5DMIH

Structure of the extracellular domain of the cd40 in complex with chi220 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
b'QIQLVQSGPELKKPGETVRISCKASGYAFTTTGMQWVQEMPGKGLKWIGWINTHSGVPKYVEDFKGRFAFSLETSANTAYLQISNLKNEDTATYFCVRSGNGNYDLAYFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 5
publication title Functional Antagonism of Human CD40 Achieved by Targeting a Unique Species-Specific Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmiH02
4KZEL 4PJ9A 4APQA 3CFCL 4OM1H 1WEJH 3UTSB 3SDXB 3BZEA 3UTOA 4L4VA 1MIML 4TPRL 3WIIL 5MENA 1BWMA 1UENA 2HH0L 2QHRH 5BS0D 1NGZA 2ADJB 3BIKB 3CFBA 1KSRA 3I75A 5K9KB 3VXOB 5TE6L 4NN7B 5ICZB 5D8JL 4AJ0A 2WBJA 5E2WL 2MNUA 3QUXB 1T04A 2BHZA 5IB1A 2Z8VC 5F1SA 1XF2A 5F3BB 3L5JA 5D7LB 7FABL 1WV7T 4OUUB 1J9CT 1JHLH 1VPOH 2YBRA 4ONOA 4R8WH 3O8XD 3OKMB 5CJ5A 3EO0B 3HHRB 4N5ED 3U9UA 1FYHB 4HK3N 4IRSD 3L3JB 2OJZL 4U2ZA 4DW2H 5IB4B 4S1RH 1R6VA 3RWGB 4Y2OA 3BRFA 4K3GA 2BVEA 1ODAA 1RK0B 4QRQA 2YK1H 3CLEL 3LDBB 1UZ6E 1YY8B 2L4OA 3CVHH 3FQXB 1Z3GL 4WGVB 2HVKB 2C1OA 3BDXA 2OL3H 4JRYA 1S7WB 4DZBB 4NZJA 3QEQE 4QRPA 1JHTB 2R1YA 1RK1A 1U92B 2A74A 3LHPL 1QLRA 2DM7A 3VFVB 4NNPL 3F7YA 1G9NC 3IU4L 5C0RL 1VENA 4L3ED 3L5IA 4MCYB 2AV1A 3QAZB 1GOHA 3LKNA 5B8CA 1AGFA 4XAWH 1IAIL 1I3GH 2HTLD 5I1KL 4LOUC 4GKZA 5FGRA 5IJVB 2ICEB 4TN9A 2FLBT 3BAEH 3KPNB 5FGSA 3TNMA 4GXUM 3CFKA 4EI5D 2R56H 1WWBX 4D3CH 4YHPA 9CGTA 4K9EH 4OI7A 4I2XB 5ID1A 2QQQA 5TDNB 3T2OA 3SGJA 4NNYB 4WNQA 5DQJB 1G7IB 4ZS6C 5E8PB 5D96B 3QA3A 5DVKA 5I9QC 3W0WE 2WIIB 3FO0H 4PJIE 1AE6L 3H7BA 3QFJA 4X8XA 1RIHL 2XA8L 3ZYOA 1ZS8A 4OB5L 3RPIB 1JK8A 1KFAL 3L5XL 5EU4B 4RQQA 3QHZL 3S96A 1N4XL 3RVVC 2ZOLA 3WS3A 5IOPB 3QUZA 4QRRA 1F3DH 3D18B 2VXQH 3UPRA 1JF1A 5C6PB 1OCWL 2EZ0D 1JBJA 1UM5H 2JTDA 5KS9A 3VWJD 3IDYB 5EZOL 4UQ3A 3L5HA 1MHHB 2QL1A 1OM3L 3VE0B 2JCCA 1CU4L 5FO8B 2A6JA 3L1OH 2HFGL 3FN0H 5SWQA 1IMHC 3FOMA 4CNIB 2BFVL 3P4MB 4WI7A 4LLWB 4S1DC 3GB7A 3T4AB 4GW4B 1UKQA 4L4JA 4XNZC 5C0AE 3EHBD 4Y19A 3E2HC 2E6JA 3M1BB 2QQKH 3I6LD 3EFDL 1EIBA 4RBPH 4G8FB 4XZUB 3V8OA 4DGIL 5FA4A 3FTGA 2PW1B 1V7NH 1U8LA 4PRPD 5HYFA 1N59A 4JFDA 4P23A 5TH2A 5IT2L 3TYGL 4QOKA 1VFAA 2F54B 3F7QA 4LASH 4RX4D 3FCTA 3DV4A 2CDGB 5CZKA 3P4NA 3TF7C 2YSSB 4ONFL 2AXJA 1MUJB 2IWGA 2VOTA 3MXWL 2CKBL 1Z9MA 2B8OT 4G6KH 3V0VA 2DQEH 4JDVA 4M3KB 4M8VA 3EOYG 3F5WB 1T83C 5DC0A 1XF1A 3NABL 3GMPA 1IAOB 3PP3H 4TULL 1GVIA 4UDTA 5EIVA 1IGCL 1GGIH 5DD3L 1U8IB 3BIAX 1NFDA 1A4KB 4P2CG 2A83A 1IGIL 2VDLL 3N1MC 5TGBB 3X3FH 1DUYB 1IVLA 3FOLB 3DYPA 4KVCL 4E42B 4GAYB 4Z7UA 4I0PC 1BVLA 5BJTB 2PXYC 3QWRD 3L95B 3SEPA 3TJEH 3NFNA 4LHQB 4CVUA 2VLKE 1DBAH 1J1XH 3IB4A 1QSFD 3RIAK 3ULVD 2CUHA 1N0XL 5CBEB 4O02L 2VAAA 3QPXL 3MA7B 4IDJL 4KTYA 2VUYA 4R0LB 3HNVH 4YO0B 4X9IA 1FGNL 1IEAA 4UDUA 4PGEB 3B9KC 1ZLUH 3IXAB 5AEAA 3OAYK 3RWEA 3BMVA 4ALAH 2BRRH 4MD5A 3NIDF 1DFBL 5ETUA 1FJ1B 3UYRH 1VACB 4KRPB 4HJ0C 4OGXH 4P2RD 4Y1AA 3BX7C 3UTPE 4KI5F 4PRHA 3OV6A 1EA9C 5J12B 1U2CA 1J7VR 1A7NH 1X5GA 3VXQB 2IH1B 4XXDA 2PO6B 4A6YB 3MMEA 4Q74A 5BOPA 2NPLX 4YHIA 3PUCA 3VXMA 4NUJA 2BHYA 3SE8H 3WFHB 2OTWB 1J1PH 5I30H 1CDYA 3B43A 3QZWG 4UNVA 1UB5B 2G9HB 4DOHB 3LIZL 4PJEA 5C86A 3LRSB 4LOUD 1MFCL 1AP2A 2P7TA 3HMXH 1KPVB 4LHUD 4YWGH 4PJ9C 4WI2A 1FNEA 1OAZL 4OIIL 4U6YB 5C0GA 3T65B 3L3DA 32C2A 3I3BA 2BSRB 3KS0J 5D2NA 4O4YL 4P59L 1OAUH 3INUH 5HYIA 4JO2H 4QRTB 1MLCB 4OBSA 4JHWH 5F89B 2C3VB 4N0YH 2ZUTA 1CICA 5GS2H 3BP6A 3LQAH 3WFCH 3L7FA 4ZS6D 2AGJH 3KPMB 5HI5C 5DVOA 5IFJA 1XR8A 4NBYB 3GEWB 3MRQB 2NCMA 2XXCB 4TRPH 2YUXA 1NBZB 1DL7H 2ITDB 3GSXA 2FB4L 1EGJA 1BZQK 1LO5B 3U7YH 1YZZA 5IMMA 1ZTXH 2F74B 2H6PB 4J6RH 3WNOA 4L8CB 3FKUS 5BMFL 5I71B 4H1LG 2AJVH 4BFGA 4PRPE 3WDJA 3RVVD 3BP4A 4HC1A 2CXGA 5HVHB 4NO0D 3PGCB 4KZEH 1Q0YH 3CFCH 4YXKL 1BPVA 3MRHB 1HNGA 4WO4B 1VEPA 1T03L 1NGYB 1HCVA 1BX2B 3WIIH 3PV6A 2FZ3A 4XRCA 2HH0H 1NAMA 3P30L 4RMQA 1HIML 4BQ9A 2VNCA 1PZ5B 4PJAF 4Z8FL 5E2WH 2BNRB 5T3ZD 1FFQA 5GS1B 5ITFA 4S1DD 1J1OH 1QHPA 3JUYA 1TQBC 5IMOB 3QWOB 4JM2A 4ESKA 2AJUH 4UTAH 5HPOA 4UU9B 1CCZA 1P4LA 4PRNB 5IFAH 1GZQB 1QKZL 1TQCB 1JGVL 1X5ZA 4HWNA 5SWZB 3U0PB 3ROLB 4WUKH 4JVPA 3CLEH 1YMHB 2G60L 1LILA 3ILPA 1Z3GH 1NMAL 4FRWA 3QFDB 5EO0B 2W0KA 3OR7A 5BW7C 2YRLA 4LARL 3C60B 2FJHB 4X6EA 4TVSa 5B39B 2HT3D 1HHJB 1KGCD 4PG2A 1O0VA 3SGJC 2C5DC 5I8EB 2VR5A 4XNMA 5TDOB 3MRPB 4JN1H 2LTQB 3NIFE 1UCTA 4YK4B 3ZKXC 1MH5B 1Z2KA 3MRIB 3O3AA 3PABB 3DVNA 1MCEA 2HA1A 3TJHD 1U8PA 3MGTB 3QEGL 1VEMA 1KF9B 1S7SA 4I0PD 1LEIA 1PJ9A 1BJ1H 2PXYD 1BREA 3ZE1E 3WUWB 3QUZC 5I1KH 3DRQB 3LRHA 1V5JA 3AS3A 5HDOA 2DIJA 3RVUD 3HC4H 3KR3L 2DBLH 3L3KB 4TVPD 4PLNC 1DANT 1WIPA 5F7LB 1M4KA 3RHWF 4ELME 1G0YR 3B9KD 1N5AA 4DFIA 1VFBA 3J7HA 3MUZ1 5F7HA 1QLEL 4JPKL 1Z5LA 2ATKB 4HJ0D 1XGYH 1YMMD 2XQYK 4JRWA 1QPXA 1CVRA 1F4AA 5IVXE 4WHYG 1T0MB 2MFNA 1RIHH 3N85H 4QHUB 5ANMA 4D9LL 4OB5H 2Z31B 1KFAH 3L5XH 1KUMA 1FRGL 2FGWH 3QHZH 5KOMC 3L7EB 3DMMC 1N4XH 3UYPA 4P23C 4OFYD 1OCWH 1I9IH 4Y5XC 5KSAA 1JZ6A 2CQVA 4PJ9D 4ODTL 5C0IA 5KN5B 4RIRA 1OAQH 3CCHB 2EYSB 1F00I 4MA8L 2YEZB 5B3NA 1UH2A 3FHAA 5HDLA 4XXCA 4NQSB 