5DM70

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
224
structure length
224
Chain Sequence
KRYRALEGKVDRNKQYSIDEAAALVKELATAKFDETVEVHFRLGIDPRKSDQNVRGTVALPHGTGRSVRVAVITKGENVQAAEAAGADVVGSDELIERIAGGFMDFDAVVATPDMMAQIGQKLARLLGPRGLLPNPKSGTVGADVAGMVRGLKAGRIEFRNDKTGVVHAPIGKASFESGNLSANYQALISALEGAKPGTAKGVFLRSAYLTTTMGPSIPLALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 8
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
0 PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 5dm7001
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dm7002
1I2AA 1MZPA 1ZHOA 3U56A 5DM60 1DWUA 4QVIA 4F9TA 1AD2A 3QOYA 4QG3A 3FPNA 1CJSA 1U63A 3U4MA 4DFCB 4REOA 3ZQJA 2HW8A 5DM70 4LQ4A 4QGBA 3TG8A 3UMYA
chains in the Genus database with same CATH superfamily
1BN7A 1AUPA 5AHKA 1D1PA 4ZOLB 3HB5X 2A5GA 2NPIA 5JMPA 4OJNA 4DJFC 2JZOA 4XDHA 3OZCA 4XJTA 4ZYVA 3DWGA 3OQ1A 4JI8B 1KEUA 1EXWA 1L2TA 4YAEA 3A6HA 5IXSA 1TW2A 1T0UA 2Y27A 3P19A 1B8NA 4N0DA 1QFMA 2OCAA 4EB6A 2Z5VA 1SIWA 4RTLA 3OHSX 5JUWA 1M33A 4HBGA 3RS5A 1SA0A 1UPPI 3DUFA 4EBBA 1T91A 5GM1A 2A0YA 1FYWA 4DPKA 4EGSA 3DE7X 3ROEA 2D2XA 1YFLA 3RHFA 3ENKA 4IRXA 4MS1A 5ITVA 1YB5A 3AUSA 1OLSB 3T7CA 1YB4A 2IWRA 5HS6A 5KX5A 1GNTA 1OH8A 3VKGA 2LV8A 4RDIA 1HZZA 3UWMA 3LUDA 3RWOA 4FSXA 4HHEA 4X60A 5ESXA 2XUOA 1UC9A 2XXAB 4EUEA 4RUKA 4CEJB 3F6YA 3ONNA 3K5HA 1V7QA 2R11A 4TM8A 4IGAA 1C3OA 4EA9A 5IULC 2Z6UA 1N2CA 1MQ8B 1LPNA 1N7IA 5KTYA 1PNOA 3AY3A 1MDBA 3MZ0A 4OXNA 3KEQA 4PQFA 2O7QA 4RD1A 4GR9A 3X0DA 1NXSA 1FTQA 4MQMA 2P3QA 1U7DA 3IUPA 4XB1A 3TMKA 5JRJA 5CJ2A 1BTOA 1KFBB 2DKNA 2OXFA 2PL5A 4IEIA 5ES3A 5I6DA 1PUIA 2W0SA 5C5EA 3VFDA 2AFVA 2J6BA 1FP6A 1S2LA 3D6TB 2ZLBA 3GLHB 5EJFA 4XKJA 2FWPA 1A8QA 2E4UA 5IC4A 3HCRA 3VOSA 3B5EA 4XWKA 2Y0BA 1HNZB 5C32A 4Z7JA 5A9SA 1JA9A 1GL6A 4FMDB 5ELXA 2B6HA 4MW4A 4QPNA 3VM6A 3LBAA 3NAMA 3UATA 4Z9XA 5E3JA 4QTXA 3A1WA 4G41A 4D4KA 4ZZIA 1QBKC 2PV7A 5I7EA 2XXBA 4RY0A 3VAZA 3ZGYA 1QYDA 5AHXA 1J99A 1M5RA 4X65B 1H8HA 1I9GA 1P5RA 1IM2A 4NATA 1VLJA 1JHDA 4M89A 1U0NA 2ICAA 4MHSA 1PWXA 3EVZA 1Q0RA 1JEQB 2FQYA 1PQYA 1FUEA 4FK8A 5BSWA 4HDNB 2HJ9A 4UVEA 2CXSA 4ONEA 3WQRA 4JSTA 2D1YA 4WRRA 3TZKA 2WUDA 3LT0A 4DCNA 1N0HA 5I9BA 1LPBB 4L9SA 5EP3A 1FSSA 1DUVG 1LQ2A 2AX4A 2X0JA 2ZFUA 3HLTA 1X92A 3LP6A 4H1VA 1RADA 4MYHA 1F51E 4I0WB 2XTJA 2YHSA 4C0LA 4IDDA 3B9PA 5LQMA 4NTZA 3SZUA 1A9XA 1XMOB 1A4IA 3GDGA 5BO5A 2WSIA 1TTHA 1XZNA 1QGAA 1QHHB 3EPHA 1Z63A 1G21A 4JL6A 3PC4A 3V1NA 3U19A 5HMLA 4LG1A 2ZW9A 4CM9D 4DIDA 2PO7A 3P2JA 1IZ0A 5JHHB 4PG7A 4XQCA 4PXYA 2AG1A 1YZLA 2WB2A 1IHOA 5H9VA 4KHPB 1TYZA 4IPTA 2NV6A 3DEIA 3NS7A 2HIHA 4LGYA 2WABA 4U7PB 2JRLA 4X1IB 4J0EA 4Z3DA 4R8SA 2CHUA 2VSXA 4YJ2F 1GTL1 1I4DD 5K6TA 3GUVA 1Z06A 3RIYA 4KQKA 3DOCA 4RF4A 3HWSA 2VP3A 4LGCA 2FE4A 5A4DA 5ANRB 2R3SA 1MUUA 2J3KA 3DKVA 2IX3A 1EFUA 1Y3CE 1CETA 2HA6A 4FNOA 5ALOA 3HKEB 1ENZA 1SUBA 2YJTD 4D43A 4W5WA 4D8XA 5F5XA 3GWGA 3P8ZA 5KI6A 5H80A 5FBKA 4PO3X 1P6QA 4EDHA 1JR2A 5LYJA 2X7HA 3IAFA 1KPHA 3ODGA 4FN5A 4HLQB 1EU1A 3ZJ4A 1E1MA 3IRVA 3HFRA 1Z28A 1JNYA 1KP9A 2TMGA 3IXQA 4UTZA 5K8TA 2WD8A 3INGA 1FJ2A 1LF0A 1BMTA 5CB4F 2AMLA 4X1YB 3L8FA 4YJ3F 1V2GA 3BMNB 4OGFA 1CRPA 1WB4A 2Y1GA 3VVBA 3WQBA 4JU9A 4FB4A 3QX3A 1N3IA 2EBWA 1EM8A 3NBXX 1AQIA 3WDKA 1EGAA 4LUCA 4KU4A 1RYEA 2C54A 2WFLA 3KDPA 3OMWA 3FMPB 4Y6OA 4AG5A 5JH7F 4PGFA 2FX5A 3D02A 1ZOPA 1UKCA 3QVLA 3HU1A 1EB9A 1W5AA 4UMVA 3UK0A 5B4VA 1T10A 2Q5FA 3GIWA 4CG3A 4XDGA 2GZ2A 3HSKA 3DJYA 3SQMA 2IS4A 3U49A 4L8VA 1WDMA 1Z45A 2O8EB 1PFGA 1FXWF 2N1MA 4GFDA 3UCEA 2O8NA 2RBGA 4GBJA 1GSHA 4BNWA 4BLUA 2CKMA 1GXSB 2ZJ1A 1ESMA 2BGJA 1NNI1 5J1SB 3AUFA 4DDKA 5LOVF 2XGJA 1Y6FA 3GGSA 3NDRA 4JVNA 1D6SA 3LUPA 4BVLA 2Q2VA 4PAGA 4XFJA 4L5CA 1T4CB 2PTGA 4FQ5A 2DETA 4HXEB 2WTEA 4ZAFA 4RX1A 1GAQA 4NULA 1EGHA 1YE8A 3D2LA 5GAJA 4MZDA 3TAHA 2WHEA 1U98A 4XUEA 3C14C 1F0YA 1SZPA 1I0LA 1MRNA 3DULA 2CLKB 3BTSA 4WJZA 3VHQA 4BMYA 4E46A 3MGKA 3F67A 2QZSA 2OWDA 1CJCA 3SYKA 2D1QA 1G7CA 5K0NA 3T0FA 4JT4A 1Z3IX 3MYYA 4POAA 5FOXA 2FETA 2D7JA 1ZDMA 2BKVA 3N6XA 1TF2A 2GJAA 3V1YA 5BQ5A 2M2IA 2XGMA 3VUFA 4ESHA 3OX3A 3P9QA 4H08A 1J25A 4FWIB 1TT5A 2V96A 3L4SO 4C7VA 3ADDA 1RFLA 1PGJA 1U8ZA 1KHTA 3IMKA 5CJJA 3RGWS 3ER9A 1DVRA 3BB4A 2FEXA 4O5OA 4CRWB 5FFMA 2XWSA 5BRAA 1RD4A 3MUNA 3R6TA 4FTWA 4RXTA 5JATA 2QROA 3TL3A 8MHTA 4HLUA 1Z4QA 2AFIA 4IIEA 1ZICA 1U7TA 3KU4A 2YYYA 4QYSA 5LDGA 4R3UC 2KQUA 5KTPA 3H11A 3CYFA 1IE3A 1CHDA 2BN4A 5L3ZA 3WE7A 3KSRA 5DPMA 5EJ4A 3Q3CA 4LK3A 3IP6A 4M9CA 3B3AA 3SC4A 2JHFA 4YS6A 2IHYA 4DV4B 1V8FA 1HYEA 2GYVA 4QPDA 4RV9A 1C81A 1T4MA 2GSDA 2YV2A 4ZT3A 2VPWA 5JD5A 3F3KA 3QJYA 2FU5C 2YJGA 4Y18A 3KQVA 2D4AA 1JNXX 1U5BA 3B12A 2G06A 4IIXA 4L0DA 2CSUA 3RVMA 1S9DA 5CYGA 1FS4A 2G9QA 2IXEA 3AT1A 1GRQA 5AJZA 2JLQA 2QDKA 2ID4A 3WA6A 4CU2A 5B57C 5BSUA 4NU0A 4KV7A 1BXKA 4KXLA 1UK8A 2QD5A 2H2GA 4KMMA 5JALA 3WJ2A 1BWRA 4YJHA 4JLSA 1ADFA 3DMRA 3JRNA 1Q2XA 4MV4A 1IN4A 1N4AA 4W5OA 3D5EA 5ALSA 2HMSA 4Y1FA 2EGHA 5CFMA 4TROA 2C2ZA 1KF0A 2JFZA 3GP5A 3WLIA 1PNRA 4KPUB 1RAFA 3H3XA 1YXMA 2HAEA 1IVNA 3OCXA 4E5MA 2YTZA 2MYPA 1V3QE 3QVGA 