5DM73

Crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
65
structure length
65
Chain Sequence
PKMKTHKMAKRRIKITGTGKVMAFKSGKRHQNTGKSGDEIRGKGKGFVLAKAEWARMKLMLPRGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic characterization of the ribosomal binding site and molecular mechanism of action of Hygromycin A.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L1
total genus 7
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF01632 Ribosomal_L35p Ribosomal protein L35
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.530 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dm7300
5DM73 4U673 3PIO3 3PIP3 4WFN3 5JVG3 5DM63 5JVH3
chains in the Genus database with same CATH superfamily
3S16B 2HDMA 5C0XH 3S2DB 1VQCA 4L5QA 2A69D 4MN3A 1B50A 5CORA 1SROA 2A73B 1J5EL 1GVPA 2O2LD 5LHY1 2UXCQ 5GQOA 1M90C 4KJNA 3ZYYX 3EQLC 1QZHA 2JA9A 4K5WA 1Y1VG 2HIXA 1E24A 2E76C 1CK1A 1X54A 4OEMB 4AIMA 3GTLH 1A3VA 1S5ED 4ALPA 3E3XA 2OTLA 1S40A 1DCZA 5ELFA 4XXEA 2CFMA 1VQ5A 4H13C 1DYQA 3I8ZA 2AUJD 1WTQA 1V1PB 1BO0A 1I50B 3I91A 2I5MX 1ET6A 3FDTA 2QDBA 1PFSA 4DV6Q 3HOUB 4GLVB 4XTCS 5JEAJ 1IKLA 1B9MA 2PNRC 4A3MB 4QIWE 1O7IA 4B9XA 4IN3A 3DMUA 1IL2A 5C4JH 4UY8C 5M5XH 1PTOC 1GJXA 3OWEB 4JI8Q 3G4SA 3BYTB 2RDHA 1P8LA 5JJLA 1D1IA 2MJ8A 3S9WA 4ABNA 1CHPD 1H9RA 4DV4L 2L0CA 4IUNA 2RHSB 3BVZA 1VQJA 2EYMA 2UXBL 4FDBA 3EFXD 4DPGA 5KNCA 2PPBC 2FXQA 5KEEA 2XWJB 2BE5C 3E5SA 4A3MH 2QF7A 5I9PA 4IOCA 3GTQB 1MD2D 5A35A 1BBWA 2I5HA 3QR8A 1YNXA 1V1OA 3H09A 1A0IA 3WDNA 1I50H 1FJGL 4CDFC 2J7ZA 3MA2B 4DR2Q 4QQBX 2K7VA 5IYDH 1DOLA 2N49A 2D5DA 4A3EB 4BBRH 1GXDC 3NBHA 3PO2G 1SNMA 5M3FH 2YV5A 3KFUA 3KOJA 5CC4A 1EOTA 4RGTA 4UDUC 1EQVA 3H3VI 1FNWA 1U0LA 2PMZB 1L1OA 4OGQC 1VQ7A 3OPOA 2ES2A 1LTAD 1PRTD 4G7OC 5T1GA 1TXYA 5J22A 2AWNA 4IO9A 5I9OA 1IZ6A 4X62Q 3G71A 1Z6HA 3HKZB 3M85A 4RMFA 3URYA 4AH6A 3SK6A 1Y8NB 4KKUA 1HUMA 3NXWA 3PO3G 3TP7A 4ID6A 4R4IA 2UXDL 2MNAA 4JI2L 4DFAA 3PUVA 2K32A 4F88A 4OIJA 2EJFC 1X3GA 4ZCKA 2Y0SG 2I07B 4FVMA 5BN3A 4OX9Q 1Q81C 2EY1A 2C5CA 1SRUA 1AFPA 1JE5A 5C6AA 2E2HB 5A2QE 1PFNA 1RDPD 4IFDH 4KJOA 2BH8A 4L5SA 2YTXA 5IP9G 2ZXRA 4DV1Q 4IUTA 2ASBA 4BXXH 3TS0A 2Z8LA 3NE5B 1VF5C 1STBA 4TVAB 3J7AF 3FVQA 1ENAA 3U4VA 4G7HC 2NN6G 1IBML 1V8QA 3BDOA 1EWCA 2ALYB 5LMNQ 1KLUD 1BR9A 2PMZE 5T1IA 5CV4A 2CW0D 1NR4A 1W6JA 2IL8A 1T5XD 4HCSA 4KHPQ 2V1CC 1Y1WB 5BN4A 1WOCA 1XPUA 4DR7L 4LF6L 3I4MH 2KCCA 3GTQH 2RSOA 3S1NH 4I7AA 1LTLA 2D9UA 1JJCB 3CU7A 5G3LF 2WB1B 1B70B 1G2SA 4I65A 3ITPA 5E4WC 5D14A 4KV6A 2FMMA 4LFCL 3J81j 3A8IE 5G3LD 4A76A 3PIP3 3JAME 1JT8A 2H5XA 1BOSA 4LF5Q 5E4XA 2WP8J 2D0OA 5CBAE 3H94A 1EQTA 3AB9A 1N36Q 4QCLA 2E2JB 2K5QA 3HOXH 3AFQA 3SVMA 1D5MC 4FP5D 3T4AC 2G5DA 5FJ8G 3KF6B 5M3FB 4F8MA 3M4QA 1SLJA 2B3GA 5I6WA 4JBMA 1WYDA 1I4RA 2AMCB 1PLFA 1X56A 2YTVA 3TN2A 4DXGA 5K5PA 3IKJA 1YHAA 4R4QA 5C5MA 3SK8A 1PH4A 2A8VA 4OWXB 4A3LG 4R4OA 5LL6S 2R6GA 4ZYSA 4B3MQ 3AQQA 4JI1L 1TY2A 4YIJA 1EY4A 4P2CB 1SNDA 4RG1A 2BH2A 5C4XH 1HNXQ 4YHHQ 1L1OB 2F0IA 2Z9HA 5CBEE 2K50A 1Q86C 4LF8L 4A3IB 1AE3A 2JQOA 1K73C 4JI7L 4NMZA 2DY8A 1WFQA 3UDIA 3ND9A 4WORA 3MFYA 4MHEA 2LXKA 4YHHL 1WD1A 4N8FA 2YU9H 3UE1A 1XPOA 1XNQL 5IWAQ 4B3RQ 4J1MA 4KTAA 3I73A 1PH2A 1PFBA 2VXWA 1DD2A 2EPBA 1STEA 1OO9B 3ONAB 1XPRA 3J80c 4NKLA 3S1MB 4DUYL 4ME5A 2EYJA 3GTPB 1BKBA 2KUMA 4JW0A 5CGKA 3AU7A 4QGUA 3HOXG 2C35B 1AH9A 1ICFB 3GTLB 2EVBA 4ILWA 1WTRA 2WINB 1EY6A 3T1YL 4FF4A 4PMCA 2KHIA 2WAQB 4MZ9A 4DK3C 1PV4A 1SN8A 1TS2A 3D31A 2PQAB 4H02A 1IXRA 1C48A 1FNUA 4JI4Q 4M1UB 5D3IB 1VMCA 1X9NA 3S16H 1U4MA 2RDFA 1SJED 3PUZA 4IURA 4CDDC 4LF4Q 3K80C 4HJAA 4DR4Q 1HQRD 1ENCA 1UEAB 4A3CG 1QE6A 1CA5A 3HOVG 2CH4A 3F2DA 3X3NA 3U9SA 2CWAA 5FKAC 4X3SA 2JEBI 4POGA 2B2YA 1TS5A 5M9OA 1STNA 3PCOB 3W5OA 1PTOF 1BXTA 2F0TA 5CV5A 3TMEA 3J80i 1B3QA 1SMYD 2K1BA 3CMAA 3DEOA 2JA8G 3SE0A 4FF3A 3G6JB 3CCSA 1IYJB 4DNRB 2NYZD 3V2TA 2EYPA 2QCPX 3RLNA 2XGTA 1WCMG 1PTOH 1TY0A 2E5LQ 3NEMA 5DLQE 2EJMA 3STBD 5HY6A 1WI5A 1S5BD 5J1ZA 1VQNA 1U4RA 3M4YA 1TWHB 2UUCL 1CFMA 3V96A 2NTSA 1L0YB 2DNEA 2N3SA 4K6LA 2RDGA 3DM3A 2F0DA 4HR7B 4QF4A 5BR8Q 4C2MB 1SAPA 4YY3L 1VQMA 1N8RC 4LF9L 3S14B 4DR1Q 2A6ED 2VW9A 3NWSA 2ATWA 2EY6A 2YYZA 2VY3A 2EYOA 2ID0A 4X65Q 2XRSD 3VR5A 4Z9CB 3RR5A 5IGCA 5FO9B 1X32A 2B2VC 3QOJA 1QVGA 4DR7Q 4NXML 1AE2A 4JOIA 2P5ZX 2QKIC 4PMWA 3L0OA 2IHFA 4KLKA 2B2UC 4A3JB 1BBXC 4C56C 2JXMB 1PMRA 4C3IH 3OW7A 3DLLA 1F2LA 3BZCA 1K8OA 4JI2Q 1SMYC 5M3MH 4TRDA 3T51B 1VQ4A 1IW7D 4EQ5A 3TRZA 1LT6D 1STGA 3A55A 1WTXA 5L37A 1Y1VB 4IPHA 4BBSB 1CQVA 1ZXTA 2V4DA 3GQBA 1F9PA 3ULJA 4GOPC 5JJKA 4HMJA 3VR6A 1IBKL 1YZ6A 4OO1I 1S3OA 3OHXC 4IJHA 2A68D 4K8JA 2K6AA 2RQXA 4P74A 2RKSA 3VR4A 4NPSA 3HOUH 4IUPA 1EY8A 1F2MA 1T5EA 2L15A 1EEFD 1TQOA 2PI2E 3HOUG 1XNRL 3GV6A 4HN7A 2EZVA 2F0SA 3S1QH 1BCPF 1QZGA 1EY5A 4JI0L 2UXDQ 1YNNC 2R61A 2VUMG 1RF2D 2F4IA 2KCMA 4Y7NH 2NZHA 1TS3A 5D3DA 4FXKC 3KJOA 4DUZQ 5F2DA 2B29A 1SYCA 4DUZL 1YEZA 4RHSA 4DR2L 4OL7A 4J15A 1EEID 5C4ZA 2SNSA 1L0WA 1C9OA 2F0NA 1PYSB 3ERSX 4BWGB 1MGSA 3S2HH 5TSSA 1LTTD 1PH8A 3PO3H 4KHZA 1FYCA 2IX0A 2R92H 2UXBQ 5FO7B 2HHHL 1HNWQ 1L2FA 3M4OB 4UP8A 1B3AA 4R1JA 5ELDA 5IY0A 2QILA 3CW2C 3KF8A 1YNJD 4YWKA 1TKWB 1AW7A 3X3MA 3NENA 2IWHA 3ULLA 1E2ZA 1OXVA 2PI2A 2HDLA 1B7YB 1S5DD 1XMOL 5E1FA 1K8AC 4OONA 3S2HB 2OXPA 2UUCQ 1LYLA 3A74A 4LF7Q 3CCLA 4KKTA 2QEJC 3R8BA 1BNZA 3QG1A 2IY5B 3ND8A 2N88A 4X3KA 2EQSA 2CKZB 1K3RA 3GTKH 1NBWA 1Y8OB 3CRKC 1SSOA 2E5LL 2SDFA 4CHTB 5KYLA 4POFA 1NUCA 1HJPA 1E1TA 3QB3A 2QDLA 1YITA 2YU9B 4RH6A 2R93H 3CAMA 4A4IA 2BOSA 2L5TA 2BDNA 3HKZE 2OEOA 1B53A 4DV5L 2DJGC 4CJ1B 4DR1L 3D4DA 1JB7A 2R92G 4DKAC 1FL0A 1GOZA 1A2UA 1BBUA 4X65L 4H7BA 2PO4A 2KBNA 1CUKA 1NE3A 1NMGA 3I56A 1G2TA 2I5LX 4DA2A 3Q0AA 2CVRA 4LF9Q 3TQYA 1OXXK 3K5LA 4JV5L 1H9SB 4DV2Q 4N9TA 2I46A 3SHLA 5FLMG 2VQEL 2CQAA 3ZJYC 1XMQL 1KABA 4LF4L 3S17B 4CKEA 4JOIC 2VB3X 1S5FD 3MTSA 2NN6H 1I4HA 1CKNA 3FMCA 5CYUA 5IYCH 3HOZG 4A3EH 2K75A 3S15B 1YIJA 5EPJA 2QW7A 1DOMA 4L5TA 1XX8A 2F0FA 5M3MB 2B2TC 3EVQA 1UE5A 2NTTA 2R3ZA 4GN3B 4MTNA 3TEHB 3K5OA 4DF7A 4AYBG 1J5EQ 1DZ1A 3QJYA 3S1NB 4YCUA 3FKIH 2JA6B 4X6AH 2JYOA 1Y69U 1Y1WH 4DNIA 3MWYW 1TWGB 1IL8A 1MIUA 3RZDH 1HR0Q 4YCWA 1HFNA 5FLXc 4A3KG 1TWAH 3NTKA 4DK1A 3I2ZA 3J81c 4Q5VA 2WB1G 2MQHA 2XIWA 5IYDG 4FF2A 5C4JB 1EWHA 1Q12A 3CQZH 3LGJA 1JC7A 3PQIA 4JI7Q 3MXNA 1SR3A 2F0HA 4BBSH 1YHQA 4LF8Q 1OXSC 4X3TA 2JA7H 4GNXA 3DWQA 4DV0L 1SXTA 3U58A 2N78A 4P71A 3K5MA 2B63G 2JA5B 2B39A 4MIUA 4LK1C 5JPNC 5K36G 1HA6A 4EVOA 2EOTA 4BA2I 1MSHA 4C3JB 4A3JH 1WTHA 5DM73 5IWAL 3K7UC 2B2YC 2AHOB 2NUCA 3PSIA 2SOBA 3TS2A 3HFZB 4ZUJA 3WOFA 4GN5A 4QJFA 1PRTF 2AQ1B 2JN4A 2XN9C 2YTYA 3MZ5A 5JVG3 5C3WA 4IALA 4LFBQ 4L8JA 1CM9A 4DV3L 4HIMA 1DOKA 2F0OA 4IPDA 3GP7A 5CMDA 1II3A 1VQBA 5I2YA 5LMUL 5JOBA 5KNDA 1QWYA 3CHBD 4EQNA 2XNAC 4OIKA 4GLXA 2VL6A 4K6DA 4EX5A 3H91A 2NZOA 2PQEA 4LUOA 4RKBA 1LTGD 4PZ8A 3PUXA 1K9MC 4X64Q 3VA5A 5ELOA 2PZWA 3W2DA 5J3BA 1ICWA 5FLMH 1SJHD 4A3DH 4EGVA 3P20A 1UE7A 4JBWA 3FHWA 4HCEA 2Q8RE 1F2ZA 1U4PA 3ULPA 3E0EA 2F1MA 4B3SQ 2B2UA 5ISRA 1HZAA 3HS0C 5DM63 2K28A 1RD9D 3K0YA 4IQZA 1E2WA 3HGBA 2OF1A 3R3OA 2JA7B 4C3HG 2UUBL 2AUKA 1XYIA 1JOOA 2Z6BA 1PRTB 4R4CA 2Q2UA 5K36H 2ZM6L 2WB1E 2ZTCA 1K0SA 3A0JA 1HZCA 5GAGC 5ELBA 3BZDB 3F2BA 1HR0W 4JYAQ 1UNSA 2Q2IA 4QMGA 3UDGA 2VB2X 1HCZA 1TWAB 1AP0A 5IP7H 3F2CA 2ZTDA 2ZT9C 3I4MG 1EIGA 1D5XC 4K0KQ 3RZDB 3J81L 1CKMA 4DV5Q 5IP9H 2OCEA 2F0KA 1JMCA 2D0PA 2VQFL 4A3DG 4DGZA 1SYGA 5EPLA 3AFPA 4OELB 3RZOB 1PDQA 1N34Q 3HOVB 2NN6I 4B3TQ 1EL0A 4NDXA 4RHRA 2J4XA 4QUCA 3VDYA 5KYIA 3PF4A 2O4XA 3P75A 2EDGA 4ZUIA 5EKKA 3EA6A 3KLRA 5IT9L 4AYBE 1ASZA 2CW0C 3FPPA 3NWTA 3VYSA 3AYHB 1KD1C 3IAYA 5CR3A 1SE8A 4UAIA 2OQ0A 2DJFC 1JB3A 2F3WA 2VNUD 3CCJA 2AWOA 2AQ3B 3NELA 1E22A 1UEBA 4CKBA 1XWEA 4DR4L 1QVFA 1EZ8A 4X62L 1O7ZA 1R9TH 1RHPA 4A93B 3J7ZC 2LS01 1EYAA 4K2KA 4IZ8A 4HTHA 4K2LA 3T13A 3A54A 4CBVA 1TWGH 2NVTB 5FK9C 4BS9A 4DV3Q 1P16A 1D5ZC 4X66Q 3HOYH 1EIFA 4XT1B 2JEAI 1SFOH 1JORA 