5DM6V

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
66
structure length
66
Chain Sequence
MKPSEMRNLQATDFAKEIDARKKELMELRFQAAAGQLAQPHRVRQLRREVAQLNTVKAELARKGEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 23
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5dm6V00
1YJ9V 1KC8W 2OTLV 1VQKV 1NJIW 1Q81W 4WF9V 4WFAV 1VQMV 1K8AW 3G6EV 3CCUV 1YJNV 1R73A 1VQ6V 1VQNV 2QA4V 1VQ7V 1YITV 3CCVV 5DM6V 3CCJV 1VQOV 1QVFU 3I55V 3G4SV 1VQ5V 1JJ2U 1K9MW 3CCLV 1KD1W 3I56V 3CMEV 3CMAV 1S72V 3CPWU 3CXCU 3CCRV 3CC2V 1KQSU 1VQ9V 4WCEV 2QEXV 3OW2U 3CC7V 1VQ4V 4WFBV 2OTJV 1K73W 1QVGU 1YI2V 1VQ8V 3CC4V 3G71V 3CCSV 1Q86W 3CD6V 1M1KW 3CCQV 3CCMV 1YJWV 1Q7YW 1Q82W 1VQLV 1YHQV 1YIJV 1M90W 1W2BU 1N8RW 2D3OW 3CCEV 1VQPV
chains in the Genus database with same CATH superfamily
2Q68A 3HKCB 4JI2O 1GM7A 4DR2B 1Z2GA 2IH1C 2R9AA 3BFRA 5BR8B 1JA8A 2UXXA 1W0KG 1SQBH 2BTQA 1GN4A 1SKVA 4DUYO 1VQ4V 1M56C 4O2BB 3K03A 3CRQA 2WLHA 1HNWO 5JH7A 5B3SC 3LNMB 2FB5A 4O2AB 1DF4A 4F4LA 1YJNV 2F4VB 2B9ZA 4PD4F 2R70A 1JJ2U 4B3SO 1GN3A 2QWRB 5CA1B 3FB7C 3VQVA 5C93A 5LYJA 5IY5B 1KQSU 2LP7A 5H5NA 4O4HA 1MZFA 4B3TB 2PF4E 4P30A 5FNVB 4LF8B 1V55C 1OJHA 1IDSA 4MW3A 1WP7A 2Q7GA 1AILA 2WPDG 3FX7A 4TV8B 4FLTA 1EN5A 2YIAA 4UVCA 1EZVH 2KB1A 4U3FH 4X1YA 3ZHTA 4BIOA 1HP8A 1FXHA 3B77A 1I5YA 1IBKO 3E83A 4JI0B 1Q6IA 4K8ZA 4O4LA 1YF2A 3U0ZA 1BMFG 3L74H 4JI3B 4DYLA 2XOKG 5KMGB 3KG2A 2XAHA 4DV1O 1TVKA 1P7GA 1J5EO 4FPPA 3JD3A 1U97A 3C90A 5IY5C 4J7ZA 5EC1C 1V54C 4BAYA 3CCLV 4I5SA 1R6KA 2CTPA 2ZT9B 2Z0AA 3BA9A 4LF5O 2W6IG 4LWSA 4MVQA 2L6LA 3STLC 2E75B 3PJSK 1IXMA 1M5IA 1WB7A 1IBMB 1XDCA 2HR3A 3A0RA 1RPOA 2FMLA 3ZHQA 4U7OA 1S5JA 3CX5F 5LBQA 5LMUO 4FMTA 4UCVA 1SQGA 3OUSA 5LXTA 2Q5ZA 3JD1A 3WB0A 4OXSA 4DV7B 2NR5A 3JYCA 4MW8A 4IL6Z 4D6TH 1H2NA 2UU9B 4B7KA 4J10A 1FXKC 5H9CA 1DLBA 4X1IA 3S3XA 1FKAO 1M57C 2WLLB 4EFBA 2A9HA 1Z5VA 5J2TB 2ZKOA 4DV1B 3D36A 1I0HA 4B3MO 1HNWB 4MVZA 1AI5A 2XAJA 2QEXV 3TXSA 3BHPA 2A3QA 5L3BA 2YEVA 3SPCA 1SESA 4DR2O 1VIBA 1VQLV 4ZI7A 1IZ3A 4CS4A 4MTOA 3IGAC 4O4LB 2BTOA 4PI0A 4PI2A 3JD4A 3ABKC 3IC9A 4JI7B 4DV4O 3OMIB 4GKJO 3D3QA 5GW7A 1NVPD 3WU2Z 1NVPB 3SR2C 3ABKB 5A2QN 1D2DA 3IJ4A 4X66B 4LBEC 2RNBA 3AG3C 3WG7C 4JI1B 2OWOA 4QE7A 4LFCB 4KFMA 1QU7A 4DK0A 1R3LC 5LP6A 4MVSA 5CB4A 2LFSA 2JGDB 5FNVA 4LH6A 1HR0O 4FZ1A 5CN0A 1Q81W 3ZX6A 1K8AW 2A79B 4X88A 4CS3A 1NTZH 3LUTB 1URFA 4DXWA 2Y0IA 5CA0B 2BE3A 3AG7A 4DW0A 1XMQO 3JARA 3N2KB 1TA8A 3J7AU 4JI2B 5LGUA 2ZNIA 5JCOC 2JVDA 3T2MA 3N2GA 1EZJA 1NT2B 2FTKA 4J41A 1VQOV 4ASUG 5BMVB 5A9GA 2CGNA 3HKBA 3W7SA 4G28B 1H2GA 3EFFK 2HKOA 1ZTEA 3BPZA 1THZA 1KBHA 3CCMV 2JJ1G 1WP8A 2F4VO 3F7VC 5KHKA 4LFBB 4Z1MG 4PA4A 4I55B 1S76D 4JZGA 3JD2A 2WLIB 3ZHVA 3W7UA 3B2EE 3WB1A 2R9RB 1S0VA 2YICA 1NTKH 3QG5A 4JTDB 4P2ZA 5J9PC 1NR7A 1Y74A 1K92A 2H94A 2KG7B 3BY6A 3QF7A 1Q82W 4KL1A 3JASB 2ITCC 5D5QA 1FYJA 2WSSG 4FK5C 3HPLC 2QJ1A 2PGGA 3ZRWA 4FFKA 1PNKA 4UB8Z 3R66A 2QR4A 3OT7A 1COWG 2ZINA 1R6NA 1HNZO 4YHHO 3HKCA 4QIWF 1JOYA 2KQXA 4CS2A 1W0JG 1F4MA 4ZIBA 1Q8IA 4TUYB 2JEUA 3T1HB 1M1KW 4DRXA 3M8AA 2G38A 3UO2A 2EIKC 3HKDA 4D7SA 1FPOA 4I0XB 4ZHQB 2GBOA 3SYPA 1PL4A 5KAFZ 1O9HA 4YJ3B 1H38A 1KP3A 2UUBB 1H2SB 3M7MX 1AROP 1B6QA 4JYBA 1V55B 2HVKC 2IW5A 3CJHA 5EBMC 4NXMB 3CC4V 3ZRSA 4GZRB 3LSSA 4PA3A 1N34B 5JJJB 5L3EA 4JI7O 3NXSA 4UVBA 3KCYA 3SJCC 1Y6XA 2K9PA 1UPGA 3OMNB 1YDXA 2BOCC 2F1MA 4NB5A 3MHSC 3HKBB 5LMUB 4E2LA 2FYUH 1YSCA 2R72A 2W6JG 3K0DA 4YHHB 1OCRC 4YJ3A 4DO2A 1WPXA 5KA6A 1YVWA 3AEIA 2LO1A 3CYOA 1HR0B 2P6JA 5E79Z 4LF4O 1QVGU 1Q7YW 3WFVA 1TUBA 3L72H 4OPAA 1PD3A 3IFXA 4RQFA 3THOA 4ZOLA 1AJQA 1Y4MA 4DR1O 3RVZA 4I9QA 1NH2D 1NH2B 4WFHA 4LFAO 3SYCA 5DEDA 4OX9O 3N2KA 1Q90D 1MSDA 1IBLB 3D36C 2HEPA 4PHZA 3N2GB 2HJDA 4ZBMA 4DV0B 4X9QA 4YJ2B 2VWJA 4JI6B 4R6ZA 4K0KO 3OM3B 5CA3A 2F95B 3QVNA 1VF5B 2Y4UA 4FLVA 1P4RA 4PA7A 1B3QA 3D8CA 5IE9A 5IJ9B 4PDVA 2LFRA 3UT5A 3BEHA 1B06A 1EFRG 2QM4A 1AP6A 5IWAO 4QE9A 2GV9A 4QNHB 4JAAA 1EN6A 1M93A 4CBCA 1K9MW 1FJGO 3E8FA 3G67A 1JQ0A 1XMOB 3RN4A 1GRJA 5CBGA 1PM9A 2CK3G 4UVAA 4X20A 5LGTA 3OEEG 3RYIB 5GONA 4DR5O 1T5EA 3K57A 2EINB 4OGQB 3ZMUA 4B3RO 2Y4TA 4TOIA 4X62B 1SA0B 1D5NA 4LF7O 4FJCC 4X1IB 4I50A 4B7EA 2Q69A 3UQ8A 3ZIAG 2EX3A 1HNZB 4WFAV 3HKEA 1JFFA 4HBNA 4NTYA 4CC6A 1HNXB 1PP9H 4FFBB 1TGOA 1GM9A 4GLXA 4X1KA 5IDJA 1AVMA 3EXAA 3UT5B 1Q6UA 5IYCO 3JCZA 5L3GA 2RDCA 4QPKA 3UKMA 4CH3A 3CCEV 2HJFC 1GO3F 4IYHA 1MA1A 1TUBB 3E86A 5GONB 1CEZA 4NR1A 3N27A 2HLDG 1GH6A 2ZCEA 2EBOA 4MTGA 2ITDC 1AI4A 3P3NA 4RO2A 3F5TA 4X65O 1NS1A 3FYEB 2XAQA 1VQ9V 5EIBC 3ABMB 1H2MA 1AI7A 3S3WA 3U11A 4JTAB 5JWPA 1GKFA 3UO3A 1XILA 2IU0A 3CWBH 1F23A 2ETNA 4JASA 1AB3A 2YXLA 3CRRA 4LF6B 2ZM6B 4FM0A 2CAZC 4EKWA 5CMUA 2ZE6A 4CC5A 5EYPB 3K59A 4DV6B 2B5UA 4UV8A 1SC5B 3AG4C 4G2KA 5LA6A 1GN6A 3ML0A 1H8EG 4NTXA 4GX5A 1N0JA 1GAXA 2DWEC 1VQ7V 2DW4A 5IJ0A 1E79G 1XHZA 3ETQA 3K5OA 3SDLA 2ZE8A 2OIEA 1L0NH 4UCUA 4ZKIA 2EULA 3STZC 1XOUA 1RSOB 1YI2V 2WLLA 2YXHA 1M4UA 1TUEB 3RYHA 1XREA 1IXBA 1O9GA 3A2FA 5EK0A 1WPBA 4CH6A 2IU3A 2O57A 2ZXWB 4RWUA 2VS0A 5BMVA 5IJ9A 1R1BA 4DUYB 1HWYA 3K5LA 3CMEV 3JAKB 1XI1A 1IX9A 1IBMO 4P9OA 4PV1B 4DUZO 4WBNA 1K73W 2Q8VA 4DR4B 3X2QC 5IYZA 3P32A 4JI8O 3TK1A 3GWOA 4N23A 5B1AC 1ENVA 4JYAB 1LUVA 1R73A 5DN6G 3L9DA 3SYQA 4LF7B 4TQFA 1Y74B 4I50B 5FPOA 4LP8A 3CE2A 1QBZA 4UXNA 4BW5A 1K97A 2IJIA 