1OM3H 2C3XA 1XIWB 4OKDA 1Q8MA 1CU4H 4Z7OE 4HIJB 2X70A 4LIQE 1MCQA 2HFGH 4FN0A 3S97C 5T3ZE 1MQ8A 4FQ1L 5HI5D 4P2QB 1T5WA 3GSNA 4MNGE 5EN2A 1U3YA 2VSDA 5FYLL 3MGOB 2HP4A 3QDGD 3OKDA 1EO8H 3T0EE 3O9WB 4YHLL 8CGTA 3KDMA 5DWUL 4KUCD 4LSQL 3EFDH 3QIWB 3KPOA 4WFGD 3F7RA 4DGIH 2NLJB 1DLHB 3HTLX 4PBVC 1OVZA 1VCAA 4X6CE 1B4RA 4HS3B 5T1DL 2YMXH 1NGQL 4O51B 4ZO9A 5DT1H 5EC2A 4ONFH 1A1NA 1AXTL 3LS4H 5JDSA 3DVGB 2VLLA 5EWIL 1EUTA 4MQSB 1KGCE 2B4CH 4HXAL 1NCAL 1D9KB 5EBWA 3NABH 3QIBA 1PDKA 4PGDA 4JO3L 1DVFA 1OL0A 1I4FB 3NN8B 3S8WA 1IGCH 1P6AB 4QRSA 1BAFL 2Y7QB 4YBLC 2VDLH 4W4OA 5A2LH 1CXHA 5FK9B 5FOBB 4KVCH 2G5BA 1AHWB 3FONB 3QDJE 1S5IH 4LF3B 4X4XA 3O2DL 1HKLH 5FO9B 1NGPH 3QDMD 5TQ0L 2FEEI 4N90D 5FXCH 3SDDA 2JIXB 4WU7A 43CAB 4Z7NE 4NN7C 1ZT4A 3CDYA 15C8L 4G5ZH 3N9GH 4O02H 5DD5H 3QUXC 1I1YA 1KCRL 3TFKC 1WZMA 4TVPE 2GSGA 2GJ6B 3QPXH 4IDJH 1R5IA 5I1AA 4LDOB 5D2NC 4G7VL 2RAMA 4I8DA 1RULL 1F3DJ 4BSJA 2GUOA 2YHGA 2YZ1A 4C56B 5BQ7B 3PWUA 1CICC 4CAGA 4BELD 1UZ8B 1F11B 1B0WA 1YMME 1LD9A 3BJLA 2FBOJ 4NUGL 4KKLC 3HR5A 3S36H 2DQTH 1DBML 2Z91B 3MLYH 3MRLB 1A7BA 4OZHE 1BGXH 5IV2A 2JB6B 4L5FH 3H8NA 4OF0A 4H5SA 4LRNL 2EE6A 3RWIA 3NCBB 1MAML 3QHTC 2HKHL 5KVGL 3LIZH 5L88L 4WW2B 3QUZD 4WFFD 4NKDB 4UZGA 5IVXB 1R5WA 2JLLA 1OAZH 1BBJA 1OGAA 4I4WB 3DX7A 2DOCA 3ZTJH 1I1CA 4L4VE 4Y4HB 5MENE 1L9MA 4LLYA 5IMKB 1ORQA 2AKRA 1YN7B 1T1ZA 3I6GB 4GAGL 4HIHB 3T1FA 2FB4H 4CGTA 3FB5B 1AO7B 1JF5A 3S3PA 1A2YB 4JFPA 3E3QC 2R23B 4WFGE 3BH8A 2X4PA 1MFDL 4JPIA 1MNUH 3DMMD 4RRPG 5FYJD 4YDLB 3O4LA 1T2QH 1NUNB 2QSQA 4P23D 4C55A 1IEHA 3PP4L 2D03L 1T3FB 4QOKD 4QHKI 4M02A 1KELL 1LO0L 1NKRA 5DZLA 3QCVH 2P42B 4FQCL 1T03H 5D96C 1HXYB 2C3GA 4P4KA 2X7LB 1HIMH 2LU3A 4PG9A 3TBVB 4Z7WA 1QNZH 3JSSA 4LAJH 1OSZB 4Z8FH 2W91A 2GK2A 3VFWA 4X6DF 4Z9KB 5J13B 5CGMA 4PG2C 3RNKB 2X4SB 3UZVB 2BVQB 4JRYE 3O6FA 3TH3T 1ZOXA 2HG5A 3TV3H 1A6TA 2FX9L 1S7TB 1KJ2B 5CEZD 1M1SA 1D5BA 4QRPE 4OI8A 2BOBB 4XCEB 1UB6A 1P69B 4HKXA 1EJOL 4U7KA 3OB0K 5KVEH 3EOTL 3IDYC 4RMRA 1KTLB 4TSCH 3S37L 1JGVH 1M7DB 1VKXB 4ZPTB 5FF6B 1EO7A 2BVOA 3QRGH 5DO2C 3TBSA 3U4EA 2G60H 4OBRA 3MV7A 3V52H 5JNYA 2NXZB 5MEPB 1N6QL 2XWTA 5M7QA 5D1ZB 1NMAH 3DI3B 4J7RA 4EDWH 4HUUA 1IRAY 5KZCD 3VFUA 4LARH 4OCSH 4X7EC 1NGWA 3X12B 4JCMA 2CUIA 3L9RB 5EU3B 4HKZA 4GQPH 3RZCB 3TN0D 3DPBA 2AJZB 3HLAB 4R6UA 2YZ8A 4PRHD 4GKNB 3RPKA 4D0BB 4DQOL 1RZJL 4JHBA 3BH9A 1TIUA 3LOWA 1MCCA 3H0TB 5EUKB 3QFJE 3QEGH 2VZSA 5I17A 1HYSC 4KROB 1P84J 5IF0B 3W9EB 5I1EH 2CR6A 3UTSD 5E5UB 3IETB 4PV8B 1U9KA 2EDNA 5AZEL 2JELL 3JWDH 4X80L 1MPAL 3BD3A 3NPSB 5K9OA 1E6JL 1I8IA 4QRRE 1AFVH 5HD8C 3BESR 5KSAC 1HHGA 4H8WC 3EYUL 3QUXD 5KS9E 4NWTH 3TFKD 1ETZB 3FQTA 3D3VB 3S4SA 5D7LD 3BRDA 1KJMA 3PL6B 4TSBH 4XXCC 4FXGB 1KN4L 2A77L 2YD3A 2JCCE 4NN5B 1CGWA 1TZHA 1CICD 2UWEA 4AIZB 3UTTB 4JFQA 3FQNA 1T2JA 4YDKH 4JY5L 4M7ZB 3IRPX 3QUYA 4KKLD 5GJTL 3OXRA 3B2VH 5ESVB 2FX7H 4Y19E 1CG9B 2MKWA 3CDCA 3U0TA 5C0BB 1ZANH 4RZCA 4XI5C 4JFEB 3RHWK 4ZO8A 4JZJA 1Q9KB 2VISB 4NHCL 1RURL 4R0LC 5DHVH 4OJFH 5FYJE 4JFDE 3U7AA 3DRTA 4QOKE 4HV8B 5DJXB 3MLVL 4ODTH 3HE7A 5I6XC 1HYRC 5CKAA 5HVFB 1CGTA 3MNWA 3VFTB 1X5XA 2WAHA 1RUKH 2G75B 5H37H 2H41A 1KB9K 2O61A 2QEJA 3E6FA 5J12C 1CBVL 1XGRB 3NCJH 5IROC 4Y0GA 3OB8A 4EIGB 5IR1A 5FM4A 2V2TA 4O2EB 2YWZA 5J6HB 3AREA 4ZFFB 3QIBC 5H35A 3H9ZA 5GSVB 5CEZE 1DVFC 1G9MH 1FQ9C 2FECL 5DWUH 4LSQH 5DJAB 1NFDE 3ZDYF 3QULB 1XGQA 3B5TA 1JPSH 3VRIB 4Z6AT 3C5JB 2FL5A 2XWJB 4Z7UE 4P9HH 1JV5A 3Q3GA 3EO9L 4Y4KA 2VL5A 3SDDC 2PTUA 3U7WL 3KPQA 1BVKB 5T1DH 2MQCA 2N56A 1FNHA 1NGQH 4KHXH 4KUZL 5HHMB 3VFSB 4OV5B 1AXTH 5CJ8A 3LSOB 4ZDHA 1RJYA 5DI8B 2AEIT 4RBPK 3VG0L 2ADFH 3MNVB 4RGNB 2OQJB 2EIZB 4R4BB 1JMZA 1JHKH 4HXAH 3VA2C 2ORBH 3HPLB 4NN6B 5C9KA 3TLRA 4J3SA 2Z35A 2R4RH 2MPAH 5IGXL 4WFHE 4AG4H 2OSLA 4Y1AE 4PRHE 1FO0A 1KCSL 1I9RH 2X9XA 3CMOL 1TITA 3NIGF 5GGVY 3WHXA 2PYEA 5HVHC 1UXWA 4U6HA 3C09C 4GS7B 1U8HB 5KSBB 1MWAA 3O2DH 1BQSA 3TT1L 3VXME 4LGRB 2MWCA 4F8QA 2HFEA 3QSKB 2EE2A 5TQ0H 4KQ3L 3PP3K 4PJDF 4WTXA 1X5JA 4UOW1 4PJEE 5EBMA 3MZGB 1EHAA 1KCRH 3SKUD 1HXMA 3TM6A 1RUML 3GIZH 4UB0L 4MAUL 5I0DA 4URTB 1QG3A 5D2NE 3C87A 1IEBB 4Z7QE 5EIIB 2W9LA 2FLRT 4YHYB 1H0DB 2VLMD 2BDNL 1QFWI 5J9PA 1JWUB 3V6ZB 3B9VA 1I9EA 4EEEA 4POZC 3CFDB 4X7FC 1TQCC 4NPYB 4NUGH 4O5LL 2CSPA 3G04B 1DBMH 4NNXA 1YEJL 4P9MH 4HMEA 1V3JA 1MOEA 3VXNB 4LRNH 4YHMH 1HYSD 1ZLUK 3GSRA 4WRLA 3ALWA 3JZ7A 1MAMH 4YHOH 4YXLH 4ZFGH 3ULVL 1FN4B 3CX5K 5KVGH 1JFQL 2BSTB 1ULVA 1DQLH 3DO7B 5LWYL 3C60C 3GSQA 1S9XB 5HD8D 5KSAD 1PQZA 5MERB 3G9AB 4EN3A 3GMOB 2XPGA 3QB7C 4GOSA 3MBEB 1XF5A 2ATPA 1SJEA 4P4KC 2FHFA 4HUMB 4YK4C 4RFEA 4XPTH 4X7TA 2DM3A 3IJHA 1JPFB 2DJSA 1A7RH 2H2PD 3GHBH 1KIRB 3O6FC 5F1NB 2R1XA 1S7XB 1JWMA 1G9NL 3CDGB 1MI5A 5A2KH 1RZ7L 3EFFA 3SDAA 4D9RD 4YHNA 5C1MB 3O41B 1G6RB 3QXDA 5T1MB 4OSUL 3DIFB 4XI5D 1AIFB 1P84K 2M1KA 4NQDB 2YPLA 4V1DA 4X4YB 2D03H 5C3TA 3VFMA 5IESL 3SE4A 5CUSL 5ESQB 1LO0H 3AXLB 1LMKA 2OTPA 4KRPD 4K3DL 1CN4A 1I8MA 1CFQA 2HFFA 3U0WL 2EXWC 2P5WA 1H8NA 3ARDA 1Z6JT 3SKMB 3R1GH 1X4YA 4U1MA 1J0ZA 2Z31C 2NY2B 5GISH 2KZWA 4G8EB 3QUMB 