4DR3L 1F77A 1WJJA 3FP9A 2F0JA 4GNXC 1NNXA 3HKZG 1YJNA 4ODGA 1FJGQ 1CSPA 3GTJH 4HEDA 1HZBA 1R4PB 2UUAL 2OT2A 3T56B 1HZ9A 5DEHA 4JI0Q 1RTOA 4A3CH 1R9TB 4JVZA 3OMGA 4NXNL 4A3FH 2DNCA 3RUZA 3HZXA 5COYA 2NVQB 2F0WA 1IYUA 1MJEA 4BY7B 1HTPA 3HKSA 1QOHA 3Q23A 5J39A 3C46A 2BDOA 3H0GH 3MHBA 1E2VA 4WJ4A 2MO0A 3GTOB 1D8LA 4DV7Q 3G48A 3MC0B 3F2UA 4DAMA 1M8AA 4O42A 5IGBA 3HOYG 4WJWA 1VQ8A 2K52A 2B8GA 4HJ8A 5C0XI 4MTKA 4JBJA 1HR0L 1DONA 4B3ML 1NJIC 4LJZC 5IP7G 3BDCA 1Q7YC 3TREA 5C0XG 3RN5A 1PRTC 4EQPA 1ILPA 3BJUA 1VF7A 3LWUA 4PZ7A 4DV4Q 1VQDA 1S72A 3NBIA 4KY6A 3IRBA 3J81E 5EJWA 4IOAA 1LTBD 3OOCA 5ELNA 3CC2A 3K6OA 2X69A 2F0PA 3S1QB 4O1NA 1CQFA 5C0XJ 3OSOA 1EY0A 5M5YB 4WRDA 1QUQB 3CCEA 4JI8L 3RN2A 1J8IA 4JI6Q 3ICEA 2JK8A 4G4KA 4B9WA 3BZKA 1XMQQ 3K81C 1RKNA 4CDEC 4R8IA 2F52A 3M3YB 2MUYA 4ZQ3A 4A3BH 4JPBW 4DR6L 2PZUA 5IT9E 1RCVD 1E7ZA 1WTOA 1EUJA 1PVOA 2IW3A 1KIXA 1U5KA 2L1BA 1CI3M 5HGTA 4DNTB 1TT2A 3NQIA 2GVAA 1ZYRD 2VUMH 3CF5A 5LMNW 2I0QA 3C3LA 3MEHA 2KOLA 3KDFA 1VMPA 3KJPA 2PQAA 4IPCA 1YJWA 5AJ3Q 2KQ3A 2NVYB 5AJ3L 3I4NB 1MI2A 2NVXB 2EY5A 4KN4C 2A6HD 5JEAH 4GOPB 4NP5A 4JCVE 2ENBA 1K3BC 4K14A 1G51A 5IYBH 2R7ZB 1HQMC 3W1BA 4LFAQ 3KYHC 1LM0A 2TMPA 4OO1H 2G9DA 4HSPA 2RF4A 1BDOA 5E7NA 4A3BG 2N55A 2FJ2A 1GKHA 3KUPA 5GROA 1ZEQX 1QG7A 5EGTA 3JC66 1IBMQ 3GTGH 2HIVA 5I4DA 4GKKQ 5FO8B 4CGYB 5JPMC 1LTSD 3U9OA 5M5XB 4H0LC 4DAYB 2BA1A 4KY7A 1VQKA 1WVLA 1G291 3J7AV 1EWIA 1SYDA 1B1ZA 1RODA 4C3JH 4B08A 3FPUB 3EN2A 3CD6A 4BBRB 3E0JA 3EROA 3A5ZB 4DR5Q 4RA8A 2LFNA 2JP1A 3VA7A 4NW2A 4KD3A 2F3IA 2JA5H 2CCZA 1OXTA 2N8NA 1NR2A 1C4QA 2UU9L 1ML0D 3CRLC 2R7ZH 3M7GA 1MJCA 3R2TA 3PO2H 3IFDA 1O78A 3HOZB 2A6HC 4DV7L 4ZRZA 4FO2A 5ELCA 3S1RB 2ZJRA 2ZJQA 2K5DA 3PV0A 2FINB 2K5HA 2NVYH 1XNQQ 3Q8DA 5KGUA 1CHQD 2B2VA 3S2DH 4A3GH 3SDZA 1N32L 4QB4A 4ZKCB 2K5VA 4L6TB 4QUFA 2BA0A 1XTCD 1C7YA 3S14H 2JA6G 3OW2A 1PHJA 1VQOA 1BCPC 3D3RA 2J0TD 4KD4A 1LABA 1O80A 3GO5A 5FLXL 3VR2A 3CXCA 1W3SA 2R93G 1VQAA 2GVBA 4JI3Q 1EY9A 3KBXA 1QNKA 3EJIA 2A68C 3DHQA 1B2TA 4X3UA 3BVMA 3ER0A 3HOWB 5IE8A 1W6KA 3A7AB 1LTRD 1TU2B 4IJLA 3TSSA 4IFDJ 1GUNA 2FMCA 2E2IH 3PIO3 1HHVA 4A3FG 4G7ZC 1G91A 2LY7A 3VYTA 1I4GA 2E8GA 4DR5L 1N34L 2AQ2B 3GTKB 2KEDA 3OIPA 1LT5D 2E74C 2F3VA 1FNVA 3SGIA 4JC0A 4HJ7A 1EIYB 3L7ZC 3K8AA 1NMFA 1EFWA 3CP0A 1IBKQ 1QUQA 2VQFQ 1WCMB 3BU2A 1HFGA 4U673 1SE4A 1V43A 1Q8KA 3MEFA 4LUVA 4LF5L 4RKLA 2NB0A 3CPWA 2DUDA 4HIDA 1PYBA 5EBDA 3H3VC 3B6YA 3NBHB 3CC4A 5C4XB 3NK9A 3A8JE 3E9IA 1VCIA 4A75A 4JYAL 2L4NA 1BCPD 2WIIB 1PH3A 3SK5A 3A7LA 2M2LA 2B2WC 2C9OA 3NTIA 2GA4B 1HXYD 4PQXA 1V9PA 1E1OA 2XTIA 3CPFA 1KC8C 2NZ1D 1PFMA 2KCNA 1O7YA 1IBLL 3M7NA 1YVCA 4HIOA 5ELEA 3QO2A 3KLSA 3P7JA 1PTOD 4U68A 5JEAG 2H4OA 2F0VA 4A3JG 3MFGA 1RIPA 5C44B 4A3LH 4OWWB 3BVGA 1EIHA 1EU4A 1Y14B 1YBYA 3H0GB 4PNYA 1UUPA 2TSSA 5BR8L 1VQHA 1AZPA 3W3AA 1N33L 2PYKA 1SDFA 3M4PA 4PV1C 3EIVA 4UHVA 4IPGA 2KJXA 2Z4HA 3FKIG 4BBSG 4KN7C 5DAUA 1YJ9A 1Q1EA 2JA7G 4C3HB 3STBC 2ZM6Q 4A3GB 4GKJQ 3KK7A 1Q1BA 1PYWD 3MVVA 4AQYL 1V1PA 4V190 2RBMA 5DNFA 1KL9A 3CCQA 2EE1A 3IFTA 2RCFA 4QIWB 3V05A 5GAHC 2JA6H 4ME3A 4OHJA 3T1YQ 1UE1A 1TWCH 1ZYRC 3AMUA 1EFID 3J7YW 3CKIB 1SNCA 3I4MB 1Y1VH 1SNOA 1X6OA 4TKOB 1JJGA 5C5LA 4N9PA 4KK7A 4K5XA 4APVA 4C3HH 2VUMB 1BF4A 4ZAIA 3T53B 2WV6D 3Q22A 3HOVH 2QA4A 4A93H 5JAVA 1GM5A 4RAUC 3NP8A 4O0AA 4XYQA 3K59A 2Z1CA 1EZ6A 4DV0Q 4TSSA 1IHZA 3GTMB 4QL5A 2L55A 4LW1A 1NTGA 1LT4D 1B4OA 5M5YH 1GUGA 3CMEA 2K05A 4FF1A 3U4ZA 3S24A 2MFIA 4XT3B 1KAAA 4P73A 1KHIA 4ZK9B 1U4LA 2PW7A 4YCVA 2CQOA 1WCMH 1E0BA 2E2DC 3BS1A 1F9RA 1SMXA 1JJ2A 2RCNA 2KA7A 1PZKD 2A1AA 4BA1I 1GUTA 3LX0A 4A93G 3I55A 4A3EG 4CKCA 1D1KA 1ILQA 3NPPA 1K0RA 3OIQA 4ZLTF 3BG3A 1K28A 1QJOA 1VQLA 4JK1C 1B44D 2HT1A 3CCUA 1NSNS 1JQYD 3I7FA 3C1EA 4BY1B 1GUSA 2ZXOA 4DAVA 4C2MH 3MAQA 1XJVA 2MGSA 1HNXL 2K5NA 4KY5A 1KDCA 4C1NI 5I6YA 1KXLA 3M4OH 1VQ9A 4GZYC 1EYCA 4RGMA 3T16A 2R92B 1JOKA 1KAWA 1A3UA 2A5HA 2EYLA 3PO3B 3K0XA 2E2IB 3HP3A 1KNAA 1N36L 2K01A 2KHSA 2Q8TA 2RA4A 4BY7G 3G7LA 4FNFA 1N33Q 2MP1A 5C3EG 1KDBA 2Y0SB 2O5IC 4PZ6A 2SNMA 2A19A 1WTVA 2ZXPA 4LFCQ 3PUWA 4RFBA 2F0EA 4KKSA 4L63B 1SYEA 2Q8IB 4GN4B 1SFOB 1DJRD 2F0QA 4B3TL 3E9HA 1J6QA 4JI5Q 1V1QA 5D65A 1F2YA 4KHPL 3HOYB 2B2WA 5HGQA 1HNZL 1FGBD 4R8NA 2D62A 4R4TA 4RCOA 5GAEC 4LF6Q 2VQEQ 1DXMA 1EQQA 5IGFA 1K83H 2CWPA 2NVTH 3UDXA 4BXXG 5JVH3 2F0GA 3TDQA 4CJ2C 3PIPA 1KQSA 4DAPA 2PNHA 1I4XA 4HIKA 3VYUA 2MHVA 1FD7D 3MXNB 3J81i 2PCFB 4I7ZC 4JI6L 2BE5D 4HSVA 4DAYA 3S1RH 3DM1A 2EY2A 5KIXA 4XQNA 4Y52H 4BY7H 2ZTEA 1I6HB 5EKLA 4JG2A 4RCNA 3HEJA 5IYCG 3JAMi 1BQQT 4O2DA 3TBIB 4A3KB 3DWAA 1HNWL 5EBCA 2EXZA 2RVLA 1OXUA 1IKMA 3NUCA 2CH4W 1MHWC 2JJQA 1ESFA 3GTJB 5CV7A 3S1MH 1SEBD 2K33A 1YHBA 5CV6A 1K83B 4C3IB 3OYYA 4OX9L 2F0MA 1B8AA 4J6HA 3ERQA 3F8TA 2KVMA 1I94L 1Z7TA 1I6HH 3CQZB 3TZDA 3KLWA 1SNPA 1LT3D 3J80E 1R4QB 2NVXH 3SEBA 2KHJA 2LXJA 3KDFB 2Z0SA 3QWNA 3CCRA 3I4NH 5AFWA 4C3JG 1SYBA 1YI2A 1Q90A 1WD0A 1CTMA 2FFKB 2KEEA 2R7DA 3OMCA 3VYRA 2R7ZG 2XVSA 1NCVA 4PG3A 2LMCB 3N52A 1TWHH 3D0FA 4L5RC 4A3BB 3L3OC 4LMQD 3RMHA 4KI0A 2WACA 5KRUA 2E2JH 2HUGA 1X3PA 1JWUD 5M5WH 1RTNA 3NSWA 3K5NA 1TWFH 4V0BA 3U50C 2Q2HA 1G6ZA 4H44C 1A2TA 1JR0D 1CZWA 5EQ0A 4OWTB 2IPKD 4X66L 1Q8IA 3RZOH 3UI2A 4DU9A 4WJ3M 3KBGA 4C1NK 1EU3A 2KCTA 1X3FA 2JA8H 1XNRQ 2L12A 2XSCA 1I3QB 3A5UA 1WTWA 3FEWX 5CV9A 3RD4A 1E3PA 5H1SE 1A63A 4E6IA 3I4OA 1B9NA 3KF8B 1CA6A 3D8GA 1D2BA 1L1OC 1SNQA 1U9RA 3GTOH 4ULLA 2KENA 2Z4IA 2F0UA 3K7AH 1KRSA 1KTKA 2FHTA 2UU9Q 3TZUA 1O7LA 3PGZA 5E3FA 3HG9A 2O5JC 5JJZA 1QNUA 5GADC 2WFWA 2WAQG 4UP7A 1NY4A 3NHHA 4DV6L 1GUOA 4A3MG 2K5WA 4LFAL 1N9WA 5I2XA 4A3DB 4XQQA 1QB5D 2HQEA 3L9AX 5EAYA 1EOVA 1LACA 2A6EC 1PH6A 4LNQA 1TWFB 1RL2A 5FLXE 1TWCB 1M1KC 4CJ0B 2QEXA 1VS0A 3HOWG 1Y8PB 3PIOA 2VZAA 4A3FB 2E2HH 2RSNA 3D6WA 1MSGA 2MO1A 3RNUA 1H9SA 1I3QH 1KDAA 1MKHA 1HNZQ 2NBFA 2JA8B 1STYA 4HMIA 1IW7C 2PW5A 5C3XA 1Z9FA 1I4QA 1EYDA 1HUNA 4JI4L 1SBBB 5A2QL 2IT1A 1JWSD 3DXJC 4Y7NB 1D6EC 3HOZH 3PO2B 1TR5A 4LUZA 4B3SL 1GHKA 4XIGS 4LWCA 1PH5A 1A62A 1LUZA 3DEPA 5C4XG 2UXCL 2M9VA 4DK6C 3GV3A 5NUCA 1GD7A 3G6EA 2K14A 5JJIA 4X64L 4DXFA 5HURA 4YWMA 1FR3A 3MXUA 4DR6Q 5M5WB 4NB3A 1I6VC 1KLGD 3S17H 2WKCA 1HA5A 4DUYQ 2JSOA 3A8KE 1Q82C 1EYGA 1GUWA 3PUYA 5LMUQ 3LWEA 3QIAA 1YNND 2DN8A 3CCVA 1HPCA 3J7A5 4HAEA 4OO1G 3GTGB 5C44H 1C8CA 1H95A 1STHA 4FXGC 3H0GG 1LLRD 1J9OA 3CCMA 1QCBD 3T1HL 1DGSA 2Q2TA 3SR1A 1LV9A 5IOCA 2OWOA 4KHVA 2CHBD 3FKIB 3NQTA 3JAML 1VQGA 1BVSA 4JI1Q 4A3GG 4GS3A 4DR3Q 3TP8A 2UUAQ 2G9HD 4RGNA 4TQUS 1CSQA 1EY7A 3DWPA 1H9JA 4DK0A 3KLSX 1PXUA 1T9HA 1JCKB 2KECA 3M9BA 3JAMc 1GHJA 1PZID 1GO3E 2NWGA 1Q46A 3TP5A 1I4PA 4HJ5A 1CZGA 3UE0A 1TS4A 1PA6A 1YNJC 1K8MA 4A3KH 3WOEA 1DM0B 2GN5A 2XRQD 4JBKA 1SE3A 1RJTA 2ICEC 3R2IA 1QILA 2VS1A 2F4VQ 1CT1D 4AQYQ 1LO5D 1VQPA 4NXNQ 1ENFA 4GKJL 4N8X1 3LNNA 4P75A 3C1FA 5FJ8H 1Y1WG 1H9KA 3DUZA 2Z6KC 5EKIA 3HRZC 1JWMD 3TP6A 1G8ZD 3OTOQ 3O13A 2OQKA 1ZKOA 1ESRA 1FGUA 1VQ6A 3N6RA 2K4KA 2PZTA 3NTHA 4OXPA 1A3TA 2B8FA 3Q6SA 4HJ9A 2MPMA 4PMBA 4P72A 2EYFA 1Q3LA 4F87A 2EXDA 1D7QA 5BN5A 1A6XA 1VQEA 3I4NG 4NXMQ 4QY7A 5IYBG 2X6GA 3GDEA 3I72A 5M3FG 2ZJPA 5KNBA 2F0LA 1TVXA 2L9HA 4LAAA 4M8AA 3P1HA 3RLFA 5IT9c 3Q24A 4JV5Q 1KRTA 1VDZA 4ZKBB 3PF5A 4K0KL 2A74C 3GTMH 3EBEA 2DY7A 4Q0FA 5C4HA 4IUVA 4BY1G 3H15A 2E75C 1F9SA 1BUVT 4R9WA 3SK4A 4BY1H 1XXGA 3WWVA 3D4WA 1NAPA 1IYVA 1S4ZA 2R7FA 4DV1L 2EJGC 3I70A 5EPKA 1AZQA 1UE6A 5IGGA 1HRJA 1CKOA 3IL8A 2UUBQ 1JICA 4JI5L 4FYDA 3SXHA 1IBLQ 4DN4M 1QVCA 1X55A 4XYOA 1I5FA 4BBRG 2H1EA 1X3EA 4GOPA 4GNXB 5LMNL 1TIID 4A3IG 4UPAA 5C3EB 4LF7L 1FVIA 3RLOA 1UWVA 4CDCC 2B63H 1XMOQ 4FXDA 5LL6X 1A15A 3F1ZA 3W1GA 1ET9A 1WTPA 1ONLA 1XTDA 1Z47A 3OTOL 5CV8A 2K03A 3C2PA 2IJ0A 3I4LA 1W2BA 1SYFA 1PH7A 3S15H 4WFN3 3D4RA 3H6MA 1BCPB 3D6CA 1STAA 2HHHQ 3L2PA 2DGYA 3GD7A 1S5CD 4LFBL 1F9QA 3HOXB 2IHEA 4RGOS 5M3MG 4K5VA 1C0AA 3CC7A 2EYHA 3K57A 2HD3A 1PTOB 4AYBB 5IGEA 2M00A 2XWBB 1SE2A 4XQJA 1K8GA 3A56A 2QGQA 2EIFA 3BDLA 3I3CA 2IX3A 2WKDA 1OTCA 1VQIA 3I90A 5IGDA 5IIFA 1UAPA 2K04A 1X65A 2R93B 2HCIA 3MXGA 3KF6A 4JI3L 1M4VA 3M3YH 3H3VH 1PH1A 2RHQB 2X6LA 4B3RL 2AKWB 3K7AB 4C3IG 1HTLD 2F4VL 1N32Q 3K58A 3VR3A 4KMUC 1PZJD 2LSSA 2JE6I 4G57A 3UDFA 3T1HQ 2OTJA 4RWSC 1LTID 2A69C 3PMFA 2JA5G 2B2TA 2B63B 1PH9A 4IUUA 4EQOA 2HCCA 5C3EH 1X3QA 2SEBD 2LKVA 1A8VA 1AN8A 2IX1A 4UP9A 4GKKL 1KNEA 3J80L 3QOLA 1I94Q 5IODA 2NVQH 2D2CC 2Z6KA 4S3SA 1EQRA 4MNOA 1G6PA 2Y0SE 3E6ZX 1VQFA 3FRPB 1L0XB 3HOWH 2WAQE 1JE4A 3BYYB 4F7XA 3GTPH 4IFDI 4XDXA 4IUQA 2F03A 5FOBB 2L11A 3R93A 1MBYA 4IFDG 1AEXA 2HQLA 4YWLA 3AEVA 1H9MA 1CKNB 3MXPA 2BCOA 1JOQA 4J8QA 4K8IA 4YY3Q 5C44G 4A3IH 1ASYA 1HH2P 4DV2L 4GLAC 3OWFA 2ICIA