4RLFA 2V8OA 3RC1A 3U4GA 4JK3A 1U3FA 4L74A 4JJAA 1PR3A 3FTNA 3PDJA 1RLDS 4FFBB 4NH4A 5SYAA 4LTNA 4MQUA 3VPCA 3PE4A 4P81A 1YR8A 2CB0A 1WXIA 1XEWX 4AJHA 5CXXA 5DCYA 2IYFA 3MQ4A 1N1MA 4WXEA 2RGDA 4Z0HO 2PSJA 2XGGA 3WLEA 3MMSA 4UAJA 3QFTA 2QTGA 3LKBA 5JVDF 1P9WA 3M8KA 4U9HS 5JNVA 1MDFA 1QWOA 1ZINA 2JJ8A 3DT6A 1WE2A 2EJWA 2REXB 1U3CA 2G5TA 2FPGB 4EB0A 3P9ZA 3TVYA 5GZ1A 5B58C 5P8WA 1ODLA 5ERXA 3ZQ4A 3TKAA 5KNBH 1OH5A 1YVEI 3SF8B 5G41A 1G3QA 16PKA 2ZRPA 2AN4A 1LWOA 1I14A 1QM5A 1YQDA 2C97A 1S2IA 2WMYA 3PV0A 4RXMA 3SAJA 4S05A 4KAFA 3RWMB 4GHWA 1KQOA 3PFHA 4TUYA 3WOHA 3FCYA 4JC8A 4FZ3A 3KB8A 2FPWA 3WLLA 1TIBA 2ZIVB 5AI4A 5DT2A 3QHQA 4NECA 1G3UA 5CB0A 1CZRA 1P9LA 1T0PA 3K20A 3QW4B 4Q16A 5DNWA 4H3VA 3HYRA 3UK2A 5BT8A 1OI4A 1D4FA 3VPXA 1IFXA 4KPUA 1LPMA 3COJA 1UJBA 3BA1A 5GWXA 4EEXA 1NBAA 4J7CA 3KUUA 4XJVA 4HDAA 5D5HA 3AWIA 1MF7A 1U2QA 2A59A 2IP1A 2ZATA 2A92A 3A32A 3LFTA 3NCHA 4J0DA 2C94A 5E4FA 4YPFA 5T3YA 4XYEA 2ZQ5A 3KJHA 3MWKA 4G0QA 1DV1A 4EAAA 3RARA 1ZOLA 2FQQA 3GRRA 3INTA 4URWR 5DHPA 3VJLA 2F1JA 2CXNA 5F51A 1V1MA 1KMQA 3IH5A 2I4RA 1AS0A 1JJIA 1MAWA 2P2DA 3GPDG 4HH4A 4OGKA 1FXWA 3AUYA 1W2GA 4UU1A 3TUJC 1F6BA 4IX1A 4DLVA 1DARA 2FP4A 4PCUA 2C82A 3AETA 5SYMA 2QUKA 1EWKA 2G28A 4ZYUA 1AN0A 1PD1A 4FPXA 5DLDA 1J2UA 1AE1A 1UPMC 1Z5OA 2A7QA 3G3EA 4IIBA 5A04A 3THSA 2WWGA 2Q3LA 5IVHA 4FDLA 5DZSA 5TVGA 1LH0A 4DTCA 4G97A 1TM5E 1WUHS 2JPDA 5TDHA 3IOCA 3WB2A 2ZT5A 3T5BA 3FTEA 3RANA 3KSZO 3MAJA 4FBLA 5I5EA 1XF1A 4YRCA 3F7OA 1UOEA 3QHPA 4DCJA 5J43A 4MDEA 5BN4A 2UUBB 2KLHA 3QF7A 3AUUA 4KXFB 5KQSA 2OQ2A 1CVIA 2VXOA 3ZLUA 4QUJA 1LVUA 4CQNA 2YZKA 1VIMA 2IE8A 4KMSA 2IEYA 1S3IA 3BBLA 3LBHA 5AKJA 1FU8A 4QU8A 5CPFA 3UA4A 4Z49A 1Q0UA 2W2NA 2WNSA 1C2YA 3NVMB 4B7XA 2C9YA 3SR3A 1F6DA 2PHZA 3H99A 3OZSA 2YS7A 4RH1A 3DDHA 4GZMA 1PJ4A 4MWOA 2K4MA 4OQLA 4REOA 1N6LA 1I3NA 3A4LA 3TG8A 1KHHA 4ZP1A 2H16A 4ZC8A 3WYFA 2K7FA 2I4OA 1D6MA 2JFPA 3RKUA 3LKZA 1YRBA 3WRWA 4KE9A 2HCJB 3ND9A 3GELA 2I7CA 4DG5A 4WZBE 4D9IA 4DJ5X 5D84A 1XCLA 3AI3A 2I0FA 2RGRA 1NBHA 1CY7A 3IELA 4MPDA 2NQ8A 2EP5A 3VZPA 4E6PA 2A33A 1WPRA 3BTUA 3KOWA 2HHLA 4H3SA 3S2IA 3EGCA 3DAHA 4M0EA 4NG5A 5IDVA 1T3HA 5TGZA 5BMVB 1KWKA 1IXYA 4OX9B 5TB5A 4OBXA 3JR3A 3WKEA 4EELA 4C0WA 2HZBA 2QE7D 4OKIA 5JMOA 4O4HA 1E98A 2GPAA 2A30A 1UFVA 2O48X 3U3MA 4QYMA 4EUHA 3K15A 4CI9A 4S3MA 4EVIA 5BWLA 3PDCA 2R1ZA 1E3LA 3A58B 4CM5A 4EHFA 1XZLA 5JZ9A 2C5HA 3BILA 1FQJA 5AI6A 1ZIYA 1JEYA 4NCNA 3F71A 2JAHA 5DT9A 4RULA 1S8FA 2HB6A 3LY5A 5LPNA 4DNFA 4RE5A 1Q0QA 1ZD8A 4BO8A 4S1OA 4FJ2A 1JKJA 2AQ8A 2HQSA 1JWBB 2EWMA 2ZRBA 1I1OA 4IHKA 3CH5A 5A4IS 5JXHA 1ZD9A 1P2VA 4AUKA 1ZL0A 4XRGA 2G9ZA 3ONVA 1LGYA 1K2VN 3OFND 2DWCA 5F9FA 2Q2OA 2AZMA 4QICA 1P31A 3MTJA 4HN2A 1VRWA 4JLKA 5A71A 3GAAA 5EHXA 2Q1TA 1QHIA 4AO8A 3L7JA 1XTIA 4UM9B 3SHOA 3A4NA 3SYLA 1PDVA 2WTAA 4ODIA 1Q3HA 4D6XA 3N75A 4Z7NB 1XZEA 1B00A 2H8KA 4JV5B 3SXUA 1U94A 4C3OB 5TEVA 2TMDA 2JCSA 2D0DA 1VZ3A 1ODKA 1USIA 2BBOA 4BLPA 2XSZA 3MBKA 3QFSA 3RSCA 2ETXA 1U4NA 2N42A 1UP7A 3I9NA 4DA9A 1Y5IA 3X1YA 2W2OA 2WJVA 4LNUB 5DTIA 3TGWA 4CF4A 1J4AA 2XKJE 5ALTA 3ZDYB 3QPAA 2A5LA 4DYHA 1JG7A 1Q1EA 1Z7YA 3PSHA 3PUIA 4QGFA 2PRKA 5IC6A 4BVAA 2J7PA 4OL0A 4BN4A 4IXWA 4RBNA 3RM3A 1IZ7A 3RAEC 3RU9A 3RT7A 2QMQA 3FF4A 3DTVA 5C8YA 4RZSA 1DG9A 1YCDA 2XVZA 3AM5A 1LU9A 4ZU6X 3HJBA 1FFCA 3WKDA 2WWWA 4PU0A 5AVWA 4PQEA 3KYCA 2PNFA 2ZYTX 1C1YA 3BIJA 4TZ6A 4G67A 1IRIA 1H23A 1K3FA 1UBJS 1WG8A 3QMMA 5EMHA 3JYNA 1KI6A 4Y9TA 1IZYA 4MIKA 5TF4A 5ALVA 1HMPA 4F12A 3QF4A 3NBAA 3DA8A 5ENDA 3I01M 1UBLS 2TS1A 1DOAA 1XXLA 3W9UA 1D0VA 1NNSA 2YRFA 3H8VA 3NX4A 2C9ZA 3QBJA 4IHQA 1US8A 5DRYA 3V3TA 1GTVA 4ANFA 1HRDA 1NW7A 3CM0A 1OI2A 2FVYA 2BKXA 5TT1A 2QLJA 3THYA 1IJKA 2QAGB 1HT3A 1PK8A 3BFJA 4MKIA 4J3FA 2ADFA 1G17A 2IPXA 5BSKA 4GI3A 1OPRA 4JLBA 1XU9A 2O9JA 5KOJA 5KVAA 3TNFA 4DA7A 3EZYA 1JQBA 3QMVA 1D03A 3CVJA 2JHPA 4L6AA 4P80A 4EG8A 4CIWA 1CZUA 3MNFA 3D3WB 2BGTA 1WIWA 1EVYA 4HBZA 2RE8A 2BJVA 1AKMA 2HSDA 1JXAA 3C7CB 3WV5A 3TS1A 5FTLA 3AL0C 1A9TA 2O7RA 2X42A 3VHLB 1RJ9B 3K0EA 4HAOA 5I01A 2O5EA 1X3SA 4HGPA 2AQIA 3IEMA 3CE6A 1XCJA 4LE2A 4QU9A 4Z7QB 4OX9Y 1DIBA 4GZ5A 2OSVA 1WCYA 5DOZA 3CF2A 5I7UA 1D0IA 2YJ3A 1S5PA 3IAEA 3PR2B 1C3EA 1EX1A 2F6RA 4Y6PA 3HE3A 1TLFA 3HA3A 1SXJB 3ELBA 2NLOA 3HKBB 1XRPA 4UM8B 2NVUA 3OPVA 1SRQA 1RRMA 4OP2A 1LS1A 2XHZA 1QJ4A 1VBKA 2B3DA 1NV9A 1NPYA 1UZAA 2BKEA 2CLIB 2XIJA 1VYVA 1GGNA 3MJCA 4PPQA 5LQSA 1EAYA 5AKEA 4ZT5A 1LX7A 3ORSA 1CHNA 1YMUA 3BWMA 1EXVA 1A98A 1M67A 4HEHA 5AJXA 3EJ6A 4DSAA 1YQQA 4MW2A 2YOGA 3O4FA 1MU0A 3T9CA 1HDIA 2DG2A 3LK7A 4YBRA 4ZZ0A 3MXOA 1H65A 1ZGGA 4J2HA 2IZ1A 6YASA 3EPJA 1SMKA 1HC7A 1HTWA 4TPKA 1CLEA 3EOZA 1G19A 1PJ3A 5FTWA 1V0JA 3UZUA 5B2FA 1ZVQA 1KK0A 4C4SA 1I30A 1LX6A 3FB1A 1Q1GA 3RYTC 4DHEA 5EIAA 1TCAA 4XSVA 3H3JA 3TTVA 1Z12A 1B0AA 1NW5A 4AULA 4YRSA 3FTPA 3TFOA 2O6LA 2I7XA 5HJ5A 4LYAA 5ALGA 4JN6B 3W5CA 3RUIA 5LKAA 1NVKA 2P1DA 4QJ4A 4F9GA 1QP0A 2IYYA 1LJ8A 2R1VA 1EESA 4FHCA 4OHCA 1QYXA 3AU9A 2OUKA 1TAUA 1PV4A 1FXSA 1ADBA 3LH5A 4R1PA 2WWYA 2YNMA 3V6MA 3PXDA 1XNRB 2P9EA 4JYMA 1WDLA 2QVLA 4RY2A 5UKDA 4B7UA 