5DM6V

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELARKGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5dm6V00
4WFBV 1KQSU 1W2BU 3OW2U 1YITV 1Q82W 1VQPV 1YIJV 3CD6V 1KC8W 1K9MW 3CCRV 1VQNV 1VQOV 1VQ5V 3CC4V 4WCEV 3I56V 1K73W 4WF9V 3CCJV 1YJWV 1M1KW 1KD1W 1YJ9V 1YHQV 1Q86W 1VQ4V 1VQ8V 1QVFU 3CCUV 1VQLV 1N8RW 3CXCU 1VQ6V 3CCEV 2QEXV 1M90W 3CCQV 5DM6V 1K8AW 3CCSV 2OTJV 3I55V 1VQMV 1NJIW 3G71V 3CCMV 1QVGU 3CC7V 1VQ9V 1S72V 2OTLV 1VQ7V 1Q7YW 4WFAV 1YJNV 3CCLV 2D3OW 2QA4V 1YI2V 1Q81W 3G4SV 3G6EV 3CCVV 3CC2V 3CMEV 1R73A 1JJ2U 3CPWU 3CMAV 1VQKV
chains in the Genus database with same CATH superfamily
3D3IA 1WP7A 5IJ0A 1N34B 1P4RA 3VQYA 5GTIZ 2F4VB 2JK5C 1QCEA 2GDSA 2ILMA 4G28B 5JVDB 2IJHA 2BSKA 3CHXA 3SYOA 5CBHA 4BIZA 2C2AA 1AILA 2D2CB 4R8CA 4LFBB 1RSOA 2RDCA 1WAZA 2ZNIA 3QVNA 3VOUA 3ZEDA 1THZA 2HHHO 1B3QA 2UUCO 1AROP 1XOUA 1ZTEA 2JS5A 2QM7A 3B2EE 2W0FC 2DMXA 2QTOA 1VQMV 2EX3A 4DW1A 5IYCO 1M5IA 3ETEA 3TXQA 2YDEA 3WG7C 1Y66A 1NU1H 3CPWU 1KP3A 3EHBB 2HR3A 5L3DA 4QE7A 4LF9O 1ORQC 3EXAA 2CTQA 3ZHQA 2QWOB 3FD9A 3HKCA 4I9WA 3JATA 4LFCO 2WWWA 1TVKA 3CCMV 3P3NA 4DW0A 1Q3EA 4DRXB 3ZN0A 1G1XB 3DC5A 2YSUB 5IWAO 2V4DA 4B3MB 3IAYA 2R72A 4O2BA 4PDRA 2ZINA 3JD1A 5BR8B 4TQDA 2VWJA 3LSUA 4IT5A 4QE9A 4JI6O 5JH7B 2RQ6A 2ZR2A 1RM1C 4O4JA 2UUAB 1WPXA 4EB6B 2OCCB 3PN1A 4MVOA 2ZM6B 5HFMA 4J41A 3JD2A 3CJHA 1N4CA 4FPPA 3BPZA 4J7KA 3FKSG 4MW3A 4MVQA 4WF9V 4DR1B 2CH7B 1XDCA 1SQQH 1WP8A 3J80N 3DXRB 3SYQA 3ZBHA 1M90W 5DM6V 1IXBA 4DR4B 1OCOB 2AHYA 3DTUB 3OUFA 1QVGU 3D3QA 1XI1A 2R9AA 5KAFZ 5CBGA 3CSXA 4ZI7B 4PDLA 1QR9A 2EIKB 5JVDA 1HNZO 1OCRC 2ZE6A 4E4EA 1AP5A 1B6QA 1HNXB 4JYBA 3U11A 2K1EA 4L8JA 2LW7A 1IBMB 1XL4A 3AK3A 1E1RG 3OR7C 1L8DA 1JCHA 4DV1B 4TWKA 2JIZG 1S0VA 4PELA 5H5NA 4DR3B 1NR7A 4F4LA 1N0JA 2QM8A 4LNUB 2XAFA 4DV7O 4DR6O 4X8AA 5EZYB 4I5SA 4BR6A 3MHSC 3SPHA 4QIWF 3ZRXA 3JSNA 2ODMA 4JGSA 4UVCA 2F95B 1RFYA 1RP3B 2WLLB 2PYJA 1KBHA 1M4UA 3HR0A 1VQKV 1JFFB 3L74H 4PDMA 3ABKC 1K9MW 3G6BA 1R6KA 4DR7B 4DRXA 2FL4A 5KA5A 1Q86W 1V55B 3JALB 2Q8VA 2E75B 5JH7A 1GO3F 1I0HA 4JI5B 3OAAG 3SDLA 3ZHVA 4EB6A 3G6EV 3AG4C 1AR4A 4BW9A 4FLWA 4BIOA 3WU2Z 4GX2A 2WLJA 4LF4B 2X7RB 1WN7A 4JYAB 1YJ9V 3RYHB 3ZHSA 3IFXA 5EBWC 1AI4A 4KHPO 2CH7A 3BFRA 4FLXA 3DXRA 5JCOA 2YICA 3RGBA 3T1HO 1TUEB 4MW8A 1DK1A 2D3OW 1K4DC 3ABLC 3K57A 4PI0A 1IDSA 2A0LA 3STZC 4WFBV 1QHTA 1QQCA 1X59A 2LFSA 2DQ3A 4JI7B 5B1AB 4ZI7A 4TV8B 2XUMA 3OMIB 4X1KB 1GTOA 4Z1MG 1R1BA 3CCQV 4WFEA 3D8CA 4B3TO 1AJPA 3E8BA 4B7EA 2IM9A 1WA8B 4EEQA 1NH2D 2HHHB 5J2UB 2UUCB 3CEIA 4JTAB 3D36C 1DLBA 1P84F 1OCCB 2LGWA 1AR5A 2UXNA 1NH2B 3ABMC 1K73W 1BHAA 4O4HB 1XHZA 1UJWB 4RUFA 3K79A 1YSCA 1EN6A 3BEHA 2N04A 2K9PA 4JI0O 3AG1B 5A2QN 4LNUA 5EZYA 2CK3G 3LNMB 4WFGA 3GWOA 1VF7A 4PHZA 2HVJC 2YXLA 2JGUA 4LFCB 4X64O 2RJZA 4QPJA 2WLLA 5IT9N 5LYJB 1R3LC 1IBKO 3R65A 3ZMZA 1JFFA 1W0JG 2P4KA 1VQ4V 4LBEC 1VQ6V 5IJ9B 1Z5WA 5IWAB 3JALA 3CC7V 1JMKC 1YXBA 2B1GA 4JI6B 2IBZH 5CBFA 2JEXA 3E83A 3QO8A 4FLZA 2EULA 4PJ0Z 1Q7YW 2UXCO 4B08A 2W0XA 5LGUA 1XL6A 2Q67A 5BMVB 3CYOA 1KU9A 2KG7B 3BA8A 1BE3H 4CH4A 2OIGA 1BT8A 1FKAO 4WBNB 1GN6A 4LWSB 4K3AA 4QNHB 1M9NA 2WSSG 3H1IH 3SJBC 3RYHA 4RWUA 1L0LH 1AP6A 1BQ0A 3THOA 2Q5ZA 4U7NA 3ZMSA 1RPOA 5LMUO 5LBQA 3WG7B 3ZIAG 2WLIB 3SYPA 5GW7A 2JVDA 1O9HA 1Q6HA 4K0KO 4TV8A 1YF2A 5IYZB 4X1KA 4MTGA 1CEZA 1FJGB 4I0XB 4JAVA 2VQEO 1RPRA 3E8HA 3ZHTA 2QDOA 1WA8A 4RAIA 5J2UA 5BY1A 2G38A 5DECA 3B8MA 2DYSC 5JQGB 1QNMA 4X62B 1KD1W 4GUNA 4J7ZA 2XT9A 4TQFA 1NKDA 2XOKG 4O4HA 2L35A 5FLXN 1NJIW 2Z3YA 1HR0O 2FB5A 3WB1A 4JTCB 4DR6B 4GKKO 1R3IC 1FAFA 4X1IB 3K3WA 3K9SA 1YTFB 3RVYA 4R6ZA 4UCUA 3IC9A 5LYJA 1VQLV 2LJ2A 3UO3A 1G6UA 3CX5F 5FL7G 1K8AW 5C8YB 4IHJB 4W4KA 2CUGA 5IJ9A 1HP8A 4XDLA 1FFTB 3ETQA 2PTMA 3KCXA 3JARB 1VF6C 4IYHA 4LF6O 1SERA 2HJDA 2XNDG 5EK0A 1OCRB 3CXHF 2WAMA 2ZIMA 5BMVA 4DUYO 2KG7A 3LSSA 4MS2A 3A0HZ 4LF8O 4WBNA 4LWSA 2WA3A 2VQFO 1H2GA 4KP4A 3S3XA 4KHPB 4PA4A 3RYFB 3TGUH 2PYLA 4UVAA 2YXHA 3T1HB 1B06A 2IU3A 3B4SA 4H44B 3KG2A 2WLIA 1AI5A 2QEXV 4WFFA 1DF4A 1QU7A 5GONB 3K5MA 2OTJV 1BQZA 3RWRD 5IYZA 1M93A 4R7CA 1N32O 2X6CA 4FM0A 4I0XA 4YXWG 1EZJA 4B3TB 2V7QG 1CPYA 1EN5A 1QVFU 2ATKC 4CS3A 5JQGA 1R3KC 2BOBC 3CWBH 3K5LA 1Q43A 3OTOO 2W6IG 1SQPH 1GH6A 2DJVA 4OX9B 4JI0B 4FZ1A 1AB3A 5B1AC 3AG4B 3APOA 2ITDC 5B5EZ 1IZ3A 4X1IA 3JASB 5DN6G 5JJEB 3H1KH 4YHHB 4GX5A 4JI8O 2ZCEA 3JAWB 3L9DA 5E1AC 5KHIA 2IJIA 1SF9A 1IBKB 3EFFK 1KMIZ 5C8YA 4IHJA 4B3RO 1S5LZ 3ABLB 3AK1A 2X6AA 1KC8W 1US6A 3JARA 5EBMC 2EJRA 1YJWV 5LL6Y 1GN4A 1R3JC 4FZ0A 3LNNA 2E5LO 1XHXA 4H0LB 5H2FZ 4LR3A 2Y0IA 2CAZC 3CRAA 1KKCA 3LDEA 1I94O 3BHPA 2ADPA 4HAMA 1SZXA 2WLNA 1IX9A 1BGYH 4UVBA 3G67A 3SJCC 4JAAA 1H2KA 2Q7HA 5B3SC 1M1KW 3RYFA 5DEDA 5KAIZ 4GCZA 3W7XA 3ABMB 5LMUB 2CDYA 4UV9A 3GVMA 3CRQA 3TJTA 1SESA 1JPXA 3L72H 2WPDG 3RT3C 4K0KB 4UFZA 5GONA 1TUBB 1HW7A 3QF7A 2YC0A 2Q68A 5LA6B 4FJCC 4GZRB 3VQXA 4UB6Z 2DWEC 1SQBH 4TV9B 4ASUG 1N33O 2PGGA 3KZIZ 1XQ8A 5LMNB 3ETDA 4MTFA 5CMUA 2UXDB 3SPGA 4PA6A 1PNKA 2HFEC 4G2KA 4UUJC 2ZE5A 1GKFA 1HR0B 4DYLA 1UPGA 2YUAA 3ASNC 3ZS8C 3CC4V 1Y76B 2IJKA 4GKKB 3JASA 3M7MX 3SPJA 1ZL8B 2HLDG 4YJ2B 4JZ2A 3W7UA 3G71V 4YJ3B 3E22B 3JAWA 1I7FA 4LF7B 1YVWA 3OW2U 2JS3A 1XMQO 1YIJV 1Q6UA 2GHYA 4A5UB 2P22C 4EFBA 3ZHUA 2UXXA 3FB7C 2V1DA 3ZN1A 1TAEA 4LF6B 1OZ0A 1GMGA 3DGEA 