3AG1B 5LYJB 1DTOA 1IURA 4EFEA 4X1KB 5B1BB 3MDSA 3AK3A 2AHYA 4BW9A 4GKKO 3EHBB 4ZHQA 3E22A 5CBFA 2W0FC 3DTUB 3VQYA 3OTOB 1Y76B 1SF9A 1BQZA 3A0BZ 4R8CA 2AXTZ 4Q20A 1YJWV 1IBLO 3AG2C 3F7YC 4H0LB 1ZX3A 3ABLC 2E74B 4MTXA 4AQYB 3ZMVA 4DV0O 1KUQA 5B66Z 4RUFA 3SGIA 2A7WA 1GK9A 4O4IB 3RYFB 1YZBA 2N74A 3TETA 4WCEV 4BR6A 4G27B 1FD9A 2YUAA 4NXMO 4WF9V 3OFNG 4Z2WA 3LNNA 1EN4A 4UUJC 2XAFA 4H33A 3RYCA 3CPWU 1LR1A 3Q4HA 2UXCB 1Q86W 5KLVH 1XMOO 4LF6O 1NBMG 2OIGA 5BZBA 2Y69C 2OTLV 1G6UA 2DQ0A 3KCXA 2RCVA 3I55V 3VBBA 2PYLA 1FS0G 4LF8O 1Y66A 3ASOC 5TISZ 3CC2V 3W7TA 1SS3A 1YXBA 1S5LZ 4HNAB 3H1HH 2RJZA 4RAIA 2E76B 4F6EA 4AHCA 2DYSC 2Q67A 2EIJB 4ZI7B 5CBHA 4XDJA 2Z3YA 3PN1A 3CS5A 1KYOF 4DUZB 2UXDO 2QGNA 3FYIB 4JV5O 2F66C 3APOA 4JAUA 1G4YB 4DK1A 1N33O 4IIJA 4Z1VA 1SQQH 4JYAO 4XDKA 3BA8A 1N32B 3RYIA 1EM1A 3G6BA 4O4HB 1OCZB 3D3IA 1S5HC 2Q4PA 2EJ7A 3APQA 1VARA 3ETEA 2N04A 4IHJB 2Y48A 1NU1H 4CZZA 4E4EA 1BQ0A 3ASNB 3QO7A 1GN2A 3OR7C 1BL8A 4MVOA 4PJ0Z 2P22C 4ICGA 2VWKA 1AJPA 4YXWG 4JI1O 3K08A 4FM2A 1VQPV 1OV9A 2Q9LA 2Q7HA 4DV7O 2ZQMA 1FFXA 3FAVA 1KMIZ 2UXNA 4FLWA 4I0XA 2ZR2A 2LGWA 1SQPH 2F43G 3JD0A 4J42A 1G1XB 4X64O 3BAAA 1SQVH 3K5NA 4F6RA 1OCOC 3Q4HB 4MS2A 5J2UA 1MOFA 1VP7A 1RM1B 3CRMA 2PI5A 4EEQA 5LOVB 2YIBD 3E8HA 2EZPA 3K79A 3MHHC 5D5PA 5LP6B 1W59A 4I9WA 1AI6A 1K5QA 2QSAA 2QE7G 1BS3A 3KKYA 4QPJA 2ATKC 3CP1A 3OUFA 1QR9A 4RUEA 3C3TA 1YTFB 1YTFD 1I5XA 1KP2A 5EC2C 2LQTA 1ZUQA 1MNGA 2OCCC 3JARB 2H8PC 5FLXN 2AGAA 1K7DA 5JJNB 2DYRB 2P5OA 3OE7G 3H1JH 3UM7A 4DW1A 2N05A 2WLIA 1YCIA 2JJ2G 3KZIZ 2QKCA 4L8JA 4QGPA 5J2UB 3L75H 4MVRA 3SPJA 5H6RA 3O9OA 3H1LH 4R50A 4LF5B 1W2BU 1Q43A 3CSXA 3QO8A 4J9YB 3ZJZA 1R3IC 2GHYA 2DOSA 2P4KA 1NQTA 4MSWC 3RYCB 4DR6O 2CE4A 2YS8A 1OCCC 3RBZA 1MZEA 3B8NA 1DF5A 2ZR3A 4FLXA 1KU9A 5KHIA 2EIJC 5DECA 2CGOA 1BHBA 1XHXA 4HAMA 3OR6C 1ROPA 2P90A 2DE0X 3ZCCA 1D5AA 1NI8A 3ASOB 1XMQB 2CH7A 3RYHB 1ZWIC 3OTOO 2M7WA 1X59A 1Q6HA 2E5LB 3T4DA 1OCCB 3OGCC 2VQFB 3C3SA 1BT8A 5IYZB 2QWPB 3ZN1A 1VMGA 2YDEA 2PZSA 1F51A 5C8YB 2B1IA 2Y0PA 5FPRA 4TV8A 1B04A 5HFMA 1VF7A 2JGUA 4GYCB 2P06A 1LNQA 1XBLA 2QWQB 4FM1A 2Q73A 2HFEC 2ODMA 4X8AA 2BSKB 3H1IH 4KXRA 1XNQB 3JCUZ 4DV5O 3H1KH 3LSQA 3VQXA 4DV3B 2Z5UA 3E89A 2IBZH 3CC7V 2EZOA 1Q3EA 2Q6AA 5B5EZ 3FB5C 1R3KC 1RP3B 1TVKB 1M90W 5E1AC 5KAIZ 3BABA 4JF3A 4DV4B 1NJIW 3FFQA 5J2TA 2Q0AA 2ZIMA 1KKCA 4JZ2A 4WFGA 4LFBO 3GWKC 3DGEA 1XL4A 1KECA 3H9VA 1QLEB 4UCSA 3RT3C 3FD9A 5C8YA 2JK5C 3M99B 2H3OA 4GUNA 5LP6C 4WFBV 1P84F 1IBKB 4NXNB 1VQ8V 1RM1C 3AG2B 4UB6Z 2PY5A 1N8RW 2KKWA 4LFCO 1KB9F 1I94B 1WLEA 4OX9B 3T4ZA 1UFIA 3VOUA 4H44B 4JI4O 3E35A 2IH3C 3E2EA 2GTAA 2V7QG 1J95A 3OMAB 5JQGA 2P7TC 4BIUA 3HB3B 1AR4A 5BXZA 5LHIA 4RQEA 5H6QA 4YY3O 2QA4V 2MK3A 3ASNC 3JATA 3BVOA 1FXVA 3DSQA 2HHHO 2PYJA 1N32O 3UCSC 1OCZC 3ABTA 5IJ0B 1N36B 1PL0A 4K0KB 1LUWA 1ZLZA 1F7YA 4FLZA 5IYBO 3CRAA 4TT3G 4J7KA 1SZXA 1M9NA 3RW0A 2LGQA 3DC6A 5F2VO 3J80N 2JDIG 3F5WC 3ZMTA 4MVUA 3JSNA 4JGSA 4D7TA 1JPXA 3J81N 4JI5B 1VF6C 1PV0A 2PUSA 3DXRB 1JX9A 1ZAUA 1VEWA 2RMKB 2UXBO 4TWKA 3A0HZ 3DC5A 3W7XA 4UCOA 5IYDO 3W7WA 2DN9A 4B08A 2P4VA 2QM8A 1FXKA 4IT5A 3JAWA 1KD1W 4FFBA 2XAGA 2ARHA 4DR1B 1AR5A 2X0LA 3E8BA 3I5DA 4O4JA 4WFEA 4LFAB 2KSDA 1JFFB 2DWDC 1HNXO 3AG4B 2BTQB 3T1CA 1F4NA 2QWOB 2M6YA 3CCUV 1QCEA 1Y76A 1XEQA 5LXTB 2EIMB 2DJVA 1N4CA 3NR7A 4O2BA 5BY1A 2EILC 2ZNJA 3H01A 3B09A 1U96A 2EILB 4JAVA 3ABMC 5IWAB 1SQFA 4DV3O 4X66O 1YITV 3ETGA 3EVKA 1NZ6A 2EIMC 4O4JB 1FFXB 2NN4A 5GTHZ 2ZM6O 1G8MA 1EBOA 2JIZG 3ABLB 2OTJV 2V1DA 5ITZA 1L8DA 2AZ2A 3OAAG 5JJEB 3QO5A 3RYFA 4JYYA 4MT8A 3L71H 4JI4B 2V4DA 1X4TA 2C2AA 5EYPA 2CDYA 1JCHA 3G4SV 3IAYA 3B4SA 5LOVA 5KX5B 3CMAV 1S77D 2LW1A 3CCRV 2A06H 3K0GA 2IM9A 2E5LO 2XHBA 3OW2U 2ADPA 2JGDA 4K35A 2WLJA 3O65A 4I4TB 2DMXA 4YIPA 3AG1C 1A32A 1AJNA 5HFLA 1BCCH 4I7ZB 3K06A 2LW7A 4YIOA 1TAEA 5LMNO 3U10A 4LNUA 1J5EB 2IJJA 4K3AA 4GX0A 3K58A 1E1RG 4EB6A 3K9AA 1H8HG 5BR8O 5CB4B 2JEXA 2ZDIC 3JAKA 2JRIA 4WBNB 1E1QG 4DV5B 3K3WA 3JAMN 3ETDA 4OPHA 5GTIZ 5LL6Y 4BIZA 3HKEB 2F93B 3OGIB 3CXCU 4J80A 3IC7A 2QTOA 4J11A 4LH7A 4P9PA 1BSMA 2OCCB 1YJ9V 3JALA 2NNUA 4IIJB 1P49A 4KHPB 4B3TO 2RQ6A 1K5SA 1GMGA 3B8MA 2LJ2A 4AILC 1P7BA 2ZE7A 2OYQA 2UXBB 4DR6B 1RPRA 3CD6V 4AQYO 1YIJV 3JSLA 2WWWA 2UUBO 2RN9A 2HG5C 1QHTA 4LC1A 4NVPA 3L73H 4F6RB 1QLEC 3TJTA 3ABUA 1PPJH 4O2AA 3WB2A 4A5UB 5KHJA 1Z5WA 3JASA 4CH4A 3G71V 1GM8A 1L0LH 4ABMA 2VQEB 2QKSA 2B1GA 4UCRA 2QM7A 4I4TA 5LHHA 5EZYA 5JVDB 5EIBD 4DV2B 2XUMA 2W0XA 2WLMA 2ZIOA 1QVFU 1WN7A 5AG2A 2X7RB 3K5MA 1SA0A 4TUYA 1WJZA 4TQDA 4YY3B 3ZEDA 2AZ0A 1WA8B 2K1EA 4N21A 2QKAA 1RSOA 4KHPO 1H2LA 1BZKA 4GKJB 1VQ6V 1ZL8A 3ZRVA 4DR3B 5KHGA 2UXCO 2YI8A 2ZE5A 3ZRXA 1Y67A 2A0LA 2DYSB 4FLUA 4TSFG 2EIKB 1DK1A 5LGNA 3ZHSA 3ZMSA 1YHQV 3ZBHA 3OD4A 2GTSA 3CXHF 5CA0A 2EINC 1JR9A 1I94O 4X89A 5LMNB 1I08A 5EBLC 1N34O 2XNDG 1ORQC 3LSUA 4W4KA 4BWAA 4GKKB 5JQGB 3T1YB 2Y69B 1RFYA 1K4CC 5K1XA 4W4LA 2ILMA 4TV9B 1XNRO 2KG7A 4GT1A 2ZDIA 4JPRA 1HW7A 2JS5A 2DYRC 1OZ0A 1V9PA 3SJAC 4DR7O 4GX2A 5LA6B 3AK1A 1PNLA 1QNMA 2BSKA 2BCCH 1FFTB 5CA1A 1WAZA 2GSMB 2WAMA 5JCOA 1PNMA 5KHHA 3K9SA 2XTAA 3OTFA 2WA3A 2YEVB 4LF9O 3ZRWB 4H37A 2AW9A 2CH7B 3JAWB 2QTSA 3LDCA 2GDSA 3QNEA 3ZN0A 4JTCB 3G80A 1KC8W 1OCOB 4JI5O 4WFFA 3CJHB 4AI8A 5KUMA 1ZL8B 3FAVB 1OCRB 5LHGA 2UXDB 5B1BC 1SQXH 3OEHG 3HKDB 4PELA 4DV2O 4QJFB 2YI9A 