5DMKA

Crystal structure of iag7 in complex with rlgl-we14
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
171
structure length
171
Chain Sequence
b'IEADHVGFYGTTVYQSPGDIGQYTHEFDGDELFYVDLDKKKTVWRLPEFGQLILFEPQGGLQNIAAEKHNLGILTKRSNFTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFLVNRDHSFHKLSYLTFIPSDDDIYDCKVEHWGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, A-D alpha chain
publication title N-terminal additions to the WE14 peptide of chromogranin A create strong autoantigen agonists in type 1 diabetes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 33
structure length 171
sequence length 171
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmkA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5dmkA01
4BK5A 1FIGL 1H15A 4XPAL 4UDUA 1TVHB 1G7QA 1G7HA 3MCG1 4O4YL 2Z92A 5JXAL 1BLNA 4JM4L 4J3OC 1MCIA 2K7PA 5CZVH 1JYXA 2WLZA 3HNSH 1MCFA 3MBXL 3RDTB 5TGBA 3GMNB 3N1PC 2F8VA 1JFQH 1S7QA 4L8DB 5HYIA 3DX6B 1X4ZA 4WFFE 2DLTA 2LABA 1UKQA 3C9NA 2NY1D 5EU6E 4K3GA 5C07D 1XF4A 5HGBA 1QBBA 5JOPD 2IAMC 3O4LD 2XA8L 2O5ZH 2B1AH 3BH9A 3E6HA 1O7SA 2FHBA 5I1GL 4G6JH 5E99H 1C5CH 3KPOA 1J0KA 1YEFH 3G5ZB 5EUOF 1FFRA 3OJDA 4NQCA 5JDSA 1GGBL 3WFEL 2HRLA 2CUMA 4EDWL 3BIAX 4OZGA 3RWHB 4JRXE 1KCSL 1DR9A 4OF7A 5TDNA 1LP9A 2HJLA 1F42A 4X6EB 2QR0A 4U1SA 2HN7A 3SGJC 3VFTB 4LVNC 4BFGA 4MDIA 2XN9B 5BV7B 4ZXBC 3KYNB 2M1KA 2EZ0D 4WW2C 3TFKC 4L5FL 5FYLH 3MOQA 3E1F1 1B9ZA 4KKBD 3MLXL 1IGFH 3BZFB 1CK0H 1BAFL 1C7SA 1WTLA 1NEZG 3WMSA 3ZT7A 4Z8FH 3NIGE 5DD1H 1F11B 4M7JH 5LGHH 4Y1AA 3DMMC 2O61B 4PPTA 4A2LA 1MH5A 5FF6B 4POYA 4GBXC 1KJMA 4BZ2H 1RV6X 4NSKA 5CSZA 4QGYA 1LDPH 5FYLD 4K3JH 3ZE1F 1L7IH 3PGFL 1HHGA 3RU8H 4P5TA 3FO1B 4D0CA 2Q7YB 4PB9L 5DMIH 1DFBH 4NKOB 3LD8B 1I1AD 3O3DB 2DQTL 2VXTL 3Q5YA 3OV6A 3ARPA 3HUJA 4LPYA 4AZ8A 1S7XB 1T21B 3P0YH 1HYSC 3KHOA 3WIFB 2LVCA 1R5VB 1EAPA 3EYSH 3IJSB 4DGYL 5HYJE 4HH9A 3S7GA 3DRTB 4HCRA 5F1NB 4I2XA 3QUZA 1PG7W 3H3KA 3TH3T 4UQ3A 4NQDA 3FQWB 3MRKA 4HC1H 4BZYA 2A1WH 4P4KB 3VXNA 2H32H 5T1LD 1RZKC 4J8RA 3VJ6A 5DVKA 1RZFL 4LCWD 3ZLQC 5HHMB 4PJEE 1Q9WA 4JY5H 4O5LL 1FNHA 3U7YL 1FNGA 2IH1A 2NZ9C 5IBLD 1OP3K 3AXLB 4G6KL 1AR1C 3MRGB 1ZWIA 4J4PA 3FRPA 3IFPB 5MEQA 4DFIA 2VIRA 1A14L 2AJ3B 1G7LA 1GGYA 1GHFH 5DJAA 4HIXH 1FVDB 5IQ7H 1M71A 2AEPH 3W0WA 2RQ8A 4UINL 4C59B 3B5TA 4PJ9C 3J7HA 4NN7B 4NNYA 4CADB 3ZE2F 1RUAL 4GW5B 3HE7D 5KJRL 2R56H 3S3JA 4HK3N 2R9HD 3LH2H 4KTEL 2CRMA 4YFLI 2Y6SC 2FWOA 1S3KL 4QHLA 3T0XA 2OZ4A 2YZ1A 4FQLL 4O2FA 5DQDH 3EGSB 4U1IA 4AYFA 4E42A 4ZOCA 4JY6A 4HUXA 1V5JA 4LSRL 3BQUD 1D3CA 5DEFB 1Q72L 4RWHA 1OWWA 1G7IA 4D9LH 4N0UE 4X4ZA 5CKAA 4BKLA 1NCUA 2VH5L 1S5IL 1I7ZA 3QCUH 2HT2D 4GAGH 4NRXA 1DVFA 1HHJA 3QWRD 4PRNA 3PHOA 4PREB 5GS2D 3T4YB 4UTBL 1JPSH 1EX0A 2AK1L 4I9WE 1RJZA 3PWUB 5DRXB 3STZB 3ARGC 4QNPF 4G5ZH 4MXVE 5I8KH 1HCFX 4R90L 2WIMA 2AK4B 3F7QA 2L4OA 2IANE 5GXBB 3HCVA 5I1AB 3ZT6A 4ODUA 8FABA 2YKLH 1EUUA 1V3MA 3C5JA 2DD8L 2DQJH 4UIKH 2KDGA 3QIWA 3BZ4A 3MV8E 5EU7C 3K4AA 1JNLH 5SWSE 1H8OA 4XCCH 1NCAH 2OCFD 4NYLB 3LHPH 3NIDE 3JV4B 1U8MB 3PWLB 4JG1L 3UX9B 3MLSH 3RWCB 3UP1A 3IXTB 