1P7BA 2H3OA 2PF4E 2BCCH 1M56C 4NXMO 3G4SV 2WLHA 1H8HG 1Z5VA 1IURA 2VQFB 4AILC 2DYSB 2OCHA 3ASOC 4H37A 4I7ZB 3D36A 4HNAB 3SJQC 4U3JB 1NVPD 4JV5O 2OYQA 4IGGA 1W59A 2HVKC 5BZBA 3CP1A 3FFQA 4FM2A 3A2FA 5LHIA 3K9AA 1S76D 1TUBA 1QLEC 1R6TA 1KUQA 1NVPB 5LGTA 2F43G 1ZWIC 2W6JG 2PI5A 2WA4A 1N32B 4D6TH 1URFA 4FK5C 2P6JA 2UXBO 2E76B 3C90A 5LA6A 2M6YA 3UKMA 1MNGA 4J10A 4JI2B 4X9QA 5LXTB 1SKVA 4HYOA 1K92A 5IYDO 4TV9A 5HFLA 1BZKA 1SZTA 4YY3B 1YEWA 2PZSA 4F6RB 2CGNA 4I9QA 3H1LH 3SPCA 1F4MA 4PD4F 3C3SA 1U96A 4KXRA 4O2AB 5BXZA 4CH5A 3FB8C 1G8MA 1Y76A 3BY6A 2MW2B 3ICXA 1VIBA 1ZL8A 4JI8B 1XEQA 4X66O 4YJ2A 2B5UA 4YJ3A 5FPRA 3E22A 2PUSA 1W0KG 2WLKA 2YIBD 3JAMN 4NTWA 2XAJA 2VS0A 4B3RB 1N36O 4FLVA 3AEIA 4J42A 1NTMH 3N2GB 4E2LA 2GBOA 4XDJA 4BIUA 1HNWO 2E5LB 2Z5UA 1Y67A 2QKSA 4QPKA 1COWG 1H2LA 1I94B 2P90A 4GX0A 4EFEA 4MVUA 4FLYA 2NNUA 1ZSPA 3ZRWB 4HNAA 2A06H 1M57C 3S3WA 5LHHA 4U3JA 3H1JH 1Y6XA 4N23A 3RYIB 1WB7A 2XAHA 3Q4HB 2ZDIA 3I56V 2YI8A 2Y69C 1JX9A 4DUZO 3B09A 3T4ZA 5CB4B 3K59A 4Q20A 3SR2C 1JA8A 2Q7EA 1H2NA 1WJZA 1T5EA 3OD4A 2JDIG 1IBLO 5LXTA 3OEHG 2Y48A 2PY5A 5CA0B 5KUMA 4Z1VA 4LF5O 1N33B 3K08A 1S5JA 2QWQB 2E3CA 1H8EG 3BCCH 1F23A 4F6RA 1VF6A 3JD3A 1K97A 4ICGA 1FXKC 1X4TA 1LUWA 4O2AA 4LF9B 2BTQB 1GM9A 4GKJO 2B9ZA 2Q0OC 2F23A 3K04A 3VBBA 2IU0A 1AVMA 5LOVB 5B3SB 3RW0A 1XMQB 3LDCA 4N21A 3SJAC 4JZGA 3QO7A 2PI4A 4I50B 1L0NH 3CCVV 3N2GA 3OFNG 1H38A 1YITV 2HKOA 2ZQMA 2DOSA 4UXNA 5B1OA 3OMAB 1DTOA 2GTAA 5IE9A 1K5QA 4AI8A 4UCTA 1AJQA 1FXHA 1LNQA 4ZBMA 4H13B 2HG5C 2F1MA 1F51A 4FLTA 3ZRWA 1OHHG 4JI4O 3N2KB 2QTSA 4JV5B 3O65A 3HB3B 2XTAA 1Q90D 4GX1A 3RYIA 3P3PA 2VWKA 1YHQV 1VQ8V 3ASNB 3Q4HA 3ZMTA 4CC6A 3BAAA 2M7WA 1K3EA 1HNZB 3IJ4A 2CTWA 1XBLA 5CB4A 1Z2GA 2UXBB 3RYCB 1YZBA 2F4VO 2EILC 1MMMA 1AJNA 5CA0A 3F5WC 3HKEB 1Q6IA 4PI2A 3SGIA 1BMFG 1MSDA 3TXSA 4GLXA 3RBZA 4LC1A 3A0RA 2JJ1G 3RVZA 5ITZB 2ZDIC 4DV7B 3F5TA 1PPJH 2BTQA 4NVPA 1M56B 1JOYA 2EIJC 1MOFA 3CCRV 2ZXWC 2ZE8A 3X2QC 4NKGB 3PJSK 5A9GA 4X66B 3ABUA 2Y4UA 3A8TA 3ASOB 1LR1A 3A0BZ 3HKDB 3IGAC 5IY5C 5LOVA 2IW5A 5LP6C 1SQFA 1N36B 3OTFA 4I50A 4GT1A 4U3FH 2UU9O 3JSLA 4OXSA 3U10A 3TETA 2Q0AA 2H94A 1HNWB 1QLEB 4J9YB 4NXNO 4Z2WA 5IDJA 2Q7GA 3JYCA 2EIMC 5BR8O 3CCLV 4FIPC 3QNEA 4QGPA 4D7SA 1D5AA 1F4NA 5KHHA 1XNQO 2NLJC 4CH6A 2HJFC 4JASA 2ZM6O 3N2KA 3MAQA 3P32A 2NN4A 2KB1A 2XAQA 3VQVA 3K5NA 2L6LA 4JI3O 5KHGA 4DUZB 1S72V 4KL1A 1H2MA 3UQ8A 1R73A 4TT3G 3RYCA 4DV4O 4D7TA 1Q8IA 4DV5O 3BABA 4JTDB 3ETGA 4DK0A 1JR9A 3SPIA 1IBLB 2QR4A 3ZCCA 4LF5B 1SETA 1ZX3A 5H9CA 3HKEA 1V9PA 3HKBB 5LGNA 2ARHA 4MVRA 4XBFA 1MZEA 4OPHA 4DXWA 3J7AU 2QA4V 1SQGA 2JEUA 3EVKA 1W2BU 1SRYA 5KX5B 4L87A 5D5QA 4DV3O 5ITZA 1ZLZA 3ZHRA 4NYKA 1ENVA 2OT5A 2AW9A 3G80A 3SYAA 4DV0O 4GKJB 3U0ZA 2B1IA 3H1HH 1V54C 4X64B 3ZX6A 2X6BA 2FTKA 4DR3O 3AG3C 1J95A 5FNVB 3WFVA 4HZ3A 3HKDA 1M57B 5KMGB 4NTYA 1NI8A 2Q4PA 4NTXA 1BL8A 3CE2A 1PNMA 1EZVH 5TISZ 2UXCB 2HP8A 1WB8A 1EN4A 1K34A 3AG2C 3WB2A 4I55B 2Y69B 4CBCA 4LP8A 2GUZB 3FB5C 2DE0X 2LO1A 1XUQA 1FXVA 5CN0A 5B1BB 4O4LB 2DYRC 4JAUA 3CMAV 1VARA 4KUMA 3T2MA 5KA6A 5EIBC 3C3TA 2Q69A 5CA3A 5J2TB 1U97A 3ZRSA 3OUSA 1DF5A 4CZZA 5EC1C 2XHBA 1WLEA 3QTCA 1SQXH 1FXKB 4I4TB 4LFAO 4P30A 1I08A 2RNBA 2OTLV 3ZRVA 4LH6A 4BAYA 1GM7A 3BA9A 3R66A 3CRRA 5E79Z 4TOIA 1CP9A 2KSDA 2P06A 3M99B 3W7WA 5K1XA 1Q5OA 1H2SB 4YIPA 2VQEB 3H01A 4JF3A 4JI1O 4R50A 2GTSA 4JI7O 5K1PA 4WFAV 2QJ1A 1NR1A 2JJ2G 3JD0A 1KECA 3HKBA 2F66C 3K0GA 5KHJA 4TUYB 4P2ZA 3CB2A 1GK9A 1VQPV 2YEVB 1BSMA 3E8FA 3CCJV 5KX5A 4YIOA 3K03A 4X65O 4OPAA 3K0DA 1SA0B 3I55V 4FFKA 2ZR3A 5LHGA 1GRJA 4JYCA 4FVMA 4FLUA 1JJ2U 1A32A 2BE3A 3AG7A 3E89A 5FNVA 5H6RA 1FPOA 4K8XA 3ZJZA 2QWPB 1N0NA 5KMGA 3RFRA 4XDKA 2LP7A 1OJHA 3E2EA 2FMLA 2P7TC 2RMKB 5L3FA 2UU9B 4LCUC 4B7KA 1BHBA 1PL0A 3BRCA 3T4DA 1EBOA 4I55A 4DUYB 4NXNB 2HEPA 1VQ5V 2GUZA 3L75H 4IYIA 5JJJB 4LF8B 4O4LA 2ETNA 2DW4A 1OCZC 2EILB 1ROPA 1XNQB 2YI9A 5J2TA 2RN9A 3DSQA 1FXKA 2QM4A 4I4TA 1SC5B 1PV0A 1KQSU 3T1YO 3FB6C 4BW5A 4JI3B 3LSQA 1CXZB 3TCUA 2EIJB 2N74A 2ZXWB 4HBNA 3OGCC 3X2QB 3CRCA 2ZE7A 3LUTB 2LGQA 2P5OA 4DV4B 4MTXA 4DV5B 3B8NA 4ZOLB 2OWOA 5IY5B 1YI2V 4G27B 5LP6B 1E79G 3L70H 1VEWA 5B66Z 2LFRA 4DR2O 3OTOB 1AI7A 1NZ6A 1FJGO 1AR1B 4TUYA 4X20B 2N05A 2YEVA 5FPOA 4DV3B 2P67A 3ZMVA 2EINC 1XNRO 1Y4MA 3K06A 4P9OA 4DV0B 1EM1A 2ZT9B 2A3QA 2QWNB 4X62O 2GSMB 1SA0A 2XAGA 1YJNV 1NBMG 2EIMB 1ZUQA 3L71H 4DV2O 2EBOA 2R9RB 1I5YA 3FAVB 1O9GA 3LDDA 2IH1C 4ZKIA 2X0LA 3T1CA 1QLNA 1WPBA 4IIJB 1NTKH 2Z0AA 2OIEA 1K33A 2Y0PA 5EBLC 2QKCA 1Q82W 4J9ZB 4RQFA 1Y74B 2CTRA 4PA7A 2BTOA 2R9IA 3W7SA 4AQYO 3F7YC 3OT7A 3TK1A 4JPRA 2MK3A 4DR5O 2KQXA 2AHZA 1KP2A 4PV1B 1HDJA 1S3JA 3UCSC 1MG1A 1D5NA 4O4IB 3MD0A 4DK1A 4LFAB 4C7UA 1GN2A 1XMOO 3CRMA 2FYUH 3H9VA 3W7TA 2EJ7A 4GYCB 1VMGA 2XASA 4TSFG 1V54B 4AHCA 3AK2A 1KYOF 4K35A 2QGNA 5B1BC 4MSWC 5CA1B 4JI1B 3AG3B 2CGOA 4ZOLA 3JAKB 1R6NA 2UUBO 2A79B 5LP6A 2QWRB 4IL6Z 1FFXB 1N8RW 3JD4A 1S77D 5JWPA 3K58A 4DV6O 3AG2B 4CS2A 3OEEG 2BOCC 4X20A 3MDSA 3NXSA 3QG5A 2CTPA 5EIBD 2KKWA 4ZHQB 4X65B 1G4YB 3RN4A 4MVZA 2ZNJA 2DYRB 3CD6V 4CC5A 4WCEV 5EYPB 3I5DA 4UB8Z 3FAVA 1JVMA 4BWAA 4OX9O 1F7YA 2JRIA 5AG2A 2IJJA 1NTZH 5H6QA 1FYJA 2Q9LA 1PM9A 4IIJA 4PA3A 1HWYA 1VQ7V 3QO5A 4J11A 2FKXA 5KUKA 3CMEV 1WNSA 4YHHO 3CS5A 2YIBA 3KCYA 1VQNV 1VQOV 3APQA 1KB9F 4NXMB 3CCUV 