXWB 3MHSC 4BW5A 3G71V 4G28B 2YSUB 4XBFA 2DWEC 2ZR3A 3IC7A 1H8HG 1KP2A 1V54B 2BOCC 4LP8A 4MVQA 2EIKC 3ZJZA 1MABG 2C2AA 1QR9A 5B1BC 5LHHA 1GTOA 2WLHA 3VBBA 3E8HA 1G4YB 3ASNB 4HZ3A 4ZBMA 2NLJC 4R6ZA 1PL0A 4MT8A 2EIJC 2HJFC 3PJSK 1CEZA 1KQSU 5KUKA 1H2GA 3FYEB 1DTOA 4P2ZA 2ZDIC 5L3DA 1VQ5V 3JD0A 5BZBA 4RQFA 3WG7C 1FXKA 1NJIW 2FTKA 1R3KC 3E8FA 3OR7C 5LGUA 4XDKA 2OTJV 2M7WA 4WCEV 2XAQA 4QPJA 1YIJV 2EINB 1ORQC 2W0FC 4WFGA 4CBCA 1KC8W 1VQ8V 1M90W 1R6KA 2X6AA 1JCHA 4H33A 4MVSA 2P6JA 3ZMUA 4P9OA 1OCZB 4U7OA 2ATKC 3T4ZA 2DQ0A 3FYIB 1VQPV 2HFEC 1MG1A 2HLDG 3OR6C 3ZN1A 4P9PA 5LGNA 5LGTA 1OHHG 5GW7A 2X6CA 1OCCC 2LFRA 3OMAB 3W7SA 3K0DA 5B3SC 3KG2A 2DYSC 1K4DC 3K03A 1YTFB 2DYRC 2XASA 2EBOA 2Q6AA 1DF4A 2ZDIA 1N8RW 2ITDC 5IYCO 4QE7A 1M56C 2IU0A 1VQKV 2MK3A 4UVBA 3ETEA 4QNHB 4MVRA 2EIMC 3CCMV 1G8MA 5C93A 5LHGA 3CC4V 3T1CA 1K5SA 2ZD9A 3AG3C 4MTOA 3CCRV 3P30A 3AG4C 1YTFD 4R50A 1JVMA 4MW3A 1BHBA 2EILB 1M1KW 2JEXA 3CYOA 5EBWC 4PDLA 1QVGU 1ZWIC 1V55B 1JQ0A 2IH1C 3K04A 4TSFG 4WFBV 2IU3A 3FB5C 3ZMSA 1Y66A 3OMNB 3ABLC 4X88A 5IYDO 3ASOB 3RW0A 4FIPC 5KA5A 3SYAA 3FKSG 4J9YB 1R3JC 3K9AA 1GM9A 1L1FA 1YSCA 1JPXA 4H37A 1AI4A 4JGSA 3ZMZA 1OCRC 1FFTB 1RPRA 1NR7A 2JJ2G 3ABTA 2PI4A 2HKOA 4QIWF 2OCCB 1KP3A 4RAIA 2OT5A 1VQLV 5H9CA 2BOBC 4WFEA 5CN0A 1CPYA 2Y48A 3LDCA 1DLBA 2DWDC 1K34A 1EZJA 1VQNV 1R3LC 4LC1A 3HPLC 1XL6A 1YI2V 1NBMG 2WLIA 2X0LA 1KECA 3JD1A 1YJ9V 3SPGA 2B1IA 4MTGA 3CP1A 5B1NA 3B8MA 3T4DA 3OUSA 1F23A 3ASNC 3GWOA 2ZR2A 4LCUC 3ZRSA 3LUTB 1FXKB 1S72V 1VQ4V 4JAUA 2YEVA 3DTUB 2F43G 3SYPA 1F51A 4Z1MG 1NQTA 3E83A 1KKDA 1R3IC 2HVKC 3OAAG 2A0LA 3W7UA 3CCJV 3OEEG 3SPIA 2EJRA 4JF3A 2Q67A 2QA4V 2EINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT V;  1YJ9 V;  1YHQ V;  3CCS V;  1VQM V;  1Q82 W;  5DM6 V;  2QEX V;  2OTJ V;  3CC2 V;  3CCR V;  4WCE V;  3CXC U;  1VQO V;  1K73 W;  1K8A W;  1YIJ V;  3I56 V;  2D3O W;  1R73 A;  3CD6 V;  3I55 V;  1K9M W;  1M1K W;  3CME V;  1JJ2 U;  1QVF U;  3OW2 U;  1QVG U;  1VQ4 V;  1S72 V;  1VQ6 V;  1Q7Y W;  1KC8 W;  3G6E V;  4WFB V;  1VQ8 V;  3CCQ V;  1VQ7 V;  1KD1 W;  4WF9 V;  1M90 W;  1Q81 W;  1NJI W;  1VQL V;  3CCU V;  1KQS U;  1N8R W;  3CC7 V;  3CCJ V;  1VQ9 V;  3G4S V;  3CCV V;  3CCL V;  1YI2 V;  4WFA V;  3G71 V;  1VQK V;  2QA4 V;  3CCE V;  2OTL V;  1VQN V;  3CPW U;  3CMA V;  1VQP V;  1VQ5 V;  1YJN V;  1Q86 W;  1YJW V;  1W2B U;  3CCM V;  3CC4 V; 
#chains in the Genus database with same CATH topology
 2Y69 C;  4B3R B;  4D7S A;  2ILM A;  2Y0P A;  3IGA C;  4EKW A;  4JTC B;  4ZIB A;  1K73 W;  1FKA O;  1GN3 A;  5JCO A;  3CD6 V;  1K9M W;  3FB8 C;  3OW2 U;  4UXN A;  2R9A A;  3DC6 A;  4CC5 A;  1SRY A;  4GX2 A;  1HR0 B;  2WLJ A;  5B1A B;  2B5U A;  1N32 B;  2DW4 A;  3R65 A;  4PJ0 Z;  1ARO P;  1IX9 A;  3ABM C;  1XRE A;  3VQX A;  5TIS Z;  2GHY A;  4GT1 A;  3NR7 A;  4PI0 A;  1BZK A;  1YJW V;  3SDL A;  1BMF G;  5GTI Z;  2XAG A;  1S76 D;  2Z0A A;  1QCE A;  2ZCE A;  3TET A;  4X89 A;  3L72 H;  2ZE6 A;  4JI7 B;  5B66 Z;  4MW8 A;  1XL4 A;  4A5U B;  4DR5 B;  1AJQ A;  4GX0 A;  4FM2 A;  1SQP H;  3RBZ A;  3CPW U;  2QTO A;  2UXN A;  1VQ9 V;  1UJW B;  2R70 A;  3B09 A;  4E2L A;  1SET A;  2EZP A;  2CTP A;  4J80 A;  3OTO O;  2LP7 A;  1NS1 A;  5H6Q A;  4UVC A;  4I4T B;  4DV6 O;  3ABK C;  1FS0 G;  4TUY B;  4FPP A;  4F6R B;  4X62 O;  5CA3 A;  3CCQ V;  1Z5W A;  4MVZ A;  2QM8 A;  4PEL