5DMIH

Structure of the extracellular domain of the cd40 in complex with chi220 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
223
structure length
223
Chain Sequence
QIQLVQSGPELKKPGETVRISCKASGYAFTTTGMQWVQEMPGKGLKWIGWINTHSGVPKYVEDFKGRFAFSLETSANTAYLQISNLKNEDTATYFCVRSGNGNYDLAYFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 5
publication title Functional Antagonism of Human CD40 Achieved by Targeting a Unique Species-Specific Epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/signaling protein
total genus 44
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2015-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmiH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmiH02
1TVHB 4E41D 1LK3L 4HJJH 5CEXA 2P48B 5TE4H 4ZFGL 2ZJSL 3RPIB 3WHXB 4XNYH 4LLQB 1NDGB 4JR9L 3MCLL 3VDCA 5EIIA 5IQ7H 1E4KA 1FYTE 3BGFB 3HC4L 1CT8A 1OM3H 2YK1H 2AVGA 4K94C 3WSQH 4D2NA 1TETL 4DTGH 3IFLL 2FBOJ 2E9IA 1FFOA 4JFHE 1WK0A 1YDPA 5TFSH 3ARGC 2XY1A 4Y16B 4ZUTB 4IRJB 4MNHA 4AT6B 5GRUL 4QHMB 4RIRB 4WW1A 1GPOL 1I3RA 3ZKMD 1D9KC 4JKPH 1KC5H 5EU6A 4YR6A 3WIHH 3L5IA 2GUOA 5E8DL 1JHTB 4GG8B 5TDOB 3DMMA 3RZCB 1CFQB 3QUXB 3NZHL 1WF5A 4XP4L 1S7SA 5FO7B 3P3YA 1BQUA 5CS7A 1AR2A 2DJSA 3VFWB 1KYOJ 2VLRE 1IGFH 4JY5L 4NZRH 1FNEB 3DBXA 4Y1AB 5GGUB 4JFQA 4WWKD 3UZQA 4EZMA 2ZPKL 2NR6C 3OGCB 3EO0A 4JREC 2DIAA 4OFYD 4LLYB 2BNRE 3SDDD 3VFMB 3DXAD 5EUOE 4XXCA 2F53B 5IBLC 1HEZA 4G6AC 1ZGLB 1LEGA 2Y06L 2VRAA 2COQA 5FV1L 1GXEA 2OXGA 3HRZA 5JIKA 2FD6H 5CSZB 1QSFB 2R23A 5C0BA 3SKMA 2DD8L 3WJJC 4UT7H 4MJIE 2AK4A 1ZVSA 3S4SA 4M48L 4HBCL 4OQTA 1LD9B 1L0YA 4JVPA 5C9JB 1HHHA 1MHHA 4LPXA 3T2NH 5E5MB 5E6IC 3ZE0E 3QXTA 4I3RL 2N4IA 1A4JA 1YN7B 4MA3B 3VCLA 2APVA 3TH3T 4OF7A 1PZUB 1UVQA 3HNVH 4Z7UF 4F33B 4O00A 1WVZA 3HFML 4PP2A 5CEYB 1DBBL 1X6LA 1M4KA 2R56L 4PJHE 1DR9A 2O5XH 4D9RE 5J13C 1Q9OB 1IILE 5IW1B 3U0WL 3UDWA 1U0QA 2FHCA 3QNYA 1I8MB 3H3KA 2G9HA 3ARGD 2NY7L 5C0IB 5AZ2L 2DLGA 4QXTB 1TZGL 2W0FB 3VXUE 4HWZB 3ARWA 3RGVB 4MDJB 5AG8A 1D9KD 5I1CH 3WCYA 1KTDB 2PNDA 4KUCF 4LPYA 1WIOA 4WO4C 1A1OB 1UZ8A 2ICWB 1RUKL 1MHEB 5IESH 5CZVH 5CJBA 1V3MA 5E9DB 1G9MC 4M6NL 3SGEI 1UXWB 2Z35A 5F9OL 2BFVH 3IDYC 3O4LE 4K23L 2DKSA 5GSVA 4J4PA 3GIZL 5DWUH 2NR6D 2PYEE 2W1NA 1E4KC 4UV4L 3C2AH 4RQQB 2V6HA 1JWMA 2AXGB 1Y0LA 4M5YL 1DN0B 3U1SL 1D5MB 1WGOA 3SE9H 2IADA 2YRPA 5IBLD 4OUUA 3NPSB 4G6AD 4UOW1 3RUGE 1NANI 2YUWA 2R29L 1R24B 5TF1H 3V9FA 1Z6JT 4FFVC 5INCA 3RFZC 1TTGA 2APXA 4GSDL 3KXFA 4L8DB 3AS1A 4HQQL 3MLRH 3MCKA 4HXBL 4ZNCD 1GZPA 2C3HA 5C08D 1NL0L 2UY6A 4YNYB 5L6YL 4U05A 1UYWL 3W9DB 4RMRA 2AJSL 3OX8A 1GIGL 2OZ4L 3DMMC 4Y5YB 3GSVA 4JAMB 3MV9B 4P4RA 4WEUD 5E6ID 4AM0B 2BVTA 3I6KB 1J0ZA 1OB1B 3UTSD 2NXZB 1FZOB 3KPRA 2E6QA 1FGVL 2Z91B 3UROR 3IJYA 3RY4A 2FZ3A 5E8OB 2IAMB 1T3FB 4D9LH 4H25A 3HS0B 4AG4L 1HQRA 1K8DA 1MJUH 5LAXA 4KROC 3REVA 1KIRA 4L8CB 2C3XA 4O58H 5CP7A 1HKLH 4QOKA 4Y19E 2E6JA 4XXCC 5F97E 8CGTA 4JZNA 2JELL 1CVRA 5BS0E 4OLYH 4RISL 4ODBD 2HKHL 2V7NB 2PCPB 2WUCH 4JHWH 1G0DA 4DGVH 4JHZA 1AGCB 2ED9A 2H26A 5T1KA 1FN4B 1S5IH 1JN6B 4Q6YA 5K9JH 4WO4D 1MH5A 3PWPD 2K7QA 3NN8A 4DW2L 3O2WH 1AD9B 5KW9L 3D6GA 2ZUWA 1R3LA 5J6GB 1S8DB 3ZDYE 4UIMA 4K3EL 1BFTA 1JL8A 1RULL 4Z7WA 5EORH 5L0QC 4YH6A 3UYOD 1G7IB 1N4XH 4LKXB 5EZLA 4CNIA 1RJZB 4NQXB 4HK0B 4OSUH 3MGOA 4J7RA 4UAOB 4DN3L 5CJQH 1EAPA 4PJAB 2ERJB 3GHBH 1TJHL 3SGDI 3B3IA 4HIIA 2GJJA 3OKLB 4Y4FD 1KCUH 4BQ6A 3DV4B 1OVZA 2ARJB 1ZT7B 3UDWC 4NNYA 3IXAB 5E8NB 1DCLA 2VXQH 3ECBA 3FO9A 3QO1A 4C4KO 2D31B 1QPPA 4FFVD 4E41B 5FUOL 1DANU 2WMPA 3DHMA 3DX6B 3NH7L 4UTBL 1NBZA 4TUOA 4KVNL 1QHPA 2GTZA 4RFOH 5ETUA 5C0EB 5EU6D 2YR3A 3HZVA 2XFXA 3VRLF 1F3DH 1Q8MA 4X7TA 4OCSL 3DMMD 1YZZA 2BVPB 4EDWL 2BMKA 5F1OB 4MJ6A 2GW5A 1KENH 2OTUB 4P2QD 4JO2L 5FO8B 5LGKA 43C9A 5KG9B 1U8NB 4PJGB 3NFNA 1BM3H 4U3CA 2Q8BL 3GUTB 1RI8A 1EO8L 3BEWB 3ORJA 3ZDZE 2EIDA 4ZYKB 1BVZA 3VI3F 3MRCB 4PJEE 4JY4A 4RZCB 1VB9A 5AEAA 3ZE1F 4KROD 3T0EA 4HV8B 4XHQA 1FZKB 5C1MB 3C5SA 2YMXH 1U58B 1W72L 2X4PB 3CC5A 3ALWA 3SO5A 3QEGH 1NGZA 2BK8A 3PWNB 3WIIL 3G6JB 5KN5A 1N3NB 3KS0H 3MRRB 3GBNL 5IQ9B 1YN6B 1MCBA 1WBXA 1P4BH 4IHOA 2DQEH 1J1XL 5C0BD 5ILTH 1IGMH 1U91B 4WWKB 2AK4D 4PG2A 4XCYB 3FCTA 1ND0B 4PJFF 3RVUC 3B5GA 4UQ2A 3X3GL 3LKSA 1NLDL 3SDDB 2PETA 4IBLT 1H3GA 3DXAB 1R5VB 2E9JA 1QA9B 3VH8B 3Q5YA 4XTRC 3ETBF 3SDYH 4JZJA 3UTTB 5F21B 4ORGA 5CGTA 5I0DA 3UBXI 4TN9A 3G08B 4M62L 4W4OA 1QFUL 1SYSB 4M61B 3QULA 1LO3L 4U3XA 4LVOB 5K59F 3WLBB 3VG0H 4LLVB 2DQCL 3TC9A 3GMNB 3TH2T 4Z5RB 4OGYH 3C8HA 2DQDH 4N9GB 2CDEB 5HI3C 1UB6B 4WDIB 4Y89A 5HGGS 1GGYA 3T0DA 1WITA 25C8L 4ELKA 2R8SH 5ANMB 2MHAA 1CK0H 5DUPH 5FF6A 3GNMH 5CEZE 5DJ8B 4K94H 5B39B 3TT1L 3FN0L 4G8GD 4P9HH 3S3JA 2FBJL 5DUBA 4DK3A 1T1YB 4MSWB 1KIQB 2E7HA 4DZBB 3CVHH 1BZ9B 1FE8L 1ZLSL 1MRDL 1NFDF 1QP1A 3BJLA 4OCMC 1EIBA 1CFNB 3UJJH 9CGTA 1ETZB 3VW3L 1BFOB 2YD1A 4LPTA 2XWJA 1BQLL 4G5ZH 3ARGB 4XXDB 3CVHB 5GGQH 1IC1A 4M8QA 4ALAH 2X1WL 1OAYH 3O6LL 2V2TB 2QQKH 3VGGA 5DJDA 3DOSA 4ZOAA 3O6KL 1NMCC 1D9KB 1SEQH 5HGAB 5IB3B 5CBAA 1FZJB 2ZCKL 3I02B 3QA3B 4NN5C 3NAAH 5F7KC 5GGRB 3L5HA 5JA8B 4HUWB 2Y07H 