3CXCU 1Y74A 4FM1A 3CCSV 4FMTA 4RQEA 4ZIBA 3OGIB 3E8GA 3FYIB 4MTOA 4MVSA 1IVSA 1K5SA 3L73H 4B3SO 1PL4A 1J5EO 4O4IA 2QKAA 2ZKOA 2GV9A 2YIAA 2JGDB 4NB5A 3T1YB 1FS0G 1XILA 2AXTZ 1N34O 5KLVH 4K8ZA 4CH3A 2WLMA 2NR5A 5CA1A 2Y4TA 1VP7A 3STLC 1SS3A 3JAKA 2EZPA 2LW1A 4X1YB 4PA9A 1E1QG 2E74B 2OCCC 4DR2B 1FFXA 5J9PC 1D2DA 4LFBO 2DN9A 5L3GA 1NQTA 1VQ9V 1YCIA 5C93A 3CC2V 1P7GA 4ZHQA 1XNRB 3NR7A 5JCOC 2EZOA 5LMNO 1UFIA 1OCOC 5L3CA 3M8AA 4DV2B 1OCZB 2UXDO 5EYPA 1YTFD 3DC6A 1RM1B 3ML0A 1MABG 4ABMA 2AZ2A 1QR8A 5F2VO 3IC7A 3UT5B 2EIKC 4CS4A 4H33A 1BS3A 3MHHC 4P9PA 2DWDC 3SYCA 5L3BA 1XREA 3O9OA 2R70A 4LF7O 1MZFA 4NR1A 1L1FA 4RO2A 4DO2A 5JJNB 5D5PA 4B3MO 4X89A 4UCSA 3ABTA 4AQYB 3HPLC 1JJOA 4DR5B 3KKYA 2UUAO 1PD3A 1OV9A 1SQVH 3CCEV 2ZD9A 4UCRA 3FX7A 1BCCH 2ZIOA 2AGAA 4FFBB 4QJFB 1XMOB 3FYEB 2JGDA 2A7WA 1TA8A 2H8PC 2LQTA 5IJ0B 2EINB 1NS1A 4DR1O 1Q81W 1PP9H 2P4VA 3UM7A 1JQ0A 1IXMA 1P49A 1GAXA 1QBZA 4DR4O 2RCVA 1V55C 1K4CC 1PKXA 3E35A 3K5OA 2QE7G 1S5HC 2Q73A 2UUBB 2CE4A 1MA1A 2BSKB 4J7JA 3WB0A 4X1YA 4PDVA 3VQWA 2Q6AA 1TGOA 1HNXO 3GB7C 1RSOB 4DV6B 3OM3B 1ZAUA 2IH3C 1IBMO 1GN3A 3UO2A 4JI2O 4LH7A 3ABKB 3OE7G 2AZ0A 4DV1O 1I5XA 4U7OA 4W4LA 1GM8A 4UV8A 4J80A 4YY3O 5KHKA 2A9HA 3JCUZ 2QSAA 1AI6A 1MSWD 5IYBO 2YXYA 3B77A 4JYYA 3N27A 3UT5A 3HKCB 4F6EA 2ADQB 4MT8A 1K7DA 1FD9A 1YDXA 3E86A 4UCVA 3JATB 4Q6GA 1B04A 4KFMA 3BVOA 4UCOA 1TVKB 2O57A 2ITCC 4RUEA 4WFHA 5GTHZ 1DGSA 4OGQB 4DR7O 1VF5B 3OMNB 2F93B 4O2BB 2VRZA 1OCCC 3ZMUA 2YIDA 2YS8A 3P30A 3GWKC 3B40A 4MVMA 4O4JB 5B1NA 4JI5O 1LUVA 4X88A 5EC2C 3AG1C 5L3EA 2DQ0A 4EKWA 4JI4B 1PNLA 4B3SB 1J5EB 1KKDA 3OR6C 1NT2B 3J81N 3JCZA 3CJHB 3F7VC 4LF4O 1EFRG 4FFBA 4JYAO
chains in the Genus database with same CATH topology
3D3IA 2LFRA 1SERA 1AI7A 2XNDG 1P4RA 5EK0A 1AR1B 1OCRB 3K04A 2WAMA 3VBBA 2IU0A 3LSSA 4MS2A 2YEVA 2JK5C 5B3SB 1QCEA 3RW0A 3LDCA 2P67A 4N21A 3ZMVA 2EINC 3QO7A 1Y4MA 3K06A 4P9OA 2PI4A 4G28B 1H2GA 1YJNV 2IJHA 2GSMB 2XAGA 4KP4A 1NBMG 3SYOA 2EIMB 5CBHA 4BIZA 2C2AA 3CCVV 3OFNG 2EBOA 2R9RB 1I5YA 4R8CA 1H38A 1YITV 4PA4A 2HKOA 3LDDA 2ZQMA 4UXNA 4UVAA 5B1OA 3VOUA 2IH1C 3OMAB 1THZA 2IU3A 4ZKIA 1DTOA 3KG2A 2WLIA 2X0LA 3T1CA 1AROP 1QLNA 1AI5A 2QEXV 1K5QA 2QM7A 4WFFA 1DF4A 2W0FC 1AJQA 1FXHA 2OTJV 1LNQA 2QTOA 4ZBMA 1VQMV 5IYCO 2HG5C 3ETEA 1K33A 4R7CA 2X6CA 5EBLC 1F51A 3WG7C 1Y66A 4YXWG 3CPWU 1EZJA 1KP3A 3ZRWA 1OHHG 2V7QG 3EHBB 1Q82W 2HR3A 4J9ZB 3HB3B 5L3DA 4QE7A 4RQFA 1ORQC 1CPYA 4GX1A 1QVFU 4PA7A 1YHQV 2ATKC 1VQ8V 3ASNB 4I9WA 2R9IA 3ZMTA 1R3KC 3W7SA 2M7WA 2BOBC 3F7YC 1K3EA 3TK1A 4JPRA 2MK3A 2AHZA 1KP2A 2W6IG 2WWWA 1S3JA 3CCMV 1MG1A 3ZN0A 5B1AC 3AG4B 2YSUB 3MD0A 2EILC 2ITDC 4PDRA 1AJNA 3JD1A 3W7TA 4QE9A 5DN6G 3F5WC 1BMFG 2XASA 4GX5A 2ZR2A 1RM1C 4TSFG 3RBZA 1WPXA 4LC1A 5E1AC 1V54B 2IJIA 2OCCB 3A0RA 4MVOA 3EFFK 5B1BC 2JJ1G 4MSWC 3RVZA 5HFMA 2ZDIC 3AG3B 3JD2A 1M56B 3ABLB 2X6AA 4FPPA 1R6NA 1KC8W 1JOYA 2EIJC 1MOFA 2A79B 3FKSG 4MW3A 3CCRV 2ZXWC 4MVQA 5EBMC 2EJRA 3X2QC 4WF9V 1YJWV 3PJSK 1R3JC 3SYQA 3ABUA 1N8RW 3JD4A 1S77D 1M90W 5DM6V 3AG2B 3ASOB 1OCOB 2BOCC 3OEEG 2AHYA 3IGAC 3DTUB 3NXSA 5IY5C 3OUFA 1QVGU 2IW5A 3LDEA 5CBGA 1G4YB 4PDLA 1QR9A 2EIKB 4HAMA 4MVZA 4GT1A 1OCRC 2DYRB 2WLNA 4OXSA 3CD6V 1B6QA 3TETA 4WCEV 4JYBA 4UVBA 2H94A 2K1EA 1JVMA 1QLEB 4J9YB 5B3SC 1M1KW 4GCZA 3W7XA 3ABMB 4UV9A 2IJJA 5H6QA 1XL4A 5IDJA 1SESA 3JYCA 1JPXA 2EIMC 1E1RG 2WPDG 4PA3A 1HWYA 3OR7C 1VQ7V 3QO5A 1JCHA 3CCLV 4FIPC 3QNEA 4TWKA 5KUKA 3CMEV 2JIZG 1F4NA 2NLJC 1S0VA 4PELA 1VQNV 2HJFC 2Q68A 4JASA 1VQOV 1NR7A 4F4LA 2QM8A 4FJCC 2XAFA 3CCUV 3CXCU 3P32A 4X8AA 4I5SA 3MHSC 2KB1A 2XAQA 2DWEC 4QIWF 3SPHA 3CCSV 3ZRXA 4FMTA 4JGSA 4RQEA 4UVCA 4ASUG 3E8GA 1S72V 3FYIB 4MTOA 2WLLB 3ETDA 4MVSA 4MTFA 1R73A 5CMUA 1VQKV 1K5SA 3SPGA 4PA6A 4PDMA 4TT3G 1PNKA 2HFEC 3ABKC 4G2KA 4UUJC 1GKFA 1K9MW 1R6KA 3ASNC 3CC4V 2IJKA 4JTDB 3ETGA 3SPIA 5KA5A 1Q86W 1V55B 3ZCCA 1SETA 1FS0G 5H9CA 3SPJA 1GO3F 2HLDG 5LGNA 3W7UA 3G71V 3OAAG 4MVRA 4XBFA 4DXWA 2QA4V 2WLMA 3G6EV 3AG4C 2JEUA 1W2BU 1SRYA 3OW2U 4L87A 1YIJV 2GHYA 4GX2A 2WLJA 3STLC 1ENVA 2OT5A 3SYAA 2X7RB 1YJ9V 2EZPA 2UXXA 3FB7C 2B1IA 3IFXA 5EBWC 4PA9A 2V1DA 1V54C 1E1QG 1AI4A 3ZN1A 2OCCC 1OZ0A 5J9PC 2X6BA 2FTKA 1GMGA 3DGEA 1P7BA 5L3GA 1NQTA 3AG3C 1VQ9V 1J95A 1TUEB 4MW8A 3WFVA 2D3OW 4HZ3A 1M56C 1K4DC 3ABLC 3G4SV 5C93A 3CC2V 1M57B 2WLHA 2A0LA 3STZC 4WFBV 1H8HG 2LFSA 2DQ3A 5B1AB 1BL8A 1PNMA 3OMIB 2DYSB 2EZOA 3AG2C 1K34A 3ASOC 4H37A 1OCOC 1GTOA 5L3CA 4Z1MG 2Y69B 1OCZB 4CBCA 3D36A 3CCQV 4LP8A 4WFEA 3SJQC 1YTFD 1AJPA 3E8BA 1RM1B 3ML0A 1NVPD 1MABG 1QR8A 1NH2D 3FB5C 3IC7A 2HVKC 5BZBA 1FXVA 5CN0A 2EIKC 3CP1A 5B1BB 4H33A 4JTAB 2DYRC 4JAUA 3CMAV 4KUMA 5KA6A 3T2MA 3MHHC 4P9PA 5LHIA 1DLBA 2DWDC 3K9AA 3SYCA 5L3BA 1S76D 1QLEC 1NVPB 5LGTA 2Q69A 1OCCB 2F43G 1ZWIC 2W6JG 5CA3A 1NH2B 2UXNA 1K73W 3ABMC 2PI5A 1BHAA 4FK5C 4RUFA 2P6JA 1DF5A 3K79A 3OUSA 3ZRSA 1YSCA 1UJWB 3BEHA 4CZZA 5EC1C 3UKMA 1L1FA 1WLEA 3AG1B 4RO2A 4DO2A 4HYOA 1FXKB 1K92A 4P30A 2CK3G 3LNMB 4WFGA 4X89A 3ZRVA 5IYDO 3GWOA 2OTLV 2HVJC 3ABTA 4BAYA 1GM7A 5HFLA 3HPLC 1SZTA 4QPJA 1CP9A 2WLLA 3M99B 3W7WA 1R3LC 3SPCA 1F4MA 3R65A 1W0JG 3ZMZA 3H01A 1PD3A 1VQ4V 4JF3A 4LBEC 1VQ6V 3CCEV 2ZD9A 4R50A 3FB8C 1G8MA 3BY6A 4QJFB 3FYEB 3CC7V 2H8PC 2B1GA 5CBFA 1Q7YW 4WFAV 2EINB 2JEXA 3E83A 3QO8A 1Q81W 1NR1A 2JJ2G 3JD0A 1KECA 3UM7A 