chains in the Genus database with same CATH topology
3S16B 2HDMA 5C0XH 3S2DB 2A69D 4MN3A 1B50A 5CORA 2A73B 2O2LD 5LHY1 4KJNA 3ZYYX 3EQLC 4K5WA 2E76C 1CK1A 1A3VA 1S5ED 1DCZA 5ELFA 4XXEA 4H13C 1DYQA 3I8ZA 2AUJD 1WTQA 1V1PB 1BO0A 1I50B 3I91A 1ET6A 3FDTA 2QDBA 3HOUB 4XTCS 5JEAJ 1IKLA 1B9MA 2PNRC 4A3MB 4B9XA 4IN3A 3DMUA 1PTOC 1GJXA 3OWEB 3BYTB 2RDHA 1D1IA 2MJ8A 3S9WA 4ABNA 1CHPD 1H9RA 2L0CA 4IUNA 3BVZA 2EYMA 3EFXD 5KNCA 2PPBC 5KEEA 2XWJB 2BE5C 3E5SA 2QF7A 5I9PA 3GTQB 1MD2D 5A35A 1V1OA 3H09A 3WDNA 2J7ZA 3MA2B 2K7VA 1DOLA 2D5DA 4A3EB 1GXDC 3NBHA 1SNMA 5CC4A 1EOTA 4RGTA 4UDUC 1EQVA 1FNWA 2PMZB 4OGQC 3OPOA 1LTAD 1PRTD 4G7OC 5T1GA 5J22A 2AWNA 5I9OA 1Z6HA 3HKZB 3M85A 3URYA 3SK6A 1Y8NB 4KKUA 1HUMA 3NXWA 3TP7A 4ID6A 4DFAA 3PUVA 2K32A 4F88A 4OIJA 2EJFC 2I07B 4FVMA 5BN3A 2EY1A 2C5CA 1AFPA 5C6AA 2E2HB 5A2QE 1PFNA 1RDPD 4IFDH 4KJOA 2ZXRA 4IUTA 2Z8LA 3NE5B 1VF5C 1STBA 3J7AF 3FVQA 1ENAA 4G7HC 2NN6G 1V8QA 3BDOA 1EWCA 1KLUD 1BR9A 5T1IA 5CV4A 2CW0D 1NR4A 1W6JA 2IL8A 1T5XD 4HCSA 1Y1WB 5BN4A 2KCCA 2RSOA 2D9UA 3CU7A 5G3LF 2WB1B 1G2SA 4I65A 3ITPA 5E4WC 5D14A 2FMMA 4KV6A 3A8IE 5G3LD 3PIP3 3JAME 1BOSA 5E4XA 2WP8J 5CBAE 3H94A 1EQTA 3AB9A 4QCLA 2E2JB 2K5QA 3SVMA 1D5MC 4FP5D 3T4AC 5M3FB 4F8MA 5I6WA 1I4RA 1PLFA 3TN2A 4DXGA 5K5PA 3IKJA 5C5MA 3SK8A 5LL6S 2R6GA 4ZYSA 1TY2A 4YIJA 1EY4A 4P2CB 1SNDA 2F0IA 5CBEE 4A3IB 4NMZA 2DY8A 3ND9A 4WORA 3MFYA 4MHEA 1WD1A 4J1MA 4KTAA 3I73A 1PFBA 2VXWA 1DD2A 2EPBA 1STEA 1OO9B 3ONAB 3S1MB 4NKLA 4ME5A 2EYJA 3GTPB 2KUMA 5CGKA 3AU7A 3GTLB 2EVBA 4ILWA 1WTRA 2WINB 1EY6A 4FF4A 4PMCA 2WAQB 1TS2A 3D31A 1C48A 1FNUA 4M1UB 5D3IB 1VMCA 1U4MA 2RDFA 1SJED 3PUZA 4IURA 1HQRD 1ENCA 1UEAB 1QE6A 1CA5A 3X3NA 3U9SA 5FKAC 4X3SA 2JEBI 2B2YA 1TS5A 5M9OA 1STNA 1PTOF 1BXTA 2F0TA 5CV5A 3TMEA 1SMYD 2K1BA 3DEOA 3SE0A 4FF3A 3G6JB 4DNRB 2NYZD 3V2TA 2EYPA 2QCPX 1PTOH 1TY0A 2EJMA 1S5BD 5J1ZA 1U4RA 3M4YA 1TWHB 1CFMA 3V96A 2NTSA 1L0YB 2DNEA 2RDGA 4K6LA 4QF4A 4C2MB 2F0DA 4HR7B 3S14B 1SAPA 2A6ED 3NWSA 2EY6A 2YYZA 2EYOA 2ID0A 2XRSD 3VR5A 4Z9CB 5IGCA 5FO9B 1X32A 2B2VC 3QOJA 2QKIC 4PMWA 2B2UC 4A3JB 1BBXC 4C56C 2JXMB 1PMRA 3OW7A 1F2LA 1K8OA 1SMYC 4TRDA 3T51B 1IW7D 1LT6D 1STGA 3A55A 1WTXA 1Y1VB 4BBSB 1CQVA 1ZXTA 2V4DA 3GQBA 1F9PA 4HMJA 3VR6A 4OO1I 3OHXC 2A68D 4K8JA 2K6AA 2RQXA 3VR4A 2RKSA 4IUPA 1EY8A 1F2MA 1T5EA 1EEFD 1TQOA 3GV6A 4HN7A 2EZVA 2F0SA 1BCPF 1EY5A 1YNNC 2R61A 1RF2D 2F4IA 1TS3A 5D3DA 4FXKC 5F2DA 1SYCA 4RHSA 4OL7A 1EEID 5C4ZA 2SNSA 2F0NA 4BWGB 1MGSA 5TSSA 1LTTD 4KHZA 1FYCA 2IX0A 5FO7B 3M4OB 1B3AA 5ELDA 2QILA 3KF8A 1YNJD 1TKWB 1AW7A 3X3MA 2IWHA 1E2ZA 1OXVA 2HDLA 1S5DD 5E1FA 3S2HB 2OXPA 4KKTA 2QEJC 3R8BA 1BNZA 3QG1A 3ND8A 2N88A 4X3KA 1Y8OB 3CRKC 1SSOA 2SDFA 4CHTB 5KYLA 1NUCA 3QB3A 2YU9B 4RH6A 2BOSA 2L5TA 2BDNA 2OEOA 1B53A 4CJ1B 3D4DA 1GOZA 1A2UA 4H7BA 2PO4A 1G2TA 4DA2A 3Q0AA 2CVRA 1OXXK 3K5LA 1H9SB 4N9TA 2I46A 3SHLA 2CQAA 1KABA 3S17B 4CKEA 2VB3X 1S5FD 3MTSA 2NN6H 1I4HA 3FMCA 5CYUA 3S15B 5EPJA 1DOMA 1XX8A 2F0FA 5M3MB 2B2TC 3EVQA 2NTTA 2R3ZA 3K5OA 4DF7A 1DZ1A 3QJYA 3S1NB 2JA6B 2JYOA 1Y69U 3MWYW 1TWGB 1IL8A 1HFNA 3NTKA 4DK1A 4Q5VA 2XIWA 4FF2A 5C4JB 1EWHA 1Q12A 1JC7A 3MXNA 2F0HA 1OXSC 4X3TA 3DWQA 1SXTA 3K5MA 2JA5B 2B39A 4MIUA 4LK1C 5JPNC 5K36G 1HA6A 4EVOA 2EOTA 4BA2I 1MSHA 4C3JB 5DM73 2B2YC 2NUCA 2SOBA 4ZUJA 3WOFA 1PRTF 2AQ1B 2XN9C 3MZ5A 5JVG3 5C3WA 4IALA 4L8JA 1CM9A 1DOKA 2F0OA 5CMDA 3GP7A 1II3A 5I2YA 5JOBA 5KNDA 1QWYA 3CHBD 4EQNA 2XNAC 4OIKA 4K6DA 3H91A 2PQEA 4RKBA 1LTGD 3PUXA 3VA5A 2PZWA 3W2DA 1ICWA 1SJHD 4EGVA 3P20A 4JBWA 4HCEA 2Q8RE 1F2ZA 1U4PA 2F1MA 2B2UA 5ISRA 3HS0C 5DM63 2K28A 1RD9D 3K0YA 4IQZA 1E2WA 3HGBA 2OF1A 3R3OA 2JA7B 4C3HG 2AUKA 1XYIA 1JOOA 1PRTB 5K36H 5ELBA 3BZDB 1UNSA 4QMGA 2VB2X 1HCZA 1TWAB 1AP0A 2ZT9C 1EIGA 1D5XC 3RZDB 3J81L 2F0KA 4DGZA 1SYGA 5EPLA 3RZOB 1PDQA 3HOVB 2NN6I 1EL0A 4NDXA 4RHRA 2J4XA 4QUCA 5KYIA 2O4XA 3P75A 2EDGA 4ZUIA 5EKKA 3EA6A 3KLRA 5IT9L 2CW0C 3FPPA 3NWTA 3VYSA 3IAYA 5CR3A 4UAIA 1JB3A 2F3WA 2VNUD 2AWOA 2AQ3B 4CKBA 1XWEA 1EZ8A 1O7ZA 1RHPA 4A93B 2LS01 1EYAA 4K2KA 4IZ8A 4HTHA 4K2LA 3T13A 3A54A 4CBVA 2NVTB 5FK9C 4BS9A 1D5ZC 4XT1B 2JEAI 1JORA 1F77A 2F0JA 4ODGA 4HEDA 1R4PB 2OT2A 3T56B 5DEHA 1RTOA 1R9TB 3OMGA 2DNCA 3RUZA 3HZXA 5COYA 2NVQB 2F0WA 1IYUA 4BY7B 1HTPA 1QOHA 3Q23A 5J39A 3C46A 2BDOA 3MHBA 1E2VA 3GTOB 3MC0B 3F2UA 1M8AA 4O42A 5IGBA 4WJWA 2B8GA 5C0XI 1DONA 4LJZC 3BDCA 5C0XG 1PRTC 4EQPA 1ILPA 1VF7A 3LWUA 3NBIA 4KY6A 3J81E 5EJWA 1LTBD 3OOCA 3K6OA 2X69A 2F0PA 3S1QB 4O1NA 1CQFA 5C0XJ 3OSOA 1EY0A 5M5YB 4WRDA 1J8IA 4G4KA 4B9WA 1RKNA 4R8IA 3M3YB 2MUYA 4ZQ3A 2PZUA 5IT9E 1RCVD 1WTOA 2IW3A 2L1BA 1CI3M 5HGTA 4DNTB 1TT2A 3NQIA 1ZYRD 3C3LA 3MEHA 2KOLA 1VMPA 2KQ3A 2NVYB 3I4NB 1MI2A 2NVXB 2EY5A 4KN4C 2A6HD 5JEAH 4NP5A 2ENBA 4K14A 2R7ZB 1HQMC 2TMPA 4OO1H 2G9DA 4HSPA 1BDOA 2N55A 2FJ2A 3KUPA 1ZEQX 1QG7A 5EGTA 5I4DA 5FO8B 4CGYB 5JPMC 1LTSD 3U9OA 5M5XB 4H0LC 2BA1A 4KY7A 1WVLA 1G291 3J7AV 1SYDA 1B1ZA 1RODA 4B08A 3FPUB 4BBRB 3E0JA 3EROA 4RA8A 2LFNA 2JP1A 3VA7A 4NW2A 4KD3A 1OXTA 1NR2A 1C4QA 1ML0D 3CRLC 3M7GA 3R2TA 3HOZB 3IFDA 1O78A 2A6HC 4ZRZA 4FO2A 5ELCA 3S1RB 2K5DA 3PV0A 2FINB 5KGUA 1CHQD 2B2VA 3SDZA 4QB4A 4ZKCB 4L6TB 4QUFA 2BA0A 1XTCD 1BCPC 3D3RA 2J0TD 4KD4A 1LABA 1O80A 3GO5A 5FLXL 3VR2A 1EY9A 3KBXA 1QNKA 3EJIA 2A68C 3DHQA 1B2TA 4X3UA 3BVMA 3HOWB 1W6KA 3A7AB 1LTRD 1TU2B 3TSSA 4IFDJ 1GUNA 2FMCA 3PIO3 1HHVA 1G91A 4G7ZC 2LY7A 3VYTA 1I4GA 2AQ2B 3GTKB 2KEDA 3OIPA 1LT5D 2E74C 2F3VA 1FNVA 3L7ZC 1WCMB 1HFGA 4U673 1SE4A 1V43A 4RKLA 2NB0A 5EBDA 3H3VC 5C4XB 3NK9A 3A8JE 1VCIA 2L4NA 1BCPD 2WIIB 3SK5A 3A7LA 2M2LA 2B2WC 2C9OA 3NTIA 2GA4B 1HXYD 4PQXA 2NZ1D 1PFMA 2KCNA 1O7YA 3M7NA 5ELEA 3QO2A 3KLSA 3P7JA 1PTOD 4U68A 5JEAG 2H4OA 2F0VA 3MFGA 5C44B 3BVGA 1EIHA 1EU4A 4PNYA 3H0GB 1UUPA 2TSSA 1AZPA 3W3AA 2PYKA 1SDFA 4PV1C 2KJXA 2Z4HA 4KN7C 5DAUA 1Q1EA 4C3HB 4A3GB 3KK7A 1Q1BA 1PYWD 3MVVA 1V1PA 4V190 2RBMA 5DNFA 2EE1A 3IFTA 4QIWB 3V05A 4OHJA 3AMUA 1ZYRC 1EFID 3J7YW 3CKIB 1SNCA 3I4MB 1SNOA 4TKOB 5C5LA 4N9PA 4KK7A 4K5XA 2VUMB 1BF4A 4ZAIA 3T53B 2WV6D 3Q22A 5JAVA 4RAUC 3NP8A 4XYQA 3K59A 2Z1CA 1EZ6A 4TSSA 1IHZA 3GTMB 2L55A 1LT4D 1B4OA 1GUGA 2K05A 4FF1A 4XT3B 1KAAA 4ZK9B 1U4LA 2PW7A 1E0BA 2E2DC 3BS1A 1F9RA 2KA7A 1PZKD 4BA1I 1GUTA 3LX0A 4CKCA 1D1KA 1ILQA 3NPPA 3OIQA 4ZLTF 3BG3A 1QJOA 4JK1C 1B44D 1NSNS 1JQYD 3C1EA 4BY1B 1GUSA 2ZXOA 4DAVA 3MAQA 2MGSA 4KY5A 1KDCA 4C1NI 5I6YA 4GZYC 1EYCA 4RGMA 3T16A 2R92B 1JOKA 1A3UA 2A5HA 2EYLA 3PO3B 2E2IB 3HP3A 1KNAA 2K01A 2KHSA 2Q8TA 2RA4A 3G7LA 4FNFA 2MP1A 1KDBA 2Y0SB 2O5IC 2SNMA 1WTVA 2ZXPA 3PUWA 4RFBA 2F0EA 4KKSA 4L63B 1SYEA 2Q8IB 1SFOB 1DJRD 2F0QA 5D65A 1F2YA 3HOYB 2B2WA 1FGBD 4R8NA 2D62A 4RCOA 1DXMA 5IGFA 5JVH3 2F0GA 3TDQA 4CJ2C 4DAPA 1I4XA 3VYUA 2MHVA 1FD7D 2PCFB 4I7ZC 2BE5D 4HSVA 4DAYA 3DM1A 2EY2A 5KIXA 4XQNA 1I6HB 5EKLA 4RCNA 3HEJA 1BQQT 3TBIB 4A3KB 3DWAA 5EBCA 2EXZA 2RVLA 1OXUA 1IKMA 3NUCA 1ESFA 3GTJB 5CV7A 1SEBD 2K33A 5CV6A 1K83B 4C3IB 2F0MA 4J6HA 3ERQA 2KVMA 1Z7TA 3CQZB 3TZDA 1SNPA 1LT3D 3J80E 1R4QB 3SEBA 3QWNA 5AFWA 4C3JG 1SYBA 1Q90A 1WD0A 1CTMA 2FFKB 2KEEA 3OMCA 3VYRA 2XVSA 1NCVA 2LMCB 3N52A 4A3BB 3L3OC 4LMQD 3RMHA 4KI0A 2WACA 5KRUA 2HUGA 1X3PA 1JWUD 1RTNA 3NSWA 3K5NA 4V0BA 1G6ZA 4H44C 1A2TA 1JR0D 1CZWA 5EQ0A 2IPKD 1Q8IA 3UI2A 4DU9A 3KBGA 4C1NK 1EU3A 2L12A 