A;  3LNM B;  2BTQ A;  4JTD B;  4J41 A;  4CZZ A;  1MSD A;  4WFA V;  1HNZ B;  2ITC C;  4TT3 G;  1YVW A;  4FLX A;  1Y67 A;  4MVU A;  5KHG A;  3BHP A;  1YHQ V;  1QLE B;  1S0V A;  1VF6 C;  2UXX A;  1WB7 A;  2ZM6 O;  4LF5 B;  5L3E A;  5KUM A;  4AIL C;  5ITZ A;  3JAW B;  3QG5 A;  3N2K B;  1V54 C;  3D36 A;  2N74 A;  1FXV A;  1GM7 A;  3TK1 A;  1IBM O;  3CCS V;  4ZKI A;  4IYH A;  3I56 V;  2F95 B;  2Q0A A;  1O9H A;  1OCR B;  3G6E V;  5BMV B;  3H1H H;  4R7C A;  5KX5 B;  3HB3 B;  4O2A A;  3DSQ A;  1SER A;  3BCC H;  2XUM A;  4R8C A;  2WLK A;  3L70 H;  4KHP O;  3AG2 B;  4DR2 O;  3MDS A;  3HKD A;  3K5N A;  4GLX A;  1DK1 A;  4G27 B;  4UCU A;  2D3O W;  2CTW A;  5KA6 A;  4JV5 B;  2V7Q G;  3H1I H;  4YXW G;  1OCZ C;  2LQT A;  1WA8 A;  3IFX A;  4YHH O;  4ICG A;  1Z5V A;  1Q6U A;  1R1B A;  3FD9 A;  5EZY B;  1N34 B;  4N21 A;  3LDD A;  3D3I A;  1VIB A;  4LFC B;  4IHJ A;  1P49 A;  3ZIA G;  4LF4 O;  1R6N A;  3RVZ A;  3QO7 A;  1Q7Y W;  4O4I B;  5GON A;  5CB4 B;  2IH3 C;  4U3J A;  5LXT A;  1PD3 A;  1K5Q A;  1V9P A;  1RPO A;  4TWK A;  3RFR A;  2XOK G;  2HEP A;  4U7N A;  3DC5 A;  2IJJ A;  3M8A A;  1XMO O;  1GAX A;  3CCU V;  1NVP B;  3ZED A;  1Q6I A;  2W6J G;  3CCV V;  1OCO B;  3RYI A;  4JAA A;  1PPJ H;  1NTZ H;  4DRX B;  2UXB B;  3KCX A;  2RMK B;  3JD2 A;  1W0K G;  1SZX A;  1N0N A;  3E8G A;  3SR2 C;  2KG7 A;  3GWK C;  4BIZ A;  1AI7 A;  5J2T B;  5LMU O;  3AK1 A;  1N36 B;  3UKM A;  3B40 A;  4B3S B;  4LF9 B;  5CMU A;  1O9G A;  3K79 A;  5IDJ A;  3STZ C;  4O4J A;  1M57 C;  2X7R B;  3OD4 A;  1G1X B;  5IY5 C;  3JSN A;  2H8P C;  3UT5 B;  3OE7 G;  1PNL A;  4NXN O;  3ZHS A;  5EIB D;  3TGU H;  2F4V B;  3JYC A;  3ETG A;  5LP6 A;  1FXK C;  2Y4T A;  4DO2 A;  2H94 A;  3WU2 Z;  4JI5 O;  3CHX A;  5GTH Z;  1KU9 A;  2QM7 A;  1IDS A;  4CS2 A;  4HAM A;  4JI8 O;  1I5X A;  2UXC B;  3MHS C;  2XTA A;  2YSU B;  5D5P A;  2UXD O;  2BOC C;  2F23 A;  5IYZ A;  5JJN B;  4MVQ A;  4X20 A;  2Q8V A;  1YF2 A;  4UCT A;  2RJZ A;  1I94 O;  3VBB A;  2WLH A;  1A32 A;  1H2N A;  1T5E A;  4DR4 O;  4TV8 A;  1KQS U;  4U3F H;  1ZX3 A;  2VQF B;  5J2U B;  2ZDI C;  1VQ5 V;  3JD0 A;  4RQF A;  4K35 A;  2PYJ A;  2F66 C;  4XDK A;  3CS5 A;  4EB6 A;  2XAQ A;  1WNS A;  4QPJ A;  3H1L H;  1YIJ V;  1DGS A;  2EIN B;  2JS5 A;  4JYA O;  3JAS B;  4LF8 O;  2Q5Z A;  1M90 W;  1FJG B;  1NTK H;  2QKC A;  1XI1 A;  2KKW A;  3T4Z A;  2DQ0 A;  4LWS B;  5K1P A;  4B08 A;  1OHH G;  5GW7 A;  4LF7 B;  2LFR A;  1XNQ O;  3KG2 A;  1K4D C;  2B9Z A;  1N33 B;  5LMN O;  2HHH B;  3APQ A;  2EBO A;  4CH5 A;  3UO3 A;  4DV1 B;  2ITD C;  1N8R W;  4QE7 A;  3BA8 A;  2IU0 A;  3ETE A;  2EIM C;  1G8M A;  3CC4 V;  2ZD9 A;  4MTO A;  3JSL A;  2O57 A;  1WN7 A;  1LUW A;  2KSD A;  2ADP A;  3SJB C;  4O4H B;  5EBW C;  1QVG U;  5LOV A;  2FYU H;  4X65 B;  3HKB A;  2E75 B;  1Y66 A;  3OMN B;  1I0H A;  4FLW A;  4J9Y B;  1Q90 D;  1L1F A;  4YJ2 A;  3K9S A;  4H37 A;  5IJ9 A;  2UU9 O;  1D5A A;  4B3M O;  1LUV A;  1OCR C;  1U97 A;  3J80 N;  4FVM A;  4DUZ B;  2PYL A;  2F1M A;  1KP3 A;  3Q4H B;  4J7K A;  4YJ3 A;  2ARH A;  3RT3 C;  4WFE A;  4LC1 A;  3JAM N;  1NBM G;  2WLI A;  5BY1 A;  1KEC A;  3SPG A;  3H1J H;  4MTG A;  5CA0 B;  3OUS A;  2ZR2 A;  2Q7G A;  4FLU A;  4O4L B;  3LUT B;  1S72 V;  1VQ4 V;  4JAU A;  2UUA O;  3DTU B;  4UCR A;  2F43 G;  4C7U A;  3E83 A;  4QGP A;  5D5Q A;  4W4L A;  1BE3 