2ADQB 3GB7C 1S3JA 1XNRB 4UFZA 4L87A 4X20B 1VQKV 4CH5A 2VQEO 2BOBC 3K04A 4X1YB 4HZ3A 4FLYA 1I7FA 3SJQC 2YC0A 1NR1A 4HYOA 4KP4A 5L3CA 1N0NA 2NLJC 5B1AB 3ZS8C 1XUQA 2YXYA 2D2CB 4PDRA 1XQ8A 2CTRA 2VRZA 4LWSB 5EZYB 1GTOA 5KMGA 5KA5A 1QLNA 2FKXA 2WA4A 5JVDA 1SRYA 1CPYA 5K1PA 4K8XA 3R65A 3SJBC 5ITZB 4FZ0A 3E22B 2FL4A 3SYAA 1JVMA 5FL7G 1CXZB 2GUZA 1QQCA 3FKSG 2ZXWC 4UV9A 4I55A 3JATB 4ZOLB 3QTCA 3ICXA 5KX5A 4HNAA 2XT9A 4FIPC 4NTWA 2X6BA 4DR5B 2EJRA 4U3JA 1MABG 2VQFO 2UUAO 2IJKA 3LDDA 2WLKA 2QDOA 3B40A 1WNSA 2R9IA 1VF6A 2CUGA 4H13B 4LF4B 4LCUC 4NYKA 3FB6C 4PDLA 4LR3A 1SETA 2UUCO 3LDEA 2YIDA 3BCCH 4EB6B 4X64B 4GCZA 1XL6A 4JI3O 2WLNA 2HP8A 3CCJV 2MW2B 4MVMA 4DR7B 4JI6O 4YJ2A 4JYCA 3ZHRA 3CRCA 4R7CA 1KKDA 1FAFA 3TXQA 4FVMA 4JI8B 1K4DC 4IGGA 1XNQO 3GVMA 4B3SB 3AK2A 1UJWB 1MMMA 4JV5B 3CCQV 4J9ZB 4IYIA 4U7NA 3RWRD 1SZTA 1N33B 3ZMZA 1DGSA 1K3EA 1WB8A 1K33A 3DXRA 2OCHA 5B1NA 5DM6V 3ZHUA 4J7JA 1V54B 3E8GA 2ZD9A 1H2KA 2UU9O 4DR3O 3SPHA 1CP9A 3HR0A 1OHHG 5KUKA 3A8TA 3JALB 1YEWA 3RVYA 4NKGB 1US6A 1PKXA 1AR1B 4PA6A 2L35A 5L3FA 4DRXB 4DV6O 4NXNO 1FJGB 4JI0O 3SYOA 2PTMA 2GUZB 1NTMH 2HVJC 3CHXA 2CTWA 4GX1A 3P30A 1BHAA 3L70H 5B1OA 2X6AA 4IHJA 1VQMV 3RGBA 1QR8A 5H2FZ 3WG7B 3AG3B 2HHHB 1R6TA 2CTQA 4B3MB 3CEIA 4XDLA 3TCUA 1WA8A 3BRCA 3T1YO 1N36O 4XBFA 2P67A 2OT5A 2YSUB 3MAQA 3P3PA 1SERA 3FB8C 3CCSV 5EBWC 1K34A 4X65B 3X2QB 2D3OW 4MTFA 2Q7EA 4DR4O 3CB2A 3G6EV 1R3JC 2DQ3A 4C7UA 1MG1A 2F23A 4O4IA 3TGUH 3SPGA 4Q6GA 2JS3A 2XASA 5B3SB 2Q0OC 1NKDA 4LF9B 2YIBA 1IVSA 3RFRA 1M56B 4UCTA 2IJHA 1MSWD 1BGYH 4KUMA 5L3DA 1VQNV 1HDJA 3MD0A 2PI4A 5JH7B 3CCVV 2UUCB 1VQ5V 1Q5OA 1BE3H 1L1FA 3I56V 3T1HO 2X6CA 1S72V 5IT9N 4LNUB 2QWNB 1M57B 4PA9A 4PDMA 2E3CA 1AP5A 3VQWA 4B3RB 2UUAB 1FXKB 1JMKC 4TV9A 1JJOA 4X62O 1ZSPA 4U3JB 3SPIA 2AHZA
chains in the Genus database with same CATH topology
2Q68A 1PD3A 3IFXA 2WWWA 4RQFA 3E8HA 2EZPA 1GM7A 2HG5C 3K79A 3MHHC 1AJQA 1Y4MA 4LC1A 3RVZA 4I9WA 1AI6A 1K5QA 2IH1C 1NH2D 4WFHA 1NH2B 2QE7G 1QLEC 3ABUA 3SYCA 4QPJA 2ATKC 3CP1A 3OUFA 1QR9A 2UXXA 1W0KG 4RUEA 1YTFB 1YTFD 1VQ4V 1I5XA 1KP2A 5EC2C 1M56C 3G71V 3K03A 1GM8A 2WLHA 2OCCC 2QKSA 2B1GA 2QM7A 4ZBMA 5LHHA 2H8PC 5B3SC 4R6ZA 3LNMB 1DF4A 4F4LA 1K7DA 1YJNV 3OM3B 5CA3A 2DYRB 2WLMA 1QVFU 3OE7G 1JJ2U 1P4RA 3UM7A 4PA7A 2WLIA 2X7RB 3FB7C 2JJ2G 5C93A 5IY5B 4PDVA 1KQSU 2LFRA 3SPJA 3BEHA 4MVRA 2K1EA 2LP7A 4N21A 1EFRG 5H6RA 4QE9A 4R50A 4QNHB 1W2BU 4CBCA 1K9MW 3QO8A 4P30A 4J9YB 3E8FA 3ZJZA 1JQ0A 1R3IC 2GHYA 1V55C 1VQ6V 5CBGA 2CK3G 5LGTA 4UVAA 4MW3A 1NQTA 3OEEG 3ZRVA 4MSWC 1OCCC 3RBZA 3B8NA 2EINB 1DF5A 2ZR3A 3ZMUA 3ZRXA 2A0LA 2WPDG 2EIJC 4UVCA 2DYSB 4TSFG 1BHBA 2EIKB 4FJCC 2KB1A 5LGNA 2Q69A 3ZMSA 1YHQV 4HAMA 3OR6C 1FXHA 1ROPA 3B77A 1I5YA 2P90A 3ZIAG 3E83A 3ZCCA 4WFAV 3ASOB 1ZWIC 2EINC 2M7WA 1BMFG 1OCCB 3T4DA 4X89A 1GM9A 3OGCC 5IDJA 2XOKG 3KG2A 5EBLC 5IYCO 3ZN1A 2XNDG 1ORQC 3JCZA 5L3GA 1F51A 2XAHA 2B1IA 2Y69B 4QPKA 4FPPA 5HFMA 3UKMA 3JD3A 3CCEV 1K4CC 1LNQA 1GO3F 2HJFC 3E86A 5IY5C 1CEZA 2HFEC 5EC1C 1V54C 4X8AA 4BAYA 2HLDG 3CCLV 2EBOA 4GT1A 4I5SA 1R6KA 2ITDC 4MTGA 2ZDIA 3LSQA 4JPRA 1AI4A 2Z5UA 2DYRC 1OZ0A 4RO2A 3E89A 3FYEB 2W6IG 2XAQA 1VQ9V 3ABMB 4GX2A 4MVQA 3CC7V 3STLC 1AI7A 2EZOA 2Q6AA 3FB5C 1R3KC 4JTAB 3PJSK 1PNLA 1GKFA 1IXMA 2IU0A 1M90W 5E1AC 1F23A 4JASA 4JF3A 1FFTB 1NJIW 2HR3A 3A0RA 2GSMB 2WAMA 1RPOA 1PNMA 4U7OA 4WFGA 3DGEA 5LBQA 1XL4A 4EKWA 4FMTA 5CMUA 1KECA 2YEVB 3OUSA 1QLEB 3ZRWB 2JK5C 4H37A 3M99B 3JD1A 4OXSA 4WFBV 1VQ8V 2B5UA 3JYCA 4MW8A 4UV8A 3LDCA 1RM1C 3AG4C 4G2KA 3AG2B 3QNEA 1FXKC 3ZN0A 4JTCB 1N8RW 5H9CA 3ML0A 1H8EG 1DLBA 1KC8W 1OCOB 1WLEA 1M57C 2WLLB 4GX5A 2A9HA 3T4ZA 2DWEC 1VQ7V 4WFFA 2DW4A 5KUMA 3VOUA 1E79G 3E35A 2IH3C 3D36A 3E2EA 4MVZA 1OCRB 1AI5A 5LHGA 2XAJA 4ZKIA 2QEXV 3STZC 5B1BC 2V7QG 3OEHG 1J95A 1YI2V 2WLLA 3OMAB 1TUEB 4PELA 5L3BA 2YEVA 3SPCA 1SESA 4QJFB 3GB7C 2P7TC 1VQLV 1S3JA 4BIUA 5EK0A 3HB3B 4L87A 2IU3A 5LHIA 1VQKV 4RQEA 2ZXWB 5H6QA 2BOBC 2QA4V 3K04A 2MK3A 4HZ3A 3ASNC 4MTOA 3IGAC 1HWYA 3CMEV 1FXVA 3SJQC 1NR1A 3JD4A 3ABKC 4HYOA 4KP4A 5L3CA 2NLJC 5B1AB 4P9OA 1OCZC 3ABTA 4PDRA 1K73W 1PL0A 3OMIB 3X2QC 1GTOA 3P32A 5KA5A 1QLNA 3TK1A 1SRYA 1CPYA 5IYBO 4TT3G 3GWOA 3R65A 4N23A 5B1AC 5GW7A 1ENVA 1NVPD 1NVPB 1R73A 3ABKB 1M9NA 5DN6G 3SYQA 3SYAA 3RW0A 1JVMA 5FL7G 2JDIG 3FKSG 4LBEC 3F5WC 3ZMTA 3AG3C 4MVUA 3WG7C 4JGSA 4LP8A 2ZXWC 4UV9A 1QBZA 4QE7A 4UXNA 4KFMA 1JPXA 1R3LC 4BW5A 1K97A 4MVSA 2IJIA 3AG1B 2LFSA 1JX9A 1DTOA 4FIPC 4TWKA 3W7XA 2X6BA 5IYDO 5CN0A 5B1BB 2EJRA 3W7WA 1Q81W 1MABG 1K8AW 2A79B 4X88A 2QM8A 2AHYA 1FXKA 2IJKA 3LDDA 2WLKA 3LUTB 2R9IA 4DXWA 4LCUC 3EHBB 1KD1W 2XAGA 3FB6C 5CBFA 4PDLA 1SETA 2W0FC 3DTUB 2X0LA 3E8BA 4WFEA 3LDEA 4R8CA 2DWDC 5LGUA 4Q20A 1YJWV 3AG2C 3AG4B 3F7YC 3T1CA 1F4NA 4GCZA 3T2MA 1XL6A 3ABLC 1EZJA 3CCUV 1QCEA 4MTXA 2WLNA 3ZMVA 2FTKA 1VQOV 3CCJV 4MVMA 4ASUG 2EIMB 4JYCA 4RUFA 4R7CA 1KKDA 3W7SA 1GK9A 1K4DC 4G28B 3TETA 4WCEV 1H2GA 3EFFK 1UJWB 2EILC 2HKOA 3H01A 1THZA 4G27B 3CCQV 3CCMV 4J9ZB 2JJ1G 4U7NA 1SZTA 3F7VC 3ZMZA 4Z1MG 2EILB 4JAVA 4PA4A 1S76D 3ABMC 3JD2A 1K3EA 4WF9V 3OFNG 1K33A 1YITV 2WLIB 3ETGA 4UUJC 5B1NA 5DM6V 2XAFA 3W7UA 2EIMC 2R9RB 1S0VA 1V54B 4H33A 3E8GA 2ZD9A 4JTDB 4P2ZA 3CPWU 1G8MA 5J9PC 1NR7A 3SPHA 1EBOA 1K92A 2JIZG 3ABLB 2H94A 2OTJV 2V1DA 3BY6A 1CP9A 1Q86W 1OHHG 3OAAG 5KUKA 1Q82W 1NBMG 3QO5A 