2XSCA 1I3QB 1WTWA 3FEWX 5CV9A 3RD4A 4E6IA 1B9NA 1CA6A 3D8GA 1D2BA 1SNQA 1U9RA 4ULLA 2Z4IA 2F0UA 1KTKA 2FHTA 3TZUA 1O7LA 5E3FA 3HG9A 2O5JC 5JJZA 1QNUA 3NHHA 1GUOA 2K5WA 5I2XA 4A3DB 4XQQA 1QB5D 2HQEA 3L9AX 1LACA 2A6EC 1TWFB 5FLXE 1TWCB 4CJ0B 1Y8PB 4A3FB 2RSNA 3D6WA 1MSGA 1H9SA 1KDAA 2NBFA 2JA8B 1STYA 4HMIA 1IW7C 2PW5A 5C3XA 1I4QA 1EYDA 1HUNA 1SBBB 5A2QL 2IT1A 1JWSD 3DXJC 4Y7NB 1D6EC 3PO2B 1TR5A 1GHKA 4XIGS 3DEPA 2M9VA 3GV3A 5NUCA 4DXFA 5HURA 1FR3A 3MXUA 5M5WB 1I6VC 1KLGD 2WKCA 1HA5A 2JSOA 3A8KE 1GUWA 3PUYA 3LWEA 3QIAA 1YNND 2DN8A 1HPCA 4HAEA 4OO1G 3GTGB 1C8CA 1STHA 4FXGC 1LLRD 1J9OA 1QCBD 3SR1A 1LV9A 5IOCA 2CHBD 3FKIB 4KHVA 3NQTA 3JAML 3TP8A 2G9HD 4RGNA 4TQUS 1EY7A 3DWPA 1H9JA 4DK0A 3KLSX 1PXUA 1JCKB 2KECA 1GHJA 1PZID 2NWGA 3TP5A 1I4PA 1CZGA 1TS4A 1YNJC 1K8MA 3WOEA 1DM0B 2XRQD 1SE3A 1RJTA 2ICEC 3R2IA 1QILA 1CT1D 1LO5D 1ENFA 3LNNA 3C1FA 1H9KA 3DUZA 5EKIA 3HRZC 1JWMD 3TP6A 1G8ZD 3O13A 1ZKOA 1ESRA 3N6RA 2PZTA 3NTHA 1A3TA 2B8FA 3Q6SA 2MPMA 4PMBA 2EYFA 1Q3LA 4F87A 5BN5A 1A6XA 2X6GA 3I72A 5KNBA 2F0LA 1TVXA 2L9HA 4LAAA 4M8AA 3P1HA 3RLFA 3Q24A 4ZKBB 1VDZA 2A74C 2DY7A 4Q0FA 5C4HA 4IUVA 2E75C 1F9SA 1BUVT 4R9WA 3SK4A 1XXGA 3D4WA 1NAPA 1IYVA 1S4ZA 2EJGC 3I70A 5EPKA 1AZQA 5IGGA 1HRJA 3IL8A 1JICA 4FYDA 3SXHA 4DN4M 4XYOA 2H1EA 1TIID 5C3EB 4FXDA 5LL6X 1A15A 1ET9A 1WTPA 1ONLA 1Z47A 5CV8A 2K03A 3C2PA 2IJ0A 3I4LA 1SYFA 4WFN3 3D4RA 3H6MA 1BCPB 3D6CA 1STAA 3GD7A 1S5CD 1F9QA 3HOXB 4RGOS 4K5VA 2EYHA 3K57A 1PTOB 4AYBB 5IGEA 2M00A 2XWBB 1SE2A 4XQJA 3A56A 3BDLA 3I3CA 2IX3A 2WKDA 3I90A 5IGDA 5IIFA 1UAPA 2K04A 2R93B 2HCIA 3MXGA 1M4VA 2X6LA 3K7AB 4C3IG 1HTLD 3K58A 3VR3A 4KMUC 1PZJD 2JE6I 4G57A 4RWSC 1LTID 2A69C 3PMFA 2B63B 2B2TA 4IUUA 4EQOA 2HCCA 1X3QA 2SEBD 2LKVA 1AN8A 2IX1A 1KNEA 3J80L 3QOLA 5IODA 2D2CC 4S3SA 3E6ZX 3FRPB 1L0XB 1JE4A 3BYYB 4F7XA 4IFDI 4XDXA 4IUQA 2F03A 5FOBB 2L11A 3R93A 1MBYA 4IFDG 1AEXA 1H9MA 3MXPA 2BCOA 1JOQA 4J8QA 4K8IA 3OWFA 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DM7 3;  4U67 3;  3PIO 3;  3PIP 3;  4WFN 3;  5JVG 3;  5DM6 3;  5JVH 3; 
#chains in the Genus database with same CATH topology
 3S16 B;  2HDM A;  5C0X H;  3S2D B;  1VQC A;  4L5Q A;  2A69 D;  4MN3 A;  1B50 A;  5COR A;  1SRO A;  2A73 B;  1J5E L;  1GVP A;  2O2L D;  5LHY 1;  2UXC Q;  5GQO A;  1M90 C;  4KJN A;  3ZYY X;  3EQL C;  1QZH A;  2JA9 A;  4K5W A;  1Y1V G;  2HIX A;  1E24 A;  2E76 C;  1CK1 A;  1X54 A;  4OEM B;  4AIM A;  3GTL H;  1A3V A;  1S5E D;  4ALP A;  3E3X A;  2OTL A;  1S40 A;  1DCZ A;  5ELF A;  4XXE A;  2CFM A;  1VQ5 A;  4H13 C;  1DYQ A;  3I8Z A;  2AUJ D;  1WTQ A;  1V1P B;  1BO0 A;  1I50 B;  3I91 A;  2I5M X;  1ET6 A;  3FDT A;  2QDB A;  1PFS A;  4DV6 Q;  3HOU B;  4GLV B;  4XTC S;  5JEA J;  1IKL A;  1B9M A;  2PNR C;  4A3M B;  4QIW E;  1O7I A;  4B9X A;  4IN3 A;  3DMU A;  1IL2 A;  5C4J H;  4UY8 C;  5M5X H;  1PTO C;  1GJX A;  3OWE B;  4JI8 Q;  3G4S A;  3BYT B;  2RDH A;  1P8L A;  5JJL A;  1D1I A;  2MJ8 A;  3S9W A;  4ABN A;  1CHP D;  1H9R A;  4DV4 L;  2L0C A;  4IUN A;  2RHS B;  3BVZ A;  1VQJ A;  2EYM A;  2UXB L;  4FDB A;  3EFX D;  4DPG A;  5KNC A;  2PPB C;  2FXQ A;  5KEE A;  2XWJ B;  2BE5 C;  3E5S A;  4A3M H;  2QF7 A;  5I9P A;  4IOC A;  3GTQ B;  1MD2 D;  5A35 A;  1BBW A;  2I5H A;  3QR8 A;  1YNX A;  1V1O A;  3H09 A;  1A0I A;  3WDN A;  1I50 H;  1FJG L;  4CDF C;  2J7Z A;  3MA2 B;  4DR2 Q;  4QQB X;  2K7V A;  5IYD H;  1DOL A;  2N49 A;  2D5D A;  4A3E B;  4BBR H;  1GXD C;  3NBH A;  3PO2 G;  1SNM A;  5M3F H;  2YV5 A;  3KFU A;  3KOJ A;  5CC4 A;  1EOT A;  4RGT A;  4UDU C;  1EQV A;  3H3V I;  1FNW A;  1U0L A;  2PMZ B;  1L1O A;  4OGQ C;  1VQ7 A;  3OPO A;  2ES2 A;  1LTA D;  1PRT D;  4G7O C;  5T1G A;  1TXY A;  5J22 A;  2AWN A;  4IO9 A;  5I9O A;  1IZ6 A;  4X62 Q;  3G71 A;  1Z6H A;  3HKZ B;  3M85 A;  4RMF A;  3URY A;  4AH6 A;  3SK6 A;  1Y8N B;  4KKU A;  1HUM A;  3NXW A;  3PO3 G;  3TP7 A;  4ID6 A;  4R4I A;  2UXD L;  2MNA A;  4JI2 L;  4DFA A;  3PUV A;  2K32 A;  4F88 A;  4OIJ A;  2EJF C;  1X3G A;  4ZCK A;  2Y0S G;  2I07 B;  4FVM A;  5BN3 A;  4OX9 Q;  1Q81 C;  2EY1 A;  2C5C A;  1SRU A;  1AFP A;  1JE5 A;  5C6A A;  2E2H B;  5A2Q E;  1PFN A;  1RDP D;  4IFD H;  4KJO A;  2BH8 A;  4L5S A;  2YTX A;  5IP9 G;  2ZXR A;  4DV1 Q;  4IUT A;  2ASB A;  4BXX H;  3TS0 A;  2Z8L A;  3NE5 B;  1VF5 C;  1STB A;  4TVA B;  3J7A F;  3FVQ A;  1ENA A;  3U4V A;  4G7H C;  2NN6 G;  1IBM L;  1V8Q A;  3BDO A;  1EWC A;  2ALY B;  5LMN Q;  1KLU D;  1BR9 A;  2PMZ E;  5T1I A;  5CV4 A;  2CW0 D;  1NR4 A;  1W6J A;  2IL8 A;  1T5X D;  4HCS A;  4KHP Q;  2V1C C;  1Y1W B;  5BN4 A;  1WOC A;  1XPU A;  4DR7 L;  4LF6 L;  3I4M H;  2KCC A;  3GTQ H;  2RSO A;  3S1N H;  4I7A A;  1LTL A;  2D9U A;  1JJC B;  3CU7 A;  5G3L F;  2WB1 B;  1B70 B;  1G2S A;  4I65 A;  3ITP A;  5E4W C;  5D14 A;  4KV6 A;  2FMM A;  4LFC L;  3J81 j;  3A8I E;  5G3L D;  4A76 A;  3PIP 3;  3JAM E;  1JT8 A;  2H5X A;  1BOS A;  4LF5 Q;  5E4X A;  2WP8 J;  2D0O A;  5CBA E;  3H94 A;  1EQT A;  3AB9 A;  1N36 Q;  4QCL A;  2E2J B;  2K5Q A;  3HOX H;  3AFQ A;  3SVM A;  1D5M C;  4FP5 D;  3T4A C;  2G5D A;  5FJ8 G;  3KF6 B;  5M3F B;  4F8M A;  3M4Q A;  1SLJ A;  2B3G A;  5I6W A;  4JBM A;  1WYD A;  1I4R A;  2AMC B;  1PLF A;  1X56 A;  2YTV A;  3TN2 A;  4DXG A;  5K5P A;  3IKJ A;  1YHA A;  4R4Q A;  5C5M A;  3SK8 A;  1PH4 A;  2A8V A;  4OWX B;  4A3L G;  4R4O A;  5LL6 S;  2R6G A;  4ZYS A;  4B3M Q;  3AQQ A;  4JI1 L;  1TY2 A;  4YIJ A;  1EY4 A;  4P2C B;  1SND A;  4RG1 A;  2BH2 A;  5C4X H;  1HNX Q;  4YHH Q;  1L1O B;  2F0I A;  2Z9H A;  5CBE E;  2K50 A;  1Q86 C;  4LF8 L;  4A3I B;  1AE3 A;  2JQO A;  1K73 C;  4JI7 L;  4NMZ A;  2DY8 A;  1WFQ A;  3UDI A;  3ND9 A;  4WOR A;  3MFY A;  4MHE A;  2LXK A;  4YHH L;  1WD1 A;  4N8F A;  2YU9 H;  3UE1 A;  1XPO A;  1XNQ L;  5IWA Q;  4B3R Q;  4J1M A;  4KTA A;  3I73 A;  1PH2 A;  1PFB A;  2VXW A;  1DD2 A;  2EPB A;  1STE A;  1OO9 B;  3ONA B;  1XPR A;  3J80 c;  4NKL A;  3S1M B;  4DUY L;  4ME5 A;  2EYJ A;  3GTP B;  1BKB A;  2KUM A;  4JW0 A;  5CGK A;  3AU7 A;  4QGU A;  3HOX G;  2C35 B;  1AH9 A;  1ICF B;  3GTL B;  2EVB A;  4ILW A;  1WTR A;  2WIN B;  1EY6 A;  3T1Y L;  4FF4 A;  4PMC A;  2KHI A;  2WAQ B;  4MZ9 A;  4DK3 C;  1PV4 A;  1SN8 A;  1TS2 A;  3D31 A;  2PQA B;  4H02 A;  1IXR A;  1C48 A;  1FNU A;  4JI4 Q;  4M1U B;  5D3I B;  1VMC A;  1X9N A;  3S16 H;  1U4M A;  2RDF A;  1SJE D;  3PUZ A;  4IUR A;  4CDD C;  4LF4 Q;  3K80 C;  4HJA A;  4DR4 Q;  1HQR D;  1ENC A;  1UEA B;  4A3C G;  1QE6 A;  1CA5 A;  3HOV G;  2CH4 A;  3F2D A;  3X3N A;  3U9S A;  2CWA A;  5FKA C;  4X3S A;  2JEB I;  4POG A;  2B2Y A;  1TS5 A;  5M9O A;  1STN A;  3PCO B;  3W5O A;  1PTO F;  1BXT A;  2F0T A;  5CV5 A;  3TME A;  3J80 i;  1B3Q A;  1SMY D;  2K1B A;  3CMA A;  3DEO A;  2JA8 G;  3SE0 A;  4FF3 A;  3G6J B;  3CCS A;  1IYJ B;  4DNR B;  2NYZ D;  3V2T A;  2EYP A;  2QCP X;  3RLN A;  2XGT A;  1WCM G;  1PTO H;  1TY0 A;  2E5L Q;  3NEM A;  5DLQ E;  2EJM A;  3STB D;  5HY6 A;  1WI5 A;  1S5B D;  5J1Z A;  1VQN A;  1U4R A;  3M4Y A;  1TWH B;  2UUC L;  1CFM A;  3V96 A;  2NTS A;  1L0Y B;  2DNE A;  2N3S A;  4K6L A;  2RDG A;  3DM3 A;  2F0D A;  4HR7 B;  4QF4 A;  5BR8 Q;  4C2M B;  1SAP A;  4YY3 L;  1VQM A;  1N8R C;  4LF9 L;  3S14 B;  4DR1 Q;  2A6E D;  2VW9 A;  3NWS A;  2ATW A;  2EY6 A;  2YYZ A;  2VY3 A;  2EYO A;  2ID0 A;  4X65 Q;  2XRS D;  3VR5 A;  4Z9C B;  3RR5 A;  5IGC A;  5FO9 B;  1X32 A;  2B2V C;  3QOJ A;  1QVG A;  4DR7 Q;  4NXM L;  1AE2 A;  4JOI A;  2P5Z X;  2QKI C;  4PMW A;  3L0O A;  2IHF A;  4KLK A;  2B2U C;  4A3J B;  1BBX C;  4C56 C;  2JXM B;  1PMR A;  4C3I H;  3OW7 A;  3DLL A;  1F2L A;  3BZC A;  1K8O A;  4JI2 Q;  1SMY C;  5M3M H;  4TRD A;  3T51 B;  1VQ4 A;  1IW7 D;  4EQ5 A;  3TRZ A;  1LT6 D;  1STG A;  3A55 A;  1WTX A;  5L37 A;  1Y1V B;  4IPH A;  4BBS B;  1CQV A;  1ZXT A;  2V4D A;  3GQB A;  1F9P A;  3ULJ A;  4GOP C;  5JJK A;  4HMJ A;  3VR6 A;  1IBK L;  1YZ6 A;  4OO1 I;  1S3O A;  3OHX C;  4IJH