1JQ0A 1IXMA 3K0GA 2B5UA 5LGUA 1XL6A 1QBZA 2Q67A 4P2ZA 3CYOA 1VQPV 1GK9A 1W0KG 1V55C 2WLKA 2YEVB 1K4CC 1PKXA 3E35A 3E8FA 3CCJV 2XAJA 3K03A 2QE7G 1S5HC 4QNHB 1M9NA 2WSSG 3AEIA 3K0DA 3I55V 2ZR3A 4PDVA 5LHGA 2Q6AA 4E2LA 3GB7C 4JYCA 4XDJA 4U7NA 4BIUA 3ZMSA 1RPOA 3OM3B 2Z5UA 1JJ2U 2IH3C 3E89A 5LBQA 2QKSA 4QPKA 5H6RA 2WLIB 3WG7B 1COWG 3ZIAG 3SYPA 3ZJZA 3ABKB 5GW7A 4XDKA 2LP7A 3OE7G 3E2EA 2P90A 2P7TC 4GX0A 5L3FA 1I5XA 4U7OA 4UV8A 1GM8A 4LCUC 1BHBA 1PL0A 4MVUA 3T4DA 2A9HA 4MTGA 1CEZA 2NNUA 1EBOA 4JAVA 3ZRWB 1AI6A 1RPRA 1MSWD 1M57C 5IYBO 5LHHA 3E8HA 3B77A 4N23A 1VQ5V 2XAHA 4RAIA 3B8MA 1K7DA 2DYSC 4MT8A 3E86A 2ZDIA 3I56V 2DW4A 2Y69C 1OCZC 1JX9A 2EILB 1KD1W 1ROPA 4KFMA 3T4ZA 1NKDA 2XOKG 2ITCC 4RUEA 4Q20A 4WFHA 1NJIW 2Z3YA 4JTCB 2JDIG 3OEHG 3OMNB 1FXKA 1R3IC 2Y48A 3K3WA 1KQSU 1OCCC 5KUMA 3ZMUA 1YTFB 3FB6C 4BW5A 3K08A 3LSQA 3P30A 3RVYA 4R6ZA 3TCUA 5B1NA 4MVMA 1H8EG 2EIJB 2ZXWB 1VQLV 4X88A 1F23A 3AG1C 3OGCC 5EC2C 5L3EA 3JD3A 3X2QB 5FL7G 1K97A 2DQ0A 1FXKC 3LUTB 4EKWA 1K8AW 1PNLA 1KKDA 3OR6C 4MTXA 4XDLA 3B8NA 3JCZA 1FFTB 1GM9A 3F7VC 5IY5B 1YI2V 1EFRG 4G27B 1E79G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WFB V;  1KQS U;  1W2B U;  3OW2 U;  1YIT V;  1Q82 W;  1VQP V;  1YIJ V;  3CD6 V;  1KC8 W;  1K9M W;  3CCR V;  1VQN V;  1VQO V;  1VQ5 V;  3CC4 V;  4WCE V;  3I56 V;  1K73 W;  4WF9 V;  3CCJ V;  1YJW V;  1M1K W;  1KD1 W;  1YJ9 V;  1YHQ V;  1Q86 W;  1VQ4 V;  1VQ8 V;  1QVF U;  3CCU V;  1VQL V;  1N8R W;  3CXC U;  1VQ6 V;  3CCE V;  2QEX V;  1M90 W;  3CCQ V;  5DM6 V;  1K8A W;  3CCS V;  2OTJ V;  3I55 V;  1VQM V;  1NJI W;  3G71 V;  3CCM V;  1QVG U;  3CC7 V;  1VQ9 V;  1S72 V;  2OTL V;  1VQ7 V;  1Q7Y W;  4WFA V;  1YJN V;  3CCL V;  2D3O W;  2QA4 V;  1YI2 V;  1Q81 W;  3G4S V;  3G6E V;  3CCV V;  3CC2 V;  3CME V;  1R73 A;  1JJ2 U;  3CPW U;  3CMA V;  1VQK V; 
#chains in the Genus database with same CATH topology
 3D3I A;  1WP7 A;  5IJ0 A;  1N34 B;  1P4R A;  3VQY A;  5GTI Z;  2F4V B;  2JK5 C;  1QCE A;  2GDS A;  2ILM A;  4G28 B;  5JVD B;  2IJH A;  2BSK A;  3CHX A;  3SYO A;  5CBH A;  4BIZ A;  2C2A A;  1AIL A;  2D2C B;  4R8C A;  4LFB B;  1RSO A;  2RDC A;  1WAZ A;  2ZNI A;  3QVN A;  3VOU A;  3ZED A;  1THZ A;  2HHH O;  1B3Q A;  2UUC O;  1ARO P;  1XOU A;  1ZTE A;  2JS5 A;  2QM7 A;  3B2E E;  2W0F C;  2DMX A;  2QTO A;  1VQM V;  2EX3 A;  4DW1 A;  5IYC O;  1M5I A;  3ETE A;  3TXQ A;  2YDE A;  3WG7 C;  1Y66 A;  1NU1 H;  3CPW U;  1KP3 A;  3EHB B;  2HR3 A;  5L3D A;  4QE7 A;  4LF9 O;  1ORQ C;  3EXA A;  2CTQ A;  3ZHQ A;  2QWO B;  3FD9 A;  3HKC A;  4I9W A;  3JAT A;  4LFC O;  2WWW A;  1TVK A;  3CCM V;  3P3N A;  4DW0 A;  1Q3E A;  4DRX B;  3ZN0 A;  1G1X B;  3DC5 A;  2YSU B;  5IWA O;  2V4D A;  4B3M B;  3IAY A;  2R72 A;  4O2B A;  4PDR A;  2ZIN A;  3JD1 A;  5BR8 B;  4TQD A;  2VWJ A;  3LSU A;  4IT5 A;  4QE9 A;  4JI6 O;  5JH7 B;  2RQ6 A;  2ZR2 A;  1RM1 C;  4O4J A;  2UUA B;  1WPX A;  4EB6 B;  2OCC B;  3PN1 A;  4MVO A;  2ZM6 B;  5HFM A;  4J41 A;  3JD2 A;  3CJH A;  1N4C A;  4FPP A;  3BPZ A;  4J7K A;  3FKS G;  4MW3 A;  4MVQ A;  4WF9 V;  4DR1 B;  2CH7 B;  1XDC A;  1SQQ H;  1WP8 A;  3J80 N;  3DXR B;  3SYQ A;  3ZBH A;  1M90 W;  5DM6 V;  1IXB A;  4DR4 B;  1OCO B;  2AHY A;  3DTU B;  3OUF A;  1QVG U;  3D3Q A;  1XI1 A;  2R9A A;  5KAF Z;  5CBG A;  3CSX A;  4ZI7 B;  4PDL A;  1QR9 A;  2EIK B;  5JVD A;  1HNZ O;  1OCR C;  2ZE6 A;  4E4E A;  1AP5 A;  1B6Q A;  1HNX B;  4JYB A;  3U11 A;  2K1E A;  4L8J A;  2LW7 A;  1IBM B;  1XL4 A;  3AK3 A;  1E1R G;  3OR7 C;  1L8D A;  1JCH A;  4DV1 B;  4TWK A;  2JIZ G;  1S0V A;  4PEL A;  5H5N A;  4DR3 B;  1NR7 A;  4F4L A;  1N0J A;  2QM8 A;  4LNU B;  2XAF A;  4DV7 O;  4DR6 O;  4X8A A;  5EZY B;  4I5S A;  4BR6 A;  3MHS C;  3SPH A;  4QIW F;  3ZRX A;  3JSN A;  2ODM A;  4JGS A;  4UVC A;  2F95 B;  1RFY A;  1RP3 B;  2WLL B;  2PYJ A;  1KBH A;  1M4U A;  3HR0 A;  1VQK V;  1JFF B;  3L74 H;  4PDM A;  3ABK C;  1K9M W;  3G6B A;  1R6K A;  4DR7 B;  4DRX A;  2FL4 A;  5KA5 A;  1Q86 W;  1V55 B;  3JAL B;  2Q8V A;  2E75 B;  5JH7 A;  1GO3 F;  1I0H A;  4JI5 B;  3OAA G;  3SDL A;  3ZHV A;  4EB6 A;  3G6E V;  3AG4 C;  1AR4 A;  4BW9 A;  4FLW A;  4BIO A;  3WU2 Z;  4GX2 A;  2WLJ A;  4LF4 B;  2X7R B;  1WN7 A;  4JYA B;  1YJ9 V;  3RYH B;  3ZHS A;  3IFX A;  5EBW C;  1AI4 A;  4KHP O;  2CH7 A;  3BFR A;  4FLX A;  3DXR A;  5JCO A;  2YIC A;  3RGB A;  3T1H O;  1TUE B;  4MW8 A;  1DK1 A;  2D3O W;  1K4D C;  3ABL C;  3K57 A;  4PI0 A;  1IDS A;  2A0L A;  3STZ C;  4WFB V;  1QHT A;  1QQC A;  1X59 A;  2LFS A;  2DQ3 A;  4JI7 B;  5B1A B;  4ZI7 A;  4TV8 B;  2XUM A;  3OMI B;  4X1K B;  1GTO A;  4Z1M G;  1R1B A;  3CCQ V;  4WFE A;  3D8C A;  4B3T O;  1AJP A;  3E8B A;  4B7E A;  2IM9 A;  1WA8 B;  4EEQ A;  1NH2 D;  2HHH B;  5J2U B;  2UUC B;  3CEI A;  4JTA B;  3D36 C;  1DLB A;  1P84 F;  1OCC B;  2LGW A;  1AR5 A;  2UXN A;  1NH2 B;  3ABM C;  1K73 W;  1BHA A;  4O4H B;  1XHZ A;  1UJW B;  4RUF A;  3K79 A;  1YSC A;  1EN6 A;  3BEH A;  2N04 A;  2K9P A;  4JI0 O;  3AG1 B;  5A2Q N;  4LNU A;  5EZY A;  2CK3 G;  3LNM B;  4WFG A;  3GWO A;  1VF7 A;  4PHZ A;  2HVJ C;  2YXL A;  2JGU A;  4LFC B;  4X64 O;  2RJZ A;  4QPJ A;  2WLL A;  5IT9 N;  5LYJ B;  1R3L C;  1IBK O;  3R65 A;  3ZMZ A;  1JFF A;  1W0J G;  2P4K A;  1VQ4 V;  4LBE C;  1VQ6 V;  5IJ9 B;  1Z5W