4ZV4A 2AKEA 5HR5A 1EUYA 1MTOA 1UMKA 4E1AA 1X1DA 1I4LD 2I3BA 2BHNA 4UBNA 2GOYA 1FNNA 3V80A 2FPMA 4QQ8A 1XYGA 4HQKA 4HQRA 3IVAA 3K1JA 2IV3A 3R7WB 3UUGA 3I6MA 1J42A 3BXOA 5HW0A 2XECA 1PZFA 1GTZA 4TKUB 5KYKA 3CU5A 1XXHE 2XWBF 3PC8C 1SQ0A 3P32A 4IH1A 4KO2S 1N9GB 4E14A 2ZYSA 3PA6A 2ZPUA 4MCAA 4EHIA 4U0KA 4IIJA 2Y9PB 4WNAB 2BFCA 1XMPA 3RT9A 3DUFB 2WG0A 3SOPA 2FY8A 4QBFA 1TO2E 5E2AA 4OHUA 1ZQ1A 1N57A 5T8KC 5LKRA 1Z18A 1L7PA 1RCFA 2WJYA 1KDRA 3KXLA 4KYUA 1Q20A 4XVQA 3AEKB 1YS7A 2D5CA 1JHXA 3L8CA 3G1TA 5D7BA 1K92A 2IDJA 3H97A 1DL5A 2W7TA 4OOFA 5ICFA 1KVUA 1QBGA 3EEYA 2DR3A 3F3SA 4I4TF 5AUOB 1C9EA 2QVCA 1PK7A 4ZPXA 3X44A 4E08A 2RKWA 3KT3A 2QPTA 4DWJA 4TQAA 4FOOA 4WKNA 1XMQB 1O8CA 1U8CB 4REMA 5EY5B 3WSWA 4JJGA 1N32B 1ZMXA 1S96A 2Q3DA 3FJ1A 2ZSKA 4I99A 4WGFA 1XZFA 2IKQA 5JMTA 1NXQA 1QOZA 4F3YA 4PQGA 4HFRA 2V5VA 3FLMA 1NTRA 1FP4A 2ZI5A 1P9RA 4MYRA 2AFHE 3ZU5A 3E1KA 5CDYA 1MA0A 1P2DA 4Z4QA 2ZBUA 3I9V6 3L1HA 4XGKA 2BR3A 3ZCQA 1ISIA 1B8VA 4PRLA 3U13A 5BN5A 3R41A 1N3LA 4R51A 3PDUA 2CVOA 5KU1A 2WM2A 3BXFA 1TF7A 3O8RA 2VZEA 4ND8B 2X19A 4XGIA 3R8XA 2EX0A 2W90A 1JBQA 3ZH9B 5BNIA 5AJTA 1P5HA 3HUEA 1DQYA 4O59O 4YT8A 2C9MA 1I13A 1ZD3A 1J9ZA 4IIJB 4LHWA 4V0QA 4Y1RA 1ZVVA 2EBUA 3PGKA 5BV7A 1B7GO 1HEIA 4OQFA 1CU1A 5TPWB 4F0KB 3WTCA 3PWZA 1RBOC 3HSSA 4JJ8A 4YRAA 2FFJA 2FR1A 1DADA 2I2AA 1ZRSA 3WR5A 5KKNB 1BKDR 1W49A 3FHOA 3P9SA 2CHEA 4QRIA 3NIBA 2WTUA 4B8WA 3UMRA 4P34A 3RVKA 4JEMA 1E7SA 1SZCA 1WLSA 4UE3S 4WDRA 4BJ1A 1ODTC 3B85A 5AVZA 3UIEA 4M38A 4PLVA 5F4ZA 1JTEA 5FADA 1RBLI 4CR8A 3IVXA 4WD3A 1Y1QA 5FBHA 5BUZA 2W71A 3AR7A 2ZJ5A 2OXTA 3WRXA 3ZY2A 2B61A 1BOOA 4IJVA 4YO7A 1U2TA 4GD3Q 1KZ1A 4P33A 2A4KA 2WHQA 1PFWA 4NZNA 1OXTA 3I05A 3MA0A 1LDNA 3FUXA 3L5OA 5E3HA 3ZD7A 2VPXA 3AFHA 4DW8A 2DGDA 3B1KA 4MPJA 5IWCA 1U3GA 4XWAA 3N1UA 5E7JA 1OXKB 4ALIA 1T1SA 2WVGA 3C5WP 1P62B 3UG6A 3ES9A 1VLVA 3G7SA 4ZCMA 2DWOA 4II7A 3ZHXA 2HA4A 3LT5A 2ID8A 4AFNA 2JIQA 5IKEA 2V69I 1N2CE 1QG0A 4Y1RB 1QUFA 1W73A 3T3PB 4DA6A 3H4MA 2PUBA 3QX9A 1OV4A 4QDXA 1U2GC 3FMFA 1J5EB 5G1OA 2QN1A 1Q7EA 3HCNA 1H9AA 4RY8A 3U0VA 1F2UA 2SKEA 3EE6A 3F6RA 4YMVA 4D4LA 2C31A 1O5IA 4WE3A 3WIUA 4UM7A 1WBBA 3GFRA 2JLRA 1VJGA 3K05A 4WUVA 1QO0A 3HL4A 1X7WB 3T0IA 3H1BA 3QEBZ 4G0NA 4WKPA 3YASA 4BS9A 2CJFA 1JYFA 5K0GA 1CG6A 2VZ9A 5I9IA 4JXXA 2J5QA 2BFNA 1AG9A 3BE5A 3GJSA 2WKQA 4Q1DA 1DXYA 1GITA 2X5XA 1YJAA 3PQEA 3VI3B 4NE7A 2CXXA 1K5DA 1DO2A 4TMVA 4BNMA 3GP8A 2J9ZB 2ZYAA 4I14A 3I5MA 4DNOA 3IILA 4Y2SA 2BELA 2HDNB 4LW8A 4YQEA 1UZNA 2BEVA 5B53A 4AURA 3O1LA 5K6AC 3OCUA 4NV1A 1VE9A 3FLBA 3VYWA 4LKOA 1J2TA 3LHKA 1GDTA 2X76A 3P9IA 2WJAA 3TD9A 3KLMX 1ECGA 1UEJA 3FPFA 3NFRA 1C7RA 4LMAA 3SJCA 1HE3A 2B4QA 3OOJA 3PYLA 4YPVA 5I7FA 3EVEA 1KAGA 2YHAA 1N5IA 1R74A 3EDRA 1CS4C 1O03A 3WBJA 2VZLA 2Y92A 2JFOA 2YL2A 4OMDA 4PX9A 2OK7A 1WCWA 2KX7A 3WKAA 3PI6A 3A7EA 3X1XA 2OYRA 4YXWD 2GN1A 3H9GA 2UUOA 3IIJA 3H5OA 4ZI7B 1J1UA 1E7MA 2I2DA 5KTSA 2ZAYA 5LZ5A 5LUAA 4Q7MB 4B31A 2DUMA 1VJ1A 4DQ0A 1GLNA 4GLFA 2WFZA 2PV0A 2R2GA 5JECA 3GVIA 3R40A 4YALA 1PJSA 1PAUA 4ZO6A 4CIYA 5BOSB 2DUNA 4TM7A 1G8GA 4BQOA 1VFNA 5K8JB 3JQCA 1TMGE 3OO0A 4TYQA 3L0CA 2PX2A 3TJMA 5I45A 1HLPA 1AMOA 2IYRA 1EGQA 5JSFA 5EL0A 1XMXA 1XVTA 4A0QA 4Z4FA 2JD1A 3THRA 1K0UA 4TYPA 1VLZA 2IHBA 3H2KA 3H5NA 3DYBA 4GKJB 3KQKA 2R66A 3R76A 1ACJA 1OBFO 2G6BA 2PLFA 5FWAA 1X7ZB 3D3NA 3VZBA 4ZJZA 1TPZA 3KZXA 2XGSA 2ODQA 4YUAA 3TKLA 3ITNA 1N6IA 2UUPA 5L3SA 4X66B 3ZDAA 1M6NA 3QJGA 3IQZA 3JU3A 2IIPA 3OX4A 3PVCA 2JASA 3WIVA 2B7CA 3P9RA 1JH8A 4YYEA 2GM5A 1XTVA 5J4HA 1Y4UA 1GAJA 1WS6A 1A04A 3UM9A 4JYZA 3ITEA 2BFDB 1T24A 3WHPA 2QW0X 4ZRMA 4AKGA 1R4NA 1I5RA 1KFKB 4Q3LA 1Y8QB 4DIEA 1FJXA 4D6PA 3G59A 4OSOA 5L7TA 3WBFA 1E1CB 2O07A 3VR6H 3ZDQA 3CX8A 4XB6B 2JKYA 1JQDA 1WSWA 3L1JA 1C4WA 4NEQA 4B2IA 4WOKA 1I8TA 5CFOA 3LUCA 5JTTA 3QEMA 2CFCA 1SBHA 4N5HX 1C2TA 5HKKD 1Y4AE 5EVJA 3AZPA 1ZU4A 2J87A 1H2EA 2YUTA 4QODA 3SDBA 2IPLA 2BMJA 4L1KA 2R00C 5CDTA 1R0YA 2AZ4A 3DVAA 4IDHA 4L5JA 2DBZA 1P0QA 1H1DA 4JD5A 4LZJA 3HBFA 3AG5A 4N01A 1KPIA 3VRHA 3UBMA 1M8FA 4XWGA 4AAYA 4CEHA 3EG5A 3TLXA 2CLCX 3AF0A 4IOMA 4MQFA 4Q1VA 2Q9BA 1N5KA 3DZBA 3IGFA 4N9QA 4YC7A 2RGNC 2RHHA 1JAXA 2IBSA 1PHRA 2IODA 4X94A 1TT7A 1R6UA 3TNYA 4YVFA 2E37A 4RKYA 2YNMC 1GSAA 4X64B 2C4WA 3BEOA 4MDFA 4HEA1 5GQSA 1DUIA 3WRYA 1IY2A 1RIFA 3AO0B 3F5MA 4AZ3A 4MVJM 3O9ZA 7MHTA 4YJHB 4IWNA 3KFVA 3F78A 2Q99A 3ND6A 3AHJA 2VP6A 3WLPA 1GTRA 3B48A 4BTEA 2OHFA 3I42A 1V8BA 3CRRA 4WFJA 1XD2A 5EIFA 5K3EA 1HF3A 3FDZA 3H1PA 4JT9A 3QKRB 6PFKA 3U5ZB 3FWHA 1BGWA 3VC3A 5IHPA 1FUUA 2OB1A 4MWEA 5FNVB 3EDYA 3HI6A 3GAZA 4G1CA 3NAGA 3E0XA 3IQIX 4UAUA 3R7AA 2NXJA 3N7AA 3MG9A 5NULA 2BGLA 1BHQ1 3TVTA 1K9SA 4GWGA 2BKLA 3NIGB 4IRUB 5AM4A 2P3LA 2CXRA 3UCXA 3K73O 5C1BA 4M83A 3DQZA 3PXEA 421PA 2CVQA 4JI3B 2AUMA 4ITRC 3OEEA 3KKPA 3OAAD 4KIUA 1DBIA 4CCSA 2ZTMA 4Y98A 3D6JA 2OC9A 1YVPA 4WFIA 1R5OA 4C5AA 2YJ4A 3FFBA 3C8HA 2GQ0A 1VLLA 3GARA 4OLFA 3VV2A 1G2PA 1YZTA 3MWGA 1HR0B 4CEHB 4C7OB 2A9VA 3SMVA 3ZVKA 3U3OA 2YFKA 3K09A 1R66A 2GDZA 2P0AA 2WNIA 2CFTA 5FPPA 2Q27A 5IF9A 2CXUA 3WYEA 3DBRB 1OE0A 3OSUA 