5DM73

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dm7300
3PIP3 5DM73 4U673 5JVH3 3PIO3 5JVG3 5DM63 4WFN3
chains in the Genus database with same CATH superfamily
4XIGS 1W6JA 2CW0C 4G7HC 2JA8H 3KK7A 4K5WA 3GV3A 4DGZA 4B3SQ 4POGA 1YBYA 4A3EH 3VYUA 4XDXA 4QMGA 1CSPA 1TR5A 1EY0A 4DR7Q 3A74A 4JBKA 3F2BA 1JOOA 2A74C 3J81j 4B3TQ 1GUOA 2R7FA 3KLWA 5I2YA 2EXZA 1T5XD 1YIJA 2B2TA 3SK5A 1JORA 1STAA 2N49A 3Q24A 4KI0A 2F0JA 1NSNS 3D0FA 4RMFA 3PO3G 5IYDH 4BBRB 2JA7B 1I4RA 2EYOA 1F9QA 3SHLA 1D1KA 2VQEQ 1D6EC 4DR6Q 5EKIA 3T13A 5ELEA 2L0CA 1VCIA 3M4OH 4C3HG 3S24A 2IW3A 4IUUA 3P75A 5DEHA 1N8RC 1PMRA 2EYJA 3AYHB 2ALYB 4I7AA 5ELCA 4DU9A 3GTLH 1MIUA 4QF4A 1WTXA 2Z6KC 2R6GA 2KA7A 5G3LD 4YHHQ 5JJLA 4QIWB 3AFPA 3OIQA 4GKKL 4IQZA 2L5TA 3UDIA 2F0VA 4YCWA 1JE4A 3W1BA 5CV4A 4C56C 4B9XA 4PZ6A 1QOHA 1JB3A 3CQZH 1KNAA 3EBEA 2PYKA 3UDFA 1S5DD 2B3GA 2OT2A 2JEAI 1Y8OB 2I46A 4H13C 2NVXB 2XN9C 2Q8TA 1DD2A 1X32A 3A7AB 1DCZA 2D9UA 3S1MB 3J81E 1BQQT 3FMCA 3TZDA 3NELA 4K0KL 3GTGB 5IP7H 5M5YB 3I4MG 2OQKA 4ILWA 4IUVA 1NR4A 3NQIA 3D4RA 2JP1A 2UUBQ 2NB0A 4LUVA 1D8LA 2JA6G 1HHVA 1WFQA 1TVXA 1QCBD 3MXGA 1TWFB 1G91A 2UUAQ 1YEZA 5EGTA 1KTKA 5E4WC 4YWMA 5IIFA 3E9HA 4BS9A 2FINB 2MHVA 5IGGA 4LF8Q 2RHQB 5I6WA 4DK6C 1E24A 5KYIA 3G6JB 2MQHA 1PLFA 1KDAA 5ELBA 4GKJQ 3DEPA 5ELDA 4TVAB 1VQ4A 1V8QA 3WOEA 3URYA 1EQRA 4DR3L 1ZKOA 3SK4A 1GVPA 4ZAIA 4C2MB 1CKNB 4K6LA 1TWAB 3H0GH 2NVQH 1BVSA 3HKZB 4OEMB 3S2DH 3UDGA 3CCEA 1NMGA 1WCMH 4BBRG 1I3QH 3H15A 2JA7G 3MXPA 2B2UA 4NB3A 4CDEC 1SNDA 1ILQA 2RBMA 2LS01 4JI2L 1OXXK 3OOCA 5J3BA 4HIMA 2VY3A 4M1UB 2JEBI 4DAYB 2ZJRA 1VQLA 2F0QA 1ZXTA 1U5KA 3HOUB 3T56B 1QUQA 3W3AA 4FP5D 1YHAA 2F0UA 4TRDA 5I9PA 1WTOA 3ND8A 1SXTA 1IL2A 2PMZB 1PRTC 1A62A 2K14A 5FLXL 5KGUA 1BO0A 1EZ6A 3S14H 4DNIA 1VQDA 2B2VA 2EJGC 5EPKA 1Y69U 2DJGC 4OIJA 2SOBA 3ZYYX 1JE5A 2K03A 4K8IA 2SDFA 1N34L 1A2UA 5ELOA 4DV4Q 1B3QA 1A8VA 1V1QA 4F88A 3K5MA 1ESFA 4WJWA 1FVIA 1HPCA 3G6EA 2XWJB 4OWTB 1A3VA 4HMIA 5FJ8H 3T1HQ 3WWVA 1MBYA 2B29A 2RSNA 2F0MA 3NTHA 1XNRL 2Q2UA 2HQEA 2PI2A 4FDBA 1HR0W 1L1OB 5M5WB 3KF6A 1LTGD 1DONA 2NZ1D 2JQOA 1FYCA 4Q5VA 3K57A 3TZUA 2E5LQ 4JI8L 1QZHA 2JXMB 1ML0D 4DK0A 5HURA 4X6AH 1R4PB 4U68A 1VQIA 2L15A 3CCVA 3TRZA 1EY9A 2KHSA 4CJ2C 3M3YH 3S1QB 3NTIA 2KEDA 3J7YW 2NN6I 4R4TA 1EY7A 2A69C 1BXTA 5GAEC 1GUGA 4OWXB 1SMYD 2ENBA 2P5ZX 2G9HD 1HTPA 1CA6A 4OX9L 4CKEA 3UE1A 3GO5A 4BWGB 2KECA 3Q22A 1A2TA 5M3FH 1XXGA 1EY6A 2RHSB 2Y0SB 3K5OA 1EIYB 4JV5Q 2MFIA 1C0AA 2CQAA 2CKZB 2HDMA 3A5UA 5M5XH 2F4IA 3CRLC 3H3VC 4EQOA 4A3CG 4IN3A 4PQXA 1NJIC 4L6TB 1XNQL 4RCOA 3GTPB 2NN6H 1J5EQ 1EIHA 3VYTA 1TWCB 2KCTA 5C3EH 3MFYA 4KKTA 2KUMA 1EYCA 5GROA 4B3SL 3J80L 3FKIH 3PSIA 1HUNA 1IW7D 2QCPX 5D65A 4DR7L 1HQMC 4A3GB 2F1MA 2YU9H 2PPBC 4LF4Q 4OWWB 3U50C 4B3TL 1FNWA 2Z4IA 2QDBA 1TT2A 3HOUG 3M4OB 1HZBA 4LFAL 3J80i 1KAWA 1PTOD 4K6DA 3L9AX 2F52A 4JI7L 1RCVD 3QR8A 1BCPF 2IHFA 3QWNA 5KYLA 1BBUA 1Y8PB 4XYOA 4X66L 3T51B 3N6RA 5LHY1 1XYIA 3C1EA 4O42A 1PTOF 5KEEA 1G6PA 4KKUA 4OELB 1N32L 4RAUC 4GOPC 4DUZQ 4DK3C 4DR4Q 4PZ7A 3BDCA 1SE8A 5LMUQ 4L5RC 1YZ6A 3BJUA 3A0JA 2PNHA 4BA1I 5D14A 2XIWA 1BBWA 4KY6A 4P2CB 3FPUB 1I4PA 2N78A 1GM5A 1DZ1A 4A76A 1BUVT 1WTPA 5IGCA 5BR8L 5C0XI 4YHHL 3M4QA 2I07B 1HH2P 4RGOS 4CDDC 1PXUA 1K28A 1XMQL 3HKSA 3UDXA 5IT9c 3OHXC 4H0LC 4DAMA 2LXKA 3LX0A 1XPOA 2EDGA 5EBCA 4P73A 3DWPA 4HCSA 1HNZQ 1C48A 2CHBD 1Q86C 1NNXA 4PG3A 1IYUA 1VQNA 1LT5D 2D0PA 1SYBA 1I50H 3MA2B 2V4DA 4DR5Q 1IBMQ 5C0XH 1X56A 4ODGA 4A4IA 1LYLA 3IFTA 3EFXD 3PO2B 3TP5A 3RR5A 1WTWA 1B4OA 2H1EA 2Y0SG 3K8AA 1SAPA 2HHHL 1Y1VH 4GLXA 2F0HA 2JA5B 3MFGA 3MHBA 5AJ3Q 3WDNA 1L0XB 2IX3A 3JAML 1HFGA 1AE2A 1ET6A 3H0GB 3SEBA 2NVQB 1G2SA 1VDZA 3EN2A 2F03A 3S2DB 5KRUA 1EQQA 4LF8L 2NVYH 4IJLA 1IL8A 3NPPA 1A3UA 1PTOH 1CQVA 3GTJH 2VUMB 4KHZA 1XMOL 3IAYA 2NYZD 4GN4B 2K5QA 3JAMi 4A3GG 1LO5D 4ID6A 4LF6Q 3S15H 4EGVA 1GXDC 1S5CD 3EA6A 5IGBA 2GVAA 1TWGH 3H09A 3T1YL 2N3SA 3OMGA 5FK9C 1YJWA 1LM0A 3H6MA 1NCVA 2D5DA 4LF9L 1FL0A 5IYCG 4FXDA 2A68D 1RODA 2DUDA 5JOBA 5GADC 4X62Q 3RLFA 3MZ5A 1FD7D 1JJ2A 3T16A 2BOSA 3FPPA 5JJZA 2M9VA 3H94A 3K80C 4H7BA 1GD7A 4UDUC 3M7GA 5COYA 2QF7A 3WOFA 1AN8A 4F87A 4AQYQ 1JQYD 2K5DA 3VR3A 5JEAH 1EIFA 3S9WA 1PFNA 2DN8A 3PQIA 3K0YA 3KBGA 3HOYB 1KXLA 1K83B 2RDHA 4HTHA 3HOXB 2PQAB 3FRPB 4MIUA 4X64Q 4KHVA 4JI3Q 1KABA 3CPFA 1Q46A 1A3TA 1GO3E 4RGNA 3HKZE 3VA7A 3PUXA 4AYBB 1PRTF 5C6AA 2ZJPA 5TSSA 2ZM6Q 1NTGA 1GOZA 1KL9A 1XX8A 2Q8RE 1YNJC 3I4NH 3D6WA 3CCLA 2F0EA 2WB1B 4IURA 1SFOH 4EQNA 3PUYA 4R4CA 1SR3A 1HNWQ 1E22A 3T1HL 4DR2Q 4UAIA 1PA6A 1F2LA 3KUPA 3NE5B 3S17H 1J6QA 2A19A 2WP8J 3L3OC 3JC66 3PO2G 3ERSX 5FLXE 4BY1H 4A3IB 2R92H 2NWGA 1VQEA 2K01A 4GS3A 4NXML 1H95A 3PUVA 2NZHA 2JA5G 5C0XJ 3ND9A 5IE8A 3GQBA 2KCCA 3K7UC 1G8ZD 1EFWA 2MP1A 2D62A 4R4QA 2PZWA 2RDGA 2RF4A 3H0GG 4P71A 1TS4A 2A1AA 3A8JE 4NXNL 4HN7A 4X65Q 2QDLA 2Z1CA 2VUMG 4JI4Q 3RMHA 4BXXH 2FJ2A 5C3EB 1OXSC 1MJEA 1PH5A 1V1PB 1RJTA 3FKIB 1I94L 1B53A 1V43A 1B3AA 3BVMA 4R8NA 3FDTA 1PHJA 1QB5D 4KN7C 4A3FB 4ZKCB 3OYYA 1R9TH 2A6EC 2F4VL 3DHQA 3MTSA 3I8ZA 5IP9G 4JI5Q 3PF4A 3S2HB 1RKNA 5CV8A 4V190 1VF7A 4A3MH 4MZ9A 4IO9A 2AQ3B 5NUCA 2ZTEA 2RVLA 1WTRA 4JI0Q 1MGSA 4CGYB 2UU9Q 1OO9B 1GHJA 1SMYC 3DWQA 2KCMA 2L1BA 2E75C 1CKOA 2WAQB 4JOIC 3C46A 3GTKH 1Q90A 2K1BA 1MSGA 3BZDB 1EOTA 3HOYG 1IHZA 2A6HC 1STGA 2E2DC 2R7DA 3CPWA 4RKLA 3K6OA 4LFCQ 1ILPA 1X65A 3HOXG 1DM0B 3HG9A 4JOIA 1JJCB 1Q12A 5IWAQ 5C44B 1F9SA 3KJPA 2L9HA 3SE0A 2RSOA 4HJ9A 2UUCQ 4FYDA 2JA9A 1UEAB 1EFID 1Y8NB 4U673 2K7VA 2ZXOA 3KOJA 5JEAJ 4UY8C 1DOKA 4QGUA 3GTMH 1NBWA 2DGYA 2G9DA 4A3KB 2XTIA 2GVBA 3EVQA 4IFDI 4JI1Q 4AYBG 3EQLC 1IKMA 1Y1WB 4OL7A 5CR3A 1UE6A 1IW7C 3J80E 2IT1A 5FLMG 1X9NA 2WB1G 3KLSX 2EYMA 1LT4D 4IUNA 4XQNA 3I4LA 4DKAC 2XVSA 1KC8C 4XYQA 3NP8A 2AUKA 3K81C 1JCKB 2BE5D 3H3VI 4LF7L 2QW7A 4KKSA 4LF5L 4A3IG 1PVOA 4IFDH 4LWCA 4XQQA 3RLOA 3RZDB 3QOLA 5I2XA 1P16A 3TSSA 3CRKC 3R3OA 1Y1VB 4EX5A 1AH9A 3BDLA 3G4SA 1HNZL 1U4MA 2BH2A 2IWHA 1SYGA 2Z6KA 1SLJA 3MXNA 4FNFA 3IRBA 2K5WA 3I3CA 4GNXB 4C1NK 4AH6A 5BN4A 2A5HA 3H3VH 1IBML 4L5SA 3DM1A 2NVYB 3SK8A 1PH2A 5C3EG 1PTOB 3GTJB 4BBSH 3MWYW 2B63H 1HJPA 1PFBA 2I5MX 3FKIG 3KDFB 1D5ZC 3NEMA 1H9SB 1K0RA 1TQOA 3T53B 4DFAA 5LMNQ 4GLVB 4A3FG 5CYUA 1SBBB 3NK9A 1U0LA 2WIIB 5AJ3L 2UXDQ 1VQ7A 2OTJA 1WJJA 1B50A 1PH4A 4R4IA 4FF3A 1EWIA 2F0IA 3CC4A 3GV6A 1KD1C 4O0AA 5JPNC 1JICA 3ONAB 3U9OA 1LABA 5FOBB 2EE1A 2IX0A 1IBKQ 1CKNA 1X3PA 2WAQG 1WYDA 1VS0A 4A3JH 2HIVA 1S5BD 1EUJA 4IPCA 5CV7A 1TKWB 1HTLD 1E1OA 3A7LA 3OMCA 3TP8A 3S16H 5C44G 5GAHC 4DXFA 2KJXA 1IBLQ 3STBD 2LKVA 3JAME 2AHOB 2E2IB 2NBFA 4A3LH 4R9WA 4A3KG 1CSQA 3VR6A 4LFBL 4GN3B 2O5JC 1PV4A 3E0JA 1Y1WG 4JYAL 1ONLA 5A2QE 2N88A 3K0XA 4JVZA 3I55A 5J39A 4QQBX 4A93B 3QIAA 1CHQD 5EKLA 2R93H 3CAMA 4M8AA 3I4NB 3HP3A 2J0TD 1CQFA 5GQOA 2IHEA 2AWOA 3NBHB 1VQCA 4KJOA 5C4JB 3K5NA 4X3SA 1G2TA 3SR1A 1SROA 4KHPQ 4YIJA 3IKJA 1A15A 2F0FA 1EIGA 1RDPD 4GZYC 5CMDA 2ZXRA 2RQXA 2CQOA 3HOVB 1ESRA 1OXUA 1Y14B 5KNBA 5E3FA 1NR2A 4FXGC 3GDEA 4WFN3 3GTOH 4C3IB 5C4XH 3AFQA 4HSVA 3C2PA 2RA4A 1H9RA 5I6YA 1LLRD 4BY1B 1F9RA 2K52A 1L1OC 2FFKB 2R61A 1AEXA 1Y1VG 2WACA 4DV6Q 5CC4A 2K4KA 3BYYB 3ZJYC 4B3ML 2NVTH 1L1OA 2EVBA 4IFDJ 4HCEA 2K5VA 2EY1A 1TU2B 3HOWB 2CWPA 1WTQA 4G57A 4UHVA 4FXKC 3M9BA 3ER0A 2A73B 3VA5A 4ZKBB 1STBA 1EWCA 2LSSA 4PMCA 4HJ7A 1PYSB 2QA4A 3OTOQ 2UXBQ 2Z0SA 1YJ9A 4ME3A 1F2YA 3D31A 3NENA 4Y7NB 1E2WA 1JWSD 2XNAC 2VQFQ 1Q8KA 4B3RL 2EYFA 2PW5A 4KTAA 1FJGQ 5FO9B 1QUQB 1PH1A 4JI6Q 3G48A 5J1ZA 1C4QA 1SJED 4B9WA 2Q2TA 1PFSA 1N33L 4BY7H 1JJGA 2OWOA 4OO1G 1QILA 4DNTB 4JI4L 5I9OA 1EYDA 3O13A 4DV2L 4DV5Q 1HNXQ 1WTHA 1F9PA 3F1ZA 5T1GA 3OPOA 3G7LA 1PZJD 3M85A 1O7IA 2H5XA 5JJIA 5IT9L 4RHRA 1Z47A 3PO3H 1SEBD 2JA8B 1EYAA 4DV3Q 2FHTA 1HCZA 4DPGA 4A3EB 4DN4M 3PIOA 2IL8A 3KF8B 3NSWA 4LUZA 1KDCA 2I5LX 3CC7A 1CM9A 1NMFA 3QOJA 1ICFB 1YNND 3NXWA 1C7YA 3I7FA 1FGBD 4C3HH 3SVMA 5C5LA 4YY3Q 