A;  5IWA B;  3JAL A;  3CC7 V;  1JMK C;  1YXB A;  2B1G A;  4JI6 B;  2IBZ H;  5CBF A;  2JEX A;  3E83 A;  3QO8 A;  4FLZ A;  2EUL A;  4PJ0 Z;  1Q7Y W;  2UXC O;  4B08 A;  2W0X A;  5LGU A;  1XL6 A;  2Q67 A;  5BMV B;  3CYO A;  1KU9 A;  2KG7 B;  3BA8 A;  1BE3 H;  4CH4 A;  2OIG A;  1BT8 A;  1FKA O;  4WBN B;  1GN6 A;  4LWS B;  4K3A A;  4QNH B;  1M9N A;  2WSS G;  3H1I H;  3SJB C;  3RYH A;  4RWU A;  1L0L H;  1AP6 A;  1BQ0 A;  3THO A;  2Q5Z A;  4U7N A;  3ZMS A;  1RPO A;  5LMU O;  5LBQ A;  3WG7 B;  3ZIA G;  2WLI B;  3SYP A;  5GW7 A;  2JVD A;  1O9H A;  1Q6H A;  4K0K O;  4TV8 A;  1YF2 A;  5IYZ B;  4X1K A;  4MTG A;  1CEZ A;  1FJG B;  4I0X B;  4JAV A;  2VQE O;  1RPR A;  3E8H A;  3ZHT A;  2QDO A;  1WA8 A;  4RAI A;  5J2U A;  5BY1 A;  2G38 A;  5DEC A;  3B8M A;  2DYS C;  5JQG B;  1QNM A;  4X62 B;  1KD1 W;  4GUN A;  4J7Z A;  2XT9 A;  4TQF A;  1NKD A;  2XOK G;  4O4H A;  2L35 A;  5FLX N;  1NJI W;  2Z3Y A;  1HR0 O;  2FB5 A;  3WB1 A;  4JTC B;  4DR6 B;  4GKK O;  1R3I C;  1FAF A;  4X1I B;  3K3W A;  3K9S A;  1YTF B;  3RVY A;  4R6Z A;  4UCU A;  3IC9 A;  5LYJ A;  1VQL V;  2LJ2 A;  3UO3 A;  1G6U A;  3CX5 F;  5FL7 G;  1K8A W;  5C8Y B;  4IHJ B;  4W4K A;  2CUG A;  5IJ9 A;  1HP8 A;  4XDL A;  1FFT B;  3ETQ A;  2PTM A;  3KCX A;  3JAR B;  1VF6 C;  4IYH A;  4LF6 O;  1SER A;  2HJD A;  2XND G;  5EK0 A;  1OCR B;  3CXH F;  2WAM A;  2ZIM A;  5BMV A;  4DUY O;  2KG7 A;  3LSS A;  4MS2 A;  3A0H Z;  4LF8 O;  4WBN A;  4LWS A;  2WA3 A;  2VQF O;  1H2G A;  4KP4 A;  3S3X A;  4KHP B;  4PA4 A;  3RYF B;  3TGU H;  2PYL A;  4UVA A;  2YXH A;  3T1H B;  1B06 A;  2IU3 A;  3B4S A;  4H44 B;  3KG2 A;  2WLI A;  1AI5 A;  2QEX V;  4WFF A;  1DF4 A;  1QU7 A;  5GON B;  3K5M A;  2OTJ V;  1BQZ A;  3RWR D;  5IYZ A;  1M93 A;  4R7C A;  1N32 O;  2X6C A;  4FM0 A;  4I0X A;  4YXW G;  1EZJ A;  4B3T B;  2V7Q G;  1CPY A;  1EN5 A;  1QVF U;  2ATK C;  4CS3 A;  5JQG A;  1R3K C;  2BOB C;  3CWB H;  3K5L A;  1Q43 A;  3OTO O;  2W6I G;  1SQP H;  1GH6 A;  2DJV A;  4OX9 B;  4JI0 B;  4FZ1 A;  1AB3 A;  5B1A C;  3AG4 B;  3APO A;  2ITD C;  5B5E Z;  1IZ3 A;  4X1I A;  3JAS B;  5DN6 G;  5JJE B;  3H1K H;  4YHH B;  4GX5 A;  4JI8 O;  2ZCE A;  3JAW B;  3L9D A;  5E1A C;  5KHI A;  2IJI A;  1SF9 A;  1IBK B;  3EFF K;  1KMI Z;  5C8Y A;  4IHJ A;  4B3R O;  1S5L Z;  3ABL B;  3AK1 A;  2X6A A;  1KC8 W;  1US6 A;  3JAR A;  5EBM C;  2EJR A;  1YJW V;  5LL6 Y;  1GN4 A;  1R3J C;  4FZ0 A;  3LNN A;  2E5L O;  1XHX A;  4H0L B;  5H2F Z;  4LR3 A;  2Y0I A;  2CAZ C;  3CRA A;  1KKC A;  3LDE A;  1I94 O;  3BHP A;  2ADP A;  4HAM A;  1SZX A;  2WLN A;  1IX9 A;  1BGY H;  4UVB A;  3G67 A;  3SJC C;  4JAA A;  1H2K A;  2Q7H A;  5B3S C;  1M1K W;  3RYF A;  5DED A;  5KAI Z;  4GCZ A;  3W7X A;  3ABM B;  5LMU B;  2CDY A;  4UV9 A;  3GVM A;  3CRQ A;  3TJT A;  1SES A;  1JPX A;  3L72 H;  2WPD G;  3RT3 C;  4K0K B;  4UFZ A;  5GON A;  1TUB B;  1HW7 A;  3QF7 A;  2YC0 A;  2Q68 A;  5LA6 B;  4FJC C;  4GZR B;  3VQX A;  4UB6 Z;  2DWE C;  1SQB H;  4TV9 B;  4ASU G;  1N33 O;  2PGG A;  3KZI Z;  1XQ8 A;  5LMN B;  3ETD A;  4MTF A;  5CMU A;  2UXD B;  3SPG A;  4PA6 A;  1PNK A;  2HFE C;  4G2K A;  4UUJ C;  2ZE5 A;  1GKF A;  1HR0 B;  4DYL A;  1UPG A;  2YUA A;  3ASN C;  3ZS8 C;  3CC4 V;  1Y76 B;  2IJK A;  4GKK B;  3JAS A;  3M7M X;  3SPJ A;  1ZL8 B;  2HLD G;  4YJ2 B;  4JZ2 A;  3W7U A;  3G71 V;  4YJ3 B;  3E22 B;  3JAW A;  1I7F A;  4LF7 B;  1YVW A;  3OW2 U;  2JS3 A;  1XMQ O;  1YIJ V;  1Q6U A;  2GHY A;  4A5U B;  2P22 C;  4EFB A;  3ZHU A;  2UXX A;  3FB7 C;  2V1D A;  3ZN1 A;  1TAE A;  4LF6 B;  1OZ0 A;  1GMG A;  3DGE A;  1P7B A;  2H3O A;  2PF4 E;  2BCC H;  1M56 C;  4NXM O;  3G4S V;  2WLH A;  1H8H G;  1Z5V A;  1IUR A;  2VQF B;  4AIL C;  2DYS B;  2OCH A;  3ASO C;  4H37 A;  4I7Z B;  3D36 A;  4HNA B;  3SJQ C;  4U3J B;  1NVP D;  4JV5 O;  2OYQ A;  4IGG A;  1W59 A;  2HVK C;  5BZB A;  3CP1 A;  3FFQ A;  4FM2 A;  3A2F A;  5LHI A;  3K9A A;  1S76 D;  1TUB A;  1QLE C;  1R6T A;  1KUQ A;  1NVP B;  5LGT A;  2F43 G;  1ZWI C;  2W6J G;  2PI5 A;  2WA4 A;  1N32 B;  4D6T H;  1URF A;  4FK5 C;  2P6J A;  2UXB O;  2E76 B;  3C90 A;  5LA6 A;  2M6Y A;  3UKM A;  1MNG A;  4J10 A;  4JI2 B;  4X9Q A;  5LXT B;  1SKV A;  4HYO A;  1K92 A;  5IYD O;  4TV9 A;  5HFL A;  1BZK A;  1SZT A;  4YY3 B;  1YEW A;  2PZS A;  4F6R B;  2CGN A;  4I9Q A;  3H1L H;  3SPC A;  1F4M A;  4PD4 F;  3C3S A;  1U96 A;  4KXR A;  4O2A B;  5BXZ A;  4CH5 A;  3FB8 C;  1G8M A;  1Y76 A;  3BY6 A;  2MW2 B;  3ICX A;  1VIB A;  1ZL8 A;  4JI8 B;  1XEQ A;  4X66 O;  4YJ2 A;  2B5U A;  4YJ3 A;  5FPR A;  3E22 A;  2PUS A;  1W0K G;  2WLK A;  2YIB D;  3JAM N;  4NTW A;  2XAJ A;  2VS0 A;  4B3R B;  1N36 O;  4FLV A;  3AEI A;  4J42 A;  1NTM H;  3N2G B;  4E2L A;  2GBO A;  4XDJ A;  4BIU A;  1HNW O;  2E5L B;  2Z5U A;  1Y67 A;  2QKS A;  4QPK A;  1COW G;  1H2L A;  1I94 B;  2P90 A;  4GX0 A;  4EFE A;  4MVU A;  4FLY A;  2NNU A;  1ZSP A;  3ZRW B;  4HNA A;  2A06 H;  1M57 C;  3S3W A;  5LHH A;  4U3J A;  3H1J H;  1Y6X A;  4N23 A;  3RYI B;  1WB7 A;  2XAH A;  3Q4H B;  2ZDI A;  3I56 V;  2YI8 A;  2Y69 C;  1JX9 A;  4DUZ O;  3B09 A;  3T4Z A;  5CB4 B;  3K59 A;  4Q20 A;  3SR2 C;  1JA8 A;  2Q7E A;  1H2N A;  1WJZ A;  1T5E A;  3OD4 A;  2JDI G;  1IBL O;  5LXT A;  3OEH G;  2Y48 A;  2PY5 A;  5CA0 B;  5KUM A;  4Z1V A;  4LF5 O;  