4NVRA 5DK6A 1E2GA 3IC5A 1CB0A 3VO9A 1CEYA 1ZX1A 2XNCA 3PVSA 2I9PA 4I9GA 1E99A 1PCXA 2PMKA 5H3CA 5CB4A 5JANA 1T6ZA 1T6YA 3VPSA 4DJJA 1Z4MA 2BGNA 2RK6A 2H3EA 3A3PA 2QYSA 1SKMA 3N0XA 1DCFA 4OHBA 1ZFNA 1ECPA 2IU6A 2CD7A 2AIRA 2YW2A 2HNKA 3Q3JB 3DSRA 1E2MA 1HPLA 5C1PA 2VLBA 3EGXB 5IU6A 1E6CA 1YHZA 2Q49A 4JJEA 3V2GA 5JTUA 1XA4A 4MTLA 5LWHA 4CFSA 4G65A 4D4GA 1UJ6A 1WO8A 3M6AA 2QMUA 2FP4B 2E87A 3Q10A 3C3XA 3RIGA 4HTAA 5I48A 1IWOA 3WLKX 4HXFB 4D8TA 4N41A 1T1JA 1JGTA 4ZDJA 3ZIDA 3G0IA 4GH5A 1ZK4A 3NVKI 1G5QA 3KZKA 1DKNA 3GLHE 1RJFA 3NRCA 1CNEA 5KCZA 3NIDB 3QQ5A 2FPPA 3WGQA 4C6RA 3WIDA 3HZOA 2P1RA 4Q3EA 1FEZA 4D9CA 4JQSA 5CNIA 1AUVA 1MFPA 1YCGA 4P32A 3WQHA 2HLNA 3TBHA 5AO9A 4DMHA 1U3UA 1YRQA 4AMZA 2WA2A 1SWVA 4FBMA 3PR1A 4PSUA 4E12A 4Z0PA 3ROKA 4WWHA 5AP9A 2VDKB 3RSGA 3NKVA 1FY2A 5HBRA 4JHLA 5TMPA 1E18A 1OR8A 4ZODA 1L8XA 2GK3A 3PE6A 4CG1A 2ZYRA 4FYVA 3I2FA 4OXXA 1RXUA 3BJEA 1LPSA 1L4GA 2ZBGA 1XU4A 3HRIA 3T1HB 2D8MA 1T1EA 2P9GA 3EFEA 3GO4A 3BQNB 4KOAA 3A1TA 2H5IA 4NBNA 3H7IA 4CKZA 3JYQA 3L8DA 3I53A 1JDJA 3PK0A 4K6FA 3LUHA 2Q3MA 5FR2A 3ZX4A 4ZEVA 2PR7A 1II8B 5DP1A 5A62A 4WT7A 3KZOA 3LTEA 1XFAA 2HT6A 4ROTA 4CMEC 3LCVB 1RLJA 821PA 2AVDA 3RVLA 2HXYA 4W5RA 2CLMB 4KN5A 3TZHA 4H27A 2NTJA 1WMFA 1ISHA 1QFXA 3ZDCA 3VH2A 5CDHA 1BE8A 4ZO7A 1MQSA 4PVDA 3B9RA 4C3VA 3HM9A 5BSGA 3WWZA 3OZAA 3PNSA 1Z35A 4MW1A 1FW8A 4WL0A 3H2BA 1V45E 2NTVA 3K9GA 3A4VA 4Q4JB 3SC6A 1BXGA 5C8VA 1DCTA 1FFEA 1TZCA 4UOEA 2DFTA 2JD0A 1P73A 4ESVA 3EISA 2HJWA 4OHPA 3GEGA 4RD6A 4A8HA 1IN1A 2KBEA 3QOYA 3PF9A 4FC7A 3IXLA 3JQDA 3N8NA 3ZBPA 3SQOA 3SQLA 3L01A 4HDRB 4Q1BA 5TR9A 1U1EA 4TVKA 1Y3FE 4W5HA 4F71A 5DHUA 2IS6A 3UV3A 2ZKLA 3NMUF 1A4UA 4X6YA 2YMLA 5A03A 3WLSA 121PA 4BWYA 4L8YA 3UB3A 4BKQA 1EP3B 1OU4A 2INGX 4B33A 3AP2A 4BVBA 8ADHA 1E92A 1G42A 2ORED 4Q3KA 1OXXK 1RLCS 3PFFA 3SIXA 3ZXSA 1MJGA 3A11A 1S6YA 3DPSA 3F5QA 4M0CA 4GE3A 1TNDA 5U4QA 4DN6A 4EMSA 2R6JA 3F0TA 1UPCA 2HF8A 3PC8A 5AW8A 1P7CA 5K6RA 1XVIA 5F77A 3TYXA 1MRZA 2ZIXA 4MB2A 1QHEA 1A7AA 2VBCA 1AHHA 4LDZA 1EFAA 2Q50A 1YQUA 4BNTA 1XMJA 5EFZA 1L5QA 5TARA 2JFBA 2YCBA 1G8KA 1NR5A 1H5QA 1OLUB 1XHLA 2YHBA 5DI3A 3V42A 2Q3BA 1X8XA 3LDAA 1X2BA 1IMOA 2C8LA 2C3PA 4DS3A 1JR3D 3UO8B 2O0MA 3ILSA 2LR0A 3CWZA 3LDFA 1W1UA 4IDQA 1QVAA 2VTDA 1FP1D 2DH5A 4YP5A 5BORA 3D4LA 1CFJA 4Q4JA 5DYTA 5KNBD 4IV8A 4BB0A 2Q9UA 2WJWA 3QFCA 3ZYZA 4L8FA 2WBLC 5LUBA 3KVRA 4IHJA 3TZBA 2WM3A 2CF5A 4YFYA 3O90A 3K30A 3CLTD 2ACKA 3IJPA 3LXUX 3DT8A 1MG0A 1M2OB 3LOQA 4QNMA 1B1CA 5AM1A 3SIWA 1NFFA 2PT9A 1LLQA 4O3MA 1JW9B 1XWWA 2LIVA 4JLWA 4RNCA 1I7LA 4KYIB 3GUZA 2YFHA 3K0FB 4JROA 1Q11A 2V7XA 5EZYA 5IBCA 1YQTA 4KK3A 3F47A 4E22A 2GCEA 3EYAA 4H31A 4XLZA 1R10A 3PQCA 2IC5A 1EX9A 4L4SA 4GQAA 5CR9A 5IT5A 3TN7A 4BC1A 1M7BA 2H51A 3RRYA 5CLLA 2EIHA 1Q17A 4FT4A 3D1JA 4NJMB 5DGIA 4OUDB 3MGBA 3TOVA 5EXXA 4OKNA 2R68A 1G291 3A6GA 3EAGA 1ZZEA 4CN9A 3RIEA 5ADHA 2HUPA 2PBLA 4QFMA 3U0BA 4X7PA 4F97A 5HIAA 3PYMA 5TPZD 4B4VA 1CUCA 2R00A 4GMKA 2ACVA 2QE6A 4RV4A 5HTOA 1ZM2A 2OLJA 1RWVA 3T7RA 2PEYA 3IQXA 3STHA 4QXMA 4A1OA 3GRVA 4XYGA 5FBQB 4ETMA 2R62A 4KPYA 3GJ6A 4QRDA 1CJSA 3TLEA 4FEEA 3E35A 5L3VA 2VUSA 4I1VA 2V4MA 3Q5DA 4DWWA 3D8NA 1J1IA 2HPAA 3FCUB 3IJEB 1GTSA 4UZFA 1R15A 5CNMA 3FKJA 1WZNA 2QJWA 1IG0A 5ARCA 3T95A 3GNLA 3ZWBA 3F3YA 4ZQBA 4EZEA 5JC8A 4B3TB 3KOXA 2J7KA 3GR6A 5KZMB 2WKRA 5LQKA 1MHPA 5DI9A 3W8DA 3C2QA 4HL6A 4BQRA 1XNQB 2PH5A 2R8EA 2GZAA 1RQXA 1CFZA 3FSGA 5JZSA 1QHYA 5B6PA 1Z4KA 5JS2A 5K0CA 5EZYB 1T9HA 2BM9A 4AXBA 2W6IA 1FNCA 1U1DA 4F3RA 4IKPA 4KE6A 3PEYA 4LZPA 1UXIA 4MEJA 2X3YA 1JBKA 2YV4A 1A2QA 3VDQA 1ZO8A 3IP8A 3QVJA 4H7HA 1T2CA 1DQZA 1RHRA 2H3HA 3TR6A 1QIHA 4G07A 2QLFA 3HJRA 1WD5A 4QUHA 4CF7A 3CURA 2C3UA 5AYVA 1T5IA 3DEJA 3EMBA 3QUSA 1FRVA 1FUIA 3PRKE 1SU7A 1PEDA 3K4HA 3KG2A 1F0KA 2YIVX 1U4OA 1YI0A 4HDKB 3FA2A 3OMXA 4WLUA 4DZRA 2WJHA 1MT3A 1OUMA 5JY1A 2QU8A 4H7EA 1NR1A 2PWBA 2IBTA 2AF4C 4Q03A 4JJ4A 4CMCA 3D7MA 2FLVA 2FV8A 4RCYA 4F11A 1EDZA 3DWFA 3KPYA 2G9VA 3VU9A 4CMHA 4FYYA 3BCRA 4JBNA 4JEIA 2W0MA 4L02A 4AYTA 1GKYA 3HSYA 3W2TA 4E2XA 1DIGA 2LKCA 3PS9A 5L7YA 3RYFA 4DRXB 1W88A 4OOEA 1HYHA 1MOQA 1TYDE 3DKIA 3KAPA 4HH3C 4JASB 1NUQA 2IQIA 4MI3A 4D4JA 3VDRA 3NHFA 4F3NA 2BP7B 1OBHA 2CJXA 5AOVA 2OV1A 3QTLA 3FPSA 4ND5A 2OAQ1 3R7WA 3SFTA 2O7VA 1LJUA 1QK4A 1II9A 2I1LA 3BTVA 3ZWQA 1I10A 1KFEB 1SUPA 3I5AA 3MUEA 4IG9A 5BQPA 2DHEA 2EKLA 2VOEA 3H5LA 3KTDA 4WGGA 3IX7A 5FWYA 5LLTA 2WE7A 2NMVA 1KYWA 4RPLA 5I3ZA 2VSQA 1N9GA 4RMIA 3K0BA 2NSLA 1UZDC 3PFWO 2JGMA 3FBWA 2ONKA 4LECA 4FHFA 1PDWA 4RJLA 4W7IA 3AP3A 4IFBA 5KSOA 3U4QB 4LFCB 1TLTA 2XY4A 4JLVA 3RRMA 1Y7LA 4Q4HB 2NN3C 1ULZA 2H2FA 4GPIB 2BFCB 4EQ6B 1XZ8A 2XZDA 3G2KA 3IDZA 3UQYS 1ORVA 3MT9A 3VPFA 4P3YA 4JLMA 2P9JA 1M0SA 2Y1OA 4WASA 5DBIA 2OV2A 4CLHA 1BA3A 1JAHA 1JSRA 2C92A 4BNLA 1J9GA 3IR7A 4Q1CA 1W4RA 4OU4A 4GO1A 3T7EA 1YJQA 2AYYA 2P5SA 3DLAA 3NEYA 2ZUVA 2WW8A 3MRXA 3NOXA 2VFAA 3OCZA 2IF0A 2PVPA 4KLNA 4DBLC 1Y98A 3A1FA 3LL4A 3LYLA 4FGWA 3TGLA 3KTOA 1Q2UA 3DYVA 3IURA 4FYWA 4UHEA 3X1MA 3S8YA 4F0JA 3NTQA 2HEIA 3TRKA 4EG7A 2C61A 2VHZA 2XW6A 4OBEA 3VVCA 1CDDA 