4HUWA 2HVJA 4QGYA 4M7JH 5A3IC 2FX9H 3QIBD 4L8SB 4ZOBA 4LLVB 1DVFD 2VQUA 3IKKA 1CFSB 2IEPA 4LP4A 4MA3A 3VFNB 2DQJH 1I7ZA 1EJOH 3C08L 2PUQT 4X6BA 3SKNA 2OJEA 2GY5A 4GRLB 5GRJH 4A2LA 4XNQB 5E00A 4PUBH 5KANG 2YKLH 1XIWC 1TETH 2XNAB 5C0CA 3O81A 1UWGL 1REIA 3SDDD 4TUKL 1FLRL 2IC2A 3LKQB 4FFYH 2O5YL 4ISVA 1SEQL 1QSEA 2I60L 4NOBA 2IBZX 4DKEH 3MLSH 4PV9B 3FRUA 5K9QI 4D8PA 2VLME 3VXRA 1LE9A 1K8DA 4YHZL 1X6NA 1TJHL 4OKVB 4MMXC 1GGYA 2KH2B 1B88A 5KVMC 2CJUL 1W0WB 3EJZC 2J6EL 5EBLA 4JKWA 1RV6X 5I76A 3V4UH 3WN5A 3MSPA 2BHUA 3IDNB 1NDGB 5ANME 4XC1L 5IBUB 1T0NA 5JA9A 1W72L 4WO4D 2XKNA 3MRFB 2LQRA 2VIRA 5AZEH 2JELH 3VFGH 5E6ZA 4Q0XL 4G6FD 4PREB 1NCBH 3F8UB 1FZJB 4MJIA 3TYFA 3SPVB 2F5BL 4OZGF 1KPRA 3HE7C 1R3KA 4PY7A 1BECA 1NFIB 2V5SA 2P44B 4I77H 4RISL 2NNAA 4NJ9H 2EC9T 3E6HB 4FMKA 4RAHA 4Z18A 5B39G 4UIMA 4PJ5A 4MHHG 2X4TA 4YDVA 2O5ZL 4LPTA 4CMHB 4FNLH 4M7LH 4JY5H 1AHWC 4X7CC 1Y18B 4POZD 3AREC 5E70A 4LVNB 3RY6A 3VXTA 4MQXC 3FB6A 1T1XB 1F4YL 3RAJL 1I3VA 5CP3A 3BISA 4D9RE 3BGMB 4QF1B 1CK0H 5SWZD 2AEQH 3UTZB 1CFNA 1FNGA 2XY2A 4OF5A 2G2RA 4YPGA 1OTSC 3TO4A 1IFHH 1LEKB 1A4JA 2SEBB 1OGTA 1JNJA 1CL7H 4HQQL 4NHCH 3G5ZB 5F97E 3WUWG 3O4LD 4RWHA 3HFML 1JYNA 3C60D 4Y4KC 3R4DA 5DUPL 1BM3H 3GMQB 5TDPA 4D2NA 1UKTA 2GJZB 2IADA 2XICA 1A22B 2FJFA 3ZHDA 1ITCA 1H3GA 3C5SA 1BF2A 1WFTA 3BDYL 4P4KD 3GMNB 5IKCB 3OX8A 3VXSB 5AWNH 3DV6A 1I9JL 1VB9A 2VR9A 4QXTB 3O6FD 2WQ8A 4EVNB 1HINH 2JB5L 5C0FB 5EG6C 1KPUA 4WEMB 3NFPB 2FHBA 4OQTH 5I2IA 4WW2C 4Y5YB 1HOCB 3K4ZA 5CWSB 4MDJA 3M45A 5B3JF 1CD1B 1MRDL 4Z0BL 1J05B 5IHUL 5DR5L 5IQ7H 1YEGL 2HN7A 1XZ0A 4JRXE 4IMLA 4GW5B 2ICES 4PJAA 3CZFA 1FFPB 4MA1C 4RDQG 3I02A 5FO7A 4KUZH 2EYRA 4JKLA 4P99A 1QRNA 3HE6B 5E94A 3ZMRA 5D72L 3OKKB 4AY0A 1FZOA 1HHKB 2NY5H 1JNHB 5DJ8B 3OR6B 1MCJA 3H3PL 1B6UA 5DEFA 4K3HA 1BFTA 2ZUUA 3UP1A 2R2EA 3GMRA 2Z31D 4IHOB 5CSZB 5ISZB 4HUVA 3LKOB 2WP3T 5A3ID 4BSWB 4LBEA 5HVWA 3VGHA 5I75B 2QV2A 4JB9H 2H3NB 3MJ8A 4ZPVA 5DURB 2DIAA 3CVHA 1KCSH 3CMOH 3NGBB 5BVPL 5L8LB 3EYSL 5GS0D 3I2CL 5JW5B 1BIIA 2OX5A 3I9GL 3I3EA 1C5BL 2OL3A 1KC5L 3TT1H 1TCMA 5GIRA 3WJLA 4KQ3H 1WWWX 1XIWD 1IC5H 1JTOA 2FIKB 4WTZA 3D9AH 4P5TA 4X9GA 1E28B 1WBYB 2V7HA 2WIMA 4JCLA 2I9TB 4HAGA 1IL1A 3DX8B 5J13C 1S7VB 4ZS7L 4XPGH 3EOAB 4P2QD 4F7PA 1IAIM 4NZTL 1OGAE 1HQ4A 1OD7A 3KXFB 3P0GB 3CSYB 4H88L 3DJ9A 1GGTA 4LLAA 2BDNH 1DSFH 1KJVA 3BHBB 3HZMA 2F8OA 4KDTC 2J7LA 5T3XD 3BP7A 4NQCB 1A6PA 3D48R 2QHLA 3OSKA 3EJZD 4Z0XA 1AI1L 1UZ6F 1YEJH 3SDAC 3LV3B 3IAGC 2Y72A 4U0RB 5FGCB 2FNBA 1S9VA 2W60B 4JN2B 3DBXA 3OG6B 4K55A 4XP6H 5D1ZC 3ULVH 3CFJB 4PJCB 1JFQH 5DMKB 4MX7B 1KIPA 3O4LE 4CDHA 4HJJL 1MQKL 1MVUA 3STLA 2KKQA 3NCFB 3SE4C 3SGDH 3HE7D 3ULUL 1TVHA 5JHDA 3CUPB 2GEEA 2IF7A 5D5MA 5EUOF 3S37X 5FHAL 5GGSB 2XI9A 4GLRI 3QXAA 3VA6A 1OLLA 1Z9LA 5HGHB 5J6GA 5L0QC 3MX0A 1KACB 3ARDC 3FO1A 4Z7WE 4RGOL 3RJQB 1JF6A 4NM4H 4XP1L 4Y16B 5FKAA 4HFWB 3REWA 3SQOH 5L9DH 3WKNA 1IM3A 5J1SC 5IM7B 3ARED 2R29L 1G9NH 3VXPA 5L7XL 2PTTA 4KDVA 4MQXD 1G7QA 1M71A 2JIXD 3KPSB 2UUDH 3JTSA 5CINL 2IPKA 4WW1B 5A1AA 4TUJB 3HG1A 4OSUH 5DFVC 5DJDA 2IALA 1OTSD 1F4WH 2GJ6D 2WUCH 2CLZB 3PL6C 1EAJA 4Y4KD 3DYMA 5CUSH 4AENA 4LSVH 2A9ML 1NBYB 3MV7E 3RWCA 1CDGA 3V2AR 1JRHH 5F7NC 4PJHB 1IAKB 3EYFA 4JRXB 4I3RH 3HI5L 3SJVA 1QOKA 1TMCB 3FN9A 3MRJA 1F6FB 2BERA 3O2WL 4ORGB 5KG9A 1ZHKA 1NCDL 2I25N 2AERT 4ZUTA 3P4OB 5A16A 3UJTL 4GMTH 2BVUA 3WN5C 5DK0A 1DQQA 1ZVHA 4X6FB 3QEUB 1URLA 4ZAKA 4X0KA 4JY4B 1ZGLM 5HYQB 3D0VB 2RB8A 1AQKH 3BEWA 3R8QA 4PLOB 1LNUB 4N1CA 2EC8A 3P9WB 1FLRH 2OLDA 4AT6B 4RMVA 1ZAGA 1J8HB 4M3JA 1FP5A 4HWBL 3J8F7 2O5YH 5T3ZH 2KUTA 2I60H 4BQBA 5MP6L 4IIQA 3CK0L 1OP5H 3FB7B 5J1AA 3LS5L 4X98A 3ARYA 1TJIH 5CP7A 4H1LH 4PJGF 2ITCA 4TSAH 1A6VL 2UWEE 4YHZH 4DN3L 1TJHH 3MLPA 2EECA 5T3XE 1KENL 2VTFA 2BVYA 3BO8A 3RY6C 3ZTNL 1XR9B 1IBGL 2J6EH 3P77A 4ZYKB 5BV7L 3EKCA 1AGBA 4XMKH 3HB3C 5DQ9A 1YEDB 1PKQE 2QKIB 4K7PL 2X10A 2PYFB 1MVFA 4HKJB 1S3KL 2Z92A 3TO4C 4BKLA 3VFPB 5ITBH 3ZE2F 3QJHA 5HPMB 4RGNC 3KJ4C 1XGTB 2FH6A 4PP1C 5CLTA 1DQML 3G6AB 3CH1B 3BVNA 5LGJB 1C7TA 2FATH 4NN6C 4OLVL 5IMLB 5FA3B 4RISH 3BI9X 4EXKA 1IKFL 5CBAB 3ZYZA 2YS4A 3CC5B 3SHSA 2KBGA 1S9WA 3G9VA 2BSSA 1N3NA 4K7FB 4GS7C 2X4UB 4ODUA 4WUUB 3HMXA 3Q5YA 4YFLI 1WUNT 3C8DA 3BZFB 4NQUA 4U3HA 1MI5D 1F4YH 3GHEL 3RY5A 3SDAD 2J8UF 3B4NA 4E41B 1T0PB 1ZLSH 5L8JB 1VSCA 4FQXB 1AQDB 5D1ZD 3RWHB 1ZEAL 1O7VA 3BW9A 4TVPH 2YPLD 3X11A 3HFMH 1YYML 2VLRA 4V1DD 4YFEA 5BRZA 3ZKMC 3KHOA 5IEKB 2GK0A 3RZCD 1BZ9A 1HSAA 5FYKD 1A6ZB 3CMGA 1C08A 2BMKA 1NL0L 2P5WD 4O2CB 3ARDD 4M7KL 1HILA 2VDQL 3ECBB 1UVQB 4OFIA 5EU6B 2JJWA 2BRQA 1FORL 3IDGA 4NJAH 3LQZB 3MLUH 4AMKL 3B3IB 3GSVB 2WP3O 1K6QL 1OF2B 5IVZA 3QCTL 1JN6A 4HG4J 2CLRA 1DUZB 4XX1E 1HH9B 3R06A 4JFYB 1RHFA 3MC0A 1FYTB 1E27B 3EYOA 1K4CB 2PYEE 4PJBB 2W0PA 4P4RB 5GRWA 4PY8I 2DS4A 1FC2D 1T7ZA 1MCPH 3SGKA 3D3VD 2H32B 1A6UH 3MBEC 3PL6D 4FQLL 1GAFL 3LPGA 3WE6A 3KYKL 3Q1SL 3HZYB 4X6DA 4LLUB 4P5TC 2AQ3A 2R0KL 5TF1L 3CZJA 1PZUB 3NA9L 2NX5A 1BOGA 1V7ML 1FIEA 4UOJA 3UTTD 1A9BA 4WENB 4U3CA 1CGSL 3WNNA 4NO2A 3H3PH 1JZ2A 1YUHA 3MCKA 2J4WL 