A;  2A68 D;  4K8J A;  2K6A A;  2RQX A;  4P74 A;  2RKS A;  3VR4 A;  4NPS A;  3HOU H;  4IUP A;  1EY8 A;  1F2M A;  1T5E A;  2L15 A;  1EEF D;  1TQO A;  2PI2 E;  3HOU G;  1XNR L;  3GV6 A;  4HN7 A;  2EZV A;  2F0S A;  3S1Q H;  1BCP F;  1QZG A;  1EY5 A;  4JI0 L;  2UXD Q;  1YNN C;  2R61 A;  2VUM G;  1RF2 D;  2F4I A;  2KCM A;  4Y7N H;  2NZH A;  1TS3 A;  5D3D A;  4FXK C;  3KJO A;  4DUZ Q;  5F2D A;  2B29 A;  1SYC A;  4DUZ L;  1YEZ A;  4RHS A;  4DR2 L;  4OL7 A;  4J15 A;  1EEI D;  5C4Z A;  2SNS A;  1L0W A;  1C9O A;  2F0N A;  1PYS B;  3ERS X;  4BWG B;  1MGS A;  3S2H H;  5TSS A;  1LTT D;  1PH8 A;  3PO3 H;  4KHZ A;  1FYC A;  2IX0 A;  2R92 H;  2UXB Q;  5FO7 B;  2HHH L;  1HNW Q;  1L2F A;  3M4O B;  4UP8 A;  1B3A A;  4R1J A;  5ELD A;  5IY0 A;  2QIL A;  3CW2 C;  3KF8 A;  1YNJ D;  4YWK A;  1TKW B;  1AW7 A;  3X3M A;  3NEN A;  2IWH A;  3ULL A;  1E2Z A;  1OXV A;  2PI2 A;  2HDL A;  1B7Y B;  1S5D D;  1XMO L;  5E1F A;  1K8A C;  4OON A;  3S2H B;  2OXP A;  2UUC Q;  1LYL A;  3A74 A;  4LF7 Q;  3CCL A;  4KKT A;  2QEJ C;  3R8B A;  1BNZ A;  3QG1 A;  2IY5 B;  3ND8 A;  2N88 A;  4X3K A;  2EQS A;  2CKZ B;  1K3R A;  3GTK H;  1NBW A;  1Y8O B;  3CRK C;  1SSO A;  2E5L L;  2SDF A;  4CHT B;  5KYL A;  4POF A;  1NUC A;  1HJP A;  1E1T A;  3QB3 A;  2QDL A;  1YIT A;  2YU9 B;  4RH6 A;  2R93 H;  3CAM A;  4A4I A;  2BOS A;  2L5T A;  2BDN A;  3HKZ E;  2OEO A;  1B53 A;  4DV5 L;  2DJG C;  4CJ1 B;  4DR1 L;  3D4D A;  1JB7 A;  2R92 G;  4DKA C;  1FL0 A;  1GOZ A;  1A2U A;  1BBU A;  4X65 L;  4H7B A;  2PO4 A;  2KBN A;  1CUK A;  1NE3 A;  1NMG A;  3I56 A;  1G2T A;  2I5L X;  4DA2 A;  3Q0A A;  2CVR A;  4LF9 Q;  3TQY A;  1OXX K;  3K5L A;  4JV5 L;  1H9S B;  4DV2 Q;  4N9T A;  2I46 A;  3SHL A;  5FLM G;  2VQE L;  2CQA A;  3ZJY C;  1XMQ L;  1KAB A;  4LF4 L;  3S17 B;  4CKE A;  4JOI C;  2VB3 X;  1S5F D;  3MTS A;  2NN6 H;  1I4H A;  1CKN A;  3FMC A;  5CYU A;  5IYC H;  3HOZ G;  4A3E H;  2K75 A;  3S15 B;  1YIJ A;  5EPJ A;  2QW7 A;  1DOM A;  4L5T A;  1XX8 A;  2F0F A;  5M3M B;  2B2T C;  3EVQ A;  1UE5 A;  2NTT A;  2R3Z A;  4GN3 B;  4MTN A;  3TEH B;  3K5O A;  4DF7 A;  4AYB G;  1J5E Q;  1DZ1 A;  3QJY A;  3S1N B;  4YCU A;  3FKI H;  2JA6 B;  4X6A H;  2JYO A;  1Y69 U;  1Y1W H;  4DNI A;  3MWY W;  1TWG B;  1IL8 A;  1MIU A;  3RZD H;  1HR0 Q;  4YCW A;  1HFN A;  5FLX c;  4A3K G;  1TWA H;  3NTK A;  4DK1 A;  3I2Z A;  3J81 c;  4Q5V A;  2WB1 G;  2MQH A;  2XIW A;  5IYD G;  4FF2 A;  5C4J B;  1EWH A;  1Q12 A;  3CQZ H;  3LGJ A;  1JC7 A;  3PQI A;  4JI7 Q;  3MXN A;  1SR3 A;  2F0H A;  4BBS H;  1YHQ A;  4LF8 Q;  1OXS C;  4X3T A;  2JA7 H;  4GNX A;  3DWQ A;  4DV0 L;  1SXT A;  3U58 A;  2N78 A;  4P71 A;  3K5M A;  2B63 G;  2JA5 B;  2B39 A;  4MIU A;  4LK1 C;  5JPN C;  5K36 G;  1HA6 A;  4EVO A;  2EOT A;  4BA2 I;  1MSH A;  4C3J B;  4A3J H;  1WTH A;  5DM7 3;  5IWA L;  3K7U C;  2B2Y C;  2AHO B;  2NUC A;  3PSI A;  2SOB A;  3TS2 A;  3HFZ B;  4ZUJ A;  3WOF A;  4GN5 A;  4QJF A;  1PRT F;  2AQ1 B;  2JN4 A;  2XN9 C;  2YTY A;  3MZ5 A;  5JVG 3;  5C3W A;  4IAL A;  4LFB Q;  4L8J A;  1CM9 A;  4DV3 L;  4HIM A;  1DOK A;  2F0O A;  4IPD A;  3GP7 A;  5CMD A;  1II3 A;  1VQB A;  5I2Y A;  5LMU L;  5JOB A;  5KND A;  1QWY A;  3CHB D;  4EQN A;  2XNA C;  4OIK A;  4GLX A;  2VL6 A;  4K6D A;  4EX5 A;  3H91 A;  2NZO A;  2PQE A;  4LUO A;  4RKB A;  1LTG D;  4PZ8 A;  3PUX A;  1K9M C;  4X64 Q;  3VA5 A;  5ELO A;  2PZW A;  3W2D A;  5J3B A;  1ICW A;  5FLM H;  1SJH D;  4A3D H;  4EGV A;  3P20 A;  1UE7 A;  4JBW A;  3FHW A;  4HCE A;  2Q8R E;  1F2Z A;  1U4P A;  3ULP A;  3E0E A;  2F1M A;  4B3S Q;  2B2U A;  5ISR A;  1HZA A;  3HS0 C;  5DM6 3;  2K28 A;  1RD9 D;  3K0Y A;  4IQZ A;  1E2W A;  3HGB A;  2OF1 A;  3R3O A;  2JA7 B;  4C3H G;  2UUB L;  2AUK A;  1XYI A;  1JOO A;  2Z6B A;  1PRT B;  4R4C A;  2Q2U A;  5K36 H;  2ZM6 L;  2WB1 E;  2ZTC A;  1K0S A;  3A0J A;  1HZC A;  5GAG C;  5ELB A;  3BZD B;  3F2B A;  1HR0 W;  4JYA Q;  1UNS A;  2Q2I A;  4QMG A;  3UDG A;  2VB2 X;  1HCZ A;  1TWA B;  1AP0 A;  5IP7 H;  3F2C A;  2ZTD A;  2ZT9 C;  3I4M G;  1EIG A;  1D5X C;  4K0K Q;  3RZD B;  3J81 L;  1CKM A;  4DV5 Q;  5IP9 H;  2OCE A;  2F0K A;  1JMC A;  2D0P A;  2VQF L;  4A3D G;  4DGZ A;  1SYG A;  5EPL A;  3AFP A;  4OEL B;  3RZO B;  1PDQ A;  1N34 Q;  3HOV B;  2NN6 I;  4B3T Q;  1EL0 A;  4NDX A;  4RHR A;  2J4X A;  4QUC A;  3VDY A;  5KYI A;  3PF4 A;  2O4X A;  3P75 A;  2EDG A;  4ZUI A;  5EKK A;  3EA6 A;  3KLR A;  5IT9 L;  4AYB E;  1ASZ A;  2CW0 C;  3FPP A;  3NWT A;  3VYS A;  3AYH B;  1KD1 C;  3IAY A;  5CR3 A;  1SE8 A;  4UAI A;  2OQ0 A;  2DJF C;  1JB3 A;  2F3W A;  2VNU D;  3CCJ A;  2AWO A;  2AQ3 B;  3NEL A;  1E22 A;  1UEB A;  4CKB A;  1XWE A;  4DR4 L;  1QVF A;  1EZ8 A;  4X62 L;  1O7Z A;  1R9T H;  1RHP A;  4A93 B;  3J7Z C;  2LS0 1;  1EYA A;  4K2K A;  4IZ8 A;  4HTH A;  4K2L A;  3T13 A;  3A54 A;  4CBV A;  1TWG H;  2NVT B;  5FK9 C;  4BS9 A;  4DV3 Q;  1P16 A;  1D5Z C;  4X66 Q;  3HOY H;  1EIF A;  4XT1 B;  2JEA I;  1SFO H;  1JOR A;  4DR3 L;  1F77 A;  1WJJ A;  3FP9 A;  2F0J A;  4GNX C;  1NNX A;  3HKZ G;  1YJN A;  4ODG A;  1FJG Q;  1CSP A;  3GTJ H;  4HED A;  1HZB A;  1R4P B;  2UUA L;  2OT2 A;  3T56 B;  1HZ9 A;  5DEH A;  4JI0 Q;  1RTO A;  4A3C H;  1R9T B;  4JVZ A;  3OMG A;  4NXN L;  4A3F H;  2DNC A;  3RUZ A;  3HZX A;  5COY A;  2NVQ B;  2F0W A;  1IYU A;  1MJE A;  4BY7 B;  1HTP A;  3HKS A;  1QOH A;  3Q23 A;  5J39 A;  3C46 A;  2BDO A;  3H0G H;  3MHB A;  1E2V A;  4WJ4 A;  2MO0 A;  3GTO B;  1D8L A;  4DV7 Q;  3G48 A;  3MC0 B;  3F2U A;  4DAM A;  1M8A A;  4O42 A;  5IGB A;  3HOY G;  4WJW A;  1VQ8 A;  2K52 A;  2B8G A;  4HJ8 A;  5C0X I;  4MTK A;  4JBJ A;  1HR0 L;  1DON A;  4B3M L;  1NJI C;  4LJZ C;  5IP7 G;  3BDC A;  1Q7Y C;  3TRE A;  5C0X G;  3RN5 A;  1PRT C;  4EQP A;  1ILP A;  3BJU A;  1VF7 A;  3LWU A;  4PZ7 A;  4DV4 Q;  1VQD A;  1S72 A;  3NBI A;  4KY6 A;  3IRB A;  3J81 E;  5EJW A;  4IOA A;  1LTB D;  3OOC A;  5ELN A;  3CC2 A;  3K6O A;  2X69 A;  2F0P A;  3S1Q B;  4O1N A;  1CQF A;  5C0X J;  3OSO A;  1EY0 A;  5M5Y B;  4WRD A;  1QUQ B;  3CCE A;  4JI8 L;  3RN2 A;  1J8I A;  4JI6 Q;  3ICE A;  2JK8 A;  4G4K A;  4B9W A;  3BZK A;  1XMQ Q;  3K81 C;  1RKN A;  4CDE C;  4R8I A;  2F52 A;  3M3Y B;  2MUY A;  4ZQ3 A;  4A3B H;  4JPB W;  4DR6 L;  2PZU A;  5IT9 E;  1RCV D;  1E7Z A;  1WTO A;  1EUJ A;  1PVO A;  2IW3 A;  1KIX A;  1U5K A;  2L1B A;  1CI3 M;  5HGT A;  4DNT B;  1TT2 A;  3NQI A;  2GVA A;  1ZYR D;  2VUM H;  3CF5 A;  5LMN W;  2I0Q A;  3C3L A;  3MEH A;  2KOL A;  3KDF A;  1VMP A;  3KJP A;  2PQA A;  4IPC A;  1YJW A;  5AJ3 Q;  2KQ3 A;  2NVY B;  5AJ3 L;  3I4N B;  1MI2 A;  2NVX B;  2EY5 A;  4KN4 C;  2A6H D;  5JEA H;  4GOP B;  4NP5 A;  4JCV E;  2ENB A;  1K3B C;  4K14 A;  1G51 A;  5IYB H;  2R7Z B;  1HQM C;  3W1B A;  4LFA Q;  3KYH C;  1LM0 A;  2TMP A;  4OO1 H;  2G9D A;  4HSP A;  2RF4 A;  1BDO A;  5E7N A;  4A3B G;  2N55 A;  2FJ2 A;  1GKH A;  3KUP A;  5GRO A;  1ZEQ X;  1QG7 A;  5EGT A;  3JC6 6;  1IBM Q;  3GTG H;  2HIV A;  5I4D A;  4GKK Q;  5FO8 B;  4CGY B;  5JPM C;  1LTS D;  3U9O A;  5M5X B;  4H0L C;  4DAY B;  2BA1 A;  4KY7 A;  1VQK A;  1WVL A;  1G29 1;  3J7A V;  1EWI A;  1SYD A;  1B1Z A;  1ROD A;  4C3J H;  4B08 A;  3FPU B;  3EN2 A;  3CD6 A;  4BBR B;  3E0J A;  3ERO A;  3A5Z B;  4DR5 Q;  4RA8 A;  2LFN A;  2JP1 A;  3VA7 A;  4NW2 A;  4KD3 A;  2F3I A;  2JA5 H;  2CCZ A;  1OXT A;  2N8N A;  1NR2 A;  1C4Q A;  2UU9 L;  1ML0 D;  3CRL C;  2R7Z H;  3M7G A;  1MJC A;  3R2T A;  3PO2 H;  3IFD A;  1O78 A;  3HOZ B;  2A6H C;  4DV7 L;  4ZRZ A;  4FO2 A;  5ELC A;  3S1R B;  2ZJR A;  2ZJQ A;  2K5D A;  3PV0 A;  2FIN B;  2K5H A;  2NVY H;  1XNQ Q;  3Q8D A;  5KGU A;  1CHQ D;  2B2V A;  3S2D H;  4A3G H;  3SDZ A;  1N32 L;  4QB4 A;  4ZKC B;  2K5V A;  4L6T B;  4QUF A;  2BA0 A;  1XTC D;  1C7Y A;  3S14 H;  2JA6 G;  3OW2 A;  1PHJ A;  1VQO A;  1BCP C;  3D3R A;  2J0T D;  4KD4 A;  1LAB A;  1O80 A;  3GO5 A;  5FLX L;  3VR2 A;  3CXC A;  1W3S A;  2R93 G;  