4G4SP 3ZJUA 2ASVA 4XCXA 3V8BA 2B8EA 2FPUA 3G88A 4OJQA 3KUDA 4PZAA 2G8LA 4JVLA 2QT9A 4K0RA 4HUTA 1N7GA 3LQ1A 1DDOA 4V0MA 1S2OA 4MAAA 4FDTA 1OIXA 5A4FS 4L28A 3P96A 2FEMA 1JDBC 3SJUA 3NJ4A 4TT3A 4O1IA 4YAKA 5JQGF 1P7VA 5CLJA 1RAHA 5JYEA 3RR2A 3UXEA 1GTJ1 5D51S 3WQQA 1CUDA 3IKMB 1GPNA 4EHJA 4F8JA 4PAOA 1SUFA 4N1AA 1KPGA 1TB4A 3BUSA 3DTNA 4KVFA 4QPJC 3V7YA 3I23A 3PL5A 2B8JA 2FRDC 1X1CA 3GJ5A 4NPHA 1NY6A 3TM4A 4QRHA 4IZOA 4FI3F 2XB9A 2VXYA 2AC4A 5FBLB 3LS2A 1SM4A 2ZWAA 1QAQA 1GPWB 3I4CA 1N2OA 5CA0F 2P77A 4Z4GA 2FZ5A 3LO8A 3WLJA 3HBMA 2NYVA 3T3HA 3ZG6A 1JXMA 2H4FA 1UBHS 2YHIA 3P9XA 4FP9A 4C2BA 2BFFA 1GHTA 3D7SA 1EP1B 3AY0A 3T1QA 3FVVA 2QL5A 4K7JA 2MJLA 1A9YA 1S3SA 1NU8A 3PEVA 3PIDA 1M6VB 5TXGA 3UC5A 5BWBA 2VHUA 4F84A 1AVTA 1SWWA 3BB3A 4LHYA 1DAPA 3KR9A 2DVMA 2RHTA 4M86A 3Q41A 3PR3A 2VJMA 1NI4B 1KJNA 2F1HA 3TBKA 4MVJH 1QFSA 5BW8A 1Z5UA 2P68A 1OZHA 2XTAA 3ML1A 3ZE0B 4A0SA 4GICA 1KYTA 4X8LA 4AICA 4BLWA 1AY0A 2ZSEA 4B85A 3R9XA 1K4KA 1T6NA 1GUAA 2GPYA 4CCYB 4YP0A 4C4PA 3L1IA 1NJ5A 1ML3A 3H1GA 3HEAA 3SGLA 4RMJA 5HEKA 3FFWA 4ZYLA 1I2ZA 1QC5B 3QVXA 1N2GA 5JS7A 1H93A 3NONA 2QY6A 2GKOA 3HNRA 5H59A 1FDRA 1YC2A 3TDNA 3VPAA 4BLVA 3W2HA 4FHEA 4BJHB 1MVOA 2X4DA 3IVMA 1Q83A 5AKKA 4F56A 2NUAA 1U3TA 3QVKA 4OU5A 1K6MA 2EG9A 3MELA 1FNDA 3I34X 4LZAA 4RHFA 1UCFA 1E0KA 3JQ7B 2XKBA 4MWCA 2ZJ6A 5CG1A 4MV5A 1AQLA 4DY6A 1ONSA 4PE5B 3HJCA 3HA5A 3AHFA 2DULA 5EYPA 1R6XA 2WP0A 3W3AD 4AZ0A 1DBPA 1O8BA 2B21A 4QAJA 1VG1A 3W05A 5LBIA 1W19A 4U2EA 1HDXA 4HPXB 3LRPA 4LX8A 4WX2B 5HS4A 2C95A 1UJ4A 2I65A 1U9JA 1CUEA 4JQCA 4XW2A 5JAOA 3CVUA 2QW1A 1AURA 2IXFA 3OEYA 2V6GA 1NUHA 4IS3A 5FFNA 1K6EA 5B1HA 3RVRA 1MB3A 1PQPA 4D5GA 1QVVA 3IL2A 2WFMA 2UUCB 2NU6A 3WV4A 1P80A 1XKQA 1A71A 5EWLA 1JKMA 3QBTA 4YMTA 3UMSA 3DAGA 3K9FC 3OETA 1GGEA 3HCPA 5AQ1A 1XE3A 3GGOA 4MRRA 4QUBA 4CCYA 3SBOA 2NZJA 2PD6A 1OGIA 3I30X 4UQPA 5TJ9A 4OHVA 3OCJA 3TQOA 3QE4A 4MS1B 5C9ZA 4ZOAA 2G36A 3S7ZA 2XRFA 4PZZA 4BV8A 5TLSA 5G40A 3VZRA 3JQPA 4KITB 4L50A 4KI0A 3KWMA 1ZESA 3ZLBA 1NQWA 1IONA 3RW9A 5FWNA 4GL4A 3JVUA 3USCS 4Z3KA 1HLGA 4QG3A 4R0MA 1O9BA 2ZTLA 3C3BA 3DEYX 3QXHA 2JHCA 4XPIA 3RRJA 3WSTA 4CM1A 3AQ4A 1Q50A 3I8XA 1FMFA 1QJCA 3B5IA 1X1RA 4GP6A 3RFVA 2PKYX 3HMKA 4NAUA 3ZN2A 2I2XB 5EINA 5HNKA 1E1DA 3NUGA 3CH6A 1G7RA 1MC8A 1QG4A 1MP0A 2C2BA 4HWPA 4IZIA 5CA1A 2DWUA 2ID9A 2DTEA 4NPCA 1G2QA 5KDDA 2AZXA 2WEKA 1DINA 3JD4A 2EF0A 1VBFA 3DL0A 3G8CA 5D86A 2ZJZA 2E48A 2CYAA 3HU5A 3GT4A 3MBIA 4P3XA 3LGAA 4PG4A 4CF6A 1SG6A 3FXAA 1IHYA 4FMDF 4JCOA 4LYJA 4U7GA 4J3NA 1K8XB 3I0ZA 4GM0A 1WXGA 4GOND 4UHDA 5LJIA 4EW1A 4S1NA 1GZ5A 2GN6A 2CHGA 1HFKA 2H1IA 4O4JA 3BXEA 4OQYA 3KL4A 4UHBA 3TQHA 2WU0A 3WFJA 3H42B 4MYDA 3LX4A 2C83A 4V38A 3RYCA 2BEWB 2PU7A 4G0OA 2VBIA 3QV2A 3EQ6A 3AQIA 1R8SA 2JFFA 3CNLA 4FEGA 5ETJA 4EPTA 5TVKA 5I4BA 1QGUB 4BRSA 3SLKA 3Q3IA 2WU3A 1TAHA 4OTZA 2QZPA 2QW8A 3AV0B 3GGPA 2ERYA 3V8QA 4AMUA 1X8KA 1E63A 1E1CA 5DGXA 1AKTA 1UZMA 4W7SA 1XC7A 5F2NA 2V6BA 3DC7A 4QT4A 5JARA 4KXUA 1X8JA 3Q7RA 3SQNA 2A1IA 4XH9B 5KQRA 3SHVA 4QXAA 4HRVA 4D9HA 4NZMA 1KWGA 4L7VA 2ZJ0A 3IAM1 2P5YA 3Q88A 1PJZA 2FNAA 3DL2A 3IT0A 1W2WB 2Z9CA 1TUIA 3L7OA 1GZ4A 1HK7A 1NLYA 4K9MA 2ZCVA 2E82A 4B2PA 3NT5A 4FILA 3TINA 1G8JA 1YZKA 1VECA 3AF4A 3HDGA 3KXKA 4GKBA 5BSRA 5IN4A 1U6IA 1V47A 4QYIB 4IEFB 1H2AS 4FOTA 4QX6A 2I5PO 1GFIA 2Z5FA 1EFRD 2H1OA 2VEDA 3NCTA 2FN4A 4EFNA 1EE9A 2Y1LA 3KQYA 1QWSA 2DUJA 2QX9A 3WLAA 3DEZA 4CLEA 1LV8A 1C4OA 2PMCA 2WD9A 2W22A 1T9AA 4F6CA 3JYPA 1EYZA 2HRBA 2XQVA 3E5HA 3JD1A 4UARA 3EXIA 3ZGVA 3CN7A 3IB6A 2Y1XA 4RKFA 4DLLA 3WWPA 2HU7A 2HMWA 3OMLA 4RZIA 1VHLA 3W5JA 1W75A 2BEWA 1CERA 4YDHB 1E79D 1QE0A 3B1JA 3MJFA 5C80A 2D2IA 1BN6A 1VTKA 4LZOA 5CDGA 4ZDIA 2PEZA 1NSYA 1ABBA 4LQ4A 1SULA 3GFPA 1NMSA 3WQSB 3EA5A 4OBBA 2J3JA 4CTKA 4XM1A 4B40A 1XU7A 1NF9A 1U9YA 2QN2A 3CRNA 2ZIWB 3MS2A 3CNBA 4GZ3A 2YZMA 4P3PA 1A5ZA 4ZREA 3W8FA 1ILEA 2BV3A 2O2SA 3PX3A 3QITA 3F4BA 4PR3A 1DJMA 4ZI3A 2G4LA 2RG1A 3IIMA 2W6OA 3P0EA 2WG2A 3P0HA 1G7TA 4LJ7A 4DR7B 1ZHOA 1VHQA 1R0SA 1XYVA 2IPNA 2Q5QA 2VSOA 4GR4A 3H18A 4MUEA 3SI7A 3TUIC 3WI7A 4AJPA 3ETEA 2D6FA 1HE4A 5IAGA 4BVFA 2PZBA 3RBXA 3DVQX 2CLFB 5J5CA 1E4YA 5LQDA 2EWVA 3CBQA 2I78A 5A7GA 1JJVA 1YBMA 3LCJA 1YONA 5KX5B 5EQJB 4V3CA 3W8NA 3H9CA 2RD2A 3H9JA 3I12A 1ORWA 4DDVA 3PGMA 4QOJA 3TLCA 3C6ZA 2MSCB 4QBHA 1FMLA 4P4SA 3HS3A 1FSGA 2C5SA 4C04A 1UKAA 1RC8A 2F43B 3EQ7A 2NU9B 1HL3A 1TFUA 3DAPA 1DC5A 2MSEB 2W00A 4BU1A 1BKYA 1Y1KE 3Q11A 3V8PA 1E6KA 1A7KA 3PNVA 2OHOA 2L69A 4HR7A 3RSZA 1V6CA 2ECPA 4RK5A 1E6EA 4PZ0A 3N8HA 3QOWA 4WECA 4I6JA 1C1HA 2ECFA 1ZH0A 1SKYE 2XQFA 5THQA 1BFDA 1V2HE 4CV1A 4UHFA 2IY7A 3V55A 3GF4A 4KK4A 2JJ2A 4UREA 2Z2XA 2P0YA 2GLXA 3E4DA 4A8JA 3IMGA 3OLZA 1J7KA 3NTXA 2LWIA 3LF2A 4OQDA 1XZMA 1XVVA 2BDEA 4W7HA 1BVRA 1C30A 1U2GA 1Q77A 4JVOA 4DV7B 4RQBA 1L1FA 1EUZA 3DHYA 1RCOC 3VYTB 3V4VB 5ER9A 2GPTA 1RM4A 1U1GA 1YFZA 4WMLA 2YFYA 1M9NA 2AFHB 1P2TA 1RTKA 1LBHA 1JDZA 5JNTA 2H0QA 4Q7QA 2OBFA 2HTEA 2YVUA 1TRKA 2PSDA 4DLPA 4MIOA 4ZV7A 3ZVNA 1IPHA 4CF3A 4P58A 1YDHA 2VI5A 2Q9AA 3CT6A 4KIJA 4NY1A 2RGBA 2IIVA 2ZRGA 4G5HA 