1DUZB 1IVLA 2A9MH 4X6BB 3DV6B 4CN6A 4JRXE 4R96B 4FOMA 2K9UA 3TBTB 1EEYB 4KMLB 1MOEA 4WFFE 1KB9K 4FQIL 1KN4L 3VXSB 2P24B 3KXFD 5A2KH 3ULVC 2GY5A 1U8HA 3K3QA 4M7JH 4Z0XA 2Y72A 3P4MA 5ICZA 4JREB 3E3QE 2IBZY 4P99A 3O41B 5JPNA 1ZVHA 1N6QL 2VZTA 4W68A 4XTRD 2R4SH 1I8KB 1XGTA 3KPRD 3HUJB 3VE0B 2R0ZH 2KKQA 5C2BH 3GSWA 4N1HB 5T33L 5DMKB 1A14L 1OARH 4TRPL 3R1GH 4QEGA 1XFPA 2XICA 2DWEA 1NGYA 2WSKA 2DAVA 4HDIA 3IFNL 1DQTA 3MGAA 4TSBH 3ZSSA 2I27N 2V17H 3S5LG 1NAMA 2HJKA 3T0EC 1JBJA 3KYKH 1CDGA 4QOKD 4JM4L 3I50L 5E6IB 4CVXA 1IGIH 4QNPE 5HYFA 1AGBB 3MV7E 3S97C 1YYLL 3HNTH 1HINL 1HH6B 2D7NA 1NBVL 2IQ9L 4BSWB 3MRMB 4PP1C 4PY8I 3VGDA 3UC0H 2M8XA 4PG2C 5DK2B 5T1KD 4YXLL 1TCRB 1OP9A 5IB1B 5J13B 1JFQL 4EVNA 4E0RA 2A6IA 1MRCL 4Z7VE 5AUMB 3QEQD 1AGDB 2YD2A 4HWEH 4QY8A 1DFBH 4GRWH 4JZJC 4OJFH 3FO2A 3KJ6H 2VXUL 2VN4A 5BMFH 1IZJA 1WWAX 2ADFL 3FRPG 1F4YL 4GRWB 5J06A 5HHXL 4FQ1H 3DTXA 1T04B 3L3KA 1G9MH 1NCAH 4WO4B 3TBWB 3T2OA 4I48B 4DQOH 3PWPB 3DO7B 4OLWL 1MCPH 3MUZ1 4XPFH 4J6RL 5TJWK 3ELAT 2QSQA 4KJPC 3U7WH 3VG9C 1MLBB 2YRLA 4FQ2H 3TT3L 1KCVH 3L3DA 4HPYH 4RMVA 4MMZC 1HWGB 5L88L 3IDYB 2VDKH 5CEXB 4NM8L 2CK0H 2R1WA 3ULVD 1WFTA 3VU2A 4PGJA 4GS7C 4HGKC 5KANI 4YDIL 1HCVA 5EIIB 3RU8H 4DKDC 3MLSL 1OT1A 1CT8B 1PDKA 2HH0L 4XMLH 4QRRA 1FFOB 1YDPB 1MCSA 1ITBB 2UZYB 2OJZL 4MNHB 1KN2H 3X13A 1FH5H 3O6FA 1MHPL 3T3MF 4ZD3H 2CK2A 4OFPA 4G3YL 4K7FA 3BZFA 4WW1B 5D7KE 2AEPL 5DRWA 1I3RB 5I1KL 2FL5A 5EU6B 1OQOA 4YR6B 4ERSH 3REWA 2GUOB 4ONFH 3S3PA 3QWOA 1CU4H 3T0ED 4G6FD 1FAIL 3DMMB 3UJIL 1S7SB 1RZFL 5EC1A 2J6EL 4GQ9H 1K3ZA 4L9LA 1NQBA 3PDOA 5TE7L 1NMAL 4PRBA 1QLRA 3MODL 4HW6A 1MCLA 15C8L 3EYVA 1C1EH 2H41A 3DBXB 4JFQB 4FZEH 3K2UH 3EO0B 5FHAL 1DANT 4W81A 2BP3A 4KROB 3NVQA 5IFAL 5JLZA 2FJHA 2VLJD 4L4VA 4YFDB 1KTLA 1WZ1H 2DQHH 3B2VL 1HEZB 4YFLF 1LEGB 4XMKL 3P11H 3HAEA 3NTCL 3HRZB 4OQTH 3L7FA 3O3UN 1MAMH 1RIVH 3A6CH 2R23B 5C0BB 3SKMB 1SJVA 2AK4B 4QRPE 5E5UB 1ZVSB 3S4SB 1A2YA 5H37G 2UY7A 1S78C 1WC7A 3NCBB 1HHHB 1MHHB 4NRXB 4CW1A 1AE6H 1JI1A 2XG4A 1A4JB 2HN7A 1XF5A 4FHBD 2X5PA 2WUBL 3VCLB 3AB0C 3PF2A 5L0QB 4NN6C 1ZHBA 4M1DH 1N0XL 2EE6A 4L4JA 1UVQB 3U4BH 1V05A 2E8YA 4PP2B 4P57A 2YBRA 2N1KA 3WFBL 1CFVL 2B2XL 4G6JH 4M00A 1JVKA 1UGNA 4JKMA 2H45A 3QNYB 5HYEA 3ARXA 3GO1L 1S7WA 2G9HB 3CNKA 4NZTL 5SWSA 4B5EA 5HJ3A 1F13A 1I9IH 3QCVL 4FNLL 3HE7A 2VMFA 5F1IA 1B9ZA 2A1WH 1XR9A 1AP2A 2GSGA 2D7MA 5GRYA 4LAJH 4HKXA 1UZ8B 1Y6KR 4R8WH 1CR9H 2WANA 4KJWC 4KTEH 2CGRH 5IJVA 3WS6C 4LF3A 4LFHG 2P44B 2Z35B 2Z8SA 5GSVB 4Z78A 2GSIA 1Q72L 1E6JL 1PY9A 5DD1L 1EHLH 1JRHI 2UVEA 2R0KH 4HFWA 5EFIA 1BFSA 5AWNH 2FB4H 1JWMB 1G7LA 4YC2C 1Y0LB 1JTTA 5HYSG 4HWNA 3AM8A 1D3CA 4R4NC 2IADB 3VMPA 4P23A 5DO2D 4OUUB 3BKMH 2EXWC 2DB8A 2VTFA 3GMMA 2VQUA 4R4BA 5INCB 5F70A 3C8DA 2DM3A 3O6FC 5GXBB 3IXTA 3MCKB 3HKFA 5EBLA 1GZPB 3OPZL 4OF6A 2O5ZL 3IU3A 1S78D 4LIQL 1MCEA 4AK1A 3OX8B 3EDDA 6CGTA 4BQ9A 1ORQA 1T6WA 3GSVB 3TESA 4P4RB 4JCMA 4LASL 1DQQA 5JOFA 2NCMA 4L9LC 3PXJA 3KPRB 2X4RB 1F2XK 2WW8A 2Q1EA 3IJYB 4NM4L 3DETC 3VXMA 2FZ3B 5KAQF 1A6AA 3W0WE 1U8PA 3GM8A 1TENA 2VZOA 2I9LA 4JFZH 4DOHE 4H25B 1G7MA 2DTML 5IIEA 3GKWH 4J23A 1HQRB 1K8DB 4PJ7A 5LAXB 1X5JA 1XEDA 1KIRB 1R6VA 3REVB 5CP7B 5EUOF 5MHSE 4PGBA 4QOKB 4JRYA 4RDQG 4EUPA 3BESR 4JFFA 3V8OA 4JZNB 4UILL 5DK0A 5A2JH 1I7UA 4G9FE 3MV8E 4K7PX 3UBXA 1U3JA 3VGAC 1JZ2A 4UT6L 2I9TA 5ADOL 1B4JL 2H26B 5T1KB 1FLRH 5ESVA 3O3AA 3VFPA 4TTDC 3TPUA 1MH5B 3OKMA 3NN8B 1MFBH 4KJWD 1JGUL 1R3LB 1NFIA 2AXHA 4AEIL 4UIMB 2RJMA 4ZDHA 4Z7WB 3LCYA 1QFWI 3GI8L 4EKXA 5EZLB 4CNIB 2MNUA 5HDBF 1NMCB 1KEGH 4KRPC 5T1MA 1H8NA 4OGXH 3DURA 3MGOB 3V6FA 1EAPB 4NN5B 4YZFE 4MCZB 4NZDA 3B3IB 4HIIB 3CK0L 3GM0A 5GRZA 3GRWL 2DMBA 4JM2F 3KPQA 4R4ND 1UCBL 5LXGH 3ULVH 3MOAL 5BVPH 4NNYB 4QRRD 1UWXK 4YHOH 3QO1B 3ECBB 2EXWD 3FO9B 4LDEB 4M7LH 4DAGH 5HPMA 1VGEL 4WY7H 2RR3A 4TQEH 1OGAA 3ARZA 1NBZB 3O6FD 1KOAA 4HIEA 4TUOB 3HE7C 3THMH 3MBEA 2NTSP 2GTZB 5ETUB 3BVNA 4RRPG 5KZCD 2CRYA 2YKLH 2XFXB 1BJ1J 5GJSH 4OD1H 4X7TB 3KYOA 4OD3H 1E4WL 2BMKB 4OIBA 4MJ6B 2AABL 2YD8A 43C9B 4X7FC 1S7TA 4YEEA 1FDLH 5KSBF 3NFNB 2D7TL 3DETD 2YPLE 3Q1SH 4ZOCA 5EN2A 4F3FA 3RL2B 5HI5C 2DDQH 1EA9C 4KXZI 2Y5TA 2DLEA 4GO6B 4JO3H 3SE3A 4HEPG 1A7QL 4JY4B 2F54A 4QGYA 1MCRA 3T0EB 4M7ZC 4G6FB 2J1KA 3AM8C 2DM2A 4ZOEA 2D03L 2OTPA 4L4VD 2H6PA 3C5SB 4U7KA 4Z7OE 4P23C 3RUGF 2KQMA 2F53E 2G2RA 3CC5B 1YEGH 5IT2H 1NGZB 5FUCC 5KN5B 2VB5A 2X4NA 1WBXB 4IHOB 5KVGL 3LD8C 1QSFE 2Q7YA 2R15A 5ICXA 3QJHA 1MFDL 3FCTB 1DLFH 3FQXA 1CE6A 1U95A 3WFDH 4TTDD 3E6HA 4UQ2B 3LKSB 5FYJU 3RY5A 4OB5H 1FL6A 3OZ9H 4JZJB 3U0PB 1KYOK 4ORGB 5HHOA 4IDLA 3LZFH 3SEPA 4HWBL 4YDKH 3QULB 2YD5A 3CXDH 4KRPD 2MSPA 4QHKI 3PIQA 1MAKA 1D5BA 2DKMA 5T1LA 1EXUA 3W39A 1QRNA 3AREA 3QG6A 3VG9B 1KCSL 5SX5H 4ELKB 1CLCA 4ZS7L 5C0DA 2CQVA 2MHAB 5GISH 5FF6B 4U1MA 1S9XA 5LBSH 4ODXA 4GS7B 3HE7D 1JPSH 4XPBH 2HT3C 2I5YH 4FZ8L 5JW4R 5DUBB 2CIIA 4KI5C 3KYNA 4OT1H 1KLFA 4NQCD 5JMRA 1T03L 1P4IL 1Y6MR 4PRNA 4D8PA 4OI8A 1CL7H 5K9OA 4KGJA 2XWJB 3ZHLA 5E9DE 1MCWM 5H2BA 3ZDYF 5T3ZE 1P5UA 4M8QB 3CLEL 1BBDL 4DKFL 2JJWA 5DJDB 4PRPB 1NEZA 5HI5D 1UH4A 5FGRA 3T4AA 6FABH 