5DM73

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
b'PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dm7300
4U673 5JVG3 4WFN3 3PIO3 3PIP3 5DM73 5DM63 5JVH3
chains in the Genus database with same CATH superfamily
1C8CA 1EIYB 1MD2D 4KKTA 4RG1A 2CWAA 1QVGA 1OXSC 2LMCB 1KNAA 4LF8Q 1VQ9A 1LUZA 1QVFA 1TWGH 1G6ZA 4BXXG 4DR7Q 4BXXH 3B6YA 2HD3A 3BYYB 5DNFA 1K8MA 1B3AA 1UEBA 2F3VA 3PF5A 2R7ZH 2R7ZG 5C4XG 1KRTA 1Y8NB 5C4XH 3I72A 4IOAA 2L0CA 3FKIG 1O80A 2D9UA 3FDTA 3FKIH 3DUZA 1HR0L 3UI2A 1RJTA 4IFDI 4G57A 4A3FB 4DR5L 4DV6L 5ELFA 1WI5A 5LHY1 1ESFA 3PCOB 3IKJA 5DM73 1SR3A 4LFCL 5K5PA 3NTIA 4DK3C 2FINB 2KCMA 1BUVT 2VQEQ 2VL6A 4MTNA 3CC4A 2R7ZB 1IKLA 4JI3L 5C4XB 3RZOH 2Y0SG 4ZUIA 2Z0SA 1QE6A 3FKIB 5ELDA 1SXTA 2F0WA 2KQ3A 4C3IH 4C3IG 1HNWL 5JVH3 2N78A 1CHQD 4NXMQ 4DK6C 1Q81C 2NB0A 2P5ZX 1I4QA 3CW2C 4DN4M 5CV8A 2KBNA 1D6EC 1TQOA 4U673 1TS3A 4YY3L 3CP0A 2G9HD 1DOLA 4UDUC 4DV7Q 1PFSA 3M85A 3RZOB 1CA5A 2Y0SB 1TWCH 3SK8A 2EIFA 1BCPB 1V9PA 3RLNA 2HUGA 1K3RA 4C3IB 4HEDA 1J5EQ 2F0GA 3I4OA 1DM0B 4DK1A 5LMNL 2JA5G 2JA5H 2VQFQ 4HSPA 1V1OA 2AHOB 1I4XA 1WTRA 3UDFA 3LGJA 1A2TA 4YCUA 3C3LA 1Q1BA 2K50A 2O5JC 1G91A 3S1MH 1UE7A 5CGKA 3J7YW 4GKJL 3PO3G 2ALYB 4K0KL 3PO3H 4L8JA 3GTMH 4LFAQ 4RCNA 4WJ4A 3RLOA 4JI0Q 1TWCB 3KJOA 1WTXA 5BR8L 2R7DA 3L7ZC 2NYZD 3HOZG 1K83H 4PZ8A 4B9WA 2JA5B 3STBD 1LLRD 1CQVA 3CCMA 1VQ5A 2UXDQ 1WTQA 4LF6Q 3SE0A 4JG2A 1XJVA 4KHPL 3KDFA 3WWVA 3QO2A 3S1MB 3PO3B 5IGFA 4DV4Q 3GTMB 1H9JA 1IBML 2BCOA 4B3TL 1LV9A 2IJ0A 4V0BA 4U68A 3HOXG 1TR5A 3HOXH 2F0FA 1GUNA 4EQPA 2A5HA 3I7FA 1WJJA 3K8AA 3WDNA 2IT1A 5CBEE 1S5ED 1W6JA 2NN6I 5AJ3Q 1LT5D 4MIUA 3MC0B 4EX5A 2A68D 3VYUA 2BE5D 3RR5A 4C1NK 2VW9A 1PH3A 3CHBD 2B2UA 3PSIA 1WTHA 1F2MA 2KCTA 4QY7A 3H91A 2E2JH 3DMUA 5IWAL 2SNSA 3S2DH 2VZAA 4X6AH 3R3OA 3S2HH 3PUXA 3L0OA 2MQHA 3TREA 4M8AA 4KV6A 1HR0Q 3D8GA 2WV6D 2EXDA 2ZT9C 2WINB 5E3FA 4GNXC 1TXYA 1H9SA 4JI6L 4GZYC 1CKMA 1U4MA 3HEJA 4IN3A 4O42A 4A75A 3HOVG 4DV6Q 3HOVH 1KDBA 3S1NH 2R61A 2GVAA 4LFCQ 4PMCA 1RDPD 3CPFA 3ERSX 1QUQA 3S2DB 4DXGA 2EYLA 2MFIA 2QEXA 3S2HB 4L63B 4MNOA 4DFAA 3NQIA 1XMQQ 1X9NA 1KABA 1JE5A 2RCFA 5C44G 5C44H 3DM3A 2G9DA 4UY8C 2UUAQ 1I4GA 4RGTA 2DY7A 5C3EG 1LT4D 5C3EH 4DGZA 3PO2G 5FLMG 3PO2H 5EQ0A 5FLMH 2PZWA 3HOVB 4RHRA 1GHKA 3S1NB 1SE8A 1HFNA 1LTAD 1MIUA 4MHEA 1MSGA 1PTOF 2RCNA 3A56A 4K14A 1RHPA 1CI3M 1XMOL 3OIPA 5C44B 4ZQ3A 4GN4B 4ME5A 4RMFA 5EAYA 5LMNQ 4A3LG 3IFDA 4PQXA 4A3LH 3BZCA 5C3EB 3H15A 1HUNA 1EQRA 2RF4A 1PH6A 2IY5B 4DUZL 3S1QB 2K05A 3R8BA 2DN8A 4IOCA 1KNEA 1EQTA 4PMBA 4GKJQ 5L37A 2UXBL 4XXEA 4HCEA 3J80L 2F4VL 1U9RA 5IY0A 2UUBL 3ND8A 4H0LC 3NXWA 3H94A 2OTLA 4IUUA 2QGQA 2UUCQ 4HCSA 1BBXC 4NXNQ 4PZ6A 4IZ8A 2QEJC 4IALA 5FLXE 3Q8DA 5IT9c 4A3GG 4A3GH 3PIOA 1IL2A 3DLLA 1FGBD 5G3LD 4KHPQ 1HA6A 4JK1C 3K80C 2ZTEA 2FFKB 3I8ZA 1JWUD 3P7JA 1ICFB 4C2MB 4NP5A 2OCEA 1I50H 3PIPA 3TQYA 1VQHA 2MP1A 4B3TQ 1J6QA 4APVA 4BA2I 1C4QA 3K5NA 3PUZA 3SR1A 2N8NA 4IURA 5ELEA 5IYBG 3F2DA 2F0IA 5IYBH 1MJCA 1RL2A 1STNA 4K6LA 4A3GB 5ELNA 1HTLD 1Q86C 3HOWG 4A93G 3HOWH 1CZGA 2N55A 4DAVA 3K5MA 1DXMA 4B9XA 2HHHL 5J1ZA 4O2DA 2IX0A 3DHQA 5C4HA 3NUCA 3MHBA 4DNRB 1J9OA 5DEHA 4LF7Q 2DY8A 4FXKC 5E7NA 1DOKA 1EQQA 3KF6B 3EVQA 5FO8B 1WTPA 2N88A 4DF7A 3CCSA 2F0PA 4BY1G 4BY1H 4N8FA 5KGUA 1M90C 1VQBA 1SMYC 3KBGA 4GOPC 2CFMA 2XSCA 1E22A 2IX3A 2A69C 3T16A 4AH6A 1BCPD 3D4RA 3EQLC 4BBRG 1EY4A 4BBRH 3OMGA 5J39A 1S40A 4GKKL 1O7LA 3N6RA 1D5ZC 2XIWA 3I91A 4GN5A 4A3EG 2PNHA 4A3EH 4QMGA 4BY1B 2A1AA 3FVQA 1IW7C 1PH4A 4K2KA 1MI2A 3UE1A 2RDGA 3CCJA 3JAMc 4GNXB 4K5XA 2NBFA 1KIXA 3U4VA 4BBRB 1MHWC 4QUFA 3NHHA 2EYOA 2LY7A 1YHQA 2A6ED 2IWHA 1VF7A 2UXCL 3OSOA 4B3SQ 2F03A 2EJFC 5IODA 1U4LA 2VY3A 5M9OA 2F3IA 3TZUA 1II3A 2MO0A 4A3EB 4JI8L 3SEBA 1JORA 4DUZQ 1B2TA 2ES2A 2UXBQ 5C4ZA 3ER0A 2SOBA 1SNOA 2B29A 4AYBB 2F4VQ 2UUBQ 1JB3A 1NBWA 5DAUA 1I4PA 3MWYW 1PFMA 1GUWA 2DUDA 3A74A 2F0LA 5T1IA 4TSSA 2IPKD 2F0MA 4HIDA 4JI7L 3M9BA 3J7AF 4DR1L 4AQYQ 4RH6A 1YNNC 5CMDA 3G6JB 3DWPA 3M4YA 2O5IC 4NB3A 4XYOA 4KMUC 1X32A 2B2YC 2HIVA 3KLRA 1IBKL 5JAVA 3M4QA 3MEFA 3GTPH 2AQ1B 3J81j 2KHJA 2M2LA 5F2DA 4YWKA 1W2BA 1I4RA 4EGVA 1LTSD 4LJZC 2PYKA 1EFID 2I5MX 3OYYA 1U0LA 2K4KA 2V1CC 3FEWX 2HHHQ 1BQQT 4WJ3M 2C9OA 2JA7G 1LTGD 2JA7H 3QIAA 2VB2X 3D31A 3K58A 4DV5Q 1F77A 2Z8LA 4ZAIA 1EUJA 3T53B 1X3EA 3GTPB 1Y14B 5C3WA 3IRBA 1W6KA 4JI2Q 2BOSA 4HJ9A 1HPCA 1W3SA 2PNRC 4HTHA 5C0XJ 4IJLA 3RLFA 2KECA 3J81i 4OL7A 1ENFA 4QGUA 1STAA 4J6HA 2JA7B 2TMPA 3I55A 2R93G 4N9TA 5IGDA 2D5DA 4DR3L 3I56A 1XPRA 3D4WA 4RHSA 2IL8A 3GTGH 3D6CA 5EPJA 1XPUA 5CV5A 1OXTA 4QIWE 1QNKA 4GKKQ 1FYCA 5BN5A 1FJGL 1IXRA 4CKCA 3TN2A 3G7LA 2QW7A 4GOPA 1DD2A 3HKSA 4ME3A 1JB7A 1YITA 2EY2A 5DM63 1HNXQ 4A3JG 2KENA 4A3JH 2LKVA 3PMFA 2KHSA 3U50C 1BXTA 3GTGB 1QCBD 1QNUA 2J7ZA 2MPMA 1KD1C 2KCNA 4NMZA 3K7AH 1EY6A 2CWPA 2QKIC 2EY1A 4RKBA 1WD1A 1L0WA 3E0EA 2SEBD 2Q8RE 3S15H 5J3BA 1FNUA 4JI8Q 3TS2A 1HNZL 2EOTA 5IE8A 1KQSA 4G7HC 1N33L 1QILA 1Z47A 2PCFB 1C48A 4A3JB 1EU3A 2JK8A 3QOJA 4OO1I 1WFQA 1Q8KA 4ZRZA 2ZXRA 4BY7B 2WB1E 2E76C 3K7AB 4B3MQ 2HT1A 1A0IA 1L1OB 4DXFA 2L9HA 5C0XG 3S15B 5C0XH 1BO0A 1M1KC 1M4VA 2PW5A 4I7ZC 4DR1Q 5D3DA 4GN3B 1GUTA 2B39A 2XNAC 1K9MC 1TWAH 3VDYA 2MGSA 3TS0A 3AFQA 3NWSA 1VQIA 1X6OA 1B9NA 1BCPF 5BN3A 1EEFD 1A62A 4KY6A 5M3FG 5M3FH 4KJOA 3V96A 1Y8OB 1PFBA 1VQCA 2A8VA 1ZXTA 4OIKA 1ENCA 2CH4A 1EOTA 1EYGA 1B50A 1KDAA 2WIIB 1CA6A 1K8GA 1A63A 3RUZA 4L5SA 3HFZB 3GTQB 2WFWA 1JR0D 2K5DA 3NBIA 4CJ2C 5C6AA 2JP1A 5IT9E 4Y7NB 3H3VI 2VUMB 2Q2UA 1SNMA 1V43A 3I2ZA 5M3FB 1SRUA 1TT2A 3LX0A 2K75A 3PV0A 5IGGA 1IYVA 1S5BD 2HQEA 5CR3A 4IPCA 3W1GA 1YNJD 2AUJD 2YTYA 2LFNA 2QDBA 3T1YL 2J4XA 3H0GG 3H0GH 4HJ8A 5IGBA 2H4OA 2XWJB 1EY9A 2UU9Q 1BBUA 1YEZA 1A8VA 2MHVA 4QF4A 5D65A 2IX1A 2B3GA 1JJGA 4OWXB 1HA5A 1KC8C 4X66Q 1FJGQ 2CW0C 2OT2A 3L2PA 2ENBA 2A74C 3HKZE 1SYGA 3H0GB 4A3FG 4A3FH 3IL8A 5T1GA 4DUYL 2K5QA 2NVXH 3RZDB 1KLGD 1SROA 2Z9HA 1AH9A 1CT1D 1WD0A 1PRTB 2NWGA 1VQ7A 4JC0A 4FNFA 5JJZA 1K0RA 4KHZA 2SDFA 1EOVA 1JOKA 2RVLA 4I65A 1UE5A 4XT1B 5FO9B 1SNQA 1AP0A 1HNZQ 4QQBX 1B70B 1LTLA 2NVXB 1EEID 1XNRL 1VF5C 3CCLA 3P75A 3ULPA 5A35A 1NUCA 1UNSA 4DAMA 3UE0A 1PZKD 1N36L 4RAUC 1UEAB 4FF4A 3A8KE 4HMJA 1EY5A 3JAME 2E2HH 1KHIA 4R4OA 3Q22A 2EE1A 2F1MA 1T9HA 4LUOA 5KYIA 1EFWA 4C1NI 4RWSC 3SK4A 3I4MG 3I4MH 5C3XA 4A4IA 1CZWA 2F0NA 1ET6A 3BU2A 4EQ5A 5FJ8G 4R8IA 4HMIA 5FJ8H 2EJMA 1GUOA 4NDXA 3BDLA 2EYPA 1FD7D 2IHFA 1BF4A 3S1RH 2E2HB 3D3RA 3Q24A 3O13A 1FNVA 3I4MB 3GV3A 3J80i 1MJEA 4IPHA 1EYAA 1N34L 5HGQA 3MXGA 3R2IA 5CYUA 1TS5A 1EWCA 4UP7A 3NBHA 4DV1Q 4O0AA 3S1RB 2NTTA 4KN4C 4DV2L 2WKCA 4F7XA 3RD4A 1PA6A 1QG7A 2Z1CA 3EN2A 4A3BB 2DJGC 2F0DA 4X64L 1E2VA 4XYQA 4KTAA 4G7ZC 3GTLH 1STHA 3NEMA 1Y8PB 5CORA 1GHJA 3C2PA 5NUCA 1LT3D 3KDFB 1KAWA 4ODGA 2DNCA 1D2BA 2WAQE 4IUVA 2FMCA 5LMUL 4PG3A 1N32L 2B2WC 1Z7TA 5EJWA 1PH5A 2MJ8A 3QB3A 4FXDA 3GTLB 1GXDC 3MFYA 1IYJB 1IW7D 4TRDA 4AIMA 2FHTA 3KF8A 5HGTA 2YU9B 2PMZE 1JCKB 2IW3A 2RHSB 1GO3E 5KNDA 3G71A 4UHVA 1NJIC 3SXHA 1E7ZA 3W3AA 4R1JA 5FOBB 1V1QA 4DR5Q 4KI0A 2EYJA 2EQSA 4B08A 2HIXA 1XYIA 1UE6A 2H1EA 3A7LA 1SE4A 4JI3Q 1N36Q 2DGYA 1H9SB 4GLVB 1E24A 4XIGS 1TKWB 1R4QB 1OO9B 5BN4A 4N8X1 1I94L 1HNWQ 1C0AA 4QB4A 4X3UA 3LNNA 1S3OA 1QUQB 1FL0A 3WOEA 1PTOC 2LSSA 5IT9L 1CK1A 3S1QH 1HXYD 1LO5D 4YY3Q 1EY8A 1VQAA 3TP6A 3URYA 3A8IE 4R4QA 2VS1A 2VXWA 3ITPA 1D7QA 3SDZA 3TP8A 4O1NA 5I4DA 2HDMA 1CFMA 1YZ6A 2WKDA 3A5UA 4PNYA 4A3CG 4A3CH 3VR6A 1OXUA 4OEMB 1JICA 1N34Q 1HQMC 4C2MH 4K0KQ 1EZ8A 4QIWB 1SAPA 2CKZB 5JPNC 4F87A 3S24A 5BR8Q 4BS9A 2L5TA 4C3JG 5CV4A 4C3JH 1VMCA 1MKHA 2AKWB 1WOCA 2PZUA 2BDOA 3F2BA 4DV2Q 1PXUA 2NZ1D 1CKNA 4A3IB 1S4ZA 4R4IA 4LWCA 4KKSA 3HGBA 2NZOA 3CU7A 3NQTA 4BBSH 2WB1G 1A15A 2EYMA 2K01A 3ICEA 4DAYA 1IBMQ 3AEVA 1BKBA 1PRTD 5GAGC 4C3JB 4K8IA 1ICWA 1E2WA 1A3TA 2EY5A 1D1KA 4LW1A 3VR3A 2Q2IA 4YWLA 1FR3A 1BVSA 2N49A 2OQ0A 4NW2A 3C46A 5LMUQ 4BBSB 2WB1B 2HCCA 2E2DC 