5I18H 1T21A 1LDPH 2DWDA 2VDML 4F9PA 5D71H 3VXRD 5C0BD 4X99A 4JFED 2EDLA 3QIUA 1FVEA 5E2TH 5BVPH 1J8KA 1SJHB 3LEXB 3EYSH 3I2CH 2HT2C 1NJ9A 5JW4R 1J5OL 5BZDB 5KSVB 3VRJB 5IIEA 1IGFL 3TWCL 1IM9B 2YPVL 3KG5A 1NGXA 5JO5A 2BP3A 4J2XA 4OZIA 3TO2A 1FG2B 1YQ2A 3BT2L 3MYJB 4NO5B 4C83A 2IH3A 1ZWIB 4MJID 1I7TA 2V5YA 4TNVF 4JFOB 2B2XH 1IAII 1FBIL 5H2BB 1PKQB 1J0KA 1PKOA 3GJFH 3RI5F 4U05A 3TA3A 4H25A 4PJ5D 1PEWA 3MRDB 4YIQA 3P40A 2ADGA 1A1OA 4LPCA 4B50A 2HKFH 3I3DA 3CX2A 1MI5E 5GRVL 3B83A 4UTBL 4DZ8B 3KYNA 1P9MA 3ULVF 3CPLB 1HQRA 5HY9A 1Q1JL 1R5VA 3HB3D 1CF8H 5F9OH 5INDA 2LE9A 4OIAA 2HFTA 4HZLB 5HHMD 4N1EA 5CJQL 2ZSVB 1I75A 4QHLB 2XY1A 1YN6A 3TO4D 3GJEA 4NYLA 1YA5A 3TCXA 2YPLE 3T3MF 3MRMA 1MQKH 3OAUH 4RGND 4V1DE 2D31A 5F96H 3UAJC 4PP1D 5E1AB 3L3GA 3NIFF 1B0GA 3SO3C 5FYKE 1Q9LA 4ONHA 5FHAH 4WWID 1NMCC 2FO1A 5KSUA 2A73B 3MLTA 4IRJB 2P5WE 2OM5A 3S34H 5HYSB 3JV6B 4XP1H 4JZOA 2IANA 3ZE1F 3QPQC 1R3HB 5L7XH 3W82A 5E24E 1S7RB 3VD5A 1U6AH 1AGCA 4NQXA 2WW8A 1MEXH 1K4DB 2ZJSH 3DTXA 1HNFA 1GPOL 2Q76A 1MSPA 5F8QC 3BE1L 4P46B 3X14B 3MCLH 4E0RB 4PBXA 3ARFA 2AABH 4RMUA 1UM6L 4FTVB 4YGVB 4H8WL 2R9HC 1I1RA 4FQHA 3VH8B 1K9TA 2X2YA 3AU1A 4NSKB 5DRWB 4PGBA 4HIEA 3CSGA 5IHLB 1FNSH 1BVZA 2R2BA 1NAKH 3LKSA 4QCIA 2DLTA 2XZCL 4KKCC 5C0CE 3ZKMD 4F9LA 1Q9OB 1IC7L 2VABB 5C92A 3UC0L 2BJML 1QRND 2DQUH 3U2SB 3MJ7B 4LVNC 1QSEE 3AAZA 3HI5H 1GHFL 5BVJA 1U3HB 2ZSWA 1U93B 2OBGA 3VXRE 4MCZB 3O2WH 5MI0B 3KLAB 3N06B 4F2MA 3DECA 2AK4A 3P0YL 1SYVB 4RAVB 3UJTH 4WI4A 3PJSB 2CKBA 5TE7L 1A9EB 3NOIA 3DYOA 3C5ZB 4U6XB 3MBED 3AM8A 4XMPH 4F57L 3QQ4B 2RCSL 4P5TD 3G5YA 1FH5L 4Q2ZB 1ZGLA 5C0DB 1QFHA 3MRCA 1KB5B 4HWBH 4TUOB 4XVSH 4Q9QL 2O5XL 4JHZA 4L1DA 3OJDA 4KI5E 4A6YL 2HJLB 2VERN 4J4PA 5LAXB 4GAJH 3HR6A 3CK0H 3VW3H 2HT4C 2VC2L 2ZUSA 1B0RB 2ED9A 1GRWA 1FL3B 5DS8B 1IGYA 3KAAA 4NWUH 4PJ5E 4XCFL 2W65A 3DGGA 4DN3H 5ACZA 4X6CF 1TZGH 2FYYA 2PCPB 3TBTB 5IEHA 1MFNA 4NQDD 4P3CL 4PJDA 3ZTNH 1YEEH 4R97B 1IBGH 4U1IB 3GBNL 2H26B 3JWOL 2XN9B 4U1LA 4JVUA 2HT2D 4HG4K 4FZEH 2Q8AL 3T09A 1RHHA 1CE6A 1ZT1B 4JAMA 4K7PH 3HE6C 4YDJB 1F58L 1OB1B 2X4NB 3RX7A 5ID0B 1T20B 3LQAC 5FUZL 1FZKA 3HNSL 3Q6FB 1RJZA 3TIDA 1UH4A 3KGRA 2FBJL 2H8PB 3GMMA 3M17A 5BO1L 4GRWH 1CTOA 4DKDC 3WFEH 1EFQA 3AB0B 1D6VL 2JF1A 4IOIB 4OD2A 1CZ8H 5MHSE 4LGSB 4MJ2A 1BJ8A 3NGBC 1EH9A 3B9DA 3CSBA 2LV4A 1ND0B 1PYWA 1T22B 4MJ5B 4ZG1A 2YRPA 5F7MC 4QHNA 4Z7NF 2F53A 4NKIL 3MREB 4ZSOB 4OLEA 3DHMA 1TDQA 3H2WA 4M61A 1E4XL 4DN4L 2BVPA 5IBUG 3W39A 3WHE0 2CK0H 3AVEA 3ARRA 2X4OA 3HG1D 1BLNB 2A6KA 5AD0A 4D94A 3BUYB 3REVB 3BD5A 1ZEAH 3EGSB 5IW1B 4MNQA 1YYMH 4FP8H 4PJAE 5IW6A 3UAJD 3O6KL 4OLWL 1UJ3A 3QEHB 5ICXB 5I16A 4JQVC 5IJKC 1KT2A 4ZUVB 1QRNE 1UGNA 1T5XB 1KIQA 1NL0H 4OZHF 3LN9A 3FFDA 3O3EB 1VERA 4M7KH 4UIKL 2E5EA 3RU8L 1MJUL 4U0QB 4HK0B 1TTGA 5FDYA 3SJVD 4F9PC 4F7MA 1K2DB 1B4JH 5EO9A 3HUJF 1FORH 5DLMH 4AMKH 3GK8L 3O3BB 3QPQD 2DWEA 3HS0A 1K6QH 4LLQB 1L0QA 3QCTH 5DD6A 4ZTOH 5IFHH 4ENEC 1P4BL 5D2LA 2X4QA 4H0GA 1MHCB 1HH6B 2E7HA 3PWNA 3OPZL 4OAWA 3QJFB 1BOYA 1CR9L 4R96A 4JO1H 3ZZ1A 2R9HD 2FJGA 5HYJB 4XCYA 3FQUB 2YC1B 2VXVL 4FQLH 3U4BL 4X5WA 3Q1SH 2IPUG 5IB5B 3RTQB 5DJZA 3K4DA 3NA9H 3U9PL 4Y16C 5EPMB 3L5WA 5EOCL 3B6SA 1O5DT 4LVHC 5I1DA 5I1JL 1WCBA 2AXGB 3NMEA 3OL2A 4FHBD 4KUCF 4L3CA 5I0ZA 2J4WH 1LEGB 4KJYA 1R0AH 1X6LA 5C9JA 2VDMH 5FDWA 2B1AH 3TA3C 4DGYL 5F7UA 5D7IB 3BUTA 3FT3A 4AK1A 4OF8A 4KTDL 4EQ3A 1TPXB 2ESVA 5AG8A 3SY0A 1MJJB 4JFHE 4Y5VA 2CLVB 4MAYB 3FT2B 1Q72L 4PPTA 2E27L 3TWCH 1A0QH 4GUPA 3NFSL 1NKOA 4NQEB 1I3RB 5EB9A 3SDYH 2IG2L 3BT2H 3U36A 1R3LB 4LKCA 4G43B 3VXSD 1BIHA 4V2CB 2Z93B 3QBTB 1P7QB 4KY1L 1MF2H 1D5XB 1EFXA 2MHAA 4EUPB 2P8PB 3IJSB 5JHDE 5D5ME 1AJ7L 5F9WB 4QXUL 4LLDB 2HT4D 4WV1A 1UYWH 1WWAX 2NXYB 3FFCA 2C7UA 4OCWL 4ODXA 4OQ1A 1T1YA 1AR2A 1DZBA 2VN7A 3S88H 4BSVA 4OZ4B 4JFFE 5C0JA 2H9GA 5GS0L 3D2UA 4HIIA 4NBXB 2P47B 1NCUA 5HGDA 5KJRL 2GQHA 4UTBH 4P57B 4LQFH 4OZGA 1Q1JH 1U8KB 4ELKA 4TNVK 5GSRB 2GW5A 3H9YA 3TBWA 5CJQH 3ARFC 3HE6D 3HG1E 4Q9RH 5GS2D 1U8OB 3D85A 3RI5K 3VXUB 5CZVL 5JHLL 1VDGA 4NQTA 4LNRB 2VLRD 4IRZH 1QBLL 3P9LA 5BRZD 3BSZH 5C07A 2P5EA 4HX1B 3TNNA 5I66B 5ADOL 4PTUA 4NT6A 1LP9B 4ZQKA 3DX6A 2YN5A 3ZHLA 3BXNA 5EZIL 1AGEA 4LK4A 4GKSB 2P45B 3C9NB 3HC3L 3AFLA 5DHVA 2ED8A 1M05B 3SJVE 4ETQA 3DVIA 3O2VL 2AS5M 1OAXL 2W07A 3B9EA 1SEBB 3STZB 2EICA 2FWOA 1YNKL 1SY6L 3CXHJ 1GPOH 4QEGA 1EPFA 1Q9WB 5D93B 3D25A 4OI9A 1D6EA 4CN6A 1OOAA 3TCLA 3TPKA 4H8WH 1NCWH 3UBXA 2JCCF 4HFUL 4XBGB 4G7YL 3RA7L 2CIKB 3WFBL 4ODWA 4Z5RB 3PWPB 4Q6IA 3WNKA 3QQNA 4K7PX 4DFHA 1IQDA 5E8EA 2UUDK 4QO1A 2AXFA 5DRNB 1HI6A 5JDJA 1RVFL 6FABL 1T1WA 1S5HA 2H1PL 3S3JA 3DX9B 3D69B 3VFOB 1KEMH 4MJ6B 2IMNA 3ES6B 2B0SL 1U91A 1L6XA 5E99L 5HHVL 5KW9L 2N4IA 43C9A 3AS1A 2ZWLT 3P0YH 4ZOEA 3WFDL 4ENED 5TE7H 1FAIL 4NCDA 4FG6C 4M5ZL 5KBNC 3KWWB 4BFEA 3CFEB 3C6LA 3H9HB 2VLJA 1VADB 1F13A 5CS7A 4F57H 3L3IB 2EEDA 4YQXH 1FH5H 1RZKL 1HE7A 1DLFH 5TPWL 4Y16D 1L6ZA 2O5XH 2YR3A 5E08H 4A6YH 3EYQC 2EKJA 4DCQB 4RCAA 1M7IA 3EZJB 5D9SA 3O2DA 2QR0A 2VC2H 3OKNA 5DMIL 3P73B 1YEIH 3OXSA 3TA3D 3DI2B 3B5HA 