5HVHC 3MJ9H 5GS1A 3RWFB 2V17H 3MCLL 4Y2DA 1IC4L 2DIJA 1F2XK 4XVJH 4RMRA 1K2DA 3W2DL 3GSWA 3MR9B 3RY6A 4WEMB 4OZFA 4HV8A 3FQXA 1T7YA 2BSRA 3QXUA 5I1CL 4MJ6B 1XF3B 3QNZA 5EO0B 2IAMD 2X4OA 4NFBA 5EOTB 1WIPA 5JMOC 4M00A 2YRZA 1MHPH 2FSEB 2UWEB 4RAUA 5J6GB 3HG1E 4I8DA 3B9VA 2V7NB 4UV4L 4S0SD 5HHQA 4S0TD 2X7LB 3VFGL 3DUHA 3WFHA 4N0CC 2OTPA 1GRWA 2PYEE 5FEBA 5ICXB 5SWZE 5ALCH 2DLIA 3JUZA 1MUJB 1AJ7H 1XZ0B 4PG2C 2NXYC 1SYVB 1WAAA 4M4PA 2HMIC 5FIEA 3K0WA 4D3CL 1T22B 3L3JB 1HHIB 2Y72A 4MA7L 2VXUL 4ZXBD 3TFKD 4HMEA 4I3SH 2BXZA 4EI5A 4G80A 4XNMB 3ZE0E 2BHYA 4QKXB 5DJXB 4P5MB 2W9EH 2A9NL 3JWOC 4L3CA 5GSRA 5KSBA 5MHSE 2GW5A 1Z5LA 3OKOB 3OR6A 5ESQB 3X13B 4KJYA 3CFJA 1IGMH 5FYJL 2DTMH 3BE1H 4RGNE 2IADB 4P2QA 4GBXD 4P9MH 2FEDC 5ICYA 2ESVB 4DN3L 2OP4H 1UWXK 2BJML 4XP5L 2Z8RA 1HINL 4ZTPL 1J10A 3F5WB 1DCLA 5ESVA 5C0DA 3WL9B 1T5XB 3V8CA 4R7NB 3CFKA 4KJWC 1HQ4A 5BO1L 4ZQKB 2X41A 4HXAL 4UT9H 5I8CA 2RCSL 3S4SA 5I8OL 1RZKH 5SX4H 4BUHA 4GW4B 2OL3L 5H94B 3GJFK 5FV1L 3ARWA 4WFFD 4TTGA 3MYJA 2V2TB 5EBMA 5EU6D 1I1FA 4Q2ZA 2IPKB 5E8PB 5ANMA 2AP2A 4M8QA 1MJJB 4Y4HB 2WQ8A 5IKCB 5F8QC 4XP9H 2XQBL 5EPMB 2PR4L 3AAZA 4WENB 1MY7A 3BN9C 3O11B 5C2BH 3AMKA 2GFBA 3U2SA 3MROA 5J6HB 2JLLA 3ARDA 1F13A 3ABZA 4EQ3A 3TYGL 3K81A 2JIXB 4JRXD 2ZCHL 2NZ9D 4V2CB 1AR1D 4MWFA 4P46B 1FZOA 2P42B 1QPPA 1YEHL 2Z9TA 5HYEA 4LLDB 2CO7B 5DC0A 1NMBL 1TVBA 3QIUB 3TBSA 4FQ2L 1QSEE 4M48H 1JNNL 4PJ9D 3VMNA 4XCNB 5CJ5A 2RAMA 1JGUL 3QZWB 3U6RB 3H9HA 1TZIB 4C56A 1AGBA 4WNQA 1MI5E 4UQ2B 1KIRA 1FZMA 4RGNC 2VDPL 5F70A 3L3HA 1MLBA 1AY1L 1W2KT 1FPTH 3QUML 4HGMA 4Y19A 8CGTA 3LKQB 4XCEB 4MQTB 5HI5C 1MAKA 2OSLB 2GQHA 3C2SA 5KSVA 2P1YA 5L88H 3MODH 4G42B 2R2EB 1P7QD 1AQKL 2Q8BL 3CU7A 4K3EH 5HD8C 3EYQC 3RWDA 5IB4A 3FFCA 4GLRH 1H5BC 5DHVH 3KDMA 1Y18A 1U8OA 2FX9L 4QRTA 2X9WA 2OQJB 5BXFB 4DJMA 2A77H 5HDOA 1LD9A 4FQQB 1GAFH 2PCPB 5HYJD 2F8XC 4KHTH 1OGTB 4HGKC 3V5HB 3CFBB 5F7HA 1AGFB 3M8OL 1CFTA 1IAIH 3ARGD 1Q1JH 3RKPA 2DBLL 1HQRA 4OCXH 3BRGC 3QDJA 1T1YB 1BF8A 2XQYG 4L1DA 1PYWA 5HDBE 3CLFH 1N64H 3HC0A 4OIAA 1C08B 5JLZB 4JM2F 1N5YL 1OGAB 3HR5B 1CGXA 5D8JH 1DQTA 2VDML 3DXAB 4Z7WB 2J8UA 5C08E 4E0RA 5J11C 4I0PC 3RIFF 4OT1L 2G75A 3B8YA 4YFDB 4UIMA 3HTLX 3RAJH 1S7RA 1WTGT 3EJJX 2DQCL 1BQHG 2DF3A 1H15B 5I16A 1MCLA 3TIEA 3O4LA 3GB7B 1G7QB 4Q6IB 1G7HB 2D0GA 4JRWA 4X6CF 5AYUL 1E28A 2Z92B 3QQ9C 2KBGA 1NCBH 1BLNB 1JGLL 3GBLA 1IEBA 5TGBB 3DVIA 3HNVH 4NNXA 1S7QB 1YDPA 5C0EB 3UPCA 1OAYL 2D03L 1HNFA 2D31A 4KU1A 1GZPB 3SKJH 3AB0C 4N0CD 3C9NB 4PJHA 1XF4B 3S3SA 1H3PL 4MLIA 5HGBB 4ODWA 4P0DA 3JWOH 5H37G 3QEGH 3BH9B 1OCWH 1KT2A 5E6IC 2FIRT 4MNGB 3KPQA 4ZFOL 2HMID 4M1GL 5I15L 3EFDL 2O5XH 2EDTA 4AL8H 1RQ5A 4NQCB 5JDSB 3WV0A 3SY0A 1N59A 2GY7B 4KUCD 4I9WD 4OZGB 5A2JH 5IB5A 2I25N 3Q6FB 1MJ8L 5TDNB 1LP9B 2HJLB 1NEUA 2QR0B 3TBVA 2XKUA 4U1SB 1KCKA 2HN7B 2IAND 3KYAA 4DZ8B 2BOBA 2WIIA 3SBWA 3LEYH 3QHZL 4HXBL 3G08A 1FNLA 3QP3A 3P73A 4M7KL 2XZQH 4QWWC 4F9PA 4TPRH 5KANI 2FEDD 5DC4B 5FHBH 3QA3B 3FB5B 3TBYA 4DVBA 1EV2E 3MV8D 4J3UA 5SWSD 1GGCH 4HUUA 4JKPH 1EXUB 1MH5B 2HJKA 4KJWD 1KJMB 4Y8AA 5CSZB 4CU7A 2QADC 1D6EB 5D7LE 4JHWH 