2LXJA 4A93G 5EBDA 1PH6A 4H44C 4HR7B 1JWUD 1WD1A 1EU3A 2K04A 3VDYA 3LWEA 3I4NG 1AZPA 1H9MA 3E5SA 3A55A 2DNEA 1LV9A 4K2KA 1VQPA 1I6HH 3Q6SA 1M8AA 2DY8A 1N36Q 3HOVG 1BCPD 2KVMA 1EYGA 1UEBA 2PZTA 3P20A 2BA0A 2TSSA 4C3IG 4ZCKA 2SNMA 2EY2A 4BY1G 4JI1L 5IY0A 1K0SA 3GTLB 3K58A 3CP0A 1UNSA 1F2ZA 4L5QA 4LJZC 4DV1Q 3OWFA 3E6ZX 4HJAA 2L12A 2VQEL 4JK1C 1IXRA 4K5VA 4DR6L 2QKIC 1I5FA 1RF2D 4KMUC 1KIXA 1BDOA 1D7QA 2KEEA 3HZXA 1VQ8A 5IYBH 3HOWG 1VQFA 2MJ8A 2ATWA 3CQZB 4R4OA 3CD6A 1PFMA 3H91A 4R8IA 2EYLA 1EEID 1GJXA 1CI3M 4GOPA 5EAYA 4BBSB 4ME5A 2B63B 5DM73 3S1RH 1HRJA 3X3MA 4Y52H 3N52A 3NWTA 3J7AV 1CFMA 4J6HA 1TIID 4YCVA 2HCIA 3VR5A 3R93A 1ET9A 4MN3A 1B8AA 2PW7A 3J7ZC 1V9PA 3K7AH 1Z9FA 1PH7A 2HD3A 4E6IA 4X3TA 4YWLA 2X6GA 1CT1D 4JW0A 2BA1A 2TMPA 2CVRA 1S40A 2ZTCA 4KJNA 2I0QA 3HGBA 1W2BA 1E0BA 3BVGA 4ZUJA 1C8CA 4R1JA 2O2LD 2N55A 5LMNL 1PZID 2OF1A 2F0TA 4DR1Q 4WJ4A 1MSHA 1QJOA 2VB2X 5EPLA 2JA8G 1R4QB 1QNUA 1O7ZA 1VQAA 2LY7A 2UXDL 4HIDA 4A3EG 4GKKQ 3NWSA 3QB3A 2UUBL 4QIWE 3PIPA 1Q3LA 2ZT9C 1GUSA 2B39A 2LMCB 2FMMA 1YNXA 2UUAL 2F0WA 1SNPA 2IY5B 1K8GA 3Q0AA 1OXVA 1X3GA 1CUKA 1I3QB 1WCMB 5IYDG 5E1FA 5A2QL 1WTVA 4K0KQ 4UP7A 5J22A 2AMCB 3PMFA 3PGZA 4GKJL 3LWUA 2R7ZH 2C5CA 2Q2HA 2Z9HA 3NUCA 5FO8B 2VXWA 1DOMA 1Q1BA 3KLSA 1GUWA 5JVG3 1E1TA 1QWYA 1W6KA 2NVXH 2NTTA 1NUCA 4XT3B 3S1MH 3TN2A 3HOZH 1Q8IA 3GD7A 2ID0A 2F3IA 3S14B 3GTGH 5M5YH 3Q8DA 4CKBA 4OONA 5E4XA 3BZCA 1L0WA 2F3VA 4RA8A 4YCUA 3K5LA 1D5MC 2DNCA 1PDQA 1X55A 2YYZA 4FF2A 1M90C 4BA2I 4IJHA 3CXCA 4KN4C 4DR3Q 2V1CC 3KJOA 2VL6A 1TWFH 5BN5A 3FVQA 1O7YA 4BBSG 4ZRZA 2B63G 2QEJC 2QILA 3DM3A 2OXPA 2F0DA 4F8MA 1PRTD 1XJVA 1S5ED 4ZYSA 3MEFA 2JYOA 2CCZA 5IP7G 3TP7A 1EQVA 5K36H 1DOLA 2F0KA 1MI2A 1EL0A 3J81c 4LK1C 5C3WA 4JI2Q 1SYDA 4CJ1B 1RD9D 2O5IC 5EJWA 5A35A 3CMAA 4DV4L 1SNOA 4BY7B 1E3PA 1NAPA 5C4ZA 3CU7A 4LUOA 2X69A 2XWBB 3QG1A 4JPBW 2HDLA 3BS1A 2DY7A 1E7ZA 4C2MH 4MTKA 4A3CH 3M3YB 1PH9A 4C1NI 3A5ZB 2R3ZA 2WINB 1SNCA 3D3RA 1ENFA 4GLAC 1Q1EA 1TS2A 1QZGA 5LL6S 2PMZE 3IL8A 3CCMA 3A8IE 4N9TA 2E5LL 1VQMA 3I4OA 5M3FB 1KLGD 2KHIA 1ZEQX 1GKHA 4WJ3M 2BDOA 1N34Q 3MC0B 3C3LA 1DJRD 4G7ZC 3OSOA 3PUWA 5M5XB 3HOUH 2OEOA 3TDQA 4DV0Q 2E2JH 1BBXC 3CKIB 1WCMG 1EQTA 3OWEB 1K3BC 4N8X1 2A69D 3KYHC 4A3BH 4V0BA 3ULJA 1XNRQ 5H1SE 1LTAD 2MNAA 5HGQA 1ENCA 2KCNA 1QVFA 3CCJA 3NBIA 2VNUD 3U4VA 4XQJA 3TP6A 4JV5L 4TKOB 2YU9B 1DXMA 3OIPA 4JI8Q 4KK7A 3HRZC 3SDZA 3I72A 5M3MH 1I4HA 2CFMA 1BKBA 2B2WC 2LFNA 2B2YC 3MXUA 4RCNA 1F2MA 1LT6D 4O1NA 2FXQA 3RLNA 4NDXA 1U4RA 1WOCA 1TXYA 4S3SA 4RWSC 1J5EL 3I90A 4RKBA 5CORA 1LT3D 4PNYA 2KENA 1X3QA 3ICEA 3D4WA 5M5WH 5IT9E 3E0EA 1B44D 1F77A 3CCSA 2WV6D 2OTLA 4LF4L 1V1OA 2YTYA 4JG2A 4ZLTF 4ZQ3A 4HAEA 1CZGA 4QL5A 1LUZA 1RIPA 3A8KE 2A8VA 2K6AA 1GHKA 1JMCA 2Y0SE 4XTCS 4QUCA 1BF4A 3J7AF 5FJ8G 3S1QH 1XNQQ 4DNRB 2ZTDA 4DV1L 4IPHA 1CKMA 4KLKA 1VQKA 1BNZA 3X3NA 4OIKA 4HSPA 3K7AB 2JJQA 4NPSA 4DUZL 1KRSA 4J8QA 4DR4L 1RL2A 3HFZB 2B2TC 5LMUL 4BY7G 2RCFA 2ZXPA 4DA2A 5T1IA 3I70A 1BCPC 1PZKD 4POFA 4GNXC 1BR9A 5LMNW 3RD4A 5EKKA 4LFAQ 1PTOC 2D2CC 3GTPH 1GUNA 1I50B 4JI7Q 4GNXA 4K5XA 1VQHA 4X66Q 1I6VC 1TWCH 2RKSA 2XRQD 1LTSD 4C3JH 2C35B 1G51A 1EWHA 2B8GA 1YHBA 3KDFA 1H9SA 1WVLA 5M3FG 1VMPA 4A3GH 1UE7A 1N32Q 2YTXA 4WORA 5IGDA 2MO0A 4I65A 4CHTB 2QEXA 3CCUA 5BN3A 4EVOA 4P72A 1X3FA 1SYCA 4NP5A 1UE1A 3B6YA 1RTOA 3W5OA 5IYCH 1BCPB 2NN6G 3NTKA 4DF7A 3CF5A 4I7ZC 1L0YB 2L11A 4DR1L 4DR5L 3BZKA 2HIXA 4J1MA 1TS3A 4FF1A 5AFWA 4IUQA 1ZYRD 2MGSA 4J15A 3I56A 5BR8Q 2VB3X 4KD3A 2VZAA 2EY6A 1L2FA 2PO4A 2OQ0A 2K75A 4KY7A 3S15B 2R7ZB 3M4PA 4Q0FA 3DEOA 3D8GA 1XMQQ 3TQYA 3A56A 1ICWA 1TWGB 4KV6A 5G3LF 2HT1A 4K8JA 4RGMA 3GTQH 3E3XA 3FEWX 2PNRC 2EIFA 1HUMA 1SE4A 1SDFA 4PV1C 3PUZA 4MNOA 3HOZB 1P8LA 2UXCQ 3F8TA 1B1ZA 1IYJB 2KHJA 1HA5A 5C4HA 4LF6L 1B2TA 1E2ZA 5JAVA 5KIXA 3MXNB 5IYBG 1AFPA 3U58A 3V05A 1XTDA 3RNUA 2HHHQ 1D2BA 4QB4A 5IODA 2K28A 3NBHA 1HZ9A 1S5FD 4X62L 4JBJA 4DAYA 3HEJA 4L63B 2KOLA 3TBIB 1M4VA 1KLUD 5ELFA 4DV7Q 1S4ZA 2PQEA 3PO2H 1PYWD 1H9JA 2BCOA 1XMOQ 1YHQA 4RH6A 2AWNA 2MUYA 2L4NA 3NQTA 1STYA 2EPBA 4EQ5A 4AQYL 1JR0D 2JA5H 5LL6X 1SFOB 1MKHA 4NW2A 2OCEA 3GP7A 4LW1A 3T1YQ 4G7OC 3TREA 2F0NA 4QJFA 3R2TA 2B2UC 3VYSA 1K8AC 4LF9Q 4X64L 3BU2A 2EJFC 2A68C 4JI3L 3AB9A 3S17B 2K32A 4GN5A 4JCVE 5C0XG 3DLLA 4B08A 1CK1A 2VW9A 2VUMH 2E2HH 2K33A 2EYHA 2R92B 1Z7TA 4HJ8A 3R8BA 2I5HA 2ZM6L 1CHPD 1JB7A 4KY5A 1YNJD 1VQBA 1LTTD 2K5HA 3V96A 2CH4W 2JK8A 3L2PA 1A0IA 1I4XA 1DGSA 1RTNA 1TWHH 3C1FA 1PH8A 5IP9H 2G5DA 1HNWL 5IGFA 1HZAA 1J9OA 4DR2L 2B2VC 1D5XC 2E2JB 3BYTB 4ALPA 1KNEA 3KLRA 1SE2A 3K59A 4A3BB 2JE6I 4IUTA 1KDBA 1K73C 4FVMA 1CZWA 2WKCA 2M00A 4OHJA 2Q8IB 2R7ZG 4A3DH 4L8JA 1WD0A 1EY8A 2EYPA 1FNVA 2K5NA 2XRSD 2M2LA 5HGTA 1FGUA 4AYBE 1R9TB 1VQ6A 1CTMA 1HQRD 1K8MA 1Z6HA 2KBNA 5M3MB 2AUJD 5F2DA 3VR2A 3HOYH 4K14A 1IZ6A 1K83H 3MAQA 1LTLA 1VF5C 2K50A 3HOXH 4DV0L 2WB1E 1EY4A 1I4GA 4AIMA 4CJ0B 2E74C 3KF8A 1E2VA 3HOZG 3F2UA 5FKAC 4X65L 4A3MB 3PF5A 1YJNA 3HS0C 2HCCA 3Q23A 3BDOA 1G6ZA 1S3OA 1PRTB 1HXYD 2B8FA 2F0OA 3R2IA 1X3EA 5E7NA 2ICEC 4JBWA 1RHPA 3FP9A 1EZ8A 4IPDA 2EQSA 2F0LA 4NXMQ 5JJKA 2HQLA 3GTKB 3OW7A 3CC2A 5JEAG 1QE6A 5C5MA 5FLMH 4DAPA 4JI5L 2A6ED 4H02A 4MHEA 3KBXA 1WI5A 2Q2IA 4N8FA 1G291 3NHHA 4HMJA 1SNMA 4O2DA 1AE3A 1KRTA 4PMWA 4DUYQ 4QCLA 2Z4HA 4NXNQ 3GTMB 2D0OA 5K36G 1ENAA 3KF6B 2UU9L 4JI0L 1JOKA 2EOTA 4PMBA 4A3IH 4IZ8A 3S1NH 2BH8A 2XGTA 1AP0A 1IYVA 1I94Q 2AKWB 3PIO3 2CW0D 4IUPA 4LFCL 5KNCA 2A6HD 1LTBD 2F4VQ 2NTSA 1CA5A 1SRUA 5IWAL 1HR0Q 2X6LA 5DM63 5ISRA 2WKDA 3AU7A 2UUCL 3HKZG 1QNKA 3EJIA 1IKLA 1LTID 3PV0A 1OXTA 1A6XA 3UI2A 5IOCA 3L7ZC 5M9OA 2IX1A 1EOVA 2R92G 1JWMD 4C3JB 5K5PA 1XPRA 5L37A 1HFNA 4LAAA 3M4YA 4CDFC 3IFDA 3SK6A 5FLXc 4A3FH 4X3UA 5KNDA 3RZOH 3I4MH 2WAQE 1EU4A 3S2HH 3ERQA 3TMEA 1ASYA 2EJMA 2EZVA 1OTCA 3AQQA 2DJFC 2YV5A 2ZJQA 4A3BG 1U4PA 5EPJA 2JA6H 4HIOA 4IOAA 4BXXG 1STHA 4IALA 2AQ2B 3BVZA 1KQSA 1UAPA 3DUZA 5FO7B 1QVCA 2JN4A 5CV5A 2SNSA 2BDNA 1K3RA 1S72A 3T4AC 2L55A 3I73A 5M3MG 1Q7YC 3DWAA 3GTQB 2J4XA 3P1HA 4XT1B 3CW2C 5C44H 1K8OA 5I4DA 1UWVA 4A3MG 4OXPA 2BE5C 2XSCA 3UE0A 4LF7Q 4A3KH 3J81L 3FHWA 1HA6A 1TY0A 4LF5Q 1Y1WH 1KHIA 4QUFA 2PZUA 5DAUA 1X6OA 1SE3A 4A3JB 4BBRH 2MO1A 2JA7H 3EROA 3EIVA 4HIKA 4RGTA 2Z6BA 3CCQA 1W3SA 4WRDA 2FMCA 4UP8A 4GOPB 5JVH3 3S16B 3J81i 3VYRA 4K2LA 5GAGC 4JC0A 2GN5A 5DLQE 3RN2A 2IJ0A 2UXCL 1AW7A 3G71A 3U9SA 3ULLA 4FO2A 1IBKL 4NMZA 3J7A5 4A75A 1M1KC 1ZYRC 5CV9A 4HEDA 5CV6A 3RZDH 4FF4A 1O7LA 1MD2D 3DMUA 1VQ5A 2CWAA 3U4ZA 1XWEA 3PIP3 4G4KA 3D6CA 4P74A 2R93B 2H4OA 4N9PA 4NKLA 3L0OA 1O78A 4IPGA 3J80c 4RHSA 1IBLL 4DXGA 1A63A 2NUCA 3W2DA 3AMUA 2MPMA 1X54A 2F0GA 1K9MC 4DV7L 1DYQA 1Q81C 1FNUA 1N9WA 1SN8A 4OO1I 2K05A 4IFDG 3GTOB 1SMXA 2F0SA 4C3JG 5C4XB 2E2HB 2E8GA 1NE3A 2PQAA 1NY4A 1JC7A 1VQOA 1XTCD 3F2DA 5IGEA 4APVA 1PYBA 2E76C 3F2CA 1D1IA 4XXEA 3W1GA 2QGQA 2NVTB 4IOCA 4LNQA 3KFUA 1TWHB 1Q82C 4KHPL 4P75A 3SGIA 3CMEA 3ULPA 1EY5A 5D3DA 3STBC 1I4QA 4MTNA 3ITPA 3CCRA 1SJHD 3RN5A 4JBMA 3LNNA 2C9OA 4OO1H 1HZCA 3P7JA 4UPAA 1H9KA 3PCOB 1PH3A 3TS0A 4LFBQ 1SYFA 2EY5A 4JYAQ 4A3DB 1STEA 1B7YB 2YTVA 1UUPA 4DV6L 5HY6A 3BG3A 4ZUIA 1J8IA 1T5EA 1FR3A 1TY2A 2EXDA 4CKCA 1YVCA 1B9NA 2NZOA 4X3KA 2RCNA 1SSOA 1VMCA 1EEFD 4CBVA 1LACA 1MJCA 1II3A 1QG7A 3QO2A 2E2IH 3RUZA 2N8NA 2CH4A 1TS5A 1TWAH 3MVVA 2Z8LA 3OTOL 2UXBL 3MEHA 2J7ZA 4DAVA 1QVGA 4A3JG 4A93H 3M7NA 5CBEE 4RG1A 2VQFL 4ULLA 3PO3B 1O80A 5JPMC 1FJGL 2KQ3A 4B3MQ 5C4JH 2ICIA 2F0PA 1V1PA 4JI6L 5C3XA 1UE5A 4UP9A 4DK1A 1GUTA 4YWKA 2SEBD 2PCFB 2JSOA 3HOVH 4A3LG 3AEVA 4EQPA 2O4XA 4C3HB 4DV5L 1HNXL 4CDCC 1B9MA 2ASBA 5DNFA 3JAMc 3QJYA 4C3IH 1B70B 1YITA 2ES2A 3S1NB 5D3IB 1XPUA 5CGKA 1T9HA 2R93G 4TSSA 2AQ1B 3TEHB 4DV3L 4ABNA 1JOQA 3I91A 4B3RQ 3D4DA 1I6HB 2F3WA 3SXHA 1BOSA 3A54A 3HOWH 2VS1A 3E9IA 4DUYL 1JT8A 1N33Q 4ZK9B 3TS2A 4LMQD 4QY7A 4HJ5A 5C4XG 3CHBD 4YY3L 4DV2Q 1MHWC 1VQGA 4PZ8A 2B2WA 5ELNA 1SYEA 2RDFA 2B2YA 3VR4A 1U9RA 5EQ0A 1YI2A 2HUGA 1SNQA 2WFWA 4Y7NH 2IPKD 3RZOB 3I4MB 1HR0L 4OX9Q 5CBAE 1N36L 1C9OA 3DXJC 4KD4A 1AZQA 1VQJA 2JA6B 4OGQC 1YNNC 4L5TA 4TQUS 4RFBA 1U4LA 2GA4B 4Z9CB 1LTRD 3OW2A 3V2TA 1KAAA 4A3DG 3S1RB 3LGJA 4F7XA 1VQ9A 1ASZA 1STNA 2PI2E 3I2ZA