1DBAH 5CBAB 5ITBH 4FTVE 3NA4A 2QR0A 3MRPB 4MYWB 3P0VL 3QP3A 3LN9A 3GEWB 4P23D 4YQXL 2IBZX 1BGXL 4ODHH 3LSOA 3DSFL 1A5FL 5GHWH 5C0CD 3H42H 4P9MH 1U8HB 3GK8H 1ZGLM 3PWUA 4WHCA 4Z0XB 3MBEC 2YN5A 1B90A 3P4MB 5ICZB 2BSRA 5FK9A 1JZ5A 3PNWA 3QI9A 4NPYA 1SY6L 1OOAA 4NOBA 3UTPD 3ABZA 3UYPA 1NH6A 3P4NA 5JPNB 3FMGH 3ZKXB 1G9NL 4Z95H 3UZEA 3MV9E 5AZEL 1BP3B 4PB9H 4LEOA 1RURL 4PREA 2YUZA 1RHHA 5JUEH 1IGYA 3DJ9A 5FYLD 3GSWB 3VFTA 3P73A 3VXMD 3ZE2F 1NAMH 5L8JB 3ZDZF 3F6IA 1J8HA 2PTUA 2OR9L 4ENEC 4PJEF 4F80A 2DWEB 4OM1L 4Z9KB 1NGYB 3SE3C 4HDIB 3WV0A 2J8UA 2ZCLL 3K2MC 4JHBA 1NAMB 2HJKB 2X2YA 4BZ1H 3LRHA 5TQ2H 4JRYD 4CVXB 1DVFB 4JFFD 3M8OL 3ARSA 1W72A 3AB0B 4MA8L 4NN6B 5GRXG 1BFVL 5D7IA 4HC1L 2HT3D 2P4AB 1OP3K 1OAZL 2AJUL 4UIKL 4KI5D 3S36L 5CLWA 3ULUE 5D4QA 1OT2A 1RY7B 2NY3B 3AFLA 5BCAA 1I9EA 4PJIA 4EVNB 4E0RB 2A6IB 1I8LA 3NCJL 4WI9A 1BLNA 1UACL 2C26A 4QY8B 3NOIA 4OV5A 1UEYA 3FO2B 1A7BA 1EEZA 3PGFH 3P30H 2NY2C 2PW1A 1FPTL 4YK4C 4KHXL 4YPGA 3WHE0 3ZKQD 2E5EA 3DTXB 3L3KB 4NWTH 4X6DA 1MREL 2M26A 4WTZA 5FOBA 4PJAE 5DC4B 4QXGH 5HY9A 4MXWH 3KYAA 2EDXA 4NC1E 3IB4A 3LQAL 3AREC 1S9KC 2DWDA 4F15C 3N1QC 3L3DB 5DT1H 4LSQH 3U4EA 4E41E 1EDQA 1EPFA 1Q0XL 4K07A 4UDUA 1KPUA 2R1WB 2VIRA 1OGAD 4JKWA 4WI7A 3V4PH 1LGVA 1QVOA 3M17A 1IAMA 3RWIA 3MBED 3UAJC 2OK0H 4OZIE 2ICCA 3LHPH 4EIGB 5C0RH 4PLJC 4YC2B 3EO9L 3SGEH 3ZL4H 2VQTA 1RIUL 1YEHH 4C56E 4NJAL 4QRRB 4E9LA 2XNAA 2FWOA 5KVEL 2X40A 4PJGE 3X13B 1JF5A 3O6FB 4K7FB 3BZFB 5DRWB 4F8QA 2FL5B 2SEBA 4HEME 2M1KA 4ENED 5KZCB 2D9QB 4NBXB 1JIBA 1JZ6A 3REWB 1P7HL 1FFRA 1LO4H 3QWOB 1YECH 4TPRL 2VLME 2DN7A 3JUZA 4AL8L 5GRWA 2KH2B 1AXTH 1DLHA 5EC1B 4L9LB 4GRLA 3PDOB 4PRBB 3T2QA 1FBIH 3VJ6A 1QLRB 4K71C 3G6JE 2A38A 3BE1H 3EYVB 2YA2A 4ZTPH 3LS4H 4JRWA 2QBWA 4LGRB 1DE4A 2ADJA 1MFEH 1H3VA 3HAEH 4JE4B 3QI9C 1E4JA 5JLZB 2FJHB 4POYA 4L4VB 3GMPA 4AIOA 4W4NA 5C07E 1NCWH 3DXAE 3GHEH 4HXAH 3G5ZB 4HMDA 4JDVA 2EDFA 5ADPH 3HAEB 2BHUA 5HHOD 3UTTE 3CUPA 3MLVH 4TSAL 3L7FB 1JGDA 1VENA 4YHIA 3VGAB 2NY2D 1BZ7A 4XCEA 3MREA 5DMYA 1A2YB 4KHTL 1WC7B 4G6MH 4WHYH 1JZ7A 3NBNA 2BDNH 4CW1B 1RMFH 4R7DA 4WTXA 4QNPF 2IPTL 3MXVL 3ARED 5EOCL 1TNMA 2HN7B 1XF5B 3F58H 4ZTOH 1RZ7H 5ANME 3ZKSD 1NGPL 4JHAH 5C92A 1K2DA 1F4XH 1ZHBB 4J3OC 4QHUA 5HXMA 1UJ3A 1W8OA 4KRPB 4OF8A 3RDTA 3UAJD 5DGRA 2HT4C 4P57B 1DQLH 2YBRB 4PLJD 3PP4H 3NIGE 2J12B 5CZKA 2WBWB 1X5GA 2VDOH 1IM9A 2P8LA 4Z7VF 1INEH 1I8LC 3T77A 5EUKA 2XV6B 1S7WB 5EIVA 1L0XA 1JWSA 5SWSB 5HJ3B 3CDFA 5GS1A 4L3EA 1ZK9A 1A6VL 4PY7A 4PJ5A 5KJRH 3VXRE 4MAUH 3HE7B 4OCNC 5F1IB 3SGDH 4LNVA 1AP2B 2GSGB 1J88A 5J56B 1CXLA 1U9KA 4HKXB 5F6HJ 1FIEA 1IARB 2D7OA 3WJLC 2H32A 4JB9L 5CFHA 4HCRL 5IJVB 3IKKA 4AY0A 4LF3B 1X4ZA 2IH3A 4CADA 5H35A 4NRYA 3AXLA 4ZFGH 2ZJSH 1JYWA 3PXHA 4OZFG 3VXSE 4XNXL 1U8OA 2FJGA 4DN4L 4Z78B 1QOKA 2GSIB 1NCDL 3HI5L 1YNLL 4PRHA 3HC4H 4FXGA 4G6KH 3FONA 4HFWB 5EFIB 3IRPX 5ALBL 3BDYH 4N8CL 2FX8L 5FM5O 1TETH 4MD4A 1G7LB 3QI9D 3IFLH 4M7ZB 5CMAA 1L7TL 2J3SA 4TSCL 1A47A 3UTOA 3BGMA 1HQ4A 3FB7A 4NN7C 3U48A 2WBJA 2Y1VA 3GMMB 3CIQA 5GRUH 4R4BB 1G7JA 4QT5A 4X4ZA 3HUJE 1IMHC 1V7ML 3LD8B 3IXTB 1NGQH 1CIUA 3HC3L 5EBLB 5E8DH 1J8HD 3ARRA 1L9MA 2WNGA 2D7QA 3IU3B 3IAQA 3NZHH 3T0VA 1K5NA 3X11B 1ORQB 5FYLH 3QQ4A 1HKFA 5DJ0A 3QIBA 1DQQB 1ADQA 3BKCL 5JOFB 4GRLC 1CLOL 5KVDL 5MEPA 2ZPKH 4JO4H 5T5NG 3VXMB 5J9PA 3CH1A 3MUY1 1J0YA 1U8PB 2I9LB 2HT4D 3WFHA 3MRFA 4EUPH 2ITCA 4XHJC 1G7MB 5IIEB 4MB5A 4PJ7B 1W0YT 2VLRA 3BH9A 5A2LH 4PGBB 2BXZA 1EHAA 4JRYB 3BDXA 4OLZH 4EUPB 4JFFB 2XACC 5DK0B 4HF5L 2DD8H 3EOBA 1H3UA 2BNRA 5E99H 1I7UB 4KGLA 3GJEA 3UBXB 4M48H 4HBCH 4F7TA 2I9TB 3VWJA 1XT5A 1JPFA 2LQRA 5HTSA 5ESVB 3O3AB 3VFPB 1VA9A 3TPUB 3OKMB 4I3RH 2FO4A 3HCVA 2Q3ZA 2BZDA 1CTNA 5D2LA 4M1GL 2ZSWA 4YFEA 3DUHA 1NFIB 3QUKA 1LVEA 5F7UA 3MYJA 4ZDHB 2X05A 4NQUA 1KEML 2BHZA 3HFMH 1DBBH 4WV1A 2R56H 5T1MB 3DURB 5C3LD 3V6FB 3U0WH 1KV3A 2EDTA 3QG7L 2R4RL 3KPQB 5HDLA 2NY7H 4PBVC 5AZ2H 4PTTA 4HJJL 4PJHA 5HPMB 1HZHL 1X6NA 1OGAB 5IQ7L 4HIEB 4DUXA 3MBEB 3WSQL 3BVNB 1IAOA 1RUKH 3OJ2C 1QBML 4DKAA 4DTGL 4LKCA 2DTSA 3V0WL 2F8VA 3KYOB 4M6NH 1L0QA 1FFQA 2EE3A 2PTVA 2E8ZA 5F9OH 1WCQA 2EDYA 1EZVY 2NY5L 4DZ8A 4GRLD 1U8JA 1S7TB 3GIZH 3OBAA 4F3FB 5EN2B 4L3AA 4GXVH 3WIHL 3FRUA 4UV4H 1BQHG 2CXKA 3D25A 2Y5TB 4XHJD 3CU7A 3U1SH 1MWAA 3O4LA 2UUDK 4F57L 2F54B 3H9HA 1FGNL 1G6VK 2R29H 2H6PB 3GJFA 5IFHL 2G2RB 4QXWA 2PYEA 2WBJC 4XB8A 2G60L 4HQQH 4HXBH 3MSPA 4AYFA 2IEPA 3ARYA 2XPGA 1W8NA 1NL0H 3O2VH 3MRGA 2Q7YB 3VXQA 5L6YH 5C0BE 5ICXB 3QJHB 2AJSH 4JQIL 2AK4E 2YPVH 5L2KE 2V5SA 1CE6B 3FQXB 2FEEI 1U95B 4GH7B 3E6HB 3GMRA 1KELH 4WFHE 2OMBA 3ARPA 4NHCL 5BZDA 2IGFL 3QIBC 1BMGA 3O3DA 5HHOB 1M7DA 2EDJA 3QQ9C 4UT7L 4BUGA 3U7YL 4LSPL 2NY2B 4Q9QL 4AG4H 4O2EA 4YK4B 4ZG1A 5HVWA 3BXNA 3KYMA 4P2YA 4L1HA 3UEZA 5C6PB 1N26A 3PIQB 2JB5L 4U6XA 1D5BB 2JELH 5T1LB 1EXUB 1NBYA 1RZJL 4IS6A 1IM9D 3W39B 2ICWJ 1QRNB 3AREB 3QG6B 2VDPL 4X7SL 1L9NA 2HKHH 4KC3B 4F15B 2ZKHH 5C0DB 3UTZA 5KVFH 2QQNL 4U1MB 1S9XB 3OKEA 4L3ED 4PJCA 5D7JA 2R69L 2R9HC 5IJKA 5CBEA 2BOCA 3O9WA 4ODXB 4PJ5D 3IETA 4PGDA 3KHOA 3VWJC 3I6LD 3SE4A 4WU5A 2CIIB 1IKNA 3KYNB 5KW9H 