4C4XA 1KKMA 3AKDA 1FUKA 1S2MA 3PP8A 2WYVA 4A9AA 1VZ2A 5K20A 1FVFA 3TZCA 2OAEA 2DAPA 1XGKA 3LCCA 5FH9A 1RXCA 4PHHA 3CH7A 4UTXA 3F5SA 3LC7O 1D5WA 3MTEA 2FZVA 4UKDA 4WXHA 3S68A 1OXUA 4D57A 2Y71A 3B3QA 4KO1S 1T3LA 4WCFC 4DYVA 3LXMA 1ICEA 1KJIA 4WACA 2I91A 2PSEA 4UU7A 5DNVA 2OT3B 1M1ZA 2JLCA 1DOZA 2X40A 3ZJYA 1QFJA 3KU1A 3DVRX 1GV1A 2ZRKA 3WBKA 2B92A 4ZQEA 1PL6A 4YJKA 4E5DA 2G5CA 3QX8A 2PGIA 2XAUA 2ZWIA 5FLEX 3VR2A 3OIUA 3X2EA 2ZROA 4K88A 2LNDA 4EHHA 5L45A 1UKZA 4ZO9A 2P6UA 4Y9UA 3S99A 3THXB 3V1UA 2H0RA 3CB2A 4HP8A 1A8SA 3RB8A 4BEJA 4ZMRA 2OCXA 1I4EB 1TEHA 3PD1A 2QQFA 3SHFA 1GU7A 1HE1C 2HADA 1CIVA 3Q72A 3TJRA 4IVPA 2AMJA 5HF5A 4BLQA 4S1PA 1JHAA 4TMWA 1A77A 4DXHA 2XRMA 1A8PA 2GARA 2ISQA 5CVCA 1NDUA 4C30A 5CBPB 3LSTA 1I3LA 2DFPA 4FYKA 4IH9A 4KGDA 4X20A 2B7LA 3QP9A 2C7GA 4NBTA 4MDHA 1UINA 2QRVB 1LC0A 3A2LA 4HRYA 1SFRA 1KSJA 2P6PA 4IH4A 5GONB 1GEGA 2NVBA 4KRGA 1M8JA 4TGLA 4RA6A 4RYDA 2QV7A 5TQ0A 3B7GA 3ZWVA 1L4NA 3FW1A 2P7HA 3CVXA 1GZSA 4D3YA 2VP5A 3H05A 4JXKA 1PVDA 3FOZA 4UUNA 3WC4A 4ZVQA 4G0YA 4EYOA 2UYCA 1Y7IA 2HDHA 4V0OA 1RP1A 1F6WA 4BRWA 4YUZA 2Q4OA 2Q4RA 3Q87B 2DOKA 4GVXA 4V24A 3T5TA 3G0DA 3JWGA 5HE9A 1OAOA 4XOUA 4OP1A 5EI5A 1I7SB 4NG4A 5FOWA 3OT4A 3SICE 4EZBA 5LQRA 4QM6A 3B1FA 3NHZA 2H7XA 2CB9A 1W5BA 3GGJA 4HNAA 2V0GA 4E30A 1Q5PA 2A0KA 1Q7GA 4RWZA 2CL7X 3DXFA 1P4AA 2WJ4A 4CNQA 4D02A 1SG0A 4G1UC 3JQ8A 3ZZ1A 1PJTA 4BGDA 4EY5A 1IIRA 3M33A 3VAAA 4ZTBA 1XNGA 4NBSA 1HKUA 2G7ZA 1XRSB 3P5BA 8ATCA 2WOOA 3PGLA 3I2IA 1U0JA 2GAIA 5CBPA 3N5CA 3TI7A 1HQKA 1DCKA 2RHCA 2VTVA 4N18A 1CQZA 4S35A 4Y2PA 5FAKA 3IBCA 1W9MA 2QRGA 3COPA 3R7NA 1XEAA 9LDBA 4Q93A 1RHKA 1ND6A 4HEA6 4PX5A 5GONA 5BXQC 5D2CA 4UFPA 3AVUA 2OECA 4IWYA 4YJFB 4HOYA 4AWBA 1OTHA 3PNBA 4B5KA 4EJSA 2KS6A 4CQLB 3M3HA 4MV6A 3EASA 2WMDA 1VOTA 4MVJI 3EGOA 2QY9A 1RYFA 3K6RA 1USWA 1VQ1A 1RAAA 3L7NA 3OF5A 4M0LA 2FWMX 4WBNB 3C24A 2HHCA 2AK3A 4GEKA 4YMHA 5FOQA 5CIYA 1W7AA 5CURA 1KO4A 3A8TA 1Z4LA 3RRZA 1M8KA 2E4XA 3AVPA 1QZXA 2WTBA 3IHWA 3SPXA 3T52A 3TTYA 3KHSA 5F3DA 3ZHOA 3ZIAD 2JFYA 3K0FA 1LBQA 3TSAA 1XHEA 3WL7A 3PBKA 2O8CA 3ECSA 3OBBA 3KX2A 2VK2A 3DMYA 1YE3A 4P84A 4YO8A 1DU4A 4JVSB 2IV7A 4P0TA 3RS0A 4CDNA 3LDUA 4CJXA 3SVTA 4ILEA 3C6QA 3J81A 1FC0A 3H2SA 1XQXA 3KE9A 4J4HA 1X80B 4K8OA 5I9SA 3ROXA 3W1WA 2JANA 5CG2A 1NOIA 1XVLA 1VA5A 3OFNA 4E51A 6CHYA 1PJLA 3OQHA 3G2QA 1G6HA 1E1YA 3EH1A 3CZPA 2VAWA 2WF8A 4B9EA 1HL7A 1IEQA 2J08A 5KQPA 2HXSA 3T3NA 1GGFA 2HCFA 2J31A 3SBXA 1ZHHA 4DJAA 3D8UA 1ODCA 2B30A 5HWSA 4LI3X 2VG8A 3RC8A 2XE4A 1UT6A 3QKWA 3GJTA 1CUAA 1PFKA 5EMNA 3TJZA 4FD2A 2Y77A 3QYJA 1LTKA 4PLPA 3RRNA 1GT6A 3FDJA 3ZTYA 4XWWA 1L7MA 2NU7B 3NYIA 5IFLA 2AI2A 1IY9A 3HCAA 4KQ9A 2UXBB 4EMBA 1H85A 3U26A 2PBRA 2YQ5A 3N2LA 1NKVA 2VHTA 3F49S 3IUMA 4HMOA 4K6KA 2PY6A 4GRIA 1XMVA 2D3WA 2L82A 3C15C 5LU8A 1EH5A 3G9XA 5FCDA 3OZIA 3ZWMA 1VKHA 2ZTUA 3U7RA 1T3SA 4IXNA 5GM2A 4EO9A 1H6BA 1FX0A 1IUNA 4FQ7A 4WZBB 4US2R 1CQJA 1ZGAA 4KLCA 4J1NA 3MD9A 4TTVA 2ILTA 4MP8A 3HR8A 3UK6A 4CCWA 1A9RA 1O2DA 2QD3A 4DA8A 4F4UA 1I24A 5C37A 4O2AF 3W6UA 1FTWA 3L46A 4WIAA 3WOVA 4DBVO 3ESXA 5CLFA 3CPHA 3MWYW 2RH4A 2NO6A 4GLBA 1N2IA 4WY2A 5JU6A 3OESA 4XVRA 4Y6SA 4FE3A 5LOVB 1E5QA 2VBFA 1BCSB 3NWEA 4PGAA 3ETGA 2NP7A 2YINC 4PYMA 1YQXA 1P3Y1 1BYUA 4WNYA 2Q4DA 1FFGA 2QN9A 4A7PA 2P0EA 4TV8B 4XTCS 4JP3A 1MB0A 1Y8ZA 4D79A 1CIPA 3VC1A 1QG2A 1ULUA 4ZMBA 4YAIA 1CS0B 8LDHA 1JH9A 3S44A 1IWAB 3OE7A 2VA8A 1T9KA 3BWXA 4CODB 1TCCA 2XMBA 3ZE7A 4Q3AA 2WAAA 2GCOA 3DE0X 1NONA 4JY7A 4ZVPA 2D54A 3S2FA 1PFUA 4R1MA 4ENSA 1L5OA 4PSVA 5DU2A 5C81A 3VU9B 2I1VB 4LYEA 2PVCA 3I8OA 4TUYB 4C4RA 3ISJA 4C6TB 2AK2A 3WK5A 2I4LA 3FY4A 2QM8A 3G8YA 2OD9A 1BD4A 2PKQP 1BFKA 3KS9A 1W88B 2HA5A 1X1TA 1RYDA 3Q6IA 4HDSB 3QW2A 3GLKA 4IJQA 1D1SA 2PSHA 4OY3A 4PGGA 5IKPA 3O8CA 3HXMA 1I01A 3EIQA 2O14A 2E5FA 3Q7TA 3ZZ0A 4F0HB 2HQOA 3GI1A 5HKOA 4EKEA 1YFJA 3HQ4O 5AKHA 3WMXA 1UBGA 4NMXB 5EP1A 4B46A 4BKPA 1YKSA 1Z7EA 3EQ8A 3T12A 1RZ3A 4BFZA 2UYHA 5JXWA 2C99A 4LJSA 5JOQA 5JV5A 3VOBA 5TGTA 1E3QA 2PT6A 5J5AA 1C41A 2VF4X 4YASA 3SQDA 5J2UF 1H0RA 2CEAA 1KDVA 4RFVA 5IJWA 2OZPA 2VNSA 3CGGA 4KPFC 5FUVA 4WOCA 5JYBA 3S6JA 5J2TB 2ZAIA 4TMTA 1PLJA 2GK4A 4WBSA 4NBWA 2VQ3A 2VWPA 5TV2A 1Q74A 1QR2A 2YDXA 3SKVA 3TX2A 4MUBA 1RJEA 3L07A 4Q7EA 3V1TC 4OFBA 2VTBB 3IAHA 3O2QB 2YY6A 3M6WA 5DXFA 4PZCA 2VUIB 3QUAA 1CRZA 2D0PB 3OFKA 4AY4A 4LQCA 1RYNA 1DEKA 1E3EA 1EVEA 2CKDA 3RBVA 2BEJA 4W5NA 1U0TA 1UAYA 3B70A 4TS4A 4IZHA 3R9KA 1RWBA 3GDWA 3I9JA 3WO1A 5C1DA 5K4HA 2DB3A 4BAZA 1UODA 1M75A 2O0HA 3FLAA 3FPLA 5ALKA 2CLLB 2OP1A 3G7NA 3WB0A 3FHCB 5IAOA 5KWSA 1GCOA 1FDTA 1OT3A 3AEZA 4DDHA 1VCIA 2XZLA 4LRYA 3P0RA 1BE0A 2H5JA 2RC6A 2H8GA 3K70C 2WF6A 5LYYA 1JLHA 1N2ZA 1YL6A 1HNWB 4NICA 1VI5A 2ASEA 2H1SA 1VE3A 4PYIA 1XUOA 4ESOA 2VAPA 3NGLA 2GBLA 3U80A 1UQUA 3IKVA 1E3DA 2A5JA 2VN8A 2ZSBA 2G88A 2J32A 1SIOA 1PT8A 1YR7A 1UEXC 3RQSA 3S2YA 1ZAYA 3GCGA 3CUVA 4XRRA 5CT9A 3E58A 2XUJA 1FVXA 3EIHA 2VYFA 4MH0R 1E8MA 1IDN1 1BQ4A 5A2QA 1GNRA 1CY4A 3AZQA 4RU1A 4U4AA 3LBNA 5T6BA 3DD5A 1CE8B 4JYPA 3MWDA 1K66A 1W30A 4LSGA 3TKYA 2PJRA 3ZHBA 3PKJA 4MRAA 3S2SA 