H;  1R3I C;  5A2Q N;  4IL6 Z;  2JS3 A;  3PN1 A;  1XQ8 A;  2EJR A;  4DV5 B;  5BR8 B;  4JF3 A;  1Q6H A;  3MD0 A;  4IIJ B;  2BSK A;  1QVF U;  4DV0 B;  4X64 O;  3OT7 A;  5EK0 A;  4RQE A;  3K0G A;  5B1B B;  5DN6 G;  3L71 H;  3LSS A;  1ZL8 A;  1K4C C;  4FFB A;  3P32 A;  2ZE8 A;  2AHZ A;  1RSO A;  2WWW A;  4DXW A;  4XDL A;  4DV7 B;  2JEU A;  4I7Z B;  2WSS G;  2P5O A;  3HKC A;  5EBL C;  4AQY O;  3J81 N;  4ABM A;  4JI4 O;  4LBE C;  1P4R A;  2P7T C;  2P06 A;  1OCO C;  5FPO A;  1TUB B;  2AW9 A;  3VQW A;  4NXM B;  4JYY A;  4I0X B;  4RUE A;  1IXM A;  3B77 A;  4KXR A;  4JI6 O;  2BTQ B;  2EIL C;  4FJC C;  2K1E A;  2E5L B;  1SQQ H;  3K5O A;  3W7X A;  3B8N A;  2Q68 A;  4X1Y A;  2R9R B;  5LL6 Y;  4DV4 B;  4GKJ B;  2VWK A;  5B3S B;  3CC7 V;  4LFA B;  1NU1 H;  3ZN0 A;  3KKY A;  2PY5 A;  4DR3 O;  2YXY A;  4FM0 A;  1GN2 A;  4RUF A;  1YJN V;  1M56 B;  5ITZ B;  4G2K A;  2A9H A;  4FM1 A;  2BCC H;  2OCC C;  4TQF A;  4HBN A;  4TV9 A;  4LR3 A;  3P3P A;  1JJ2 U;  5LBQ A;  3FX7 A;  3STL C;  3SYO A;  1F4N A;  3TCU A;  1AJP A;  5JVD B;  2OCH A;  4ZOL B;  1Y76 A;  2JDI G;  1K3E A;  2YEV B;  2NR5 A;  1M93 A;  4PA4 A;  3ZRW A;  3BVO A;  5EBM C;  4BIU A;  1M57 B;  2ODM A;  3F5W C;  5JH7 A;  4XDJ A;  5IY5 B;  4B3R O;  2FL4 A;  2B1G A;  1K33 A;  3RYC A;  1SZT A;  3HKD B;  2H3O A;  2QR4 A;  3F7V C;  1HR0 O;  1Q81 W;  1Q5O A;  4AI8 A;  3G4S V;  1QQC A;  1M5I A;  4HNA A;  4B3T B;  3G6B A;  3P3N A;  2PI5 A;  1HWY A;  4N23 A;  1CXZ B;  4NVP A;  4I9W A;  3D3Q A;  1HNW B;  3FFQ A;  5FL7 G;  1U96 A;  5KMG A;  1VQ7 V;  4LFB B;  1XNR B;  1QBZ A;  2PGG A;  4K8X A;  3D8C A;  1NH2 B;  4LF6 B;  4JI7 O;  1S5H C;  4DR5 O;  2JJ1 G;  2IW5 A;  4D6T H;  3WFV A;  3EHB B;  5GON B;  2RQ6 A;  1WJZ A;  5DM6 V;  3BEH A;  1BSM A;  5JJE B;  3H01 A;  1P84 F;  4I9Q A;  3LSU A;  2K9P A;  2WLL A;  3F7Y C;  2WA3 A;  4GX5 A;  3M99 B;  2JIZ G;  1JFF B;  4JI0 B;  5L3B A;  1ENV A;  1X59 A;  1IBL B;  3HR0 A;  4I5S A;  4I55 B;  2ZNI A;  4Q20 A;  4MVO A;  1HNX B;  1HNZ O;  4PA6 A;  4K0K B;  4JYB A;  4L8J A;  1KUQ A;  2KB1 A;  1MSW D;  4J10 A;  1FAF A;  4JAS A;  3M7M X;  2YC0 A;  3H1K H;  4LF5 O;  3S3W A;  4FLY A;  1H2S B;  2JGD A;  1PKX A;  2WLM A;  4JTA B;  2AGA A;  1JOY A;  4NTX A;  1HP8 A;  2ZQM A;  2CH7 B;  4MTF A;  4O4J B;  5CA1 A;  3CXC U;  4H44 B;  1K8A W;  2EIM B;  5IT9 N;  1RM1 C;  4I50 A;  3ZBH A;  1WPX A;  5C8Y B;  1S77 D;  1YDX A;  2YIC A;  1I5Y A;  2EZO A;  2V4D A;  1XIL A;  3X2Q B;  1Y74 B;  1AVM A;  3OTO B;  2DOS A;  1J95 A;  2IJI A;  2KQX A;  3ZHV A;  5KHI A;  2OIE A;  1MOF A;  4DK0 A;  2NN4 A;  4KFM A;  3JD4 A;  5K1X A;  1AR4 A;  5IYZ B;  5CBH A;  3RYH A;  5LYJ A;  2GUZ A;  2Q69 A;  3N2G A;  1SA0 A;  4EFE A;  4BW5 A;  2ZXW B;  4E4E A;  5JQG A;  3G71 V;  1MMM A;  3CRQ A;  4OX9 B;  4G28 B;  4XBF A;  2GTA A;  3FAV A;  4TOI A;  2Q7H A;  1TVK A;  1MAB G;  4LFC O;  2C2A A;  2JVD A;  2ZM6 B;  2QDO A;  4Z2W A;  4CH4 A;  5B1B C;  5LHH A;  5E79 Z;  1G4Y B;  1PP9 H;  1MA1 A;  4MT8 A;  1FFX B;  2EIJ C;  3PJS K;  3DXR A;  3JAL A;  1GN6 A;  1H2G A;  4DYL A;  1FXK A;  4GZR B;  3IAY A;  3OR7 C;  2Q9L A;  3JAK A;  3RYF B;  1ORQ C;  2W0F C;  4CBC A;  1D5N A;  2ZIN A;  1VQ8 V;  4X9Q A;  4FZ0 A;  2QGN A;  1R6K A;  2X6A A;  1JCH A;  1VEW A;  4H13 B;  3K5L A;  3ZMU A;  3WB0 A;  4KHP B;  1GN4 A;  2HFE C;  2HLD G;  3T1Y O;  2Q0O