chains in the Genus database with same CATH topology
4XIGS 1W6JA 2CW0C 4G7HC 3KK7A 4K5WA 3GV3A 4DGZA 3VYUA 4XDXA 4QMGA 1TR5A 1EY0A 1JOOA 2A74C 1GUOA 5I2YA 2EXZA 1T5XD 2B2TA 3SK5A 1JORA 1STAA 3Q24A 4KI0A 2F0JA 1NSNS 4BBRB 2JA7B 1I4RA 2EYOA 1F9QA 3SHLA 1D1KA 1D6EC 5EKIA 3T13A 5ELEA 2L0CA 1VCIA 4C3HG 2IW3A 4IUUA 3P75A 5DEHA 1PMRA 2EYJA 5ELCA 4DU9A 4QF4A 1WTXA 2R6GA 2KA7A 5G3LD 4QIWB 3OIQA 4IQZA 2L5TA 2F0VA 1JE4A 5CV4A 4C56C 4B9XA 1QOHA 1JB3A 1KNAA 2PYKA 1S5DD 2OT2A 2JEAI 1Y8OB 2I46A 4H13C 2NVXB 2XN9C 2Q8TA 1DD2A 1X32A 3A7AB 1DCZA 2D9UA 3S1MB 3J81E 1BQQT 3FMCA 3TZDA 3GTGB 5M5YB 4ILWA 4IUVA 1NR4A 3NQIA 3D4RA 2JP1A 2NB0A 1HHVA 1TVXA 1QCBD 3MXGA 1TWFB 1G91A 5EGTA 1KTKA 5E4WC 5IIFA 4BS9A 2FINB 2MHVA 5IGGA 5I6WA 5KYIA 3G6JB 1PLFA 1KDAA 5ELBA 3DEPA 5ELDA 1V8QA 3WOEA 3URYA 1ZKOA 3SK4A 4ZAIA 4C2MB 4K6LA 1TWAB 3HKZB 3MXPA 2B2UA 1SNDA 1ILQA 2RBMA 2LS01 1OXXK 3OOCA 4M1UB 2JEBI 2F0QA 1ZXTA 3HOUB 3T56B 3W3AA 4FP5D 2F0UA 4TRDA 5I9PA 1WTOA 3ND8A 1SXTA 2PMZB 1PRTC 5FLXL 5KGUA 1BO0A 1EZ6A 2B2VA 2EJGC 5EPKA 1Y69U 4OIJA 2SOBA 3ZYYX 2K03A 4K8IA 2SDFA 1A2UA 4F88A 3K5MA 1ESFA 4WJWA 1HPCA 2XWJB 1A3VA 4HMIA 1MBYA 2RSNA 2F0MA 3NTHA 2HQEA 5M5WB 1LTGD 1DONA 2NZ1D 4Q5VA 1FYCA 3K57A 3TZUA 2JXMB 1ML0D 4DK0A 5HURA 1R4PB 4U68A 1EY9A 2KHSA 4CJ2C 3S1QB 3NTIA 2KEDA 3J7YW 2NN6I 1EY7A 2A69C 1BXTA 1GUGA 1SMYD 2ENBA 2G9HD 1HTPA 1CA6A 4CKEA 4BWGB 3GO5A 2KECA 3Q22A 1A2TA 1XXGA 1EY6A 2Y0SB 3K5OA 2CQAA 2HDMA 2F4IA 3CRLC 3H3VC 4EQOA 4IN3A 4PQXA 4L6TB 4RCOA 3GTPB 2NN6H 1EIHA 3VYTA 1TWCB 3MFYA 4KKTA 2KUMA 1EYCA 3J80L 1HUNA 1IW7D 2QCPX 5D65A 4A3GB 1HQMC 2F1MA 2PPBC 1FNWA 2Z4IA 2QDBA 1TT2A 3M4OB 1PTOD 4K6DA 3L9AX 1RCVD 1BCPF 3QWNA 5KYLA 1Y8PB 4XYOA 3T51B 3N6RA 5LHY1 1XYIA 3C1EA 4O42A 1PTOF 5KEEA 4KKUA 4RAUC 3BDCA 4BA1I 5D14A 2XIWA 4KY6A 4P2CB 3FPUB 1I4PA 1DZ1A 1BUVT 1WTPA 5IGCA 5C0XI 2I07B 4RGOS 1PXUA 3OHXC 4H0LC 3LX0A 2EDGA 5EBCA 3DWPA 4HCSA 1C48A 2CHBD 1IYUA 1LT5D 1SYBA 3MA2B 2V4DA 5C0XH 4ODGA 3IFTA 3EFXD 3PO2B 3TP5A 1WTWA 1B4OA 2H1EA 1SAPA 2F0HA 2JA5B 3MFGA 3MHBA 3WDNA 1L0XB 2IX3A 3JAML 1HFGA 1ET6A 3H0GB 3SEBA 2NVQB 1G2SA 1VDZA 2F03A 3S2DB 5KRUA 1IL8A 3NPPA 1A3UA 1PTOH 1CQVA 2VUMB 4KHZA 3IAYA 2NYZD 2K5QA 1LO5D 4ID6A 4EGVA 1GXDC 1S5CD 3EA6A 5IGBA 3H09A 3OMGA 5FK9C 3H6MA 1NCVA 2D5DA 4FXDA 2A68D 1RODA 5JOBA 3RLFA 3MZ5A 1FD7D 3T16A 2BOSA 3FPPA 5JJZA 2M9VA 3H94A 4H7BA 4UDUC 3M7GA 5COYA 2QF7A 3WOFA 1AN8A 4F87A 1JQYD 2K5DA 3VR3A 5JEAH 3S9WA 1PFNA 2DN8A 3HOYB 3K0YA 3KBGA 1K83B 2RDHA 4HTHA 3HOXB 4MIUA 3FRPB 4KHVA 1KABA 1A3TA 4RGNA 3VA7A 3PUXA 4AYBB 1PRTF 5C6AA 5TSSA 1GOZA 1XX8A 2Q8RE 1YNJC 3D6WA 2F0EA 2WB1B 4IURA 4EQNA 3PUYA 4UAIA 1F2LA 3KUPA 3NE5B 2WP8J 3L3OC 5FLXE 4A3IB 2NWGA 2K01A 3PUVA 5C0XJ 3ND9A 3GQBA 2KCCA 1G8ZD 2MP1A 2D62A 2PZWA 2RDGA 1TS4A 3A8JE 4HN7A 2Z1CA 3RMHA 2FJ2A 5C3EB 1OXSC 1V1PB 1RJTA 3FKIB 1B53A 1V43A 1B3AA 3BVMA 4R8NA 3FDTA 1QB5D 4KN7C 4A3FB 4ZKCB 2A6EC 3DHQA 3MTSA 3I8ZA 3S2HB 1RKNA 5CV8A 4V190 1VF7A 2AQ3B 5NUCA 2RVLA 1WTRA 1MGSA 4CGYB 1OO9B 1GHJA 1SMYC 3DWQA 2L1BA 2E75C 2WAQB 3C46A 1Q90A 2K1BA 1MSGA 3BZDB 1EOTA 1IHZA 2A6HC 1STGA 2E2DC 1ILPA 4RKLA 3K6OA 1DM0B 3HG9A 1Q12A 5C44B 1F9SA 2L9HA 3SE0A 2RSOA 4FYDA 1UEAB 1EFID 1Y8NB 4U673 2K7VA 2ZXOA 5JEAJ 1DOKA 2G9DA 4A3KB 3EVQA 4IFDI 3EQLC 1IKMA 1Y1WB 4OL7A 5CR3A 1IW7C 3J80E 2IT1A 3KLSX 2EYMA 1LT4D 4IUNA 4XQNA 3I4LA 2XVSA 4XYQA 3NP8A 2AUKA 1JCKB 2BE5D 4KKSA 4IFDH 4XQQA 3RZDB 3QOLA 5I2XA 3TSSA 3CRKC 3R3OA 1Y1VB 3BDLA 1U4MA 2IWHA 1SYGA 3MXNA 4FNFA 2K5WA 3I3CA 4C1NK 5BN4A 2A5HA 3DM1A 2NVYB 3SK8A 1PTOB 3GTJB 3MWYW 1PFBA 1D5ZC 1H9SB 1TQOA 3T53B 4DFAA 5CYUA 1SBBB 3NK9A 2WIIB 1B50A 4FF3A 2F0IA 3GV6A 5JPNC 1JICA 3ONAB 3U9OA 1LABA 5FOBB 2EE1A 2IX0A 1X3PA 1S5BD 5CV7A 1TKWB 1HTLD 3A7LA 3OMCA 3TP8A 4DXFA 2KJXA 2LKVA 3JAME 2E2IB 2NBFA 4R9WA 3VR6A 2O5JC 3E0JA 1ONLA 5A2QE 2N88A 5J39A 4A93B 3QIAA 1CHQD 5EKLA 4M8AA 3I4NB 3HP3A 2J0TD 1CQFA 3K5NA 2AWOA 4KJOA 5C4JB 4X3SA 1G2TA 3SR1A 4YIJA 3IKJA 1A15A 2F0FA 1EIGA 1RDPD 4GZYC 5CMDA 2ZXRA 2RQXA 3HOVB 5KNBA 1ESRA 1OXUA 5E3FA 1NR2A 4FXGC 4WFN3 4C3IB 3C2PA 4HSVA 2RA4A 1H9RA 5I6YA 1LLRD 4BY1B 1F9RA 2FFKB 2R61A 1AEXA 2WACA 5CC4A 3BYYB 2EVBA 4IFDJ 4HCEA 2EY1A 1TU2B 3HOWB 1WTQA 4G57A 4FXKC 2A73B 3VA5A 4ZKBB 1STBA 1EWCA 4PMCA 1F2YA 3D31A 4Y7NB 1E2WA 1JWSD 2XNAC 2EYFA 2PW5A 4KTAA 5FO9B 5J1ZA 1C4QA 1SJED 4B9WA 4OO1G 1QILA 4DNTB 5I9OA 1EYDA 3O13A 1F9PA 5T1GA 3OPOA 3G7LA 1PZJD 3M85A 5IT9L 4RHRA 1Z47A 1SEBD 2JA8B 1EYAA 2FHTA 1HCZA 4A3EB 4DN4M 2IL8A 3NSWA 1KDCA 1CM9A 3QOJA 1YNND 3NXWA 1FGBD 3SVMA 5C5LA 5EBDA 4H44C 4HR7B 1JWUD 1WD1A 1EU3A 2K04A 3LWEA 1AZPA 1H9MA 3E5SA 3A55A 2DNEA 1LV9A 4K2KA 3Q6SA 1M8AA 2DY8A 1BCPD 2KVMA 2PZTA 3P20A 2BA0A 2TSSA 4C3IG 2SNMA 2EY2A 3GTLB 3K58A 1UNSA 1F2ZA 4LJZC 3OWFA 3E6ZX 2L12A 4JK1C 4K5VA 2QKIC 4KMUC 1RF2D 1BDOA 2KEEA 3HZXA 2MJ8A 3CQZB 1PFMA 3H91A 4R8IA 2EYLA 1EEID 1GJXA 1CI3M 4BBSB 4ME5A 2B63B 5DM73 1HRJA 3X3MA 3N52A 3NWTA 3J7AV 1CFMA 4J6HA 1TIID 2HCIA 3VR5A 3R93A 1ET9A 4MN3A 2PW7A 4E6IA 4X3TA 2X6GA 1CT1D 2BA1A 2TMPA 2CVRA 4KJNA 3HGBA 1E0BA 3BVGA 4ZUJA 1C8CA 2O2LD 2N55A 1PZID 2OF1A 2F0TA 1MSHA 1QJOA 2VB2X 5EPLA 1R4QB 1QNUA 1O7ZA 2LY7A 3NWSA 3QB3A 1Q3LA 2ZT9C 1GUSA 2B39A 2LMCB 2FMMA 2F0WA 1SNPA 3Q0AA 1OXVA 1WCMB 1I3QB 5E1FA 5A2QL 1WTVA 5J22A 3PMFA 3LWUA 2C5CA 3NUCA 5FO8B 2VXWA 1DOMA 1Q1BA 3KLSA 1GUWA 5JVG3 1QWYA 1W6KA 2NTTA 1NUCA 4XT3B 3TN2A 1Q8IA 3GD7A 2ID0A 3S14B 4CKBA 5E4XA 2F3VA 4RA8A 3K5LA 1D5MC 2DNCA 1PDQA 2YYZA 4FF2A 4BA2I 4KN4C 5BN5A 1O7YA 3FVQA 4ZRZA 2QEJC 2QILA 2OXPA 2F0DA 4F8MA 1PRTD 1S5ED 4ZYSA 2JYOA 3TP7A 1EQVA 5K36H 1DOLA 2F0KA 1MI2A 1EL0A 4LK1C 5C3WA 1SYDA 4CJ1B 1RD9D 2O5IC 5EJWA 5A35A 1SNOA 4BY7B 1NAPA 5C4ZA 3CU7A 2X69A 2XWBB 3QG1A 2HDLA 3BS1A 2DY7A 3M3YB 4C1NI 2R3ZA 2WINB 1SNCA 3D3RA 1ENFA 1Q1EA 1TS2A 5LL6S 3IL8A 3A8IE 4N9TA 5M3FB 1KLGD 1ZEQX 2BDOA 3MC0B 3C3LA 1DJRD 4G7ZC 3OSOA 3PUWA 5M5XB 2OEOA 3TDQA 1BBXC 3CKIB 1EQTA 3OWEB 2A69D 4V0BA 1LTAD 1ENCA 2KCNA 3NBIA 2VNUD 4XQJA 3TP6A 4TKOB 2YU9B 1DXMA 3OIPA 4KK7A 3HRZC 3SDZA 3I72A 1I4HA 2B2WC 2LFNA 2B2YC 3MXUA 4RCNA 1F2MA 1LT6D 4O1NA 4NDXA 1U4RA 4S3SA 4RWSC 3I90A 4RKBA 5CORA 1LT3D 4PNYA 1X3QA 3D4WA 5IT9E 1B44D 1F77A 2WV6D 1V1OA 4ZLTF 4ZQ3A 4HAEA 1CZGA 3A8KE 2K6AA 1GHKA 4XTCS 4QUCA 1BF4A 3J7AF 4DNRB 1BNZA 3X3NA 4OIKA 4HSPA 3K7AB 4J8QA 2B2TC 2ZXPA 4DA2A 5T1IA 3I70A 1BCPC 1PZKD 1BR9A 3RD4A 5EKKA 1PTOC 2D2CC 1GUNA 1I50B 4K5XA 1I6VC 2RKSA 2XRQD 1LTSD 1EWHA 2B8GA 1H9SA 1WVLA 1VMPA 4WORA 5IGDA 4I65A 4CHTB 5BN3A 4EVOA 1SYCA 4NP5A 1RTOA 1BCPB 2NN6G 3NTKA 4DF7A 4I7ZC 1L0YB 2L11A 4J1MA 1TS3A 4FF1A 5AFWA 4IUQA 1ZYRD 2MGSA 2VB3X 4KD3A 2EY6A 2PO4A 4KY7A 3S15B 2R7ZB 4Q0FA 3DEOA 3D8GA 3A56A 1ICWA 1TWGB 4KV6A 5G3LF 4K8JA 4RGMA 3FEWX 2PNRC 1HUMA 1SE4A 1SDFA 4PV1C 3PUZA 3HOZB 1B1ZA 1HA5A 5C4HA 1B2TA 1E2ZA 5JAVA 5KIXA 1AFPA 3V05A 1D2BA 4QB4A 5IODA 2K28A 3NBHA 1S5FD 4DAYA 3HEJA 4L63B 2KOLA 3TBIB 1M4VA 1KLUD 5ELFA 1S4ZA 2PQEA 1PYWD 1H9JA 2BCOA 4RH6A 2AWNA 2MUYA 2L4NA 1STYA 3NQTA 2EPBA 1JR0D 5LL6X 1SFOB 4NW2A 3GP7A 4G7OC 2F0NA 3R2TA 2B2UC 3VYSA 2EJFC 2A68C 3AB9A 3S17B 2K32A 5C0XG 4B08A 1CK1A 2K33A 2EYHA 2R92B 1Z7TA 3R8BA 1CHPD 4KY5A 1YNJD 1LTTD 3V96A 1I4XA 1RTNA 3C1FA 5IGFA 1J9OA 2B2VC 1D5XC 2E2JB 3BYTB 1KNEA 3KLRA 1SE2A 3K59A 4A3BB 2JE6I 4IUTA 1KDBA 4FVMA 1CZWA 2WKCA 2M00A 4OHJA 2Q8IB 4L8JA 1WD0A 1EY8A 2EYPA 1FNVA 2XRSD 2M2LA 5HGTA 1R9TB 1CTMA 1HQRD 1K8MA 1Z6HA 5M3MB 2AUJD 5F2DA 3VR2A 4K14A 3MAQA 1VF5C 1EY4A 1I4GA 4CJ0B 2E74C 3KF8A 1E2VA 3F2UA 5FKAC 4A3MB 3HS0C 2HCCA 3Q23A 3BDOA 1G6ZA 1PRTB 1HXYD 2B8FA 2F0OA 3R2IA 2ICEC 4JBWA 1RHPA 1EZ8A 2F0LA 3GTKB 3OW7A 5JEAG 1QE6A 5C5MA 4DAPA 2A6ED 4MHEA 