4YAGA 4YY3B 3KKZA 4B6RA 3P4UA 2ES4A 4AJNA 2A6PA 2XODA 1LZLA 4TRNA 2C5AA 4IOLA 1JWAB 1V5IA 2O8DB 2VAXA 3C74A 4FDAA 1PL0A 4ARZB 4NR0A 4TVBA 5A6SB 1L5VA 3BRSA 4YUVA 2IBMA 4FDVA 2IYQA 4KXMA 5A5EA 1FLAA 1KBQA 1YNSA 2QTZA 4BP8A 3GB9A 4NOKA 1UR5A 3ILXA 4NCIA 5D1HA 1PZEA 4KBYA 3SJZA 3HKEA 4NEHB 3ZDFA 3OQBA 2ZVQX 1V41E 4PGHA 4C0AC 2O5CA 1Z2AA 5JAMA 2HLDD 3CV3A 3MUOA 1M72A 3OURA 3VR0A 2QR5A 2XMSA 3FWNA 4P3NA 3FOEC 5F2EA 1GVHA 3I6IA 3OQIA 5H82A 3L92A 3RF6A 1EMDA 1NMXA 3MCZA 1SKUA 2HWYA 2PSSA 1JJ7A 2DBVO 2P1ZA 3CKYA 4AYXA 2C7QA 4LRTB 1Z8HA 4EMTA 4XVHA 4Z7OB 3DC2A 3DP9A 4Q39A 2RMKA 3HN7A 1AF4A 1T9CA 1RZVA 2REQB 3PGA1 3SZOA 3WIOA 4ARIA 1UFKA 2CLSA 4BWGA 3LWNA 4BP9A 3FZQA 3DDSA 2G9RA 4Q3CA 3D3JA 2C20A 1B43A 1CD5A 2JLBA 4GP7A 4D98A 3D4OA 3P2YA 2G67A 3DMGA 3K2BA 3W79A 2X8JA 3DTVD 3WX0A 1XZBA 4LNUA 4BNJA 3HGQA 4B6SA 2J3IA 2R96A 4YCLA 2BMVA 1QQ7A 2BONA 3OQJA 3OOSA 2JLWA 3CZCA 2QVXX 1H5UA 1V3TA 3DTVB 3EVGA 5C8YB 3D7RA 4DCOA 1VP3A 3LQ2A 4PRYA 1TVMA 1M1YB 3EN0A 4Y6LA 3KSBC 1FW6A 5K0FA 2GHIA 3AR3A 3INNA 4RZQA 1KEEA 4XR4A 2DXIA 1XAGA 4WVLA 2VXBA 1LRKA 1BE6A 2HJHA 3TRDA 3EVDA 3E8MA 5EIOA 2GD2A 1EVQA 4Q3NA 4Y6QA 1KI6B 1HX7A 4YREA 2GO7A 3PXCX 4OO3A 1H42A 3CFYA 1ES9A 3S27A 1VXOA 1IWPB 1RAIA 4WPGA 1GRNA 2FR0A 4DV6B 1Z2CA 2XB6A 3E7DA 1WY7A 4PLZA 2PQMA 1GPKA 4YH1A 4YRJA 1WCV1 4HB4A 4B5LA 5IKMA 4EF5A 4CMAA 1SUCA 1W4BA 3DLTA 1CUUA 2VWQA 1A9QA 3NTOA 3LPDA 2XNJA 4DCPA 2ZM5A 1YA6A 1WNFA 3Q7QA 3THYB 3LUKA 1ODIA 1Q0TA 1SPBS 5E6UB 1NR7A 1DTWB 4YRGA 1KSGA 3WMRA 3AOGA 3DHWC 5BYJA 4ER5A 1GN9A 1U0FA 4IQGA 4ZWNA 2Y99A 3A1UA 4PC3A 2JGFA 3W77A 2CFIA 3KVYA 1PZXA 2Y4NA 1VPDA 4JBYA 2W98A 4AMGA 3SR4A 3BFPA 5K0BA 1JEOA 1ORDA 2WF7A 4A2CA 2VQ6A 5AVSA 4YK7A 3EG9B 4X84A 4A16A 1AQJA 2FUEA 2JCYA 3KYDA 3ORYA 2I6XA 3EJWA 4ABTA 3PKZA 3AVYA 4CN8A 3IEUA 3CLVA 1Q16A 2O4CA 4P82A 2KYRA 2QMEA 4KUGA 4MEBA 4NU5A 3RTBA 1XTTA 2IZ0A 4DAOA 2WINI 4FE4A 1R7RA 4KCGA 1UWKA 3DCYA 4QDOA 2JJMA 3H2YA 4FX5A 1OZ0A 3IEXA 1W4CA 4JGGA 2UV8A 3HKBA 3IVGA 3CVWA 3SQXA 4WN9A 1BFUA 4QDUA 4BNDB 4TXMA 1RI4A 3OKAA 3SC2B 1KBOA 1NZFA 1H0KA 1TLLA 1OTXA 5FB3A 4M60A 1WNTA 2Q46A 3CC8A 5H3HA 1RI5A 1Z26A 2BL4A 2QZJA 4H1UA 1QP4A 1J0XO 3NBMA 1LPAB 4QXRA 4PQYA 5JO0A 1TU4A 4ZKDA 3WWEA 1L4MA 1T9GR 1IAVA 3BH7A 3V8RA 3H2HA 4MUKA 3IP7A 1NN5A 1OASA 1EVJA 2WPNA 3PHHA 4I9NA 4M0MA 2Y1WA 1JIQA 2GS9A 3AJ8A 3N53A 2OGUA 4JNKA 5B1IA 4EG5A 5DTQA 2DUUA 1RXVA 1D7AA 1MMFB 3V46A 3KOZA 1MX3A 2BCJQ 2NSJA 1XCMA 2Z4RA 3NFYA 3PDIB 3R6WA 2AUNA 1EM6A 1ZA2A 4E3ZA 4JYBA 3C3MA 3LFUA 1JG6A 4J1TA 5JLAA 4CYMA 3UB2A 5BPHA 4RFSB 1M6EX 5DM2A 3UAWA 4JP2A 3IVCA 3HHEA 5L3RA 3MW8A 3A9RA 4ZI7F 2X8WA 3EPPA 4NENA 3OTOB 2YN4A 3K32A 4Q5IA 3MT0A 3OG9A 1ZSVA 3BXHA 2FJUA 4FS3A 3V8VA 3VPDA 4DKJA 3I1IA 221PA 2P4QA 2BCGY 4ZV9A 3F9CA 4DHWA 4F8EA 3KD2A 2FPLA 1NLFA 5HJEA 1C8VB 2GKSA 4DR5B 3ELUA 1ZJ5A 3IESA 4DC9A 3FPNA 3Q8MA 2PXAA 3ETJA 3HJNA 2PX4A 1U7ZA 1DLJA 1JJFA 3U40A 2Z8YA 3QOFA 5AVTA 3QYAA 4F1WA 4N40A 2BFBA 3O4GA 1NQOA 3GCZA 2V6FA 2ZE7A 4GX1A 1AKVA 1NF2A 2IYOA 4FFVA 3HV0A 5FPQA 4EVQA 2IW1A 2WYUA 2CY0A 1T8UA 2AOUB 2BGUA 2CWDA 4BVHA 3EIXA 4RF5A 4K1XA 3WK7A 5KYWA 3TRJA 1A9ZA 4HQ6A 3G7UA 3I09A 4UM9D 3JPYA 1JQAA 3C3DA 3U3DA 5ALQA 1V96A 4BVEA 3SSMA 5DNUA 3OOYA 3SY8A 1Y9JA 4NZOA 5T6MA 1LNZA 1X7DA 2FZEA 3PPYA 1Z6TA 2E4VA 4MW0A 1NJ1A 2E18A 3RS8A 1EIWA 1ZBDA 1AQ6A 2BJHA 2Z9BA 4EY7A 2I34A 4INOA 5BW5A 3ET4A 2GBCA 2HX1A 2PE5A 2TYSB 3I37X 3BWCA 2BAGA 4JYAB 2OGWA 4RFSA 3KQPA 5B55A 3U62A 4HATA 3VNRA 3QPBA 1OWNA 1U0LA 2IEGA 2YWRA 1UC5B 3BWYA 1TYAE 1WVMA 5FBWB 4ZGGA 3BIXA 1ULSA 5EGSA 2R4QA 1RRPA 1V1MB 1SVNA 2XXJA 2QTTA 1CF2O 3R7SA 2ZJ8A 5F52A 5DRTA 3RTEA 2Q5EA 1GU0A 1Y3DE 2Q8NA 4HNGA 4RLHA 1OX5A 3EVFA 5F64A 4B32A 2FW6A 2VJKA 2J07A 3IO3A 4OLHA 1TM3E 2R79A 3IUEA 1TC1A 2BH2A 3UGTA 4CKXA 2FHPA 2OCIA 5EXSA 3OFVA 1T2VA 2Z56A 1OX4B 2OD2A 2JLVA 3OFSA 2NUBA 2Z4TA 3N2GA 5ARDA 4BX9A 3HVHA 4NDAA 4TTSA 3ZU4A 4C78A 4LXYA 4OGWA 4DCMA 5C5IA 1GIAA 3PUZA 2GAFA 4KAAA 1N33B 2Q0HA 3A6EA 1MNQA 4OJKA 4MQ5A 4PY2A 1Z13A 1UBKS 4GMXA 4FCCA 5KYWB 4F5EA 2PLAA 2Q5HA 3VR5D 2JW5A 4EJSC 2C57A 2X4LA 2XR1A 3LQRA 4H7KA 4KVZA 5JPIA 3T1NA 5AI9A 5D85A 4BN5A 2V7QA 4K0KB 1KJJA 1WMSA 3GJ4A 2NUPA 2HMVA 4B0PA 2CE2X 5K8CA 4YCDA 4LHXA 3U1VA 4Z0TA 1WZ2A 5CDFA 3DVSX 2YC2C 1C30B 1ND5A 5MFPA 5C7OO 4XEHA 4DJDC 1VL0A 4E0BA 2DY1A 4OD0A 2QJFA 2VHCA 5JNWA 1DDGA 1FQWA 1D4AA 4LY0A 5BNTA 2AFHA 4KZKA 3F4LA 2AW3A 1QKIA 3FPKA 2R6R1 1S2GA 2Y93A 2YHUA 1KY2A 1FF9A 2FUG6 2D74A 3THWB 5A5VA 4PNHA 3ROFA 1VFPA 1IQRA 2YV5A 4UEQA 2YNMD 5IZCC 2ZS9A 4J0IA 4AL4A 1W44A 3GBSA 1P1CA 4L9RA 2O0KA 3TQSA 4PONA 2JRCA 2VDOB 2WUVA 4BNFA 3N2YA 1H94A 1SCUB 1XQVA 5AK0A 3TOZA 3ULKA 3ZI0A 2EAUA 3FLEA 1JX6A 1YGPA 2EZ8A 4W5QA 1VGVA 1Y81A 3GLRA 3U56A 5JBQA 1INLA 1TVKA 5JCJA 2EX4A 4LC9A 3ZVRA 5ICEA 3G02A 1SD1A 1SC6A 1TO6A 4JX9A 1KY5A 4W8GA 5LDHA 5C4GB 4QVIA 3N59A 3MSCA 1BYIA 4NK5A 3I5YA 3QEOA 2A1UB 2GH1A 4IHJF 3R0VA 4A26A 4HB0A 2WIFA 3OIDA 1FP7A 1DEHA 1NQXA 1PNTA 2CCGA 2UYOA 1MQ9A 1YO6A 4EENA 4QTTB 5EMLA 1NPTO 2HOQA 2GPNA 2DYKA 2PRJA 2RG7A 3THXA 3NBUA 2UZ1A 2VF5X 4JS0A 2GZRA 3C5CA 1TKAA 