2QL1A 2ADIA 1QSED 1S9VA 3CAFA 4HLZH 4PRNB 3PL6A 1RULH 3A6BH 4D8PB 4OTXH 5K9OB 1AGFA 5H2BB 2B7DT 1NLBH 5I1JL 4OZHA 4JZOA 3CXHJ 3O8XA 2J2ZA 5T3ZL 4WV1C 1NEZB 2BNQA 1TJHH 4PRHD 3T4AB 4K3GA 4PGCA 5C7XL 5J8OA 2QR0B 2W0PA 4YZFF 4B41A 3JWOL 5CZVL 3HB3C 4FS0A 4QHLA 1KCKA 1T1ZA 1MCDA 1U92A 2BFVL 2EYSA 2WBJD 3B5HA 3NH7H 1FYTD 4UTBH 1D5IH 3DI2B 3LSOB 4K71B 4FRWA 3ESUF 4JGMA 3C2AL 3H9ZA 3PWUB 3C6SA 5E6ZA 2BSRB 5FK9B 3PP3K 4EDWH 3PNWB 3QEUA 3QI9B 4NPYB 5DJ2A 5KS9A 4JO2H 2AV1A 2EDHA 3P4NB 3LS5L 1HN1A 3F7PC 5TPWL 5FAAA 3QIBD 2FGWH 3FB5A 1SVZA 4XBPA 4LEOB 3QQ9D 4PREB 2Q8BH 1RHHB 3KPRE 4UNVA 1IGYB 1WWCA 3VFTB 3P73B 1CVSC 4P3CH 3DX7A 2JKXA 1J8HB 3IJSA 4O9HL 3OXSA 3PWJA 5F7FA 2D0FA 1QR4A 5IHLB 1W72H 4YWGH 7CGTA 2J8UB 2VLRD 3UPRA 3H0TA 4QOKE 3GBNH 2VXSL 1J1XH 2VZVA 1W72B 5MP6L 3QDJE 4DVBA 3T2PA 1JNNH 3QFJE 2BNRD 3CSBA 2R9HD 4WHTA 2J8OA 3K80A 3TP4A 1P4LA 1MJUL 1X5YA 5C0AA 1DQDH 3VWJD 3X3GH 5IOPA 3MLPA 1NLDH 4O58L 2OBGA 3DVFA 2YXMA 3V7AE 2BNUA 3KPLA 4LBEA 4PJIB 1GH7A 4MJID 1JUFA 1LE9A 3KPNA 4M62H 3ULUL 1QFUH 5FGBA 1A6ZA 1BLNB 2KZ1B 3QDMA 3WKNA 3UX9B 1UZ6F 4OV5B 3VD9A 5IF0A 4JHWL 3NCMA 4RAUA 1NC4A 4DGVL 5IB2A 5BW7A 1EEZB 2DQCH 2CXGA 4X7CC 4Z7WE 4PD4J 3BX7C 1FNSH 2PW1B 4HWBA 4EBQH 5K9JL 4YPGB 4PG9A 3TO4B 1NCNA 1DDHA 4RMTA 4X6DB 5FOBB 2CIKA 5E0QA 2RHEA 1CLZL 1LILA 4FABL 2PW2A 2HFGL 5HY9B 5BRZA 25C8H 4JFXA 4HSQA 2R2BA 2JTDA 1UENA 5EORL 2ORBH 2DWDB 1Q9WA 1N4XL 2WK2A 1HILA 1JPTL 1MFAL 4AIZA 3U4EB 3TT1H 3FN0H 2CRZA 4UDUB 1KPUB 2VIRB 5D7JC 1HHKA 2FBJH 5CJQL 1F3DJ 3IS0X 5IJKC 3GHBL 3O9WC 1CGUA 1QVOB 2ZOLA 3M17B 2XG5A 3RWIB 1ZLSH 1KCUL 1A6WL 5L7XL 1OGTA 2G75A 4MMXC 3S3SA 1ZV5A 3WKML 3MPCA 3SE4C 1VFBA 1IKNC 3VW3H 1MNUH 2VXQL 1BQLH 1MCFA 1RUPL 4KZDH 4NNPL 4NN7B 3PL6C 1MVUA 3D9AH 3O6LH 4PFEA 2DLFL 2XNAB 2FWOB 3O6KH 1JRHH 4RFOL 3L3OA 2HP4A 1E4XL 3W2DH 4ZNEA 3O8XC 4HKBA 3OF6D 4OCRH 1XH3A 2ZCKH 1L7IH 2EDQA 3L95A 1XGYL 2SEBB 4Y88A 2EDOA 4KK9C 2EDDA 3O4LD 4CMHC 3L3GA 4GMTL 4FQIH 1KN4H 4XAWH 1DLHB 1BM3L 2PYED 4N1CA 4M43L 4GRLB 2IMMA 5HBBA 4U1IA 3VJ6B 5DZLA 3O45A 2ZP0T 4OUOA 4JRXA 1VFAA 1QNZH 3WUWG 5JHDA 5EU4A 3K4ZA 5T3XD 1IEAA 2EO9A 2ADJB 3RA7L 2YMXL 4FQXA 4AEHH 4AEFA 4HG4K 3GMPB 1VEPA 1SY6A 4FXKA 1P4BL 5DURD 2BJML 4OIIH 4JDVB 2D4FA 5T33H 1ZTXH 5ILTL 4DEPC 3CUPB 1PEWA 1GGUA 1JGDB 4YBHA 4QTIL 4YHIB 1BZ7B 5LQBH 4DCQA 4XCEB 3L3HA 3MREB 3I9GH 1CXHA 4OLUH 2YXFA 3QHZL 4O2FA 4LP4A 2X42A 3U7AA 4JM4H 3SDYL 3BPCA 1YYLH 4DK6A 1HINH 3QAZC 3VA6A 3B9AA 4R7DB 3V5HA 1R3IH 1CDBA 2IBGA 3VG0L 4AZ8A 5D7JD 4QHUB 4RWHA 1UJ3B 3O9WD 4OGYL 5ICYA 3MV7A 3RDTB 4HC1A 2YUXA 3OG4B 2IANE 1JFQH 1MRCH 4C4KT 1B6DA 3MLXH 5AD0A 3EAKA 2DJ4A 2R8SL 3DROA 1ZEAL 4ZXBA 1IM9B 2P8LB 3T77B 4JPIA 5EUKB 3TZVA 3PL6D 1T0MA 2XIDA 1QFWH 5FGBC 2CR3A 4JN2A 4K94L 1JWSB 1MCNA 2ADFH 2Y9RT 5GS1B 4HULB 5BW7C 4L3EB 4P9HL 5HHXH 4NJ9H 1R5IA 4PJ5B 3O8XD 4PY7B 5ACMA 4KQ4H 1NFKA 1MCOL 2BNQD 2H32H 4PRPE 2MQCA 3ARDA 4KK9D 4PJAF 4TNWF 5E94A 1C8PA 4J6RH 1IRAY 1G9EA 2H32B 5GGQL 1LWRA 1PG7X 4CU8A 3TT3H 4YFLI 4ALAL 4XPGL 5DJCA 2IH3B 4CADB 5H35B 4NRYB 3AXLB 4QCIA 2W9LA 4NYLA 5CJOH 1AO7B 1SEQL 1U8OB 3RL1A 2FJGB 4YDIH 1J0IA 1O0VA 3MLSH 3EYUH 3NAAL 4FXGB 2OJEA 4PRHB 4LL9A 2VDNL 1OAUL 1Z9MA 3FONB 4CDHA 1MRFH 1XGPA 4MD4B 4JEGB 4PTUA 5HHVL 3F6LA 5F89A 3KWWA 2OJZH 1HQ4B 3BGMB 3FB7B 2WBJB 2QADC 4CU7A 3BH8A 1G7JB 4G3YH 4ZPTA 4QT5B 1VEMA 5I1KH 4KXZH 4FQCL 1I8IA 4X99A 2FHBA 3V5KA 5C0JA 3MUJA 1X5HA 4GBXA 1RHFA 1FAIH 1ADQH 1J10A 2R4SL 1K5NB 2XOTA 1BX2A 1C08A 1RZFH 3WN5A 3QQ4B 3O0RH 5DJ0B 1DSFL 1FVCA 1NMAH 3QIBB 3MODH 4WUKL 4R6UA 15C8H 2R0ZL 3L5JA 4OLEA 5C2BL 5ACLA 2FIKA 2A6JA 2L4OA 1OARL 5I6XC 2XI9A 4FQJH 2HKFL 5D6DA 5MEPB 5J9PB 4KK8C 3CH1B 4C83A 2Z8RA 4KPHH 4P5MA 3WFHB 3MRFB 2ITCB 3KYKL 1OLLA 1TPXC 3BPNC 1B4RA 2OR7A 4FQXC 2EDLA 2VLRB 3BH9B 4XBEH 3HNTL 4XMKH 4JPWL 3V6ZA 1TQCC 3LN4A 2J7LA 5E03A 2VABA 3QDMD 4MNQB 5IVOA 1OWRM 3EOBB 1G9NC 4MVBC 5MEQA 4X80L 2BNRB 4DFHA 1GL4B 3GJEB 3GSNL 1UM6L 4EI6A 4F7TB 3VWJB 2QEJA 1JPFB 3CFDA 5A16A 3D85A 3TVMA 2FO4B 5FA3A 3HCVB 5BRZD 4LSUH 5J0BA 5D2LB 4QRPA 5GS3A 2ZSWB 4OD2A 1M7IA 3QUKB 1N0XH 2E27L 4PB0H 2RBLA 3MYJB 1Z3GH 1G9ML 4WV1B 2XXCB 1NCAL 5E2VH 4IRSA 1NSNL 1CFVH 1PW3A 3WFBH 1VHPA 1TDQA 35C8L 5JW5A 1MCPL 5KOVC 1XR8A 3NIGF 1INQA 3BYYA 4NT6A 2VC2H 1AXIB 1KCVL 4ZXBC 1S7XB 4NZTH 4PTTB 3TZVC 4I0KA 3S5LA 2QADD 3LY6A 4QRRE 3C08L 2VLKE 4PJHB 3TNNA 2J88H 1EZVX 1MY7A 4OV6F 1WSST 4I18B 1BREA 1IAOB 3UO1L 4CGTA 4NGHH 3ARDC 5JXAH 3H3PL 4LKCB 3S34H 3RI5F 4P49A 3IVKA 1A1MA 1KN2L 5CSBA 1AJ7L 2P42B 4DZ8B 4HCRA 4M6OL 4ZD3L 1Q72H 3LQAC 1U8JB 3MJGX 3QQ3A 4LCCA 4N0FA 5DD1H 4KU1A 1MWAH 2R0LL 4P3WA 4RGOL 3FRUB 4KK8D 4HKZA 4JRXD 4ONFL 1SQ2N 5JHDD 2DOCA 2BY1A 3DPBA 3GJFH 3D25B 3CDGA 1H5BA 1MWAB 3W5NA 3O4LB 5E1HB 4ZSOA 2D4DA 5H94A 3H9HB 2E9BA 4GQ9L 3VFNA 3GJFB 3L6FA 3SE8L 1HK6A 2APTA 4JG1L 1C1EL 5T3XH 4MVBD 1Z0MA 3HUJF 3KG5A 2XPGB 4FZEL 3OPZH 4XPAH 1XF2A 2O5ZH 4ETYA 3MRGB 3VXQB 1YY9C 4XVSH 4LIQH 2GCYA 2VOTA 4U31A 2GK2A 4GBXC 3BD3A 1WZ1L 2DQHL 2DRUA 3GMRB 3OQ3B 3VFUA 5FKPA 1T1XA 3MRKA 3P11L 3WN5C 5BZDB 4X6CF 4H88L 1RIVL 3L3IB 5DURB 1FL3A 1LDSA 3BT2H 3O3DB 