1N33 B;  3K08 A;  1S5J A;  2QWQ B;  2E3C A;  1H8E G;  3BCC H;  1F23 A;  4F6R A;  1VF6 A;  3JD3 A;  1K97 A;  4ICG A;  1FXK C;  1X4T A;  1LUW A;  4O2A A;  4LF9 B;  2BTQ B;  1GM9 A;  4GKJ O;  2B9Z A;  2Q0O C;  2F23 A;  3K04 A;  3VBB A;  2IU0 A;  1AVM A;  5LOV B;  5B3S B;  3RW0 A;  1XMQ B;  3LDC A;  4N21 A;  3SJA C;  4JZG A;  3QO7 A;  2PI4 A;  4I50 B;  1L0N H;  3CCV V;  3N2G A;  3OFN G;  1H38 A;  1YIT V;  2HKO A;  2ZQM A;  2DOS A;  4UXN A;  5B1O A;  3OMA B;  1DTO A;  2GTA A;  5IE9 A;  1K5Q A;  4AI8 A;  4UCT A;  1AJQ A;  1FXH A;  1LNQ A;  4ZBM A;  4H13 B;  2HG5 C;  2F1M A;  1F51 A;  4FLT A;  3ZRW A;  1OHH G;  4JI4 O;  3N2K B;  2QTS A;  4JV5 B;  3O65 A;  3HB3 B;  2XTA A;  1Q90 D;  4GX1 A;  3RYI A;  3P3P A;  2VWK A;  1YHQ V;  1VQ8 V;  3ASN B;  3Q4H A;  3ZMT A;  4CC6 A;  3BAA A;  2M7W A;  1K3E A;  1HNZ B;  3IJ4 A;  2CTW A;  1XBL A;  5CB4 A;  1Z2G A;  2UXB B;  3RYC B;  1YZB A;  2F4V O;  2EIL C;  1MMM A;  1AJN A;  5CA0 A;  3F5W C;  3HKE B;  1Q6I A;  4PI2 A;  3SGI A;  1BMF G;  1MSD A;  3TXS A;  4GLX A;  3RBZ A;  4LC1 A;  3A0R A;  2JJ1 G;  3RVZ A;  5ITZ B;  2ZDI C;  4DV7 B;  3F5T A;  1PPJ H;  2BTQ A;  4NVP A;  1M56 B;  1JOY A;  2EIJ C;  1MOF A;  3CCR V;  2ZXW C;  2ZE8 A;  3X2Q C;  4NKG B;  3PJS K;  5A9G A;  4X66 B;  3ABU A;  2Y4U A;  3A8T A;  3ASO B;  1LR1 A;  3A0B Z;  3HKD B;  3IGA C;  5IY5 C;  5LOV A;  2IW5 A;  5LP6 C;  1SQF A;  1N36 B;  3OTF A;  4I50 A;  4GT1 A;  4U3F H;  2UU9 O;  3JSL A;  4OXS A;  3U10 A;  3TET A;  2Q0A A;  2H94 A;  1HNW B;  1QLE B;  4J9Y B;  4NXN O;  4Z2W A;  5IDJ A;  2Q7G A;  3JYC A;  2EIM C;  5BR8 O;  3CCL V;  4FIP C;  3QNE A;  4QGP A;  4D7S A;  1D5A A;  1F4N A;  5KHH A;  1XNQ O;  2NLJ C;  4CH6 A;  2HJF C;  4JAS A;  2ZM6 O;  3N2K A;  3MAQ A;  3P32 A;  2NN4 A;  2KB1 A;  2XAQ A;  3VQV A;  3K5N A;  2L6L A;  4JI3 O;  5KHG A;  4DUZ B;  1S72 V;  4KL1 A;  1H2M A;  3UQ8 A;  1R73 A;  4TT3 G;  3RYC A;  4DV4 O;  4D7T A;  1Q8I A;  4DV5 O;  3BAB A;  4JTD B;  3ETG A;  4DK0 A;  1JR9 A;  3SPI A;  1IBL B;  2QR4 A;  3ZCC A;  4LF5 B;  1SET A;  1ZX3 A;  5H9C A;  3HKE A;  1V9P A;  3HKB B;  5LGN A;  2ARH A;  4MVR A;  4XBF A;  1MZE A;  4OPH A;  4DXW A;  3J7A U;  2QA4 V;  1SQG A;  2JEU A;  3EVK A;  1W2B U;  1SRY A;  5KX5 B;  4L87 A;  5D5Q A;  4DV3 O;  5ITZ A;  1ZLZ A;  3ZHR A;  4NYK A;  1ENV A;  2OT5 A;  2AW9 A;  3G80 A;  3SYA A;  4DV0 O;  4GKJ B;  3U0Z A;  2B1I A;  3H1H H;  1V54 C;  4X64 B;  3ZX6 A;  2X6B A;  2FTK A;  4DR3 O;  3AG3 C;  1J95 A;  5FNV B;  3WFV A;  4HZ3 A;  3HKD A;  1M57 B;  5KMG B;  4NTY A;  1NI8 A;  2Q4P A;  4NTX A;  1BL8 A;  3CE2 A;  1PNM A;  1EZV H;  5TIS Z;  2UXC B;  2HP8 A;  1WB8 A;  1EN4 A;  1K34 A;  3AG2 C;  3WB2 A;  4I55 B;  2Y69 B;  4CBC A;  4LP8 A;  2GUZ B;  3FB5 C;  2DE0 X;  2LO1 A;  1XUQ A;  1FXV A;  5CN0 A;  5B1B B;  4O4L B;  2DYR C;  4JAU A;  3CMA V;  1VAR A;  4KUM A;  3T2M A;  5KA6 A;  5EIB C;  3C3T A;  2Q69 A;  5CA3 A;  5J2T B;  1U97 A;  3ZRS A;  3OUS A;  1DF5 A;  4CZZ A;  5EC1 C;  2XHB A;  1WLE A;  3QTC A;  1SQX H;  1FXK B;  4I4T B;  4LFA O;  4P30 A;  1I08 A;  2RNB A;  2OTL V;  3ZRV A;  4LH6 A;  4BAY A;  1GM7 A;  3BA9 A;  3R66 A;  3CRR A;  5E79 Z;  4TOI A;  1CP9 A;  2KSD A;  2P06 A;  3M99 B;  3W7W A;  5K1X A;  1Q5O A;  1H2S B;  4YIP A;  2VQE B;  3H01 A;  4JF3 A;  4JI1 O;  4R50 A;  2GTS A;  4JI7 O;  5K1P A;  4WFA V;  2QJ1 A;  1NR1 A;  2JJ2 G;  3JD0 A;  1KEC A;  3HKB A;  2F66 C;  3K0G A;  5KHJ A;  4TUY B;  4P2Z A;  3CB2 A;  1GK9 A;  1VQP V;  2YEV B;  1BSM A;  3E8F A;  3CCJ V;  5KX5 A;  4YIO A;  3K03 A;  4X65 O;  4OPA A;  3K0D A;  1SA0 B;  3I55 V;  4FFK A;  2ZR3 A;  5LHG A;  1GRJ A;  4JYC A;  4FVM A;  4FLU A;  1JJ2 U;  1A32 A;  2BE3 A;  3AG7 A;  3E89 A;  5FNV A;  5H6R A;  1FPO A;  4K8X A;  3ZJZ A;  2QWP B;  1N0N A;  5KMG A;  3RFR A;  4XDK A;  2LP7 A;  1OJH A;  3E2E A;  2FML A;  2P7T C;  2RMK B;  5L3F A;  2UU9 B;  4LCU C;  4B7K A;  1BHB A;  1PL0 A;  3BRC A;  3T4D A;  1EBO A;  4I55 A;  4DUY B;  4NXN B;  2HEP A;  1VQ5 V;  2GUZ A;  3L75 H;  4IYI A;  5JJJ B;  4LF8 B;  4O4L A;  2ETN A;  2DW4 A;  1OCZ C;  2EIL B;  1ROP A;  1XNQ B;  2YI9 A;  5J2T A;  2RN9 A;  3DSQ A;  1FXK A;  2QM4 A;  4I4T A;  1SC5 B;  1PV0 A;  1KQS U;  3T1Y O;  3FB6 C;  4BW5 A;  4JI3 B;  3LSQ A;  1CXZ B;  3TCU A;  2EIJ B;  2N74 A;  2ZXW B;  4HBN A;  3OGC C;  3X2Q B;  3CRC A;  2ZE7 A;  3LUT B;  2LGQ A;  2P5O A;  4DV4 B;  4MTX A;  4DV5 B;  3B8N A;  4ZOL B;  2OWO A;  5IY5 B;  1YI2 V;  4G27 B;  5LP6 B;  1E79 G;  3L70 H;  1VEW A;  5B66 Z;  2LFR A;  4DR2 O;  3OTO B;  1AI7 A;  1NZ6 A;  1FJG O;  1AR1 B;  4TUY A;  4X20 B;  2N05 A;  2YEV A;  5FPO A;  4DV3 B;  2P67 A;  3ZMV A;  2EIN C;  1XNR O;  1Y4M A;  3K06 A;  4P9O A;  4DV0 B;  1EM1 A;  2ZT9 B;  2A3Q A;  2QWN B;  4X62 O;  2GSM B;  1SA0 A;  2XAG A;  1YJN V;  1NBM G;  2EIM B;  1ZUQ A;  3L71 H;  4DV2 O;  2EBO A;  2R9R B;  1I5Y A;  3FAV B;  1O9G A;  3LDD A;  2IH1 C;  4ZKI A;  2X0L A;  3T1C A;  1QLN A;  1WPB A;  4IIJ B;  1NTK H;  2Z0A A;  2OIE A;  1K33 A;  2Y0P A;  5EBL C;  2QKC A;  1Q82 W;  4J9Z B;  4RQF A;  1Y74 B;  2CTR A;  4PA7 A;  2BTO A;  2R9I A;  3W7S A;  4AQY O;  3F7Y C;  3OT7 A;  3TK1 A;  4JPR A;  2MK3 A;  4DR5 O;  2KQX A;  2AHZ A;  1KP2 A;  4PV1 B;  1HDJ A;  1S3J A;  3UCS C;  1MG1 A;  1D5N A;  4O4I B;  