4R0LA 1HHGB 4P5TB 3HE6B 4D0CB 1QSZA 3QI9C 1RZIA 3DURA 3C8KA 3NCYS 1S8DA 5FUCC 3PIQA 4U0RB 1DJSA 4MJ4A 2YS4A 4NN6B 2AJVL 3GJFB 3L3GA 5T1LA 5TE6H 2W1NA 4U1JA 1VERA 3L3IA 1J0IA 1MIML 4NHCH 3BDYL 1T3FA 3HG1D 3H3PL 2I5YL 3QH3B 3BN9D 4LCWA 4JKWA 3Q5TA 1EAPB 3LEVH 3T2QA 3JZ7A 1UA6H 5KG9A 4HT1H 2R4RL 2CUIA 4I2XB 3IXAB 2W65B 2PYED 3NTCL 1J1PH 4UQ3B 5SWZD 1SM3L 2Y5TB 2H32A 1RZGA 5ADPH 3GSXA 3IFLH 4J8RB 4QOKE 3VJ6B 1FG9C 1G1CA 2DYPA 2AS5M 1TZHB 1E4XI 3WN5A 1KN4L 1Q9WB 4NUJA 2E27H 2A73A 3VFVB 1NPUA 4WI3A 3HE7A 2IH1B 1B4JH 4LLYA 1LO2L 2BDNH 4UV7L 4JB9H 2Y25A 3IS1X 1ZWIB 5LJYH 5MHSD 2Y1VA 5FOJA 5FOBA 1CCZA 5INDA 1P69B 3WYRA 2GK2A 2VIRB 1JI2A 3QCTH 4KVNL 3INUL 4TVSa 1B0RA 2H8PB 4WWKC 5DJAB 1G6RL 4FZEH 4RGND 1CD8A 1SVCP 4MZ3A 5JOEA 1UACH 5INCA 3QG6A 3CX5K 3VCLA 2QKIB 4NNYB 1AGEA 5CCKH 3BQUA 5HI5D 2H6PA 4JPVH 5DF0A 2MKLC 4DTGH 2XXCB 3H42H 1T0NA 1T6WA 1NKOA 2X4UB 2X42A 3QRGL 2G2RB 1PVHA 5HD8D 4KGLA 5SX5H 5GRZA 1CXHA 1WZ1H 4QHLB 1KF9B 2BY3A 2Y36H 4O2FB 5CGYC 4RFOL 1ORSA 4E42B 4K7PY 1IRAY 3MTRA 4JY6B 2Z8VC 4HUXB 1P1ZA 1Z6JT 1ZT4A 4WI7A 1HHKA 4G7YL 3BISA 5DRNA 3BKYL 1G7IB 2RJMA 4NIKB 2PUQT 4GJTB 1S7UA 3BRFA 4F2MB 2CKBL 1I7ZB 5F9WB 4NRXB 5A2IH 2YWZA 1DVFB 4JDTL 4ZUWA 3CFIC 4JEGB 3BP7A 1ZGLP 3RA7H 1TXKA 1RJZB 5JNYA 2PO6C 5J9PA 2PETA 3GSNA 5T5FL 2Q7NA 2HRPH 3HCVB 4I0PD 1D5MA 2C1OA 1CDBA 2V2XA 3D0VA 1FGVH 3NFPA 4ODUB 8FABB 1TENA 4PBXA 1MCPH 1H3UA 5TE7L 1MFEH 1UJ3B 1HILA 4FABH 1G9NL 4MA3A 1F4YH 1QSED 1A5FH 3C5JB 1WCBA 3D3VE 1NANH 1OAUH 4LLQA 2ITDB 1IGTA 1AXIB 3GO1L 3GI8H 2IAMA 2K3TA 2APFA 4L9LB 2CK0H 4S1RH 1I1CA 5CUSH 4KI5F 2HTLD 4JPWL 5IV2A 3QQ9D 5D1XC 1MI5D 3MJ9A 3I6KA 1KELH 2ADIA 5CFHA 5KW9H 3U30B 4O02H 2CLZA 4KQ4H 2ARWA 1K6QL 2PXYC 1NFDE 4Y2DB 3VXME 5HYSG 1K2DB 2ERJB 4ZS7L 5IMLA 2IG2H 5E70A 4HV8B 3FQXB 2F53E 1FFNB 3QNZB 5DSCA 2W38A 15C8H 3SGJA 1A6VH 2X4OB 2CRYA 3RUGF 3HRZA 5EOQL 5E6ID 2F5AH 4RAUB 3VFPA 5HHQB 3RI5K 1FSKC 4ZXBA 1XGQA 1HH6A 4WW2A 2FLBT 2BSTA 3UROR 3V4VL 4GMSL 3CX5J 1PEWA 2C7UB 3BXNA 3TVMC 5JIPA 5BZDA 5DURD 4OF6A 4JHBA 2B4CH 4NN5C 2R8SL 4DVRH 3QCVH 4TULH 2MKWA 4ZFGL 4XPGL 1I1RA 1FAIH 3QZWG 3DMMA 3EOYG 5KVGL 3E2HB 3SQOL 2ADFL 4GBXA 3UBXA 1F45A 2KUTA 2YRPA 3FJTA 4NJ9H 5I19H 1G9MC 1VFBA 5FUOL 1C5DA 4LCCB 3V0AC 4JREB 2ZPKH 3U48A 4U3CA 3ALWA 3BX7C 4L3CB 5GSRB 5C08D 4BH8A 5KSBB 4K71C 3GMLB 1ZLVH 3PG2A 1T66C 4KJYB 43CAB 5J0BA 1MCHA 4P2QB 1XFPA 4KQ3L 4WHYG 5ICYB 1M7DB 2XZCL 2W0PA 5CD3B 3CFCL 3FN0H 3U0PA 3LN9A 4XH2A 5EU6A 5ESVB 3LZFH 5C0DB 4H0IA 3QI9D 3AREC 5IFHL 1YC8A 3CFKB 4NNPH 5F96L 3K1DA 3QR2A 3H0TA 4PY7B 4NUGL 5I8CB 1O0VA 5JTWA 1U95A 3B2UD 3G5XB 5H2BA 5I74C 3VWKB 2BMKA 1DDHA 3GSUB 5EU5A 1RMFH 4JRXA 4QHNA 3L6FB 3MYJB 3MZTA 4DKFH 2ATKA 5EBMB 3LOWA 1I1FB 4Q2ZB 4BQ8A 4NFCA 5ANMB 4GT7A 4M8QB 1DBML 4OFDA 4GXUN 2EH8L 1I3RB 3AAZB 4PGBA 3U2SB 1VKXB 3PWPE 4GKSA 4PJ9A 4WEUD 1BVZA 2FBJL 3GHBL 3H9YA 5IESH 3GSVA 3VFSA 2L7UA 4HWNA 1A1NB 3HC4H 1TETL 5JIKA 1BECA 4S1QL 3O2VL 1F4WH 3O3BA 4MWFB 5LG1A 4JVWA 4R4FH 3DBXA 5F88A 5TJWK 4WWKD 4XC1L 1TVBB 3TBSB 2CMRL 1UM4H 4Q6YA 1B0WA 5L0QC 3ECBA 5EU3A 2H41A 1J0HA 3O8XC 1HIMH 1INEH 1P7QA 