1VQA A;  2GVB A;  4JI3 Q;  1EY9 A;  3KBX A;  1QNK A;  3EJI A;  2A68 C;  3DHQ A;  1B2T A;  4X3U A;  3BVM A;  3ER0 A;  3HOW B;  5IE8 A;  1W6K A;  3A7A B;  1LTR D;  1TU2 B;  4IJL A;  3TSS A;  4IFD J;  1GUN A;  2FMC A;  2E2I H;  3PIO 3;  1HHV A;  4A3F G;  4G7Z C;  1G91 A;  2LY7 A;  3VYT A;  1I4G A;  2E8G A;  4DR5 L;  1N34 L;  2AQ2 B;  3GTK B;  2KED A;  3OIP A;  1LT5 D;  2E74 C;  2F3V A;  1FNV A;  3SGI A;  4JC0 A;  4HJ7 A;  1EIY B;  3L7Z C;  3K8A A;  1NMF A;  1EFW A;  3CP0 A;  1IBK Q;  1QUQ A;  2VQF Q;  1WCM B;  3BU2 A;  1HFG A;  4U67 3;  1SE4 A;  1V43 A;  1Q8K A;  3MEF A;  4LUV A;  4LF5 L;  4RKL A;  2NB0 A;  3CPW A;  2DUD A;  4HID A;  1PYB A;  5EBD A;  3H3V C;  3B6Y A;  3NBH B;  3CC4 A;  5C4X B;  3NK9 A;  3A8J E;  3E9I A;  1VCI A;  4A75 A;  4JYA L;  2L4N A;  1BCP D;  2WII B;  1PH3 A;  3SK5 A;  3A7L A;  2M2L A;  2B2W C;  2C9O A;  3NTI A;  2GA4 B;  1HXY D;  4PQX A;  1V9P A;  1E1O A;  2XTI A;  3CPF A;  1KC8 C;  2NZ1 D;  1PFM A;  2KCN A;  1O7Y A;  1IBL L;  3M7N A;  1YVC A;  4HIO A;  5ELE A;  3QO2 A;  3KLS A;  3P7J A;  1PTO D;  4U68 A;  5JEA G;  2H4O A;  2F0V A;  4A3J G;  3MFG A;  1RIP A;  5C44 B;  4A3L H;  4OWW B;  3BVG A;  1EIH A;  1EU4 A;  1Y14 B;  1YBY A;  3H0G B;  4PNY A;  1UUP A;  2TSS A;  5BR8 L;  1VQH A;  1AZP A;  3W3A A;  1N33 L;  2PYK A;  1SDF A;  3M4P A;  4PV1 C;  3EIV A;  4UHV A;  4IPG A;  2KJX A;  2Z4H A;  3FKI G;  4BBS G;  4KN7 C;  5DAU A;  1YJ9 A;  1Q1E A;  2JA7 G;  4C3H B;  3STB C;  2ZM6 Q;  4A3G B;  4GKJ Q;  3KK7 A;  1Q1B A;  1PYW D;  3MVV A;  4AQY L;  1V1P A;  4V19 0;  2RBM A;  5DNF A;  1KL9 A;  3CCQ A;  2EE1 A;  3IFT A;  2RCF A;  4QIW B;  3V05 A;  5GAH C;  2JA6 H;  4ME3 A;  4OHJ A;  3T1Y Q;  1UE1 A;  1TWC H;  1ZYR C;  3AMU A;  1EFI D;  3J7Y W;  3CKI B;  1SNC A;  3I4M B;  1Y1V H;  1SNO A;  1X6O A;  4TKO B;  1JJG A;  5C5L A;  4N9P A;  4KK7 A;  4K5X A;  4APV A;  4C3H H;  2VUM B;  1BF4 A;  4ZAI A;  3T53 B;  2WV6 D;  3Q22 A;  3HOV H;  2QA4 A;  4A93 H;  5JAV A;  1GM5 A;  4RAU C;  3NP8 A;  4O0A A;  4XYQ A;  3K59 A;  2Z1C A;  1EZ6 A;  4DV0 Q;  4TSS A;  1IHZ A;  3GTM B;  4QL5 A;  2L55 A;  4LW1 A;  1NTG A;  1LT4 D;  1B4O A;  5M5Y H;  1GUG A;  3CME A;  2K05 A;  4FF1 A;  3U4Z A;  3S24 A;  2MFI A;  4XT3 B;  1KAA A;  4P73 A;  1KHI A;  4ZK9 B;  1U4L A;  2PW7 A;  4YCV A;  2CQO A;  1WCM H;  1E0B A;  2E2D C;  3BS1 A;  1F9R A;  1SMX A;  1JJ2 A;  2RCN A;  2KA7 A;  1PZK D;  2A1A A;  4BA1 I;  1GUT A;  3LX0 A;  4A93 G;  3I55 A;  4A3E G;  4CKC A;  1D1K A;  1ILQ A;  3NPP A;  1K0R A;  3OIQ A;  4ZLT F;  3BG3 A;  1K28 A;  1QJO A;  1VQL A;  4JK1 C;  1B44 D;  2HT1 A;  3CCU A;  1NSN S;  1JQY D;  3I7F A;  3C1E A;  4BY1 B;  1GUS A;  2ZXO A;  4DAV A;  4C2M H;  3MAQ A;  1XJV A;  2MGS A;  1HNX L;  2K5N A;  4KY5 A;  1KDC A;  4C1N I;  5I6Y A;  1KXL A;  3M4O H;  1VQ9 A;  4GZY C;  1EYC A;  4RGM A;  3T16 A;  2R92 B;  1JOK A;  1KAW A;  1A3U A;  2A5H A;  2EYL A;  3PO3 B;  3K0X A;  2E2I B;  3HP3 A;  1KNA A;  1N36 L;  2K01 A;  2KHS A;  2Q8T A;  2RA4 A;  4BY7 G;  3G7L A;  4FNF A;  1N33 Q;  2MP1 A;  5C3E G;  1KDB A;  2Y0S B;  2O5I C;  4PZ6 A;  2SNM A;  2A19 A;  1WTV A;  2ZXP A;  4LFC Q;  3PUW A;  4RFB A;  2F0E A;  4KKS A;  4L63 B;  1SYE A;  2Q8I B;  4GN4 B;  1SFO B;  1DJR D;  2F0Q A;  4B3T L;  3E9H A;  1J6Q A;  4JI5 Q;  1V1Q A;  5D65 A;  1F2Y A;  4KHP L;  3HOY B;  2B2W A;  5HGQ A;  1HNZ L;  1FGB D;  4R8N A;  2D62 A;  4R4T A;  4RCO A;  5GAE C;  4LF6 Q;  2VQE Q;  1DXM A;  1EQQ A;  5IGF A;  1K83 H;  2CWP A;  2NVT H;  3UDX A;  4BXX G;  5JVH 3;  2F0G A;  3TDQ A;  4CJ2 C;  3PIP A;  1KQS A;  4DAP A;  2PNH A;  1I4X A;  4HIK A;  3VYU A;  2MHV A;  1FD7 D;  3MXN B;  3J81 i;  2PCF B;  4I7Z C;  4JI6 L;  2BE5 D;  4HSV A;  4DAY A;  3S1R H;  3DM1 A;  2EY2 A;  5KIX A;  4XQN A;  4Y52 H;  4BY7 H;  2ZTE A;  1I6H B;  5EKL A;  4JG2 A;  4RCN A;  3HEJ A;  5IYC G;  3JAM i;  1BQQ T;  4O2D A;  3TBI B;  4A3K B;  3DWA A;  1HNW L;  5EBC A;  2EXZ A;  2RVL A;  1OXU A;  1IKM A;  3NUC A;  2CH4 W;  1MHW C;  2JJQ A;  1ESF A;  3GTJ B;  5CV7 A;  3S1M H;  1SEB D;  2K33 A;  1YHB A;  5CV6 A;  1K83 B;  4C3I B;  3OYY A;  4OX9 L;  2F0M A;  1B8A A;  4J6H A;  3ERQ A;  3F8T A;  2KVM A;  1I94 L;  1Z7T A;  1I6H H;  3CQZ B;  3TZD A;  3KLW A;  1SNP A;  1LT3 D;  3J80 E;  1R4Q B;  2NVX H;  3SEB A;  2KHJ A;  2LXJ A;  3KDF B;  2Z0S A;  3QWN A;  3CCR A;  3I4N H;  5AFW A;  4C3J G;  1SYB A;  1YI2 A;  1Q90 A;  1WD0 A;  1CTM A;  2FFK B;  2KEE A;  2R7D A;  3OMC A;  3VYR A;  2R7Z G;  2XVS A;  1NCV A;  4PG3 A;  2LMC B;  3N52 A;  1TWH H;  3D0F A;  4L5R C;  4A3B B;  3L3O C;  4LMQ D;  3RMH A;  4KI0 A;  2WAC A;  5KRU A;  2E2J H;  2HUG A;  1X3P A;  1JWU D;  5M5W H;  1RTN A;  3NSW A;  3K5N A;  1TWF H;  4V0B A;  3U50 C;  2Q2H A;  1G6Z A;  4H44 C;  1A2T A;  1JR0 D;  1CZW A;  5EQ0 A;  4OWT B;  2IPK D;  4X66 L;  1Q8I A;  3RZO H;  3UI2 A;  4DU9 A;  4WJ3 M;  3KBG A;  4C1N K;  1EU3 A;  2KCT A;  1X3F A;  2JA8 H;  1XNR Q;  2L12 A;  2XSC A;  1I3Q B;  3A5U A;  1WTW A;  3FEW X;  5CV9 A;  3RD4 A;  1E3P A;  5H1S E;  1A63 A;  4E6I A;  3I4O A;  1B9N A;  3KF8 B;  1CA6 A;  3D8G A;  1D2B A;  1L1O C;  1SNQ A;  1U9R A;  3GTO H;  4ULL A;  2KEN A;  2Z4I A;  2F0U A;  3K7A H;  1KRS A;  1KTK A;  2FHT A;  2UU9 Q;  3TZU A;  1O7L A;  3PGZ A;  5E3F A;  3HG9 A;  2O5J C;  5JJZ A;  1QNU A;  5GAD C;  2WFW A;  2WAQ G;  4UP7 A;  1NY4 A;  3NHH A;  4DV6 L;  1GUO A;  4A3M G;  2K5W A;  4LFA L;  1N9W A;  5I2X A;  4A3D B;  4XQQ A;  1QB5 D;  2HQE A;  3L9A X;  5EAY A;  1EOV A;  1LAC A;  2A6E C;  1PH6 A;  4LNQ A;  1TWF B;  1RL2 A;  5FLX E;  1TWC B;  1M1K C;  4CJ0 B;  2QEX A;  1VS0 A;  3HOW G;  1Y8P B;  3PIO A;  2VZA A;  4A3F B;  2E2H H;  2RSN A;  3D6W A;  1MSG A;  2MO1 A;  3RNU A;  1H9S A;  1I3Q H;  1KDA A;  1MKH A;  1HNZ Q;  2NBF A;  2JA8 B;  1STY A;  4HMI A;  1IW7 C;  2PW5 A;  5C3X A;  1Z9F A;  1I4Q A;  1EYD A;  1HUN A;  4JI4 L;  1SBB B;  5A2Q L;  2IT1 A;  1JWS D;  3DXJ C;  4Y7N B;  1D6E C;  3HOZ H;  3PO2 B;  1TR5 A;  4LUZ A;  4B3S L;  1GHK A;  4XIG S;  4LWC A;  1PH5 A;  1A62 A;  1LUZ A;  3DEP A;  5C4X G;  2UXC L;  2M9V A;  4DK6 C;  3GV3 A;  5NUC A;  1GD7 A;  3G6E A;  2K14 A;  5JJI A;  4X64 L;  4DXF A;  5HUR A;  4YWM A;  1FR3 A;  3MXU A;  4DR6 Q;  5M5W B;  4NB3 A;  1I6V C;  1KLG D;  3S17 H;  2WKC A;  1HA5 A;  4DUY Q;  2JSO A;  3A8K E;  1Q82 C;  1EYG A;  1GUW A;  3PUY A;  5LMU Q;  3LWE A;  3QIA A;  1YNN D;  2DN8 A;  3CCV A;  1HPC A;  3J7A 5;  4HAE A;  4OO1 G;  3GTG B;  5C44 H;  1C8C A;  1H95 A;  1STH A;  4FXG C;  3H0G G;  1LLR D;  1J9O A;  3CCM A;  1QCB D;  3T1H L;  1DGS A;  2Q2T A;  3SR1 A;  1LV9 A;  5IOC A;  2OWO A;  4KHV A;  2CHB D;  3FKI B;  3NQT A;  3JAM L;  1VQG A;  1BVS A;  4JI1 Q;  4A3G G;  4GS3 A;  4DR3 Q;  3TP8 A;  2UUA Q;  2G9H D;  4RGN A;  4TQU S;  1CSQ A;  1EY7 A;  3DWP A;  1H9J A;  4DK0 A;  3KLS X;  1PXU A;  1T9H A;  1JCK B;  2KEC A;  3M9B A;  3JAM c;  1GHJ A;  1PZI D;  1GO3 E;  2NWG A;  1Q46 A;  3TP5 A;  1I4P A;  4HJ5 A;  1CZG A;  3UE0 A;  1TS4 A;  1PA6 A;  1YNJ C;  1K8M A;  4A3K H;  3WOE A;  1DM0 B;  2GN5 A;  2XRQ D;  4JBK A;  1SE3 A;  1RJT A;  2ICE C;  3R2I A;  1QIL A;  2VS1 A;  2F4V Q;  1CT1 D;  4AQY Q;  1LO5 D;  1VQP A;  4NXN Q;  1ENF A;  4GKJ L;  4N8X 1;  3LNN A;  4P75 A;  3C1F A;  5FJ8 H;  1Y1W G;  1H9K A;  3DUZ A;  2Z6K C;  5EKI A;  3HRZ C;  1JWM D;  3TP6 A;  1G8Z D;  3OTO Q;  3O13 A;  2OQK A;  1ZKO A;  1ESR A;  1FGU A;  1VQ6 A;  3N6R A;  2K4K A;  2PZT A;  3NTH A;  4OXP A;  1A3T A;  2B8F A;  3Q6S A;  4HJ9 A;  2MPM A;  4PMB A;  4P72 A;  2EYF A;  1Q3L A;  4F87 A;  2EXD A;  1D7Q A;  5BN5 A;  1A6X A;  1VQE A;  3I4N G;  4NXM Q;  4QY7 A;  5IYB G;  2X6G A;  3GDE A;  3I72 A;  5M3F G;  2ZJP A;  5KNB A;  2F0L A;  1TVX A;  2L9H A;  4LAA A;  4M8A A;  3P1H A;  3RLF A;  5IT9 c;  3Q24 A;  4JV5 Q;  1KRT A;  1VDZ A;  4ZKB B;  3PF5 A;  4K0K L;  2A74 C;  3GTM H;  3EBE A;  2DY7 A;  4Q0F A;  5C4H A;  4IUV A;  4BY1 G;  3H15 A;  2E75 