C;  3ZN1 A;  2L6L A;  5LGT A;  1XBL A;  1IUR A;  5B3S C;  1N36 O;  2CDY A;  3K03 A;  3OGI B;  4NB5 A;  4B3S O;  1UFI A;  2XAS A;  2ZDI A;  4LF9 O;  4JZ2 A;  4OPA A;  1M56 C;  1VQK V;  5LHG A;  2P22 C;  1K5S A;  3AG3 C;  1BGY H;  1VMG A;  4LF4 B;  1BCC H;  4R50 A;  1BHB A;  2EIL B;  1M1K W;  4PDL A;  4X66 B;  3CRA A;  3GVM A;  2ZE7 A;  5IJ9 B;  3K04 A;  2IU3 A;  3ZMS A;  4ZI7 B;  3C3T A;  1OJH A;  5IYD O;  1OV9 A;  1R3J C;  1SQX H;  2UXC O;  5IJ0 B;  4TUY A;  4F6R A;  4X1I B;  4LH6 A;  4JGS A;  4IT5 A;  3ZMZ A;  1XMO B;  2YID A;  2ETN A;  3ABT A;  3EVK A;  2OCC B;  4J11 A;  2LGQ A;  2OT5 A;  1KB9 F;  5H9C A;  1VQL V;  2CTR A;  3CJH B;  5CN0 A;  5KHK A;  2Y48 A;  3LDC A;  1K34 A;  2M6Y A;  4DR7 B;  2X0L A;  1F7Y A;  1AIL A;  3E22 B;  3B8M A;  3T4D A;  3K58 A;  1F23 A;  3GWO A;  4GKK B;  5LMU B;  4UB8 Z;  4ZHQ B;  4DK1 A;  4CH6 A;  3N2K A;  3AK3 A;  3SYP A;  3ZS8 C;  4Z1M G;  3HKE A;  5DED A;  1YZB A;  2A0L A;  1XHZ A;  1PL4 A;  3OEE G;  3SPI A;  2QSA A;  4YIO A;  2CGN A;  2XAJ A;  5BMV A;  3A2F A;  4P30 A;  1GMG A;  4PDV A;  1AI6 A;  5KX5 A;  4UCV A;  3TXQ A;  1JJO A;  1JR9 A;  4TQD A;  3ZHQ A;  2EIK B;  2XAH A;  3THO A;  4JI3 O;  5HFL A;  5B5E Z;  3W7W A;  4X1K B;  2YI9 A;  3BY6 A;  1WB8 A;  1N33 O;  2HHH O;  1LR1 A;  2VS0 A;  5CBG A;  2GSM B;  2UUC O;  3JCZ A;  5HFM A;  3ZCC A;  4KP4 A;  2X6B A;  1GO3 F;  2EX3 A;  4LNU B;  5JJJ B;  1PNM A;  2WAM A;  4DR4 B;  1VAR A;  3RVY A;  5EZY A;  1ZSP A;  4BAY A;  4GX1 A;  2AZ0 A;  3A0H Z;  3JAT B;  3T2M A;  1SQV H;  2D2C B;  3JAR B;  1J5E B;  4FLZ A;  3A0B Z;  4WFH A;  4O4I A;  3DGE A;  4EEQ A;  4PA3 A;  4K8Z A;  5CB4 A;  4JYA B;  5EIB C;  1RP3 B;  4LF8 B;  4DUZ O;  2HR3 A;  2Q4P A;  1KMI Z;  1KD1 W;  2BE3 A;  4UCS A;  3JD3 A;  1L0N H;  2P90 A;  1WPB A;  1NI8 A;  5B1O A;  4TV9 B;  3E8B A;  3X2Q C;  3OTF A;  3CEI A;  2LGW A;  2JK5 C;  3OEH G;  2E76 B;  3W7T A;  3MAQ A;  1B6Q A;  3UCS C;  4DR1 O;  2YUA A;  1WLE A;  1VQM V;  1Q82 W;  5IYB O;  5LA6 B;  4D7T A;  1NR1 A;  3RWR D;  3ZRW B;  5L3G A;  4J9Z B;  3AG4 B;  3QO8 A;  4RWU A;  3SYQ A;  4DRX A;  1COW G;  2CK3 G;  1RM1 B;  1EFR G;  1S3J A;  3K08 A;  2ZXW C;  4NTW A;  2VQE B;  3SGI A;  1K92 A;  3ABL B;  2DE0 X;  3QO5 A;  3GB7 C;  2Y0I A;  1ROP A;  5J2T A;  4JYC A;  2E74 B;  2QKS A;  2QWP B;  3KCY A;  1QR8 A;  4QPK A;  3E35 A;  2PZS A;  2AHY A;  1TGO A;  2W0X A;  2ZE5 A;  3UT5 A;  4BIO A;  2DQ3 A;  4FFK A;  2YIB A;  2F93 B;  1YXB A;  4F6E A;  4O2B A;  2HP8 A;  2AZ2 A;  4L87 A;  4EFB A;  2ZIO A;  2UU9 B;  1H2K A;  4B3M B;  3L74 H;  4YY3 B;  1OZ0 A;  3ZRV A;  3ZRX A;  1YCI A;  1ZAU A;  1X4T A;  1SES A;  5LHI A;  4PDR A;  3BFR A;  2XT9 A;  1DF5 A;  1Q8I A;  1GKF A;  2WLL B;  2EIJ B;  3TXS A;  3CMA V;  2UUB O;  1W2B U;  1THZ A;  4HYO A;  1NKD A;  2NNU A;  5EC1 C;  4JI2 B;  2Q7E A;  2E5L O;  4J7J A;  2UUA B;  4J7Z A;  1F4M A;  4PDM A;  1VQ6 V;  5J2U A;  4UUJ C;  1AR1 B;  4FLT A;  4DV3 O;  4DV4 O;  2HG5 C;  4GKJ O;  3OUF A;  2W6I G;  4LFA O;  3O9O A;  2RNB A;  2QWQ B;  1XMQ B;  3LDE A;  4MSW C;  3JAS A;  5EYP A;  4QE9 A;  1L0L H;  3K06 A;  5IE9 A;  4X8A A;  5FNV A;  1XHX A;  1M9N A;  4GCZ A;  1FD9 A;  2QE7 G;  2Z3Y A;  2A06 H;  4DR6 B;  3AK2 A;  4H0L B;  3I5D A;  3CXH F;  3OGC C;  4CC6 A;  3CC2 V;  1AI5 A;  4JI4 B;  3AG3 B;  1IBK B;  4DUY B;  4MTX A;  2XND G;  4DV2 B;  