2ITCC 5BZBA 2Y69C 3RVYA 2WSSG 4FK5C 1PKXA 2DQ0A 4MT8A 3HPLC 4PA6A 1AR1B 2C2AA 2OTLV 3ZRWA 5L3FA 1PNKA 1JCHA 1COWG 3I55V 3G4SV 1R6NA 3CMAV 3VBBA 1FS0G 4QIWF 3SYOA 1Y66A 1S77D 1JOYA 1W0JG 3ASOC 3CCRV 3K0GA 3W7TA 3CC2V 1F4MA 3OW2U 2HVJC 2JEUA 2WLJA 4RAIA 1M1KW 3AG1C 1AJNA 5HFLA 4GX1A 2EIKC 3P30A 2DYSC 1BHAA 3K06A 5B1OA 2Q67A 2X6AA 3SYPA 2EIJB 1VQMV 1QR8A 3WG7B 5CBHA 3AG3B 4XDJA 2Z3YA 2IJJA 4XDLA 3TCUA 4GX0A 1H38A 1KP3A 4XBFA 3FYIB 1E1RG 2P67A 1AROP 1B6QA 4JYBA 1V55B 2HVKC 2IW5A 2OT5A 2YSUB 4JAUA 1G4YB 3K9AA 1H8HG 2JEXA 2ZDIC 5EBMC 1SERA 3CC4V 3ZRSA 3FB8C 3LSSA 3CCSV 5EBWC 1K34A 4PA3A 4XDKA 1E1QG 3X2QB 5L3EA 2D3OW 4MTFA 1OCZB 3D3IA 1S5HC 3K3WA 3ETDA 3NXSA 3G6EV 1R3JC 4UVBA 3ETEA 2DQ3A 1MG1A 4BIZA 2Y48A 3OMNB 4CZZA 2BOCC 3ASNB 3SPGA 3QO7A 3CXCU 3OR7C 3MHSC 1BL8A 3IC7A 4MVOA 2QTOA 2XASA 4E2LA 5B3SB 1NKDA 1YSCA 1AJPA 4P9PA 2OCCB 4YXWG 2W6JG 3K08A 1M56B 3K0DA 1VQPV 1YJ9V 2IJHA 1MSWD 2ZQMA 2NNUA 1OCRC 4KUMA 5L3DA 1VQNV 4DO2A 2UXNA 3MD0A 2PI4A 1WPXA 3CCVV 1VQ5V 1K5SA 1L1FA 1GMGA 3B8MA 3I56V 2ZR2A 5KA6A 2X6CA 1S72V 2F43G 3JD0A 3AEIA 1P7BA 3CYOA 1M57B 1OCOC 4PA9A 2P6JA 4PDMA 1QVGU 1RPRA 4MS2A 3CD6V 1FXKB 1Q7YW 3WFVA 1MOFA 3SPIA 1RM1B 1YIJV 2AHZA 2PI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 V;  1KC8 W;  2OTL V;  1VQK V;  1NJI W;  1Q81 W;  4WF9 V;  4WFA V;  1VQM V;  1K8A W;  3G6E V;  3CCU V;  1YJN V;  1R73 A;  1VQ6 V;  1VQN V;  2QA4 V;  1VQ7 V;  1YIT V;  3CCV V;  5DM6 V;  3CCJ V;  1VQO V;  1QVF U;  3I55 V;  3G4S V;  1VQ5 V;  1JJ2 U;  1K9M W;  3CCL V;  1KD1 W;  3I56 V;  3CME V;  3CMA V;  1S72 V;  3CPW U;  3CXC U;  3CCR V;  3CC2 V;  1KQS U;  1VQ9 V;  4WCE V;  2QEX V;  3OW2 U;  3CC7 V;  1VQ4 V;  4WFB V;  2OTJ V;  1K73 W;  1QVG U;  1YI2 V;  1VQ8 V;  3CC4 V;  3G71 V;  3CCS V;  1Q86 W;  3CD6 V;  1M1K W;  3CCQ V;  3CCM V;  1YJW V;  1Q7Y W;  1Q82 W;  1VQL V;  1YHQ V;  1YIJ V;  1M90 W;  1W2B U;  1N8R W;  2D3O W;  3CCE V;  1VQP V; 
#chains in the Genus database with same CATH topology
 2Q68 A;  3HKC B;  4JI2 O;  1GM7 A;  4DR2 B;  1Z2G A;  2IH1 C;  2R9A A;  3BFR A;  5BR8 B;  1JA8 A;  2UXX A;  1W0K G;  1SQB H;  2BTQ A;  1GN4 A;  1SKV A;  4DUY O;  1VQ4 V;  1M56 C;  4O2B B;  3K03 A;  3CRQ A;  2WLH A;  1HNW O;  5JH7 A;  5B3S C;  3LNM B;  2FB5 A;  4O2A B;  1DF4 A;  4F4L A;  1YJN V;  2F4V B;  2B9Z A;  4PD4 F;  2R70 A;  1JJ2 U;  4B3S O;  1GN3 A;  2QWR B;  5CA1 B;  3FB7 C;  3VQV A;  5C93 A;  5LYJ A;  5IY5 B;  1KQS U;  2LP7 A;  5H5N A;  4O4H A;  1MZF A;  4B3T B;  2PF4 E;  4P30 A;  5FNV B;  4LF8 B;  1V55 C;  1OJH A;  1IDS A;  4MW3 A;  1WP7 A;  2Q7G A;  1AIL A;  2WPD G;  3FX7 A;  4TV8 B;  4FLT A;  1EN5 A;  2YIA A;  4UVC A;  1EZV H;  2KB1 A;  4U3F H;  4X1Y A;  3ZHT A;  4BIO A;  1HP8 A;  1FXH A;  3B77 A;  1I5Y A;  1IBK O;  3E83 A;  4JI0 B;  1Q6I A;  4K8Z A;  4O4L A;  1YF2 A;  3U0Z A;  1BMF G;  3L74 H;  4JI3 B;  4DYL A;  2XOK G;  5KMG B;  3KG2 A;  2XAH A;  4DV1 O;  1TVK A;  1P7G A;  1J5E O;  4FPP A;  3JD3 A;  1U97 A;  3C90 A;  5IY5 C;  4J7Z A;  5EC1 C;  1V54 C;  4BAY A;  3CCL V;  4I5S A;  1R6K A;  2CTP A;  2ZT9 B;  2Z0A A;  3BA9 A;  4LF5 O;  2W6I G;  4LWS A;  4MVQ A;  2L6L A;  3STL C;  2E75 B;  3PJS K;  1IXM A;  1M5I A;  1WB7 A;  1IBM B;  1XDC A;  2HR3 A;  3A0R A;  1RPO A;  2FML A;  3ZHQ A;  4U7O A;  1S5J A;  3CX5 F;  5LBQ A;  5LMU O;  4FMT A;  4UCV A;  1SQG A;  3OUS A;  5LXT A;  2Q5Z A;  3JD1 A;  3WB0 A;  4OXS A;  4DV7 B;  2NR5 A;  3JYC A;  4MW8 A;  4IL6 Z;  4D6T H;  1H2N A;  2UU9 B;  4B7K A;  4J10 A;  1FXK C;  5H9C A;  1DLB A;  4X1I A;  3S3X A;  1FKA O;  1M57 C;  2WLL B;  4EFB A;  2A9H A;  1Z5V A;  5J2T B;  2ZKO A;  4DV1 B;  3D36 A;  1I0H A;  4B3M O;  1HNW B;  4MVZ A;  1AI5 A;  2XAJ A;  2QEX V;  3TXS A;  3BHP A;  2A3Q A;  5L3B A;  2YEV A;  3SPC A;  1SES A;  4DR2 O;  1VIB A;  1VQL V;  4ZI7 A;  1IZ3 A;  4CS4 A;  4MTO A;  3IGA C;  4O4L B;  2BTO A;  4PI0 A;  4PI2 A;  3JD4 A;  3ABK C;  3IC9 A;  4JI7 B;  4DV4 O;  3OMI B;  4GKJ O;  3D3Q A;  5GW7 A;  1NVP D;  3WU2 Z;  1NVP B;  3SR2 C;  3ABK B;  5A2Q N;  1D2D A;  3IJ4 A;  4X66 B;  4LBE C;  2RNB A;  3AG3 C;  3WG7 C;  4JI1 B;  2OWO A;  4QE7 A;  4LFC B;  4KFM A;  1QU7 A;  4DK0 A;  1R3L C;  5LP6 A;  4MVS A;  5CB4 A;  2LFS A;  2JGD B;  5FNV A;  4LH6 A;  1HR0 O;  4FZ1 A;  5CN0 A;  1Q81 W;  3ZX6 A;  1K8A W;  2A79 B;  4X88 A;  4CS3 A;  1NTZ H;  3LUT B;  1URF A;  4DXW A;  2Y0I A;  5CA0 B;  2BE3 A;  3AG7 A;  4DW0 A;  1XMQ O;  3JAR A;  3N2K B;  1TA8 A;  3J7A U;  4JI2 B;  5LGU A;  2ZNI A;  5JCO C;  2JVD A;  3T2M A;  3N2G A;  1EZJ A;  1NT2 B;  2FTK A;  4J41 A;  1VQO V;  4ASU G;  5BMV B;  5A9G A;  2CGN A;  3HKB A;  3W7S A;  4G28 B;  1H2G A;  3EFF K;  2HKO A;  1ZTE A;  3BPZ A;  1THZ A;  1KBH A;  3CCM V;  2JJ1 G;  1WP8 A;  2F4V O;  3F7V C;  5KHK A;  4LFB B;  4Z1M G;  4PA4 A;  4I55 B;  1S76 D;  4JZG A;  3JD2 A;  2WLI B;  3ZHV A;  3W7U A;  3B2E E;  3WB1 A;  2R9R B;  1S0V A;  2YIC A;  1NTK H;  3QG5 A;  4JTD B;  4P2Z A;  5J9P C;  1NR7 A;  1Y74 A;  1K92 A;  2H94 A;  2KG7 B;  3BY6 A;  3QF7 A;  1Q82 W;  4KL1 A;  3JAS B;  2ITC C;  5D5Q A;  1FYJ A;  2WSS G;  4FK5 C;  3HPL C;  2QJ1 A;  2PGG A;  3ZRW A;  4FFK A;  1PNK A;  4UB8 Z;  3R66 A;  2QR4 A;  3OT7 A;  1COW G;  2ZIN A;  1R6N A;  1HNZ O;  4YHH O;  3HKC A;  4QIW F;  1JOY A;  2KQX A;  4CS2 A;  1W0J G;  