C;  1F9S A;  1BUV T;  4R9W A;  3SK4 A;  4BY1 H;  1XXG A;  3WWV A;  3D4W A;  1NAP A;  1IYV A;  1S4Z A;  2R7F A;  4DV1 L;  2EJG C;  3I70 A;  5EPK A;  1AZQ A;  1UE6 A;  5IGG A;  1HRJ A;  1CKO A;  3IL8 A;  2UUB Q;  1JIC A;  4JI5 L;  4FYD A;  3SXH A;  1IBL Q;  4DN4 M;  1QVC A;  1X55 A;  4XYO A;  1I5F A;  4BBR G;  2H1E A;  1X3E A;  4GOP A;  4GNX B;  5LMN L;  1TII D;  4A3I G;  4UPA A;  5C3E B;  4LF7 L;  1FVI A;  3RLO A;  1UWV A;  4CDC C;  2B63 H;  1XMO Q;  4FXD A;  5LL6 X;  1A15 A;  3F1Z A;  3W1G A;  1ET9 A;  1WTP A;  1ONL A;  1XTD A;  1Z47 A;  3OTO L;  5CV8 A;  2K03 A;  3C2P A;  2IJ0 A;  3I4L A;  1W2B A;  1SYF A;  1PH7 A;  3S15 H;  4WFN 3;  3D4R A;  3H6M A;  1BCP B;  3D6C A;  1STA A;  2HHH Q;  3L2P A;  2DGY A;  3GD7 A;  1S5C D;  4LFB L;  1F9Q A;  3HOX B;  2IHE A;  4RGO S;  5M3M G;  4K5V A;  1C0A A;  3CC7 A;  2EYH A;  3K57 A;  2HD3 A;  1PTO B;  4AYB B;  5IGE A;  2M00 A;  2XWB B;  1SE2 A;  4XQJ A;  1K8G A;  3A56 A;  2QGQ A;  2EIF A;  3BDL A;  3I3C A;  2IX3 A;  2WKD A;  1OTC A;  1VQI A;  3I90 A;  5IGD A;  5IIF A;  1UAP A;  2K04 A;  1X65 A;  2R93 B;  2HCI A;  3MXG A;  3KF6 A;  4JI3 L;  1M4V A;  3M3Y H;  3H3V H;  1PH1 A;  2RHQ B;  2X6L A;  4B3R L;  2AKW B;  3K7A B;  4C3I G;  1HTL D;  2F4V L;  1N32 Q;  3K58 A;  3VR3 A;  4KMU C;  1PZJ D;  2LSS A;  2JE6 I;  4G57 A;  3UDF A;  3T1H Q;  2OTJ A;  4RWS C;  1LTI D;  2A69 C;  3PMF A;  2JA5 G;  2B2T A;  2B63 B;  1PH9 A;  4IUU A;  4EQO A;  2HCC A;  5C3E H;  1X3Q A;  2SEB D;  2LKV A;  1A8V A;  1AN8 A;  2IX1 A;  4UP9 A;  4GKK L;  1KNE A;  3J80 L;  3QOL A;  1I94 Q;  5IOD A;  2NVQ H;  2D2C C;  2Z6K A;  4S3S A;  1EQR A;  4MNO A;  1G6P A;  2Y0S E;  3E6Z X;  1VQF A;  3FRP B;  1L0X B;  3HOW H;  2WAQ E;  1JE4 A;  3BYY B;  4F7X A;  3GTP H;  4IFD I;  4XDX A;  4IUQ A;  2F03 A;  5FOB B;  2L11 A;  3R93 A;  1MBY A;  4IFD G;  1AEX A;  2HQL A;  4YWL A;  3AEV A;  1H9M A;  1CKN B;  3MXP A;  2BCO A;  1JOQ A;  4J8Q A;  4K8I A;  4YY3 Q;  5C44 G;  4A3I H;  1ASY A;  1HH2 P;  4DV2 L;  4GLA C;  3OWF A;  2ICI A; 
#chains in the Genus database with same CATH homology
 3S16 B;  2HDM A;  5C0X H;  3S2D B;  2A69 D;  4MN3 A;  1B50 A;  5COR A;  2A73 B;  2O2L D;  5LHY 1;  4KJN A;  3ZYY X;  3EQL C;  4K5W A;  2E76 C;  1CK1 A;  1A3V A;  1S5E D;  1DCZ A;  5ELF A;  4XXE A;  4H13 C;  1DYQ A;  3I8Z A;  2AUJ D;  1WTQ A;  1V1P B;  1BO0 A;  1I50 B;  3I91 A;  1ET6 A;  3FDT A;  2QDB A;  3HOU B;  4XTC S;  5JEA J;  1IKL A;  1B9M A;  2PNR C;  4A3M B;  4B9X A;  4IN3 A;  3DMU A;  1PTO C;  1GJX A;  3OWE B;  3BYT B;  2RDH A;  1D1I A;  2MJ8 A;  3S9W A;  4ABN A;  1CHP D;  1H9R A;  2L0C A;  4IUN A;  3BVZ A;  2EYM A;  3EFX D;  5KNC A;  2PPB C;  5KEE A;  2XWJ B;  2BE5 C;  3E5S A;  2QF7 A;  5I9P A;  3GTQ B;  1MD2 D;  5A35 A;  1V1O A;  3H09 A;  3WDN A;  2J7Z A;  3MA2 B;  2K7V A;  1DOL A;  2D5D A;  4A3E B;  1GXD C;  3NBH A;  1SNM A;  5CC4 A;  1EOT A;  4RGT A;  4UDU C;  1EQV A;  1FNW A;  2PMZ B;  4OGQ C;  3OPO A;  1LTA D;  1PRT D;  4G7O C;  5T1G A;  5J22 A;  2AWN A;  5I9O A;  1Z6H A;  3HKZ B;  3M85 A;  3URY A;  3SK6 A;  1Y8N B;  4KKU A;  1HUM A;  3NXW A;  3TP7 A;  4ID6 A;  4DFA A;  3PUV A;  2K32 A;  4F88 A;  4OIJ A;  2EJF C;  2I07 B;  4FVM A;  5BN3 A;  2EY1 A;  2C5C A;  1AFP A;  5C6A A;  2E2H B;  5A2Q E;  1PFN A;  1RDP D;  4IFD H;  4KJO A;  2ZXR A;  4IUT A;  2Z8L A;  3NE5 B;  1VF5 C;  1STB A;  3J7A F;  3FVQ A;  1ENA A;  4G7H C;  2NN6 G;  1V8Q A;  3BDO A;  1EWC A;  1KLU D;  1BR9 A;  5T1I A;  5CV4 A;  2CW0 D;  1NR4 A;  1W6J A;  2IL8 A;  1T5X D;  4HCS A;  1Y1W B;  5BN4 A;  2KCC A;  2RSO A;  2D9U A;  3CU7 A;  5G3L F;  2WB1 B;  1G2S A;  4I65 A;  3ITP A;  5E4W C;  5D14 A;  2FMM A;  4KV6 A;  3A8I E;  5G3L D;  3PIP 3;  3JAM E;  1BOS A;  5E4X A;  2WP8 J;  5CBA E;  3H94 A;  1EQT A;  3AB9 A;  4QCL A;  2E2J B;  2K5Q A;  3SVM A;  1D5M C;  4FP5 D;  3T4A C;  5M3F B;  4F8M A;  5I6W A;  1I4R A;  1PLF A;  3TN2 A;  4DXG A;  5K5P A;  3IKJ A;  5C5M A;  3SK8 A;  5LL6 S;  2R6G A;  4ZYS A;  1TY2 A;  4YIJ A;  1EY4 A;  4P2C B;  1SND A;  2F0I A;  5CBE E;  4A3I B;  4NMZ A;  2DY8 A;  3ND9 A;  4WOR A;  3MFY A;  4MHE A;  1WD1 A;  4J1M A;  4KTA A;  3I73 A;  1PFB A;  2VXW A;  1DD2 A;  2EPB A;  1STE A;  1OO9 B;  3ONA B;  3S1M B;  4NKL A;  4ME5 A;  2EYJ A;  3GTP B;  2KUM A;  5CGK A;  3AU7 A;  3GTL B;  2EVB A;  4ILW A;  1WTR A;  2WIN B;  1EY6 A;  4FF4 A;  4PMC A;  2WAQ B;  1TS2 A;  3D31 A;  1C48 A;  1FNU A;  4M1U B;  5D3I B;  1VMC A;  1U4M A;  2RDF A;  1SJE D;  3PUZ A;  4IUR A;  1HQR D;  1ENC A;  1UEA B;  1QE6 A;  1CA5 A;  3X3N A;  3U9S A;  5FKA C;  4X3S A;  2JEB I;  2B2Y A;  1TS5 A;  5M9O A;  1STN A;  1PTO F;  1BXT A;  2F0T A;  5CV5 A;  3TME A;  1SMY D;  2K1B A;  3DEO A;  3SE0 A;  4FF3 A;  3G6J B;  4DNR B;  2NYZ D;  3V2T A;  2EYP A;  2QCP X;  1PTO H;  1TY0 A;  2EJM A;  1S5B D;  5J1Z A;  1U4R A;  3M4Y A;  1TWH B;  1CFM A;  3V96 A;  2NTS A;  1L0Y B;  2DNE A;  2RDG A;  4K6L A;  4QF4 A;  4C2M B;  2F0D A;  4HR7 B;  3S14 B;  1SAP A;  2A6E D;  3NWS A;  2EY6 A;  2YYZ A;  2EYO A;  2ID0 A;  2XRS D;  3VR5 A;  4Z9C B;  5IGC A;  5FO9 B;  1X32 A;  2B2V C;  3QOJ A;  2QKI C;  4PMW A;  2B2U C;  4A3J B;  1BBX C;  4C56 C;  2JXM B;  1PMR A;  3OW7 A;  1F2L A;  1K8O A;  1SMY C;  4TRD A;  3T51 B;  1IW7 D;  1LT6 D;  1STG A;  3A55 A;  1WTX A;  1Y1V B;  4BBS B;  1CQV A;  1ZXT A;  2V4D A;  3GQB A;  1F9P A;  4HMJ A;  3VR6 A;  4OO1 I;  3OHX C;  2A68 D;  4K8J A;  2K6A A;  2RQX A;  3VR4 A;  2RKS A;  4IUP A;  1EY8 A;  1F2M A;  1T5E A;  1EEF D;  1TQO A;  3GV6 A;  4HN7 A;  2EZV A;  2F0S A;  1BCP F;  1EY5 A;  1YNN C;  2R61 A;  1RF2 D;  2F4I A;  1TS3 A;  5D3D A;  4FXK C;  5F2D A;  1SYC A;  4RHS A;  4OL7 A;  1EEI D;  5C4Z A;  2SNS A;  2F0N A;  4BWG B;  1MGS A;  5TSS A;  1LTT D;  4KHZ A;  1FYC A;  2IX0 A;  5FO7 B;  3M4O B;  1B3A A;  5ELD A;  2QIL A;  3KF8 A;  1YNJ D;  1TKW B;  1AW7 A;  3X3M A;  2IWH A;  1E2Z A;  1OXV A;  2HDL A;  1S5D D;  5E1F A;  3S2H B;  2OXP A;  4KKT A;  2QEJ C;  3R8B A;  1BNZ A;  3QG1 A;  3ND8 A;  2N88 A;  4X3K A;  1Y8O B;  3CRK C;  1SSO A;  2SDF A;  4CHT B;  5KYL A;  1NUC A;  3QB3 A;  2YU9 B;  4RH6 A;  2BOS A;  2L5T A;  2BDN A;  2OEO A;  1B53 A;  4CJ1 B;  3D4D A;  1GOZ A;  1A2U A;  4H7B A;  2PO4 A;  1G2T A;  4DA2 A;  3Q0A A;  2CVR A;  1OXX K;  3K5L A;  1H9S B;  4N9T A;  2I46 A;  3SHL A;  2CQA A;  1KAB A;  3S17 B;  4CKE A;  2VB3 X;  1S5F D;  3MTS A;  2NN6 H;  1I4H A;  3FMC A;  5CYU A;  3S15 B;  5EPJ A;  1DOM A;  1XX8 A;  2F0F A;  5M3M B;  2B2T C;  3EVQ A;  2NTT A;  2R3Z A;  3K5O A;  4DF7 A;  1DZ1 A;  3QJY A;  3S1N B;  2JA6 B;  2JYO A;  1Y69 U;  3MWY W;  1TWG B;  1IL8 A;  1HFN A;  3NTK A;  4DK1 A;  4Q5V A;  2XIW A;  4FF2 A;  5C4J B;  1EWH A;  1Q12 A;  1JC7 A;  3MXN A;  2F0H A;  1OXS C;  4X3T A;  3DWQ A;  1SXT A;  3K5M A;  2JA5 B;  2B39 A;  4MIU A;  4LK1 C;  5JPN C;  5K36 G;  1HA6 A;  4EVO A;  2EOT A;  4BA2 I;  1MSH A;  4C3J B;  5DM7 3;  2B2Y C;  2NUC A;  2SOB A;  4ZUJ A;  3WOF A;  1PRT F;  2AQ1 B;  2XN9 C;  3MZ5 A;  5JVG 3;  5C3W A;  4IAL A;  4L8J A;  1CM9 A;  1DOK A;  2F0O A;  5CMD A;  3GP7 A;  1II3 A;  5I2Y A;  5JOB A;  5KND A;  1QWY A;  3CHB D;  4EQN A;  2XNA C;  4OIK A;  4K6D A;  3H91 A;  2PQE A;  4RKB A;  1LTG D;  3PUX A;  3VA5 A;  2PZW A;  3W2D A;  1ICW A;  1SJH D;  4EGV A;  3P20 A;  4JBW A;  4HCE A;  2Q8R E;  1F2Z A;  1U4P A;  2F1M A;  2B2U A;  5ISR A;  3HS0 C;  5DM6 3;  2K28 A;  1RD9 D;  3K0Y A;  4IQZ A;  1E2W A;  3HGB A;  2OF1 A;  3R3O A;  2JA7 B;  4C3H G;  2AUK A;  1XYI A;  1JOO A;  1PRT B;  5K36 H;  5ELB A;  3BZD B;  1UNS A;  4QMG A;  2VB2 X;  1HCZ A;  1TWA B;  1AP0 A;  2ZT9 C;  1EIG A;  1D5X C;  3RZD B;  3J81 L;  2F0K A;  4DGZ A;  1SYG A;  5EPL A;  3RZO B;  1PDQ A;  3HOV B;  2NN6 I;  1EL0 A;  4NDX A;  4RHR A;  2J4X A;  4QUC A;  5KYI A;  2O4X A;  3P75 A;  2EDG A;  4ZUI A;  5EKK A;  3EA6 A;  3KLR A;  5IT9 L;  2CW0 C;  3FPP A;  3NWT A;  3VYS A;  3IAY A;  5CR3 A;  