2M00A 2E74C 4IUNA 1N32Q 2K33A 3DWQA 5C4JH 1F9PA 1ASYA 1V8QA 2XRSD 1A3UA 1SE3A 5I9PA 2D2CC 2JEAI 3JAML 5IWAQ 3GTJH 1XWEA 4E6IA 3K0XA 4DR2L 2RDFA 2B2WA 1VQ4A 4G7OC 5EKIA 4CHTB 2OF1A 4CJ0B 2XTIA 4JI6Q 4HAEA 5C4JB 1XPOA 3HOYG 3HOYH 4IJHA 1JQYD 5H1SE 2B8GA 3LWEA 4P71A 3T51B 3A8JE 4OGQC 3STBC 3UDGA 3GTJB 4YCWA 4R8NA 5E4WC 2K28A 1Q90A 5FK9C 4OWWB 1I94Q 2AUKA 3AMUA 2NVYH 1EL0A 3BYTB 3HOYB 1M8AA 4EQOA 1QZGA 5FO7B 1DZ1A 4K5VA 1F9RA 1I6HH 2XN9C 4KHVA 2CH4W 4POGA 1MGSA 5COYA 4AYBG 1QB5D 4H44C 5FKAC 2J0TD 1UE1A 1WTVA 1QZHA 1XMOQ 2JSOA 3HKZG 4CDEC 2QA4A 1SBBB 1HH2P 2A68C 2NVYB 2I5HA 3EFXD 4JOIC 4ID6A 2C5CA 2X6LA 2B2VC 5GQOA 3H3VC 3OHXC 1NMFA 4Q0FA 4RA8A 1I6HB 1CUKA 3X3MA 3BVZA 3OW7A 1SYBA 1VQ8A 4ZYSA 1YVCA 2BDNA 4JBJA 4Z9CB 3UDIA 3KUPA 2L15A 2N3SA 3CCVA 5KRUA 3ONAB 2OQKA 4X65L 2K03A 1A2UA 1OTCA 3MXUA 4A76A 2RBMA 3AYHB 3E9HA 3HKZB 5AFWA 1JJ2A 1C9OA 1V1PA 1SDFA 1LACA 2OTJA 3VA7A 1E2ZA 2MO1A 3H6MA 3IFTA 1JMCA 2YV5A 3ULJA 2PO4A 2FJ2A 4G4KA 4P72A 1L0XB 1TS4A 1AZQA 4OXPA 1VS0A 1Y1VB 1PZJD 5M5YH 3F2UA 4QCLA 2RKSA 3CKIB 2SNMA 3U4ZA 1ZYRD 2A6HD 1GUSA 1RODA 2PPBC 2B2TC 1JOQA 1HCZA 1SYCA 1AE2A 4PV1C 4R4CA 4M1UB 4OHJA 1Z6HA 4J1MA 5M5YB 3S9WA 1FVIA 3K59A 4DR2Q 4OX9L 1F2YA 1TY0A 3BZKA 1P16A 1K0SA 1GD7A 1VQKA 5M3MG 5M3MH 3EA6A 5JEAH 2B63G 2F0EA 3HRZC 1S72A 2B63H 4QL5A 2ZJRA 1EIFA 4Y52H 3ULLA 1IL8A 3M3YB 1HQRD 2RA4A 3L9AX 3Q23A 5KYLA 3JC66 3G4SA 4HIKA 1NSNS 1Q7YC 1AZPA 2RSOA 1QWYA 1R9TH 4LFBL 1VQEA 1SSOA 3MA2B 1ILQA 3WOFA 1CTMA 5M3MB 3CD6A 2B63B 1JWMD 3CC2A 4TVAB 2XGTA 4DV0L 5G3LF 4DA2A 1O7YA 2RDHA 3MXNA 3TSSA 4EQNA 5K36G 4LK1C 5K36H 4J8QA 1YJWA 4BY7G 1R9TB 2O4XA 2WAQG 4BY7H 3VR5A 4GOPB 4FO2A 2K1BA 3NPPA 1A3VA 1VMPA 3MEHA 2UXCQ 1PVOA 4JW0A 1J8IA 3GQBA 4WRDA 4IPGA 2ZM6L 1EIHA 4JYAL 4IFDJ 2CHBD 3SK5A 5D14A 1YJ9A 2AQ2B 3W5OA 1NNXA 1KAAA 4XQJA 4GLAC 3I4NH 2PQAA 1EZ6A 4DR7L 1Q12A 1PH8A 2R7FA 4ILWA 3K5LA 2WAQB 1O78A 2EY6A 2PZTA 4X65Q 1VQMA 3TBIB 1QJOA 2KVMA 4JOIA 4IUQA 4DU9A 1Y69U 2JA8G 2JA8H 2B2VA 2GA4B 2ZTCA 3K81C 1OXXK 2F0TA 5EGTA 4HN7A 4BA1I 4JI7Q 1RTOA 1Q3LA 2F52A 4R4TA 1F2ZA 5KIXA 3NP8A 1G8ZD 3W2DA 2F0KA 2PMZB 3I4NB 1BCPC 2BH8A 1ESRA 2R92H 2PI2A 2A19A 4YIJA 1DGSA 2I07B 3AU7A 3M7NA 3GTQH 1IKMA 1IBKQ 2VUMG 2VUMH 4Y7NH 3NWTA 2JA8B 3PIO3 2RSNA 1LM0A 4FVMA 4ZK9B 1HFGA 4IQZA 2YTXA 1VQGA 1PV4A 3CQZH 4NXML 3PIP3 3LWUA 2TSSA 3J7ZC 3IAYA 1PH7A 4CDDC 4WFN3 2R92B 1YBYA 2JJQA 1NAPA 2A6EC 4X62L 1WTWA 1Q1EA 3QG1A 3BDOA 1PZID 3NK9A 3CF5A 3E6ZX 3MAQA 4OX9Q 1D1IA 3D0FA 3QWNA 4JBWA 4UP9A 2B2TA 4TKOB 2F0QA 3VR4A 3CQZB 3K5OA 1B1ZA 5JVG3 4IFDG 1O7IA 2X6GA 4IFDH 1YHAA 2FXQA 1SLJA 2L11A 1GM5A 4LFAL 1PH1A 3GTOB 1EWIA 1KLUD 4DR3Q 3RZDH 1EWHA 4ULLA 4JV5L 1SNDA 4LFBQ 3BVMA 2EDGA 3E3XA 5C0XI 3F2CA 3CCQA 4EVOA 5JJKA 3KLSA 1HZBA 1STEA 2D0PA 3ZYYX 1MSHA 1GOZA 3AB9A 3J81L 3KLSX 3F1ZA 3NELA 4DV0Q 2Z6KC 1TIID 3A5ZB 2L12A 2C35B 4JI5L 3BS1A 2BH2A 2KOLA 4F88A 5IOCA 4L5TA 1EYCA 2JYOA 1PFNA 4ABNA 1E0BA 4FYDA 3BJUA 5C5LA 4DKAC 5IYCG 5IYCH 4DR6L 3HOUB 4OELB 4X3KA 2A73B 3KJPA 1SMXA 3M7GA 1S5DD 3KLWA 3TEHB 1O7ZA 2G5DA 1EQVA 2ZM6Q 4JYAQ 3D6WA 5IIFA 5AJ3L 3I90A 4JVZA 1G51A 5EKLA 3GDEA 1N33Q 1STYA 1TY2A 2RQXA 1PH2A 3RMHA 3P20A 4JI1L 1XNQL 3OWEB 5KNCA 1HJPA 4RFBA 1X3QA 4HIOA 1JWSD 3GTKH 4H7BA 3J7A5 3J81c 4LUVA 4OWTB 3M4OH 2EYFA 2WACA 4ZKCB 2LXKA 1CM9A 2YTVA 2ZXOA 3U58A 4J15A 5KEEA 3FPPA 1FNWA 3J7AV 1KXLA 3KOJA 1TWGB 3ZJYC 3Q6SA 3C1FA 5EBCA 2KEEA 4QUCA 3FPUB 1B4OA 1H9MA 1RTNA 5ELCA 2KCCA 3GTKB 3HG9A 1T5XD 1XMQL 4MN3A 2F4IA 3CAMA 1HZAA 3M4OB 2UUAL 2OEOA 4XT3B 3OWFA 2K5WA 3UDXA 2NN6G 2NN6H 4A3BG 1N9WA 4A3BH 1SE2A 1UAPA 1PH9A 3ND9A 3NENA 1PYSB 1Q46A 4X62Q 2NVQH 1ONLA 3R93A 1AN8A 1E1TA 2CQAA 3QJYA 2VNUD 1ZEQX 5EPKA 3SHLA 2HQLA 1YNXA 3R2TA 2K52A 1PHJA 3VA5A 3NE5B 3V2TA 4RKLA 2K7VA 4RGNA 3CCUA 1TWFH 2F0SA 3T1YQ 5ELBA 1ZKOA 3NTHA 3CCEA 1AFPA 3NBHB 2NVQB 2FMMA 1DONA 2I0QA 1SMYD 4JV5Q 4IUTA 3FMCA 2UUCL 3TMEA 3CCRA 3HOZH 5ISRA 4NXNL 2YU9H 2A69D 3GP7A 3TP7A 4GS3A 1CQFA 2D0OA 5EKKA 1IHZA 2MUYA 3GO5A 1TWFB 4IPDA 3FRPB 3BDCA 1SJHD 2EVBA 4KN7C 4JI5Q 4FF1A 1ILPA 4DUYQ 3C1EA 1EYDA 1XXGA 2GN5A 3JAMi 3PUVA 1SN8A 3HOZB 1K83B 4CDCC 4POFA 2F0UA 4DR6Q 1BBWA 1NY4A 1MBYA 4LUZA 4K8JA 1NCVA 2Z6KA 2KJXA 3L3OC 1E1OA 3EJIA 3KF8B 1SYEA 1KDCA 1TVXA 4L5RC 1ENAA 1LABA 5C5MA 5DLQE 3BZDB 1XNRQ 2PI2E 2Q8IB 1KRSA 1X56A 3HOXB 2R6GA 2ID0A 2EYHA 1JC7A 4JI1Q 1S5CD 2AWOA 2Z4HA 4C56C 1L0YB 1YI2A 1XNQQ 5IGEA 1X3FA 5M5XH 4LF7L 1YNJC 2KUMA 1HUMA 3HZXA 2PW7A 1UUPA 3I4LA 2Z6BA 4MZ9A 1F2LA 1GVPA 1U5KA 1CSPA 5CV6A 5A2QL 4GLXA 5JJIA 2BA1A 1HHVA 1X54A 2L55A 2E2JB 1YNND 4XQNA 1HZCA 5M5XB 1I3QH 4CKBA 3RN2A 2Q8TA 4LF9L 2XRQD 3MTSA 2VB3X 3SVMA 1I5FA 1XX8A 4A3IG 2K5VA 5LL6X 4NPSA 1NE3A 4A3IH 3E9IA 4K6DA 5TSSA 4ZUJA 1VQPA 1X3GA 1YJNA 4JI4L 1VQDA 3CMAA 1S5FD 3VR2A 3G6EA 1HRJA 1I3QB 2GVBA 1LTTD 1P8LA 4B3SL 2WP8J 3F8TA 3I73A 2OWOA 4XQQA 3PO2B 4CJ1B 3OTOL 2RHQB 4JPBW 3T56B 1D8LA 2Q2TA 4BBSG 3OOCA 1KTKA 2AMCB 3EROA 4YCVA 4X64Q 4HJ7A 4DNTB 3N52A 2D62A 1F9SA 4XDXA 4P74A 3T1HL 2M9VA 1CKNB 4LNQA 4KY7A 1F9QA 1B9MA 3S14H 4F8MA 2QCPX 4P75A 5GADC 2QILA 3CPWA 1R4PB 3NTKA 3T13A 4DAYB 2ZJPA 1BOSA 2V4DA 2NTSA 4DR4L 3U9OA 4AQYL 3PUWA 4L6TB 1EY0A 3I3CA 2IHEA 3QOLA 2QDLA 3QR8A 2EPBA 2KHIA 3A54A 4DK0A 2JA6G 2JA6H 3S14B 2E5LL 1UWVA 2F0OA 4HSVA 4IO9A 4H13C 3A55A 5CV9A 3HS0C 4A93H 4HJ5A 1B53A 1QOHA 3J80c 1I50B 4A3DG 4FP5D 1VQFA 4A3DH 1K8OA 2Q2HA 3OPOA 5I6WA 3KF6A 1PMRA 5LL6S 1U4RA 3FHWA 1TWHH 3SGIA 4LF4L 4Q5VA 4DV5L 1ASZA 2NVTH 2JEBI 2JA6B 4KJNA 1EIGA 3PGZA 1NR2A 4UAIA 4B3RL 4JI2L 2EZVA 2CCZA 3ERQA 1BNZA 4KLKA 1OXVA 3HOWB 4A93B 2Y0SE 3I70A 4A3DB 1K73C 2JE6I 4KKUA 1TWHB 4WJWA 4DV3L 2NVTB 5KNBA 5CV7A 3TZDA 4WORA 1C7YA 2PQEA 1PTOH 3CXCA 2E2IH 3DEOA 4LF9Q 2JA9A 4GNXA 1G6PA 1SEBD 3HP3A 4YHHL 3CRKC 1ML0D 1JJCB 2BE5C 5JOBA 1WVLA 4KY5A 5JEAJ 5M5WH 1RF2D 4IUPA 4JI4Q 1Q8IA 1HNXL 3K0YA 1L1OC 5I2YA 1VDZA 4X3TA 1B3QA 3J81E 1SFOH 2ASBA 1IYUA 1PTOB 2DJFC 2E2IB 4DNIA 2O2LD 1VQNA 4HR7B 5I2XA 1H9RA 1Y1VG 1Y1VH 2K32A 3T4AC 1SYFA 5IP9G 3V05A 5IP9H 3OTOQ 5JJLA 1LT6D 1EY7A 1EU4A 5M5WB 1X65A 3CRLC 4LF5L 4QJFA 3K7UC 4YWMA 1SFOB 3VYSA 1VQLA 3MXPA 1LTBD 1NMGA 1E3PA 1V1PB 1B44D 1IBLL 1KL9A 3T1HQ 4B3ML 4CKEA 4JCVE 1STBA 4HIMA 3RN5A 3PF4A 3OIQA 3S17H 1RD9D 4C3HG 4FF3A 4C3HH 5JPMC 4HJAA 4ZKBB 4DR4Q 2E8GA 4P2CB 4RGOS 4ZCKA 3TP5A 4N9PA 1NTGA 4DAPA 3VYTA 5I9OA 2CW0D 3K6OA 4S3SA 1PDQA 4FXGC 1I6VC 4OIJA 3U9SA 2K04A 1AEXA 1JE4A 1XTDA 4BWGB 5HURA 3M3YH 1DOMA 3S17B 2E5LQ 5IGCA 2EJGC 1K8AC 4C3HB 2KEDA 1Q82C 4FF2A 1GJXA 1PYWD 2R3ZA 4JBKA 4DPGA 5JEAG 1VQOA 4OONA 1CSQA 1LTID 4TQUS 1D5XC 4LF4Q 2L4NA 4OO1G 4OO1H 4H02A 2F0HA 5J22A 1K3BC 2F3WA 1L2FA 4K5WA 2CQOA 4B3RQ 1T5EA 4I7AA 1X3PA 1ET9A 1JOOA 1SNCA 5E4XA 1YIJA 2F0JA 2ICIA 4LMQD 4UP8A 5EBDA 4RCOA 1GUGA 1PRTC 5GAEC 4CBVA 1NR4A 2R93H 4DV3Q 3KFUA 3AQQA 2UU9L 2DNEA 2OXPA 2EXZA 2XVSA 1DYQA 2X69A 5CC4A 4V190 1WYDA 2K5NA 3E5SA 1RKNA 5IP7G 1PRTF 1GKHA 3PUYA 5IP7H 1RIPA 2K5HA 5GAHC 1AE3A 1LYLA 2ZTDA 4X66L 3M4PA 4CGYB 3MXNB 4YHHQ 1VQ6A 2HCIA 3DM1A 2AQ3B 2H5XA 3D4DA 4P73A 1PLFA 1STGA 5GROA 2R93B 3BVGA 4UPAA 4LF8L 1I4HA 2BA0A 3I4NG 1LTRD 3H3VH 1JT8A 4XTCS 3MFGA 5FLXL 4A3KG 3VYRA 3Q0AA 4A3KH 1DJRD 5HY6A 3DEPA 1HZ9A 3GV6A 1TU2B 2AWNA 1U4PA 1G2TA 3PQIA 2PQAB 1AW7A 2LXJA 3A7AB 3BG3A 1L1OA 1VQJA 1Y1WG 3TRZA 1Y1WH 1H9KA 2Z4IA 4LF5Q 3P1HA 1H95A 1IZ6A 2NUCA 3DXJC 5I6YA 1BR9A 2R92G 3MVVA 2VQEL 4FDBA 1IBLQ 3K57A 2NZHA 1CHPD 4ZLTF 1G2SA 4A3KB 1YHBA 2CVRA 5EPLA 2K6AA 1A6XA 1QVCA 1HTPA 4PZ7A 2K14A 3EIVA 5IYDG 5IYDH 5ELOA 4KD3A 1PYBA 2QF7A 1Y1WB 3S16H 1TS2A 2ICEC 3KBXA 2I46A 2F0VA 1WCMG 1WCMH 1X55A 3X3NA 5FLXc 3TDQA 4DV7L 3GD7A 1D5MC 1HR0W 2JN4A 5CBAE 3GTOH 1FGUA 5A2QE 3RNUA 2ZXPA 1SNPA 2B8FA 1Z9FA 4KD4A 5D3IB 1J5EL 2LS01 3G48A 2JQOA 4RGMA 2JXMB 1SYDA 3E0JA 2VQFL 4MTKA 1B8AA 4PMWA 3S16B 3OMCA 3H09A 4LAAA 2ZJQA 1WCMB 2B2YA 4KK7A 3FP9A 4A3MG 3EBEA 4A3MH 1TWAB 3OW2A 3A0JA 4JBMA 4NKLA 2HDLA 1K28A 3KYHC 1VCIA 4JI0L 1BDOA 2E75C 1SJED 3MZ5A 3AFPA 1WTOA 4DV1L 4ALPA 3HOUG 3HOUH 1DCZA 3NSWA 1G291 2UXDL 4LF6L 5E1FA 1B7YB 2MNAA 1N8RC 3CC7A 4A3MB 2L1BA 1RCVD 3SK6A 4DV4L 4L5QA 2KA7A 3KK7A 2YYZA 2ATWA 5LMNW 4K2LA 1PTOD 3W1BA 3DWAA 4CDFC 1ZYRC 2A6HC 2I5LX 2B2UC 1CKOA 3J80E 3CMEA 4AYBE 4X3SA 4R9WA 2XWBB 1XTCD