2IAMA 2V17H 3IJYB 4Z7UF 3D0LA 3L3OA 5DJYB 1N2RB 1EMTL 2AP2A 3FQWB 2Q8AH 1OP5K 2DM2A 2DYPB 4U6VL 2P48B 1MIEL 2BZDA 4ZXBA 2BK8A 3O6ML 4Y4FA 1C8PA 1OLZA 4JFFB 2F9BT 3HNSH 4GRWF 1G7LA 4JANB 1A7PH 2Q7YA 1KXVC 2VLRE 1YQVL 2ZG1A 2WM0A 4JY6B 4PRIA 5GQBA 3V4PH 1QA9B 5BRZE 2FBJH 1UJ3C 3MROA 4OGAC 1A6AA 3QNZB 4LCYA 5I1LA 1D6VH 3MJGX 2V7NA 1YC7A 1MCWW 5HGBA 5L2KA 4MXVE 4X9HA 3NCCB 2YA2A 4QKXB 1BD2B 3TIEB 2F19L 2VDPL 5L8KB 3W9DB 4O58H 3BWUC 4BUHA 3NZ8A 3T04D 1G9EA 3ROOA 4LVOB 5JOFA 1NDMA 4DN4H 4QTHB 1J8HD 1S7UA 5JXEA 3CLFL 1Y0LA 3D1MC 4BH8B 4Z7QF 3QI9A 3P9MA 4K07A 4MD4A 1A3RL 4UILL 1KJ2L 5D1QA 4X6DE 3O6KH 3GSOA 4NRYA 4UI2A 4QTIH 5DJ2B 3HCVA 2NX5E 4OCRL 3ARBB 4XPHL 2P4AB 4G6JL 2QQNH 3AS0A 4UT9L 3CIQA 3RVXC 1G1YA 3VRLF 4GG6B 3MNZB 3A67L 5AUMB 3RU8H 1MJUH 1PSKL 3RUGB 5MEQB 1WITA 1C5CL 4M93B 1CFTA 3IXTB 3KYMA 1FFOB 4PRDA 2FO4A 2VDNH 3MV8A 2APWA 2R1WA 4NC1C 5ICYA 1P4BH 1P2CA 3VWKB 3LPWA 4M1CC 3OPZH 1CDJA 2X4RA 4RAUB 1KN2L 4FOMA 4WWKB 3U4BH 4N0UB 4OZIE 1ES0A 5C0EB 3N1GC 3U9PH 2DI7A 2ICWJ 3FAWA 4M6NL 2AJ3A 2GSIB 1AH1A 2IPTL 1RJLB 2YA1A 4M1GH 4XNXL 3EOBA 2YXFA 4BFIB 5BS0A 4KTDH 5FYJU 3MV9B 5AAWA 3D39B 4HLZG 4IS6B 3PHOA 1K8IB 3UROR 4X5XA 3F6LA 1DEDA 1Q72H 1NBVL 5DYOB 1C7SA 5K33A 5C6TH 4GRMB 5F7EH 4IM8A 4FG6D 2ENSA 3NFSH 2PW2B 4I18A 5SWSB 1NEZB 4Y7MA 2XTJC 2AEPL 2IG2H 1H5BA 1IGML 2B5IC 1I1AB 4XNYH 3DUHA 4PJGA 4F33B 1R3IL 3LVEA 4ODHL 5E5MB 1U58A 4MXWL 1VGEL 1J87A 5GGRA 1JUFA 4U1SB 4M5YL 1AJ7H 5DRXA 3DUSB 1W0YT 5MI0C 3EYQD 4QRUB 5E03A 3O11A 5E8OA 3BKCL 1XCQA 1ED3A 4HS8H 4OCWH 3H9SB 3T0XA 5F1IA 1FYTD 3THMH 4NHUA 5FECA 5GS0H 2GCYA 4XH2A 3RL1B 3QO0A 2IANE 5D6CB 3ZYJA 4LFHG 4XBGA 4XBEH 4LLMB 5C09B 3GJFK 4G9DB 5FKPA 4PJ8B 4ZUWA 5DGQA 3BMWA 3GSWB 4NRXB 4EXPX 3FQRA 4MQ7B 2ZG2A 3G5VB 4I5BB 1ITBB 3DO3A 2CDEA 4CU7A 4HH9B 2VRAA 4PRAA 3UYOD 5DD0L 4JDZB 5DK2A 5M94B 4OLYL 1I7UB 2F5AL 5CZVH 3PQYB 1AKJB 5JLZB 1A47A 5TQ2L 4LSTL 4MNQD 1QBLH 3KPLA 4L3EA 2AJYL 4MGXA 4Q6IC 5DJCA 4Q9CA 1X5YA 1AR1C 4WFED 1IC4L 4OGAD 1YPZA 2CXKA 3WXVL 4AYFA 5JTWA 1FPTH 5T3XH 5EZIH 5E8DL 4QXGL 1Y6MR 2J8UA 4R97C 4OUOA 4F3FA 4S1QL 3QH3B 1MY7A 4N0FB 5C2BH 2R39A 3MRKB 1XGUB 2DQFA 1IT9L 2Q6WB 5K9JL 2A2QT 4HWZA 2EIBA 4HSQA 4EI5A 1IM9D 5EOTA 1OAXH 1W72B 5D7SH 5D70L 2WINB 2AK4E 4JJ5A 3EYVA 3RWJA 3BZ4B 5AYQA 2GITA 3NTCL 5IB2B 2VXSH 2FECI 5ACLA 1S9YA 1UA6L 3C6LC 1D5MB 4G7YH 4LCUA 3WFBH 2A6DA 4R7NA 1QSVA 4X7SH 1ZT7B 1BEYL 4ONGL 1BZ7B 2V2XB 3MR9B 2RIKA 4OD3L 3RVXD 6FABH 5CHNB 1D5ZA 1ZVSA 4QHMB 3NCYP 3LY6A 3NIGE 3VWJA 1F90L 5HYSG 2AK1L 5F88B 1CXFA 3LN4B 4LCWE 4KVNL 1CDUA 3SE9H 2IAMC 3O6LL 4GW1B 5E4EC 5E99H 5HHVH 1YEKH 4HS6B 1FL6B 3WFDH 2Y5TA 3S35L 3K4AA 1RZFH 4PJDE 5ILTL 4GBXA 1N6VA 4M1CD 4M5ZH 4LDLB 1XFPA 4ZXBC 1H15B 4R7DB 4HCRL 1EK3A 3VH8G 1ZSDA 4Y4FC 3HI1B 1LK3H 4YC2C 3SN6N 4YUEL 1TTFA 1P7KB 4WVRA 1WLHA 3EO1A 2C1PA 2CMRL 1HEZA 4DAGH 1KG0A 1YYLL 5TPWH 4XCNB 4N0CD 1XF3A 3ELAT 4G9FB 5IHZB 1FFNA 4OIBA 4R26H 1UCBL 1MLBA 2VXUL 2PR4L 1QEWA 1QLFA 2BNQB 4NGHL 4YXHL 4J1UA 1ZHNB 2D4FA 3BWAA 2R8SH 4RX4A 1OY3B 3DSFL 4HUXA 4OFPA 4ZO7A 5DMIH 2X1WL 5DUBA 3SCMB 4JREB 5ERWB 1EBPA 3L3HB 5DC4B 5EZJB 1BQHB 1X44A 4AEHH 1GXEA 3TT3L 3EIFA 4FTVD 3BN9C 1Y6NR 1TCRA 2IJ0C 3MACL 1WT5C 4K8RL 1MWAH 1S8DB 2F53E 4U6VH 4BH7A 2I9LA 3C2AH 5GHWH 8FABB 1G7JA 5JXEC 2XTJD 5D1XB 4DUVA 5EO1A 4DWHA 1KYOK 2HLAA 3KHQA 3QI9C 3KYOA 4K2UL 3QUKA 4L9LB 5JPNB 1LO4L 4MNQE 4FQ2L 1YQVH 1RZ8B 1XCTB 1MCIA 2Y36L 4M00A 1U3HD 2P5ED 5C07D 3QWRA 4OCYL 2XZQH 4GMSH 1QVOA 1UACL 1G6RL 5IQ9B 4HKBB 3RGVB 4O2FA 3T4YB 1HHHB 3MPCA 2CUMA 1N8ZA 1QSFA 5C0NC 5I8CB 2C4XA 1FVDA 2HRLA 2IGFH 2QSCL 1UQSA 1FC1A 3AY4C 3X13B 3IS1X 4DVBA 5FEBA 1KLUB 2EXYC 1QFWH 1A7OH 2K7QA 2F19H 2VDPH 1MRCL 3O3DA 1VGKB 4XTRC 4R3SB 3KNBA 3NZHL 5E6YA 4G6AD 3QG6A 2GT9B 1OT2A 5EC1B 1YY9C 3T0AA 5HDQL 5DJ6B 3LN5B 3WEXB 3C2SA 5D2LE 5DMGC 5INCA 3CLFH 3WSQH 2BCKA 3ZL4H 2RFXB 1U8QA 2OK0L 5F9WC 5EOQL 5JW3L 3QUML 4L29A 1RZGA 1A3RH 4EDXB 4U1GB 3DROB 5GZOC 5FYLD 2GJJA 4PJXA 5F9JA 1AR1D 1Z9OA 3BFOA 1F02I 2R2HB 5HYEA 1ZGLP 5D7JB 4UT9H 3RDTB 4P2OB 4G6ML 1NBQA 4ZTPL 1FIGL 4Z95H 1F6AA 2QQLL 3C6SA 3IAPA 1MAKA 3O45B 4Z76B 3UCRA 5I73B 3GMLA 3IDMA 2BNUA 3MRGB 4G42B 4GH7B 1SBSH 1T6WA 4XBPA 4MQTB 3VJ6A 5HVGB 4PJ7B 2ESVE 4FQJL 1QR1B 1EAPA 4D0DA 1Q0XL 3OKLB 4DKAA 4KZDL 1IGTB 4HEPG 3HZKA 5L2JA 1E0OB 4JEGB 3F58H 3MCG1 3BPOB 5E4IA 1U8JB 4U1HB 3QZWA 5DZOA 4I18C 4LCWB 4XHJD 5ALBH 5FYKH 2X1XR 3C6LD 3GM8A 2VLJD 3F7VA 3TH4T 4OZFB 1MJ7L 2EDJA 3BDBA 4WCYL 2JKXA 1RZJC 2R69H 3G6JA 1KCVL 1JGLL 5GPRA 4OCXL 1DR9A 3IDJB 4NO0A 1DN0A 2UY7A 2IPTH 3ARXA 4PR5B 2Q8BH 4KHTL 3VGEA 1H9VA 3GUTB 4JGMA 3FFCE 1AC0A 3MBXL 3T0VA 3GFUA 4LRIA 3V0WL 2IAMD 4PRBA 5F6IB 2ZUQB 3BQUB 2MCPH 5C08B 1P5UA 4WEBH 3WDIA 3RIAF 3FO9A 4WY7L 4OZGE 4U1JA 3V5DA 3ZDZF 2XYCA 4UUJB 4KWUA 4LCCB 4H1LA 1W0VA 5GRUL 4PTTA 5HJ3A 1R24B 2XTJE 4HBCL 4Y4FD 4LPVA 4LAQL 3SQBA 1NLDH 1IGMH 2VZ3A 4DVRH 3SE3C 1R3IH 5HHQB 4ODHH 2J6EA 5E56A 4ZNEA 1NCTA 4MXWH 1VGEH 2QADB 3F6IA 2P5EE 5C07E 3V5KB 4M5YH 4HWUA 4KJPD 4TOYL 4KU1A 1G7HA 1PY4A 2NW2B 3BKCH 3RWFA 3TVMA 5HHPA 4GXVL 2C4FT 3ARGA 4N8VA 