2MJWA 3H9HB 1MPAH 3MBEC 1VA9A 4C56B 3R1GL 4WNQB 1FZMB 1J0YA 2W0FA 3L3HB 5KTEL 4NP4H 2VDRL 1RIUL 5BS0E 4AENA 5D7LD 5HYJA 3C2AH 4YXKH 4U7MA 3K7UA 5KSVB 5CGYD 4PR5A 3ARGA 4HBCL 4JFFE 1YY9C 3NA9H 3IFOA 2B1HL 3EYUH 3GK8L 4NM4L 3BO8B 3Q0HA 3C08H 3RWDB 1ZVHA 5DHVA 3UZEA 5E8DL 1TQBC 2NY2B 3FFCB 1WFNA 5FV2A 3KDMB 3QUYC 1Y18B 1U8OB 4QRTB 2A9ML 1AI1H 4NJAH 1PZUB 1N4XH 4PJEA 4UT7L 1DBBH 5IQ9A 1KJ2H 5B39A 1TTUA 1LD9B 1GPOL 4JO3H 3GHEL 4KK9C 2PO6D 4Q0XL 1UGNA 1CFTB 1WJ3A 4ODHL 5LQBH 3QDJB 1AFVH 1WIOA 2CXKA 3CGTA 3QO0A 3L7FA 3HC0B 4KZDH 1CGVA 2WINB 4QRPE 5E0QA 1QACA 2CRZA 4QOKD 4X5XA 3OKMA 4P49A 5DLML 5C0IA 1T4KB 1JNHA 1QBMH 4S1SH 2J8UB 5DI8A 4BH7A 4E0RB 2VLRE 4DAGL 4MVBC 2VZSA 4X9IA 1S7RB 4QT5B 3VXUE 4JVPA 5D1XD 2WBWB 4KMTL 1JYWA 2EIDA 1CQYA 5I9QC 2PXYD 2NMSA 4XC3L 2NY1B 1CF8L 5C07B 3RHWF 3O4LB 3LVEA 1RUQH 2HKFL 3EW3B 3ARRA 4GQPH 2CJUH 2EE6A 3RZCC 3B9AA 1E28B 1QNZH 1T03L 4PG2A 4N0UA 5FYKE 4HUMB 5TF0A 5CP3H 4GRWF 2RB8A 1T1ZB 4LAJH 1JWSA 1UCBL 1IEBB 5KZCB 3GMQA 2BRRH 3V4PH 1G9MH 1NGXA 5AZEH 3JWDL 3CK0H 1RULL 4G8GE 5E2WH 3CCHA 4YC2C 1I3GL 4X7FC 4PJHB 4Z18A 3TVMD 4DGVL 1NFIA 4NO0D 4ODWB 1FLRL 5J3HC 1MJ7H 4WFGE 1KT2B 2NY0C 3W82A 3KPQB 4HDIA 4KHXL 4C83B 3Q2CA 3BMWA 1DLFL 4H88H 4OM1L 1KTDA 3QDME 4HPOL 3UCRA 1P84K 4WHDA 4K23L 3PV7A 3AS3A 5D71H 3BPNB 2MCPH 1FAKT 3DV6B 5IB5B 4JKMA 2NY4C 3RGVC 2J1KA 3ULVC 3OKKA 1T66D 3G08B 1N6VA 4U3HA 3LKRB 3D9AL 3EHBC 4PJIE 2BCKA 5EN2A 1MCDA 2GITA 3R0NA 3FFDB 1IGYB 1F8TL 3D3VD 1NBZA 4GO6B 1I1AB 3TBYB 4DVBB 3ISWA 3A6CH 2BNQA 3OAZH 3ARED 4R97B 4HUUB 5KBNC 2HJKB 1G9EA 3HG1A 1S5HA 4WCYL 3KPLA 5EZJB 1OLZA 3D0LB 1I7RA 5D72H 1J0ZA 3I2CL 2CDEA 4ZPVB 3WUWB 4JY4A 4O00A 4LP5A 3VXMD 2PYEA 3CAFA 1RZIB 3DURB 3C8KB 2ZOLA 1U0QA 3PIQB 1XGRA 5HDLA 5MI0B 1BOGB 3L3GB 4RA3A 2F53D 5T1LB 2FRGP 4Z9KB 5GRXG 3MV9E 3MUGA 3L3IB 3BMVA 3L1OL 2IBBA 1T3FB 1KPRB 1M6OA 2QQKL 4LCWB 1UWGL 3BYTA 5C0ND 1FN4A 4NBYB 1NSNL 5KG9B 4ODXA 4LRNL 1J87A 1J8HE 2EDLA 5L2KB 3FMGH 2APVA 4U6VL 1G7PA 1LHZA 4QHUB 5K93A 1HNGA 4APQC 4JVUA 4X5WA 3MLWH 1A9BA 2FLRT 1U3ZA 2OZ4L 5EFIA 1RU9L 1IAKA 1RZGB 32C2A 1LO0H 3WKMH 4N0FA 4M7ZB 2C3VB 1BVKB 1UQSA 1T2QH 2P5WE 1CLOH 2OMNA 1YJDL 4NUJB 3GIZL 1A7OH 2A73B 2VN4A 1DBAL 3K8LA 1KEGH 5I75B 3HMWL 3O8XD 4LVHB 1RURH 2P24A 3MBED 5FOBB 4BSVB 1N5AA 2G5BA 1B0RB 4XBPA 1H5BA 4HG4K 3CUPA 3P9WB 2KZ1B 3VWJD 5B3JE 3T0EE 4YDLC 5INCB 3V0WL 3QG6B 1P84J 1TJIL 1YECH 3VCLB 4MYWB 1AGEB 3HI1A 3W9DA 3BQUB 3QAZC 5BQ7B 3B2VL 2ORBH 2H6PB 2ZJSH 1K4CB 5EA0H 1YY9D 3NCFB 1KC5L 4WU5A 1FFQA 4MNHA 5F6HJ 3CH1B 2R1WA 5EBWA 1VFAA 1H8SA 1I9RH 4PV9A 5EWIL 4AIOA 3MOAH 4PJBF 1A7RH 3QUYD 4PRDA 1RZJH 1DEEB 2CD0A 1CLZH 1EO8L 1ORSB 2LE9A 3WIIL 1MWAA 1P1ZB 1A8JH 1ZT4B 4LVOC 4PRIE 3DPBA 1AE6L 5DRNB 1FO0H 4I0PA 3JV0A 2IFFH 1XR8B 3X3FL 2J5LB 3IAPA 4NO2A 1ZT1B 2FX7H 1QSEA 3OKNB 3OAUH 4ZUWB 4P2CG 3PWPD 3BP7B 3HB3C 1KJVB 1TZGH 4QXGL 4GRLC 4BQCA 3ZTJH 5DK3A 5J9PB 2V9QA 4GAYB 2XZAL 4KZEH 3GSNB 1D6VH 4XVTL 2ADGA 1EFXD 2DMKA 1TDQA 1BEYL 1MI5A 4YWGL 4OFIA 2C1OB 2V2XB 3D0VB 3NFPB 2DOCA 1KBGH 4XWGH 1URLA 4E9LA 2C9AA 1KPVA 5EO9B 3O6LH 1HILB 4HS6A 5L8LB 4O2EA 5MEOB 1YEIH 