chains in the Genus database with same CATH topology
1C8CA 1MD2D 4KKTA 1OXSC 2LMCB 1KNAA 1G6ZA 3BYYB 5DNFA 1K8MA 1B3AA 2F3VA 1Y8NB 3I72A 2L0CA 1O80A 2D9UA 3FDTA 3DUZA 3UI2A 1RJTA 4IFDI 4G57A 4A3FB 5ELFA 5LHY1 1ESFA 3IKJA 5DM73 5K5PA 3NTIA 2FINB 1BUVT 2R7ZB 1IKLA 5C4XB 4ZUIA 1QE6A 3FKIB 5ELDA 1SXTA 2F0WA 2KQ3A 4C3IG 5JVH3 1CHQD 2NB0A 1I4QA 4DN4M 5CV8A 1D6EC 1TQOA 4U673 1TS3A 2G9HD 1DOLA 4UDUC 3M85A 3RZOB 1CA5A 2Y0SB 3SK8A 1BCPB 2HUGA 4C3IB 4HEDA 2F0GA 1DM0B 4DK1A 4HSPA 1V1OA 1I4XA 1WTRA 1A2TA 3C3LA 1Q1BA 1G91A 2O5JC 5CGKA 3J7YW 4L8JA 4RCNA 1TWCB 1WTXA 3L7ZC 2NYZD 4B9WA 2JA5B 1LLRD 1CQVA 1WTQA 3SE0A 3QO2A 3S1MB 3PO3B 5IGFA 3GTMB 1H9JA 2BCOA 1LV9A 2IJ0A 4V0BA 4U68A 1TR5A 2F0FA 1GUNA 4EQPA 2A5HA 3WDNA 2IT1A 5CBEE 1S5ED 1W6JA 2NN6I 1LT5D 4MIUA 3MC0B 2A68D 3VYUA 2BE5D 4C1NK 3CHBD 2B2UA 1F2MA 3H91A 3DMUA 2SNSA 3R3OA 3PUXA 4M8AA 4KV6A 3D8GA 2WV6D 2ZT9C 2WINB 5E3FA 1H9SA 4GZYC 1U4MA 3HEJA 4IN3A 4O42A 1KDBA 2R61A 4PMCA 1RDPD 3S2DB 4DXGA 2EYLA 3S2HB 4L63B 4DFAA 3NQIA 1KABA 2G9DA 1I4GA 4RGTA 2DY7A 1LT4D 4DGZA 5EQ0A 2PZWA 3HOVB 4RHRA 1GHKA 3S1NB 1HFNA 1LTAD 4MHEA 1MSGA 1PTOF 3A56A 4K14A 1RHPA 1CI3M 3OIPA 5C44B 4ZQ3A 4ME5A 3IFDA 4PQXA 5C3EB 1HUNA 3S1QB 2K05A 3R8BA 2DN8A 1KNEA 1EQTA 4PMBA 4XXEA 4HCEA 3J80L 1U9RA 3ND8A 4H0LC 3NXWA 3H94A 4IUUA 4HCSA 1BBXC 4IZ8A 2QEJC 4IALA 5FLXE 1FGBD 5G3LD 1HA6A 4JK1C 2FFKB 3I8ZA 1JWUD 3P7JA 4C2MB 4NP5A 2MP1A 4BA2I 1C4QA 3K5NA 3PUZA 3SR1A 4IURA 5ELEA 2F0IA 1STNA 4K6LA 4A3GB 1HTLD 1CZGA 2N55A 4DAVA 3K5MA 1DXMA 4B9XA 5J1ZA 2IX0A 3DHQA 5C4HA 3NUCA 3MHBA 4DNRB 1J9OA 5DEHA 2DY8A 4FXKC 1DOKA 3EVQA 5FO8B 1WTPA 2N88A 4DF7A 2F0PA 5KGUA 1SMYC 3KBGA 2XSCA 2IX3A 2A69C 3T16A 1BCPD 3D4RA 3EQLC 1EY4A 3OMGA 5J39A 1O7LA 3N6RA 1D5ZC 2XIWA 3I91A 4QMGA 4BY1B 3FVQA 1IW7C 4K2KA 1MI2A 2RDGA 4K5XA 2NBFA 4BBRB 4QUFA 3NHHA 2EYOA 2LY7A 2A6ED 2IWHA 1VF7A 3OSOA 2F03A 2EJFC 5IODA 1U4LA 5M9OA 3TZUA 1II3A 4A3EB 3SEBA 1JORA 1B2TA 5C4ZA 2SOBA 1SNOA 4AYBB 1JB3A 5DAUA 1I4PA 3MWYW 1PFMA 1GUWA 2F0LA 5T1IA 4TSSA 2IPKD 2F0MA 3J7AF 4RH6A 1YNNC 5CMDA 3G6JB 3DWPA 3M4YA 2O5IC 4XYOA 4KMUC 1X32A 2B2YC 3KLRA 5JAVA 2AQ1B 2M2LA 5F2DA 1I4RA 4EGVA 1LTSD 4LJZC 2PYKA 1EFID 3FEWX 1BQQT 2C9OA 1LTGD 3QIAA 2VB2X 3D31A 3K58A 1F77A 2Z8LA 4ZAIA 3T53B 3GTPB 5C3WA 1W6KA 2BOSA 1HPCA 2PNRC 4HTHA 5C0XJ 3RLFA 2KECA 4OL7A 1ENFA 1STAA 4J6HA 2JA7B 2TMPA 4N9TA 5IGDA 2D5DA 3D4WA 4RHSA 2IL8A 3D6CA 5EPJA 5CV5A 1OXTA 1QNKA 1FYCA 5BN5A 4CKCA 3TN2A 3G7LA 1DD2A 2EY2A 5DM63 2LKVA 3PMFA 2KHSA 1BXTA 3GTGB 1QCBD 1QNUA 2J7ZA 2MPMA 2KCNA 4NMZA 1EY6A 2QKIC 2EY1A 4RKBA 1WD1A 2SEBD 2Q8RE 1FNUA 2EOTA 4G7HC 1QILA 1Z47A 2PCFB 1C48A 4A3JB 1EU3A 3QOJA 4OO1I 4ZRZA 2ZXRA 4BY7B 2E76C 3K7AB 4DXFA 2L9HA 5C0XG 3S15B 5C0XH 1BO0A 1M4VA 2PW5A 4I7ZC 5D3DA 1GUTA 2B39A 2XNAC 2MGSA 3NWSA 1B9NA 1BCPF 5BN3A 1EEFD 4KY6A 4KJOA 3V96A 1Y8OB 1PFBA 1ZXTA 4OIKA 1ENCA 1EOTA 1B50A 1KDAA 2WIIB 1CA6A 3RUZA 3GTQB 5C6AA 1JR0D 2K5DA 3NBIA 4CJ2C 5IT9E 2JP1A 2VUMB 4Y7NB 1SNMA 1V43A 5M3FB 1TT2A 3LX0A 3PV0A 5IGGA 1IYVA 1S5BD 2HQEA 5CR3A 1YNJD 2AUJD 2LFNA 2QDBA 2J4XA 5IGBA 2H4OA 2XWJB 1EY9A 2MHVA 4QF4A 5D65A 2IX1A 1HA5A 2CW0C 2OT2A 2ENBA 2A74C 1SYGA 3H0GB 3IL8A 5T1GA 2K5QA 3RZDB 1KLGD 1CT1D 1WD0A 1PRTB 2NWGA 4FNFA 5JJZA 4KHZA 2SDFA 1JOKA 2RVLA 4I65A 4XT1B 5FO9B 1SNQA 1AP0A 2NVXB 1EEID 1VF5C 3P75A 5A35A 1NUCA 1UNSA 1PZKD 4RAUC 1UEAB 4FF4A 3A8KE 4HMJA 1EY5A 3JAME 3Q22A 2EE1A 2F1MA 5KYIA 4C1NI 4RWSC 3SK4A 5C3XA 1CZWA 2F0NA 1ET6A 4R8IA 4HMIA 2EJMA 1GUOA 4NDXA 3BDLA 2EYPA 1FD7D 1BF4A 2E2HB 3D3RA 3Q24A 3O13A 1FNVA 3I4MB 3GV3A 1EYAA 3MXGA 3R2IA 5CYUA 1TS5A 1EWCA 3NBHA 3S1RB 2NTTA 4KN4C 2WKCA 4F7XA 3RD4A 1QG7A 2Z1CA 4A3BB 2F0DA 1E2VA 4XYQA 4KTAA 4G7ZC 1STHA 1Y8PB 5CORA 1GHJA 3C2PA 5NUCA 1LT3D 4ODGA 2DNCA 1D2BA 4IUVA 2FMCA 2B2WC 1Z7TA 5EJWA 2MJ8A 3QB3A 4FXDA 3GTLB 1GXDC 3MFYA 4TRDA 1IW7D 2FHTA 3KF8A 5HGTA 2YU9B 1JCKB 2IW3A 5KNDA 3SXHA 3W3AA 5FOBB 4KI0A 2EYJA 4B08A 1XYIA 2H1EA 3A7LA 1SE4A 1H9SB 4XIGS 1TKWB 1R4QB 1OO9B 5BN4A 4QB4A 4X3UA 3LNNA 3WOEA 1PTOC 5IT9L 1CK1A 1HXYD 1LO5D 1EY8A 3TP6A 3URYA 3A8IE 2VXWA 3ITPA 3SDZA 3TP8A 4O1NA 5I4DA 2HDMA 1CFMA 2WKDA 4PNYA 3VR6A 1OXUA 1JICA 1HQMC 1EZ8A 4QIWB 1SAPA 5JPNC 4F87A 4BS9A 2L5TA 4C3JG 5CV4A 1VMCA 2PZUA 2BDOA 1PXUA 2NZ1D 4A3IB 1S4ZA 4KKSA 3CU7A 3HGBA 3NQTA 1A15A 2EYMA 2K01A 4DAYA 1PRTD 4C3JB 4K8IA 1ICWA 1E2WA 1A3TA 2EY5A 1D1KA 3VR3A 1FR3A 4NW2A 3C46A 4BBSB 2WB1B 2HCCA 2E2DC 2M00A 2E74C 4IUNA 2K33A 3DWQA 1F9PA 1V8QA 2XRSD 1A3UA 1SE3A 5I9PA 2D2CC 2JEAI 3JAML 1XWEA 4E6IA 2RDFA 2B2WA 4G7OC 5EKIA 4CHTB 2OF1A 4CJ0B 4HAEA 5C4JB 1JQYD 2B8GA 3LWEA 3T51B 3A8JE 4OGQC 3GTJB 4R8NA 5E4WC 2K28A 1Q90A 5FK9C 2AUKA 3AMUA 1EL0A 3BYTB 3HOYB 1M8AA 4EQOA 5FO7B 1DZ1A 4K5VA 1F9RA 2XN9C 4KHVA 1MGSA 5COYA 1QB5D 4H44C 5FKAC 2J0TD 1WTVA 2JSOA 1SBBB 2A68C 2NVYB 3EFXD 4ID6A 2C5CA 2X6LA 2B2VC 3H3VC 3OHXC 4RA8A 4Q0FA 1I6HB 3X3MA 3BVZA 3OW7A 1SYBA 4ZYSA 2BDNA 4Z9CB 3KUPA 5KRUA 3ONAB 2K03A 1A2UA 3MXUA 2RBMA 3HKZB 5AFWA 1V1PA 1SDFA 1LACA 3VA7A 1E2ZA 3H6MA 3IFTA 2PO4A 2FJ2A 4G4KA 1L0XB 1TS4A 1AZQA 1Y1VB 1PZJD 4QCLA 3F2UA 2RKSA 3CKIB 2SNMA 1ZYRD 2A6HD 1GUSA 1RODA 2PPBC 2B2TC 1JOQA 1HCZA 1SYCA 4PV1C 4M1UB 4OHJA 1Z6HA 4J1MA 5M5YB 3S9WA 3K59A 1F2YA 1TY0A 3EA6A 5JEAH 2F0EA 3HRZC 1IL8A 3M3YB 1HQRD 2RA4A 3L9AX 3Q23A 5KYLA 1AZPA 1NSNS 2RSOA 1QWYA 1SSOA 3MA2B 1ILQA 3WOFA 1CTMA 5M3MB 2B63B 1JWMD 5G3LF 4DA2A 1O7YA 2RDHA 3MXNA 3TSSA 4EQNA 5K36G 4LK1C 5K36H 4J8QA 1R9TB 2O4XA 3VR5A 4FO2A 2K1BA 3NPPA 1A3VA 1VMPA 3MEHA 1J8IA 3GQBA 4WRDA 1EIHA 4IFDJ 2CHBD 3SK5A 5D14A 2AQ2B 1KAAA 4XQJA 1EZ6A 1Q12A 4ILWA 3K5LA 2WAQB 1O78A 2EY6A 2PZTA 3TBIB 1QJOA 2KVMA 4IUQA 4DU9A 1Y69U 2B2VA 2GA4B 1OXXK 2F0TA 5EGTA 4HN7A 4BA1I 1RTOA 1Q3LA 1F2ZA 5KIXA 3W2DA 3NP8A 1G8ZD 2F0KA 2PMZB 3I4NB 1BCPC 1ESRA 4YIJA 2I07B 3M7NA 3AU7A 1IKMA 3NWTA 2JA8B 3PIO3 2RSNA 4FVMA 4ZK9B 1HFGA 4IQZA 3PIP3 3LWUA 2TSSA 3IAYA 4WFN3 2R92B 1NAPA 2A6EC 1WTWA 1Q1EA 3QG1A 3BDOA 1PZID 3NK9A 3E6ZX 3MAQA 1D1IA 3QWNA 4JBWA 2B2TA 4TKOB 2F0QA 3VR4A 3CQZB 3K5OA 1B1ZA 5JVG3 4IFDG 2X6GA 4IFDH 2L11A 3GTOB 1KLUD 1EWHA 4ULLA 1SNDA 3BVMA 2EDGA 5C0XI 4EVOA 3KLSA 1STEA 3ZYYX 1MSHA 1GOZA 3AB9A 3J81L 3KLSX 1TIID 2L12A 3BS1A 5IOCA 2KOLA 4F88A 1EYCA 2JYOA 1PFNA 4ABNA 1E0BA 4FYDA 5C5LA 3HOUB 4X3KA 2A73B 3M7GA 1S5DD 1O7ZA 1EQVA 3D6WA 5IIFA 3I90A 5EKLA 1STYA 1TY2A 2RQXA 3RMHA 3P20A 3OWEB 5KNCA 4RFBA 1X3QA 1JWSD 4H7BA 2EYFA 2WACA 4ZKCB 2ZXOA 1CM9A 5KEEA 3FPPA 1FNWA 3J7AV 1TWGB 3Q6SA 3C1FA 5EBCA 2KEEA 4QUCA 3FPUB 1B4OA 1H9MA 1RTNA 5ELCA 2KCCA 3GTKB 3HG9A 1T5XD 4MN3A 2F4IA 3M4OB 2OEOA 4XT3B 3OWFA 2K5WA 2NN6G 2NN6H 1SE2A 1UAPA 3ND9A 1ONLA 3R93A 1AN8A 2CQAA 3QJYA 2VNUD 1ZEQX 5EPKA 3SHLA 3R2TA 3VA5A 3NE5B 3V2TA 4RKLA 2K7VA 4RGNA 2F0SA 5ELBA 1ZKOA 3NTHA 1AFPA 2NVQB 2FMMA 1DONA 1SMYD 4IUTA 3FMCA 3TMEA 5ISRA 2A69D 3GP7A 3TP7A 1CQFA 5EKKA 1IHZA 2MUYA 3GO5A 1TWFB 3FRPB 3BDCA 1SJHD 2EVBA 4KN7C 4FF1A 1ILPA 3C1EA 1EYDA 1XXGA 3PUVA 3HOZB 1K83B 2F0UA 1MBYA 4K8JA 1NCVA 2KJXA 3L3OC 3EJIA 1SYEA 1KDCA 1TVXA 1ENAA 1LABA 5C5MA 3BZDB 2Q8IB 3HOXB 2R6GA 2ID0A 2EYHA 1JC7A 1S5CD 2AWOA 2Z4HA 4C56C 1L0YB 5IGEA 1YNJC 2KUMA 1HUMA 3HZXA 2PW7A 1UUPA 3I4LA 1F2LA 5CV6A 5A2QL 1HHVA 2BA1A 2L55A 2E2JB 1YNND 4XQNA 5M5XB 4CKBA 2Q8TA 2XRQD 3MTSA 2VB3X 3SVMA 1XX8A 5LL6X 4K6DA 5TSSA 4ZUJA 1S5FD 3VR2A 1HRJA 1I3QB 1LTTD 2WP8J 3I73A 4XQQA 3PO2B 4CJ1B 3T56B 3OOCA 1KTKA 3EROA 4DNTB 3N52A 2D62A 1F9SA 4XDXA 2M9VA 4KY7A 1F9QA 1B9MA 4F8MA 2QCPX 2QILA 1R4PB 3NTKA 3T13A 1BOSA 2V4DA 2NTSA 3U9OA 3PUWA 4L6TB 1EY0A 3I3CA 3QOLA 2EPBA 3A54A 4DK0A 3S14B 2F0OA 4HSVA 4H13C 3A55A 5CV9A 3HS0C 1B53A 1QOHA 