4PYGA 1P1ZA 1JTTA 5FCUH 3BKJL 2BC4B 3ZT6A 3FL7A 4OT1L 4EI5C 2XZAH 4ZFZA 3BN9D 1A1MA 5HYJD 5I1IL 4AL8H 1T83A 5DRZB 5DEZA 4K3JL 3WKMH 3UTQB 4J3UA 2D7QA 1KTDA 2XG4A 3BPNC 5JXED 3K1DA 4OLYH 3DURA 5CZXC 1U3ZA 4MNHB 2F5AH 4N9GA 1K5NA 4LSTH 2GYSA 2AJYH 1RIVL 2UWEF 3QNXA 1A3LH 4F15C 5FYLE 2PXYA 1D7FA 1CIDA 5D6DA 1OTTC 1JNNL 4X4ZA 3U46B 5E8DH 4QXGH 5C0ND 5ALCL 4Z78A 1X7QB 4S1QH 1MCOL 2ZP0T 3WXWL 5B3JE 2VB5A 5LGHL 1IT9H 2EXYD 2FGZA 3IKCA 4JDTL 5CP3H 1INDL 4XTRD 5EOCJ 2Z4QA 1BFOA 2ICWB 3K1KC 1JMXA 5HHNA 1U42A 5F7DB 1YY9D 3MUGB 2ZPKL 3DXAB 4GBXC 1C12A 4MWFB 4X5LA 5DMGD 4K71B 2VMFA 2ZCHL 2AJSL 1P7QD 4LSRL 3EHBC 3KLDA 4G8GA 2NW3A 1QQDB 4NZUL 2D3VA 5JR1L 1LE5B 2DQGH 5F70A 4AM0A 4WGWB 3ESVF 3H3BC 5GZOD 1MHEB 3HUJA 2GTZA 1BEYH 4B5EA 4ONGH 5T1KA 3SOBH 5DFTA 1UM4H 2UZIH 5EFIA 4OFYA 2IQAB 4P5MB 1H3PL 4ZFOB 5J8OA 2ARJB 1F90H 1NC2B 2NTFA 4CU6A 4IOFC 3P0VH 3FT4B 4KVNH 1CD8A 4DEPC 3IF1A 3OB0H 4U6TA 1FZMB 4L4TA 1RUQL 5ILTH 1DDHA 4PJFB 3QDGA 3FAXA 3ARBC 2JK5A 5I1CL 1JGUL 4MSWB 2JJSC 4YEEA 4F7TA 3ULSA 4YUEH 1R3JA 4G80A 4S10A 4ZUUA 4PRIE 4W6YB 1L7TH 4M93C 2KQMA 1UCBH 1KEGL 2AV7A 4EI6A 3GSUA 2PR4H 3G08A 3QNYA 4NGHH 3V7AG 2DTMH 3PDOA 4WW2F 3MOBH 4KMTH 4P3DA 4NDMA 3DSFH 5DTFA 1JZ3A 3K8LA 3T08A 3ULVC 5L2KE 3SDCB 1ZHLB 2XFXB 4K3EL 2LFGA 2CDFA 1WTLA 1RU9L 1TVBA 4QT5B 1H8OA 1L4IA 3TT3H 2V2WA 3QG7L 1BBDH 1JGDA 1XGPB 3GGWB 4HIXH 1J11A 3MACH 4FMFA 2HYMA 4K8RH 3K7UA 3GJFA 2CIIA 2DMBA 3WCYA 2EE3A 1TXKA 4HUKB 4I48A 2DLFL 5EUOE 1JPTL 1CDBA 4QYOA 1UXSA 3ZDXE 5JXAH 1KOAA 1DQDL 1VFOA 2APXA 3PGDA 4FQ2H 2Q86A 1XF4A 2DQDL 3HRZB 5E2UL 2Y36H 3QDMA 4OCYH 1EXUA 1UACH 5CJOL 1AD0A 2QSCH 3DETD 2Y06L 4YZFF 4XMLL 1PBYA 2EDRA 4M8QA 1SM3H 4U1KB 1MJ8L 4PP2B 4WJ5B 1MRCH 2W0FA 3T77B 3WS6A 1WK0A 4LMQI 5BW7A 1NLBH 4X8JA 3NZHH 2L7UA 3MV8E 4XWGH 3UMTA 4HBQA 4HH8A 5HDQH 4DTGL 1I1AC 1G7MA 3WV0A 3KPRA 4CDGC 1GOFA 3BN3B 3WL9B 2BOCA 5CZXD 5HHOB 5E9DB 4XGZB 2FHCA 3IVKB 2OK0H 1WFUA 3GI9L 5JW3H 1DBBL 3PNWA 4V2BA 2VE6A 5I8KL 4B7LA 5KAQG 3PWVA 4YR6B 1M6OA 1WAAA 3SKOA 3V6BR 3OGCB 4GLRH 1OTTD 4LKXA 3LKPB 2YRZA 5ACMA 2CRMA 2I07A 3TZVA 2DYPD 2GAZB 1AXSB 3K74B 5I74B 4LRIC 1J88A 1MHPL 1NC4B 3KPPB 4JG0L 4JKMA 5BS0E 3W2DL 2CGRL 5F7WC 1WC7A 4KXZI 1Q0XH 4KZDH 4UINL 2XOTA 4BZ2L 1HZHL 4OM0L 2WZPD 4GQ9L 1U8NB 3EZ8A 4GBXD 4HXBL 1T89A 2YD1A 4HF5L 3PWJA 2MCG1 4CADA 3RRQA 2DI9A 2UZXB 3WIFB 4Z7VA 3HZVA 4NFDA 3U4AA 5JPMB 4RGMB 2DLGA 2VQ1A 3IDIB 3QQ3A 2EKSB 3PWLB 4HHAA 4ZUSB 1MJ7H 4WDIA 4PJGE 3DMMA 4L8BB 1BD2D 1C16B 1JGLH 1QSZA 3LKRB 1G6VK 2V6HA 4OCXH 4NM8H 4Y5XA 3QHFH 1VA9A 1WVZA 4KHTH 3TVMC 4DGVH 3ARGC 4IOFD 4N8CL 5DHYA 2DN7A 2W92A 3HAEB 1FL5A 2EDDA 4NZDA 1FE8H 5E2VL 3SKJH 1EO5A 1RI8A 1U8MB 1XH3A 1OWRM 3MRRA 4HWBA 3VI3E 2HT3C 3ZE2E 1OPGH 5DD1L 4I3SL 4WHTA 3UJJL 3V6FA 3E8UH 4M4PA 4K7PY 3OKEA 1C5DA 1WZLA 5ADPL 1TZIB 4RRPA 3ARBD 3PHQB 4HBCH 4LAQH 3IU3A 3TJHC 1WZ1H 4JZNA 3IDXL 3BEVA 3TBYB 2ADIA 1ZKAA 1IGJB 4L3EE 1D3CA 1G7PB 2P24B 1DEEB 2NY4C 3QEQB 4TNWF 3MRNA 3I6KA 3MO1A 1JGEB 5D6DC 5EUOB 4NQVB 5IK3A 2N7AA 4OLUL 1NANI 3RVUC 4S2SB 4M43H 2J8UE 1I8KA 2QSVA 4HGWA 1YC8A 1ONQB 1CT8B 1ORSA 4GG8A 1GZPA 1EEYA 1UH3A 2E3VA 3S3SA 5ENWB 2ZCLL 5EH1A 1FDLH 1U95A 4Z77A 4Y2DA 3O0RL 5CIPB 3OJVC 2UYLA 3TN0A 4HDIB 4W6WB 3FO2B 4MD0A 4H26A 3JV4A 1DE4A 1BWWA 1EV2E 1NEZG 1TENA 4YBHA 4KV5F 1EEZA 3HPJB 1SYSA 3S35X 1MFBL 1CS6A 5DEGB 1HWHB 2W9DH 1RIVH 3UTSA 3LEVL 3LMJL 3SDXA 5LCVL 1PW3A 4NP4L 2M26A 3SCMC 5J57B 1FLTX 2ADJA 4IEFB 5F3HB 3BIKA 3W0WB 5K9KA 3VXOA 2HRPL 5ICZA 3VDCA 4PJIB 4K94L 4KKNA 4XP9H 1Z0MA 2D0GA 1MCOH 3QUXA 3WXWH 4R90H 1JYWA 4CJ1A 5CEXB 5D7LA 5F3BA 1JZ7A 3KJ6H 4RNRB 4OUUA 5SWSD 4UNUA 3OKMA 4RFNC 3MODH 3EO0A 1KBGL 5EU5B 4J23A 3L3JA 4YDIL 1I1AD 2ZPKH 5IB4A 5CMAB 2ZCHH 5IG7B 3RWGA 2AJSH 1CD0A 3HC0B 2FDBP 4LSRH 4PB9H 4CW1B 3JXAA 3MXVL 1PEZA 1M7XA 5JMOC 2XKUA 4NFBA 4R2GC 1RK0A 4NZUH 1S7QB 1AD9B 5GGQL 2WWMD 4KH2A 3I6LE 2VITB 3FRPG 5MEOB 1YY8A 4F7CB 3H9SD 3FQXA 2VJXA 2HVKA 5C0AB 4Q7DA 5C09D 1KLGB 2V9QA 4J3TA 3O8XB 1S7WA 4M48L 4DZBA 4PJ8D 4ODVL 1MIMH 4IRSB 1HHIB 4TPRH 3ISWA 1JHTA 1U92A 2NY6C 5TE6H 5D8JH 1OAYL 4LSPL 3PQYD 3VFVA 1ZHBB 4FQQB 1FVCB 2X1PA 1DQTA 1I7RB 4MCYA 7FABH 1QO3B 3ARPA 2OYPA 1JGUH 2V5MA 3RDTC 4P2OC 2EDXA 3VFRB 5IJVA 4NKQB 2AI0L 2ICEA 2OJZH 2DDQL 1ZA6B 3KPNA 2Y07L 5GGUB 2DAVA 1KEGH 1WBZB 5B21A 2DLEA 3GBML 4I2XA 1ZA3B 1HSBB 5TDNA 2DBJA 1QSFE 4NNYA 3TVMD 5DQJA 1G7IA 2YD5A 3ULVE 3ARGD 5E8PA 4K3EH 1LVEA 1F3JB 1BFVL 2WIIA 5D7KD 3QG7H 3WS6C 3U30B 1NUDA 2VR4A 5JOPD 3ULUC 4W4NA 3WO3B 5IUSA 2FEDD 3ZKSD 3RPIA 3T3ME 4XPFL 5EU4A 2VLKB 2VO5A 4NKOB 4P2RE 2DRUA 4D0CB 1CFBA 2P8LB 2DLFH 5IOPA 1JPTH 3D18A 1DQDH 3LHPH 4NNPH 2P8MB 4JGUA 3IU4H 2DQDH 5C0RH 4LU5L 4JQIL 1IZKA 5I1HL 5DJ0B 1MHHA 3T3PF 2HAZA 3RNQB 5I1GL 4PJXE 2NY4D 3IFOB 3VE0A 5A43C 1IAIH 2YPKB 5FO8A 5B4MC 3RX8A 5FUCC 4AH2B 1YDPB 4OF3A 2Y06H 3IAQA 4XMLH 4CNIA 3P4MA 4M6OL 1MJ8H 4LLWA 2W1NA 3T4AA 4NKMB 3TZVC 4GW4A 1BQHG 3IFPB 4AIXA 2D7MA 3ZSSA 3M1BA 1NSNL 4G3YL 4UV7L 1FO0L 4DTGH 4G8FA 4XZUA 1QBBA 2HJFB 5GRYA 1T89C 2PW1A 5D5MF 1X5AA 3CDFA 1PGRB 2QADC 3SGEH 2FR4B 3U6RB 3S5LB 1AE6H 