3V6FA 1WCBB 3DYOA 2HT4C 4LLQB 1IGTB 3F6IA 4U6YB 3UTSE 4QF1B 1IQWH 3ESUF 4YGVA 4GMTL 1AXTL 2FL5B 3RZCD 5E6IA 5IV2B 3C6LB 3UXFA 3I6KB 2YK1L 1BX2A 2CLZB 2EDQA 4IM8A 4N8VG 3T0EC 3VXTB 5BS0D 3ZDYE 5F7FA 5C2UB 5IMLB 4AMKL 3KPTA 4LLVA 3S35H 2I26N 4ODTH 4JHZA 3NOIA 4TSAH 5D6CA 4JFFD 2C5DC 1RHHB 2R1XA 3KPRE 3BVNA 5DSCB 2QQLH 5J3HD 3SDDC 1CVSC 4XAKE 1MCNA 3ULVH 1UB5A 2NY0D 1W0VA 3L5JA 3RL1A 1ZLUH 1FV1B 3MO1A 4ZXBB 3VFRA 2BNRE 1Q8MA 1HH6B 3DHMA 3IDIA 4FQ1H 4H1LG 4TOYL 4EN3D 3CXHK 3KYKH 4HG4J 2NX5B 4NQVA 3CDGA 3BXNB 5E9DE 5C08A 4CMMB 4ZPTB 3FZUC 2N4IA 5I71C 1JPTL 2V2WA 2ZUQB 2NY4D 5AZ2L 1UENA 1SEBA 2B0SL 2EH7L 2B5IC 3UBXB 5A16A 1NMCB 4QRPD 1MCJA 5CSBA 4JZNA 4HZLB 3WSQL 3QI9A 3L5WA 3MLVL 4BH8B 2VLRD 5I2IB 3IETA 2DQIL 2NW2A 5FYKH 3QRFM 1U91B 3VXUD 4MB4A 3IVKA 5KVDH 3OSKA 2C3HA 2DLFL 4C55A 5I1IH 4OLYL 3U0PB 4XH2B 5EU6B 3LCYA 2H1PH 4UB0L 1IQDA 2J6EH 4N5UA 4ZUTB 5LVEA 3ARYA 3BFOA 5DD0H 1X5LA 3QXTA 2E3VA 4OLXH 5FYKD 1ZTXH 4XNYL 5FXCH 1BOYA 1U95B 1PSKL 4QHKJ 2EDOA 2Z0BA 2BMKB 1DDHB 1YEKH 4YK4C 3G5VA 3SJVE 4JRXB 4QHNB 2IGFL 4G8GD 4MSWA 4MA1C 4JFHE 2CIIB 1N0LA 4LSSL 3JTTA 4UTAH 4XMKH 1WF5A 3EOTH 1L9MA 4WFGD 4AH2B 3LKOA 1S7TA 3DWTA 5L2JB 3QO1B 4WWKA 2NY7H 2ZKHH 2R0WH 4X80H 4PGBB 4Y5XC 1S9XA 4GKSB 4PJ9B 5LWYH 1OWRM 3QDMD 4OD3L 5IG7B 1DP0A 4K9EL 2XNAA 3OKDA 5ICZA 2XZZA 1C5BL 3GSVB 4HUKB 5TFSL 2OR7A 3BESR 2R39A 4UBDD 3MRLA 3O3BB 3CXDH 4XNZB 1EHLL 3CSGA 3DBXB 3U9PL 5F88B 1ZS8B 4B41A 4JRYE 3VXPA 4UDTB 4JFDE 3QXAB 5D7LA 3AC0A 3QFDA 1Z0MA 2CGRL 4JFXA 5B38G 2VR4A 3KGRA 4LGSB 3A6BH 3CXHJ 1CD1A 1KENL 5EU3B 2R2BB 4QHMB 4Z7NF 4Z7VE 2IFGA 4DUVA 1P7QB 2MQ3A 2OMBA 1PX4A 1A6ZA 1IGIL 4Y8DC 4H8WC 3IF1A 5IM7B 4M61A 4YBLB 3HZKB 4I77L 1IMHC 1CL7L 3VI4E 3IJHA 2IF7A 5GIRA 4XMPL 3T08A 3IFNL 5D7SH 5HYJB 1HI6A 4NO5A 4YX2L 4XCFL 5DZNA 1WBZA 1YNKL 1MHHA 1MCWW 2PO6A 5SX5K 4C54A 4DK6A 1RVFH 5TQ0H 4DKAA 4PR5B 3ARGB 2GT9B 4PGCA 4CMHC 2HFTA 1DE4A 1E4XH 5LCVL 2VZTA 1MCWM 2R29L 3MV9D 2D7NA 4QOKA 3GRWH 4X9FA 5HDQH 1XCQA 1KJ2A 1A2YB 4EIZC 4M5YH 5AG9A 4PJEB 5B39B 4ERSH 5CZVL 1QFUL 4WTZG 3HB3D 4GRLD 1J8HD 3LPWA 4RQQA 2WP3T 4X99A 5D1XA 4RCAA 3L7FB 4KAQH 5IMMB 5HVHB 1SBSL 2O5ZL 2B1AL 4RMTA 2PXYA 4Z7OF 4X5XB 4OLZH 3OKMB 2P5WD 3TN0C 3BT2L 5E99L 1A6TA 1C5CL 4LIQH 2MPAL 5IB3A 3WUWG 1YEFL 2HT4D 5DI8B 4BH7B 2DI7A 4PTUA 4WTXA 2V5SA 3PDDA 4ODSH 4N9OB 4HF5H 2KQMA 4XP4H 1WCQA 1YYMH 1XGPA 1Q38A 3ARBB 3MCKB 3BKJH 3RNQA 4O2CA 3U7WL 3T0ED 2Z4QA 3EBAA 4DFHA 2AXFA 1MHCA 3WO4C 4XP1L 3TVMA 2FO4A 2EEAA 3FHQA 1YNTA 4BFIA 5M7QA 1LEIB 5DDHA 5CP3A 5E00B 1OOAA 1IGFL 4N0UB 1CK0L 3UTZA 1A4JA 1F5WA 5BVPH 4Z8FL 1FH5H 3SDDD 4L3EA 4MNQE 4EI6A 1PFCA 1JWSB 2B39A 4NWTH 5KAQF 3GMQB 5DD1L 3WFBH 5DEGB 1MQ8A 2YD3A 4HW6A 2Y5EA 3E3QE 4G6AD 4XNQA 1IKFH 1EO7A 4X4XA 3T3PF 3CCHB 4KROC 2DI9A 5GRVK 4M1DH 3G04A 4WO4C 4PRID 1R24B 2IANB 2UVEA 3RU8L 3EO9L 1PQZA 3FZUD 1PAMA 4YFEA 5IHBA 1SVZA 4OZHF 5DMIL 1NGQH 1N6QH 1CDUA 4JO1H 4DN4L 1LE9A 2XWJA 3MRCB 1CWVA 3FCTA 4LSVL 4UAOC 3D3VA 2R2CA 2BVPB 5L8JB 4AIXA 3MV8B 2ED8A 2NTFB 3T0AA 1RSFA 5SWSB 1UWEL 5K9KA 3AREA 3WDJA 3OKKB 1DBKH 1MCEA 3ZYIA 2UZXB 3MJ7A 4BM7A 1JZ8A 