3G80 A;  5IWA O;  4O4H A;  5E1A C;  2Z5U A;  4PD4 F;  2ZKO A;  4Q6G A;  3ML0 A;  3AG1 C;  3N2G B;  4O2A B;  4OPH A;  4PA9 A;  1XOU A;  3SPJ A;  4F4L A;  1PM9 A;  4KUM A;  1QLN A;  1P7B A;  3L9D A;  2EUL A;  4PI2 A;  4WBN A;  1HNW O;  1Q43 A;  1W0J G;  3AEI A;  4IGG A;  1N32 O;  2GV9 A;  3O65 A;  4MVM A;  1ZUQ A;  1PNK A;  2ZR3 A;  3IC7 A;  1H8H G;  1WA8 B;  1KP2 A;  4LP8 A;  1VF6 A;  1US6 A;  2EIK C;  5DEC A;  1QR9 A;  3C90 A;  2R72 A;  4JI1 B;  2QWN B;  1EN6 A;  1GTO A;  3CX5 F;  1PL0 A;  3CRM A;  4IHJ B;  1IBL O;  1CEZ A;  1L8D A;  5KUK A;  1XEQ A;  5CA0 A;  5L3D A;  4O4L A;  1HNX O;  3WG7 C;  2FTK A;  4U3J B;  5LXT B;  4K0K O;  3E8F A;  1ZTE A;  2OTJ V;  2M7W A;  4NR1 A;  1NTM H;  4UFZ A;  3T1H B;  2ZNJ A;  3RN4 A;  2A3Q A;  3ZHT A;  4WFG A;  2FML A;  2FB5 A;  2FKX A;  4MVS A;  4IIJ A;  2DJV A;  2ATK C;  1R6T A;  4CH3 A;  1SQG A;  3OR6 C;  3APO A;  5LGN A;  3RGB A;  3TJT A;  2DN9 A;  3RYI B;  2X6C A;  3CRC A;  3CE2 A;  1OCC C;  3OMA B;  3W7S A;  2DYS C;  2L35 A;  2VRZ A;  2DMX A;  2DYR C;  2KG7 B;  4PHZ A;  2QTS A;  1DF4 A;  4W4K A;  1IXB A;  4UVB A;  4QNH B;  2VWJ A;  3KZI Z;  3L75 H;  5C93 A;  3T1C A;  1IVS A;  3BAB A;  3CCR V;  1HDJ A;  3AG4 C;  3A8T A;  1YTF D;  1JVM A;  1TUB A;  4MW3 A;  2BTO A;  5F2V O;  2JEX A;  3CYO A;  3ZX6 A;  1ZWI C;  1JQ0 A;  1FPO A;  4TSF G;  4WFB V;  4I0X A;  3FB5 C;  5LP6 B;  2PUS A;  3ABL C;  1MZF A;  4BW9 A;  3ASO B;  3RW0 A;  2A7W A;  1VF5 B;  3FKS G;  3K9A A;  2PF4 E;  2YDE A;  3G67 A;  1WP7 A;  4OX9 O;  1PV0 A;  1FFT B;  4DV6 B;  1RPR A;  1NR7 A;  4X62 B;  3K57 A;  2PI4 A;  2HKO A;  1B06 A;  5JCO C;  5KHJ A;  4JV5 O;  4X20 B;  1EZV H;  2BOB C;  1CPY A;  1VQN V;  3HKE B;  3HPL C;  1XL6 A;  4TV8 B;  3JD1 A;  1YJ9 V;  1N34 O;  2RCV A;  1P7G A;  5B1N A;  3ASN C;  5JVD A;  2QWR B;  4ZOL A;  3ZHU A;  2YEV A;  1AB3 A;  4EB6 B;  1F51 A;  1KKD A;  3OAA G;  3JCU Z;  3CCJ V;  1IBM B;  3IC9 A;  3EXA A;  2Q67 A;  4QJF B;  2QJ1 A;  3UQ8 A;  3MHH C;  4YIP A;  1K7D A;  4PA7 A;  2QKA A;  3H9V A;  5FLX N;  1FXH A;  3UO2 A;  2Y4U A;  2CGO A;  3ABU A;  3WB1 A;  2ZT9 B;  3SPC A;  2V1D A;  5H6R A;  4DR2 B;  3VQY A;  1TUE B;  1Q86 W;  2UXB O;  5J9P C;  3ZMV A;  1NH2 D;  1K97 A;  1URF A;  4JAV A;  1GK9 A;  2LJ2 A;  1R73 A;  3B4S A;  3CME V;  1H38 A;  1SQF A;  1AR5 A;  4X66 O;  1NT2 B;  1Z2G A;  2WA4 A;  3A0R A;  1AJN A;  1I7F A;  1S5J A;  4YHH B;  2GTS A;  3SYC A;  5LOV B;  3CWB H;  3S3X A;  4JZG A;  1QU7 A;  1SF9 A;  3HKB B;  2LFS A;  2OIG A;  2YXH A;  3N27 A;  3D36 C;  3F5T A;  1JFF A;  1GH6 A;  1V55 C;  1IZ3 A;  1XUQ A;  3LNN A;  3E86 A;  2HVJ C;  3LSQ A;  4YJ2 B;  2F4V O;  3SPH A;  4I55 A;  1GRJ A;  3CRR A;  3SJQ C;  4CS4 A;  4OXS A;  1S5L Z;  4OGQ B;  5L3F A;  4RO2 A;  5KLV H;  1JMK C;  1MNG A;  3CCL V;  3E89 A;  3FB6 C;  4PV1 B;  5L3C A;  4I4T A;  3T1Y B;  4DR7 O;  4YJ3 B;  1WAZ A;  3K3W A;  1EBO A;  2LO1 A;  4GKK O;  2WLN A;  5H5N A;  2WLI B;  1H2M A;  3U11 A;  1G6U A;  2IBZ H;  2N05 A;  1BS3 A;  2CH7 A;  2WPD G;  2IJK A;  1CP9 A;  4FLV A;  4UV8 A;  2VQF O;  3J7A U;  4KL1 A;  4AHC A;  1BHA A;  4WFF A;  4UVA A;  4O2B B;  3AG1 B;  5C8Y A;  4MS2 A;  2CAZ C;  3JAW A;  3QVN A;  4UCO A;  3ZHR A;  3ZMT A;  1D2D A;  1Y74 A;  2HJD A;  2BSK B;  1FJG O;  3NXS A;  3K59 A;  4NTY A;  3CSX A;  4JPR A;  4GYC B;  4NXN B;  4UV9 A;  1GM8 A;  