3KBXA 1G291 3NHHA 4HMJA 1SNMA 4PMWA 4QCLA 2Z4HA 3GTMB 5K36G 1ENAA 1JOKA 2EOTA 4PMBA 4IZ8A 1AP0A 1IYVA 3PIO3 2CW0D 4IUPA 5KNCA 2A6HD 1LTBD 2NTSA 1CA5A 2X6LA 5DM63 5ISRA 2WKDA 3AU7A 1QNKA 3EJIA 1IKLA 1LTID 3PV0A 1OXTA 1A6XA 3UI2A 5IOCA 3L7ZC 5M9OA 2IX1A 1JWMD 4C3JB 5K5PA 1HFNA 4LAAA 3M4YA 3IFDA 3SK6A 4X3UA 5KNDA 1EU4A 3ERQA 3TMEA 2EJMA 2EZVA 1U4PA 5EPJA 1STHA 4IALA 2AQ2B 3BVZA 1UAPA 3DUZA 5FO7B 5CV5A 2SNSA 2BDNA 3T4AC 2L55A 3I73A 3DWAA 3GTQB 2J4XA 3P1HA 4XT1B 1K8OA 5I4DA 2BE5C 2XSCA 3J81L 1HA6A 1TY0A 4QUFA 2PZUA 5DAUA 1SE3A 4A3JB 3EROA 4RGTA 4WRDA 2FMCA 5JVH3 3S16B 3VYRA 4K2LA 2IJ0A 1AW7A 3U9SA 4FO2A 4NMZA 1ZYRC 5CV9A 4HEDA 5CV6A 4FF4A 1O7LA 1MD2D 3DMUA 1XWEA 3PIP3 4G4KA 3D6CA 2R93B 2H4OA 4N9PA 4NKLA 1O78A 4RHSA 4DXGA 2NUCA 3W2DA 3AMUA 2MPMA 2F0GA 1DYQA 1FNUA 4OO1I 2K05A 4IFDG 3GTOB 2F0SA 4C3JG 5C4XB 2E2HB 1JC7A 1XTCD 5IGEA 2E76C 1D1IA 4XXEA 2NVTB 1TWHB 1EY5A 5D3DA 1I4QA 3ITPA 1SJHD 3LNNA 2C9OA 4OO1H 3P7JA 1H9KA 1SYFA 2EY5A 4A3DB 1STEA 1UUPA 3BG3A 4ZUIA 1J8IA 1T5EA 1FR3A 1TY2A 4CKCA 1B9NA 4X3KA 1SSOA 1VMCA 1EEFD 4CBVA 1LACA 1II3A 1QG7A 3QO2A 3RUZA 1TS5A 3MVVA 2Z8LA 3MEHA 2J7ZA 4DAVA 3M7NA 5CBEE 4ULLA 3PO3B 1O80A 5JPMC 2KQ3A 2ICIA 2F0PA 1V1PA 5C3XA 4DK1A 1GUTA 2SEBD 2PCFB 2JSOA 4EQPA 2O4XA 4C3HB 1B9MA 5DNFA 3QJYA 3S1NB 5D3IB 5CGKA 4TSSA 2AQ1B 4ABNA 1JOQA 3I91A 3D4DA 1I6HB 2F3WA 3SXHA 1BOSA 3A54A 4ZK9B 4LMQD 3CHBD 2B2WA 1SYEA 2RDFA 2B2YA 3VR4A 1U9RA 5EQ0A 2HUGA 1SNQA 2IPKD 3RZOB 3I4MB 5CBAE 3DXJC 4KD4A 1AZQA 2JA6B 4OGQC 1YNNC 4TQUS 4RFBA 1U4LA 2GA4B 4Z9CB 1LTRD 3V2TA 1KAAA 3S1RB 4F7XA 1STNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP 3;  5DM7 3;  4U67 3;  5JVH 3;  3PIO 3;  5JVG 3;  5DM6 3;  4WFN 3; 
#chains in the Genus database with same CATH topology
 4XIG S;  1W6J A;  2CW0 C;  4G7H C;  2JA8 H;  3KK7 A;  4K5W A;  3GV3 A;  4DGZ A;  4B3S Q;  4POG A;  1YBY A;  4A3E H;  3VYU A;  4XDX A;  4QMG A;  1CSP A;  1TR5 A;  1EY0 A;  4DR7 Q;  3A74 A;  4JBK A;  3F2B A;  1JOO A;  2A74 C;  3J81 j;  4B3T Q;  1GUO A;  2R7F A;  3KLW A;  5I2Y A;  2EXZ A;  1T5X D;  1YIJ A;  2B2T A;  3SK5 A;  1JOR A;  1STA A;  2N49 A;  3Q24 A;  4KI0 A;  2F0J A;  1NSN S;  3D0F A;  4RMF A;  3PO3 G;  5IYD H;  4BBR B;  2JA7 B;  1I4R A;  2EYO A;  1F9Q A;  3SHL A;  1D1K A;  2VQE Q;  1D6E C;  4DR6 Q;  5EKI A;  3T13 A;  5ELE A;  2L0C A;  1VCI A;  3M4O H;  4C3H G;  3S24 A;  2IW3 A;  4IUU A;  3P75 A;  5DEH A;  1N8R C;  1PMR A;  2EYJ A;  3AYH B;  2ALY B;  4I7A A;  5ELC A;  4DU9 A;  3GTL H;  1MIU A;  4QF4 A;  1WTX A;  2Z6K C;  2R6G A;  2KA7 A;  5G3L D;  4YHH Q;  5JJL A;  4QIW B;  3AFP A;  3OIQ A;  4GKK L;  4IQZ A;  2L5T A;  3UDI A;  2F0V A;  4YCW A;  1JE4 A;  3W1B A;  5CV4 A;  4C56 C;  4B9X A;  4PZ6 A;  1QOH A;  1JB3 A;  3CQZ H;  1KNA A;  3EBE A;  2PYK A;  3UDF A;  1S5D D;  2B3G A;  2OT2 A;  2JEA I;  1Y8O B;  2I46 A;  4H13 C;  2NVX B;  2XN9 C;  2Q8T A;  1DD2 A;  1X32 A;  3A7A B;  1DCZ A;  2D9U A;  3S1M B;  3J81 E;  1BQQ T;  3FMC A;  3TZD A;  3NEL A;  4K0K L;  3GTG B;  5IP7 H;  5M5Y B;  3I4M G;  2OQK A;  4ILW A;  4IUV A;  1NR4 A;  3NQI A;  3D4R A;  2JP1 A;  2UUB Q;  2NB0 A;  4LUV A;  1D8L A;  2JA6 G;  1HHV A;  1WFQ A;  1TVX A;  1QCB D;  3MXG A;  1TWF B;  1G91 A;  2UUA Q;  1YEZ A;  5EGT A;  1KTK A;  5E4W C;  4YWM A;  5IIF A;  3E9H A;  4BS9 A;  2FIN B;  2MHV A;  5IGG A;  4LF8 Q;  2RHQ B;  5I6W A;  4DK6 C;  1E24 A;  5KYI A;  3G6J B;  2MQH A;  1PLF A;  1KDA A;  5ELB A;  4GKJ Q;  3DEP A;  5ELD A;  4TVA B;  1VQ4 A;  1V8Q A;  3WOE A;  3URY A;  1EQR A;  4DR3 L;  1ZKO A;  3SK4 A;  1GVP A;  4ZAI A;  4C2M B;  1CKN B;  4K6L A;  1TWA B;  3H0G H;  2NVQ H;  1BVS A;  3HKZ B;  4OEM B;  3S2D H;  3UDG A;  3CCE A;  1NMG A;  1WCM H;  4BBR G;  1I3Q H;  3H15 A;  2JA7 G;  3MXP A;  2B2U A;  4NB3 A;  4CDE C;  1SND A;  1ILQ A;  2RBM A;  2LS0 1;  4JI2 L;  1OXX K;  3OOC A;  5J3B A;  4HIM A;  2VY3 A;  4M1U B;  2JEB I;  4DAY B;  2ZJR A;  1VQL A;  2F0Q A;  1ZXT A;  1U5K A;  3HOU B;  3T56 B;  1QUQ A;  3W3A A;  4FP5 D;  1YHA A;  2F0U A;  4TRD A;  5I9P A;  1WTO A;  3ND8 A;  1SXT A;  1IL2 A;  2PMZ B;  1PRT C;  1A62 A;  2K14 A;  5FLX L;  5KGU A;  1BO0 A;  1EZ6 A;  3S14 H;  4DNI A;  1VQD A;  2B2V A;  2EJG C;  5EPK A;  1Y69 U;  2DJG C;  4OIJ A;  2SOB A;  3ZYY X;  1JE5 A;  2K03 A;  4K8I A;  2SDF A;  1N34 L;  1A2U A;  5ELO A;  4DV4 Q;  1B3Q A;  1A8V A;  1V1Q A;  4F88 A;  3K5M A;  1ESF A;  4WJW A;  1FVI A;  1HPC A;  3G6E A;  2XWJ B;  4OWT B;  1A3V A;  4HMI A;  5FJ8 H;  3T1H Q;  3WWV A;  1MBY A;  2B29 A;  2RSN A;  2F0M A;  3NTH A;  1XNR L;  2Q2U A;  2HQE A;  2PI2 A;  4FDB A;  1HR0 W;  1L1O B;  5M5W B;  3KF6 A;  1LTG D;  1DON A;  2NZ1 D;  2JQO A;  1FYC A;  4Q5V A;  3K57 A;  3TZU A;  2E5L Q;  4JI8 L;  1QZH A;  2JXM B;  1ML0 D;  4DK0 A;  5HUR A;  4X6A H;  1R4P B;  4U68 A;  1VQI A;  2L15 A;  3CCV A;  3TRZ A;  1EY9 A;  2KHS A;  4CJ2 C;  3M3Y H;  3S1Q B;  3NTI A;  2KED A;  3J7Y W;  2NN6 I;  4R4T A;  1EY7 A;  2A69 C;  1BXT A;  5GAE C;  1GUG A;  4OWX B;  1SMY D;  2ENB A;  2P5Z X;  2G9H D;  1HTP A;  1CA6 A;  4OX9 L;  4CKE A;  3UE1 A;  3GO5 A;  4BWG B;  2KEC A;  3Q22 A;  1A2T A;  5M3F H;  1XXG A;  1EY6 A;  2RHS B;  2Y0S B;  3K5O A;  1EIY B;  4JV5 Q;  2MFI A;  1C0A A;  2CQA A;  2CKZ B;  2HDM A;  3A5U A;  5M5X H;  2F4I A;  3CRL C;  3H3V C;  4EQO A;  4A3C G;  4IN3 A;  4PQX A;  1NJI C;  4L6T B;  1XNQ L;  4RCO A;  3GTP B;  2NN6 H;  1J5E Q;  1EIH A;  3VYT A;  1TWC B;  2KCT A;  5C3E H;  3MFY A;  4KKT A;  2KUM A;  1EYC A;  5GRO A;  4B3S L;  3J80 L;  3FKI H;  3PSI A;  1HUN A;  1IW7 D;  2QCP X;  5D65 A;  4DR7 L;  1HQM C;  4A3G B;  2F1M A;  2YU9 H;  2PPB C;  4LF4 Q;  4OWW B;  3U50 C;  4B3T L;  1FNW A;  2Z4I A;  2QDB A;  1TT2 A;  3HOU G;  3M4O B;  1HZB A;  4LFA L;  3J80 i;  1KAW A;  1PTO D;  4K6D A;  3L9A X;  2F52 A;  4JI7 L;  1RCV D;  3QR8 A;  1BCP F;  2IHF A;  3QWN A;  5KYL A;  1BBU A;  1Y8P B;  4XYO A;  4X66 L;  3T51 B;  3N6R A;  5LHY 1;  1XYI A;  3C1E A;  4O42 A;  1PTO F;  5KEE A;  1G6P A;  4KKU A;  4OEL B;  1N32 L;  4RAU C;  4GOP C;  4DUZ Q;  4DK3 C;  4DR4 Q;  4PZ7 A;  3BDC A;  1SE8 A;  5LMU Q;  4L5R C;  1YZ6 A;  3BJU A;  3A0J A;  2PNH A;  4BA1 I;  5D14 A;  2XIW A;  1BBW A;  4KY6 A;  4P2C B;  3FPU B;  1I4P A;  2N78 A;  1GM5 A;  1DZ1 A;  4A76 A;  1BUV T;  1WTP A;  5IGC A;  5BR8 L;  5C0X I;  4YHH L;  3M4Q A;  2I07 B;  1HH2 P;  4RGO S;  4CDD C;  1PXU A;  1K28 A;  1XMQ L;  3HKS A;  3UDX A;  5IT9 c;  3OHX C;  4H0L C;  4DAM A;  2LXK A;  3LX0 A;  1XPO A;  2EDG A;  5EBC A;  4P73 A;  3DWP A;  4HCS A;  1HNZ Q;  1C48 A;  2CHB D;  1Q86 C;  1NNX A;  4PG3 A;  1IYU A;  1VQN A;  1LT5 D;  2D0P A;  1SYB A;  1I50 H;  3MA2 B;  2V4D A;  4DR5 Q;  1IBM Q;  5C0X H;  1X56 A;  4ODG A;  4A4I A;  1LYL A;  3IFT A;  3EFX D;  3PO2 B;  3TP5 A;  3RR5 A;  1WTW A;  1B4O A;  2H1E A;  2Y0S G;  3K8A A;  1SAP A;  2HHH L;  1Y1V H;  4GLX A;  2F0H A;  2JA5 B;  3MFG A;  3MHB A;  5AJ3 Q;  3WDN A;  1L0X B;  2IX3 A;  3JAM L;  1HFG A;  1AE2 A;  1ET6 A;  3H0G B;  3SEB A;  2NVQ B;  1G2S A;  1VDZ A;  3EN2 A;  2F03 A;  3S2D B;  5KRU A;  1EQQ A;  4LF8 L;  2NVY H;  4IJL A;  1IL8 A;  3NPP A;  1A3U A;  1PTO H;  1CQV A;  3GTJ H;  2VUM B;  4KHZ A;  1XMO L;  3IAY A;  2NYZ D;  4GN4 B;  2K5Q A;  3JAM i;  4A3G G;  1LO5 D;  4ID6 A;  4LF6 Q;  3S15 H;  4EGV A;  1GXD C;  1S5C D;  3EA6 A;  5IGB A;  2GVA A;  1TWG H;  3H09 A;  3T1Y L;  2N3S A;  3OMG A;  5FK9 C;  1YJW A;  1LM0 A;  3H6M A;  1NCV A;  2D5D A;  4LF9 L;  1FL0 A;  5IYC G;  4FXD A;  2A68 D;  1ROD A;  2DUD A;  5JOB A;  5GAD C;  4X62 Q;  3RLF A;  3MZ5 A;  1FD7 D;  1JJ2 A;  3T16 A;  2BOS A;  3FPP A;  5JJZ A;  2M9V A;  3H94 A;  3K80 C;  4H7B A;  1GD7 A;  4UDU C;  3M7G A;  5COY A;  2QF7 A;  3WOF A;  1AN8 A;  4F87 A;  4AQY Q;  1JQY D;  2K5D A;  3VR3 A;  5JEA H;  1EIF A;  3S9W A;  1PFN A;  2DN8 A;  3PQI A;  3K0Y A;  3KBG A;  3HOY B;  1KXL