1I50B 4FP5D 1K8OA 3OPOA 5I6WA 1PMRA 5LL6S 1U4RA 4Q5VA 2JEBI 2JA6B 4KJNA 1EIGA 1NR2A 4UAIA 2EZVA 3ERQA 1BNZA 1OXVA 3HOWB 4A93B 3I70A 4A3DB 2JE6I 4KKUA 1TWHB 4WJWA 2NVTB 5KNBA 5CV7A 3TZDA 4WORA 2PQEA 1PTOH 3DEOA 1SEBD 3HP3A 3CRKC 1ML0D 2BE5C 5JOBA 1WVLA 4KY5A 5JEAJ 1RF2D 4IUPA 1Q8IA 3K0YA 5I2YA 1VDZA 4X3TA 3J81E 1IYUA 1PTOB 2E2IB 2O2LD 4HR7B 5I2XA 1H9RA 2K32A 3T4AC 1SYFA 3V05A 1LT6D 1EY7A 1EU4A 5M5WB 3CRLC 1SFOB 3VYSA 3MXPA 1LTBD 1V1PB 1B44D 4CKEA 1STBA 3OIQA 1RD9D 4C3HG 4FF3A 5JPMC 4ZKBB 4P2CB 4RGOS 3TP5A 4N9PA 4DAPA 3VYTA 5I9OA 2CW0D 3K6OA 4S3SA 1PDQA 4FXGC 3U9SA 1I6VC 4OIJA 2K04A 1AEXA 1JE4A 5HURA 4BWGB 1DOMA 3S17B 5IGCA 2EJGC 4C3HB 2KEDA 4FF2A 1GJXA 1PYWD 2R3ZA 5JEAG 1LTID 4TQUS 1D5XC 2L4NA 4OO1G 4OO1H 2F0HA 5J22A 2F3WA 4K5WA 1T5EA 1X3PA 1ET9A 1JOOA 1SNCA 5E4XA 2F0JA 2ICIA 4LMQD 5EBDA 4RCOA 1GUGA 1PRTC 4CBVA 1NR4A 2DNEA 2OXPA 2EXZA 2XVSA 1DYQA 2X69A 5CC4A 4V190 3E5SA 1RKNA 1PRTF 3PUYA 4CGYB 2HCIA 3DM1A 2AQ3B 3D4DA 1PLFA 1STGA 2R93B 3BVGA 1I4HA 2BA0A 1LTRD 4XTCS 3MFGA 5FLXL 3VYRA 3Q0AA 1DJRD 3DEPA 3GV6A 1TU2B 2AWNA 1U4PA 1G2TA 1AW7A 3A7AB 3BG3A 1H9KA 2Z4IA 3P1HA 2NUCA 3DXJC 5I6YA 1BR9A 3MVVA 3K57A 1CHPD 4ZLTF 1G2SA 4A3KB 2CVRA 5EPLA 2K6AA 1A6XA 1HTPA 4KD3A 2QF7A 1Y1WB 1TS2A 2ICEC 3KBXA 2I46A 2F0VA 3X3NA 3TDQA 3GD7A 1D5MC 5CBAE 5A2QE 2ZXPA 1SNPA 2B8FA 4KD4A 5D3IB 2LS01 4RGMA 2JXMB 1SYDA 3E0JA 4PMWA 3S16B 3OMCA 3H09A 4LAAA 1WCMB 2B2YA 4KK7A 1TWAB 4NKLA 2HDLA 1VCIA 1BDOA 2E75C 1SJED 3MZ5A 1WTOA 1DCZA 3NSWA 1G291 5E1FA 4A3MB 2L1BA 1RCVD 3SK6A 2KA7A 3KK7A 2YYZA 4K2LA 1PTOD 3DWAA 1ZYRC 2A6HC 2B2UC 3J80E 4X3SA 4R9WA 2XWBB 1XTCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U67 3;  5JVG 3;  4WFN 3;  3PIO 3;  3PIP 3;  5DM7 3;  5DM6 3;  5JVH 3; 
#chains in the Genus database with same CATH topology
 1C8C A;  1EIY B;  1MD2 D;  4KKT A;  4RG1 A;  2CWA A;  1QVG A;  1OXS C;  2LMC B;  1KNA A;  4LF8 Q;  1VQ9 A;  1LUZ A;  1QVF A;  1TWG H;  1G6Z A;  4BXX G;  4DR7 Q;  4BXX H;  3B6Y A;  2HD3 A;  3BYY B;  5DNF A;  1K8M A;  1B3A A;  1UEB A;  2F3V A;  3PF5 A;  2R7Z H;  2R7Z G;  5C4X G;  1KRT A;  1Y8N B;  5C4X H;  3I72 A;  4IOA A;  2L0C A;  3FKI G;  1O80 A;  2D9U A;  3FDT A;  3FKI H;  3DUZ A;  1HR0 L;  3UI2 A;  1RJT A;  4IFD I;  4G57 A;  4A3F B;  4DR5 L;  4DV6 L;  5ELF A;  1WI5 A;  5LHY 1;  1ESF A;  3PCO B;  3IKJ A;  5DM7 3;  1SR3 A;  4LFC L;  5K5P A;  3NTI A;  4DK3 C;  2FIN B;  2KCM A;  1BUV T;  2VQE Q;  2VL6 A;  4MTN A;  3CC4 A;  2R7Z B;  1IKL A;  4JI3 L;  5C4X B;  3RZO H;  2Y0S G;  4ZUI A;  2Z0S A;  1QE6 A;  3FKI B;  5ELD A;  1SXT A;  2F0W A;  2KQ3 A;  4C3I H;  4C3I G;  1HNW L;  5JVH 3;  2N78 A;  1CHQ D;  4NXM Q;  4DK6 C;  1Q81 C;  2NB0 A;  2P5Z X;  1I4Q A;  3CW2 C;  4DN4 M;  5CV8 A;  2KBN A;  1D6E C;  1TQO A;  4U67 3;  1TS3 A;  4YY3 L;  3CP0 A;  2G9H D;  1DOL A;  4UDU C;  4DV7 Q;  1PFS A;  3M85 A;  3RZO B;  1CA5 A;  2Y0S B;  1TWC H;  3SK8 A;  2EIF A;  1BCP B;  1V9P A;  3RLN A;  2HUG A;  1K3R A;  4C3I B;  4HED A;  1J5E Q;  2F0G A;  3I4O A;  1DM0 B;  4DK1 A;  5LMN L;  2JA5 G;  2JA5 H;  2VQF Q;  4HSP A;  1V1O A;  2AHO B;  1I4X A;  1WTR A;  3UDF A;  3LGJ A;  1A2T A;  4YCU A;  3C3L A;  1Q1B A;  2K50 A;  2O5J C;  1G91 A;  3S1M H;  1UE7 A;  5CGK A;  3J7Y W;  4GKJ L;  3PO3 G;  2ALY B;  4K0K L;  3PO3 H;  4L8J A;  3GTM H;  4LFA Q;  4RCN A;  4WJ4 A;  3RLO A;  4JI0 Q;  1TWC B;  3KJO A;  1WTX A;  5BR8 L;  2R7D A;  3L7Z C;  2NYZ D;  3HOZ G;  1K83 H;  4PZ8 A;  4B9W A;  2JA5 B;  3STB D;  1LLR D;  1CQV A;  3CCM A;  1VQ5 A;  2UXD Q;  1WTQ A;  4LF6 Q;  3SE0 A;  4JG2 A;  1XJV A;  4KHP L;  3KDF A;  3WWV A;  3QO2 A;  3S1M B;  3PO3 B;  5IGF A;  4DV4 Q;  3GTM B;  1H9J A;  1IBM L;  2BCO A;  4B3T L;  1LV9 A;  2IJ0 A;  4V0B A;  4U68 A;  3HOX G;  1TR5 A;  3HOX H;  2F0F A;  1GUN A;  4EQP A;  2A5H A;  3I7F A;  1WJJ A;  3K8A A;  3WDN A;  2IT1 A;  5CBE E;  1S5E D;  1W6J A;  2NN6 I;  5AJ3 Q;  1LT5 D;  4MIU A;  3MC0 B;  4EX5 A;  2A68 D;  3VYU A;  2BE5 D;  3RR5 A;  4C1N K;  2VW9 A;  1PH3 A;  3CHB D;  2B2U A;  3PSI A;  1WTH A;  1F2M A;  2KCT A;  4QY7 A;  3H91 A;  2E2J H;  3DMU A;  5IWA L;  2SNS A;  3S2D H;  2VZA A;  4X6A H;  3R3O A;  3S2H H;  3PUX A;  3L0O A;  2MQH A;  3TRE A;  4M8A A;  4KV6 A;  1HR0 Q;  3D8G A;  2WV6 D;  2EXD A;  2ZT9 C;  2WIN B;  5E3F A;  4GNX C;  1TXY A;  1H9S A;  4JI6 L;  4GZY C;  1CKM A;  1U4M A;  3HEJ A;  4IN3 A;  4O42 A;  4A75 A;  3HOV G;  4DV6 Q;  3HOV H;  1KDB A;  3S1N H;  2R61 A;  2GVA A;  4LFC Q;  4PMC A;  1RDP D;  3CPF A;  3ERS X;  1QUQ A;  3S2D B;  4DXG A;  2EYL A;  2MFI A;  2QEX A;  3S2H B;  4L63 B;  4MNO A;  4DFA A;  3NQI A;  1XMQ Q;  1X9N A;  1KAB A;  1JE5 A;  2RCF A;  5C44 G;  5C44 H;  3DM3 A;  2G9D A;  4UY8 C;  2UUA Q;  1I4G A;  4RGT A;  2DY7 A;  5C3E G;  1LT4 D;  5C3E H;  4DGZ A;  3PO2 G;  5FLM G;  3PO2 H;  5EQ0 A;  5FLM H;  2PZW A;  3HOV B;  4RHR A;  1GHK A;  3S1N B;  1SE8 A;  1HFN A;  1LTA D;  1MIU A;  4MHE A;  1MSG A;  1PTO F;  2RCN A;  3A56 A;  4K14 A;  1RHP A;  1CI3 M;  1XMO L;  3OIP A;  5C44 B;  4ZQ3 A;  4GN4 B;  4ME5 A;  4RMF A;  5EAY A;  5LMN Q;  4A3L G;  3IFD A;  4PQX A;  4A3L H;  3BZC A;  5C3E B;  3H15 A;  1HUN A;  1EQR A;  2RF4 A;  1PH6 A;  2IY5 B;  4DUZ L;  3S1Q B;  2K05 A;  3R8B A;  2DN8 A;  4IOC A;  1KNE A;  1EQT A;  4PMB A;  4GKJ Q;  5L37 A;  2UXB L;  4XXE A;  4HCE A;  3J80 L;  2F4V L;  1U9R A;  5IY0 A;  2UUB L;  3ND8 A;  4H0L C;  3NXW A;  3H94 A;  2OTL A;  4IUU A;  2QGQ A;  2UUC Q;  4HCS A;  1BBX C;  4NXN Q;  4PZ6 A;  4IZ8 A;  2QEJ C;  4IAL A;  5FLX E;  3Q8D A;  5IT9 c;  4A3G G;  4A3G H;  3PIO A;  1IL2 A;  3DLL A;  1FGB D;  5G3L D;  4KHP Q;  1HA6 A;  4JK1 C;  3K80 C;  2ZTE A;  2FFK B;  3I8Z A;  1JWU D;  3P7J A;  1ICF B;  4C2M B;  4NP5 A;  2OCE A;  1I50 H;  3PIP A;  3TQY A;  1VQH A;  2MP1 A;  4B3T Q;  1J6Q A;  4APV A;  4BA2 I;  1C4Q A;  3K5N A;  3PUZ A;  3SR1 A;  2N8N A;  4IUR A;  5ELE A;  5IYB G;  3F2D A;  2F0I A;  5IYB H;  1MJC A;  1RL2 A;  1STN A;  4K6L A;  4A3G B;  5ELN A;  1HTL D;  1Q86 C;  3HOW G;  4A93 G;  3HOW H;  1CZG A;  2N55 A;  4DAV A;  3K5M A;  1DXM A;  4B9X A;  2HHH L;  5J1Z A;  4O2D A;  2IX0 A;  3DHQ A;  5C4H A;  3NUC A;  3MHB A;  4DNR B;  1J9O A;  5DEH A;  4LF7 Q;  2DY8 A;  4FXK C;  5E7N A;  1DOK A;  1EQQ A;  3KF6 B;  3EVQ A;  5FO8 B;  1WTP A;  2N88 A;  4DF7 A;  3CCS A;  2F0P A;  4BY1 G;  4BY1 H;  4N8F A;  5KGU A;  1M90 C;  1VQB A;  1SMY C;  3KBG A;  4GOP C;  2CFM A;  2XSC A;  1E22 A;  2IX3 A;  2A69 C;  3T16 A;  4AH6 A;  1BCP D;  3D4R A;  3EQL C;  4BBR G;  1EY4 A;  4BBR H;  3OMG A;  5J39 A;  1S40 A;  4GKK L;  1O7L A;  3N6R A;  1D5Z C;  2XIW A;  3I91 A;  4GN5 A;  4A3E G;  2PNH A;  4A3E H;  4QMG A;  4BY1 B;  2A1A A;  3FVQ A;  1IW7 C;  1PH4 A;  4K2K A;  1MI2 A;  3UE1 A;  2RDG A;  3CCJ A;  3JAM c;  4GNX B;  4K5X A;  2NBF A;  1KIX A;  3U4V A;  4BBR B;  1MHW C;  4QUF A;  3NHH A;  2EYO A;  2LY7 A;  1YHQ A;  2A6E D;  2IWH A;  1VF7 A;  2UXC L;  3OSO A;  4B3S Q;  2F03 A;  2EJF C;  5IOD A;  1U4L A;  2VY3 A;  5M9O A;  2F3I A;  3TZU A;  1II3 A;  2MO0 A;  4A3E B;  4JI8 L;  3SEB A;  1JOR A;  4DUZ Q;  1B2T A;  2ES2 A;  2UXB Q;  5C4Z A;  3ER0 A;  2SOB A;  1SNO A;  2B29 A;  4AYB B;  2F4V Q;  2UUB Q;  1JB3 A;  1NBW A;  5DAU A;  1I4P A;  3MWY W;  1PFM A;  1GUW A;  2DUD A;  3A74 A;  2F0L A;  5T1I A;  4TSS A;  2IPK D;  2F0M A;  4HID A;  4JI7 L;  3M9B A;  3J7A F;  4DR1 L;  4AQY Q;  4RH6 A;  1YNN C;  5CMD A;  3G6J B;  3DWP A;  3M4Y A;  2O5I C;  4NB3 A;  4XYO A;  4KMU C;  1X32 A;  2B2Y C;  2HIV A;  3KLR A;  1IBK L;  5JAV A;  3M4Q A;  3MEF A;  3GTP H;  2AQ1 B;  3J81 j;  2KHJ A;  2M2L A;  5F2D A;  4YWK A;  1W2B A;  1I4R A;  4EGV A;  1LTS D;  4LJZ C;  2PYK A;  1EFI D;  2I5M X;  3OYY A;  1U0L A;  2K4K A;  2V1C C;  3FEW X;  2HHH Q;  1BQQ T;  4WJ3 M;  2C9O A;  2JA7 G;  1LTG D;  2JA7 H;  3QIA A;  2VB2 X;  3D31 A;  3K58 A;  4DV5 Q;  1F77 A;  