1F4M A;  4ZIB A;  1Q8I A;  4TUY B;  2JEU A;  3T1H B;  1M1K W;  4DRX A;  3M8A A;  2G38 A;  3UO2 A;  2EIK C;  3HKD A;  4D7S A;  1FPO A;  4I0X B;  4ZHQ B;  2GBO A;  3SYP A;  1PL4 A;  5KAF Z;  1O9H A;  4YJ3 B;  1H38 A;  1KP3 A;  2UUB B;  1H2S B;  3M7M X;  1ARO P;  1B6Q A;  4JYB A;  1V55 B;  2HVK C;  2IW5 A;  3CJH A;  5EBM C;  4NXM B;  3CC4 V;  3ZRS A;  4GZR B;  3LSS A;  4PA3 A;  1N34 B;  5JJJ B;  5L3E A;  4JI7 O;  3NXS A;  4UVB A;  3KCY A;  3SJC C;  1Y6X A;  2K9P A;  1UPG A;  3OMN B;  1YDX A;  2BOC C;  2F1M A;  4NB5 A;  3MHS C;  3HKB B;  5LMU B;  4E2L A;  2FYU H;  1YSC A;  2R72 A;  2W6J G;  3K0D A;  4YHH B;  1OCR C;  4YJ3 A;  4DO2 A;  1WPX A;  5KA6 A;  1YVW A;  3AEI A;  2LO1 A;  3CYO A;  1HR0 B;  2P6J A;  5E79 Z;  4LF4 O;  1QVG U;  1Q7Y W;  3WFV A;  1TUB A;  3L72 H;  4OPA A;  1PD3 A;  3IFX A;  4RQF A;  3THO A;  4ZOL A;  1AJQ A;  1Y4M A;  4DR1 O;  3RVZ A;  4I9Q A;  1NH2 D;  1NH2 B;  4WFH A;  4LFA O;  3SYC A;  5DED A;  4OX9 O;  3N2K A;  1Q90 D;  1MSD A;  1IBL B;  3D36 C;  2HEP A;  4PHZ A;  3N2G B;  2HJD A;  4ZBM A;  4DV0 B;  4X9Q A;  4YJ2 B;  2VWJ A;  4JI6 B;  4R6Z A;  4K0K O;  3OM3 B;  5CA3 A;  2F95 B;  3QVN A;  1VF5 B;  2Y4U A;  4FLV A;  1P4R A;  4PA7 A;  1B3Q A;  3D8C A;  5IE9 A;  5IJ9 B;  4PDV A;  2LFR A;  3UT5 A;  3BEH A;  1B06 A;  1EFR G;  2QM4 A;  1AP6 A;  5IWA O;  4QE9 A;  2GV9 A;  4QNH B;  4JAA A;  1EN6 A;  1M93 A;  4CBC A;  1K9M W;  1FJG O;  3E8F A;  3G67 A;  1JQ0 A;  1XMO B;  3RN4 A;  1GRJ A;  5CBG A;  1PM9 A;  2CK3 G;  4UVA A;  4X20 A;  5LGT A;  3OEE G;  3RYI B;  5GON A;  4DR5 O;  1T5E A;  3K57 A;  2EIN B;  4OGQ B;  3ZMU A;  4B3R O;  2Y4T A;  4TOI A;  4X62 B;  1SA0 B;  1D5N A;  4LF7 O;  4FJC C;  4X1I B;  4I50 A;  4B7E A;  2Q69 A;  3UQ8 A;  3ZIA G;  2EX3 A;  1HNZ B;  4WFA V;  3HKE A;  1JFF A;  4HBN A;  4NTY A;  4CC6 A;  1HNX B;  1PP9 H;  4FFB B;  1TGO A;  1GM9 A;  4GLX A;  4X1K A;  5IDJ A;  1AVM A;  3EXA A;  3UT5 B;  1Q6U A;  5IYC O;  3JCZ A;  5L3G A;  2RDC A;  4QPK A;  3UKM A;  4CH3 A;  3CCE V;  2HJF C;  1GO3 F;  4IYH A;  1MA1 A;  1TUB B;  3E86 A;  5GON B;  1CEZ A;  4NR1 A;  3N27 A;  2HLD G;  1GH6 A;  2ZCE A;  2EBO A;  4MTG A;  2ITD C;  1AI4 A;  3P3N A;  4RO2 A;  3F5T A;  4X65 O;  1NS1 A;  3FYE B;  2XAQ A;  1VQ9 V;  5EIB C;  3ABM B;  1H2M A;  1AI7 A;  3S3W A;  3U11 A;  4JTA B;  5JWP A;  1GKF A;  3UO3 A;  1XIL A;  2IU0 A;  3CWB H;  1F23 A;  2ETN A;  4JAS A;  1AB3 A;  2YXL A;  3CRR A;  4LF6 B;  2ZM6 B;  4FM0 A;  2CAZ C;  4EKW A;  5CMU A;  2ZE6 A;  4CC5 A;  5EYP B;  3K59 A;  4DV6 B;  2B5U A;  4UV8 A;  1SC5 B;  3AG4 C;  4G2K A;  5LA6 A;  1GN6 A;  3ML0 A;  1H8E G;  4NTX A;  4GX5 A;  1N0J A;  1GAX A;  2DWE C;  1VQ7 V;  2DW4 A;  5IJ0 A;  1E79 G;  1XHZ A;  3ETQ A;  3K5O A;  3SDL A;  2ZE8 A;  2OIE A;  1L0N H;  4UCU A;  4ZKI A;  2EUL A;  3STZ C;  1XOU A;  1RSO B;  1YI2 V;  2WLL A;  2YXH A;  1M4U A;  1TUE B;  3RYH A;  1XRE A;  1IXB A;  1O9G A;  3A2F A;  5EK0 A;  1WPB A;  4CH6 A;  2IU3 A;  2O57 A;  2ZXW B;  4RWU A;  2VS0 A;  5BMV A;  5IJ9 A;  1R1B A;  4DUY B;  1HWY A;  3K5L A;  3CME V;  3JAK B;  1XI1 A;  1IX9 A;  1IBM O;  4P9O A;  4PV1 B;  4DUZ O;  4WBN A;  1K73 W;  2Q8V A;  4DR4 B;  3X2Q C;  5IYZ A;  3P32 A;  4JI8 O;  3TK1 A;  3GWO A;  4N23 A;  5B1A C;  1ENV A;  4JYA B;  1LUV A;  1R73 A;  5DN6 G;  3L9D A;  3SYQ A;  4LF7 B;  4TQF A;  1Y74 B;  4I50 B;  5FPO A;  4LP8 A;  3CE2 A;  1QBZ A;  4UXN A;  4BW5 A;  1K97 A;  2IJI A;  3AG1 B;  5LYJ B;  1DTO A;  1IUR A;  4EFE A;  4X1K B;  5B1B B;  3MDS A;  3AK3 A;  2AHY A;  4BW9 A;  4GKK O;  3EHB B;  4ZHQ A;  3E22 A;  5CBF A;  2W0F C;  3DTU B;  3VQY A;  3OTO B;  1Y76 B;  1SF9 A;  1BQZ A;  3A0B Z;  4R8C A;  2AXT Z;  4Q20 A;  1YJW V;  1IBL O;  3AG2 C;  3F7Y C;  4H0L B;  1ZX3 A;  3ABL C;  2E74 B;  4MTX A;  4AQY B;  3ZMV A;  4DV0 O;  1KUQ A;  5B66 Z;  4RUF A;  3SGI A;  2A7W A;  1GK9 A;  4O4I B;  3RYF B;  1YZB A;  2N74 A;  3TET A;  4WCE V;  4BR6 A;  4G27 B;  1FD9 A;  2YUA A;  4NXM O;  4WF9 V;  3OFN G;  4Z2W A;  3LNN A;  1EN4 A;  4UUJ C;  2XAF A;  4H33 A;  3RYC A;  3CPW U;  1LR1 A;  3Q4H A;  2UXC B;  1Q86 W;  5KLV H;  1XMO O;  4LF6 O;  1NBM G;  2OIG A;  5BZB A;  2Y69 C;  2OTL V;  1G6U A;  2DQ0 A;  3KCX A;  2RCV A;  3I55 V;  3VBB A;  2PYL A;  1FS0 G;  4LF8 O;  1Y66 A;  3ASO C;  5TIS Z;  3CC2 V;  3W7T A;  1SS3 A;  1YXB A;  1S5L Z;  4HNA B;  3H1H H;  2RJZ A;  4RAI A;  2E76 B;  4F6E A;  4AHC A;  2DYS C;  2Q67 A;  2EIJ B;  4ZI7 B;  5CBH A;  4XDJ A;  2Z3Y A;  3PN1 A;  3CS5 A;  1KYO F;  4DUZ B;  2UXD O;  2QGN A;  3FYI B;  4JV5 O;  2F66 C;  3APO A;  4JAU A;  1G4Y B;  4DK1 A;  1N33 O;  4IIJ A;  4Z1V A;  1SQQ H;  4JYA O;  4XDK A;  3BA8 A;  1N32 B;  3RYI A;  1EM1 A;  3G6B A;  4O4H B;  1OCZ B;  3D3I A;  1S5H C;  2Q4P A;  2EJ7 A;  3APQ A;  1VAR A;  3ETE A;  2N04 A;  4IHJ B;  2Y48 A;  1NU1 H;  4CZZ A;  4E4E A;  1BQ0 A;  3ASN B;  3QO7 A;  1GN2 A;  3OR7 C;  1BL8 A;  4MVO A;  4PJ0 Z;  2P22 C;  4ICG A;  2VWK A;  1AJP A;  4YXW G;  4JI1 O;  3K08 A;  4FM2 A;  1VQP V;  1OV9 A;  2Q9L A;  2Q7H A;  4DV7 O;  2ZQM A;  1FFX A;  3FAV A;  1KMI Z;  2UXN A;  4FLW A;  4I0X A;  2ZR2 A;  2LGW A;  1SQP H;  2F43 G;  3JD0 A;  4J42 A;  1G1X B;  4X64 O;  3BAA A;  1SQV H;  3K5N A;  4F6R A;  1OCO C;  3Q4H B;  4MS2 A;  5J2U A;  1MOF A;  1VP7 A;  1RM1 B;  3CRM A;  2PI5 