A;  1K83 B;  2RDH A;  4HTH A;  3HOX B;  2PQA B;  3FRP B;  4MIU A;  4X64 Q;  4KHV A;  4JI3 Q;  1KAB A;  3CPF A;  1Q46 A;  1A3T A;  1GO3 E;  4RGN A;  3HKZ E;  3VA7 A;  3PUX A;  4AYB B;  1PRT F;  5C6A A;  2ZJP A;  5TSS A;  2ZM6 Q;  1NTG A;  1GOZ A;  1KL9 A;  1XX8 A;  2Q8R E;  1YNJ C;  3I4N H;  3D6W A;  3CCL A;  2F0E A;  2WB1 B;  4IUR A;  1SFO H;  4EQN A;  3PUY A;  4R4C A;  1SR3 A;  1HNW Q;  1E22 A;  3T1H L;  4DR2 Q;  4UAI A;  1PA6 A;  1F2L A;  3KUP A;  3NE5 B;  3S17 H;  1J6Q A;  2A19 A;  2WP8 J;  3L3O C;  3JC6 6;  3PO2 G;  3ERS X;  5FLX E;  4BY1 H;  4A3I B;  2R92 H;  2NWG A;  1VQE A;  2K01 A;  4GS3 A;  4NXM L;  1H95 A;  3PUV A;  2NZH A;  2JA5 G;  5C0X J;  3ND9 A;  5IE8 A;  3GQB A;  2KCC A;  3K7U C;  1G8Z D;  1EFW A;  2MP1 A;  2D62 A;  4R4Q A;  2PZW A;  2RDG A;  2RF4 A;  3H0G G;  4P71 A;  1TS4 A;  2A1A A;  3A8J E;  4NXN L;  4HN7 A;  4X65 Q;  2QDL A;  2Z1C A;  2VUM G;  4JI4 Q;  3RMH A;  4BXX H;  2FJ2 A;  5C3E B;  1OXS C;  1MJE A;  1PH5 A;  1V1P B;  1RJT A;  3FKI B;  1I94 L;  1B53 A;  1V43 A;  1B3A A;  3BVM A;  4R8N A;  3FDT A;  1PHJ A;  1QB5 D;  4KN7 C;  4A3F B;  4ZKC B;  3OYY A;  1R9T H;  2A6E C;  2F4V L;  3DHQ A;  3MTS A;  3I8Z A;  5IP9 G;  4JI5 Q;  3PF4 A;  3S2H B;  1RKN A;  5CV8 A;  4V19 0;  1VF7 A;  4A3M H;  4MZ9 A;  4IO9 A;  2AQ3 B;  5NUC A;  2ZTE A;  2RVL A;  1WTR A;  4JI0 Q;  1MGS A;  4CGY B;  2UU9 Q;  1OO9 B;  1GHJ A;  1SMY C;  3DWQ A;  2KCM A;  2L1B A;  2E75 C;  1CKO A;  2WAQ B;  4JOI C;  3C46 A;  3GTK H;  1Q90 A;  2K1B A;  1MSG A;  3BZD B;  1EOT A;  3HOY G;  1IHZ A;  2A6H C;  1STG A;  2E2D C;  2R7D A;  3CPW A;  4RKL A;  3K6O A;  4LFC Q;  1ILP A;  1X65 A;  3HOX G;  1DM0 B;  3HG9 A;  4JOI A;  1JJC B;  1Q12 A;  5IWA Q;  5C44 B;  1F9S A;  3KJP A;  2L9H A;  3SE0 A;  2RSO A;  4HJ9 A;  2UUC Q;  4FYD A;  2JA9 A;  1UEA B;  1EFI D;  1Y8N B;  4U67 3;  2K7V A;  2ZXO A;  3KOJ A;  5JEA J;  4UY8 C;  1DOK A;  4QGU A;  3GTM H;  1NBW A;  2DGY A;  2G9D A;  4A3K B;  2XTI A;  2GVB A;  3EVQ A;  4IFD I;  4JI1 Q;  4AYB G;  3EQL C;  1IKM A;  1Y1W B;  4OL7 A;  5CR3 A;  1UE6 A;  1IW7 C;  3J80 E;  2IT1 A;  5FLM G;  1X9N A;  2WB1 G;  3KLS X;  2EYM A;  1LT4 D;  4IUN A;  4XQN A;  3I4L A;  4DKA C;  2XVS A;  1KC8 C;  4XYQ A;  3NP8 A;  2AUK A;  3K81 C;  1JCK B;  2BE5 D;  3H3V I;  4LF7 L;  2QW7 A;  4KKS A;  4LF5 L;  4A3I G;  1PVO A;  4IFD H;  4LWC A;  4XQQ A;  3RLO A;  3RZD B;  3QOL A;  5I2X A;  1P16 A;  3TSS A;  3CRK C;  3R3O A;  1Y1V B;  4EX5 A;  1AH9 A;  3BDL A;  3G4S A;  1HNZ L;  1U4M A;  2BH2 A;  2IWH A;  1SYG A;  2Z6K A;  1SLJ A;  3MXN A;  4FNF A;  3IRB A;  2K5W A;  3I3C A;  4GNX B;  4C1N K;  4AH6 A;  5BN4 A;  2A5H A;  3H3V H;  1IBM L;  4L5S A;  3DM1 A;  2NVY B;  3SK8 A;  1PH2 A;  5C3E G;  1PTO B;  3GTJ B;  4BBS H;  3MWY W;  2B63 H;  1HJP A;  1PFB A;  2I5M X;  3FKI G;  3KDF B;  1D5Z C;  3NEM A;  1H9S B;  1K0R A;  1TQO A;  3T53 B;  4DFA A;  5LMN Q;  4GLV B;  4A3F G;  5CYU A;  1SBB B;  3NK9 A;  1U0L A;  2WII B;  5AJ3 L;  2UXD Q;  1VQ7 A;  2OTJ A;  1WJJ A;  1B50 A;  1PH4 A;  4R4I A;  4FF3 A;  1EWI A;  2F0I A;  3CC4 A;  3GV6 A;  1KD1 C;  4O0A A;  5JPN C;  1JIC A;  3ONA B;  3U9O A;  1LAB A;  5FOB B;  2EE1 A;  2IX0 A;  1IBK Q;  1CKN A;  1X3P A;  2WAQ G;  1WYD A;  1VS0 A;  4A3J H;  2HIV A;  1S5B D;  1EUJ A;  4IPC A;  5CV7 A;  1TKW B;  1HTL D;  1E1O A;  3A7L A;  3OMC A;  3TP8 A;  3S16 H;  5C44 G;  5GAH C;  4DXF A;  2KJX A;  1IBL Q;  3STB D;  2LKV A;  3JAM E;  2AHO B;  2E2I B;  2NBF A;  4A3L H;  4R9W A;  4A3K G;  1CSQ A;  3VR6 A;  4LFB L;  4GN3 B;  2O5J C;  1PV4 A;  3E0J A;  1Y1W G;  4JYA L;  1ONL A;  5A2Q E;  2N88 A;  3K0X A;  4JVZ A;  3I55 A;  5J39 A;  4QQB X;  4A93 B;  3QIA A;  1CHQ D;  5EKL A;  2R93 H;  3CAM A;  4M8A A;  3I4N B;  3HP3 A;  2J0T D;  1CQF A;  5GQO A;  2IHE A;  2AWO A;  3NBH B;  1VQC A;  4KJO A;  5C4J B;  3K5N A;  4X3S A;  1G2T A;  3SR1 A;  1SRO A;  4KHP Q;  4YIJ A;  3IKJ A;  1A15 A;  2F0F A;  1EIG A;  1RDP D;  4GZY C;  5CMD A;  2ZXR A;  2RQX A;  2CQO A;  3HOV B;  1ESR A;  1OXU A;  1Y14 B;  5KNB A;  5E3F A;  1NR2 A;  4FXG C;  3GDE A;  4WFN 3;  3GTO H;  4C3I B;  5C4X H;  3AFQ A;  4HSV A;  3C2P A;  2RA4 A;  1H9R A;  5I6Y A;  1LLR D;  4BY1 B;  1F9R A;  2K52 A;  1L1O C;  2FFK B;  2R61 A;  1AEX A;  1Y1V G;  2WAC A;  4DV6 Q;  5CC4 A;  2K4K A;  3BYY B;  3ZJY C;  4B3M L;  2NVT H;  1L1O A;  2EVB A;  4IFD J;  4HCE A;  2K5V A;  2EY1 A;  1TU2 B;  3HOW B;  2CWP A;  1WTQ A;  4G57 A;  4UHV A;  4FXK C;  3M9B A;  3ER0 A;  2A73 B;  3VA5 A;  4ZKB B;  1STB A;  1EWC A;  2LSS A;  4PMC A;  4HJ7 A;  1PYS B;  2QA4 A;  3OTO Q;  2UXB Q;  2Z0S A;  1YJ9 A;  4ME3 A;  1F2Y A;  3D31 A;  3NEN A;  4Y7N B;  1E2W A;  1JWS D;  2XNA C;  2VQF Q;  1Q8K A;  4B3R L;  2EYF A;  2PW5 A;  4KTA A;  1FJG Q;  5FO9 B;  1QUQ B;  1PH1 A;  4JI6 Q;  3G48 A;  5J1Z A;  1C4Q A;  1SJE D;  4B9W A;  2Q2T A;  1PFS A;  1N33 L;  4BY7 H;  1JJG A;  2OWO A;  4OO1 G;  1QIL A;  4DNT B;  4JI4 L;  5I9O A;  1EYD A;  3O13 A;  4DV2 L;  4DV5 Q;  1HNX Q;  1WTH A;  1F9P A;  3F1Z A;  5T1G A;  3OPO A;  3G7L A;  1PZJ D;  3M85 A;  1O7I A;  2H5X A;  5JJI A;  5IT9 L;  4RHR A;  1Z47 A;  3PO3 H;  1SEB D;  2JA8 B;  1EYA A;  4DV3 Q;  2FHT A;  1HCZ A;  4DPG A;  4A3E B;  4DN4 M;  3PIO A;  2IL8 A;  3KF8 B;  3NSW A;  4LUZ A;  1KDC A;  2I5L X;  3CC7 A;  1CM9 A;  1NMF A;  3QOJ A;  1ICF B;  1YNN D;  3NXW A;  1C7Y A;  3I7F A;  1FGB D;  4C3H H;  3SVM A;  5C5L A;  4YY3 Q;  2LXJ A;  4A93 G;  5EBD A;  1PH6 A;  4H44 C;  4HR7 B;  1JWU D;  1WD1 A;  1EU3 A;  2K04 A;  3VDY A;  3LWE A;  3I4N G;  1AZP A;  1H9M A;  3E5S A;  3A55 A;  2DNE A;  1LV9 A;  4K2K A;  1VQP A;  1I6H H;  3Q6S A;  1M8A A;  2DY8 A;  1N36 Q;  3HOV G;  1BCP D;  2KVM A;  1EYG A;  1UEB A;  2PZT A;  3P20 A;  2BA0 A;  2TSS A;  4C3I G;  4ZCK A;  2SNM A;  2EY2 A;  4BY1 G;  4JI1 L;  5IY0 A;  1K0S A;  3GTL B;  3K58 A;  3CP0 A;  1UNS A;  1F2Z A;  4L5Q A;  4LJZ C;  4DV1 Q;  3OWF A;  3E6Z X;  4HJA A;  2L12 A;  2VQE L;  4JK1 C;  1IXR A;  4K5V A;  4DR6 L;  2QKI C;  1I5F A;  1RF2 D;  4KMU C;  1KIX A;  1BDO A;  1D7Q A;  2KEE A;  3HZX A;  1VQ8 A;  5IYB H;  3HOW G;  1VQF A;  2MJ8 A;  2ATW A;  3CQZ B;  4R4O A;  3CD6 A;  1PFM A;  3H91 A;  4R8I A;  2EYL A;  1EEI D;  1GJX A;  1CI3 M;  4GOP A;  5EAY A;  4BBS B;  4ME5 A;  2B63 B;  5DM7 3;  3S1R H;  1HRJ A;  3X3M A;  4Y52 H;  3N52 A;  3NWT A;  3J7A V;  1CFM A;  4J6H A;  1TII D;  4YCV A;  2HCI A;  3VR5 A;  3R93 A;  1ET9 A;  4MN3 A;  1B8A A;  2PW7 A;  3J7Z C;  1V9P A;  3K7A H;  1Z9F A;  1PH7 A;  2HD3 A;  4E6I A;  4X3T A;  4YWL A;  2X6G A;  1CT1 D;  4JW0 A;  2BA1 A;  2TMP A;  2CVR A;  1S40 A;  2ZTC A;  4KJN A;  2I0Q A;  3HGB A;  1W2B A;  1E0B A;  3BVG A;  4ZUJ A;  1C8C A;  4R1J A;  2O2L D;  2N55 A;  5LMN L;  1PZI D;  2OF1 A;  2F0T A;  4DR1 Q;  4WJ4 A;  1MSH A;  1QJO A;  2VB2 X;  5EPL A;  2JA8 G;  1R4Q B;  1QNU A;  1O7Z A;  1VQA A;  2LY7 A;  2UXD L;  4HID A;  4A3E G;  4GKK Q;  3NWS A;  3QB3 A;  2UUB L;  4QIW E;  3PIP A;  1Q3L A;  2ZT9 C;  1GUS A;  2B39 A;  2LMC B;  2FMM A;  1YNX A;  2UUA L;  2F0W A;  1SNP A;  2IY5 B;  1K8G A;  3Q0A A;  1OXV A;  1X3G A;  1CUK A;  1I3Q B;  1WCM B;  5IYD G;  5E1F A;  5A2Q L;  1WTV A;  4K0K Q;  4UP7 A;  5J22 A;  2AMC B;  3PMF A;  3PGZ A;  4GKJ L;  3LWU A;  2R7Z H;  2C5C A;  2Q2H A;  2Z9H A;  3NUC A;  5FO8 B;  2VXW A;  1DOM A;  1Q1B A;  3KLS A;  1GUW A;  5JVG 3;  1E1T A;  1QWY A;  1W6K A;  2NVX H;  2NTT A;  1NUC A;  4XT3 B;  3S1M H;  3TN2 A;  3HOZ H;  1Q8I A;  3GD7 A;  2ID0 A;  2F3I A;  3S14 B;  3GTG H;  5M5Y H;  3Q8D A;  4CKB A;  4OON A;  5E4X A;  3BZC A;  1L0W A;  2F3V A;  4RA8 A;  4YCU A;  3K5L A;  1D5M C;  2DNC A;  1PDQ A;  1X55 A;  2YYZ A;  4FF2 A;  1M90 C;  4BA2 I;  4IJH A;  3CXC A;  4KN4 C;  4DR3 Q;  2V1C C;  3KJO A;  2VL6 A;  1TWF H;  5BN5 A;  3FVQ A;  1O7Y A;  4BBS G;  4ZRZ A;  2B63 G;  2QEJ C;  2QIL A;  3DM3 A;  