1YIT V;  1ZL8 B;  2LW7 A;  4FFB B;  5B1A C;  3QNE A;  3VOU A;  2P67 A;  3CB2 A;  4JI5 B;  4LF7 O;  1E1R G;  1RSO B;  1YEW A;  2CUG A;  4JI8 B;  2GDS A;  5H2F Z;  3EFF K;  1BL8 A;  3HKC B;  4DV1 O;  3CCE V;  4GUN A;  2UXD B;  1J5E O;  4ASU G;  3R66 A;  1FFX A;  4NYK A;  3WG7 B;  2OWO A;  1I94 B;  2Y69 B;  3I55 V;  2OYQ A;  1Y4M A;  5EYP B;  3ETD A;  3SJA C;  5JWP A;  4X65 O;  3VQV A;  4X1Y B;  1NZ6 A;  1W59 A;  4DW0 A;  3BPZ A;  3AG7 A;  5FNV B;  1B3Q A;  3ABM B;  3RYF A;  1E1Q G;  1AP5 A;  4FK5 C;  3B2E E;  2QWO B;  4JI3 B;  5LP6 C;  2PTM A;  2R9I A;  4FZ1 A;  3ASO C;  3UM7 A;  1OCC B;  1HW7 A;  4B7K A;  1UPG A;  2UUC B;  2DYS B;  3ICX A;  1N4C A;  2IJH A;  2VQE O;  1B04 A;  2OTL V;  1JX9 A;  3U10 A;  1H2L A;  2DYR B;  1QLE C;  3OMI B;  2RDC A;  1Q3E A;  2A79 B;  1Y76 B;  2QEX V;  1LNQ A;  1VQO V;  2AXT Z;  1Y6X A;  4FMT A;  3OM3 B;  2G38 A;  2YI8 A;  1NVP D;  1XNQ B;  3QF7 A;  5CBF A;  5EC2 C;  2YIA A;  2QM4 A;  5JH7 B;  3ABK B;  5LMN B;  1KYO F;  3RYC B;  2XAF A;  3K5M A;  4WBN B;  2XHB A;  4IYI A;  3OFN G;  4DV5 O;  5BR8 O;  1QHT A;  3C3S A;  4ZI7 A;  1EN4 A;  4YY3 O;  2MW2 B;  1E79 G;  1H8E G;  4HNA B;  3E2E A;  4DW1 A;  4DV0 O;  1AP6 A;  5IJ0 A;  4WF9 V;  4X1I A;  2ADQ B;  3AG2 C;  2YIB D;  4BWA A;  5AG2 A;  3FB7 C;  2CTQ A;  4DR1 B;  5KMG B;  2JRI A;  2DWE C;  2EJ7 A;  2LW1 A;  1V54 B;  3ZJZ A;  4JI2 O;  4DV7 O;  3CJH A;  3E8H A;  3ASN B;  4ZBM A;  4HZ3 A;  1SS3 A;  2NLJ C;  4R6Z A;  2HJF C;  2Q73 A;  3E22 A;  3IJ4 A;  1JA8 A;  3FYE B;  4NXM O;  1DTO A;  3BA9 A;  2CE4 A;  4P2Z A;  4ZHQ A;  1BT8 A;  5BZB A;  1XMQ O;  5BXZ A;  1NJI W;  2N04 A;  1R3K C;  5LGU A;  5FPR A;  3ETQ A;  4WCE V;  5KHH A;  1BQ0 A;  4K3A A;  5A9G A;  1WP8 A;  1KC8 W;  1TA8 A;  4H33 A;  2P6J A;  1QNM A;  2GBO A;  2P4K A;  4P9O A;  1OCZ B;  4U7O A;  3FYI B;  1VQP V;  4DR6 O;  1MG1 A;  5KAF Z;  4P9P A;  4X1K A;  2JGD B;  1EM1 A;  1SC5 B;  4X64 B;  3K0D A;  1IBK O;  4DUY O;  5CA1 B;  4DV2 O;  4LWS A;  1YTF B;  2Q6A A;  5IYC O;  1N0J A;  2UUB B;  2YS8 A;  4I50 B;  4LNU A;  2MK3 A;  4MVR A;  1SKV A;  3CCM V;  2RN9 A;  4LH7 A;  4B7E A;  3P30 A;  1FYJ A;  3L73 H;  1RFY A;  1VP7 A;  3JAT A;  4AQY B;  3WB2 A;  1V55 B;  2IH1 C;  4DV3 B;  3JAR A;  4X88 A;  4FIP C;  5KA5 A;  3SYA A;  1SQB H;  1GM9 A;  1YSC A;  1JPX A;  3RYH B;  4JI6 B;  5LYJ B;  2GUZ B;  3BAA A;  1AI4 A;  4B3T O;  1SA0 B;  5KAI Z;  3BRC A;  5JQG B;  1BQZ A;  2JJ2 G;  2E3C A;  4JI1 O;  1XDC A;  4QIW F;  3FAV B;  3U0Z A;  4RAI A;  1TVK B;  4LFB O;  1XNR O;  2JGU A;  4J42 A;  4DR3 B;  4LF6 O;  5LA6 A;  4BR6 A;  1DLB A;  2DWD C;  1EZJ A;  3SJC C;  1R3L C;  2IM9 A;  1YI2 V;  3DXR B;  4NKG B;  3JAL B;  3QTC A;  1KBH A;  1ZLZ A;  2B1I A;  2ZIM A;  4CS3 A;  3CP1 A;  4LCU C;  3Q4H A;  3ZRS A;  3T1H O;  1FXK B;  1EN5 A;  1VF7 A;  2YXL A;  1NQT A;  5IWA B;  4JI0 O;  4UB6 Z;  2HVK C;  3JAK B;  3W7U A;  2P4V A;  1I08 A;  1M4U A;  1TAE A;  1KKC A;  4Z1V A;  1MZE A;  2QA4 V;  2EIN C; 
#chains in the Genus database with same CATH homology