2Z8L A;  4ZAI A;  1EUJ A;  3T53 B;  1X3E A;  3GTP B;  1Y14 B;  5C3W A;  3IRB A;  1W6K A;  4JI2 Q;  2BOS A;  4HJ9 A;  1HPC A;  1W3S A;  2PNR C;  4HTH A;  5C0X J;  4IJL A;  3RLF A;  2KEC A;  3J81 i;  4OL7 A;  1ENF A;  4QGU A;  1STA A;  4J6H A;  2JA7 B;  2TMP A;  3I55 A;  2R93 G;  4N9T A;  5IGD A;  2D5D A;  4DR3 L;  3I56 A;  1XPR A;  3D4W A;  4RHS A;  2IL8 A;  3GTG H;  3D6C A;  5EPJ A;  1XPU A;  5CV5 A;  1OXT A;  4QIW E;  1QNK A;  4GKK Q;  1FYC A;  5BN5 A;  1FJG L;  1IXR A;  4CKC A;  3TN2 A;  3G7L A;  2QW7 A;  4GOP A;  1DD2 A;  3HKS A;  4ME3 A;  1JB7 A;  1YIT A;  2EY2 A;  5DM6 3;  1HNX Q;  4A3J G;  2KEN A;  4A3J H;  2LKV A;  3PMF A;  2KHS A;  3U50 C;  1BXT A;  3GTG B;  1QCB D;  1QNU A;  2J7Z A;  2MPM A;  1KD1 C;  2KCN A;  4NMZ A;  3K7A H;  1EY6 A;  2CWP A;  2QKI C;  2EY1 A;  4RKB A;  1WD1 A;  1L0W A;  3E0E A;  2SEB D;  2Q8R E;  3S15 H;  5J3B A;  1FNU A;  4JI8 Q;  3TS2 A;  1HNZ L;  2EOT A;  5IE8 A;  1KQS A;  4G7H C;  1N33 L;  1QIL A;  1Z47 A;  2PCF B;  1C48 A;  4A3J B;  1EU3 A;  2JK8 A;  3QOJ A;  4OO1 I;  1WFQ A;  1Q8K A;  4ZRZ A;  2ZXR A;  4BY7 B;  2WB1 E;  2E76 C;  3K7A B;  4B3M Q;  2HT1 A;  1A0I A;  1L1O B;  4DXF A;  2L9H A;  5C0X G;  3S15 B;  5C0X H;  1BO0 A;  1M1K C;  1M4V A;  2PW5 A;  4I7Z C;  4DR1 Q;  5D3D A;  4GN3 B;  1GUT A;  2B39 A;  2XNA C;  1K9M C;  1TWA H;  3VDY A;  2MGS A;  3TS0 A;  3AFQ A;  3NWS A;  1VQI A;  1X6O A;  1B9N A;  1BCP F;  5BN3 A;  1EEF D;  1A62 A;  4KY6 A;  5M3F G;  5M3F H;  4KJO A;  3V96 A;  1Y8O B;  1PFB A;  1VQC A;  2A8V A;  1ZXT A;  4OIK A;  1ENC A;  2CH4 A;  1EOT A;  1EYG A;  1B50 A;  1KDA A;  2WII B;  1CA6 A;  1K8G A;  1A63 A;  3RUZ A;  4L5S A;  3HFZ B;  3GTQ B;  2WFW A;  1JR0 D;  2K5D A;  3NBI A;  4CJ2 C;  5C6A A;  2JP1 A;  5IT9 E;  4Y7N B;  3H3V I;  2VUM B;  2Q2U A;  1SNM A;  1V43 A;  3I2Z A;  5M3F B;  1SRU A;  1TT2 A;  3LX0 A;  2K75 A;  3PV0 A;  5IGG A;  1IYV A;  1S5B D;  2HQE A;  5CR3 A;  4IPC A;  3W1G A;  1YNJ D;  2AUJ D;  2YTY A;  2LFN A;  2QDB A;  3T1Y L;  2J4X A;  3H0G G;  3H0G H;  4HJ8 A;  5IGB A;  2H4O A;  2XWJ B;  1EY9 A;  2UU9 Q;  1BBU A;  1YEZ A;  1A8V A;  2MHV A;  4QF4 A;  5D65 A;  2IX1 A;  2B3G A;  1JJG A;  4OWX B;  1HA5 A;  1KC8 C;  4X66 Q;  1FJG Q;  2CW0 C;  2OT2 A;  3L2P A;  2ENB A;  2A74 C;  3HKZ E;  1SYG A;  3H0G B;  4A3F G;  4A3F H;  3IL8 A;  5T1G A;  4DUY L;  2K5Q A;  2NVX H;  3RZD B;  1KLG D;  1SRO A;  2Z9H A;  1AH9 A;  1CT1 D;  1WD0 A;  1PRT B;  2NWG A;  1VQ7 A;  4JC0 A;  4FNF A;  5JJZ A;  1K0R A;  4KHZ A;  2SDF A;  1EOV A;  1JOK A;  2RVL A;  4I65 A;  1UE5 A;  4XT1 B;  5FO9 B;  1SNQ A;  1AP0 A;  1HNZ Q;  4QQB X;  1B70 B;  1LTL A;  2NVX B;  1EEI D;  1XNR L;  1VF5 C;  3CCL A;  3P75 A;  3ULP A;  5A35 A;  1NUC A;  1UNS A;  4DAM A;  3UE0 A;  1PZK D;  1N36 L;  4RAU C;  1UEA B;  4FF4 A;  3A8K E;  4HMJ A;  1EY5 A;  3JAM E;  2E2H H;  1KHI A;  4R4O A;  3Q22 A;  2EE1 A;  2F1M A;  1T9H A;  4LUO A;  5KYI A;  1EFW A;  4C1N I;  4RWS C;  3SK4 A;  3I4M G;  3I4M H;  5C3X A;  4A4I A;  1CZW A;  2F0N A;  1ET6 A;  3BU2 A;  4EQ5 A;  5FJ8 G;  4R8I A;  4HMI A;  5FJ8 H;  2EJM A;  1GUO A;  4NDX A;  3BDL A;  2EYP A;  1FD7 D;  2IHF A;  1BF4 A;  3S1R H;  2E2H B;  3D3R A;  3Q24 A;  3O13 A;  1FNV A;  3I4M B;  3GV3 A;  3J80 i;  1MJE A;  4IPH A;  1EYA A;  1N34 L;  5HGQ A;  3MXG A;  3R2I A;  5CYU A;  1TS5 A;  1EWC A;  4UP7 A;  3NBH A;  4DV1 Q;  4O0A A;  3S1R B;  2NTT A;  4KN4 C;  4DV2 L;  2WKC A;  4F7X A;  3RD4 A;  1PA6 A;  1QG7 A;  2Z1C A;  3EN2 A;  4A3B B;  2DJG C;  2F0D A;  4X64 L;  1E2V A;  4XYQ A;  4KTA A;  4G7Z C;  3GTL H;  1STH A;  3NEM A;  1Y8P B;  5COR A;  1GHJ A;  3C2P A;  5NUC A;  1LT3 D;  3KDF B;  1KAW A;  4ODG A;  2DNC A;  1D2B A;  2WAQ E;  4IUV A;  2FMC A;  5LMU L;  4PG3 A;  1N32 L;  2B2W C;  1Z7T A;  5EJW A;  1PH5 A;  2MJ8 A;  3QB3 A;  4FXD A;  3GTL B;  1GXD C;  3MFY A;  1IYJ B;  1IW7 D;  4TRD A;  4AIM A;  2FHT A;  3KF8 A;  5HGT A;  2YU9 B;  2PMZ E;  1JCK B;  2IW3 A;  2RHS B;  1GO3 E;  5KND A;  3G71 A;  4UHV A;  1NJI C;  3SXH A;  1E7Z A;  3W3A A;  4R1J A;  5FOB B;  1V1Q A;  4DR5 Q;  4KI0 A;  2EYJ A;  2EQS A;  4B08 A;  2HIX A;  1XYI A;  1UE6 A;  2H1E A;  3A7L A;  1SE4 A;  4JI3 Q;  1N36 Q;  2DGY A;  1H9S B;  4GLV B;  1E24 A;  4XIG S;  1TKW B;  1R4Q B;  1OO9 B;  5BN4 A;  4N8X 1;  1I94 L;  1HNW Q;  1C0A A;  4QB4 A;  4X3U A;  3LNN A;  1S3O A;  1QUQ B;  1FL0 A;  3WOE A;  1PTO C;  2LSS A;  5IT9 L;  1CK1 A;  3S1Q H;  1HXY D;  1LO5 D;  4YY3 Q;  1EY8 A;  1VQA A;  3TP6 A;  3URY A;  3A8I E;  4R4Q A;  2VS1 A;  2VXW A;  3ITP A;  1D7Q A;  3SDZ A;  3TP8 A;  4O1N A;  5I4D A;  2HDM A;  1CFM A;  1YZ6 A;  2WKD A;  3A5U A;  4PNY A;  4A3C G;  4A3C H;  3VR6 A;  1OXU A;  4OEM B;  1JIC A;  1N34 Q;  1HQM C;  4C2M H;  4K0K Q;  1EZ8 A;  4QIW B;  1SAP A;  2CKZ B;  5JPN C;  4F87 A;  3S24 A;  5BR8 Q;  4BS9 A;  2L5T A;  4C3J G;  5CV4 A;  4C3J H;  1VMC A;  1MKH A;  2AKW B;  1WOC A;  2PZU A;  2BDO A;  3F2B A;  4DV2 Q;  1PXU A;  2NZ1 D;  1CKN A;  4A3I B;  1S4Z A;  4R4I A;  4LWC A;  4KKS A;  3HGB A;  2NZO A;  3CU7 A;  3NQT A;  4BBS H;  2WB1 G;  1A15 A;  2EYM A;  2K01 A;  3ICE A;  4DAY A;  1IBM Q;  3AEV A;  1BKB A;  1PRT D;  5GAG C;  4C3J B;  4K8I A;  1ICW A;  1E2W A;  1A3T A;  2EY5 A;  1D1K A;  4LW1 A;  3VR3 A;  2Q2I A;  4YWL A;  1FR3 A;  1BVS A;  2N49 A;  2OQ0 A;  4NW2 A;  3C46 A;  5LMU Q;  4BBS B;  2WB1 B;  2HCC A;  2E2D C;  2M00 A;  2E74 C;  4IUN A;  1N32 Q;  2K33 A;  3DWQ A;  5C4J H;  1F9P A;  1ASY A;  1V8Q A;  2XRS D;  1A3U A;  1SE3 A;  5I9P A;  2D2C C;  2JEA I;  3JAM L;  5IWA Q;  3GTJ H;  1XWE A;  4E6I A;  3K0X A;  4DR2 L;  2RDF A;  2B2W A;  1VQ4 A;  4G7O C;  5EKI A;  4CHT B;  2OF1 A;  4CJ0 B;  2XTI A;  4JI6 Q;  4HAE A;  5C4J B;  1XPO A;  3HOY G;  3HOY H;  4IJH A;  1JQY D;  5H1S E;  2B8G A;  3LWE A;  4P71 A;  3T51 B;  3A8J E;  4OGQ C;  3STB C;  3UDG A;  3GTJ B;  4YCW A;  4R8N A;  5E4W C;  2K28 A;  1Q90 A;  5FK9 C;  4OWW B;  1I94 Q;  2AUK A;  3AMU A;  2NVY H;  1EL0 A;  3BYT B;  3HOY B;  1M8A A;  4EQO A;  1QZG A;  5FO7 B;  1DZ1 A;  4K5V A;  1F9R A;  1I6H H;  2XN9 C;  4KHV A;  2CH4 W;  4POG A;  1MGS A;  5COY A;  4AYB G;  1QB5 D;  4H44 C;  5FKA C;  2J0T D;  1UE1 A;  1WTV A;  1QZH A;  1XMO Q;  2JSO A;  3HKZ G;  4CDE C;  2QA4 A;  1SBB B;  1HH2 P;  2A68 C;  2NVY B;  2I5H A;  3EFX D;  4JOI C;  4ID6 A;  2C5C A;  2X6L A;  2B2V C;  5GQO A;  3H3V C;  3OHX C;  1NMF A;  4Q0F A;  4RA8 A;  1I6H B;  1CUK A;  3X3M A;  3BVZ A;  3OW7 A;  1SYB A;  1VQ8 A;  4ZYS A;  1YVC A;  2BDN A;  4JBJ A;  4Z9C B;  3UDI A;  3KUP A;  2L15 A;  2N3S A;  3CCV A;  5KRU A;  3ONA B;  2OQK A;  4X65 L;  2K03 A;  1A2U A;  1OTC A;  3MXU A;  4A76 A;  2RBM A;  3AYH B;  3E9H A;  3HKZ B;  5AFW A;  1JJ2 A;  1C9O A;  1V1P A;  1SDF A;  1LAC A;  2OTJ A;  3VA7 A;  1E2Z A;  2MO1 A;  3H6M A;  3IFT A;  1JMC A;  2YV5 A;  3ULJ A;  2PO4 A;  2FJ2 A;  4G4K A;  4P72 A;  1L0X B;  1TS4 A;  1AZQ A;  4OXP A;  1VS0 A;  1Y1V B;  1PZJ D;  5M5Y H;  3F2U A;  4QCL A;  2RKS A;  3CKI B;  2SNM A;  3U4Z A;  1ZYR D;  2A6H D;  1GUS A;  1ROD A;  2PPB C;  2B2T C;  1JOQ A;  1HCZ A;  1SYC A;  1AE2 A;  4PV1 C;  4R4C A;  4M1U B;  4OHJ A;  1Z6H A;  4J1M A;  5M5Y B;  3S9W A;  1FVI A;  3K59 A;  4DR2 Q;  4OX9 L;  1F2Y A;  1TY0 A;  3BZK A;  1P16 A;  1K0S A;  1GD7 A;  1VQK A;  5M3M G;  5M3M H;  3EA6 A;  5JEA H;  2B63 G;  2F0E A;  3HRZ C;  1S72 A;  2B63 H;  4QL5 A;  2ZJR A;  1EIF A;  4Y52 H;  3ULL A;  1IL8 A;  3M3Y B;  1HQR D;  2RA4 A;  3L9A X;  3Q23 A;  5KYL A;  3JC6 6;  3G4S A;  4HIK A;  1NSN S;  1Q7Y C;  1AZP A;  2RSO A;  1QWY A;  1R9T H;  4LFB L;  1VQE A;  1SSO A;  3MA2 B;  1ILQ A;  3WOF A;  1CTM A;  5M3M B;  3CD6 A;  2B63 B;  1JWM D;  3CC2 A;  4TVA B;  2XGT A;  4DV0 L;  5G3L F;  4DA2 A;  1O7Y A;  2RDH A;  3MXN A;  3TSS A;  4EQN A;  5K36 G;  4LK1 C;  5K36 H;  4J8Q A;  1YJW A;  4BY7 G;  1R9T B;  2O4X A;  2WAQ G;  4BY7 