2OXP A;  2F0D A;  4F8M A;  1PRT D;  1XJV A;  1S5E D;  4ZYS A;  3MEF A;  2JYO A;  2CCZ A;  5IP7 G;  3TP7 A;  1EQV A;  5K36 H;  1DOL A;  2F0K A;  1MI2 A;  1EL0 A;  3J81 c;  4LK1 C;  5C3W A;  4JI2 Q;  1SYD A;  4CJ1 B;  1RD9 D;  2O5I C;  5EJW A;  5A35 A;  3CMA A;  4DV4 L;  1SNO A;  4BY7 B;  1E3P A;  1NAP A;  5C4Z A;  3CU7 A;  4LUO A;  2X69 A;  2XWB B;  3QG1 A;  4JPB W;  2HDL A;  3BS1 A;  2DY7 A;  1E7Z A;  4C2M H;  4MTK A;  4A3C H;  3M3Y B;  1PH9 A;  4C1N I;  3A5Z B;  2R3Z A;  2WIN B;  1SNC A;  3D3R A;  1ENF A;  4GLA C;  1Q1E A;  1TS2 A;  1QZG A;  5LL6 S;  2PMZ E;  3IL8 A;  3CCM A;  3A8I E;  4N9T A;  2E5L L;  1VQM A;  3I4O A;  5M3F B;  1KLG D;  2KHI A;  1ZEQ X;  1GKH A;  4WJ3 M;  2BDO A;  1N34 Q;  3MC0 B;  3C3L A;  1DJR D;  4G7Z C;  3OSO A;  3PUW A;  5M5X B;  3HOU H;  2OEO A;  3TDQ A;  4DV0 Q;  2E2J H;  1BBX C;  3CKI B;  1WCM G;  1EQT A;  3OWE B;  1K3B C;  4N8X 1;  2A69 D;  3KYH C;  4A3B H;  4V0B A;  3ULJ A;  1XNR Q;  5H1S E;  1LTA D;  2MNA A;  5HGQ A;  1ENC A;  2KCN A;  1QVF A;  3CCJ A;  3NBI A;  2VNU D;  3U4V A;  4XQJ A;  3TP6 A;  4JV5 L;  4TKO B;  2YU9 B;  1DXM A;  3OIP A;  4JI8 Q;  4KK7 A;  3HRZ C;  3SDZ A;  3I72 A;  5M3M H;  1I4H A;  2CFM A;  1BKB A;  2B2W C;  2LFN A;  2B2Y C;  3MXU A;  4RCN A;  1F2M A;  1LT6 D;  4O1N A;  2FXQ A;  3RLN A;  4NDX A;  1U4R A;  1WOC A;  1TXY A;  4S3S A;  4RWS C;  1J5E L;  3I90 A;  4RKB A;  5COR A;  1LT3 D;  4PNY A;  2KEN A;  1X3Q A;  3ICE A;  3D4W A;  5M5W H;  5IT9 E;  3E0E A;  1B44 D;  1F77 A;  3CCS A;  2WV6 D;  2OTL A;  4LF4 L;  1V1O A;  2YTY A;  4JG2 A;  4ZLT F;  4ZQ3 A;  4HAE A;  1CZG A;  4QL5 A;  1LUZ A;  1RIP A;  3A8K E;  2A8V A;  2K6A A;  1GHK A;  1JMC A;  2Y0S E;  4XTC S;  4QUC A;  1BF4 A;  3J7A F;  5FJ8 G;  3S1Q H;  1XNQ Q;  4DNR B;  2ZTD A;  4DV1 L;  4IPH A;  1CKM A;  4KLK A;  1VQK A;  1BNZ A;  3X3N A;  4OIK A;  4HSP A;  3K7A B;  2JJQ A;  4NPS A;  4DUZ L;  1KRS A;  4J8Q A;  4DR4 L;  1RL2 A;  3HFZ B;  2B2T C;  5LMU L;  4BY7 G;  2RCF A;  2ZXP A;  4DA2 A;  5T1I A;  3I70 A;  1BCP C;  1PZK D;  4POF A;  4GNX C;  1BR9 A;  5LMN W;  3RD4 A;  5EKK A;  4LFA Q;  1PTO C;  2D2C C;  3GTP H;  1GUN A;  1I50 B;  4JI7 Q;  4GNX A;  4K5X A;  1VQH A;  4X66 Q;  1I6V C;  1TWC H;  2RKS A;  2XRQ D;  1LTS D;  4C3J H;  2C35 B;  1G51 A;  1EWH A;  2B8G A;  1YHB A;  3KDF A;  1H9S A;  1WVL A;  5M3F G;  1VMP A;  4A3G H;  1UE7 A;  1N32 Q;  2YTX A;  4WOR A;  5IGD A;  2MO0 A;  4I65 A;  4CHT B;  2QEX A;  3CCU A;  5BN3 A;  4EVO A;  4P72 A;  1X3F A;  1SYC A;  4NP5 A;  1UE1 A;  3B6Y A;  1RTO A;  3W5O A;  5IYC H;  1BCP B;  2NN6 G;  3NTK A;  4DF7 A;  3CF5 A;  4I7Z C;  1L0Y B;  2L11 A;  4DR1 L;  4DR5 L;  3BZK A;  2HIX A;  4J1M A;  1TS3 A;  4FF1 A;  5AFW A;  4IUQ A;  1ZYR D;  2MGS A;  4J15 A;  3I56 A;  5BR8 Q;  2VB3 X;  4KD3 A;  2VZA A;  2EY6 A;  1L2F A;  2PO4 A;  2OQ0 A;  2K75 A;  4KY7 A;  3S15 B;  2R7Z B;  3M4P A;  4Q0F A;  3DEO A;  3D8G A;  1XMQ Q;  3TQY A;  3A56 A;  1ICW A;  1TWG B;  4KV6 A;  5G3L F;  2HT1 A;  4K8J A;  4RGM A;  3GTQ H;  3E3X A;  3FEW X;  2PNR C;  2EIF A;  1HUM A;  1SE4 A;  1SDF A;  4PV1 C;  3PUZ A;  4MNO A;  3HOZ B;  1P8L A;  2UXC Q;  3F8T A;  1B1Z A;  1IYJ B;  2KHJ A;  1HA5 A;  5C4H A;  4LF6 L;  1B2T A;  1E2Z A;  5JAV A;  5KIX A;  3MXN B;  5IYB G;  1AFP A;  3U58 A;  3V05 A;  1XTD A;  3RNU A;  2HHH Q;  1D2B A;  4QB4 A;  5IOD A;  2K28 A;  3NBH A;  1HZ9 A;  1S5F D;  4X62 L;  4JBJ A;  4DAY A;  3HEJ A;  4L63 B;  2KOL A;  3TBI B;  1M4V A;  1KLU D;  5ELF A;  4DV7 Q;  1S4Z A;  2PQE A;  3PO2 H;  1PYW D;  1H9J A;  2BCO A;  1XMO Q;  1YHQ A;  4RH6 A;  2AWN A;  2MUY A;  2L4N A;  3NQT A;  1STY A;  2EPB A;  4EQ5 A;  4AQY L;  1JR0 D;  2JA5 H;  5LL6 X;  1SFO B;  1MKH A;  4NW2 A;  2OCE A;  3GP7 A;  4LW1 A;  3T1Y Q;  4G7O C;  3TRE A;  2F0N A;  4QJF A;  3R2T A;  2B2U C;  3VYS A;  1K8A C;  4LF9 Q;  4X64 L;  3BU2 A;  2EJF C;  2A68 C;  4JI3 L;  3AB9 A;  3S17 B;  2K32 A;  4GN5 A;  4JCV E;  5C0X G;  3DLL A;  4B08 A;  1CK1 A;  2VW9 A;  2VUM H;  2E2H H;  2K33 A;  2EYH A;  2R92 B;  1Z7T A;  4HJ8 A;  3R8B A;  2I5H A;  2ZM6 L;  1CHP D;  1JB7 A;  4KY5 A;  1YNJ D;  1VQB A;  1LTT D;  2K5H A;  3V96 A;  2CH4 W;  2JK8 A;  3L2P A;  1A0I A;  1I4X A;  1DGS A;  1RTN A;  1TWH H;  3C1F A;  1PH8 A;  5IP9 H;  2G5D A;  1HNW L;  5IGF A;  1HZA A;  1J9O A;  4DR2 L;  2B2V C;  1D5X C;  2E2J B;  3BYT B;  4ALP A;  1KNE A;  3KLR A;  1SE2 A;  3K59 A;  4A3B B;  2JE6 I;  4IUT A;  1KDB A;  1K73 C;  4FVM A;  1CZW A;  2WKC A;  2M00 A;  4OHJ A;  2Q8I B;  2R7Z G;  4A3D H;  4L8J A;  1WD0 A;  1EY8 A;  2EYP A;  1FNV A;  2K5N A;  2XRS D;  2M2L A;  5HGT A;  1FGU A;  4AYB E;  1R9T B;  1VQ6 A;  1CTM A;  1HQR D;  1K8M A;  1Z6H A;  2KBN A;  5M3M B;  2AUJ D;  5F2D A;  3VR2 A;  3HOY H;  4K14 A;  1IZ6 A;  1K83 H;  3MAQ A;  1LTL A;  1VF5 C;  2K50 A;  3HOX H;  4DV0 L;  2WB1 E;  1EY4 A;  1I4G A;  4AIM A;  4CJ0 B;  2E74 C;  3KF8 A;  1E2V A;  3HOZ G;  3F2U A;  5FKA C;  4X65 L;  4A3M B;  3PF5 A;  1YJN A;  3HS0 C;  2HCC A;  3Q23 A;  3BDO A;  1G6Z A;  1S3O A;  1PRT B;  1HXY D;  2B8F A;  2F0O A;  3R2I A;  1X3E A;  5E7N A;  2ICE C;  4JBW A;  1RHP A;  3FP9 A;  1EZ8 A;  4IPD A;  2EQS A;  2F0L A;  4NXM Q;  5JJK A;  2HQL A;  3GTK B;  3OW7 A;  3CC2 A;  5JEA G;  1QE6 A;  5C5M A;  5FLM H;  4DAP A;  4JI5 L;  2A6E D;  4H02 A;  4MHE A;  3KBX A;  1WI5 A;  2Q2I A;  4N8F A;  1G29 1;  3NHH A;  4HMJ A;  1SNM A;  4O2D A;  1AE3 A;  1KRT A;  4PMW A;  4DUY Q;  4QCL A;  2Z4H A;  4NXN Q;  3GTM B;  2D0O A;  5K36 G;  1ENA A;  3KF6 B;  2UU9 L;  4JI0 L;  1JOK A;  2EOT A;  4PMB A;  4A3I H;  4IZ8 A;  3S1N H;  2BH8 A;  2XGT A;  1AP0 A;  1IYV A;  1I94 Q;  2AKW B;  3PIO 3;  2CW0 D;  4IUP A;  4LFC L;  5KNC A;  2A6H D;  1LTB D;  2F4V Q;  2NTS A;  1CA5 A;  1SRU A;  5IWA L;  1HR0 Q;  2X6L A;  5DM6 3;  5ISR A;  2WKD A;  3AU7 A;  2UUC L;  3HKZ G;  1QNK A;  3EJI A;  1IKL A;  1LTI D;  3PV0 A;  1OXT A;  1A6X A;  3UI2 A;  5IOC A;  3L7Z C;  5M9O A;  2IX1 A;  1EOV A;  2R92 G;  1JWM D;  4C3J B;  5K5P A;  1XPR A;  5L37 A;  1HFN A;  4LAA A;  3M4Y A;  4CDF C;  3IFD A;  3SK6 A;  5FLX c;  4A3F H;  4X3U A;  5KND A;  3RZO H;  3I4M H;  2WAQ E;  1EU4 A;  3S2H H;  3ERQ A;  3TME A;  1ASY A;  2EJM A;  2EZV A;  1OTC A;  3AQQ A;  2DJF C;  2YV5 A;  2ZJQ A;  4A3B G;  1U4P A;  5EPJ A;  2JA6 H;  4HIO A;  4IOA A;  4BXX G;  1STH A;  4IAL A;  2AQ2 B;  3BVZ A;  1KQS A;  1UAP A;  3DUZ A;  5FO7 B;  1QVC A;  2JN4 A;  5CV5 A;  2SNS A;  2BDN A;  1K3R A;  1S72 A;  3T4A C;  2L55 A;  3I73 A;  5M3M G;  1Q7Y C;  3DWA A;  3GTQ B;  2J4X A;  3P1H A;  4XT1 B;  3CW2 C;  5C44 H;  1K8O A;  5I4D A;  1UWV A;  4A3M G;  4OXP A;  2BE5 C;  2XSC A;  3UE0 A;  4LF7 Q;  4A3K H;  3J81 L;  3FHW A;  1HA6 A;  1TY0 A;  4LF5 Q;  1Y1W H;  1KHI A;  4QUF A;  2PZU A;  5DAU A;  1X6O A;  1SE3 A;  4A3J B;  4BBR H;  2MO1 A;  2JA7 H;  3ERO A;  3EIV A;  4HIK A;  4RGT A;  2Z6B A;  3CCQ A;  1W3S A;  4WRD A;  2FMC A;  4UP8 A;  4GOP B;  5JVH 3;  3S16 B;  3J81 i;  3VYR A;  4K2L A;  5GAG C;  4JC0 A;  2GN5 A;  5DLQ E;  3RN2 A;  2IJ0 A;  2UXC L;  1AW7 A;  3G71 A;  3U9S A;  3ULL A;  4FO2 A;  1IBK L;  4NMZ A;  3J7A 5;  4A75 A;  1M1K C;  1ZYR C;  5CV9 A;  4HED A;  5CV6 A;  3RZD H;  4FF4 A;  1O7L A;  1MD2 D;  3DMU A;  1VQ5 A;  2CWA A;  3U4Z A;  1XWE A;  3PIP 3;  4G4K A;  3D6C A;  4P74 A;  2R93 B;  2H4O A;  4N9P A;  4NKL A;  3L0O A;  1O78 A;  4IPG A;  3J80 c;  4RHS A;  1IBL L;  4DXG A;  1A63 A;  2NUC A;  3W2D A;  3AMU A;  2MPM A;  1X54 A;  2F0G A;  1K9M C;  4DV7 L;  1DYQ A;  1Q81 C;  1FNU A;  1N9W A;  1SN8 A;  4OO1 I;  2K05 A;  4IFD G;  3GTO B;  1SMX A;  2F0S A;  4C3J G;  5C4X B;  2E2H B;  2E8G A;  1NE3 A;  2PQA A;  1NY4 A;  1JC7 A;  1VQO A;  1XTC D;  3F2D A;  5IGE A;  4APV A;  1PYB A;  2E76 C;  3F2C A;  1D1I A;  4XXE A;  3W1G A;  2QGQ A;  2NVT B;  4IOC A;  4LNQ A;  3KFU A;  1TWH B;  1Q82 C;  4KHP L;  