3MD0 A;  4DK1 A;  4LFA B;  4C7U A;  1GN2 A;  1XMO O;  3CRM A;  2FYU H;  3H9V A;  3W7T A;  2EJ7 A;  4GYC B;  1VMG A;  2XAS A;  4TSF G;  1V54 B;  4AHC A;  3AK2 A;  1KYO F;  4K35 A;  2QGN A;  5B1B C;  4MSW C;  5CA1 B;  4JI1 B;  3AG3 B;  2CGO A;  4ZOL A;  3JAK B;  1R6N A;  2UUB O;  2A79 B;  5LP6 A;  2QWR B;  4IL6 Z;  1FFX B;  1N8R W;  3JD4 A;  1S77 D;  5JWP A;  3K58 A;  4DV6 O;  3AG2 B;  4CS2 A;  3OEE G;  2BOC C;  4X20 A;  3MDS A;  3NXS A;  3QG5 A;  2CTP A;  5EIB D;  2KKW A;  4ZHQ B;  4X65 B;  1G4Y B;  3RN4 A;  4MVZ A;  2ZNJ A;  2DYR B;  3CD6 V;  4CC5 A;  4WCE V;  5EYP B;  3I5D A;  4UB8 Z;  3FAV A;  1JVM A;  4BWA A;  4OX9 O;  1F7Y A;  2JRI A;  5AG2 A;  2IJJ A;  1NTZ H;  5H6Q A;  1FYJ A;  2Q9L A;  1PM9 A;  4IIJ A;  4PA3 A;  1HWY A;  1VQ7 V;  3QO5 A;  4J11 A;  2FKX A;  5KUK A;  3CME V;  1WNS A;  4YHH O;  3CS5 A;  2YIB A;  3KCY A;  1VQN V;  1VQO V;  3APQ A;  1KB9 F;  4NXM B;  3CCU V;  3CXC U;  1Y74 A;  4FM1 A;  3CCS V;  4FMT A;  4RQE A;  4ZIB A;  3OGI B;  3E8G A;  3FYI B;  4MTO A;  4MVS A;  1IVS A;  1K5S A;  3L73 H;  4B3S O;  1PL4 A;  1J5E O;  4O4I A;  2QKA A;  2ZKO A;  2GV9 A;  2YIA A;  2JGD B;  4NB5 A;  3T1Y B;  1FS0 G;  1XIL A;  2AXT Z;  1N34 O;  5KLV H;  4K8Z A;  4CH3 A;  2WLM A;  2NR5 A;  5CA1 A;  2Y4T A;  1VP7 A;  3STL C;  1SS3 A;  3JAK A;  2EZP A;  2LW1 A;  4X1Y B;  4PA9 A;  1E1Q G;  2E74 B;  2OCC C;  4DR2 B;  1FFX A;  5J9P C;  1D2D A;  4LFB O;  2DN9 A;  5L3G A;  1NQT A;  1VQ9 V;  1YCI A;  5C93 A;  3CC2 V;  1P7G A;  4ZHQ A;  1XNR B;  3NR7 A;  5JCO C;  2EZO A;  5LMN O;  1UFI A;  1OCO C;  5L3C A;  3M8A A;  4DV2 B;  1OCZ B;  2UXD O;  5EYP A;  1YTF D;  3DC6 A;  1RM1 B;  3ML0 A;  1MAB G;  4ABM A;  2AZ2 A;  1QR8 A;  5F2V O;  3IC7 A;  3UT5 B;  2EIK C;  4CS4 A;  4H33 A;  1BS3 A;  3MHH C;  4P9P A;  2DWD C;  3SYC A;  5L3B A;  1XRE A;  3O9O A;  2R70 A;  4LF7 O;  1MZF A;  4NR1 A;  1L1F A;  4RO2 A;  4DO2 A;  5JJN B;  5D5P A;  4B3M O;  4X89 A;  4UCS A;  3ABT A;  4AQY B;  3HPL C;  1JJO A;  4DR5 B;  3KKY A;  2UUA O;  1PD3 A;  1OV9 A;  1SQV H;  3CCE V;  2ZD9 A;  4UCR A;  3FX7 A;  1BCC H;  2ZIO A;  2AGA A;  4FFB B;  4QJF B;  1XMO B;  3FYE B;  2JGD A;  2A7W A;  1TA8 A;  2H8P C;  2LQT A;  5IJ0 B;  2EIN B;  1NS1 A;  4DR1 O;  1Q81 W;  1PP9 H;  2P4V A;  3UM7 A;  1JQ0 A;  1IXM A;  1P49 A;  1GAX A;  1QBZ A;  4DR4 O;  2RCV A;  1V55 C;  1K4C C;  1PKX A;  3E35 A;  3K5O A;  2QE7 G;  1S5H C;  2Q73 A;  2UUB B;  2CE4 A;  1MA1 A;  2BSK B;  4J7J A;  3WB0 A;  4X1Y A;  4PDV A;  3VQW A;  2Q6A A;  1TGO A;  1HNX O;  3GB7 C;  1RSO B;  4DV6 B;  3OM3 B;  1ZAU A;  2IH3 C;  1IBM O;  1GN3 A;  3UO2 A;  4JI2 O;  4LH7 A;  3ABK B;  3OE7 G;  2AZ0 A;  4DV1 O;  1I5X A;  4U7O A;  4W4L A;  1GM8 A;  4UV8 A;  4J80 A;  4YY3 O;  5KHK A;  2A9H A;  3JCU Z;  2QSA A;  1AI6 A;  1MSW D;  5IYB O;  2YXY A;  3B77 A;  4JYY A;  3N27 A;  3UT5 A;  3HKC B;  4F6E A;  2ADQ B;  4MT8 A;  1K7D A;  1FD9 A;  1YDX A;  3E86 A;  4UCV A;  3JAT B;  4Q6G A;  1B04 A;  4KFM A;  3BVO A;  4UCO A;  1TVK B;  2O57 A;  2ITC C;  4RUE A;  4WFH A;  5GTH Z;  1DGS A;  4OGQ B;  4DR7 O;  1VF5 B;  3OMN B;  2F93 B;  4O2B B;  2VRZ A;  1OCC C;  3ZMU A;  2YID A;  2YS8 A;  3P30 A;  3GWK C;  3B40 A;  4MVM A;  4O4J B;  5B1N A;  4JI5 O;  1LUV A;  4X88 A;  5EC2 C;  3AG1 C;  5L3E A;  2DQ0 A;  4EKW A;  4JI4 B;  1PNL A;  4B3S B;  1J5E B;  1KKD A;  3OR6 C;  1NT2 B;  3J81 N;  3JCZ A;  3CJH B;  3F7V C;  4LF4 O;  1EFR G;  4FFB A;  4JYA O; 
#chains in the Genus database with same CATH homology
 3D3I A;  2LFR A;  1SER A;  1AI7 A;  2XND G;  1P4R A;  5EK0 A;  1AR1 B;  1OCR B;  3K04 A;  2WAM A;  3VBB A;  2IU0 A;  3LSS A;  4MS2 A;  2YEV A;  2JK5 C;  5B3S B;  1QCE A;  3RW0 A;  3LDC A;  2P67 A;  4N21 A;  3ZMV A;  2EIN C;  3QO7 A;  1Y4M A;  3K06 A;  4P9O A;  2PI4 A;  4G28 B;  1H2G A;  1YJN V;  2IJH A;  2GSM B;  2XAG A;  4KP4 A;  1NBM G;  3SYO A;  2EIM B;  5CBH A;  4BIZ A;  2C2A A;  3CCV V;  3OFN G;  2EBO A;  2R9R B;  1I5Y A;  4R8C A;  1H38 A;  1YIT V;  4PA4 A;  2HKO A;  3LDD A;  2ZQM A;  4UXN A;  4UVA A;  5B1O A;  3VOU A;  2IH1 C;  3OMA B;  1THZ A;  2IU3 A;  4ZKI A;  1DTO A;  3KG2 A;  2WLI A;  2X0L A;  3T1C A;  1ARO P;  1QLN A;  1AI5 A;  2QEX V;  1K5Q A;  2QM7 A;  4WFF A;  1DF4 A;  2W0F C;  1AJQ A;  1FXH A;  2OTJ V;  1LNQ A;  2QTO A;  4ZBM A;  1VQM V;  5IYC O;  2HG5 C;  3ETE A;  1K33 A;  4R7C A;  2X6C A;  5EBL C;  1F51 A;  3WG7 C;  1Y66 A;  4YXW G;  3CPW U;  1EZJ A;  1KP3 A;  3ZRW A;  1OHH G;  2V7Q G;  3EHB B;  1Q82 W;  2HR3 A;  4J9Z B;  3HB3 B;  5L3D A;  4QE7 A;  4RQF A;  1ORQ C;  1CPY A;  4GX1 A;  1QVF U;  4PA7 A;  1YHQ V;  2ATK C;  1VQ8 V;  3ASN B;  4I9W A;  2R9I A;  3ZMT A;  1R3K C;  3W7S A;  2M7W A;  2BOB C;  3F7Y C;  1K3E A;  3TK1 A;  4JPR A;  2MK3 A;  2AHZ A;  1KP2 A;  2W6I G;  2WWW A;  1S3J A;  3CCM V;  1MG1 A;  3ZN0 A;  5B1A C;  3AG4 B;  2YSU B;  3MD0 A;  2EIL C;  2ITD C;  4PDR A;  1AJN A;  3JD1 A;  3W7T A;  4QE9 A;  5DN6 G;  3F5W C;  1BMF G;  2XAS A;  4GX5 A;  2ZR2 A;  1RM1 C;  4TSF G;  3RBZ A;  1WPX A;  4LC1 A;  5E1A C;  1V54 B;  2IJI A;  2OCC B;  3A0R A;  4MVO A;  3EFF K;  5B1B C;  2JJ1 G;  4MSW C;  3RVZ A;  5HFM A;  2ZDI C;  3AG3 B;  3JD2 A;  1M56 B;  3ABL B;  2X6A A;  4FPP A;  1R6N A;  1KC8 W;  1JOY A;  2EIJ C;  1MOF A;  2A79 B;  3FKS G;  4MW3 