4NM4H 1M7DB 4MDIB 3ZTNH 5D6DC 3EUUA 2DTMH 4KTDL 4O2EB 3BXNB 3MV7D 2YD7A 3KYMB 5TF0A 4ODSL 2CUIA 1KSRA 4O5LH 4U6XB 1HIML 3QSKB 4JPKL 1LHZA 2AJZA 2FEDC 2VDLH 4QO1A 4ZXBD 1NBYB 5D1ZA 4IS6B 4U3HA 2R1XA 3TZVD 3RKPA 3WO3B 2CH8A 3KPOA 3U4BL 3UTZB 4OQ1A 3HZKB 4BUHA 5SWSE 1B4JH 3PQYA 5ADOH 2H9GA 3OKEB 4PJCB 5T1DL 5CBEB 2BOCB 3O9WB 3VRIA 1KIUA 2BVYA 3IETB 3ZYOA 4PGDB 4GRWF 4P2CG 2P8MA 5JQHC 2BRQA 4WU5B 3ARDD 1BD2E 1JGVL 4LMQI 3TVMC 2JLLA 4XVUC 1S9VB 4H8WL 1BF2A 4AEIH 1BOGA 3PL6B 1AGFB 3GI8H 4OZHB 2VYRE 5IB5A 3MV01 4JZOB 3ZYZA 4Z0BL 3O8XB 1T7VA 3K4DA 4I13B 2BNQB 3DSNA 4IRSC 4PGCB 2F19L 1KCRH 2X4UA 2XWBA 3CK0H 3BMVA 4R8WL 1CR9L 1FNHA 1UCBH 4TUKL 1JZ8A 3MOAH 1FNAA 2B20A 4WI3A 4QHLB 1DBKL 1T1ZB 3EDKA 4CMHB 5A2IH 5I16A 1U92B 1VGEH 5MERA 3V6BR 2EYSB 1EHLL 1S9WA 1IGJA 2E6PA 2JJVA 2R0KL 3QXWA 5AWNL 3SN6N 5E5RB 2NW2A 3QIWA 3C6SB 1MCKA 3KPMA 1PKQA 4GBXD 5GPRA 1I75A 3D2UA 3QEUB 5DJ2B 2AABH 1VCAA 5KS9B 2AV1B 4LPVA 3STZA 4RNRA 5D7KD 1ZSDA 3FB5B 2D7TH 4XBPB 4DEPB 2C4FU 1PKOA 4LCCC 4P2RA 4RBPK 5DJZA 5FYLE 3EYSL 1JI2A 5C3TA 4UB0H 3DX7B 4JY6B 1A7QH 3IJSB 3IAGC 3OXSB 3P9LA 3PWJB 1H5BC 2D03H 4PJ8A 2Z92A 2YPLA 3AMKA 4UV7H 2FEDD 3UXFA 4PJ7E 3UPRB 3QAZB 3H0TB 4MX7A 4JRYE 4XP5L 4HH9A 1I7ZA 4X98A 4DVBB 4KJQC 3ZZ1A 4JFZL 3MUGA 4WHTB 4L1DA 4HUXA 1P4LB 1O7VA 5C0AB 5IOPB 1TTUA 2D3VA 4YGAB 4L8SA 3D85D 3SJVA 2EICA 3TVMD 4UOW0 5IFJA 2BNUB 3KPLB 2A77H 4LBEB 5GRJL 1JUFB 1LE9B 3KPNB 4HWBH 4QRPD 5HHPA 1A6ZB 5HYSA 5KANG 3QDMB 2BY2A 1RUML 5IF0B 3PHOA 5GGVH 4RAUB 1G0YR 1NC4B 5IB2B 5C9JA 1CN4A 2IF7A 3NCYP 4J2XA 4FN0A 5DGQA 1UA6H 4IRSD 4PG9B 5JNYA 1DDHB 1EVUA 2P1YA 3S8WA 2PW2B 3JBG7 5BRZB 4GMSL 4JFXB 4YIQA 5D1ZC 4ORZC 4XVJH 1Q9WB 3GZKA 1HILB 1CLYL 4AIZB 4XWGL 1FQ9C 3DGGA 1KEGL 3J7HA 3KLHC 1QLFA 2CDFA 5IG7A 4OGXL 4FZ8H 2OLDA 1HHKB 5CJ5A 4ONHA 2ZOLB 3MGTA 1QACA 1QBBA 2MFNA 2Q3AA 4BA8A 1BZQK 1OGTB 2G75B 4LHUG 1T03H 5ERWA 1VFBB 1P4IH 1JGLL 4OF3A 2NTFA 5HGDA 1F58L 1QFPA 4M7LL 1BHGA 4MB3A 1MVUB 1BBDH 1T80A 2QADB 1TTFA 5DA0B 4DKFH 4EN3A 1KPRA 2JIXA 3NCFB 3L3OB 2D0HA 2EYTA 4HKBB 1LP9A 1GRWA 1XH3B 2GFBA 3L95B 3SQOL 4OD1L 4N0RA 3W81A 3DX9A 4KV5F 3V6OE 3VFOA 5IR1A 2F54E 4J8RA 3L3GB 1BGXH 4NQEE 2ILLA 4PLKC 3SCMD 1A5FH 1G7HA 4TVPD 3T08A 4FTVA 3Q1SL 5I6XB 1I1AA 4MJ5A 4U1IB 5LGHL 2DDQL 3CSYA 5J11C 4JRXB 2C9AA 1VFAB 4JO3L 4BJLA 2IWGA 5EU4B 5JHDB 3QIWC 1SY6H 5I8OH 1FIGH 1TPXB 3BPNB 2IFFL 1G9NH 1N59A 4FQXB 5AZEH 4RWYL 1RURH 4PV8A 1TQCB 4FXKB 5GRVK 2E9WA 4K7PL 4URTB 3MRLA 2N7AA 5F7EL 3P77A 5HHOE 4RCAA 1L4IA 3VFVA 2LABA 4G8EA 1JHLL 2NY5C 3MACH 2OR9H 1P7KA 2E7CA 4XCCH 4DCQB 3L3HB 3WFDL 2MPAH 3F7YA 2ZWLT 1VFUA 2ZCLH 4O2FB 1Z9SA 1UWXH 4PJ8C 3TCLA 3BPCB 3OZ9L 4RRPA 2B1AL 4OFVA 4U6VH 5D1ZD 2FR4A 1WZMA 5CP3A 1RQ5A 5MENA 1QRNE 3V5HB 2YS4A 2EEBA 1BFVH 1MEXL 1RJYA 4HC1H 1LNUA 3PQYD 5DA4A 2QQLL 1OAZH 2AJUH 5MHSD 3L9RA 5ICYB 1NAKH 3V0VA 3MV7B 4FQQA 5EZIL 2KBGA 4GAFB 3NCJH 4L8SC 4JVUA 4X8JA 5AD0B 3M07A 1UACH 4UQ3B 3DROB 4ZXBB 5J57B 4C59B 5GISL 4JPIB 3TZVB 1FG9C 1T0MB 2DM7A 1IFHL 4JN2B 1GGCL 3P9WB 4JDTL 4XPBL 4Z7WF 4KHXH 2DQJL 1BIHA 4U1SB 1R5IB 1MREH 3MFFB 4LDLB 2QTEA 1A6UH 4YXHH 1JHKL 4YO0A 3ARDB 5E94B 4U1NA 3LQAH 3FFCE 1R0AL 5DJCB 3OAZK 4PLKD 1Q0XH 2GAZA 2Y36H 1RZJC 4QCIB 4NYLB 1G84A 1UKSA 4TULL 3RL1B 3ULVF 3BZEA 1XAUA 2OJEB 3QIWD 1EK3A 3SKNA 3EO9H 2DLHA 1XGPB 1HSAA 5TGBA 1II4E 4PTUB 1KFAL 4ODHL 5F89B 3KWWB 5KVEH 1XGQA 5GHWL 4JQXA 4P9ML 4OZIA 4QRUA 3BH8B 4IM8A 4YBLC 4EN3C 4ZPTB 3KNBA 4P2RD 3VRJA 1ITCA 1MIEH 2VWEC 4C56A 1I8IB 1GGBL 4X99B 3V5KB 2Q76A 5C0JB 1K9TA 2CRIA 3QHFH 3O4OC 4GBXB 1SJEA 2V2WA 3FMGL 1FJ1A 1SEBA 3G5XA 4Z18A 4AL8H 1UADC 4PJGA 5I1IL 4PJ8D 2YPLD 1BX2B 1C08B 4PB9L 2J8UE 3WN5B 3JWOC 1FVCB 4OLVH 1WIUA 4XP9L 5FEBA 3OTTA 4QRTA 5ENWA 2FIKB 1A7NL 2A6JB 2NZIA 1I1AC 5B3JE 4LFHD 4RGNE 4FFWC 4C83B 2XN9A 4P5MB 1Y6NR 3NPSC 1Z5LA 4BZ1L 3RVTC 1G6RA 1AI1L 4EQ2A 3V6ZB 3LN4B 3OAUH 2VABB 5TDNA 1IAKA 4OZ4A 2H3NA 3QUZA 1K85A 1KBGL 3IAPA 5MEQB 2A2QT 3TYFA 1RZ8A 2BSED 4U4BA 4KHTH 5C07A 4EI6B 3LPWA 2AQ1A 3TJEL 4NSKA 3CFDB 3C9NB 3UTTA 5A16B 3RHWK 5CD3A 4X6DE 1GCFA 3D85B 3ZDXE 3TVMB 1CZ8L 3MXVH 3HMWL 5FA3B 2RCSH 4BM7A 5EOCH 3B9VA 4LVNC 4QRPB 4OD2B 1M7IB 3PGFL 5IKCA 3WDIA 3NIDE 1XMWA 1N6VA 3V4VL 2ATKA 1KLUA 5JQ6L 3ARQA 4NWTL 4HS3A 4WDIA 4IRSB 5JW3L 4QXGL 3VXPA 5C9KA 2DM4A 5JDJA 5JW5B 1IAII 5DC0A 5TQ0L 1XR8B 4M6AA 4PBXA 1AKJA 1INQB 2CKBL 3L7EA 4NT6B 1D6EA 2CRMA 3KR3L 5DT1L 4LSQL 4DGIL 4UUJA 2QKIA 3S5LB 4PJXA 4PD4K 1LMKA 4HHAA 5DJ6A 3JWDL 3ULUC 3RVXC 3LVEA 2JIXD 3TNNB 3B83A 4Z77A 5E7BA 5C0RL 4B7IA 3VD3A 1KTRL 5T3ZD 3HZYA 3ZL4L 1DZBA 4HCRH 1YEHL 2XTLA 1WIPA 2KUTA 3SO3C 4MZ2A 2EC8A 3S6CA 3VXRA 4PYHA 2VAAA 4O02L 4G80A 4HD9A 3IVKB 1A1MB 4XNXH 4FTVD 2XA3A 3NACH 4DN4H 4R4FL 1I1AD 3QQ3B 4LCCB 1NCDH 5I1DA 2ERJC 4N0FB 1YNLH 3SBWA 5GGRA 1OP3H 1S9YA 4FFWD 2VLLA 4HKZB 1G1YA 4NC1C 2B0SH 2FX8H 4N8CH 1LO4L 1YECL 4TVPH 3CDGB 1H5BB 2VL4A 4TSCH 1AIFA 5DJYA 3W82A 2XZCL 3RVTD 2N56A 3EYFA 2XTJC 3C87A 1UT9A 1Y18A 4S1SH 4UINH 4ZSOB 5H94B 5JORA 3BYTA 3VFNB 3LN5A 4LRNL 3BE1L 3L6FB 2BVQA 4Z7NE 4JQXC 1V7MH 1J0HA 3HC3H 3GSOA 2EIEA 4ODUA 3O41A 4DGYL 4WI2A 2GCYB 5EWIH 