A;  4EEQ A;  5LOV B;  2YIB D;  3E8H A;  2EZP A;  3K79 A;  3MHH C;  5D5P A;  5LP6 B;  1W59 A;  4I9W A;  1AI6 A;  1K5Q A;  2QSA A;  2QE7 G;  1BS3 A;  3KKY A;  4QPJ A;  2ATK C;  3CP1 A;  3OUF A;  1QR9 A;  4RUE A;  3C3T A;  1YTF B;  1YTF D;  1I5X A;  1KP2 A;  5EC2 C;  2LQT A;  1ZUQ A;  1MNG A;  2OCC C;  3JAR B;  2H8P C;  5FLX N;  2AGA A;  1K7D A;  5JJN B;  2DYR B;  2P5O A;  3OE7 G;  3H1J H;  3UM7 A;  4DW1 A;  2N05 A;  2WLI A;  1YCI A;  2JJ2 G;  3KZI Z;  2QKC A;  4L8J A;  4QGP A;  5J2U B;  3L75 H;  4MVR A;  3SPJ A;  5H6R A;  3O9O A;  3H1L H;  4R50 A;  4LF5 B;  1W2B U;  1Q43 A;  3CSX A;  3QO8 A;  4J9Y B;  3ZJZ A;  1R3I C;  2GHY A;  2DOS A;  2P4K A;  1NQT A;  4MSW C;  3RYC B;  4DR6 O;  2CE4 A;  2YS8 A;  1OCC C;  3RBZ A;  1MZE A;  3B8N A;  1DF5 A;  2ZR3 A;  4FLX A;  1KU9 A;  5KHI A;  2EIJ C;  5DEC A;  2CGO A;  1BHB A;  1XHX A;  4HAM A;  3OR6 C;  1ROP A;  2P90 A;  2DE0 X;  3ZCC A;  1D5A A;  1NI8 A;  3ASO B;  1XMQ B;  2CH7 A;  3RYH B;  1ZWI C;  3OTO O;  2M7W A;  1X59 A;  1Q6H A;  2E5L B;  3T4D A;  1OCC B;  3OGC C;  2VQF B;  3C3S A;  1BT8 A;  5IYZ B;  2QWP B;  3ZN1 A;  1VMG A;  2YDE A;  2PZS A;  1F51 A;  5C8Y B;  2B1I A;  2Y0P A;  5FPR A;  4TV8 A;  1B04 A;  5HFM A;  1VF7 A;  2JGU A;  4GYC B;  2P06 A;  1LNQ A;  1XBL A;  2QWQ B;  4FM1 A;  2Q73 A;  2HFE C;  2ODM A;  4X8A A;  2BSK B;  3H1I H;  4KXR A;  1XNQ B;  3JCU Z;  4DV5 O;  3H1K H;  3LSQ A;  3VQX A;  4DV3 B;  2Z5U A;  3E89 A;  2IBZ H;  3CC7 V;  2EZO A;  1Q3E A;  2Q6A A;  5B5E Z;  3FB5 C;  1R3K C;  1RP3 B;  1TVK B;  1M90 W;  5E1A C;  5KAI Z;  3BAB A;  4JF3 A;  4DV4 B;  1NJI W;  3FFQ A;  5J2T A;  2Q0A A;  2ZIM A;  1KKC A;  4JZ2 A;  4WFG A;  4LFB O;  3GWK C;  3DGE A;  1XL4 A;  1KEC A;  3H9V A;  1QLE B;  4UCS A;  3RT3 C;  3FD9 A;  5C8Y A;  2JK5 C;  3M99 B;  2H3O A;  4GUN A;  5LP6 C;  4WFB V;  1P84 F;  1IBK B;  4NXN B;  1VQ8 V;  1RM1 C;  3AG2 B;  4UB6 Z;  2PY5 A;  1N8R W;  2KKW A;  4LFC O;  1KB9 F;  1I94 B;  1WLE A;  4OX9 B;  3T4Z A;  1UFI A;  3VOU A;  4H44 B;  4JI4 O;  3E35 A;  2IH3 C;  3E2E A;  2GTA A;  2V7Q G;  1J95 A;  3OMA B;  5JQG A;  2P7T C;  4BIU A;  3HB3 B;  1AR4 A;  5BXZ A;  5LHI A;  4RQE A;  5H6Q A;  4YY3 O;  2QA4 V;  2MK3 A;  3ASN C;  3JAT A;  3BVO A;  1FXV A;  3DSQ A;  2HHH O;  2PYJ A;  1N32 O;  3UCS C;  1OCZ C;  3ABT A;  5IJ0 B;  1N36 B;  1PL0 A;  4K0K B;  1LUW A;  1ZLZ A;  1F7Y A;  4FLZ A;  5IYB O;  3CRA A;  4TT3 G;  4J7K A;  1SZX A;  1M9N A;  3RW0 A;  2LGQ A;  3DC6 A;  5F2V O;  3J80 N;  2JDI G;  3F5W C;  3ZMT A;  4MVU A;  3JSN A;  4JGS A;  4D7T A;  1JPX A;  3J81 N;  4JI5 B;  1VF6 C;  1PV0 A;  2PUS A;  3DXR B;  1JX9 A;  1ZAU A;  1VEW A;  2RMK B;  2UXB O;  4TWK A;  3A0H Z;  3DC5 A;  3W7X A;  4UCO A;  5IYD O;  3W7W A;  2DN9 A;  4B08 A;  2P4V A;  2QM8 A;  1FXK A;  4IT5 A;  3JAW A;  1KD1 W;  4FFB A;  2XAG A;  2ARH A;  4DR1 B;  1AR5 A;  2X0L A;  3E8B A;  3I5D A;  4O4J A;  4WFE A;  4LFA B;  2KSD A;  1JFF B;  2DWD C;  1HNX O;  3AG4 B;  2BTQ B;  3T1C A;  1F4N A;  2QWO B;  2M6Y A;  3CCU V;  1QCE A;  1Y76 A;  1XEQ A;  5LXT B;  2EIM B;  2DJV A;  1N4C A;  3NR7 A;  4O2B A;  5BY1 A;  2EIL C;  2ZNJ A;  3H01 A;  3B09 A;  1U96 A;  2EIL B;  4JAV A;  3ABM C;  5IWA B;  1SQF A;  4DV3 O;  4X66 O;  1YIT V;  3ETG A;  3EVK A;  1NZ6 A;  2EIM C;  4O4J B;  1FFX B;  2NN4 A;  5GTH Z;  2ZM6 O;  1G8M A;  1EBO A;  2JIZ G;  3ABL B;  2OTJ V;  2V1D A;  5ITZ A;  1L8D A;  2AZ2 A;  3OAA G;  5JJE B;  3QO5 A;  3RYF A;  4JYY A;  4MT8 A;  3L71 H;  4JI4 B;  2V4D A;  1X4T A;  2C2A A;  5EYP A;  2CDY A;  1JCH A;  3G4S V;  3IAY A;  3B4S A;  5LOV A;  5KX5 B;  3CMA V;  1S77 D;  2LW1 A;  3CCR V;  2A06 H;  3K0G A;  2IM9 A;  2E5L O;  2XHB A;  3OW2 U;  2ADP A;  2JGD A;  4K35 A;  2WLJ A;  3O65 A;  4I4T B;  2DMX A;  4YIP A;  3AG1 C;  1A32 A;  1AJN A;  5HFL A;  1BCC H;  4I7Z B;  3K06 A;  2LW7 A;  4YIO A;  1TAE A;  5LMN O;  3U10 A;  4LNU A;  1J5E B;  2IJJ A;  4K3A A;  4GX0 A;  3K58 A;  1E1R G;  4EB6 A;  3K9A A;  1H8H G;  5BR8 O;  5CB4 B;  2JEX A;  2ZDI C;  3JAK A;  2JRI A;  4WBN B;  1E1Q G;  4DV5 B;  3K3W A;  3JAM N;  3ETD A;  4OPH A;  5GTI Z;  5LL6 Y;  4BIZ A;  3HKE B;  2F93 B;  3OGI B;  3CXC U;  4J80 A;  3IC7 A;  2QTO A;  4J11 A;  4LH7 A;  4P9P A;  1BSM A;  2OCC B;  1YJ9 V;  3JAL A;  2NNU A;  4IIJ B;  1P49 A;  4KHP B;  4B3T O;  2RQ6 A;  1K5S A;  1GMG A;  3B8M A;  2LJ2 A;  4AIL C;  1P7B A;  2ZE7 A;  2OYQ A;  2UXB B;  4DR6 B;  1RPR A;  3CD6 V;  4AQY O;  1YIJ V;  3JSL A;  2WWW A;  2UUB O;  2RN9 A;  2HG5 C;  1QHT A;  4LC1 A;  4NVP A;  3L73 H;  4F6R B;  1QLE C;  3TJT A;  3ABU A;  1PPJ H;  4O2A A;  3WB2 A;  4A5U B;  5KHJ A;  1Z5W A;  3JAS A;  4CH4 A;  3G71 V;  1GM8 A;  1L0L H;  4ABM A;  2VQE B;  2QKS A;  2B1G A;  4UCR A;  2QM7 A;  4I4T A;  5LHH A;  5EZY A;  5JVD B;  5EIB D;  4DV2 B;  2XUM A;  2W0X A;  2WLM A;  2ZIO A;  1QVF U;  1WN7 A;  5AG2 A;  2X7R B;  3K5M A;  1SA0 A;  4TUY A;  1WJZ A;  4TQD A;  4YY3 B;  3ZED A;  2AZ0 A;  1WA8 B;  2K1E A;  4N21 A;  2QKA A;  1RSO A;  4KHP O;  1H2L A;  1BZK A;  4GKJ B;  1VQ6 V;  1ZL8 A;  3ZRV A;  4DR3 B;  5KHG A;  2UXC O;  2YI8 A;  2ZE5 A;  3ZRX A;  1Y67 A;  2A0L A;  2DYS B;  4FLU A;  4TSF G;  2EIK B;  1DK1 A;  5LGN A;  3ZHS A;  3ZMS A;  1YHQ V;  3ZBH A;  3OD4 A;  2GTS A;  3CXH F;  5CA0 A;  2EIN C;  1JR9 A;  1I94 O;  4X89 A;  