4P75 A;  3SGI A;  3CME A;  3ULP A;  1EY5 A;  5D3D A;  3STB C;  1I4Q A;  4MTN A;  3ITP A;  3CCR A;  1SJH D;  3RN5 A;  4JBM A;  3LNN A;  2C9O A;  4OO1 H;  1HZC A;  3P7J A;  4UPA A;  1H9K A;  3PCO B;  1PH3 A;  3TS0 A;  4LFB Q;  1SYF A;  2EY5 A;  4JYA Q;  4A3D B;  1STE A;  1B7Y B;  2YTV A;  1UUP A;  4DV6 L;  5HY6 A;  3BG3 A;  4ZUI A;  1J8I A;  1T5E A;  1FR3 A;  1TY2 A;  2EXD A;  4CKC A;  1YVC A;  1B9N A;  2NZO A;  4X3K A;  2RCN A;  1SSO A;  1VMC A;  1EEF D;  4CBV A;  1LAC A;  1MJC A;  1II3 A;  1QG7 A;  3QO2 A;  2E2I H;  3RUZ A;  2N8N A;  2CH4 A;  1TS5 A;  1TWA H;  3MVV A;  2Z8L A;  3OTO L;  2UXB L;  3MEH A;  2J7Z A;  4DAV A;  1QVG A;  4A3J G;  4A93 H;  3M7N A;  5CBE E;  4RG1 A;  2VQF L;  4ULL A;  3PO3 B;  1O80 A;  5JPM C;  1FJG L;  2KQ3 A;  4B3M Q;  5C4J H;  2ICI A;  2F0P A;  1V1P A;  4JI6 L;  5C3X A;  1UE5 A;  4UP9 A;  4DK1 A;  1GUT A;  4YWK A;  2SEB D;  2PCF B;  2JSO A;  3HOV H;  4A3L G;  3AEV A;  4EQP A;  2O4X A;  4C3H B;  4DV5 L;  1HNX L;  4CDC C;  1B9M A;  2ASB A;  5DNF A;  3JAM c;  3QJY A;  4C3I H;  1B70 B;  1YIT A;  2ES2 A;  3S1N B;  5D3I B;  1XPU A;  5CGK A;  1T9H A;  2R93 G;  4TSS A;  2AQ1 B;  3TEH B;  4DV3 L;  4ABN A;  1JOQ A;  3I91 A;  4B3R Q;  3D4D A;  1I6H B;  2F3W A;  3SXH A;  1BOS A;  3A54 A;  3HOW H;  2VS1 A;  3E9I A;  4DUY L;  1JT8 A;  1N33 Q;  4ZK9 B;  3TS2 A;  4LMQ D;  4QY7 A;  4HJ5 A;  5C4X G;  3CHB D;  4YY3 L;  4DV2 Q;  1MHW C;  1VQG A;  4PZ8 A;  2B2W A;  5ELN A;  1SYE A;  2RDF A;  2B2Y A;  3VR4 A;  1U9R A;  5EQ0 A;  1YI2 A;  2HUG A;  1SNQ A;  2WFW A;  4Y7N H;  2IPK D;  3RZO B;  3I4M B;  1HR0 L;  4OX9 Q;  5CBA E;  1N36 L;  1C9O A;  3DXJ C;  4KD4 A;  1AZQ A;  1VQJ A;  2JA6 B;  4OGQ C;  1YNN C;  4L5T A;  4TQU S;  4RFB A;  1U4L A;  2GA4 B;  4Z9C B;  1LTR D;  3OW2 A;  3V2T A;  1KAA A;  4A3D G;  3S1R B;  3LGJ A;  4F7X A;  1VQ9 A;  1ASZ A;  1STN A;  2PI2 E;  3I2Z A; 
#chains in the Genus database with same CATH homology
 4XIG S;  1W6J A;  2CW0 C;  4G7H C;  3KK7 A;  4K5W A;  3GV3 A;  4DGZ A;  3VYU A;  4XDX A;  4QMG A;  1TR5 A;  1EY0 A;  1JOO A;  2A74 C;  1GUO A;  5I2Y A;  2EXZ A;  1T5X D;  2B2T A;  3SK5 A;  1JOR A;  1STA A;  3Q24 A;  4KI0 A;  2F0J A;  1NSN S;  4BBR B;  2JA7 B;  1I4R A;  2EYO A;  1F9Q A;  3SHL A;  1D1K A;  1D6E C;  5EKI A;  3T13 A;  5ELE A;  2L0C A;  1VCI A;  4C3H G;  2IW3 A;  4IUU A;  3P75 A;  5DEH A;  1PMR A;  2EYJ A;  5ELC A;  4DU9 A;  4QF4 A;  1WTX A;  2R6G A;  2KA7 A;  5G3L D;  4QIW B;  3OIQ A;  4IQZ A;  2L5T A;  2F0V A;  1JE4 A;  5CV4 A;  4C56 C;  4B9X A;  1QOH A;  1JB3 A;  1KNA A;  2PYK A;  1S5D D;  2OT2 A;  2JEA I;  1Y8O B;  2I46 A;  4H13 C;  2NVX B;  2XN9 C;  2Q8T A;  1DD2 A;  1X32 A;  3A7A B;  1DCZ A;  2D9U A;  3S1M B;  3J81 E;  1BQQ T;  3FMC A;  3TZD A;  3GTG B;  5M5Y B;  4ILW A;  4IUV A;  1NR4 A;  3NQI A;  3D4R A;  2JP1 A;  2NB0 A;  1HHV A;  1TVX A;  1QCB D;  3MXG A;  1TWF B;  1G91 A;  5EGT A;  1KTK A;  5E4W C;  5IIF A;  4BS9 A;  2FIN B;  2MHV A;  5IGG A;  5I6W A;  5KYI A;  3G6J B;  1PLF A;  1KDA A;  5ELB A;  3DEP A;  5ELD A;  1V8Q A;  3WOE A;  3URY A;  1ZKO A;  3SK4 A;  4ZAI A;  4C2M B;  4K6L A;  1TWA B;  3HKZ B;  3MXP A;  2B2U A;  1SND A;  1ILQ A;  2RBM A;  2LS0 1;  1OXX K;  3OOC A;  4M1U B;  2JEB I;  2F0Q A;  1ZXT A;  3HOU B;  3T56 B;  3W3A A;  4FP5 D;  2F0U A;  4TRD A;  5I9P A;  1WTO A;  3ND8 A;  1SXT A;  2PMZ B;  1PRT C;  5FLX L;  5KGU A;  1BO0 A;  1EZ6 A;  2B2V A;  2EJG C;  5EPK A;  1Y69 U;  4OIJ A;  2SOB A;  3ZYY X;  2K03 A;  4K8I A;  2SDF A;  1A2U A;  4F88 A;  3K5M A;  1ESF A;  4WJW A;  1HPC A;  2XWJ B;  1A3V A;  4HMI A;  1MBY A;  2RSN A;  2F0M A;  3NTH A;  2HQE A;  5M5W B;  1LTG D;  1DON A;  2NZ1 D;  4Q5V A;  1FYC A;  3K57 A;  3TZU A;  2JXM B;  1ML0 D;  4DK0 A;  5HUR A;  1R4P B;  4U68 A;  1EY9 A;  2KHS A;  4CJ2 C;  3S1Q B;  3NTI A;  2KED A;  3J7Y W;  2NN6 I;  1EY7 A;  2A69 C;  1BXT A;  1GUG A;  1SMY D;  2ENB A;  2G9H D;  1HTP A;  1CA6 A;  4CKE A;  4BWG B;  3GO5 A;  2KEC A;  3Q22 A;  1A2T A;  1XXG A;  1EY6 A;  2Y0S B;  3K5O A;  2CQA A;  2HDM A;  2F4I A;  3CRL C;  3H3V C;  4EQO A;  4IN3 A;  4PQX A;  4L6T B;  4RCO A;  3GTP B;  2NN6 H;  1EIH A;  3VYT A;  1TWC B;  3MFY A;  4KKT A;  2KUM A;  1EYC A;  3J80 L;  1HUN A;  1IW7 D;  2QCP X;  5D65 A;  4A3G B;  1HQM C;  2F1M A;  2PPB C;  1FNW A;  2Z4I A;  2QDB A;  1TT2 A;  3M4O B;  1PTO D;  4K6D A;  3L9A X;  1RCV D;  1BCP F;  3QWN A;  5KYL A;  1Y8P B;  4XYO A;  3T51 B;  3N6R A;  5LHY 1;  1XYI A;  3C1E A;  4O42 A;  1PTO F;  5KEE A;  4KKU A;  4RAU C;  3BDC A;  4BA1 I;  5D14 A;  2XIW A;  4KY6 A;  4P2C B;  3FPU B;  1I4P A;  1DZ1 A;  1BUV T;  1WTP A;  5IGC A;  5C0X I;  2I07 B;  4RGO S;  1PXU A;  3OHX C;  4H0L C;  3LX0 A;  2EDG A;  5EBC A;  3DWP A;  4HCS A;  1C48 A;  2CHB D;  1IYU A;  1LT5 D;  1SYB A;  3MA2 B;  2V4D A;  5C0X H;  4ODG A;  3IFT A;  3EFX D;  3PO2 B;  3TP5 A;  1WTW A;  1B4O A;  2H1E A;  1SAP A;  2F0H A;  2JA5 B;  3MFG A;  3MHB A;  3WDN A;  1L0X B;  2IX3 A;  3JAM L;  1HFG A;  1ET6 A;  3H0G B;  3SEB A;  2NVQ B;  1G2S A;  1VDZ A;  2F03 A;  3S2D B;  5KRU A;  1IL8 A;  3NPP A;  1A3U A;  1PTO H;  1CQV A;  2VUM B;  4KHZ A;  3IAY A;  2NYZ D;  2K5Q A;  1LO5 D;  4ID6 A;  4EGV A;  1GXD C;  1S5C D;  3EA6 A;  5IGB A;  3H09 A;  3OMG A;  5FK9 C;  3H6M A;  1NCV A;  2D5D A;  4FXD A;  2A68 D;  1ROD A;  5JOB A;  3RLF A;  3MZ5 A;  1FD7 D;  3T16 A;  2BOS A;  3FPP A;  5JJZ A;  2M9V A;  3H94 A;  4H7B A;  4UDU C;  3M7G A;  5COY A;  2QF7 A;  3WOF A;  1AN8 A;  4F87 A;  1JQY D;  2K5D A;  3VR3 A;  5JEA H;  3S9W A;  1PFN A;  2DN8 A;  3HOY B;  3K0Y A;  3KBG A;  1K83 B;  2RDH A;  4HTH A;  3HOX B;  4MIU A;  3FRP B;  4KHV A;  1KAB A;  1A3T A;  4RGN A;  3VA7 A;  3PUX A;  4AYB B;  1PRT F;  5C6A A;  5TSS A;  1GOZ A;  1XX8 A;  2Q8R E;  1YNJ C;  3D6W A;  2F0E A;  2WB1 B;  4IUR A;  4EQN A;  3PUY A;  4UAI A;  1F2L A;  3KUP A;  3NE5 B;  2WP8 J;  3L3O C;  5FLX E;  4A3I B;  2NWG A;  2K01 A;  3PUV A;  5C0X J;  3ND9 A;  3GQB A;  2KCC A;  1G8Z D;  2MP1 A;  2D62 A;  2PZW A;  2RDG A;  1TS4 A;  3A8J E;  4HN7 A;  2Z1C A;  3RMH A;  2FJ2 A;  5C3E B;  1OXS C;  1V1P B;  1RJT A;  3FKI B;  1B53 A;  1V43 A;  1B3A A;  3BVM A;  4R8N A;  3FDT A;  1QB5 D;  4KN7 C;  4A3F B;  4ZKC B;  2A6E C;  3DHQ A;  3MTS A;  3I8Z A;  3S2H B;  1RKN A;  5CV8 A;  4V19 0;  1VF7 A;  2AQ3 B;  5NUC A;  2RVL A;  1WTR A;  1MGS A;  4CGY B;  1OO9 B;  1GHJ A;  1SMY C;  3DWQ A;  2L1B A;  2E75 C;  2WAQ B;  3C46 A;  1Q90 A;  2K1B A;  1MSG A;  3BZD B;  1EOT A;  1IHZ A;  2A6H C;  1STG A;  2E2D C;  1ILP A;  4RKL A;  3K6O A;  1DM0 B;  3HG9 A;  1Q12 A;  5C44 B;  1F9S A;  2L9H A;  3SE0 A;  2RSO A;  4FYD A;  1UEA B;  1EFI D;  1Y8N B;  4U67 3;  2K7V A;  2ZXO A;  5JEA J;  1DOK A;  2G9D A;  4A3K B;  3EVQ A;  4IFD I;  3EQL C;  1IKM A;  1Y1W B;  4OL7 A;  5CR3 A;  1IW7 C;  3J80 E;  2IT1 A;  3KLS X;  2EYM A;  1LT4 D;  4IUN A;  4XQN A;  3I4L A;  2XVS A;  4XYQ A;  3NP8 A;  2AUK A;  1JCK B;  2BE5 D;  4KKS A;  4IFD H;  4XQQ A;  3RZD B;  3QOL A;  5I2X A;  3TSS A;  3CRK C;  3R3O A;  1Y1V B;  3BDL A;  1U4M A;  2IWH A;  1SYG A;  3MXN A;  4FNF A;  2K5W A;  3I3C A;  4C1N K;  5BN4 A;  2A5H A;  3DM1 A;  2NVY B;  3SK8 A;  1PTO B;  3GTJ B;  3MWY W;  1PFB A;  1D5Z C;  1H9S B;  1TQO A;  3T53 B;  4DFA A;  5CYU A;  1SBB B;  3NK9 A;  2WII B;  1B50 A;  4FF3 A;  2F0I A;  3GV6 A;  5JPN C;  1JIC A;  3ONA B;  3U9O A;  1LAB A;  5FOB B;  2EE1 A;  2IX0 A;  1X3P A;  1S5B D;  5CV7 A;  1TKW B;  1HTL D;  3A7L A;  3OMC A;  3TP8 A;  4DXF A;  2KJX A;  2LKV A;  3JAM E;  2E2I B;  2NBF A;  4R9W A;  3VR6 A;  2O5J C;  3E0J A;  1ONL A;  5A2Q E;  2N88 A;  5J39 A;  4A93 B;  3QIA A;  1CHQ D;  5EKL A;  4M8A A;  3I4N B;  3HP3 A;  2J0T D;  1CQF A;  3K5N A;  2AWO A;  4KJO A;  5C4J B;  4X3S A;  1G2T A;  3SR1 A;  4YIJ A;  3IKJ A;  1A15 A;  2F0F A;  1EIG A;  1RDP D;  4GZY C;  5CMD A;  2ZXR