3BRFA 3I2CL 3NCCB 1RUAL 4R90L 1XF1A 2APFA 1ZT1A 4MWFA 2RGSA 1JZ4A 2MTPA 4TYUA 1NCWL 4R0LA 4Y4HA 5B38G 3GHEL 1REIA 3VFUB 5FKPB 1T1XB 2X7LA 3BKJL 5CINL 3MRKB 3VMOA 3C2SA 1IKFL 1OAQH 1F02I 1CLOH 1T89A 1GSMA 1FL3B 1G7QA 3AC0A 5F1KC 5MEND 5E24E 4ZO6A 4Q74A 1FFNB 2ZNXA 4JVWA 4YEFA 2C1OA 4PPTA 4Y2OA 5GGSA 1QTYT 2R2EA 1IGTA 4PS4L 1T7YA 4F7CA 1B88A 1V7NH 2W92A 5IB4A 1TFHA 1CXFA 1A7PL 3SGKA 4ZTOL 4HF5H 5D1ZB 2R1XB 4NZUH 1J5OH 4JHAL 4DOHB 1F4XL 4KKCC 1C5DA 4XCFL 3KPOB 3ULUD 3RVXD 3QUZC 1YMMA 3T0WA 3AU1A 3PQYB 1J05A 2H9GB 4Y2DA 1B2WL 3VRIB 2UWEA 3GSNA 4MXVE 5F6HI 2P8MB 5KOMC 3KDMA 3I6LE 4JN1L 1RIHL 4M3JA 4M1GH 4DKEL 4S11A 5DMJB 3IGAA 4JCLA 3BO8A 2MQ3A 1BOGB 3K1KC 4OGAC 4ONGH 5KJRL 3JWNC 4MAUL 4R7NA 5IB5B 4R3SA 5IVNA 3BP6A 4HUUA 4RGMC 5CIPA 1AO7E 5H37H 4PLNC 5D2NA 2X4UB 2XWBB 4PRHE 3M45A 4QKXB 3QG7H 2R4RH 2Q6WA 1ULVA 4YGVA 3B6SA 5LKNA 2XTJD 2NMSA 3P40A 1TQBC 3TIDA 3FL7A 4PJDA 1S7QA 5I16B 2DI9A 1HZHH 5MERB 1I9RH 2IG2H 2OI9C 5FYKU 4G8IA 3QNZB 1S9WB 1IGJB 1RK1A 4G6KL 1J1PL 5J11B 3RNKA 4BZ2L 3BDYL 1GOFA 4W70A 3IYLW 4C56D 1QBMH 2DIBA 4P9HC 2NW2B 3QIWB 3VXTA 5F6IC 3KPMB 3V0WH 1PKQB 3D2UB 3X14A 3X12A 5DFVC 2NY5H 3STZB 4RNRB 1ZSDB 4Q2ZA 4ZOBA 3KPTA 4ODTL 1CE1L 1NGQL 5F96H 4P2RB 1X7QA 3SBWC 5LWYH 3JV6A 1BVLA 1RPQA 5DJZB 2VLMD 4N8VG 2XN9D 2LTQC 1P84J 1UFUA 1OTSC 3P9LB 4F57H 1FGNH 1ZANL 5FYLL 4PJ8B 2Z92B 2YPLB 5IFHH 3MMEA 3MLZH 2G60H 4MX7B 1KXQE 1TJIL 2A83A 4JO4L 1JK8A 4KKCD 5F7NC 4HH9B 1I7ZB 4MNQE 4X98B 5FA4A 3QUZD 4HJGA 4ZUWA 1KXVC 3MUGB 4JQIH 1NCCL 1NBQA 1J7VR 1G7PA 4XP6H 5E2UH 5C07D 2BERA 4OZFA 4HUXB 5DHXB 3STLA 3WXVL 4APQA 2DIJA 4EOWL 3DYOA 1GGIL 4NHCH 2IPUK 3LEXA 3UTTD 4L8SB 3QO0A 4OLZL 4R0LC 4Y4HC 5C6WH 3SJVB 2IGFH 4XNZC 5IFJB 1QFWM 4KDWA 5HHPB 5E99L 5D2LE 5HYSB 1T89C 4OGAD 1LO0H 3BPLB 3U7YH 5L2KA 4LSPH 1JZ3A 4QRQA 3PHOB 4Q9QH 2GJ6A 2ICES 2WBKA 2NLJA 2VH5L 4NRXA 1BJ8A 4TOYH 5A1AA 3F8UB 2JB5H 5D70H 5JNYB 1QFOA 1PEZA 1RZJH 3C09C 1AKJD 2VDPH 2VDRL 3L5XL 4X7SH 2EXYC 4YIQB 1SM3L 3MFGB 3SGKC 1CD9B 2QQNH 1CGWA 3OKDA 1PGRB 3MJ9L 2R69H 1T1WA 5JW4M 3DGGB 1QLFB 2CDFB 5IG7B 4Y2DC 3RGHA 4LLMA 4ONHB 5SWZA 3SDAA 1F45A 2AV7A 2EH7H 4A2MA 3MGTB 2RFXA 4KWUA 2XYCA 5E2TL 5ERWB 2NTFB 5DFVD 3EZ8A 5HGDB 3TLRA 3VXRD 4FFZL 5I1JH 1GHFL 1F90L 3EYQC 3QHTC 4YBLB 2YRZA 1KPRB 5T3ZH 1YEIL 4EN3B 3S37X 2JIXB 3FAWA 5C7XH 4H0HB 5DRXA 2ZUTA 4POUB 2EYTB 4U1KA 1LP9B 1J1OH 2GFBB 3JWOH 1QHOA 1OTSD 5D2NC 3NFPA 3O4OB 1YPZA 3NFSH 1NC2A 3DX9B 3VFOB 1YUHA 1Q9LA 3VXSD 5IR1B 4MGXA 3ILQC 4J8RB 4E42B 1G7HB 4FTVB 4GXVL 4CUCA 4L5FL 1I1AB 4MJ5B 2QSCL 2QSTA 5SWQA 2AP2A 3CSYB 5BXFA 5CGYC 5C6TL 3N1GC 4U6YA 3OJMB 4JG0H 5T3XE 3O6ML 4XPHL 3LRGA 3LS5H 5TPWH 4Y4HD 1N59B 4UNTA 5D1XA 4PV8B 4NDMA 4LIQE 1N5AA 3FO1A 4PRDA 3R8QA 3H9YA 4XBGA 5F1SA 4EI5A 2R1YA 3O2VL 3MRLB 1W0WA 3P77B 4D94A 3VFVB 4O9HH 2YPVL 4G8EB 5CSGA 3QXUA 1P7KB 1IE5A 2AEIT 1OCWL 1KELL 3F7YB 4M7KL 3T65A 3RIAK 5CP3H 2X4RA 5I74C 2A9NH 2YOCA 3TCLB 4PJ7F 1ZAGA 2EXYD 2VXSH 4LVNB 5MP6H 2FR4B 3VDAA 1WFNA 5MENB 3O81A 1RJYB 3LV3A 32C2A 4GAGL 4A2LA 1LNUB 4Y2DD 2HAZA 4CAGA 4PJCE 3L9RB 5C09A 4AIXA 3V0VB 4OI7A 4FQQB 4PRIA 3RWHA 2HRLA 3G6DH 3QDJA 1Q38A 1YA5A 3QFJA 4KI5F 3HRPA 1BQHA 4X8JB 3ULUH 2NY0C 2BX5A 2VISA 2VSDA 2ZKHL 3QBTB 5KVFL 1FZMA 5IV2A 3P4LA 3K8LA 2APWA 1T83A 3QRGH 4OZHE 1NCTA 2FGZA 1M71B 2Z4QA 3IU4H 2UUDH 2P46B 4P46A 3G9VA 2BNQE 1WZLA 4YBQC 1CLZH 4FABH 5E8EA 2HFGH 4YO0B 1EFQA 2IJ0C 4U1NB 3A6BL 3MX0A 4OTXL 3SO3B 3ILQD 1NLBL 1OLZA 4JFPA 1JPTH 3BRGC 1MFAH 2H8PA 3MV11 2PF6A 2GAZB 4MCZA 4D0CA 4WFEE 5I15L 3BZEB 5L7XH 1A6WH 4H0GA 5CGYD 1BF8A 3WKMH 3SDAC 3AROA 4HH8A 4LDOB 2W59A 5EG6C 1LDPL 1CDJA 1RUPH 3SKNB 5I8CA 4WGVB 5ELIA 1HSAB 4HS8L 4NNPH 2HFFA 5ISZE 2XTJB 2VR9A 5TGBB 3MLUL 1D5IL 5KS9E 2DLFH 1KJVA 4K3DL 1XGQB 3LKQA 2X1PA 5ACZA 3RX7A 4LSSL 4GG6E 4H8WC 4OZIB 3P0YL 3CX2A 4QRUB 1E4XH 1FNFA 3KNBB 3VRJB 1EAJA 1UM5H 1XGYH 4V2CB 1FV1A 5CUSL 1J9CT 4XAKD 4C56B 5KSAA 2Q76B 4N5UA 3MA7A 1SJEB 2V2WB 4GMTH 1FJ1B 1SEBB 3G5XB 1S7VA 2FGWL 5HYQA 1IQDA 2DI7A 4LSVH 4M43H 3ARTA 3RL2A 4J4PC 4QRTB 4IIQA 5ENWB 1VPOL 4P3CL 3GDBA 2EDBA 3EHBC 2ZG3A 1GAFH 3JXAA 1G6RH 3VMNA 2NYYC 2ZSVA 2XN9B 3RA7H 1YEJL 2V9QA 5D7LA 4YWGL 3T0XA 5C0AE 1Z5LB 4LQ1A 3S88L 1JPST 5DD0L 5IUSA 1I7RA 4LHQB 1G6RB 2NY0D 1MFNA 2EDEA 2BJMH 1KG0A 1T2QL 5D1XC 5ECJE 3HN3A 1JNNL 3ZYIA 5TDNB 4QTIH 5L2KD 2R2HA 4K55A 3QDME 4EI5C 1IAKB 4KZEL 4OZ4B 2H3NB 3QUZB 2GJ6D 1DQDL 3TYFB 1RZ8B 4WFHD 3QHZH 4XX1G 5C07B 2YA1A 5B22A 2LU4A 4P2OA 4YBQD 2OTWA 4NSKB 4JQVA 3WEXA 3U0PA 1O7SA 4TNVK 5CD3B 3WFCL 2W9DH 5JMOC 3LAFA 2P5WE 4GKOA 5BRZE 1GC1H 1CDCA 5IHUL 5IKCB 1FNSL 5GGTL 4EBQL 1HHJA 2ATKB 4RGMB 1KLUB 4OM0L 5I0ZA 3PP3H 4HS3B 5SWZD 3SDAD 3BSZL 5F1NA 3VXPB 3G9AB 4XCNA 1ZEAH 4F7EA 1VSCA 3WE6A 2ORBL 1AKJB 1TQBB 3B8YA 3CZFA 3MBXL 3L7EB 1ACYH 1D6EB 5EIQA 4UUJB 2QKIB 2OI9B 4PJXB 2IANA 4HHAB 5DJ6B 1T83C 1MCOH 2C7UA 1ZLUK 4Z77B 4XC1L 1JJUA 3UPCA 5CD5C 4ZNEE 5BVJA 5BV7H 4P46C 3KGRA 4XGZA 5F6IB 1MNUL 5DQJA 4PGEA 4KZDL 5GJTL 3MRQA 4L3CA 3HZYB 1NC2D 3MLYL 2CUMA 4XPGH 3D9AL 1RZIA 4WU7A 3FQTA 3VXRB 5BV7B 2VAAB 4J4PD 4PRPA 5FV2A 3OKNA 4G80B 4LPUA 2ZUQC 1JRHL 3W2DL 