4P9HC 4HC1L 2VXQH 1NFDA 2DM2A 1T7ZA 3WNLA 3VXMA 5JZ7C 2BCKB 4YQXH 5EN2B 2GITB 2A1WL 1A9EA 3D2UD 1NBZB 5GJTH 3TPUB 5DQJA 4EXPX 2F53A 3UTSD 1K8IB 3PHQA 2BERA 2OI9B 4JY5L 1OARL 5E2VH 3NGBB 1DN2A 1S5HB 5E5RB 1I7RB 1JNJA 2CDEB 1AGCB 2AERT 3LKPA 1GHFL 2PYEB 4M4RA 4HIXL 4PJGE 1LK3H 1RD6A 3ALPA 5F89A 2AEPL 5SWZB 5IQ7L 4Z0XB 2ZOLB 2VABA 1XGRB 4DZBA 4PGEA 3KPRD 1KIPA 3QPQC 3UYOD 4LBEA 3MUGB 3ROOA 1B88A 4M03A 4XAKD 3CFDA 4NC2B 2R56L 1M6OB 2BNRD 3LH2L 3QXDA 4ONGH 3JTSA 4FXKA 5I30H 4ODXB 1IAMA 3U4AA 1IC5H 3O8XA 5E9DD 5DJ0A 1X6NA 2JB6A 1G7PB 3MBEA 5HSFA 2X89D 4MD5A 1TTGA 3O81A 5DUMH 4X5WB 1A9BB 1BJMA 2HFEB 4GXUM 5EFIB 4H8WH 32C2B 5GGSB 3RQ3A 3IJYA 1CD9B 4N0FB 1UQSB 3VG0L 1CN4A 5C6PB 5J1SC 3I6LE 3QCUL 1SJXA 5LXGH 2FO1A 1ZANL 5IB1A 1FZKB 4JO2H 3O2WH 3P0VH 3GMMB 1JPSL 3PQYE 3RVUC 2VITB 5FO8A 3DVGA 3DETD 3QPXH 4F8TA 1N5AB 4ONFL 4HWEH 1H5BB 5I8KL 2ZSVA 4KXZI 3CUPB 3QUYA 1J86A 4DKEH 1JVKA 3OWEA 1NMAH 1CFSA 2J2ZA 1V7NH 2CDFA 3AGVA 3HI1B 3U4EA 3ROLB 4HQQH 4FRWA 2YKLL 4QXUL 1RZ7L 4PJCE 3VGEA 3PGDB 3SDYH 3ZTNH 1BGXH 4OUUA 5KSAD 4ETQB 4WU5B 4MNHB 2R4SL 1U8PA 2AJUL 4OV5A 4RGOH 2R1WB 1XR9A 5EBWB 1F6AA 1VFAB 4WDIA 4U1HA 2VUOA 4P4KC 1MF2H 1LNUB 1JTOA 3PWPA 4XCCL 1JPGA 3CNKA 3TBWA 1UXWA 5GISH 1JHLH 4ONHA 4DQOH 1MWAB 1EFXA 1FO0A 2H2PC 4KMLB 4Q58C 3SJVD 5J11B 4I0PB 4JFHD 3TPKA 5CJOH 5IVZA 3MV01 4PTTA 4OD2A 5T1KD 5T33H 1JUFB 4NO2B 2IQAA 1MFAL 5FK9B 1REIA 4YHZL 3B9EA 1X44A 1UKSA 4ZFFA 3TN0D 2AGJH 2ADGB 3RZCA 1KN2H 2EXYC 2IMMA 5E1AA 4JGUA 5ALCL 5IHZA 4RX4D 5CMAA 4JRYD 4KTDH 5BS0A 3FT3A 1KPVB 4H25B 2ARJQ 3G6DL 4JFDD 5KS9E 1G0DA 4FOMA 3GJEB 2XACC 1XF2A 4JFFA 1UZ6E 5CJXC 3D85B 3OX8A 3OF6D 1GC1C 1KLUA 4YGVB 4I3SL 4JPKH 4WW2F 3PV6A 5E6IB 2W60B 1TIUA 1JHKL 2NLJB 2W9EL 3T77A 1A6AB 4L8CA 3NACH 3NCEB 4YZFE 1Q0YL 5KVEL 4YDVB 3CZJA 5M94B 4PJAF 2DTML 1MRFL 1U8JA 5IK3A 5DURB 5CBAA 3CMGA 4LLVB 5GGUA 1S7SA 4KROD 5D6CB 1OD7A 4AEIH 1P9MC 2NY5L 2R1XB 1E6JH 5FM5O 3RGVA 4WO4D 4YHPA 2OP4L 3S36X 3U46B 2F54B 5HVGB 1UB5B 1W0VB 2GUOA 3RL1B 3EYFA 3BRDA 2ZOKA 4QRPA 1A3QA 5E6YA 3FO9A 3VFRB 3IDIB 3OJVC 1J8KA 3S5LG 3MLRH 1ES0A 4P9HH 1ZAGA 5D96C 7FABH 2EEBA 2VQ1A 5JUEH 1CIUA 3CDGB 4FHBD 4OCRH 2X10A 1YZZA 3IU3A 2VLRA 1BQLH 1ZA6A 2AV7A 2HYMA 1BBJA 5FA3A 3RWEB 2V2WB 3VXUA 5T1DL 1SEBB 1HXMA 1KOAA 5CGTA 4NKQB 3FQNA 1HOCA 4M5ZL 5A16B 4O9HH 2B8OT 2Y23A 2D2OA 4MXWL 2GEEA 5DYOA 2Z93A 5JZ7D 1UCTA 3BGAA 1JPST 3QI9B 5JMRA 5C2BL 3L5WB 4KC3B 2OX5A 2OJZH 3WD5H 3IETB 1ND0B 1WEJH 2NW2B 1NL0H 3KJ4B 3N85H 5JORA 4MB3A 1J5OH 1F3JA 3OAZK 4FA8A 3U82B 4G8GA 2R0ZH 1A6UL 1FLTX 2J6EA 3LAFA 4KMQA 1BZQK 1IQDB 4U1MB 4APQA 4FNLL 3P9LA 1TJGH 1ACYH 4ODBD 3ZYOA 5DJZA 4MNQD 4OIIL 4FQJH 3QDMA 3O4OC 4GXVH 4IRJB 4XI5C 5IIEA 1YEDB 3QIBB 4PJ7A 2X70B 2VTFA 4PGDB 2YA1A 4MSWB 4L8BA 2JCCE 3JTTB 3WXVH 4JN1H 4YHIA 2EC8A 1YQ2A 3CPLA 4Y89A 1KCVH 3RVWC 3LKOB 3VXSA 1S7TB 1WZLA 4L4JA 4JHAL 3MA7A 3MODL 1S9XB 4K3DH 4PJIA 3WHXA 3ZDXE 4K3EL 1IEHA 4UNUA 2VLLA 3ULUE 1IGCH 2XNAB 1CGUA 3OKDB 5D2NE 1W0WA 5E8EA 4HD9A 4CAGA 1WUNT 2MQCA 3MRLB 1NCCL 2A77L 4F7MB 2VISA 1GGIH 4QCIA 2D3VA 5GGQL 5IJVB 3RVUD 5E8NA 2X9XA 4GOSA 3I75B 3FN3A 