A;  3CCR V;  2ZXW C;  4MVQ A;  5EBM C;  2EJR A;  3X2Q C;  4WF9 V;  1YJW V;  3PJS K;  1R3J C;  3SYQ A;  3ABU A;  1N8R W;  3JD4 A;  1S77 D;  1M90 W;  5DM6 V;  3AG2 B;  3ASO B;  1OCO B;  2BOC C;  3OEE G;  2AHY A;  3IGA C;  3DTU B;  3NXS A;  5IY5 C;  3OUF A;  1QVG U;  2IW5 A;  3LDE A;  5CBG A;  1G4Y B;  4PDL A;  1QR9 A;  2EIK B;  4HAM A;  4MVZ A;  4GT1 A;  1OCR C;  2DYR B;  2WLN A;  4OXS A;  3CD6 V;  1B6Q A;  3TET A;  4WCE V;  4JYB A;  4UVB A;  2H94 A;  2K1E A;  1JVM A;  1QLE B;  4J9Y B;  5B3S C;  1M1K W;  4GCZ A;  3W7X A;  3ABM B;  4UV9 A;  2IJJ A;  5H6Q A;  1XL4 A;  5IDJ A;  1SES A;  3JYC A;  1JPX A;  2EIM C;  1E1R G;  2WPD G;  4PA3 A;  1HWY A;  3OR7 C;  1VQ7 V;  3QO5 A;  1JCH A;  3CCL V;  4FIP C;  3QNE A;  4TWK A;  5KUK A;  3CME V;  2JIZ G;  1F4N A;  2NLJ C;  1S0V A;  4PEL A;  1VQN V;  2HJF C;  2Q68 A;  4JAS A;  1VQO V;  1NR7 A;  4F4L A;  2QM8 A;  4FJC C;  2XAF A;  3CCU V;  3CXC U;  3P32 A;  4X8A A;  4I5S A;  3MHS C;  2KB1 A;  2XAQ A;  2DWE C;  4QIW F;  3SPH A;  3CCS V;  3ZRX A;  4FMT A;  4JGS A;  4RQE A;  4UVC A;  4ASU G;  3E8G A;  1S72 V;  3FYI B;  4MTO A;  2WLL B;  3ETD A;  4MVS A;  4MTF A;  1R73 A;  5CMU A;  1VQK V;  1K5S A;  3SPG A;  4PA6 A;  4PDM A;  4TT3 G;  1PNK A;  2HFE C;  3ABK C;  4G2K A;  4UUJ C;  1GKF A;  1K9M W;  1R6K A;  3ASN C;  3CC4 V;  2IJK A;  4JTD B;  3ETG A;  3SPI A;  5KA5 A;  1Q86 W;  1V55 B;  3ZCC A;  1SET A;  1FS0 G;  5H9C A;  3SPJ A;  1GO3 F;  2HLD G;  5LGN A;  3W7U A;  3G71 V;  3OAA G;  4MVR A;  4XBF A;  4DXW A;  2QA4 V;  2WLM A;  3G6E V;  3AG4 C;  2JEU A;  1W2B U;  1SRY A;  3OW2 U;  4L87 A;  1YIJ V;  2GHY A;  4GX2 A;  2WLJ A;  3STL C;  1ENV A;  2OT5 A;  3SYA A;  2X7R B;  1YJ9 V;  2EZP A;  2UXX A;  3FB7 C;  2B1I A;  3IFX A;  5EBW C;  4PA9 A;  2V1D A;  1V54 C;  1E1Q G;  1AI4 A;  3ZN1 A;  2OCC C;  1OZ0 A;  5J9P C;  2X6B A;  2FTK A;  1GMG A;  3DGE A;  1P7B A;  5L3G A;  1NQT A;  3AG3 C;  1VQ9 V;  1J95 A;  1TUE B;  4MW8 A;  3WFV A;  2D3O W;  4HZ3 A;  1M56 C;  1K4D C;  3ABL C;  3G4S V;  5C93 A;  3CC2 V;  1M57 B;  2WLH A;  2A0L A;  3STZ C;  4WFB V;  1H8H G;  2LFS A;  2DQ3 A;  5B1A B;  1BL8 A;  1PNM A;  3OMI B;  2DYS B;  2EZO A;  3AG2 C;  1K34 A;  3ASO C;  4H37 A;  1OCO C;  1GTO A;  5L3C A;  4Z1M G;  2Y69 B;  1OCZ B;  4CBC A;  3D36 A;  3CCQ V;  4LP8 A;  4WFE A;  3SJQ C;  1YTF D;  1AJP A;  3E8B A;  1RM1 B;  3ML0 A;  1NVP D;  1MAB G;  1QR8 A;  1NH2 D;  3FB5 C;  3IC7 A;  2HVK C;  5BZB A;  1FXV A;  5CN0 A;  2EIK C;  3CP1 A;  5B1B B;  4H33 A;  4JTA B;  2DYR C;  4JAU A;  3CMA V;  4KUM A;  5KA6 A;  3T2M A;  3MHH C;  4P9P A;  5LHI A;  1DLB A;  2DWD C;  3K9A A;  3SYC A;  5L3B A;  1S76 D;  1QLE C;  1NVP B;  5LGT A;  2Q69 A;  1OCC B;  2F43 G;  1ZWI C;  2W6J G;  5CA3 A;  1NH2 B;  2UXN A;  1K73 W;  3ABM C;  2PI5 A;  1BHA A;  4FK5 C;  4RUF A;  2P6J A;  1DF5 A;  3K79 A;  3OUS A;  3ZRS A;  1YSC A;  1UJW B;  3BEH A;  4CZZ A;  5EC1 C;  3UKM A;  1L1F A;  1WLE A;  3AG1 B;  4RO2 A;  4DO2 A;  4HYO A;  1FXK B;  1K92 A;  4P30 A;  2CK3 G;  3LNM B;  4WFG A;  4X89 A;  3ZRV A;  5IYD O;  3GWO A;  2OTL V;  2HVJ C;  3ABT A;  4BAY A;  1GM7 A;  5HFL A;  3HPL C;  1SZT A;  4QPJ A;  1CP9 A;  2WLL A;  3M99 B;  3W7W A;  1R3L C;  3SPC A;  1F4M A;  3R65 A;  1W0J G;  3ZMZ A;  3H01 A;  1PD3 A;  1VQ4 V;  4JF3 A;  4LBE C;  1VQ6 V;  3CCE V;  2ZD9 A;  4R50 A;  3FB8 C;  1G8M A;  3BY6 A;  4QJF B;  3FYE B;  3CC7 V;  2H8P C;  2B1G A;  5CBF A;  1Q7Y W;  4WFA V;  2EIN B;  2JEX A;  3E83 A;  3QO8 A;  1Q81 W;  1NR1 A;  2JJ2 G;  3JD0 A;  1KEC A;  3UM7 A;  1JQ0 A;  1IXM A;  3K0G A;  2B5U A;  5LGU A;  1XL6 A;  1QBZ A;  2Q67 A;  4P2Z A;  3CYO A;  1VQP V;  1GK9 A;  1W0K G;  1V55 C;  2WLK A;  2YEV B;  1K4C C;  1PKX A;  3E35 A;  3E8F A;  3CCJ V;  2XAJ A;  3K03 A;  2QE7 G;  1S5H C;  4QNH B;  1M9N A;  2WSS G;  3AEI A;  3K0D A;  3I55 V;  2ZR3 A;  4PDV A;  5LHG A;  2Q6A A;  4E2L A;  3GB7 C;  4JYC A;  4XDJ A;  4U7N A;  4BIU A;  3ZMS A;  1RPO A;  3OM3 B;  2Z5U A;  1JJ2 U;  2IH3 C;  3E89 A;  5LBQ A;  2QKS A;  4QPK A;  5H6R A;  2WLI B;  3WG7 B;  1COW G;  3ZIA G;  3SYP A;  3ZJZ A;  3ABK B;  5GW7 A;  4XDK A;  2LP7 A;  3OE7 G;  3E2E A;  2P90 A;  2P7T C;  4GX0 A;  5L3F A;  1I5X A;  4U7O A;  4UV8 A;  1GM8 A;  4LCU C;  1BHB A;  1PL0 A;  4MVU A;  3T4D A;  2A9H A;  4MTG A;  1CEZ A;  2NNU A;  1EBO A;  4JAV A;  3ZRW B;  1AI6 A;  1RPR A;  1MSW D;  1M57 C;  5IYB O;  5LHH A;  3E8H A;  3B77 A;  4N23 A;  1VQ5 V;  2XAH A;  4RAI A;  3B8M A;  1K7D A;  2DYS C;  4MT8 A;  3E86 A;  2ZDI A;  3I56 V;  2DW4 A;  2Y69 C;  1OCZ C;  1JX9 A;  2EIL B;  1KD1 W;  1ROP A;  4KFM A;  3T4Z A;  1NKD A;  2XOK G;  2ITC C;  4RUE A;  4Q20 A;  4WFH A;  1NJI W;  2Z3Y A;  4JTC B;  2JDI G;  3OEH G;  3OMN B;  1FXK A;  1R3I C;  2Y48 A;  3K3W A;  1KQS U;  1OCC C;  5KUM A;  3ZMU A;  1YTF B;  3FB6 C;  4BW5 A;  3K08 A;  3LSQ A;  3P30 A;  3RVY A;  4R6Z A;  3TCU A;  5B1N A;  4MVM A;  1H8E G;  2EIJ B;  2ZXW B;  1VQL V;  4X88 A;  1F23 A;  3AG1 C;  3OGC C;  5EC2 C;  5L3E A;  3JD3 A;  3X2Q B;  5FL7 G;  1K97 A;  2DQ0 A;  1FXK C;  3LUT B;  4EKW A;  1K8A W;  1PNL A;  1KKD A;  3OR6 C;  4MTX A;  4XDL A;  3B8N A;  3JCZ A;  1FFT B;  1GM9 A;  3F7V C;  5IY5 B;  1YI2 V;  1EFR G;  4G27 B;  1E79 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...