4MDIB 5ABDE 2F54A 4UOW0 4G8GD 1QFPA 2XA8H 2DQCL 3C8HA 2VQTA 1ADQL 2CDGA 2YSSA 1T4KB 4UAOC 1MUJA 3N1FC 4ZMAT 3SCMD 5T1KD 3V8CA 5DF0A 4ERSL 3TPUB 3VCLB 5H94B 2DQHL 4P5KB 4E5XB 3ZKNC 3F5WA 1L0XA 3MJ9L 3T2NL 5EZOH 4BFBD 1IAOA 1MCRA 2CD0A 5CJXC 3A6BL 4QY8B 1U8IA 2MMXA 2CGRH 4J3WA 1PVHA 1A4KA 1KB5L 4PRPB 1SBBA 2GTWB 5TGBA 5AZ2L 4BZ2H 1X5HA 1DUYA 4L4TD 3QO1B 4OM0H 1S9KC 4GQ9H 3FOLA 4EZMA 2BFVH 4L8DB 4HXBH 4E42A 4GAYA 2XWBB 5BJTA 3L95A 4U1NB 3VU2A 2EIDA 4R2GD 4YE4L 1ACYL 1QD0A 2K3TA 3FMGL 4X9FA 4JLRB 5CBEA 4N8PA 1DQJB 1BQUA 3TESA 1CXKA 5F71A 5GGTL 3D5OF 3MA7A 3DUUB 4ZNEE 1X5KA 4R0LA 5BV7C 4YO0A 5IT2H 1VHPA 3TYGH 2VZOA 4PGEA 3ZE0F 4PD4J 2GFBB 3IXAA 5HTSA 4KKAC 1FJ1A 2IFGA 1VACA 4N8CH 5JIPA 1PLGL 3MXWH 4K71C 5E2VH 2CKBH 2DMCA 4CJ0A 4W70A 1JPGB 2NY6D 3ZYIA 5IB3B 5IROA 3VXQA 2IH1A 4CMMB 1T80A 5JOPE 4LEOB 2PO6A 4Y2DC 3UX9B 4A6YA 1EHXA 2FSEB 5DD1H 4WU5B 3TN0C 3UJJH 1I1FB 2X44D 3WFHA 4I1NB 2OTWA 4TULH 5DSCB 1UB5A 2G9HA 4N9OB 5DD3H 5B38B 3LRSA 3RDTD 4P2OD 1IGIH 5CGYC 1WBXB 1KPVA 1QR4A 4KRNA 4OZFG 4NC0B 1MRFL 4U6YA 3T65A 4F7EB 1YEFL 2KQNA 2A9NL 1UC6A 4AEIL 3AS2A 2BSRA 2EDQA 4JPVL 3BPCB 4P2RB 4QRTA 4YAQB 4NRZB 1MLCA 3OKOB 2GHWB 4C4KO 5F89A 2C3VA 4JFXB 2EYTB 4BK4A 4OLUH 5KOVC 4KJWC 4CUCA 1N0XH 4W81A 2CRZA 3KPMA 3MFFB 5E1HB 1DBKL 2ZCLH 5LVEA 1PG7L 3T0WA 3F12B 3MRQA 2PN5A 1FGNH 4CVXB 1NBZA 3ULUD 1XT5A 2ITDA 5CILL 3HI6L 3GKWL 1QFWM 1LO5A 5F6HJ 5KANI 2UVEA 2F74A 2H6PA 5T1LB 3GIVB 1DFBH 4L8CA 3PDGA 4LHUB 5DQDL 3KPRD 4TNWK 5J0BA 1MFBH 3PGCA 4G8GE 1E4XI 3G5XB 4ELMB 5C8JB 1A21A 3MRHA 4J8RB 1INQB 3IT8D 4WO4A 3LDBC 1KJ3L 3LMJH 3SDCC 1NGYA 3IGAB 1BX2A 5EZLB 1RZIB 3QISA 3ZTJG 3HUJE 4NZRL 1Y6KR 5JORB 4MVBC 1PZ5A 5I9QB 3CAFA 5B4MD 1MFCH 3L6FB 2BNRA 4OGYL 5C08D 1T2XA 4YFLF 4FXKB 4OIIH 5GS1A 2H32H 4JKPL 5LQBL 4N0RA 3TZVD 1AGDB 4O4YH 5IMOA 3QWOA 4P59H 1B2WL 3QWQB 1FSKB 2Q3ZA 2XT1B 4RMWA 1FAKT 4UU9A 1LK2B 1Q94B 1V3MA 4YDIH 5HI4C 4PRNA 3K2MC 1GZQA 2FH8A 1U41A 1CGYA 5GZND 3QAZC 1H3WM 2QADD 3MXVH 3QDGE 4MXVF 5HXMA 4YHKL 5SWZA 3U0PA 5GGQH 3C8KB 1YNTB 3ROLA 4HD9A 2R0ZL 1YMHA 4MHHI 2B39A 5BMFH 5EO0A 3QFDA 1MFEL 3V5HB 4MNGB 3C60A 2FJHA 5B39A 1HHJA 1P53A 4XNZB 4RSVA 2OTUB 3OHXB 4YXKH 5BXFB 3ZKND 2HJKB 3E2HB 3T0EB 1GH7A 3MRBB 2CO6B 5HGAB 5I8EA 4ODVH 3FB8B 5TDOA 2ZOKB 3MRPA 1DBJL 3T8XB 4XC3L 2PETA 3P30H 2J1KA 1MH5A 3MRIA 1KXTB 3IDUA 4WI9A 3PABA 4X6CB 2BY3A 3MGTA 4NO3B 2ENYA 1PAMA 4HJGB 3JTTB 2RGSA 1WIUA 2QSTA 3PGFL 2XACC 3WUWA 3DRQA 5FB8B 4HGMA 4IDLA 2Y07H 5DXWA 1QKZH 3L3KA 1JWSB 4NIKB 2CRIA 5E6IB 5JQ6L 5I74C 2NR6C 5BOZG 4PJCF 3QDME 1HDMB 4UBDC 3PIQB 4N90E 5FCSH 5D4QA 4YNYB 4KKAD 1EHLL 2VWEC 2A6IB 2PNDA 5ELIA 1RUPL 2ATKA 3DXAD 1BFVH 3RWDB 1GGCL 3QDJB 5CEYB 5IBLC 2WUBL 4OZIF 1WEJL 3LRGA 4I0PB 1T0MA 4QHUA 3ULUE 4RGMC 4Y2DD 5BZWB 4XPFH 2Z31A 3MQIA 5DDHB 3L7EA 3MUHL 4ACPA 3KPRE 2C26A 1JTPA 1FV1B 5ESAB 5F9DC 5CGYD 1L0YA 4QNPF 3BP5B 5KN5A 1JHLL 3B9KB 2EYSA 3CCHA 4LU5H 1NC2D 4R8WL 2YEZA 4FABL 4NQSA 1PD6A 1XIWA 3K8MA 1YMMB 1KNOB 4S1RL 4HIJA 1WAAE 3BOVA 5FUCE 4WFFE 1QBAA 3ARTA 3WLBB 4KJWD 3KR3H 4PGCB 4P2QA 4OZHB 1MCHA 4M6OH 4CVZB 1UEMA 4XCCL 3RL2B 3NCYS 2YK1L 3MGOA 3KLHC 4JQXA 4PJHF 1NEUA 3O9WA 4UQ2B 2CRYA 5E8NB 1QLEH 1TNNA 4G8IB 4JPKH 4S0SD 2H2PC 3QIWA 2NLJA 4PJ9B 1DLHA 4APQB 3BZEB 4L4VB 5EULV 1N6UA 4Z7VE 5MENB 4D9LH 4GSDL 4HS3A 2ZUWA 1NGZB 5GXBB 1ADQH 3CFBB 1MCBA 3I75B 4O51A 3SDCD 4X4MA 1FRGH 2X42A 2WBJB 5H37G 3SBWC 3DVGA 1T04B 5IB1B 1XF2B 4MVBD 3NCEB 3E0GA 4GFTB 5FGBA 1EZVY 4ZNCD 3P3YA 4XAWL 3UBXG 1D9KA 2YBRB 3QCUL 4RMTA 4MA8H 5BCAA 1UEYA 4KRPC 3U9UB 1I4FA 3NN8A 3N1QC 4XAKD 4S1SL 1KB5H 2Y7QA 4PFEA 3QRFM 2A0LC 5DGRA 5AZ2H 2D2OA 5FK9A 2PO6C 5FOBA 4FQ1H 5HI4D 1BHGA 1AHWA 3FONA 4LF3A 4D3CL 4K9EL 4QRQB 5FO9A 5FYLH 5DVNA 43CAA 2JIXA 2BXYA 4YHLH 3FO0L 2ERJB 1FNFA 5IWLA 4JO4L 2C1OB 3JWOC 2GJ6A 4JRYB 1QACA 1TQBB 2VN4A 4QRPB 4AZ8A 4C56A 5BQ7A 4KK5C 2R1YB 1RK1B 4HMDA 2A74B 4JE4B 1UZ8A 1F11A 1PLGH 1QLRB 4LCIL 3N50A 3F7YB 1WICA 4B53A 5EWIH 2Z91A 2AV1B 3MRLA 3LKNB 2B20A 2JB6A 5B8CB 1AGFB 4GRWE 1NCAH 3L1OL 3RY4A 4GKZB 3FN0L 4JO3H 5I71C 3P4LA 4WW2A 1BAFH 3TNMB 4NKDA 5IVXA 3CFKB 4RA3A 1MRFH 5F1KC 4WO4C 4YHPB 4I4WA 2A9NH 5ID1B 3UTSE 1RIUL 3SDXE 2Q20A 3ILQD 2NR6D 4P0DA 4WNQB 4Y4HA 3EUUA 3QA3B 4UBDD 5IMKA 15C8H 4HK3J 3H7BB 3QFJB 5GS1C 3HAEG 1YN7A 1ZS8B 5D7LE 1JK8B 3I6GA 5IBLD 4G7VH 4HIHA 1RULH 4RQQB 1A3QA 3FB5A 3HI6H 1AO7A 2D7NA 4ZOAA 3S96B 3WS3B 4CN4A 2ZOLB 1A2YA 2E9WA 3QUZB 4QRRB 2R23A 3UPRB 1JF1B 4M6AA 2DQEL 4ZO6A 1WQVT 4UT7L 5KS9B 1OWWA 3VD9A 1T3FA 2IPUK 4UQ3B 2F54D 3VRLE 2QBWA 2R4SL 2JCCB 3RBGA 2A6JB 1HXYA 5SWQB 2HKHH 3X3FL 2X7LA 3TBVA 3FOMB 5L88H 2RR3A 1OHQA 4PS4L 1OSZA 1OP3H 3GB7B 4OGYH 3RNKA 2X4SA 2BVQA 1FCGA 3TJEL 4JKPH 4Y19B 3DNKA 2DL9A 1GIGL 25C8L 1S7TA 1J1XL 1KJ2A 2LTQC 4HMCA 1B2WH 4EQ2A 3KLHD 2BOBA 4XCEA 3U1SL 1X9QA 5FA4B 3FTGB 1U8LB 3EDJA 1N59B 4JFDB 4P23B 5TH2B 3HNVL 4KDTA 1LWRA 4QOKB 1VFAB 1KTLA 1XAUA 2CO7B 4ALAL 1M7DA 3FCTB 3DV4B 4GAGH 4ZPTA 1VKXA 3P4NB 3QEQD 3UYRL 5FF6A 4OGXL 4YHKH 4NCC1 5MEPA 2X40A 2J88L 3E3QE 4PB0L 4Q9BA 2JJTC 5D1ZA 3V0VB 1INEL 1MFDH 4J3VA 4JDVB 3PP4H 