H;  3VR5 A;  4GOP B;  4FO2 A;  2K1B A;  3NPP A;  1A3V A;  1VMP A;  3MEH A;  2UXC Q;  1PVO A;  4JW0 A;  1J8I A;  3GQB A;  4WRD A;  4IPG A;  2ZM6 L;  1EIH A;  4JYA L;  4IFD J;  2CHB D;  3SK5 A;  5D14 A;  1YJ9 A;  2AQ2 B;  3W5O A;  1NNX A;  1KAA A;  4XQJ A;  4GLA C;  3I4N H;  2PQA A;  1EZ6 A;  4DR7 L;  1Q12 A;  1PH8 A;  2R7F A;  4ILW A;  3K5L A;  2WAQ B;  1O78 A;  2EY6 A;  2PZT A;  4X65 Q;  1VQM A;  3TBI B;  1QJO A;  2KVM A;  4JOI A;  4IUQ A;  4DU9 A;  1Y69 U;  2JA8 G;  2JA8 H;  2B2V A;  2GA4 B;  2ZTC A;  3K81 C;  1OXX K;  2F0T A;  5EGT A;  4HN7 A;  4BA1 I;  4JI7 Q;  1RTO A;  1Q3L A;  2F52 A;  4R4T A;  1F2Z A;  5KIX A;  3NP8 A;  1G8Z D;  3W2D A;  2F0K A;  2PMZ B;  3I4N B;  1BCP C;  2BH8 A;  1ESR A;  2R92 H;  2PI2 A;  2A19 A;  4YIJ A;  1DGS A;  2I07 B;  3AU7 A;  3M7N A;  3GTQ H;  1IKM A;  1IBK Q;  2VUM G;  2VUM H;  4Y7N H;  3NWT A;  2JA8 B;  3PIO 3;  2RSN A;  1LM0 A;  4FVM A;  4ZK9 B;  1HFG A;  4IQZ A;  2YTX A;  1VQG A;  1PV4 A;  3CQZ H;  4NXM L;  3PIP 3;  3LWU A;  2TSS A;  3J7Z C;  3IAY A;  1PH7 A;  4CDD C;  4WFN 3;  2R92 B;  1YBY A;  2JJQ A;  1NAP A;  2A6E C;  4X62 L;  1WTW A;  1Q1E A;  3QG1 A;  3BDO A;  1PZI D;  3NK9 A;  3CF5 A;  3E6Z X;  3MAQ A;  4OX9 Q;  1D1I A;  3D0F A;  3QWN A;  4JBW A;  4UP9 A;  2B2T A;  4TKO B;  2F0Q A;  3VR4 A;  3CQZ B;  3K5O A;  1B1Z A;  5JVG 3;  4IFD G;  1O7I A;  2X6G A;  4IFD H;  1YHA A;  2FXQ A;  1SLJ A;  2L11 A;  1GM5 A;  4LFA L;  1PH1 A;  3GTO B;  1EWI A;  1KLU D;  4DR3 Q;  3RZD H;  1EWH A;  4ULL A;  4JV5 L;  1SND A;  4LFB Q;  3BVM A;  2EDG A;  3E3X A;  5C0X I;  3F2C A;  3CCQ A;  4EVO A;  5JJK A;  3KLS A;  1HZB A;  1STE A;  2D0P A;  3ZYY X;  1MSH A;  1GOZ A;  3AB9 A;  3J81 L;  3KLS X;  3F1Z A;  3NEL A;  4DV0 Q;  2Z6K C;  1TII D;  3A5Z B;  2L12 A;  2C35 B;  4JI5 L;  3BS1 A;  2BH2 A;  2KOL A;  4F88 A;  5IOC A;  4L5T A;  1EYC A;  2JYO A;  1PFN A;  4ABN A;  1E0B A;  4FYD A;  3BJU A;  5C5L A;  4DKA C;  5IYC G;  5IYC H;  4DR6 L;  3HOU B;  4OEL B;  4X3K A;  2A73 B;  3KJP A;  1SMX A;  3M7G A;  1S5D D;  3KLW A;  3TEH B;  1O7Z A;  2G5D A;  1EQV A;  2ZM6 Q;  4JYA Q;  3D6W A;  5IIF A;  5AJ3 L;  3I90 A;  4JVZ A;  1G51 A;  5EKL A;  3GDE A;  1N33 Q;  1STY A;  1TY2 A;  2RQX A;  1PH2 A;  3RMH A;  3P20 A;  4JI1 L;  1XNQ L;  3OWE B;  5KNC A;  1HJP A;  4RFB A;  1X3Q A;  4HIO A;  1JWS D;  3GTK H;  4H7B A;  3J7A 5;  3J81 c;  4LUV A;  4OWT B;  3M4O H;  2EYF A;  2WAC A;  4ZKC B;  2LXK A;  1CM9 A;  2YTV A;  2ZXO A;  3U58 A;  4J15 A;  5KEE A;  3FPP A;  1FNW A;  3J7A V;  1KXL A;  3KOJ A;  1TWG B;  3ZJY C;  3Q6S A;  3C1F A;  5EBC A;  2KEE A;  4QUC A;  3FPU B;  1B4O A;  1H9M A;  1RTN A;  5ELC A;  2KCC A;  3GTK B;  3HG9 A;  1T5X D;  1XMQ L;  4MN3 A;  2F4I A;  3CAM A;  1HZA A;  3M4O B;  2UUA L;  2OEO A;  4XT3 B;  3OWF A;  2K5W A;  3UDX A;  2NN6 G;  2NN6 H;  4A3B G;  1N9W A;  4A3B H;  1SE2 A;  1UAP A;  1PH9 A;  3ND9 A;  3NEN A;  1PYS B;  1Q46 A;  4X62 Q;  2NVQ H;  1ONL A;  3R93 A;  1AN8 A;  1E1T A;  2CQA A;  3QJY A;  2VNU D;  1ZEQ X;  5EPK A;  3SHL A;  2HQL A;  1YNX A;  3R2T A;  2K52 A;  1PHJ A;  3VA5 A;  3NE5 B;  3V2T A;  4RKL A;  2K7V A;  4RGN A;  3CCU A;  1TWF H;  2F0S A;  3T1Y Q;  5ELB A;  1ZKO A;  3NTH A;  3CCE A;  1AFP A;  3NBH B;  2NVQ B;  2FMM A;  1DON A;  2I0Q A;  1SMY D;  4JV5 Q;  4IUT A;  3FMC A;  2UUC L;  3TME A;  3CCR A;  3HOZ H;  5ISR A;  4NXN L;  2YU9 H;  2A69 D;  3GP7 A;  3TP7 A;  4GS3 A;  1CQF A;  2D0O A;  5EKK A;  1IHZ A;  2MUY A;  3GO5 A;  1TWF B;  4IPD A;  3FRP B;  3BDC A;  1SJH D;  2EVB A;  4KN7 C;  4JI5 Q;  4FF1 A;  1ILP A;  4DUY Q;  3C1E A;  1EYD A;  1XXG A;  2GN5 A;  3JAM i;  3PUV A;  1SN8 A;  3HOZ B;  1K83 B;  4CDC C;  4POF A;  2F0U A;  4DR6 Q;  1BBW A;  1NY4 A;  1MBY A;  4LUZ A;  4K8J A;  1NCV A;  2Z6K A;  2KJX A;  3L3O C;  1E1O A;  3EJI A;  3KF8 B;  1SYE A;  1KDC A;  1TVX A;  4L5R C;  1ENA A;  1LAB A;  5C5M A;  5DLQ E;  3BZD B;  1XNR Q;  2PI2 E;  2Q8I B;  1KRS A;  1X56 A;  3HOX B;  2R6G A;  2ID0 A;  2EYH A;  1JC7 A;  4JI1 Q;  1S5C D;  2AWO A;  2Z4H A;  4C56 C;  1L0Y B;  1YI2 A;  1XNQ Q;  5IGE A;  1X3F A;  5M5X H;  4LF7 L;  1YNJ C;  2KUM A;  1HUM A;  3HZX A;  2PW7 A;  1UUP A;  3I4L A;  2Z6B A;  4MZ9 A;  1F2L A;  1GVP A;  1U5K A;  1CSP A;  5CV6 A;  5A2Q L;  4GLX A;  5JJI A;  2BA1 A;  1HHV A;  1X54 A;  2L55 A;  2E2J B;  1YNN D;  4XQN A;  1HZC A;  5M5X B;  1I3Q H;  4CKB A;  3RN2 A;  2Q8T A;  4LF9 L;  2XRQ D;  3MTS A;  2VB3 X;  3SVM A;  1I5F A;  1XX8 A;  4A3I G;  2K5V A;  5LL6 X;  4NPS A;  1NE3 A;  4A3I H;  3E9I A;  4K6D A;  5TSS A;  4ZUJ A;  1VQP A;  1X3G A;  1YJN A;  4JI4 L;  1VQD A;  3CMA A;  1S5F D;  3VR2 A;  3G6E A;  1HRJ A;  1I3Q B;  2GVB A;  1LTT D;  1P8L A;  4B3S L;  2WP8 J;  3F8T A;  3I73 A;  2OWO A;  4XQQ A;  3PO2 B;  4CJ1 B;  3OTO L;  2RHQ B;  4JPB W;  3T56 B;  1D8L A;  2Q2T A;  4BBS G;  3OOC A;  1KTK A;  2AMC B;  3ERO A;  4YCV A;  4X64 Q;  4HJ7 A;  4DNT B;  3N52 A;  2D62 A;  1F9S A;  4XDX A;  4P74 A;  3T1H L;  2M9V A;  1CKN B;  4LNQ A;  4KY7 A;  1F9Q A;  1B9M A;  3S14 H;  4F8M A;  2QCP X;  4P75 A;  5GAD C;  2QIL A;  3CPW A;  1R4P B;  3NTK A;  3T13 A;  4DAY B;  2ZJP A;  1BOS A;  2V4D A;  2NTS A;  4DR4 L;  3U9O A;  4AQY L;  3PUW A;  4L6T B;  1EY0 A;  3I3C A;  2IHE A;  3QOL A;  2QDL A;  3QR8 A;  2EPB A;  2KHI A;  3A54 A;  4DK0 A;  2JA6 G;  2JA6 H;  3S14 B;  2E5L L;  1UWV A;  2F0O A;  4HSV A;  4IO9 A;  4H13 C;  3A55 A;  5CV9 A;  3HS0 C;  4A93 H;  4HJ5 A;  1B53 A;  1QOH A;  3J80 c;  1I50 B;  4A3D G;  4FP5 D;  1VQF A;  4A3D H;  1K8O A;  2Q2H A;  3OPO A;  5I6W A;  3KF6 A;  1PMR A;  5LL6 S;  1U4R A;  3FHW A;  1TWH H;  3SGI A;  4LF4 L;  4Q5V A;  4DV5 L;  1ASZ A;  2NVT H;  2JEB I;  2JA6 B;  4KJN A;  1EIG A;  3PGZ A;  1NR2 A;  4UAI A;  4B3R L;  4JI2 L;  2EZV A;  2CCZ A;  3ERQ A;  1BNZ A;  4KLK A;  1OXV A;  3HOW B;  4A93 B;  2Y0S E;  3I70 A;  4A3D B;  1K73 C;  2JE6 I;  4KKU A;  1TWH B;  4WJW A;  4DV3 L;  2NVT B;  5KNB A;  5CV7 A;  3TZD A;  4WOR A;  1C7Y A;  2PQE A;  1PTO H;  3CXC A;  2E2I H;  3DEO A;  4LF9 Q;  2JA9 A;  4GNX A;  1G6P A;  1SEB D;  3HP3 A;  4YHH L;  3CRK C;  1ML0 D;  1JJC B;  2BE5 C;  5JOB A;  1WVL A;  4KY5 A;  5JEA J;  5M5W H;  1RF2 D;  4IUP A;  4JI4 Q;  1Q8I A;  1HNX L;  3K0Y A;  1L1O C;  5I2Y A;  1VDZ A;  4X3T A;  1B3Q A;  3J81 E;  1SFO H;  2ASB A;  1IYU A;  1PTO B;  2DJF C;  2E2I B;  4DNI A;  2O2L D;  1VQN A;  4HR7 B;  5I2X A;  1H9R A;  1Y1V G;  1Y1V H;  2K32 A;  3T4A C;  1SYF A;  5IP9 G;  3V05 A;  5IP9 H;  3OTO Q;  5JJL A;  1LT6 D;  1EY7 A;  1EU4 A;  5M5W B;  1X65 A;  3CRL C;  4LF5 L;  4QJF A;  3K7U C;  4YWM A;  1SFO B;  3VYS A;  1VQL A;  3MXP A;  1LTB D;  1NMG A;  1E3P A;  1V1P B;  1B44 D;  1IBL L;  1KL9 A;  3T1H Q;  4B3M L;  4CKE A;  4JCV E;  1STB A;  4HIM A;  3RN5 A;  3PF4 A;  3OIQ A;  3S17 H;  1RD9 D;  4C3H G;  4FF3 A;  4C3H H;  5JPM C;  4HJA A;  4ZKB B;  4DR4 Q;  2E8G A;  4P2C B;  4RGO S;  4ZCK A;  3TP5 A;  4N9P A;  1NTG A;  4DAP A;  3VYT A;  5I9O A;  2CW0 D;  3K6O A;  4S3S A;  1PDQ A;  4FXG C;  1I6V C;  4OIJ A;  3U9S A;  2K04 A;  1AEX A;  1JE4 A;  1XTD A;  4BWG B;  5HUR A;  3M3Y H;  1DOM A;  3S17 B;  2E5L Q;  5IGC A;  2EJG C;  1K8A C;  4C3H B;  2KED A;  1Q82 C;  4FF2 A;  1GJX A;  1PYW D;  2R3Z A;  4JBK A;  4DPG A;  5JEA G;  1VQO A;  4OON A;  1CSQ A;  1LTI D;  4TQU S;  1D5X C;  4LF4 Q;  2L4N A;  4OO1 G;  4OO1 H;  4H02 A;  2F0H A;  5J22 A;  1K3B C;  2F3W A;  1L2F A;  4K5W A;  2CQO A;  4B3R Q;  1T5E A;  4I7A A;  1X3P A;  1ET9 A;  1JOO A;  1SNC A;  5E4X A;  1YIJ A;  2F0J A;  2ICI A;  4LMQ D;  4UP8 A;  5EBD A;  4RCO A;  1GUG A;  1PRT C;  5GAE C;  4CBV A;  1NR4 A;  2R93 H;  4DV3 Q;  3KFU A;  3AQQ A;  2UU9 L;  2DNE A;  2OXP A;  2EXZ A;  2XVS A;  1DYQ A;  2X69 A;  5CC4 A;  4V19 0;  1WYD A;  2K5N A;  3E5S A;  1RKN A;  5IP7 G;  1PRT F;  1GKH A;  3PUY A;  5IP7 H;  1RIP A;  2K5H A;  5GAH C;  1AE3 