A;  2RQX A;  3HOV B;  5KNB A;  1ESR A;  1OXU A;  5E3F A;  1NR2 A;  4FXG C;  4WFN 3;  4C3I B;  3C2P A;  4HSV A;  2RA4 A;  1H9R A;  5I6Y A;  1LLR D;  4BY1 B;  1F9R A;  2FFK B;  2R61 A;  1AEX A;  2WAC A;  5CC4 A;  3BYY B;  2EVB A;  4IFD J;  4HCE A;  2EY1 A;  1TU2 B;  3HOW B;  1WTQ A;  4G57 A;  4FXK C;  2A73 B;  3VA5 A;  4ZKB B;  1STB A;  1EWC A;  4PMC A;  1F2Y A;  3D31 A;  4Y7N B;  1E2W A;  1JWS D;  2XNA C;  2EYF A;  2PW5 A;  4KTA A;  5FO9 B;  5J1Z A;  1C4Q A;  1SJE D;  4B9W A;  4OO1 G;  1QIL A;  4DNT B;  5I9O A;  1EYD A;  3O13 A;  1F9P A;  5T1G A;  3OPO A;  3G7L A;  1PZJ D;  3M85 A;  5IT9 L;  4RHR A;  1Z47 A;  1SEB D;  2JA8 B;  1EYA A;  2FHT A;  1HCZ A;  4A3E B;  4DN4 M;  2IL8 A;  3NSW A;  1KDC A;  1CM9 A;  3QOJ A;  1YNN D;  3NXW A;  1FGB D;  3SVM A;  5C5L A;  5EBD A;  4H44 C;  4HR7 B;  1JWU D;  1WD1 A;  1EU3 A;  2K04 A;  3LWE A;  1AZP A;  1H9M A;  3E5S A;  3A55 A;  2DNE A;  1LV9 A;  4K2K A;  3Q6S A;  1M8A A;  2DY8 A;  1BCP D;  2KVM A;  2PZT A;  3P20 A;  2BA0 A;  2TSS A;  4C3I G;  2SNM A;  2EY2 A;  3GTL B;  3K58 A;  1UNS A;  1F2Z A;  4LJZ C;  3OWF A;  3E6Z X;  2L12 A;  4JK1 C;  4K5V A;  2QKI C;  4KMU C;  1RF2 D;  1BDO A;  2KEE A;  3HZX A;  2MJ8 A;  3CQZ B;  1PFM A;  3H91 A;  4R8I A;  2EYL A;  1EEI D;  1GJX A;  1CI3 M;  4BBS B;  4ME5 A;  2B63 B;  5DM7 3;  1HRJ A;  3X3M A;  3N52 A;  3NWT A;  3J7A V;  1CFM A;  4J6H A;  1TII D;  2HCI A;  3VR5 A;  3R93 A;  1ET9 A;  4MN3 A;  2PW7 A;  4E6I A;  4X3T A;  2X6G A;  1CT1 D;  2BA1 A;  2TMP A;  2CVR A;  4KJN A;  3HGB A;  1E0B A;  3BVG A;  4ZUJ A;  1C8C A;  2O2L D;  2N55 A;  1PZI D;  2OF1 A;  2F0T A;  1MSH A;  1QJO A;  2VB2 X;  5EPL A;  1R4Q B;  1QNU A;  1O7Z A;  2LY7 A;  3NWS A;  3QB3 A;  1Q3L A;  2ZT9 C;  1GUS A;  2B39 A;  2LMC B;  2FMM A;  2F0W A;  1SNP A;  3Q0A A;  1OXV A;  1WCM B;  1I3Q B;  5E1F A;  5A2Q L;  1WTV A;  5J22 A;  3PMF A;  3LWU A;  2C5C A;  3NUC A;  5FO8 B;  2VXW A;  1DOM A;  1Q1B A;  3KLS A;  1GUW A;  5JVG 3;  1QWY A;  1W6K A;  2NTT A;  1NUC A;  4XT3 B;  3TN2 A;  1Q8I A;  3GD7 A;  2ID0 A;  3S14 B;  4CKB A;  5E4X A;  2F3V A;  4RA8 A;  3K5L A;  1D5M C;  2DNC A;  1PDQ A;  2YYZ A;  4FF2 A;  4BA2 I;  4KN4 C;  5BN5 A;  1O7Y A;  3FVQ A;  4ZRZ A;  2QEJ C;  2QIL A;  2OXP A;  2F0D A;  4F8M A;  1PRT D;  1S5E D;  4ZYS A;  2JYO A;  3TP7 A;  1EQV A;  5K36 H;  1DOL A;  2F0K A;  1MI2 A;  1EL0 A;  4LK1 C;  5C3W A;  1SYD A;  4CJ1 B;  1RD9 D;  2O5I C;  5EJW A;  5A35 A;  1SNO A;  4BY7 B;  1NAP A;  5C4Z A;  3CU7 A;  2X69 A;  2XWB B;  3QG1 A;  2HDL A;  3BS1 A;  2DY7 A;  3M3Y B;  4C1N I;  2R3Z A;  2WIN B;  1SNC A;  3D3R A;  1ENF A;  1Q1E A;  1TS2 A;  5LL6 S;  3IL8 A;  3A8I E;  4N9T A;  5M3F B;  1KLG D;  1ZEQ X;  2BDO A;  3MC0 B;  3C3L A;  1DJR D;  4G7Z C;  3OSO A;  3PUW A;  5M5X B;  2OEO A;  3TDQ A;  1BBX C;  3CKI B;  1EQT A;  3OWE B;  2A69 D;  4V0B A;  1LTA D;  1ENC A;  2KCN A;  3NBI A;  2VNU D;  4XQJ A;  3TP6 A;  4TKO B;  2YU9 B;  1DXM A;  3OIP A;  4KK7 A;  3HRZ C;  3SDZ A;  3I72 A;  1I4H A;  2B2W C;  2LFN A;  2B2Y C;  3MXU A;  4RCN A;  1F2M A;  1LT6 D;  4O1N A;  4NDX A;  1U4R A;  4S3S A;  4RWS C;  3I90 A;  4RKB A;  5COR A;  1LT3 D;  4PNY A;  1X3Q A;  3D4W A;  5IT9 E;  1B44 D;  1F77 A;  2WV6 D;  1V1O A;  4ZLT F;  4ZQ3 A;  4HAE A;  1CZG A;  3A8K E;  2K6A A;  1GHK A;  4XTC S;  4QUC A;  1BF4 A;  3J7A F;  4DNR B;  1BNZ A;  3X3N A;  4OIK A;  4HSP A;  3K7A B;  4J8Q A;  2B2T C;  2ZXP A;  4DA2 A;  5T1I A;  3I70 A;  1BCP C;  1PZK D;  1BR9 A;  3RD4 A;  5EKK A;  1PTO C;  2D2C C;  1GUN A;  1I50 B;  4K5X A;  1I6V C;  2RKS A;  2XRQ D;  1LTS D;  1EWH A;  2B8G A;  1H9S A;  1WVL A;  1VMP A;  4WOR A;  5IGD A;  4I65 A;  4CHT B;  5BN3 A;  4EVO A;  1SYC A;  4NP5 A;  1RTO A;  1BCP B;  2NN6 G;  3NTK A;  4DF7 A;  4I7Z C;  1L0Y B;  2L11 A;  4J1M A;  1TS3 A;  4FF1 A;  5AFW A;  4IUQ A;  1ZYR D;  2MGS A;  2VB3 X;  4KD3 A;  2EY6 A;  2PO4 A;  4KY7 A;  3S15 B;  2R7Z B;  4Q0F A;  3DEO A;  3D8G A;  3A56 A;  1ICW A;  1TWG B;  4KV6 A;  5G3L F;  4K8J A;  4RGM A;  3FEW X;  2PNR C;  1HUM A;  1SE4 A;  1SDF A;  4PV1 C;  3PUZ A;  3HOZ B;  1B1Z A;  1HA5 A;  5C4H A;  1B2T A;  1E2Z A;  5JAV A;  5KIX A;  1AFP A;  3V05 A;  1D2B A;  4QB4 A;  5IOD A;  2K28 A;  3NBH A;  1S5F D;  4DAY A;  3HEJ A;  4L63 B;  2KOL A;  3TBI B;  1M4V A;  1KLU D;  5ELF A;  1S4Z A;  2PQE A;  1PYW D;  1H9J A;  2BCO A;  4RH6 A;  2AWN A;  2MUY A;  2L4N A;  1STY A;  3NQT A;  2EPB A;  1JR0 D;  5LL6 X;  1SFO B;  4NW2 A;  3GP7 A;  4G7O C;  2F0N A;  3R2T A;  2B2U C;  3VYS A;  2EJF C;  2A68 C;  3AB9 A;  3S17 B;  2K32 A;  5C0X G;  4B08 A;  1CK1 A;  2K33 A;  2EYH A;  2R92 B;  1Z7T A;  3R8B A;  1CHP D;  4KY5 A;  1YNJ D;  1LTT D;  3V96 A;  1I4X A;  1RTN A;  3C1F A;  5IGF A;  1J9O A;  2B2V C;  1D5X C;  2E2J B;  3BYT B;  1KNE A;  3KLR A;  1SE2 A;  3K59 A;  4A3B B;  2JE6 I;  4IUT A;  1KDB A;  4FVM A;  1CZW A;  2WKC A;  2M00 A;  4OHJ A;  2Q8I B;  4L8J A;  1WD0 A;  1EY8 A;  2EYP A;  1FNV A;  2XRS D;  2M2L A;  5HGT A;  1R9T B;  1CTM A;  1HQR D;  1K8M A;  1Z6H A;  5M3M B;  2AUJ D;  5F2D A;  3VR2 A;  4K14 A;  3MAQ A;  1VF5 C;  1EY4 A;  1I4G A;  4CJ0 B;  2E74 C;  3KF8 A;  1E2V A;  3F2U A;  5FKA C;  4A3M B;  3HS0 C;  2HCC A;  3Q23 A;  3BDO A;  1G6Z A;  1PRT B;  1HXY D;  2B8F A;  2F0O A;  3R2I A;  2ICE C;  4JBW A;  1RHP A;  1EZ8 A;  2F0L A;  3GTK B;  3OW7 A;  5JEA G;  1QE6 A;  5C5M A;  4DAP A;  2A6E D;  4MHE A;  3KBX A;  1G29 1;  3NHH A;  4HMJ A;  1SNM A;  4PMW A;  4QCL A;  2Z4H A;  3GTM B;  5K36 G;  1ENA A;  1JOK A;  2EOT A;  4PMB A;  4IZ8 A;  1AP0 A;  1IYV A;  3PIO 3;  2CW0 D;  4IUP A;  5KNC A;  2A6H D;  1LTB D;  2NTS A;  1CA5 A;  2X6L A;  5DM6 3;  5ISR A;  2WKD A;  3AU7 A;  1QNK A;  3EJI A;  1IKL A;  1LTI D;  3PV0 A;  1OXT A;  1A6X A;  3UI2 A;  5IOC A;  3L7Z C;  5M9O A;  2IX1 A;  1JWM D;  4C3J B;  5K5P A;  1HFN A;  4LAA A;  3M4Y A;  3IFD A;  3SK6 A;  4X3U A;  5KND A;  1EU4 A;  3ERQ A;  3TME A;  2EJM A;  2EZV A;  1U4P A;  5EPJ A;  1STH A;  4IAL A;  2AQ2 B;  3BVZ A;  1UAP A;  3DUZ A;  5FO7 B;  5CV5 A;  2SNS A;  2BDN A;  3T4A C;  2L55 A;  3I73 A;  3DWA A;  3GTQ B;  2J4X A;  3P1H A;  4XT1 B;  1K8O A;  5I4D A;  2BE5 C;  2XSC A;  3J81 L;  1HA6 A;  1TY0 A;  4QUF A;  2PZU A;  5DAU A;  1SE3 A;  4A3J B;  3ERO A;  4RGT A;  4WRD A;  2FMC A;  5JVH 3;  3S16 B;  3VYR A;  4K2L A;  2IJ0 A;  1AW7 A;  3U9S A;  4FO2 A;  4NMZ A;  1ZYR C;  5CV9 A;  4HED A;  5CV6 A;  4FF4 A;  1O7L A;  1MD2 D;  3DMU A;  1XWE A;  3PIP 3;  4G4K A;  3D6C A;  2R93 B;  2H4O A;  4N9P A;  4NKL A;  1O78 A;  4RHS A;  4DXG A;  2NUC A;  3W2D A;  3AMU A;  2MPM A;  2F0G A;  1DYQ A;  1FNU A;  4OO1 I;  2K05 A;  4IFD G;  3GTO B;  2F0S A;  4C3J G;  5C4X B;  2E2H B;  1JC7 A;  1XTC D;  5IGE A;  2E76 C;  1D1I A;  4XXE A;  2NVT B;  1TWH B;  1EY5 A;  5D3D A;  1I4Q A;  3ITP A;  1SJH D;  3LNN A;  2C9O A;  4OO1 H;  3P7J A;  1H9K A;  1SYF A;  2EY5 A;  4A3D B;  1STE A;  1UUP A;  3BG3 A;  4ZUI A;  1J8I A;  1T5E A;  1FR3 A;  1TY2 A;  4CKC A;  1B9N A;  4X3K A;  1SSO A;  1VMC A;  1EEF D;  4CBV A;  1LAC A;  1II3 A;  1QG7 A;  3QO2 A;  3RUZ A;  1TS5 A;  3MVV A;  2Z8L A;  3MEH A;  2J7Z A;  4DAV A;  3M7N A;  5CBE E;  4ULL A;  3PO3 B;  1O80 A;  5JPM C;  2KQ3 A;  2ICI A;  2F0P A;  1V1P A;  5C3X A;  4DK1 A;  1GUT A;  2SEB D;  2PCF B;  2JSO A;  4EQP A;  2O4X A;  4C3H B;  1B9M A;  5DNF A;  3QJY A;  3S1N B;  5D3I B;  5CGK A;  4TSS A;  2AQ1 B;  4ABN A;  1JOQ A;  3I91 A;  3D4D A;  1I6H B;  2F3W A;  3SXH A;  1BOS A;  3A54 A;  4ZK9 B;  4LMQ D;  3CHB D;  2B2W A;  1SYE A;  2RDF A;  2B2Y A;  3VR4 A;  1U9R A;  5EQ0 A;  2HUG A;  1SNQ A;  2IPK D;  3RZO B;  3I4M B;  5CBA E;  3DXJ C;  4KD4 A;  1AZQ A;  2JA6 B;  4OGQ C;  1YNN C;  4TQU S;  4RFB A;  1U4L A;  2GA4 B;  4Z9C B;  1LTR D;  3V2T A;  1KAA A;  3S1R B;  4F7X A;  1STN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...