 2XAJ A;  4QJF B;  3MD0 A;  2Y69 C;  4P30 A;  3MHH C;  3IGA C;  4EKW A;  1GMG A;  1K7D A;  1AI6 A;  4JTC B;  4PDV A;  1K73 W;  4PA7 A;  3CD6 V;  1K9M W;  3FB8 C;  1QVF U;  2EIK B;  3OW2 U;  4UXN A;  2XAH A;  1SRY A;  4GX2 A;  5EK0 A;  2WLJ A;  1FXH A;  2B5U A;  5B1A B;  5HFL A;  3W7W A;  4RQE A;  2DW4 A;  3R65 A;  3K0G A;  5B1B B;  5DN6 G;  3ABU A;  3BY6 A;  1ARO P;  3ABM C;  3LSS A;  5CBG A;  3SPC A;  2GSM B;  2V1D A;  1K4C C;  5H6R A;  3P32 A;  3JCZ A;  2GHY A;  2AHZ A;  4GT1 A;  1TUE B;  1Q86 W;  1YJW V;  2WWW A;  5HFM A;  4DXW A;  4XDL A;  5J9P C;  1BMF G;  3ZCC A;  4KP4 A;  2XAG A;  3ZMV A;  2X6B A;  1GO3 F;  1NH2 D;  1K97 A;  4JAV A;  1GK9 A;  2JEU A;  1R73 A;  1S76 D;  1QCE A;  2WSS G;  3CME V;  1PNM A;  5EBL C;  2WAM A;  1H38 A;  3TET A;  3RVY A;  4X89 A;  4LBE C;  3A0R A;  1P4R A;  4BAY A;  1AJN A;  2P7T C;  4GX1 A;  1OCO C;  4MW8 A;  1XL4 A;  1AJQ A;  4GX0 A;  3T2M A;  3SYC A;  3RBZ A;  3CPW U;  2QTO A;  2UXN A;  2LFS A;  4RUE A;  1IXM A;  3B77 A;  1UJW B;  4E2L A;  1VQ9 V;  4WFH A;  1SET A;  2EIL C;  2EZP A;  4FJC C;  3DGE A;  4PA3 A;  2K1E A;  1V55 C;  2LP7 A;  3E86 A;  2HVJ C;  3LSQ A;  3W7X A;  5H6Q A;  3B8N A;  4UVC A;  2Q68 A;  3ABK C;  1FS0 G;  3SPH A;  4FPP A;  2R9R B;  2HR3 A;  3SJQ C;  5CA3 A;  3CCQ V;  4OXS A;  1KD1 W;  4MVZ A;  3JD3 A;  2P90 A;  5B3S B;  2QM8 A;  5B1O A;  5L3F A;  3E8B A;  4PEL A;  3LNM B;  4RO2 A;  3CC7 V;  3X2Q C;  4JTD B;  3ZN0 A;  3CCL V;  3E89 A;  4CZZ A;  2JK5 C;  4WFA V;  3FB6 C;  2ITC C;  5L3C A;  4TT3 G;  4RUF A;  3OEH G;  3W7T A;  1YJN V;  1B6Q A;  1M56 B;  1WLE A;  4MVU A;  3K3W A;  1VQM V;  1YHQ V;  4G2K A;  2A9H A;  5IYB O;  1Q82 W;  1QLE B;  2OCC C;  1S0V A;  1EBO A;  2UXX A;  1NR1 A;  3ZRW B;  5L3G A;  2WLN A;  1JJ2 U;  4J9Z B;  5LBQ A;  2WLI B;  3AG4 B;  3QO8 A;  3STL C;  3SYO A;  1F4N A;  3SYQ A;  5L3E A;  5KUM A;  1COW G;  2CK3 G;  1RM1 B;  1EFR G;  1S3J A;  3K08 A;  3TCU A;  1AJP A;  2ZXW C;  2WPD G;  2JDI G;  2IJK A;  1CP9 A;  1K92 A;  3ABL B;  3QO5 A;  2YEV B;  1K3E A;  1V54 C;  3D36 A;  3GB7 C;  4PA4 A;  4UV8 A;  1ROP A;  1FXV A;  1GM7 A;  4JYC A;  5EBM C;  3TK1 A;  3ZRW A;  4BIU A;  4WFF A;  1BHA A;  1M57 B;  3F5W C;  3CCS V;  4UVA A;  2QKS A;  4XDJ A;  5IY5 B;  4ZKI A;  3I56 V;  3AG1 B;  1QR8 A;  2B1G A;  4QPK A;  1K33 A;  4MS2 A;  3E35 A;  1OCR B;  1SZT A;  3ZMT A;  2AHY A;  3G6E V;  3F7V C;  4R7C A;  1Q81 W;  3HB3 B;  2DQ3 A;  3NXS A;  1SER A;  3G4S V;  4R8C A;  2WLK A;  4JPR A;  4L87 A;  3AG2 B;  4UV9 A;  1GM8 A;  1YIT V;  2PI5 A;  1HWY A;  4N23 A;  1OZ0 A;  3ZRV A;  4G27 B;  5B1A C;  2D3O W;  3QNE A;  3VOU A;  4I9W A;  3ZRX A;  2P67 A;  1E1R G;  5KA6 A;  2V7Q G;  5FL7 G;  1SES A;  4YXW G;  1VQ7 V;  5LHI A;  1QBZ A;  1NH2 B;  1OCZ C;  4PDR A;  3IFX A;  1S5H C;  1BL8 A;  3EFF K;  1DF5 A;  2JJ1 G;  1GKF A;  2WLL B;  2IW5 A;  2EIJ B;  3CCE V;  3WFV A;  3CMA V;  3EHB B;  4N21 A;  1W2B U;  1THZ A;  3LDD A;  4HYO A;  4ASU G;  5DM6 V;  1NKD A;  3D3I A;  2NNU A;  3BEH A;  5EC1 C;  3WG7 B;  3H01 A;  3ZIA G;  2Y69 B;  3I55 V;  1F4M A;  1R6N A;  4PDM A;  3RVZ A;  1Y4M A;  3QO7 A;  1VQ6 V;  2WLL A;  3F7Y C;  4GX5 A;  1Q7Y W;  3M99 B;  2JIZ G;  4UUJ C;  3ETD A;  1ENV A;  5L3B A;  1AR1 B;  2HG5 C;  2IH3 C;  4I5S A;  3OUF A;  2W6I G;  4Q20 A;  4MVO A;  3ABM B;  1PD3 A;  3LDE A;  1E1Q G;  1K5Q A;  4PA6 A;  1RPO A;  4TWK A;  4JYB A;  4MSW C;  2XOK G;  4QE9 A;  4FK5 C;  4U7N A;  2IJJ A;  2KB1 A;  1MSW D;  3K06 A;  2R9I A;  4X8A A;  4JAS A;  3ASO C;  1M9N A;  4GCZ A;  3UM7 A;  2QE7 G;  1OCC B;  2Z3Y A;  3CCU V;  1NVP B;  2DYS B;  2IJH A;  2W6J G;  3CCV V;  1OCO B;  2OTL V;  1JX9 A;  1PKX A;  2WLM