5LMN B;  1I08 A;  5EBL C;  1N34 O;  2XND G;  1ORQ C;  3LSU A;  4W4K A;  4BWA A;  4GKK B;  5JQG B;  3T1Y B;  2Y69 B;  1RFY A;  1K4C C;  5K1X A;  4W4L A;  2ILM A;  4TV9 B;  1XNR O;  2KG7 A;  4GT1 A;  2ZDI A;  4JPR A;  1HW7 A;  2JS5 A;  2DYR C;  1OZ0 A;  1V9P A;  3SJA C;  4DR7 O;  4GX2 A;  5LA6 B;  3AK1 A;  1PNL A;  1QNM A;  2BSK A;  2BCC H;  1FFT B;  5CA1 A;  1WAZ A;  2GSM B;  2WAM A;  5JCO A;  1PNM A;  5KHH A;  3K9S A;  2XTA A;  3OTF A;  2WA3 A;  2YEV B;  4LF9 O;  3ZRW B;  4H37 A;  2AW9 A;  2CH7 B;  3JAW B;  2QTS A;  3LDC A;  2GDS A;  3QNE A;  3ZN0 A;  4JTC B;  3G80 A;  1KC8 W;  1OCO B;  4JI5 O;  4WFF A;  3CJH B;  4AI8 A;  5KUM A;  1ZL8 B;  3FAV B;  1OCR B;  5LHG A;  2UXD B;  5B1B C;  1SQX H;  3OEH G;  3HKD B;  4PEL A;  4DV2 O;  4QJF B;  2YI9 A;  2ADQ B;  3GB7 C;  1S3J A;  1XNR B;  4UFZ A;  4L87 A;  4X20 B;  1VQK V;  4CH5 A;  2VQE O;  2BOB C;  3K04 A;  4X1Y B;  4HZ3 A;  4FLY A;  1I7F A;  3SJQ C;  2YC0 A;  1NR1 A;  4HYO A;  4KP4 A;  5L3C A;  1N0N A;  2NLJ C;  5B1A B;  3ZS8 C;  1XUQ A;  2YXY A;  2D2C B;  4PDR A;  1XQ8 A;  2CTR A;  2VRZ A;  4LWS B;  5EZY B;  1GTO A;  5KMG A;  5KA5 A;  1QLN A;  2FKX A;  2WA4 A;  5JVD A;  1SRY A;  1CPY A;  5K1P A;  4K8X A;  3R65 A;  3SJB C;  5ITZ B;  4FZ0 A;  3E22 B;  2FL4 A;  3SYA A;  1JVM A;  5FL7 G;  1CXZ B;  2GUZ A;  1QQC A;  3FKS G;  2ZXW C;  4UV9 A;  4I55 A;  3JAT B;  4ZOL B;  3QTC A;  3ICX A;  5KX5 A;  4HNA A;  2XT9 A;  4FIP C;  4NTW A;  2X6B A;  4DR5 B;  2EJR A;  4U3J A;  1MAB G;  2VQF O;  2UUA O;  2IJK A;  3LDD A;  2WLK A;  2QDO A;  3B40 A;  1WNS A;  2R9I A;  1VF6 A;  2CUG A;  4H13 B;  4LF4 B;  4LCU C;  4NYK A;  3FB6 C;  4PDL A;  4LR3 A;  1SET A;  2UUC O;  3LDE A;  2YID A;  3BCC H;  4EB6 B;  4X64 B;  4GCZ A;  1XL6 A;  4JI3 O;  2WLN A;  2HP8 A;  3CCJ V;  2MW2 B;  4MVM A;  4DR7 B;  4JI6 O;  4YJ2 A;  4JYC A;  3ZHR A;  3CRC A;  4R7C A;  1KKD A;  1FAF A;  3TXQ A;  4FVM A;  4JI8 B;  1K4D C;  4IGG A;  1XNQ O;  3GVM A;  4B3S B;  3AK2 A;  1UJW B;  1MMM A;  4JV5 B;  3CCQ V;  4J9Z B;  4IYI A;  4U7N A;  3RWR D;  1SZT A;  1N33 B;  3ZMZ A;  1DGS A;  1K3E A;  1WB8 A;  1K33 A;  3DXR A;  2OCH A;  5B1N A;  5DM6 V;  3ZHU A;  4J7J A;  1V54 B;  3E8G A;  2ZD9 A;  1H2K A;  2UU9 O;  4DR3 O;  3SPH A;  1CP9 A;  3HR0 A;  1OHH G;  5KUK A;  3A8T A;  3JAL B;  1YEW A;  3RVY A;  4NKG B;  1US6 A;  1PKX A;  1AR1 B;  4PA6 A;  2L35 A;  5L3F A;  4DRX B;  4DV6 O;  4NXN O;  1FJG B;  4JI0 O;  3SYO A;  2PTM A;  2GUZ B;  1NTM H;  2HVJ C;  3CHX A;  2CTW A;  4GX1 A;  3P30 A;  1BHA A;  3L70 H;  5B1O A;  2X6A A;  4IHJ A;  1VQM V;  3RGB A;  1QR8 A;  5H2F Z;  3WG7 B;  3AG3 B;  2HHH B;  1R6T A;  2CTQ A;  4B3M B;  3CEI A;  4XDL A;  3TCU A;  1WA8 A;  3BRC A;  3T1Y O;  1N36 O;  4XBF A;  2P67 A;  2OT5 A;  2YSU B;  3MAQ A;  3P3P A;  1SER A;  3FB8 C;  3CCS V;  5EBW C;  1K34 A;  4X65 B;  3X2Q B;  2D3O W;  4MTF A;  2Q7E A;  4DR4 O;  3CB2 A;  3G6E V;  1R3J C;  2DQ3 A;  4C7U A;  1MG1 A;  2F23 A;  4O4I A;  3TGU H;  3SPG A;  4Q6G A;  2JS3 A;  2XAS A;  5B3S B;  2Q0O C;  1NKD A;  4LF9 B;  2YIB A;  1IVS A;  3RFR A;  1M56 B;  4UCT A;  2IJH A;  1MSW D;  1BGY H;  4KUM A;  5L3D A;  1VQN V;  1HDJ A;  3MD0 A;  2PI4 A;  5JH7 B;  3CCV V;  2UUC B;  1VQ5 V;  1Q5O A;  1BE3 H;  1L1F A;  3I56 V;  3T1H O;  2X6C A;  1S72 V;  5IT9 N;  4LNU B;  2QWN B;  1M57 B;  4PA9 A;  4PDM A;  2E3C A;  1AP5 A;  3VQW A;  4B3R B;  2UUA B;  1FXK B;  1JMK C;  4TV9 A;  1JJO A;  4X62 O;  1ZSP A;  4U3J B;  3SPI A;  2AHZ A; 
#chains in the Genus database with same CATH homology
 2Q68 A;  1PD3 A;  3IFX A;  2WWW A;  4RQF A;  3E8H A;  2EZP A;  1GM7 A;  2HG5 C;  3K79 A;  3MHH C;  1AJQ A;  1Y4M A;  4LC1 A;  3RVZ A;  4I9W A;  1AI6 A;  1K5Q A;  2IH1 C;  1NH2 D;  4WFH A;  1NH2 B;  2QE7 G;  1QLE C;  3ABU A;  3SYC A;  4QPJ A;  2ATK C;  3CP1 A;  3OUF A;  1QR9 A;  2UXX A;  1W0K G;  4RUE A;  1YTF B;  1YTF D;  1VQ4 V;  1I5X A;  1KP2 A;  5EC2 C;  1M56 C;  3G71 V;  3K03 A;  1GM8 A;  2WLH A;  2OCC C;  2QKS A;  2B1G A;  2QM7 A;  4ZBM A;  5LHH A;  2H8P C;  5B3S C;  4R6Z A;  3LNM B;  1DF4 A;  4F4L A;  1K7D A;  1YJN V;  3OM3 B;  5CA3 A;  2DYR B;  2WLM A;  1QVF U;  3OE7 G;  1JJ2 U;  1P4R A;  3UM7 A;  4PA7 A;  2WLI A;  2X7R B;  3FB7 C;  2JJ2 G;  5C93 A;  5IY5 B;  4PDV A;  1KQS U;  2LFR A;  3SPJ A;  3BEH A;  4MVR A;  2K1E A;  2LP7 A;  4N21 A;  1EFR G;  5H6R A;  4QE9 A;  4R50 A;  4QNH B;  1W2B U;  4CBC A;  1K9M W;  3QO8 A;  4P30 A;  4J9Y B;  3E8F A;  3ZJZ A;  1JQ0 A;  1R3I C;  2GHY A;  1V55 C;  1VQ6 V;  5CBG A;  2CK3 G;  5LGT A;  4UVA A;  4MW3 A;  1NQT A;  3OEE G;  3ZRV A;  4MSW C;  1OCC C;  3RBZ A;  3B8N A;  2EIN B;  1DF5 A;  2ZR3 A;  3ZMU A;  3ZRX A;  2A0L A;  2WPD G;  2EIJ C;  4UVC A;  2DYS B;  4TSF G;  1BHB A;  2EIK B;  4FJC C;  2KB1 A;  5LGN A;  2Q69 A;  3ZMS A;  1YHQ V;  4HAM A;  3OR6 C;  1FXH A;  1ROP A;  3B77 A;  1I5Y A;  2P90 A;  3ZIA G;  3E83 A;  3ZCC A;  4WFA V;  3ASO B;  1ZWI C;  2EIN C;  2M7W A;  1BMF G;  1OCC B;  3T4D A;  4X89 A;  1GM9 A;  3OGC C;  5IDJ A;  2XOK G;  3KG2 A;  5EBL C;  5IYC O;  3ZN1 A;  2XND G;  1ORQ C;  3JCZ A;  5L3G A;  1F51 A;  2XAH A;  2B1I A;  2Y69 B;  4QPK A;  4FPP A;  5HFM A;  3UKM A;  3JD3 A;  3CCE V;  1K4C C;  1LNQ A;  1GO3 F;  2HJF C;  3E86 A;  5IY5 C;  1CEZ A;  2HFE C;  5EC1 C;  1V54 C;  4X8A A;  