A;  1LYL A;  2ZTD A;  4X66 L;  3M4P A;  4CGY B;  3MXN B;  4YHH Q;  1VQ6 A;  2HCI A;  3DM1 A;  2AQ3 B;  2H5X A;  3D4D A;  4P73 A;  1PLF A;  1STG A;  5GRO A;  2R93 B;  3BVG A;  4UPA A;  4LF8 L;  1I4H A;  2BA0 A;  3I4N G;  1LTR D;  3H3V H;  1JT8 A;  4XTC S;  3MFG A;  5FLX L;  4A3K G;  3VYR A;  3Q0A A;  4A3K H;  1DJR D;  5HY6 A;  3DEP A;  1HZ9 A;  3GV6 A;  1TU2 B;  2AWN A;  1U4P A;  1G2T A;  3PQI A;  2PQA B;  1AW7 A;  2LXJ A;  3A7A B;  3BG3 A;  1L1O A;  1VQJ A;  1Y1W G;  3TRZ A;  1Y1W H;  1H9K A;  2Z4I A;  4LF5 Q;  3P1H A;  1H95 A;  1IZ6 A;  2NUC A;  3DXJ C;  5I6Y A;  1BR9 A;  2R92 G;  3MVV A;  2VQE L;  4FDB A;  1IBL Q;  3K57 A;  2NZH A;  1CHP D;  4ZLT F;  1G2S A;  4A3K B;  1YHB A;  2CVR A;  5EPL A;  2K6A A;  1A6X A;  1QVC A;  1HTP A;  4PZ7 A;  2K14 A;  3EIV A;  5IYD G;  5IYD H;  5ELO A;  4KD3 A;  1PYB A;  2QF7 A;  1Y1W B;  3S16 H;  1TS2 A;  2ICE C;  3KBX A;  2I46 A;  2F0V A;  1WCM G;  1WCM H;  1X55 A;  3X3N A;  5FLX c;  3TDQ A;  4DV7 L;  3GD7 A;  1D5M C;  1HR0 W;  2JN4 A;  5CBA E;  3GTO H;  1FGU A;  5A2Q E;  3RNU A;  2ZXP A;  1SNP A;  2B8F A;  1Z9F A;  4KD4 A;  5D3I B;  1J5E L;  2LS0 1;  3G48 A;  2JQO A;  4RGM A;  2JXM B;  1SYD A;  3E0J A;  2VQF L;  4MTK A;  1B8A A;  4PMW A;  3S16 B;  3OMC A;  3H09 A;  4LAA A;  2ZJQ A;  1WCM B;  2B2Y A;  4KK7 A;  3FP9 A;  4A3M G;  3EBE A;  4A3M H;  1TWA B;  3OW2 A;  3A0J A;  4JBM A;  4NKL A;  2HDL A;  1K28 A;  3KYH C;  1VCI A;  4JI0 L;  1BDO A;  2E75 C;  1SJE D;  3MZ5 A;  3AFP A;  1WTO A;  4DV1 L;  4ALP A;  3HOU G;  3HOU H;  1DCZ A;  3NSW A;  1G29 1;  2UXD L;  4LF6 L;  5E1F A;  1B7Y B;  2MNA A;  1N8R C;  3CC7 A;  4A3M B;  2L1B A;  1RCV D;  3SK6 A;  4DV4 L;  4L5Q A;  2KA7 A;  3KK7 A;  2YYZ A;  2ATW A;  5LMN W;  4K2L A;  1PTO D;  3W1B A;  3DWA A;  4CDF C;  1ZYR C;  2A6H C;  2I5L X;  2B2U C;  1CKO A;  3J80 E;  3CME A;  4AYB E;  4X3S A;  4R9W A;  2XWB B;  1XTC D; 
#chains in the Genus database with same CATH homology
 1C8C A;  1MD2 D;  4KKT A;  1OXS C;  2LMC B;  1KNA A;  1G6Z A;  3BYY B;  5DNF A;  1K8M A;  1B3A A;  2F3V A;  1Y8N B;  3I72 A;  2L0C A;  1O80 A;  2D9U A;  3FDT A;  3DUZ A;  3UI2 A;  1RJT A;  4IFD I;  4G57 A;  4A3F B;  5ELF A;  5LHY 1;  1ESF A;  3IKJ A;  5DM7 3;  5K5P A;  3NTI A;  2FIN B;  1BUV T;  2R7Z B;  1IKL A;  5C4X B;  4ZUI A;  1QE6 A;  3FKI B;  5ELD A;  1SXT A;  2F0W A;  2KQ3 A;  4C3I G;  5JVH 3;  1CHQ D;  2NB0 A;  1I4Q A;  4DN4 M;  5CV8 A;  1D6E C;  1TQO A;  4U67 3;  1TS3 A;  2G9H D;  1DOL A;  4UDU C;  3M85 A;  3RZO B;  1CA5 A;  2Y0S B;  3SK8 A;  1BCP B;  2HUG A;  4C3I B;  4HED A;  2F0G A;  1DM0 B;  4DK1 A;  4HSP A;  1V1O A;  1I4X A;  1WTR A;  1A2T A;  3C3L A;  1Q1B A;  1G91 A;  2O5J C;  5CGK A;  3J7Y W;  4L8J A;  4RCN A;  1TWC B;  1WTX A;  3L7Z C;  2NYZ D;  4B9W A;  2JA5 B;  1LLR D;  1CQV A;  1WTQ A;  3SE0 A;  3QO2 A;  3S1M B;  3PO3 B;  5IGF A;  3GTM B;  1H9J A;  2BCO A;  1LV9 A;  2IJ0 A;  4V0B A;  4U68 A;  1TR5 A;  2F0F A;  1GUN A;  4EQP A;  2A5H A;  3WDN A;  2IT1 A;  5CBE E;  1S5E D;  1W6J A;  2NN6 I;  1LT5 D;  4MIU A;  3MC0 B;  2A68 D;  3VYU A;  2BE5 D;  4C1N K;  3CHB D;  2B2U A;  1F2M A;  3H91 A;  3DMU A;  2SNS A;  3R3O A;  3PUX A;  4M8A A;  4KV6 A;  3D8G A;  2WV6 D;  2ZT9 C;  2WIN B;  5E3F A;  1H9S A;  4GZY C;  1U4M A;  3HEJ A;  4IN3 A;  4O42 A;  1KDB A;  2R61 A;  4PMC A;  1RDP D;  3S2D B;  4DXG A;  2EYL A;  3S2H B;  4L63 B;  4DFA A;  3NQI A;  1KAB A;  2G9D A;  1I4G A;  4RGT A;  2DY7 A;  1LT4 D;  4DGZ A;  5EQ0 A;  2PZW A;  3HOV B;  4RHR A;  1GHK A;  3S1N B;  1HFN A;  1LTA D;  4MHE A;  1MSG A;  1PTO F;  3A56 A;  4K14 A;  1RHP A;  1CI3 M;  3OIP A;  5C44 B;  4ZQ3 A;  4ME5 A;  3IFD A;  4PQX A;  5C3E B;  1HUN A;  3S1Q B;  2K05 A;  3R8B A;  2DN8 A;  1KNE A;  1EQT A;  4PMB A;  4XXE A;  4HCE A;  3J80 L;  1U9R A;  3ND8 A;  4H0L C;  3NXW A;  3H94 A;  4IUU A;  4HCS A;  1BBX C;  4IZ8 A;  2QEJ C;  4IAL A;  5FLX E;  1FGB D;  5G3L D;  1HA6 A;  4JK1 C;  2FFK B;  3I8Z A;  1JWU D;  3P7J A;  4C2M B;  4NP5 A;  2MP1 A;  4BA2 I;  1C4Q A;  3K5N A;  3PUZ A;  3SR1 A;  4IUR A;  5ELE A;  2F0I A;  1STN A;  4K6L A;  4A3G B;  1HTL D;  1CZG A;  2N55 A;  4DAV A;  3K5M A;  1DXM A;  4B9X A;  5J1Z A;  2IX0 A;  3DHQ A;  5C4H A;  3NUC A;  3MHB A;  4DNR B;  1J9O A;  5DEH A;  2DY8 A;  4FXK C;  1DOK A;  3EVQ A;  5FO8 B;  1WTP A;  2N88 A;  4DF7 A;  2F0P A;  5KGU A;  1SMY C;  3KBG A;  2XSC A;  2IX3 A;  2A69 C;  3T16 A;  1BCP D;  3D4R A;  3EQL C;  1EY4 A;  3OMG A;  5J39 A;  1O7L A;  3N6R A;  1D5Z C;  2XIW A;  3I91 A;  4QMG A;  4BY1 B;  3FVQ A;  1IW7 C;  4K2K A;  1MI2 A;  2RDG A;  4K5X A;  2NBF A;  4BBR B;  4QUF A;  3NHH A;  2EYO A;  2LY7 A;  2A6E D;  2IWH A;  1VF7 A;  3OSO A;  2F03 A;  2EJF C;  5IOD A;  1U4L A;  5M9O A;  3TZU A;  1II3 A;  4A3E B;  3SEB A;  1JOR A;  1B2T A;  5C4Z A;  2SOB A;  1SNO A;  4AYB B;  1JB3 A;  5DAU A;  1I4P A;  3MWY W;  1PFM A;  1GUW A;  2F0L A;  5T1I A;  4TSS A;  2IPK D;  2F0M A;  3J7A F;  4RH6 A;  1YNN C;  5CMD A;  3G6J B;  3DWP A;  3M4Y A;  2O5I C;  4XYO A;  4KMU C;  1X32 A;  2B2Y C;  3KLR A;  5JAV A;  2AQ1 B;  2M2L A;  5F2D A;  1I4R A;  4EGV A;  1LTS D;  4LJZ C;  2PYK A;  1EFI D;  3FEW X;  1BQQ T;  2C9O A;  1LTG D;  3QIA A;  2VB2 X;  3D31 A;  3K58 A;  1F77 A;  2Z8L A;  4ZAI A;  3T53 B;  3GTP B;  5C3W A;  1W6K A;  2BOS A;  1HPC A;  2PNR C;  4HTH A;  5C0X J;  3RLF A;  2KEC A;  4OL7 A;  1ENF A;  1STA A;  4J6H A;  2JA7 B;  2TMP A;  4N9T A;  5IGD A;  2D5D A;  3D4W A;  4RHS A;  2IL8 A;  3D6C A;  5EPJ A;  5CV5 A;  1OXT A;  1QNK A;  1FYC A;  5BN5 A;  4CKC A;  3TN2 A;  3G7L A;  1DD2 A;  2EY2 A;  5DM6 3;  2LKV A;  3PMF A;  2KHS A;  1BXT A;  3GTG B;  1QCB D;  1QNU A;  2J7Z A;  2MPM A;  2KCN A;  4NMZ A;  1EY6 A;  2QKI C;  2EY1 A;  4RKB A;  1WD1 A;  2SEB D;  2Q8R E;  1FNU A;  2EOT A;  4G7H C;  1QIL A;  1Z47 A;  2PCF B;  1C48 A;  4A3J B;  1EU3 A;  3QOJ A;  4OO1 I;  4ZRZ A;  2ZXR A;  4BY7 B;  2E76 C;  3K7A B;  4DXF A;  2L9H A;  5C0X G;  3S15 B;  5C0X H;  1BO0 A;  1M4V A;  2PW5 A;  4I7Z C;  5D3D A;  1GUT A;  2B39 A;  2XNA C;  2MGS A;  3NWS A;  1B9N A;  1BCP F;  5BN3 A;  1EEF D;  4KY6 A;  4KJO A;  3V96 A;  1Y8O B;  1PFB A;  1ZXT A;  4OIK A;  1ENC A;  1EOT A;  1B50 A;  1KDA A;  2WII B;  1CA6 A;  3RUZ A;  3GTQ B;  5C6A A;  1JR0 D;  2K5D A;  3NBI A;  4CJ2 C;  5IT9 E;  2JP1 A;  2VUM B;  4Y7N B;  1SNM A;  1V43 A;  5M3F B;  1TT2 A;  3LX0 A;  3PV0 A;  5IGG A;  1IYV A;  1S5B D;  2HQE A;  5CR3 A;  1YNJ D;  2AUJ D;  2LFN A;  2QDB A;  2J4X A;  5IGB A;  2H4O A;  2XWJ B;  1EY9 A;  2MHV A;  4QF4 A;  5D65 A;  2IX1 A;  1HA5 A;  2CW0 C;  2OT2 A;  2ENB A;  2A74 C;  1SYG A;  3H0G B;  3IL8 A;  5T1G A;  2K5Q A;  3RZD B;  1KLG D;  1CT1 D;  1WD0 A;  1PRT B;  2NWG A;  4FNF A;  5JJZ A;  4KHZ A;  2SDF A;  1JOK A;  2RVL A;  4I65 A;  4XT1 B;  5FO9 B;  1SNQ A;  1AP0 A;  2NVX B;  1EEI D;  1VF5 C;  3P75 A;  5A35 A;  1NUC A;  1UNS A;  1PZK D;  4RAU C;  1UEA B;  4FF4 A;  3A8K E;  4HMJ A;  1EY5 A;  3JAM E;  3Q22 A;  2EE1 A;  2F1M A;  5KYI A;  4C1N I;  4RWS C;  3SK4 A;  5C3X A;  1CZW A;  2F0N A;  1ET6 A;  4R8I A;  4HMI A;  2EJM A;  1GUO A;  4NDX A;  3BDL A;  2EYP A;  1FD7 D;  1BF4 A;  2E2H B;  3D3R A;  3Q24 A;  3O13 A;  1FNV A;  3I4M B;  3GV3 A;  1EYA A;  3MXG A;  3R2I A;  5CYU A;  1TS5 A;  1EWC A;  3NBH A;  3S1R B;  2NTT A;  4KN4 C;  2WKC A;  4F7X A;  3RD4 A;  1QG7 A;  2Z1C A;  4A3B B;  2F0D A;  1E2V A;  4XYQ A;  4KTA A;  4G7Z C;  1STH A;  1Y8P B;  5COR A;  1GHJ A;  3C2P A;  5NUC A;  1LT3 D;  4ODG A;  2DNC A;  1D2B A;  4IUV A;  2FMC A;  2B2W C;  1Z7T A;  5EJW A;  2MJ8 A;  3QB3 A;  4FXD A;  3GTL B;  1GXD C;  3MFY A;  4TRD A;  1IW7 D;  2FHT A;  3KF8 A;  5HGT A;  2YU9 B;  1JCK B;  2IW3 A;  5KND A;  3SXH A;  3W3A A;  5FOB B;  4KI0 A;  2EYJ A;  4B08 A;  1XYI A;  2H1E A;  3A7L A;  1SE4 A;  1H9S B;  4XIG S;  1TKW B;  1R4Q B;  1OO9 B;  5BN4 A;  4QB4 