4B0OA 2IHVA 4HX2A 4EGAA 1P3DA 3M3PA 1EJ2A 4WFKA 3VSCA 1BX0A 1YMQA 5DK4A 1L1RA 1KOLA 1GUZA 3T94A 4G8CA 1ZKDA 2C0CA 1ZOIA 2VWGA 3L7LA 3LY9A 3MQFA 1IZZA 1ZXXA 4FMBB 3OOHA 1H2ZA 4CKCB 1T4CA 5K0TA 3KRTA 4AECA 1IDOA 4PBRA 1JDUA 3DJFA 4RTQA 2VJBA 4KQEA 3RAGA 4R4JA 3THWA 2ORIA 2A9FA 4FW8A 1ABFA 3TEJA 5TQ0B 2CV2A 3C6YA 3MINB 2B20A 2FEPA 2WVHA 4IIDA 3D6NB 1WOYA 3REQB 1GPDG 1Z88A 3RJTA 4TS3A 3R9WA 2VPYA 4YUWA 4GBED 1JUDA 4J43A 1GGMA 2VT7A 3PXAA 1EUCA 3RLIA 4LPSA 1UWLA 3IP3A 4RADA 4YRNA 3D4BA 2QYTA 3UV6A 1F1BA 4FYHA 5ARBA 5CXUA 3ZEIA 4F4FA 3HP7A 4IFTA 3OQMA 5FPKA 4G23A 3W1VA 3CW8X 2ZYWX 1BS1A 1NW8A 2H1WA 3D4PA 1YZQA 3WDLA 3VDNB 3H4TA 1CWUA 4KWIA 4M9UA 4JLJA 1U9ZA 1DAMA 1D8TA 4I50F 4BMCA 1CEEA 4C21A 1EHIA 4FT2A 1IHDA 4JOQA 2M6LA 3PRYA 3NALA 3L05A 1U2SA 4P98A 2CNKA 3HRHA 3BA6A 1MQAA 1O6ZA 3ZI4A 3TRIA 5BMOA 1MPTA 4Y2UA 1MAHA 3EZGA 4EX6A 4ZIRA 3V2UA 3TXYA 2GNOA 4HK4A 1G20B 2XTNA 4R5MA 4XFDA 5HA5A 3UUWA 4JJZA 3GJXC 1ISGA 4TL6A 1T15A 1BD3A 5EPEA 5CH5A 5HXAA 3I64A 2G9UA 4I6EA 2W2VA 3R0IA 2I67A 2Y1EA 4FLMA 3GDFA 4HV4A 2YMMA 3OZWA 4JDUA 4K46A 1N0UA 2IKSA 5ALEA 4L6IA 3AHCA 4H17A 5CU7A 4CDMA 4F7WA 3KR1A 3TH5A 4HYYA 4P7FA 1ESCA 1G4AE 1VPTA 2IYSA 3MCVA 4KSYA 4MUGA 3QLEA 3L77A 2MSWA 1YRHA 4PSDA 4EO4A 1N7JA 1COWA 2RH5A 2QRHA 2XYQA 4DLTA 1TK3A 2VDWB 3JXEA 1BW9B 3ZHRA 2G1PA 3TK1A 3ZK8A 5FPSA 3OLYA 3A37A 1U9IC 2EGUA 1EWVA 3TL6A 2UXCB 3TIFA 3B82A 1MORA 3VPGA 2OFPA 1L5HB 4GZ6A 3N70A 2BM1A 4YP9A 3CIFA 1XKTA 3L6DA 2ZRHA 4H1TA 3HVJA 1GQSA 4BMPB 3RO7A 2F8MA 4A6PA 1XEXA 2X4IA 2DFNA 2Z3ZA 2GVNA 1H2FA 2CNBA 4O25A 4DG9A 2IH2A 3WGYA 1R6DA 3B5JA 1E4OA 1WUJS 1X3LA 3DFFA 3Q3GE 3KYIB 1PJCA 1Y7TA 2RHJA 3DMPA 3PTZA 2GRUA 5HGJA 2OTCA 2ZAGA 3FH0A 3I2JA 2L19A 2GBIA 1NBMD 1WDWB 1X7XA 3H9QA 3QU2A 5H68A 2PD4A 1MO4A 1S3GA 2P6OA 2GN9A 1G5HA 4U63A 4BBPA 1E6LA 1SBZA 3F5FA 1K06A 3EPKA 1GLGA 2CFSA 4R1QA 4K6CA 2FSIA 4E31A 1FCJA 2GEJA 4XQEA 5JNLA 2RK4A 1MJHA 3EUFA 1UMDA 2GF0A 3OZUA 1YIAA 3EK2A 1WUTA 5A9RA 2OHJA 5FLYA 1X14A 2MYTA 1BGVA 2ODBA 1BX3A 2XQGA 3FMGA 5IDYA 2J3DA 4HN9A 1M1NB 1FX0B 3QELB 2ZYGA 1CQJB 1KZ4A 3VR5A 1M2JA 2IZOA 2D62A 2EFCB 1PKEA 2W2KA 3B1YA 5CYPA 4MS3A 4A1FA 1J8MF 3OZFA 2AXEA 2TRSB 3MJTA 2V6IA 3O4IA 4NAHA 4BAUA 2QXUA 5JSUA 3NU1A 3Q5GA 5HIIA 1H1LB 1OFUA 1L7AA 2VR1A 1RR6A 5K3BA 3DMNA 1JAIA 3IJRA 1FVHA 1Y5LA 3Q40A 4XARA 1PWYE 5I8WA 3U6KA 1XKXA 1WRBA 4FYIA 4PR0A 3RSLA 4UVIA 3CNNA 3O2NA 4YB8A 5BT9A 4FDUA 1FS5A 1UM8A 4YCSA 5C8DA 3UMCA 4BZWA 4EGJA 1E4EB 1XZDA 1Q0ZA 2GFHA 5COAA 1JWLA 1WOMA 1HNNA 3DT9A 3HZHA 5ECGC 5K8LA 1P2UA 3MJVA 1I2MA 3GK3A 4TV8A 4K26A 2VAVA 3DLHA 1J0DA 3D7NA 1XRNA 3EDQA 3EFOB 4NYIQ 2PH3A 5J63A 5KYXA 3WL4A 3PEWA 2CUNA 2D06A 3JWPA 4QATA 3G9ZA 4C7XA 1QU3A 1VHJA 4OYHA 1EVLA 4D45A 2WUEA 4F91B 3ZUGA 3CSDA 1PYGA 2NO5A 4C7OA 5E1BA 1RWNA 4YP6A 1MD9A 1UBUS 2G72A 1DTSA 2F3PA 3FYUC 4OYLA 5GMOA 3RH0A 2IYPA 3CKLA 3IYLW 3ZHCA 2KSQA 2VSYA 1N2SA 1QS0A 1K8YB 2B78A 4WNIA 2UYQA 1E0SA 4N7BA 1GSIA 1EAMA 2GPBA 3LM8A 3G9QA 4GSKA 5JJCA 1R0BA 2JLAA 3I2HA 1CUWA 3ZCXA 1QYIA 4XWOA 1O95C 2HA7A 2YV3A 2JJQA 4R7GA 3TIIA 5B7QA 4DG8A 1JSLA 3WZMA 3BIOA 2GRJA 2EEPA 1W5SA 4MS3B 1SVUA 1V9CA 1DQSA 2QX7A 2JHAA 2KWIA 3CLKA 3D0KA 3R77A 4K8RB 4LI0A 5FA8A 4BDSA 4V1CI 2KI5A 1K9VF 5CVUA 2PUDA 2B82A 4A2QA 1YIDA 4TMXA 4KP7A 1GKIA 2C84A 3EWAA 3CNOA 4S1WA 3AIMA 3NT4A 1UIRA 2JK0A 4URZR 5EIXA 1CR1A 3BMQB 3JQGA 3NO4A 3GL9A 3IP5A 4HLNA 5TQ2A 2EBFX 3BXGA 3GC6A 3EGXA 4EW2A 4H18A 2HH9A 4LFBB 3OZBA 3ICQB 4KGVA 4UC0A 2OK8A 4IQ0A 1LQUA 4JSYA 3B1WA 4FSDA 1GDHA 2PJZA 4OXRA 5KYXB 3HACA 3WYBA 1I1HA 5FPHA 3FJYA 3VKUA 2C8VA 2QWXA 3BYZA 3FGOA 5E9JA 3SM9A 1Z34A 1DQNA 1ZJWA 2VJCA 3V33A 3JASA 2BM0A 2ZDHA 1H0SA 4RZ2A 4AIRA 3DMDA 1H66A 3O03A 5IZCA 2QTBA 2DPYA 4JB3A 1VGRA 3IXMA 4DMFA 2V9ZA 4JIGA 4KFCA 4V02A 5G2OA 3SBDA 2AG0A 4OB6A 1YTLA 1QS0B 4XX1A 3R5JA 3RK1A 1V7CA 3AJRA 5KQLA 2XUKA 1DCMA 4V2IA 3C4JA 5HFNA 1B93A 2VDLB 1XA3A 3RSOA 1NKSA 5HBGA 3QBEA 5EHGA 4XPZA 5AM3A 3AVXA 4OYRA 5IWAB 5EKUA 1P81A 3E3MA 3LLCA 4UVGA 4AKHA 5ALHA 1YS1X 4IXTA 2ZB2A 3TSCA 1W36B 2ZETA 4UM5A 3IO5A 4HAWA 3W5IA 1KP2A 2NO9A 4D8YA 5AJHA 1SU8A 4RORA 3L8EA 4NOLA 4BZXA 5AJUA 4COOA 4KR0A 3GQBB 1SJ9A 3U4IA 2FMFA 5TQVA 4HWGA 3B9QA 3WG9A 2IP2A 5D3ZA 3KOMA 4B44A 2VNKA 3WRYC 1QTRA 2OGTA 4KWHA 3UK7A 2O4UX 3FCOA 4MA4A 2NOAA 1VIYA 1NXPA 1VKJA 2R751 1JEJA 4HYQA 2D5AA 1QZZA 2YZGA 4P4LA 4FKZA 2XADA 3GGCA 4LY6A 1SOUA 3C48A 1IR21 1JEEA 1L1QA 5FL7D 2X0DA 4PIVA 3RVOA 3GRAA 5DOVA 3RC7A 4N8EA 2BZGA 4P53A 4F21A 3U3RA 1R4MA 2B1QA 2DJ5A 3NM4A 3AVQA 4M9QA 4D3ZA 3E2MA 4HWKA 3BKXA 5KNCH 5KTOA 4MVWA 1XZQA 4N12A 1ZY2A 2WOJA 5SZJA 3ST7A 2QTCA 4R8RA 3CUEF 2GFIA 4WSOA 3OJXA 4CDRA 1UMBB 4NBKA 2X9GA 1AQNA 1AGXA 4FGUA 4TKMA 4RELA 1UK7A 1GXSA 3FR7A 1YZVA 3MJEA 4BMOB 4R40A 4AY6A 2K2QB 2E0IA 2AH5A 3B3GA 4R1NA 1VJ5A 1CQPA 2V7PA 1GZ3A 4JLOA 1Q0SA 1QH0A 1YUMA 3DMTA 2MDTA 2C2YA 5TQJA 3KSDO 4WW0A 5HQ3A 2R8ZA 2C2WA 4EB3A 5KWIA 2RGUA 1SZJG 4L22A 2PUVA 2PZAA 4IWXA 5B2EA 1L8LA 5NLLA 3WBBA 1AUQA 2VC2B 4OV6B 3UT6A 1G6Q1 4W1SA 1IR1S 3DW1X 1N1EA 5K2MA 3UFXA 5E4JA 4YQFA 4LSZA 1WHSA 3OQIB 2IZ6A 1W5FA 1B1AA 3EXEB 2JAXA