4BAY A;  2HLD G;  3CCL V;  2EBO A;  4GT1 A;  4I5S A;  1R6K A;  2ITD C;  4MTG A;  2ZDI A;  3LSQ A;  4JPR A;  1AI4 A;  2Z5U A;  2DYR C;  1OZ0 A;  4RO2 A;  3E89 A;  3FYE B;  2W6I G;  2XAQ A;  1VQ9 V;  3ABM B;  4GX2 A;  4MVQ A;  3CC7 V;  3STL C;  1AI7 A;  2EZO A;  2Q6A A;  3FB5 C;  1R3K C;  4JTA B;  3PJS K;  1PNL A;  1GKF A;  1IXM A;  2IU0 A;  1M90 W;  5E1A C;  1F23 A;  4JAS A;  4JF3 A;  1FFT B;  1NJI W;  2HR3 A;  3A0R A;  2GSM B;  2WAM A;  1RPO A;  1PNM A;  4U7O A;  4WFG A;  3DGE A;  5LBQ A;  1XL4 A;  4EKW A;  4FMT A;  5CMU A;  1KEC A;  2YEV B;  3OUS A;  1QLE B;  3ZRW B;  2JK5 C;  4H37 A;  3M99 B;  3JD1 A;  4OXS A;  4WFB V;  1VQ8 V;  2B5U A;  3JYC A;  4MW8 A;  4UV8 A;  3LDC A;  1RM1 C;  3AG4 C;  4G2K A;  3AG2 B;  3QNE A;  1FXK C;  3ZN0 A;  4JTC B;  1N8R W;  5H9C A;  3ML0 A;  1H8E G;  1DLB A;  1KC8 W;  1OCO B;  1WLE A;  1M57 C;  2WLL B;  4GX5 A;  2A9H A;  3T4Z A;  2DWE C;  1VQ7 V;  4WFF A;  2DW4 A;  5KUM A;  3VOU A;  1E79 G;  3E35 A;  2IH3 C;  3D36 A;  3E2E A;  4MVZ A;  1OCR B;  1AI5 A;  5LHG A;  2XAJ A;  4ZKI A;  2QEX V;  3STZ C;  5B1B C;  2V7Q G;  3OEH G;  1J95 A;  1YI2 V;  2WLL A;  3OMA B;  1TUE B;  4PEL A;  5L3B A;  2YEV A;  3SPC A;  1SES A;  4QJF B;  3GB7 C;  2P7T C;  1VQL V;  1S3J A;  4BIU A;  5EK0 A;  3HB3 B;  4L87 A;  2IU3 A;  5LHI A;  1VQK V;  4RQE A;  2ZXW B;  5H6Q A;  2BOB C;  2QA4 V;  3K04 A;  2MK3 A;  4HZ3 A;  3ASN C;  4MTO A;  3IGA C;  1HWY A;  3CME V;  1FXV A;  3SJQ C;  1NR1 A;  3JD4 A;  3ABK C;  4HYO A;  4KP4 A;  5L3C A;  2NLJ C;  5B1A B;  4P9O A;  1OCZ C;  3ABT A;  4PDR A;  1K73 W;  1PL0 A;  3OMI B;  3X2Q C;  1GTO A;  3P32 A;  5KA5 A;  1QLN A;  3TK1 A;  1SRY A;  1CPY A;  5IYB O;  4TT3 G;  3GWO A;  3R65 A;  4N23 A;  5B1A C;  5GW7 A;  1ENV A;  1NVP D;  1NVP B;  1R73 A;  3ABK B;  1M9N A;  5DN6 G;  3SYQ A;  3SYA A;  3RW0 A;  1JVM A;  5FL7 G;  2JDI G;  3FKS G;  4LBE C;  3F5W C;  3ZMT A;  3AG3 C;  4MVU A;  3WG7 C;  4JGS A;  4LP8 A;  2ZXW C;  4UV9 A;  1QBZ A;  4QE7 A;  4UXN A;  4KFM A;  1JPX A;  1R3L C;  4BW5 A;  1K97 A;  4MVS A;  2IJI A;  3AG1 B;  2LFS A;  1JX9 A;  1DTO A;  4FIP C;  4TWK A;  3W7X A;  2X6B A;  5IYD O;  5CN0 A;  5B1B B;  2EJR A;  3W7W A;  1Q81 W;  1MAB G;  1K8A W;  2A79 B;  4X88 A;  2QM8 A;  2AHY A;  1FXK A;  2IJK A;  3LDD A;  2WLK A;  3LUT B;  2R9I A;  4DXW A;  4LCU C;  3EHB B;  1KD1 W;  2XAG A;  3FB6 C;  5CBF A;  4PDL A;  1SET A;  2W0F C;  3DTU B;  2X0L A;  3E8B A;  4WFE A;  3LDE A;  4R8C A;  2DWD C;  5LGU A;  4Q20 A;  1YJW V;  3AG2 C;  3AG4 B;  3F7Y C;  3T1C A;  1F4N A;  4GCZ A;  3T2M A;  1XL6 A;  3ABL C;  1EZJ A;  3CCU V;  1QCE A;  4MTX A;  2WLN A;  3ZMV A;  2FTK A;  1VQO V;  3CCJ V;  4MVM A;  4ASU G;  2EIM B;  4JYC A;  4RUF A;  4R7C A;  1KKD A;  3W7S A;  1GK9 A;  1K4D C;  4G28 B;  3TET A;  4WCE V;  1H2G A;  3EFF K;  1UJW B;  2EIL C;  2HKO A;  3H01 A;  1THZ A;  4G27 B;  3CCQ V;  3CCM V;  4J9Z B;  2JJ1 G;  4U7N A;  1SZT A;  3F7V C;  3ZMZ A;  4Z1M G;  2EIL B;  4JAV A;  4PA4 A;  1S76 D;  3ABM C;  3JD2 A;  1K3E A;  4WF9 V;  3OFN G;  1K33 A;  1YIT V;  2WLI B;  3ETG A;  4UUJ C;  5B1N A;  5DM6 V;  2XAF A;  3W7U A;  2EIM C;  2R9R B;  1S0V A;  1V54 B;  4H33 A;  3E8G A;  2ZD9 A;  4JTD B;  4P2Z A;  3CPW U;  1G8M A;  5J9P C;  1NR7 A;  3SPH A;  1EBO A;  1K92 A;  2JIZ G;  3ABL B;  2H94 A;  2OTJ V;  2V1D A;  3BY6 A;  1CP9 A;  1Q86 W;  1OHH G;  3OAA G;  5KUK A;  1Q82 W;  1NBM G;  3QO5 A;  2ITC C;  5BZB A;  2Y69 C;  3RVY A;  2WSS G;  4FK5 C;  1PKX A;  2DQ0 A;  4MT8 A;  3HPL C;  4PA6 A;  1AR1 B;  2C2A A;  2OTL V;  3ZRW A;  5L3F A;  1PNK A;  1JCH A;  1COW G;  3I55 V;  3G4S V;  1R6N A;  3CMA V;  3VBB A;  1FS0 G;  4QIW F;  3SYO A;  1Y66 A;  1S77 D;  1JOY A;  1W0J G;  3ASO C;  3CCR V;  3K0G A;  3W7T A;  3CC2 V;  1F4M A;  3OW2 U;  2HVJ C;  2JEU A;  2WLJ A;  4RAI A;  1M1K W;  3AG1 C;  1AJN A;  5HFL A;  4GX1 A;  2EIK C;  3P30 A;  2DYS C;  1BHA A;  3K06 A;  5B1O A;  2Q67 A;  2X6A A;  3SYP A;  2EIJ B;  1VQM V;  1QR8 A;  3WG7 B;  5CBH A;  3AG3 B;  4XDJ A;  2Z3Y A;  2IJJ A;  4XDL A;  3TCU A;  4GX0 A;  1H38 A;  1KP3 A;  4XBF A;  3FYI B;  1E1R G;  2P67 A;  1ARO P;  1B6Q A;  4JYB A;  1V55 B;  2HVK C;  2IW5 A;  2OT5 A;  2YSU B;  4JAU A;  1G4Y B;  3K9A A;  1H8H G;  2JEX A;  2ZDI C;  5EBM C;  1SER A;  3CC4 V;  3ZRS A;  3FB8 C;  3LSS A;  3CCS V;  5EBW C;  1K34 A;  4PA3 A;  4XDK A;  1E1Q G;  3X2Q B;  5L3E A;  2D3O W;  4MTF A;  1OCZ B;  3D3I A;  1S5H C;  3K3W A;  3ETD A;  3NXS A;  3G6E V;  1R3J C;  4UVB A;  3ETE A;  2DQ3 A;  1MG1 A;  4BIZ A;  2Y48 A;  3OMN B;  4CZZ A;  2BOC C;  3ASN B;  3SPG A;  3QO7 A;  3CXC U;  3OR7 C;  3MHS C;  1BL8 A;  3IC7 A;  4MVO A;  2QTO A;  2XAS A;  4E2L A;  5B3S B;  1NKD A;  1YSC A;  1AJP A;  4P9P A;  2OCC B;  4YXW G;  2W6J G;  3K08 A;  1M56 B;  3K0D A;  1VQP V;  1YJ9 V;  2IJH A;  1MSW D;  2ZQM A;  2NNU A;  1OCR C;  4KUM A;  5L3D A;  1VQN V;  4DO2 A;  2UXN A;  3MD0 A;  2PI4 A;  1WPX A;  3CCV V;  1VQ5 V;  1K5S A;  1L1F A;  1GMG A;  3B8M A;  3I56 V;  2ZR2 A;  5KA6 A;  2X6C A;  1S72 V;  2F43 G;  3JD0 A;  3AEI A;  1P7B A;  3CYO A;  1M57 B;  1OCO C;  4PA9 A;  2P6J A;  4PDM A;  1QVG U;  1RPR A;  4MS2 A;  3CD6 V;  1FXK B;  1Q7Y W;  3WFV A;  1MOF A;  3SPI A;  1RM1 B;  1YIJ V;  2AHZ A;  2PI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...