A;  4X3U A;  3LNN A;  3WOE A;  1PTO C;  5IT9 L;  1CK1 A;  1HXY D;  1LO5 D;  1EY8 A;  3TP6 A;  3URY A;  3A8I E;  2VXW A;  3ITP A;  3SDZ A;  3TP8 A;  4O1N A;  5I4D A;  2HDM A;  1CFM A;  2WKD A;  4PNY A;  3VR6 A;  1OXU A;  1JIC A;  1HQM C;  1EZ8 A;  4QIW B;  1SAP A;  5JPN C;  4F87 A;  4BS9 A;  2L5T A;  4C3J G;  5CV4 A;  1VMC A;  2PZU A;  2BDO A;  1PXU A;  2NZ1 D;  4A3I B;  1S4Z A;  4KKS A;  3CU7 A;  3HGB A;  3NQT A;  1A15 A;  2EYM A;  2K01 A;  4DAY A;  1PRT D;  4C3J B;  4K8I A;  1ICW A;  1E2W A;  1A3T A;  2EY5 A;  1D1K A;  3VR3 A;  1FR3 A;  4NW2 A;  3C46 A;  4BBS B;  2WB1 B;  2HCC A;  2E2D C;  2M00 A;  2E74 C;  4IUN A;  2K33 A;  3DWQ A;  1F9P A;  1V8Q A;  2XRS D;  1A3U A;  1SE3 A;  5I9P A;  2D2C C;  2JEA I;  3JAM L;  1XWE A;  4E6I A;  2RDF A;  2B2W A;  4G7O C;  5EKI A;  4CHT B;  2OF1 A;  4CJ0 B;  4HAE A;  5C4J B;  1JQY D;  2B8G A;  3LWE A;  3T51 B;  3A8J E;  4OGQ C;  3GTJ B;  4R8N A;  5E4W C;  2K28 A;  1Q90 A;  5FK9 C;  2AUK A;  3AMU A;  1EL0 A;  3BYT B;  3HOY B;  1M8A A;  4EQO A;  5FO7 B;  1DZ1 A;  4K5V A;  1F9R A;  2XN9 C;  4KHV A;  1MGS A;  5COY A;  1QB5 D;  4H44 C;  5FKA C;  2J0T D;  1WTV A;  2JSO A;  1SBB B;  2A68 C;  2NVY B;  3EFX D;  4ID6 A;  2C5C A;  2X6L A;  2B2V C;  3H3V C;  3OHX C;  4RA8 A;  4Q0F A;  1I6H B;  3X3M A;  3BVZ A;  3OW7 A;  1SYB A;  4ZYS A;  2BDN A;  4Z9C B;  3KUP A;  5KRU A;  3ONA B;  2K03 A;  1A2U A;  3MXU A;  2RBM A;  3HKZ B;  5AFW A;  1V1P A;  1SDF A;  1LAC A;  3VA7 A;  1E2Z A;  3H6M A;  3IFT A;  2PO4 A;  2FJ2 A;  4G4K A;  1L0X B;  1TS4 A;  1AZQ A;  1Y1V B;  1PZJ D;  4QCL A;  3F2U A;  2RKS A;  3CKI B;  2SNM A;  1ZYR D;  2A6H D;  1GUS A;  1ROD A;  2PPB C;  2B2T C;  1JOQ A;  1HCZ A;  1SYC A;  4PV1 C;  4M1U B;  4OHJ A;  1Z6H A;  4J1M A;  5M5Y B;  3S9W A;  3K59 A;  1F2Y A;  1TY0 A;  3EA6 A;  5JEA H;  2F0E A;  3HRZ C;  1IL8 A;  3M3Y B;  1HQR D;  2RA4 A;  3L9A X;  3Q23 A;  5KYL A;  1AZP A;  1NSN S;  2RSO A;  1QWY A;  1SSO A;  3MA2 B;  1ILQ A;  3WOF A;  1CTM A;  5M3M B;  2B63 B;  1JWM D;  5G3L F;  4DA2 A;  1O7Y A;  2RDH A;  3MXN A;  3TSS A;  4EQN A;  5K36 G;  4LK1 C;  5K36 H;  4J8Q A;  1R9T B;  2O4X A;  3VR5 A;  4FO2 A;  2K1B A;  3NPP A;  1A3V A;  1VMP A;  3MEH A;  1J8I A;  3GQB A;  4WRD A;  1EIH A;  4IFD J;  2CHB D;  3SK5 A;  5D14 A;  2AQ2 B;  1KAA A;  4XQJ A;  1EZ6 A;  1Q12 A;  4ILW A;  3K5L A;  2WAQ B;  1O78 A;  2EY6 A;  2PZT A;  3TBI B;  1QJO A;  2KVM A;  4IUQ A;  4DU9 A;  1Y69 U;  2B2V A;  2GA4 B;  1OXX K;  2F0T A;  5EGT A;  4HN7 A;  4BA1 I;  1RTO A;  1Q3L A;  1F2Z A;  5KIX A;  3W2D A;  3NP8 A;  1G8Z D;  2F0K A;  2PMZ B;  3I4N B;  1BCP C;  1ESR A;  4YIJ A;  2I07 B;  3M7N A;  3AU7 A;  1IKM A;  3NWT A;  2JA8 B;  3PIO 3;  2RSN A;  4FVM A;  4ZK9 B;  1HFG A;  4IQZ A;  3PIP 3;  3LWU A;  2TSS A;  3IAY A;  4WFN 3;  2R92 B;  1NAP A;  2A6E C;  1WTW A;  1Q1E A;  3QG1 A;  3BDO A;  1PZI D;  3NK9 A;  3E6Z X;  3MAQ A;  1D1I A;  3QWN A;  4JBW A;  2B2T A;  4TKO B;  2F0Q A;  3VR4 A;  3CQZ B;  3K5O A;  1B1Z A;  5JVG 3;  4IFD G;  2X6G A;  4IFD H;  2L11 A;  3GTO B;  1KLU D;  1EWH A;  4ULL A;  1SND A;  3BVM A;  2EDG A;  5C0X I;  4EVO A;  3KLS A;  1STE A;  3ZYY X;  1MSH A;  1GOZ A;  3AB9 A;  3J81 L;  3KLS X;  1TII D;  2L12 A;  3BS1 A;  5IOC A;  2KOL A;  4F88 A;  1EYC A;  2JYO A;  1PFN A;  4ABN A;  1E0B A;  4FYD A;  5C5L A;  3HOU B;  4X3K A;  2A73 B;  3M7G A;  1S5D D;  1O7Z A;  1EQV A;  3D6W A;  5IIF A;  3I90 A;  5EKL A;  1STY A;  1TY2 A;  2RQX A;  3RMH A;  3P20 A;  3OWE B;  5KNC A;  4RFB A;  1X3Q A;  1JWS D;  4H7B A;  2EYF A;  2WAC A;  4ZKC B;  2ZXO A;  1CM9 A;  5KEE A;  3FPP A;  1FNW A;  3J7A V;  1TWG B;  3Q6S A;  3C1F A;  5EBC A;  2KEE A;  4QUC A;  3FPU B;  1B4O A;  1H9M A;  1RTN A;  5ELC A;  2KCC A;  3GTK B;  3HG9 A;  1T5X D;  4MN3 A;  2F4I A;  3M4O B;  2OEO A;  4XT3 B;  3OWF A;  2K5W A;  2NN6 G;  2NN6 H;  1SE2 A;  1UAP A;  3ND9 A;  1ONL A;  3R93 A;  1AN8 A;  2CQA A;  3QJY A;  2VNU D;  1ZEQ X;  5EPK A;  3SHL A;  3R2T A;  3VA5 A;  3NE5 B;  3V2T A;  4RKL A;  2K7V A;  4RGN A;  2F0S A;  5ELB A;  1ZKO A;  3NTH A;  1AFP A;  2NVQ B;  2FMM A;  1DON A;  1SMY D;  4IUT A;  3FMC A;  3TME A;  5ISR A;  2A69 D;  3GP7 A;  3TP7 A;  1CQF A;  5EKK A;  1IHZ A;  2MUY A;  3GO5 A;  1TWF B;  3FRP B;  3BDC A;  1SJH D;  2EVB A;  4KN7 C;  4FF1 A;  1ILP A;  3C1E A;  1EYD A;  1XXG A;  3PUV A;  3HOZ B;  1K83 B;  2F0U A;  1MBY A;  4K8J A;  1NCV A;  2KJX A;  3L3O C;  3EJI A;  1SYE A;  1KDC A;  1TVX A;  1ENA A;  1LAB A;  5C5M A;  3BZD B;  2Q8I B;  3HOX B;  2R6G A;  2ID0 A;  2EYH A;  1JC7 A;  1S5C D;  2AWO A;  2Z4H A;  4C56 C;  1L0Y B;  5IGE A;  1YNJ C;  2KUM A;  1HUM A;  3HZX A;  2PW7 A;  1UUP A;  3I4L A;  1F2L A;  5CV6 A;  5A2Q L;  1HHV A;  2BA1 A;  2L55 A;  2E2J B;  1YNN D;  4XQN A;  5M5X B;  4CKB A;  2Q8T A;  2XRQ D;  3MTS A;  2VB3 X;  3SVM A;  1XX8 A;  5LL6 X;  4K6D A;  5TSS A;  4ZUJ A;  1S5F D;  3VR2 A;  1HRJ A;  1I3Q B;  1LTT D;  2WP8 J;  3I73 A;  4XQQ A;  3PO2 B;  4CJ1 B;  3T56 B;  3OOC A;  1KTK A;  3ERO A;  4DNT B;  3N52 A;  2D62 A;  1F9S A;  4XDX A;  2M9V A;  4KY7 A;  1F9Q A;  1B9M A;  4F8M A;  2QCP X;  2QIL A;  1R4P B;  3NTK A;  3T13 A;  1BOS A;  2V4D A;  2NTS A;  3U9O A;  3PUW A;  4L6T B;  1EY0 A;  3I3C A;  3QOL A;  2EPB A;  3A54 A;  4DK0 A;  3S14 B;  2F0O A;  4HSV A;  4H13 C;  3A55 A;  5CV9 A;  3HS0 C;  1B53 A;  1QOH A;  1I50 B;  4FP5 D;  1K8O A;  3OPO A;  5I6W A;  1PMR A;  5LL6 S;  1U4R A;  4Q5V A;  2JEB I;  2JA6 B;  4KJN A;  1EIG A;  1NR2 A;  4UAI A;  2EZV A;  3ERQ A;  1BNZ A;  1OXV A;  3HOW B;  4A93 B;  3I70 A;  4A3D B;  2JE6 I;  4KKU A;  1TWH B;  4WJW A;  2NVT B;  5KNB A;  5CV7 A;  3TZD A;  4WOR A;  2PQE A;  1PTO H;  3DEO A;  1SEB D;  3HP3 A;  3CRK C;  1ML0 D;  2BE5 C;  5JOB A;  1WVL A;  4KY5 A;  5JEA J;  1RF2 D;  4IUP A;  1Q8I A;  3K0Y A;  5I2Y A;  1VDZ A;  4X3T A;  3J81 E;  1IYU A;  1PTO B;  2E2I B;  2O2L D;  4HR7 B;  5I2X A;  1H9R A;  2K32 A;  3T4A C;  1SYF A;  3V05 A;  1LT6 D;  1EY7 A;  1EU4 A;  5M5W B;  3CRL C;  1SFO B;  3VYS A;  3MXP A;  1LTB D;  1V1P B;  1B44 D;  4CKE A;  1STB A;  3OIQ A;  1RD9 D;  4C3H G;  4FF3 A;  5JPM C;  4ZKB B;  4P2C B;  4RGO S;  3TP5 A;  4N9P A;  4DAP A;  3VYT A;  5I9O A;  2CW0 D;  3K6O A;  4S3S A;  1PDQ A;  4FXG C;  3U9S A;  1I6V C;  4OIJ A;  2K04 A;  1AEX A;  1JE4 A;  5HUR A;  4BWG B;  1DOM A;  3S17 B;  5IGC A;  2EJG C;  4C3H B;  2KED A;  4FF2 A;  1GJX A;  1PYW D;  2R3Z A;  5JEA G;  1LTI D;  4TQU S;  1D5X C;  2L4N A;  4OO1 G;  4OO1 H;  2F0H A;  5J22 A;  2F3W A;  4K5W A;  1T5E A;  1X3P A;  1ET9 A;  1JOO A;  1SNC A;  5E4X A;  2F0J A;  2ICI A;  4LMQ D;  5EBD A;  4RCO A;  1GUG A;  1PRT C;  4CBV A;  1NR4 A;  2DNE A;  2OXP A;  2EXZ A;  2XVS A;  1DYQ A;  2X69 A;  5CC4 A;  4V19 0;  3E5S A;  1RKN A;  1PRT F;  3PUY A;  4CGY B;  2HCI A;  3DM1 A;  2AQ3 B;  3D4D A;  1PLF A;  1STG A;  2R93 B;  3BVG A;  1I4H A;  2BA0 A;  1LTR D;  4XTC S;  3MFG A;  5FLX L;  3VYR A;  3Q0A A;  1DJR D;  3DEP A;  3GV6 A;  1TU2 B;  2AWN A;  1U4P A;  1G2T A;  1AW7 A;  3A7A B;  3BG3 A;  1H9K A;  2Z4I A;  3P1H A;  2NUC A;  3DXJ C;  5I6Y A;  1BR9 A;  3MVV A;  3K57 A;  1CHP D;  4ZLT F;  1G2S A;  4A3K B;  2CVR A;  5EPL A;  2K6A A;  1A6X A;  1HTP A;  4KD3 A;  2QF7 A;  1Y1W B;  1TS2 A;  2ICE C;  3KBX A;  2I46 A;  2F0V A;  3X3N A;  3TDQ A;  3GD7 A;  1D5M C;  5CBA E;  5A2Q E;  2ZXP A;  1SNP A;  2B8F A;  4KD4 A;  5D3I B;  2LS0 1;  4RGM A;  2JXM B;  1SYD A;  3E0J A;  4PMW A;  3S16 B;  3OMC A;  3H09 A;  4LAA A;  1WCM B;  2B2Y A;  4KK7 A;  1TWA B;  4NKL A;  2HDL A;  1VCI A;  1BDO A;  2E75 C;  1SJE D;  3MZ5 A;  1WTO A;  1DCZ A;  3NSW A;  1G29 1;  5E1F A;  4A3M B;  2L1B A;  1RCV D;  3SK6 A;  2KA7 A;  3KK7 A;  2YYZ A;  4K2L A;  1PTO D;  3DWA A;  1ZYR C;  2A6H C;  2B2U C;  3J80 E;  4X3S A;  4R9W A;  2XWB B;  1XTC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...