2DQEL 1IAIL 5D7LB 3TEUA 4PJXF 1Q1JL 3G6JE 3IDMB 3QFDB 2VLJE 4JFXB 4JFOB 4KI1A 2PW2A 4EUPB 4LCUA 4LSQH 3TWCH 3CVHH 1CGYA 1P4LA 3CLFL 4F57H 1YEJH 1U92A 1FL5A 2APXA 3QDHA 5J12C 3FRUB 1A6ZB 4IS6A 5H37H 3NH7H 3MV9A 3MV7E 4M8VA 4CVXA 4IOFC 4Y4HC 1F97A 4PJFA 2ICWI 1JP5A 5J06A 1FRGL 5GIRB 3SCMD 1JMZA 3PXHA 1KJ3L 3K46A 5HVFB 4NO5B 5IJKC 4GRLA 4G3YL 3MACH 1NKRA 1J8HA 2PO6B 1RAMA 3WDHA 4JDVA 4MD4A 4PGCB 5DJYA 4JJ5B 2H2PD 3K2UH 1DE4B 1N26A 1HHHA 1F90H 2IPUG 3GRWA 1IBGH 2I60H 3H8NA 4P46C 3O2DH 3KWWA 1A3LH 4QOKB 4X0KA 5I1JH 1XCQB 1KJ2B 2VJXA 3ARVA 5IFAH 1NEZA 1NCBL 2P5WA 5FCSH 5GGRA 5I1KH 2ZWLT 2HLAA 4FTVA 3HNVL 3EYVA 4RQQB 3MRDA 5IEKA 2VDQH 4Y4KC 3ZDZE 4LASL 2EXYD 2BX5A 1GC1H 5D1XB 5DUPH 1MAML 1LE5A 1MAJA 1J0JA 5E2TH 1H3GA 1RIHH 3JWOL 3T0EA 2PXYB 5B8CB 3SOBH 4X6DF 3ULUC 2XRAL 1GH7A 5D2NC 3LIZL 1DL7L 2Y06H 3I6LD 3EDFA 3TCXA 3WLWC 1KFAH 4PS4L 3SDDA 4MA8L 3PQYD 3BPOB 3FAXA 1FSKB 3RVVC 1MFCH 1DEDA 3UTQA 1ZMYA 3RNQB 3LEYL 4HH8A 2Z4QB 1FG2A 3DX9A 1HH9B 1MHCB 4ISVA 3TVMB 2FO4B 4NO0B 5AYQA 9CGTA 4PRIA 3PP3H 1MCKA 3O41A 1YNTB 4NN5B 1QP1A 4BFIB 5DDHB 3FOMB 3UTZB 5FDWA 1A4JB 1DTUA 4TTDD 1I9JH 4HS8H 3JV6B 4XCYA 4XNQB 5C0JA 4JKPL 4X4YB 4Z95L 1AD0A 3G04B 5HGAA 5D1QB 2IQ9H 1XT5A 4K71B 4I3GA 3TNMA 4NRZA 2EO9A 4G9FB 5DVNA 4OLUH 4D0DA 2QLVB 3SDAB 5IVXF 1Z9SA 3FQRA 3NFSL 3SDXF 2XPGB 3AROA 4FXGA 5DS8B 5FECB 4LSUH 2XWJB 4P2OC 5TE6L 3FCTB 3D2UA 4AM0A 1KLGA 4NWUH 2R69H 4BFEA 1C12A 3UTSA 1MVFA 3LEVL 5K9KB 4D9QE 4Q6IC 4QYOB 1E4KC 1QLRB 4HT1L 2ENSA 5LBSL 4BJLA 4MS8C 3T2PA 4ESKA 1J1PL 3MJ7B 3BW9B 2XTJE 1NFDB 3VXMB 4R4NC 1XMWA 1A9EB 4YDIH 5ADPL 4BK4A 4ORGA 5DQJB 3NCJL 3KPRA 2F53B 3NN8A 1NGWA 5C0FB 1XGUA 4Z7QF 2NY6C 4F58L 4E5XA 1B4JL 2BDNL 4ZMAT 4Y5XA 1M1SA 5CJBA 1A3RH 3L5XH 3QCTL 4XI5D 4XHQA 5KVMC 5E9DA 3DX8A 5GRUH 2X89A 1UACL 1QFWM 2J12B 4LLUA 3SGDH 5CCKL 4NBZB 4LBEB 3ROOB 3IGAA 3ULSB 3CFDB 2DN7A 3PABA 3RVWD 4DTGL 3H42L 1P5VA 1BIHA 5EBLA 1FDLL 2AXJA 4LCYA 1UVQA 3QXDB 3JTSB 5L0QB 1C16B 4FXKB 4WGWB 4OSUH 4Z7UF 5EUOE 3IDYC 1EO5A 4OGXL 4PUBH 3GSRB 3O8XB 1MFDH 3MOBH 5DJ0B 3FOLA 1YQVH 3MBEB 3O3UN 1QRNE 2FECL 2GJ6E 4I5BA 3RPIA 4ZDHA 1L7TH 3VWJB 3MXWL 1NBQA 1DQLH 5GGVY 3PGCA 4GSDL 1XH3A 3KR3L 3HE6C 5IB1B 2NW3B 3NFNA 3WNKA 2D7QA 5F21B 5C9JA 3RA7L 2YBRA 4U0RC 5E24E 4NN6C 5FO8B 5T3XL 3DVGB 2YPLA 3FB8A 3EO0A 1TQBB 3VDCA 2ZSVB 2XTJC 1U8LA 5DJ6A 4YBQC 3DYPA 1KXTB 4GAFB 1OP3H 2CDFB 1FGVL 4OGZA 3TM6A 3U4EB 2XYCA 3SJVA 3ZE1E 1MCPL 3P77A 4FABL 3ET9F 4OUUB 1F4YL 1A5FL 1WISA 3OXRB 4OV5B 5DRZA 1OAUL 2F58L 1XR9B 1F6AB 1J1OH 1RZ8B 4WDIB 4U1HB 4L29B 5DUBA 3MGTB 4K2UL 1RK0A 3PWPB 4S1RL 2WUBH 5EIIB 2W9LA 1IM9A 3TBWB 1U2CA 2M2DA 3TN0A 1KELL 1X5JA 2DB8A 4ONHB 3HC3L 1HKLH 1EFXB 1BJ1J 1ZVSA 1FO0B 2FEEL 5KW9L 3ULUH 4O02L 3V79C 1TCRB 5LAXA 4FQIH 2VZOA 3QT2A 1S9WA 2H45A 3T8XA 2DQHL 1LDSA 4WIQA 4Y4KD 1J05A 4RX4A 4JRYA 4S2SA 1QFWL 2MSPA 2RFXA 4OD2B 4PTTB 1BZ9B 4JFDA 3UDWC 2YUXA 2IQAB 2YMXL 1VDGA 3I85A 1QO3A 2UV3A 3RWIB 5DA0B 2AQ2A 2QHRL 2VLKE 5F9AC 1CFVH 2F5AL 2XWBA 3P4MA 3ULUD 4Z7VA 3OF6A 5GRVL 1RUKH 3RZCB 3WLWD 3CC5B 1GOGA 4R96B 4NPYA 4JKKA 2QSCH 1SMOA 3QQ4B 5CMAB 2B4CL 