3GMPB 3SE8L 3X12A 1J1PL 5EU3A 1KELH 3L9RA 1P4IL 4UDTB 4I2XE 2K7PA 5D2LF 3RZCA 4FQCH 1NFDB 2A83B 2AJZA 1SVCP 3GRWL 3HLAA 4YWGL 4XC3H 4GKNA 4D0BA 3H0TA 4Z7UB 1BVLB 2A0LD 5EUKA 1FCCA 4EUPH 2PO6D 5IF0A 3NFNB 1B6DA 3W9EA 1GYAA 3IETA 4PV8A 3WFCL 5JZ7C 2VAAB 3W0WD 5GS0C 1IEAB 3EOTH 4UDUB 1ETZA 2IQ9L 3D3VA 3S37H 1OT1A 3RWEB 4MD5B 3PL6A 1ZTXL 4FXGA 1RD6A 4XWOC 5ETUB 2OI9B 2NYYD 4Y1AB 4F8TA 4I0KA 4PRHB 2AJVL 4KK5D 1EDQA 4AIZA 1N6QH 4YBLB 3UTTA 1W8NA 2ZNWA 2YUVA 4XXDB 1Q0YL 1GGCH 3MMEB 2P49B 4YHIB 2WUBH 3VXMB 3QP3A 4NUJB 5ESVA 4JQXC 1CG9A 3O9WC 5C0BA 4LQ1A 3QIWC 4PJEB 2O26U 4N1HB 4JFEA 1AP2B 2P7TB 4DQOH 2OXHA 1FNEB 2E6QA 1RZJH 1Q9KA 2VISA 5C0GB 5EBGA 1J1OL 3L3DB 32C2B 2VDOL 4HV8A 2F54E 5DJXA 5D2NB 5C0AD 3ET9F 3VFTA 2AJUL 4UTAL 3JVGA 4S11A 2G75A 4FABH 1CICB 1HK6A 3BP6B 5I8OL 3L7FB 1NUFA 4X80H 1MPAH 2YUWA 4MZ3A 5IFJB 5IFAL 1KTRL 1XGRA 1E6JH 1XR8B 5FGBC 3V79C 2BNRD 2N7BA 3EYUH 4O2EA 1D9KC 5J6HA 3GSXB 2Z8SA 4XCCH 4ZFFA 2AQ1A 4WUKL 5GSVA 5IMMB 1YJDC 1KN4H 4QWWC 2A77H 4XB7A 5F7FA 5DJAA 3QULA 3W11C 3VRIA 3BP4B 3C5JA 1MREL 2AXHA 2XWJA 5GJTH 5JW4M 1ERNA 3PV6B 4BUGA 4GSDH 4JN1L 2FZ3B 4XRCB 1NAMB 4AEEA 1BVKA 4XPBL 3VFSA 5IWLC 4OV5A 1A6WL 3LSOA 4O9HL 5DI8A 3CU7A 3OG4B 1GGUA 3CFIC 1RURH 3MNVA 3KLSA 2OQJA 5ITFB 2EIZA 4R4BA 3MLVH 3ME0A 4JM2B 1MFAL 3HPLA 5JOEA 1U2HA 3QCUH 2VLKD 2E9BA 1P4LB 4HPOL 1FGVL 3HC4L 1CBVH 1RZKC 4S1SH 2DBLL 1CQKA 3BRGC 1KULA 3FZUD 1U8HA 5KSBA 3JWNC 1PG7X 4U7SA 1LGVA 3S5LG 3ILPB 2D0FA 4AQ1B 2YD9A 3UTPD 1XGYL 4DOHE 3CXDL 3OR7B 2Y5EA 4JO4H 1QPPA 4X6EB 3N85L 5F1OB 3X17A 4Y8AA 3NH7L 3MFGB 1PG7W 4Y4HC 1IEBA 3EO9H 5EIIA 4XNMB 2FGWL 1FSKC 3U7WH 1H0DA 2E7CA 4HCRA 3F7PC 3QYCA 1JWUA 3V6ZA 3O3AB 3DVNB 4FFWC 3CFDA 1I9IL 1U8PB 1J0JA 4LCIH 4NPYA 3VG0H 4LSDA 1OAQL 3G04A 3STBA 1RPQA 1S7SB 3PF2A 1LEIB 1JIBA 3VXNA 5IGXH 1FN4A 3S6CA 2EDTA 5CAYB 2BSTA 5JZ7D 4YDLC 1T66C 2APTA 3DO7A 4XPAL 1S9XA 1P5VA 2I27N 2YD2A 5T33L 5MERA 3T0EC 1N5AB 1EO8L 3GMOA 1VFBB 4MA7L 1RIUH 3MBEA 1Z5LB 2WV3A 4XWOD 3N0PB 1F8TL 1JPFA 1W8OA 2BNRE 1KIRA 3BZDA 5F1NA 1RUMH 4UB0H 5ANMB 1S7XA 4MAUH 3CDGA 3K81A 2YMXL 5DT1L 3O41A 3O9WD 1G6RA 3LS4L 1WIOA 2QJDA 5T1MA 3QIWD 3DIFA 3ARVA 1AIFA 1T7WA 5KSAB 4NQDA 2B4CL 4O5LH 4UT7H 5E6IC 4RIRB 5C0IB 3WNPA 2V5TA 1ZLVH 4X4YA 5B38G 1MAJA 4YEFA 1N26A 5ESQA 1A02N 5SWZE 2R4SH 1H3VA 2NXZC 3AXLA 5F72S 2X70B 5IHBA 3M8OL 1T5WB 3GSNB 4PS4H 3SKMA 1S5IL 5DK3A 5LWYH 5A2IH 1HKLL 5EN2B 2WLYA 1NGPL 2X89D 3OKDB 3RZCC 4G8EA 1D9KD 3QUMA 4CN1A 3KDMB 1GIGH 3MLWL 25C8H 4L8SA 3ZDXF 3ALPA 4LLVA 5DUML 5F6HI 4G5ZL 3N9GL 1CFSA 3KPOB 4QWWD 5DD5L 3U1SH 3VFNA 3JUZA 1IKNC 2X09A 3W11D 4KROC 5D7IF 4LHUG 4GRLA 3X3GL 1QZ1A 5I6XB 4XNQA 1EEQA 1EVTC 1RZ7H 3CNKA 5EC2B 2XNAA 1A1NB 4ZD3L 3NPSC 5CJBA 5JDSB 2Z9TA 3LKQA 2ZUYA 2J88H 2VLLB 4PB0H 3S36L 2DQTL 1FG9C 1I85A 3MLYL 1INEH 3PG2A 1BGXL 2O93L 5J06A 4L5FL 1DCLA 3S9DB 2YD4A 3Q5OA 4YBQC 3RZWA 1CTNA 5EBWB 3QIBB 5IESH 4PGDB 4PV9A 1DVFB 1P4IH 2Q3AA 4NN5C 4RWYL 4AIOA 4C56D 5E7FA 4QRSB 5T1LD 3GRWH 3ZDZE 4K3DH 4OKVA 4M7ZC 5EDXA 2EIEA 2CR3A 4APQC 2AEWA 4YX2L 2G5BB 3U0WH 1W0WA 6CGTA 3UJIL 3RQ3A 4X4XB 1HN1A 1CXIA 3IDNA 1NDGA 3SDDB 3W81A 4WU7B 1ZT4B 2WBJC 3MRFA 2EE9A 1KXQE 1I1YB 4PREA 2FX8L 1FZJA 2GSGB 3SPVA 3C08H 1R5IB 5I1AB 1IILE 5FM5O 1NFIA 2IQ9H 2GUOB 3JVGC 2NZ9C 3PWUB 3E6HA 4Y89A 2OZ4L 4HZAA 3Q6GL 4Y4HD 3D87B 1UWGH 1ZV5A 3MYZA 1LD9B 1MNUL 4TUKH 1MCSA 2JJVA 1T2QL 3HR5B 3UZEA 4P2QE 1Y18A 4FFWD 2D0HA 5IV2B 1LP9F 1SEQH 3C09B 4H5SB 3RWIB 1T1XA 3QCVL 1G1CA 3BGMA 4QF1A 3OTTA 1AO7D 3UTZA 4B41A 4G6FB 2ERJC 1QNZL 3U79A 5FFLA 1LEKA 4BQ6A 2SEBA 4N8VG 1R5WB 2H45A 4F37F 1BBJB 4GJTB 2CJUH 3G5ZA 1OGAB 1T66D 1A5FL 3TV3L 3DX7B 2VDOH 3GMQA 5EU7C 2NTSP 1W72H 2GJZA 1G84A 3T0ED 4LLYB 4X4ME 3VI3F 5I8OH 3OZ9L 1ORQB 5KVEL 4Q0XH 4U3XA 3GMNA 2XZZA 5IKCA 2AKRB 3D6GA 2F5BH 4TSCL 3VGGA 3VXSA 1T1ZB 5CD5C 2NZIA 5B8CC 4QXTA 3MOQA 4EVNA 3T1FB 1WFOA 3QRGL 5C0FA 3V6OA 5CLWA 3V52L 4EBQL 2VDKL 4JFPB 3NFPA 1KIUA 3BH8B 2X4PB 4Y5YA 1HOCA 5CWSA 4JPIB 1CD1A 4EDWL 4PYHA 3O4LB 2O5ZH 1J05A 2G5RA 1MREH 4OCSL 4ZFOL 3V0AC 1YPZF 1WGOA 5E6ID 4GW5A 4U7MA 3RAJH 1Z0NA 1FFPA 5J56B 3ALXA 1NUGA 4P4KB 4PG9B 4L1HA 2Y1VA 1QP1A 4Z7WB 2NXZD 3HE6A 4XPBH 3VFWB 1A6WH 4O9HH 3OKKA 1HHKA 1JNHA 4HQQH 2GJ6E 3OR6A 2YUZA 3O6FB 5DJ8A 3QDJD 5C2UB 4BK5A 5I1EL 2HG5B 1A6TB 1I8LA 4RFOL 1RJCA 2KZ1B 3WIHL 5DUPH 4YHYC 3DSNA 1D5BB 1MFAH 3PXJA 4IHOA 5CSZA 3JWDL 5ISZA 4C56E 3LKOA 2A38A 1UB6B 4HKXB 4BSWA 1AFVL 2Y4SA 4HPOH 1FGVH 2H3NA 5F8RC 3BDYH 5TFSL 4NWTL 3BJ91 4MJ4A 1I9JH 3RGHA 5JW5A 4TSBL 4KROD 2BVOB 4I9WD 2JB5H 4E9LA 3TBSB 3U4EB 1RFDL 3MV7B 5JNYB 2XWTB 4YDKL 2FIKA 2X41A 3HNTL 3CXDH 1E28A 1WBYA 1MRDH 4HUUB 2I9TA 3DX8A 1S7VA 4Z0BH 3VFUB 3EOAA 5IHUH 5DR5H 1YEGH 1NGWB 3B2VL 5C6WH 2FX7L 4K8RC 4HKZB 3LCYA 3NH7H 2W59A 4DUWA 3GM0A 3KXFA 4YBQD 3CSYA 1ZANL 1BFSA 2V9RA 5CFHA 4GT7A 2EEBA 4Q58C 3BHBA 5KAQF 4JQVA 4WHYH 3BH9B 4OJFL 5IJKA 2MQ0A 4BZ1L 5D72H 4XVUC 4NQCA 2V9TA 4APQD 5I17B 4C58B 3ZO0A 5FM8A 2I5YL 3H7LA 3TH2T 4AQOA 4BQCA 3LV3A 1RUKL 4L4VD 5MEND 5GGSY 1AO7E 5K9OB 2W60A 3NCJL 1I8IB 4EKXA 4JN2A 4Q6YA 2WBJD 3EDFA 2EO9