A;  2DYR B;  4JTA B;  1QLE C;  1JOY A;  3OGC C;  3OMI B;  3JD2 A;  1W0K G;  2A79 B;  2ZQM A;  4MTF A;  2QEX V;  3E8G A;  1LNQ A;  3CC2 V;  3CXC U;  1AI5 A;  1VQO V;  1K8A W;  2EIM B;  4FMT A;  3OM3 B;  1NVP D;  4BIZ A;  1AI7 A;  1RM1 C;  5CBF A;  3AG3 B;  5EC2 C;  4MTX A;  2XND G;  3UKM A;  3ABK B;  5CMU A;  1WPX A;  3K79 A;  5IDJ A;  3STZ C;  2XAF A;  1M57 C;  2X7R B;  1S77 D;  1I5Y A;  2EZO A;  5E1A C;  2Z5U A;  5IY5 C;  2H8P C;  3X2Q B;  3ML0 A;  3AG1 C;  3OE7 G;  3OFN G;  1PNL A;  4PA9 A;  3SPJ A;  3JYC A;  3ETG A;  1J95 A;  4F4L A;  1FXK C;  2IJI A;  4DO2 A;  4KUM A;  1QLN A;  1MOF A;  1P7B A;  2H94 A;  1E79 G;  1H8E G;  3JD4 A;  4KFM A;  3E2E A;  5CBH A;  1W0J G;  3AEI A;  4WF9 V;  2QM7 A;  2Q69 A;  4HAM A;  3AG2 C;  4MVM A;  1PNK A;  1I5X A;  3FB7 C;  2ZXW B;  3MHS C;  4BW5 A;  3G71 V;  4G28 B;  2YSU B;  4XBF A;  2DWE C;  2ZR3 A;  3IC7 A;  1H8H G;  1KP2 A;  1V54 B;  2BOC C;  4LP8 A;  4MVQ A;  2EIK C;  3ZJZ A;  1MAB G;  2C2A A;  1QR9 A;  5B1B C;  5LHH A;  1GTO A;  2WLH A;  3VBB A;  3E8H A;  1G4Y B;  3ASN B;  4HZ3 A;  4ZBM A;  2NLJ C;  4R6Z A;  1PL0 A;  4MT8 A;  2EIJ C;  2HJF C;  3PJS K;  1CEZ A;  1KQS U;  5KUK A;  1H2G A;  3FYE B;  1DTO A;  4P2Z A;  2ZDI C;  5L3D A;  1VQ5 V;  3JD0 A;  5BZB A;  4RQF A;  3WG7 C;  1FXK A;  1NJI W;  2FTK A;  1R3K C;  3E8F A;  3OR7 C;  5LGU A;  4XDK A;  2OTJ V;  2M7W A;  4WCE V;  2XAQ A;  4QPJ A;  1YIJ V;  2EIN B;  1ORQ C;  2W0F C;  4WFG A;  4CBC A;  1KC8 W;  1VQ8 V;  1M90 W;  1R6K A;  2X6A A;  1JCH A;  4H33 A;  4MVS A;  2P6J A;  3ZMU A;  4P9O A;  1OCZ B;  4U7O A;  2ATK C;  3T4Z A;  2DQ0 A;  3FYI B;  1VQP V;  2HFE C;  1MG1 A;  2HLD G;  3OR6 C;  3ZN1 A;  4P9P A;  5LGN A;  5LGT A;  1OHH G;  5GW7 A;  2X6C A;  1OCC C;  2LFR A;  3OMA B;  3W7S A;  3K0D A;  5B3S C;  3KG2 A;  2DYS C;  1K4D C;  3K03 A;  1YTF B;  2DYR C;  2XAS A;  2EBO A;  2Q6A A;  1DF4 A;  2ZDI A;  1N8R W;  2ITD C;  5IYC O;  4QE7 A;  1M56 C;  2IU0 A;  1VQK V;  2MK3 A;  4UVB A;  3ETE A;  4QNH B;  4MVR A;  2EIM C;  3CCM V;  1G8M A;  5C93 A;  5LHG A;  3CC4 V;  3T1C A;  1K5S A;  2ZD9 A;  3AG3 C;  4MTO A;  3CCR V;  3P30 A;  3AG4 C;  1YTF D;  4R50 A;  1JVM A;  4MW3 A;  1BHB A;  2EIL B;  1M1K W;  2JEX A;  3CYO A;  5EBW C;  4PDL A;  1QVG U;  1ZWI C;  1V55 B;  1JQ0 A;  2IH1 C;  3K04 A;  4TSF G;  4WFB V;  2IU3 A;  3FB5 C;  3ZMS A;  1Y66 A;  3OMN B;  3ABL C;  4X88 A;  5IYD O;  3ASO B;  3RW0 A;  4FIP C;  5KA5 A;  3SYA A;  3FKS G;  4J9Y B;  1R3J C;  3K9A A;  1GM9 A;  1L1F A;  1YSC A;  1JPX A;  4H37 A;  1AI4 A;  4JGS A;  3ZMZ A;  1OCR C;  1FFT B;  1RPR A;  1NR7 A;  2JJ2 G;  3ABT A;  2PI4 A;  2HKO A;  4QIW F;  2OCC B;  1KP3 A;  4RAI A;  2OT5 A;  1VQL V;  5H9C A;  2BOB C;  4WFE A;  5CN0 A;  1CPY A;  2Y48 A;  3LDC A;  1DLB A;  2DWD C;  1K34 A;  1EZJ A;  1VQN V;  1R3L C;  4LC1 A;  3HPL C;  1XL6 A;  1YI2 V;  1NBM G;  2WLI A;  2X0L A;  1KEC A;  3JD1 A;  1YJ9 V;  3SPG A;  2B1I A;  4MTG A;  3CP1 A;  5B1N A;  3B8M A;  3T4D A;  3OUS A;  1F23 A;  3ASN C;  3GWO A;  2ZR2 A;  4LCU C;  3ZRS A;  3LUT B;  1FXK B;  1S72 V;  1VQ4 V;  4JAU A;  2YEV A;  3DTU B;  2F43 G;  3SYP A;  1F51 A;  4Z1M G;  1NQT A;  3E83 A;  1KKD A;  1R3I C;  2HVK C;  3OAA G;  2A0L A;  3W7U A;  3CCJ V;  3OEE G;  3SPI A;  2EJR A;  4JF3 A;  2Q67 A;  2QA4 V;  2EIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...