1L6ZA 3LKNA 4OCRL 3MRPA 5I1DB 3ZHDA 2QHRL 3EHBD 1FVDA 1L7IL 2FLBT 1JF1A 2Q8AL 3W5MA 1KACB 1OAKL 1OAUH 1S9YB 2VDNH 2VLLB 3QR2A 4LPCA 4OGZA 1A3RH 2NYYD 2LTQB 5CILL 3WD5H 5JHDE 1ZHKA 5GSRA 1EFXA 1X5ZA 5HHVH 1AIFB 3DX8A 5DJYB 4XAWL 3EYFB 1Y18B 1F00I 3QRFM 5JORB 1JF6A 5D1XD 2BSSA 3LN5B 3V0AC 5EO1A 2BVQB 4EI5D 3IDJA 1QNZL 4FQCH 2CMRL 3RVUD 2ED8A 3GSOB 3LEVL 2OM5A 4ODUB 3TYGL 2PYFA 5HYJA 1AHWA 3LKRA 2ICEA 3N9GL 3RNQA 2GTWA 5EULV 4AEHL 1FHGA 5KSAC 1YNKL 4J3VA 4MWFB 1ZT1B 4WW2A 1OHQA 1MPAL 1DSFH 4R0LB 4Y4HB 4F37F 3DGCR 1X4YA 4WUKH 4XNZB 2X7LB 4OIIL 4ONOA 1AY1H 4ZFOL 1ZTXL 2FHFA 2P5EA 2HKFH 1G7QB 4IIQC 2WV3A 2CSPA 5LQBL 4I9WE 5B3JF 3I9GL 3RWFA 3EFDH 4OLUL 4ZO8A 1BBJA 3VI4E 4Y8DC 3T0AA 4NZJA 3IFPA 5HI3D 5D7IF 5C09D 3B43A 2C1OB 1DVFA 4J3WA 1HHGA 2ENYA 5GGSB 4KI1A 3L5WA 3QDJD 3GMOA 1B3JA 2R2EB 1IGTB 3MLTA 3QFJD 4JPWH 4F7CB 3BZDA 3C09B 5IB4B 2EDRA 1KT2A 1R3IL 3JSSA 4PJIF 2DLTA 4X80H 3MRJA 5IWLA 2XKUA 3GSNH 2LVCA 5L8LB 1UM6H 1C5DB 2DKUA 3H8NA 1YEDA 2DQIL 1YMMB 3AU1B 1J05B 4Y2DB 4OI9A 4Q6IA 5CD5D 2NX5A 2UWEB 3GSNB 3MLXL 4P46D 4P2OC 5F8QC 4JQVC 3KDMB 4X6DF 3WUWA 3ZDXF 4W4OC 5DVKA 3IGAB 1N2RA 1QFWL 4PGZA 5FB8A 5A2FA 3BO8B 4JFEA 4JJHA 5CIPH 1V3LA 2E27H 1F4HA 1JGEA 3IKCA 3QB7C 4NJ9L 3NIDF 4XX1E 4KQ4L 4R7NB 4R3SB 4P48A 3BP6B 1NSNH 4HUUB 5CIPB 2DF3A 1RUQH 35C8H 2BVUA 2VQ1A 3RRQA 5D2NB 2R2CA 2Q6WB 4YGVB 3B6SB 1JYNA 4S1QH 2ID5A 3TIDB 4JLRA 4PJDB 3C08H 1S7QB 2K7PA 2FIRT 2CKBA 5CJOL 1WAAA 4G8IB 4OZGA 4XT1C 5C0NC 3EYUL 1RK1B 5AAWA 1MRFL 3BEVA 3RNKB 3UO1H 3H3PH 3VXTB 5KSAD 2W0LA 2VLKA 1WV7T 2JK5A 5IW3A 3X14B 3X12B 3PGCA 1AJ7H 4M6OH 1MELA 5DEGA 4HFUH 4UTAL 4Q2ZB 4HAGA 3AS0A 2R0LH 2GKIA 5DFTA 5B3NA 4RGOH 5E2WL 1KGCD 1X7QB 3JV6B 1BVLB 1AC0A 1FLTX 1IM3A 1UXSA 2PKDA 1ADQL 2X70A 5D7LD 3UJTH 4XNUH 3O0RL 5I74B 2P45B 1EERB 3SE8H 3U9PL 5J7CC 3MMEB 4JG1H 4PP1D 2BY0A 4FQJL 4JDZA 4OZFH 3S36X 4LVEA 2A83B 1JK8B 4FP8L 5FA4B 3DIFA 1KPVA 1GZQA 3GSXA 4HJGB 4ZUWB 4KPHL 1K3IA 1G7PB 4CN4A 4I3SH 4OZFB 1AHWC 2JCCF 2X9YA 3ZKXC 4P2OD 3STLB 4APQB 3G5ZA 2CDGA 4XBEL 2RQ8A 4N0UA 4XNQA 3LEXB 4WW2C 3MR9A 5FECA 2YWYA 3QO0B 3ZT6A 2NY0B 1F8TL 1YEEH 4H88H 5K9QG 3U2SA 4QXUH 3CGTA 4PR5A 1KXTB 3BIAX 4Q9CA 1A3LL 1U8LA 3EGSA 5L2KB 1CI5A 4QRQB 4I4WA 3BZ4A 2RAMA 4M9OA 2GJ6B 4KTDH 5EO9A 2HFTA 3MRDA 4LRIA 3RJDA 5JHLH 2NLJB 4ODSH 4ZQKA 3WO4C 1PY4A 2Y25A 4NQVA 3CD4A 2H1PH 2DBLL 4JFDA 1DVFC 1HIMH 4JPKH 4KJPD 4LSUL 4X4YA 3QQNA 1I4FA 5KBNC 2JJUA 4PB0L 1CFSA 4LLDB 4NO5A 1AFVL 4LVHC 3OKDB 1E6OL 1Z3GL 5IWLC 5T1DH 2IAND 1VFOA 3RAJH 5E2VL 1T1WB 5C0ND 1X5AA 2NY3C 5K93A 5SV3A 2I25N 5F93C 4ZUSA 4Q6IC 2A73B 4LLMB 5SWZB 3SDAB 4MXVF 2AV7B 1JGVH 1IT9H 2RFXB 3ZTJG 4M6MH 3QCUL 5CCKL 3JVGA 2VC2L 4H8WH 4D3CH 4MHHI 4ISVA 4HKJA 2FECI 1I3GH 4PRPD 4MNGE 1OTUC 2J88L 4Z0BH 4ODWA 1BD2A 1M05A 3HZMA 4M03A 2F19H 5GZNC 1MQKL 3H6JA 5DRXB 2ESVA 1T6VN 4U1KB 4NKOA 4TUKH 4NGHL 5JXAL 2NZ9C 1DQML 3VWKA 5F9WC 2FRGP 2VAJA 1DBKH 3S34L 3NFPB 1T5XA 1EFXD 1YPZB 1A7OH 1NC2B 2EZ0C 1YUHB 1Q9LB 1IC7H 2W60A 4ZSOE 4P4KA 1MJ8H 5IROA 4WUUA 3AMLA 1MWAL 4TVPE 1NGWA 4X5LA 4H1LA 4LSRH 2MOVA 4NKMA 4J12A 5SWQB 5BXFB 3JWDC 4UOJA 4U6YB 1PLGL 5HYJD 1A1NB 4QHNA 3SDXA 3MA9H 1QR1A 1U3HA 4YDVA 1GJIA 5D1XB 2CLZA 1I9JL 4NDMB 5T3XL 3LMJL 5DI8A 1N5AB 1NFDE 3FO1B 4PRDB 43CAA 1X4XA 2P5ED 5I8KH 1ZLWK 3ILPB 1IQWL 2EECA 4MA1C 2DI8A 3MNZA 4XPAL 4XBGB 4EI5B 2R1YB 3EYSH 5C0GA 3TA3A 3WIFA 1W0WB 4XVSL 1AXSA 1JNLL 2DYPA 5I1LA 5F7WC 3X11A 3HNSL 3IDNA 3ME0A 1FCGA 3T65B 1DVFD 4MQ7A 1Q94A 3DVIA 3ZSTA 3BT2L 2HVKA 5FCUL 4XP5H 3S35X 3ZTNL 4H20L 1F4WL 4HUVA 2VSCA 5HD8C 4MZ3A 3LV3B 32C2B 1KJMA 2NY3D 1PBYA 1Q1JL 1YYML 2OP4H 4FQHA 3PQYE 3BN3B 4O5LL 4XRCA 5C09B 2NX5D 4L29A 2EDKA 1VDGA 3DARA 5E70A 4PRIB 3RWHB 2VDLL 1IZKA 3QDJB 1WZKA 1FC1A 3EOTL 3QFJB 4QGTA 2AGJL 1NKRA 1BQHB 5GRJH 3S9DB 4LARH 2VISB 1RUMH 4JFED 4YDLB 3VXNA 4OAWA 5D2LF 1FZMB 1OTUD 5IV2B 1YC7A 3UP1A 1JWUA 5IGXH 4PIRF 1WICA 4N9OB 4B7LA 5GZND 1EEUA 4LRIC 3U82B 4N0YH 4HPOH 2Z4QB 2NZ9D 4P46B 3ZE0F 5E8EB 1HHIA 4GMSH 1WWWX 2EZ0D 2X10A 5DUMH 5FGCB 4BKLA 4YHYC 3CDYA 3R4DA 4JFPB 2F8XC 1CLYH 2H8PB 4XWGH 2ZUQB 4EDXA 1X5XA 1P6AB 5GGRY 4PJHF 4D0CB 1KCRL 1OPGH 3FT2A 3MJ9A 5J89A 4Z6AT 1NDMA 2WLYA 5LVEA 3WFZA 4LCUA 1JGLH 1H3PH 1F58H 1AD0A 2VLKD 4MS8C 5I8CB 3JVGC 1PKQE 2HFFB 1ED3A 1DEEA 4HIHA 1N64L 2QQQA 4S2SA 1KJVB 3LKQB 2XQYG 5ACZB 1QG3A 5FIEA 4PJBA 1BPVA 2B1HH 2WWKO 4P2RE 3SQOH 5C86A 4HZLA 1FV1B 1FO0A 1IC4L 3VWKC 5KSAB 4GAYA 4LSDA 3MA7B 3E8UL 4YJZL 1S7VB 1CGVA 4YHKL 5HYQB 1IQDB 3R0MA 4P4KC 4F8TA 5IROC 1DEDA 5LGHH 3KJ4C 4GLRH 1SYVA 4I0PA 5HHQA 4IIQB 5HD8D 3FHQA 3GMQA 4UB0L 3V6OA 2CLVA 2UYLA 5MI0C 4GJTB 4NQEA 2ZSVB 5SX4I 2IFFH 5D7LB 4N5EC 4UV7L 4RWYH 2AJ3A 1ZGLP 1F6FB 1I7RB 3WYRA 3V79C 4LCWA 4K7PH 3SJVE 4ZFFA 5HPOA 2V2XA 1U3HC 1RJLB 1KG0B 2CR6A 5F7EH 2X9XA 5I30L 1MI5E 1DBJH 1JHLH 1LQSR 4XMPH 1U3ZA 2R2HB 1AGEA 4MD0B 2GK0A 2IPKA 3A67L 1WWBX 4NUGH 1NKOA 4IRZL 12E8H 4K2UH 5HHMB 4P2OB 5DEZA 1NUDA 3OKOA 4JFDD 2OTWB 3T3ME 3WEXB 3Q3GA 2A77L 2B1AH 3D39A 3I84A 2DQTL 5KAQG 5FM4A 4ZUVA 2BRRL 4OCXL 1ZWIA 5GGVL 1MEXH 1IL1B 1UQSA 2QQLH 4H5SB 3VD7A 1UA6L 2OL3L 5HVHC 1HHJB 1IC5L 