4UAI A;  1JB3 A;  2F3W A;  2VNU D;  2AWO A;  2AQ3 B;  4CKB A;  1XWE A;  1EZ8 A;  1O7Z A;  1RHP A;  4A93 B;  2LS0 1;  1EYA A;  4K2K A;  4IZ8 A;  4HTH A;  4K2L A;  3T13 A;  3A54 A;  4CBV A;  2NVT B;  5FK9 C;  4BS9 A;  1D5Z C;  4XT1 B;  2JEA I;  1JOR A;  1F77 A;  2F0J A;  4ODG A;  4HED A;  1R4P B;  2OT2 A;  3T56 B;  5DEH A;  1RTO A;  1R9T B;  3OMG A;  2DNC A;  3RUZ A;  3HZX A;  5COY A;  2NVQ B;  2F0W A;  1IYU A;  4BY7 B;  1HTP A;  1QOH A;  3Q23 A;  5J39 A;  3C46 A;  2BDO A;  3MHB A;  1E2V A;  3GTO B;  3MC0 B;  3F2U A;  1M8A A;  4O42 A;  5IGB A;  4WJW A;  2B8G A;  5C0X I;  1DON A;  4LJZ C;  3BDC A;  5C0X G;  1PRT C;  4EQP A;  1ILP A;  1VF7 A;  3LWU A;  3NBI A;  4KY6 A;  3J81 E;  5EJW A;  1LTB D;  3OOC A;  3K6O A;  2X69 A;  2F0P A;  3S1Q B;  4O1N A;  1CQF A;  5C0X J;  3OSO A;  1EY0 A;  5M5Y B;  4WRD A;  1J8I A;  4G4K A;  4B9W A;  1RKN A;  4R8I A;  3M3Y B;  2MUY A;  4ZQ3 A;  2PZU A;  5IT9 E;  1RCV D;  1WTO A;  2IW3 A;  2L1B A;  1CI3 M;  5HGT A;  4DNT B;  1TT2 A;  3NQI A;  1ZYR D;  3C3L A;  3MEH A;  2KOL A;  1VMP A;  2KQ3 A;  2NVY B;  3I4N B;  1MI2 A;  2NVX B;  2EY5 A;  4KN4 C;  2A6H D;  5JEA H;  4NP5 A;  2ENB A;  4K14 A;  2R7Z B;  1HQM C;  2TMP A;  4OO1 H;  2G9D A;  4HSP A;  1BDO A;  2N55 A;  2FJ2 A;  3KUP A;  1ZEQ X;  1QG7 A;  5EGT A;  5I4D A;  5FO8 B;  4CGY B;  5JPM C;  1LTS D;  3U9O A;  5M5X B;  4H0L C;  2BA1 A;  4KY7 A;  1WVL A;  1G29 1;  3J7A V;  1SYD A;  1B1Z A;  1ROD A;  4B08 A;  3FPU B;  4BBR B;  3E0J A;  3ERO A;  4RA8 A;  2LFN A;  2JP1 A;  3VA7 A;  4NW2 A;  4KD3 A;  1OXT A;  1NR2 A;  1C4Q A;  1ML0 D;  3CRL C;  3M7G A;  3R2T A;  3HOZ B;  3IFD A;  1O78 A;  2A6H C;  4ZRZ A;  4FO2 A;  5ELC A;  3S1R B;  2K5D A;  3PV0 A;  2FIN B;  5KGU A;  1CHQ D;  2B2V A;  3SDZ A;  4QB4 A;  4ZKC B;  4L6T B;  4QUF A;  2BA0 A;  1XTC D;  1BCP C;  3D3R A;  2J0T D;  4KD4 A;  1LAB A;  1O80 A;  3GO5 A;  5FLX L;  3VR2 A;  1EY9 A;  3KBX A;  1QNK A;  3EJI A;  2A68 C;  3DHQ A;  1B2T A;  4X3U A;  3BVM A;  3HOW B;  1W6K A;  3A7A B;  1LTR D;  1TU2 B;  3TSS A;  4IFD J;  1GUN A;  2FMC A;  3PIO 3;  1HHV A;  1G91 A;  4G7Z C;  2LY7 A;  3VYT A;  1I4G A;  2AQ2 B;  3GTK B;  2KED A;  3OIP A;  1LT5 D;  2E74 C;  2F3V A;  1FNV A;  3L7Z C;  1WCM B;  1HFG A;  4U67 3;  1SE4 A;  1V43 A;  4RKL A;  2NB0 A;  5EBD A;  3H3V C;  5C4X B;  3NK9 A;  3A8J E;  1VCI A;  2L4N A;  1BCP D;  2WII B;  3SK5 A;  3A7L A;  2M2L A;  2B2W C;  2C9O A;  3NTI A;  2GA4 B;  1HXY D;  4PQX A;  2NZ1 D;  1PFM A;  2KCN A;  1O7Y A;  3M7N A;  5ELE A;  3QO2 A;  3KLS A;  3P7J A;  1PTO D;  4U68 A;  5JEA G;  2H4O A;  2F0V A;  3MFG A;  5C44 B;  3BVG A;  1EIH A;  1EU4 A;  4PNY A;  3H0G B;  1UUP A;  2TSS A;  1AZP A;  3W3A A;  2PYK A;  1SDF A;  4PV1 C;  2KJX A;  2Z4H A;  4KN7 C;  5DAU A;  1Q1E A;  4C3H B;  4A3G B;  3KK7 A;  1Q1B A;  1PYW D;  3MVV A;  1V1P A;  4V19 0;  2RBM A;  5DNF A;  2EE1 A;  3IFT A;  4QIW B;  3V05 A;  4OHJ A;  3AMU A;  1ZYR C;  1EFI D;  3J7Y W;  3CKI B;  1SNC A;  3I4M B;  1SNO A;  4TKO B;  5C5L A;  4N9P A;  4KK7 A;  4K5X A;  2VUM B;  1BF4 A;  4ZAI A;  3T53 B;  2WV6 D;  3Q22 A;  5JAV A;  4RAU C;  3NP8 A;  4XYQ A;  3K59 A;  2Z1C A;  1EZ6 A;  4TSS A;  1IHZ A;  3GTM B;  2L55 A;  1LT4 D;  1B4O A;  1GUG A;  2K05 A;  4FF1 A;  4XT3 B;  1KAA A;  4ZK9 B;  1U4L A;  2PW7 A;  1E0B A;  2E2D C;  3BS1 A;  1F9R A;  2KA7 A;  1PZK D;  4BA1 I;  1GUT A;  3LX0 A;  4CKC A;  1D1K A;  1ILQ A;  3NPP A;  3OIQ A;  4ZLT F;  3BG3 A;  1QJO A;  4JK1 C;  1B44 D;  1NSN S;  1JQY D;  3C1E A;  4BY1 B;  1GUS A;  2ZXO A;  4DAV A;  3MAQ A;  2MGS A;  4KY5 A;  1KDC A;  4C1N I;  5I6Y A;  4GZY C;  1EYC A;  4RGM A;  3T16 A;  2R92 B;  1JOK A;  1A3U A;  2A5H A;  2EYL A;  3PO3 B;  2E2I B;  3HP3 A;  1KNA A;  2K01 A;  2KHS A;  2Q8T A;  2RA4 A;  3G7L A;  4FNF A;  2MP1 A;  1KDB A;  2Y0S B;  2O5I C;  2SNM A;  1WTV A;  2ZXP A;  3PUW A;  4RFB A;  2F0E A;  4KKS A;  4L63 B;  1SYE A;  2Q8I B;  1SFO B;  1DJR D;  2F0Q A;  5D65 A;  1F2Y A;  3HOY B;  2B2W A;  1FGB D;  4R8N A;  2D62 A;  4RCO A;  1DXM A;  5IGF A;  5JVH 3;  2F0G A;  3TDQ A;  4CJ2 C;  4DAP A;  1I4X A;  3VYU A;  2MHV A;  1FD7 D;  2PCF B;  4I7Z C;  2BE5 D;  4HSV A;  4DAY A;  3DM1 A;  2EY2 A;  5KIX A;  4XQN A;  1I6H B;  5EKL A;  4RCN A;  3HEJ A;  1BQQ T;  3TBI B;  4A3K B;  3DWA A;  5EBC A;  2EXZ A;  2RVL A;  1OXU A;  1IKM A;  3NUC A;  1ESF A;  3GTJ B;  5CV7 A;  1SEB D;  2K33 A;  5CV6 A;  1K83 B;  4C3I B;  2F0M A;  4J6H A;  3ERQ A;  2KVM A;  1Z7T A;  3CQZ B;  3TZD A;  1SNP A;  1LT3 D;  3J80 E;  1R4Q B;  3SEB A;  3QWN A;  5AFW A;  4C3J G;  1SYB A;  1Q90 A;  1WD0 A;  1CTM A;  2FFK B;  2KEE A;  3OMC A;  3VYR A;  2XVS A;  1NCV A;  2LMC B;  3N52 A;  4A3B B;  3L3O C;  4LMQ D;  3RMH A;  4KI0 A;  2WAC A;  5KRU A;  2HUG A;  1X3P A;  1JWU D;  1RTN A;  3NSW A;  3K5N A;  4V0B A;  1G6Z A;  4H44 C;  1A2T A;  1JR0 D;  1CZW A;  5EQ0 A;  2IPK D;  1Q8I A;  3UI2 A;  4DU9 A;  3KBG A;  4C1N K;  1EU3 A;  2L12 A;  2XSC A;  1I3Q B;  1WTW A;  3FEW X;  5CV9 A;  3RD4 A;  4E6I A;  1B9N A;  1CA6 A;  3D8G A;  1D2B A;  1SNQ A;  1U9R A;  4ULL A;  2Z4I A;  2F0U A;  1KTK A;  2FHT A;  3TZU A;  1O7L A;  5E3F A;  3HG9 A;  2O5J C;  5JJZ A;  1QNU A;  3NHH A;  1GUO A;  2K5W A;  5I2X A;  4A3D B;  4XQQ A;  1QB5 D;  2HQE A;  3L9A X;  1LAC A;  2A6E C;  1TWF B;  5FLX E;  1TWC B;  4CJ0 B;  1Y8P B;  4A3F B;  2RSN A;  3D6W A;  1MSG A;  1H9S A;  1KDA A;  2NBF A;  2JA8 B;  1STY A;  4HMI A;  1IW7 C;  2PW5 A;  5C3X A;  1I4Q A;  1EYD A;  1HUN A;  1SBB B;  5A2Q L;  2IT1 A;  1JWS D;  3DXJ C;  4Y7N B;  1D6E C;  3PO2 B;  1TR5 A;  1GHK A;  4XIG S;  3DEP A;  2M9V A;  3GV3 A;  5NUC A;  4DXF A;  5HUR A;  1FR3 A;  3MXU A;  5M5W B;  1I6V C;  1KLG D;  2WKC A;  1HA5 A;  2JSO A;  3A8K E;  1GUW A;  3PUY A;  3LWE A;  3QIA A;  1YNN D;  2DN8 A;  1HPC A;  4HAE A;  4OO1 G;  3GTG B;  1C8C A;  1STH A;  4FXG C;  1LLR D;  1J9O A;  1QCB D;  3SR1 A;  1LV9 A;  5IOC A;  2CHB D;  3FKI B;  4KHV A;  3NQT A;  3JAM L;  3TP8 A;  2G9H D;  4RGN A;  4TQU S;  1EY7 A;  3DWP A;  1H9J A;  4DK0 A;  3KLS X;  1PXU A;  1JCK B;  2KEC A;  1GHJ A;  1PZI D;  2NWG A;  3TP5 A;  1I4P A;  1CZG A;  1TS4 A;  1YNJ C;  1K8M A;  3WOE A;  1DM0 B;  2XRQ D;  1SE3 A;  1RJT A;  2ICE C;  3R2I A;  1QIL A;  1CT1 D;  1LO5 D;  1ENF A;  3LNN A;  3C1F A;  1H9K A;  3DUZ A;  5EKI A;  3HRZ C;  1JWM D;  3TP6 A;  1G8Z D;  3O13 A;  1ZKO A;  1ESR A;  3N6R A;  2PZT A;  3NTH A;  1A3T A;  2B8F A;  3Q6S A;  2MPM A;  4PMB A;  2EYF A;  1Q3L A;  4F87 A;  5BN5 A;  1A6X A;  2X6G A;  3I72 A;  5KNB A;  2F0L A;  1TVX A;  2L9H A;  4LAA A;  4M8A A;  3P1H A;  3RLF A;  3Q24 A;  4ZKB B;  1VDZ A;  2A74 C;  2DY7 A;  4Q0F A;  5C4H A;  4IUV A;  2E75 C;  1F9S A;  1BUV T;  4R9W A;  3SK4 A;  1XXG A;  3D4W A;  1NAP A;  1IYV A;  1S4Z A;  2EJG C;  3I70 A;  5EPK A;  1AZQ A;  5IGG A;  1HRJ A;  3IL8 A;  1JIC A;  4FYD A;  3SXH A;  4DN4 M;  4XYO A;  2H1E A;  1TII D;  5C3E B;  4FXD A;  5LL6 X;  1A15 A;  1ET9 A;  1WTP A;  1ONL A;  1Z47 A;  5CV8 A;  2K03 A;  3C2P A;  2IJ0 A;  3I4L A;  1SYF A;  4WFN 3;  3D4R A;  3H6M A;  1BCP B;  3D6C A;  1STA A;  3GD7 A;  1S5C D;  1F9Q A;  3HOX B;  4RGO S;  4K5V A;  2EYH A;  3K57 A;  1PTO B;  4AYB B;  5IGE A;  2M00 A;  2XWB B;  1SE2 A;  4XQJ A;  3A56 A;  3BDL A;  3I3C A;  2IX3 A;  2WKD A;  3I90 A;  5IGD A;  5IIF A;  1UAP A;  2K04 A;  2R93 B;  2HCI A;  3MXG A;  1M4V A;  2X6L A;  3K7A B;  4C3I G;  1HTL D;  3K58 A;  3VR3 A;  4KMU C;  1PZJ D;  2JE6 I;  4G57 A;  4RWS C;  1LTI D;  2A69 C;  3PMF A;  2B63 B;  2B2T A;  4IUU A;  4EQO A;  2HCC A;  1X3Q A;  2SEB D;  2LKV A;  1AN8 A;  2IX1 A;  1KNE A;  3J80 L;  3QOL A;  5IOD A;  2D2C C;  4S3S A;  3E6Z X;  3FRP B;  1L0X B;  1JE4 A;  3BYY B;  4F7X A;  4IFD I;  4XDX A;  4IUQ A;  2F03 A;  5FOB B;  2L11 A;  3R93 A;  1MBY A;  4IFD G;  1AEX A;  1H9M A;  3MXP A;  2BCO A;  1JOQ A;  4J8Q A;  4K8I A;  3OWF A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...