1KB5A 4PJCF 5EZIH 3IF1A 1WEJH 1RV6X 5F1NB 4RFEA 4NQSA 1Q0YH 3O3BA 4XCNB 4MS8D 4F7EB 3WE6B 4FQLH 3LPFA 5SWSD 4XVJL 1IFHH 3CZFB 1GGCH 2HA1A 5FDWA 4RBPH 4MB4A 3WNPA 4JDTH 5C2UB 2WINA 1XCQA 2DQJH 2IANB 1SJHA 1BD2D 5E00A 4OZHF 1JHKH 2C7UB 4C55A 3D3VA 1NUFA 2ESVD 5T5FL 4I77L 2VWEE 1LP9E 5BVJB 4U49A 3VWKD 4XGZB 3BI9X 4LAQL 4PGEB 5DQJB 1R0AH 5C08A 3MRQB 4L3CB 3MXWL 4MQXC 1RZIB 3MUHL 4WU7B 3FQTB 4P4KD 5DZOA 3OKNB 4WUUD 1DBML 4TULH 2W91A 3LKNB 3UTSA 3FFCA 2L7UA 1FVDB 1V3JA 1JF1B 1NUNB 4RX4A 1BIIA 4N5ED 4XP1L 1CGXA 1ZHKB 5GSRB 1EFXB 1Z9LA 1KFAH 2OX5A 2DQFA 3DX8B 1F3RB 5DQDL 1J87A 5IMMA 3ZHKA 1U3HD 5KS9F 4BFIA 2BSSB 4WI5A 5EO1B 1ZOXA 4O2CA 4LOUC 2DLIA 3IDJB 4KKLC 3CFBA 2GI7A 4UMGA 1GGBH 3H7LA 2DYPD 5I8OL 2VZSA 3WXWH 1FIGL 2PYFB 4Z7QE 5HYJB 1AHWB 3LKRB 2ICEB 2V5TA 4HMEA 1KNOA 3RNQB 2GTWB 3RBSA 5I1IH 5CKGA 1OY3B 4HK3N 4WW2B 2P47B 2BY3A 3JV5A 5ITFA 1UB5A 4XP9H 4LHUA 1I7TB 1A7NH 1PYWA 2FX7H 4RA3A 2P5EB 3MACL 4I0PC 5MENE 4XCCL 1JMXA 3V6OC 3RWFB 2MPAL 3CSGA 1BBJB 1CL7I 2BCKA 3IFPB 4U6HA 3WO4B 4G7YL 1PVHA 3RKDC 1HHGB 3D48R 1AI1H 3L5WB 4U6VL 3GMOB 3MLTB 1D5XA 5EU5A 2CO6B 1UWGH 3MOQA 1KT2B 4Y4FA 2JB6A 1FC2D 1KBGH 3MRJB 4LVHB 3WFEH 3CX5J 1RU9L 3BDBA 1YEDB 1NAKL 3QZWG 4V1DE 2E7LA 1U2CA 1UKTA 3TJEH 4Q6IB 5J12C 5CAYB 2NX5B 1CZ8H 3HMWH 4HUMB 3WUWB 5FYJE 4MQXD 1N2RB 5FB8B 3EOYG 4JFEB 1KJ3H 1OSPL 5D96C 5CHNA 4ELMA 3CFKA 3V4VH 1JGEB 3IKCB 5D71L 3TO4A 4P2QA 5JQ6H 4KMQA 1EJ6A 1EJOH 1A6UL 4YXHL 2XZQL 5JW3H 5GGTA 5EOQH 1TVBA 5JZ7C 2VQ1B 5F9WB 5TQ0H 3HG1E 3ES6A 2VR4A 2CKBH 3KR3H 4D9QD 4DGIH 3Q6FA 2XTJE 5HDQL 5I76A 2Y36L 4JLRB 3JWDH 2GJZA 2CKBB 5IBTL 1HH9A 3OV6A 4LOUD 4KKLD 4OZGB 3TO2A 3NCEB 4HS6A 2AEWA 3BEVB 3I3BA 4QLRA 2XXMB 5ALCH 5I75C 4KKNA 1BJMA 2VLKB 2JK5B 4MXQC 2UZXB 4N90E 4O02H 1MCQA 2A0LC 2EC9U 3PGCB 4NKIH 5EBMA 5D5MA 4R4FH 5DEGB 1A02N 4MA1B 4I0PD 3FQNA 5M7QA 1MIEL 3F65A 3IT8D 2IQAA 2F54D 3QHFL 1NANH 4MQTB 1IM3B 1UXSB 4OBRA 4NQED 2W0KA 2X70B 3RKDD 3SOBL 2XN9E 2XZCH 5F9JA 4NO3A 5HDBE 4K9EL 5DK3A 4XC3H 4OLVL 4X9HA 4LRNH 3E1F1 2WIMA 4F37K 2FO1A 5F7DA 4KMTL 1A3QA 4LCWD 3S7GA 5DMGC 3WS3A 4I5BA 4JO1H 4JDZB 1IGCH 4DGYH 3GSXB 1KPVB 1GZQB 2FEEL 3DIFB 4GAJL 4U33A 1WBYA 3QCTL 1CD1A 3I2CH 1K4DB 1RUAH 4R90H 5EOCJ 3MRHA 4BQBA 4YHPA 3OB0K 4XNQB 2CDGB 3BKJH 4G8GA 4N0UB 5CINH 5FECB 3MR9B 2YZ8A 3D39D 3OAZH 3OAUL 1IKFH 1VADA 4PYGA 1R3KB 3U2SB 4YHML 3FOMA 4PR5B 1U8LB 3EGSB 4ZFOA 2K1MA 1H8SA 4I4WB 1CF8H 3BZ4B 3EKCA 3ZO0A 4L4TE 4NC0B 5DJAA 5EO9B 4G7VL 3MRDB 4LEXL 3VI4F 5KSBE 4ZQKB 5T1LD 5JZ7D 4NQVB 3QISA 3P4OA 4PS4H 5EH1A 4JFDB 1QRND 2RCSL 5K33A 2QLVB 4X4YB 1A7PH 1ACZA 4K3HA 4YHYB 1I4FB 4RGNC 4XCFH 4Y4FC 1CFSB 4NO5B 4LMQE 1NMBL 3C5ZA 5L9DL 1NPUA 3L1OH 1B2WH 4PJXE 3BOVA 1PX4A 1C7SA 2E7LC 3CMGA 1QKZH 3D3VD 4ZUSB 4JN1H 1RIHH 4DKEH 3VA2C 2HT2C 4KH2A 4KDVA 4MXQD 4XPTL 4ISVB 3KPSE 1DL7L 1OSZA 2A0LD 1J0KA 5M95B 1MHCA 4HKJB 5CJ8A 3LKPA 3DRTA 3U6RA 4P5TA 4ZPVB 4ZUUA 3TO4C 4ODWB 1BD2B 3TCXA 1M05B 3HZMB 3K4AA 3FFCD 1PZ5A 1JCKA 2ESVB 4NKOB 4RX4D 3VWKB 1EHNA 3C8KA 1QLEL 1T5XB 4EXKA 3EBAA 3RTQA 5CJXA 2W60B 1AO7A 3BIKA 4H1LH 3U79A 4P4KB 3NACL 1CDYA 5DMGD 3KJ4B 1JYXA 4WUUB 2X41A 1J1PH 1NGWB 3HMXA 4BZ2H 2B0SL 4H1LB 2VXVH 1Q9KA 4NKMB 4WEBL 4TVPL 5MI0B 4KKBC 1HE7A 4S1SL 2HYMA 3OR7A 4UINL 4QHNB 3SDXB 2G5BA 1QBAA 1U8MA 1QR1B 1LEIA 1U3HB 4YDVB 2CLZB 4ODTH 4LHUD 4XI5C 1CE1H 4UT9L 5DI8B 43CAB 4HUNB 4MAYA 3MNZB 1EO7A 3QEQA 3RWCA 5I71C 5C0GB 4K7PY 3TA3B 3WIFB 2MJWA 1FFPA 5EWIL 1AXSB 2OSLA 2VZ1A 2Y5EA 2DYPB 3UMTA 5I1LB 4CJ0A 3JZ7A 1ZANH 3QIUB 3IDNB 2OXHA 3PDGA 4MQ7B 1Q94B 2ZNWA 1OAQL 4RGND 3MQIA 2HVKB 1TJIH 1QUNA 4HT1H 5H8DA 4HUVB 1HOCA 3PE9A 3PWLA 1NCCH 1IBGH 5HVHB 1C5BL 4JPVH 2XA8L 3NABH 1KJMB 1YQVH 3ISWA 1YMME 4FQHB 3D5OF 5IMOA 3WXVH 4EOWH 1GGIH 2IFGA 4XRCB 3BD4A 4L29B 2OS7A 1V7NL 2UWEE 2HT2D 5DFWH 1EGJA 1J18A 4IDJL 1R3JA 4MNQA 4NZUL 1J5OL 2JE8A 3VXNB 4OAWB 3V4UH 1JWUB 3TO4D 2VH5H 5MEOA 4GKZA 4N8PA 4M02A 3O11A 1SBBA 4PRAA 5E95B 2ZG2A 3ZE2E 3BAEL 4WHDA 3L5XH 5D2NE 2VDRH 1HHIB 1SM3H 2QHLA 1YEFH 1B0WA 4GKSA 1TIUA 4BKLB 2WQ8A 4ONGL 2CJUL 3MJ9H 5K9KA 4PJDE 5B38A 1UJ3C 3RDTC 2XQYK 3C5ZC 4YHNA 4EDXB 4B53A 1B0RA 1F42A 3DECA 3FT2B 4KKBD 5E2TH 1NDMB 2F58L 1S7XA 4LCUB 4D0BA 5IP4A 1AD0B 5IM7A 5LGJA 1ED3B 4FFZH 1DEEB 4HIHB 1GHFH 1F90H 5GS1C 1I9RL 2IG2L 5DHYA 2VLJA 4XI5D 4S2SB 1YEIH 1FO0H 2JJTA 4I18A 4P5TC 4PJBB 3N1FC 1UM4L 3CLFL 4CBPA 3PABA 4HZLB 4NWUL 1FO0B 2HRPH 4XAKE 1VACA 4GAYB 2GIYA 5FOJA 2OYPA 3MNVA 2IBBA 2O5YH 3MRNA 3CFCH 3TPKA 3RTQC 1HDMA 5CJXC 4L5FH 5F96L 2QSCH 1SYVB 2EEAA 4I0PB 5HHQB 5LWYL 2B8OT 3PHQA 3GMQB 5C6TH 5DYOA 2CLVB 1A7RL 2UYLB 1WUNT 2L0DA 1F11A 1FL5A 3O6MH 4NQEB 4XPHH 1W0VA 3W11C 2VXTH 1OL0A 3MRIA 1EX0A 2AJ3B 3MLZL 3R0NA 2D7PA 4LCWB 5HGHA 4ZFFB 2V2XB 4AMKL 3FQWA 5IVXA 4MAYC 2FX9L 2F5BL 4GXUM 4XP6L 5E2UL 3EDEA 1AGEB 1KTKE 1P53A 2GK0B 3U30C 1H0DA 2IPKB 1OCWH 3VGEA 1ONQA 2GJ6E 4M7KH 5J12B 2EC9T 5E4IA 4CVZA 1CQYA 2C3GA 3OKOB 3F7VA 3L3IA 1YY8A 3Q3GB 3FTGA 3K8KA 3ET9F 2YD6A 1WTGT 3D39B 4U1LA 4MDIA 2NY4C 3PJSA 1LO0L 1U6AL 4AENA 4ZUVB 4X9GA 5D96B 1ZWIB 3QUYA 1KB5H 4GAGH 3ZLQC 3FZUC 1P69B 5GS0L 2AJYL 3RDTD 3HI6H 1UQSB<