3QCVL 4HIJA 5BS0B 3FT3B 3ZL4H 2SEBA 3BD4A 3GSQA 3RVVD 1MNUH 1FAIL 2VLJD 4OF8A 1C8PA 4NQSA 4Y0GA 1PKQB 2FX8L 3PHSA 3GIVA 4M62L 4YC2B 4JFFB 2YOCA 4OLVH 2CLVA 3OX8B 2N7AA 3I6GB 4WO4A 1EGJA 3ZE2E 4O51A 1KLUB 4K55A 1VPOH 3RIAK 3DTXA 2NY0B 3GMOA 3MV7D 4PLOB 4EN3B 1A7BA 2JJSC 4J3WA 4EDXB 3O3EB 3RX8A 2EYSB 3EZ8A 1A7NL 1TVHA 2NY4B 1S9VA 1MREH 4YHPB 1PLGH 4RISL 1PBYA 3BEVA 2GUOB 1FBIH 3EYFB 3LZFL 2ZOKB 4C4KT 4P3WA 1CFNA 1ES0B 1WT5C 4NNPL 3WXWH 1UJ3C 3UYRH 4P2OD 2VQ1B 3QQ3A 4EVNB 1JMXA 4F3FA 3OHXA 1KB5B 2EC9U 4EUPG 2VLRB 4YHYC 1ZA6B 2HTKC 1CBVH 4GG6F 4QNPE 1RMFL 3VXUB 4L9LC 1HXMB 4DKFL 4LHUD 1HOCB 3PL6C 5C71A 3U30C 1FP5A 3G5ZA 2Q6WA 4OFVA 5DYOB 2Z93B 3UTTB 5FM8A 2G9HA 2LU4A 4R4ND 5A40E 3TT3H 4GUPA 3KJ6H 4Q9QH 4M6NH 2BZDA 3VH8G 4OCNC 1NCWH 4XRCB 5HHNB 4K7FB 4NCDA 4MNQA 3VFTA 4ZNEE 2NY6D 2D7PA 4J12A 3HC4L 1OSZA 4HK0A 1F4WL 2XN9A 5CILH 1F3JB 4OCWH 1JYVA 1U3HD 4U0QB 4G8GB 5D7JD 3VFUB 4MAYC 1IILE 1U3YA 2E5EA 2JB5H 2G60L 5EZIL 4J3XA 3NAAH 1F11A 3MX0A 3P9LB 1INEL 2I07A 3F58H 4QEGA 5DJZB 3E2HC 3W81A 3I02A 2JELL 4R8WH 4X7EC 5IIEB 3WIHH 1W72A 4LCCC 2Q7YA 4NKDB 4L8BB 1VGEL 3C2AL 4N0RA 4YXKL 2EYRA 4YHIB 3CPLB 4OUOA 3O3DA 5DEZA 2YUVA 2VDKH 3MA7B 3GJFH 4FQHA 4XP6H 1S7XA 1BQHA 4HWBL 3V6OE 3FT2B 4PJIB 3WHXB 3EYUL 1XGTB 3WIFA 2BY1A 4Y2OA 5EORH 2VLLB 4HJJH 2DJ4A 4LK4A 4PJAB 3IJSA 3QAZB 2RBLA 5GRJH 2Q3ZA 2FATH 1W0WB 3HMXH 5E8EB 3KXFE 2WSKA 3HE6D 4NJAL 4C58B 4ALAL 1T7WA 1HZHL 3U9UA 4PJ8C 2VISB 4D9QD 4QCIB 2IPTL 4IRZL 2FJHA 2EIZA 5E8NB 3TZVC 5C86A 3CMOH 1FORH 4P4KA 1SHMA 4XBEL 2HA1A 2FNBA 1K4DA 4M43H 3CVHA 5LQBL 2DLEA 2PW2B 2XTJD 1AFVL 2A83A 1YC7A 1VSCA 1B6DA 4PJGA 3VWKC 2D7TL 4KZDL 1U92B 1KCUH 1FL5B 5L8KB 4LVOB 2EE3A 5TDPA 5DK2A 4IS6B 3AXLA 4XPAH 3OKEB 3ZHLA 3JVGC 4KH2A 3IFPA 1VFOA 5ALBH 3S97C 4FFYH 1G0YR 3V2AR 4QO1A 4O4YH 4Q7DA 4PP2B 1FVDA 3T4AA 5E03A 2YRLA 5FYJE 5JXAH 2WUCH 3R8QA 3ZKQD 1NDMA 4GRLB 1J8HB 2C4FT 3MBXH 1U6AL 1YYLH 2FJFA 4MD4B 5DJYB 1C1EH 3X17A 3GSOA 1HHHB 2W92A 3O2DA 5JQ6H 4YR6B 2QV2A 3OMZA 3P4OA 3KWWB 2CJUL 4N8CH 2GKIA 4X0KB 1QNZL 3OPZL 3AM8C 5TPWH 2GSGA 5GGRB 2BVQA 5F7DA 5JO5A 3FB6A 2HLAB 3EGSA 3MJ8A 1WWWX 3QDGE 4KXZH 3V4PL 1GGBH 1G9ML 3MRHB 1OSPH 3MRDB 3PQYA 5AZEL 5IEKB 3WFEH 3CK0L 5E2WL 1QRND 2EECA 2GJ6D 5JDJA 3PDGA 5FKPB 4TSBH 3QNXA 3V6OC 3BPCB 3T0EB 1MJ7L 2ZSWA 4F80A 4QXWA 4HUNB 5HVWA 2GCYA 3QQNA 4PJCA 4OM0H 2KL6A 6CGTA 5DRXA 1P9MA 5GZND 3MLXH 3SDDB 4QTIL 1BAFH 1VGKA 1AO7E 3FAWA 4XBGB 3BEWB 3FQTB 2E9BA 3V8OA 2NY2C 2VNCA 3UTQB 3V4UL 2VO5A 3OZ9H 2ZG3A 1JRHI 2CPCA 4OB5L 1FG2B 4ISVB 3C5ZB 1OAXL 4PRIB 1SQ2N 3O41B 3VDAA 4X98A 3PGFH 3NABL 2WBKA 1T7VA 2IMNA 4X6BB 4PB9H 1BZ7B 2B5IB 3T3MF 2FD6H 1LO4L 4XCYB 5IW6A 3A6CL 2DQTH 4P2RE 1H3WM 2VXTH 5JIHA 3RWFA 5C0JB 4LAQL 2JF1A 2FIKA 5DA4A 4OCMC 4Z77A 4RMVA 1ZHKB 5KAQG 4NGHL 5M95B 5HGDA 5D72L 5HGAB 1R3IH 3TNMB 4NRZB 3HAEB 1EZVX 1WLHA 1XF3A 4ZO8A 5EO0A 3TO2B 3FQRB 2QSVA 5K9OB 5E5MB 2FSEA 2UWEA 5KS9A 1VEOA 2DMCA 3PL6D 3ARSA 5KSUA 4POZC 5AWNH 1OTTC 4AM0B 2X7LA 35C8H 2EKJA 2VLKD 2JCCF 2PTTA 3HRPA 1C12B 3UTSB 5ICXA 1RZFH 3SGEI 5D1ZC 5IEHB 5JQHC 3S9DB 1SYVA 2E7HA 2HFGH 3FMGL 1BM3H 4G6KH 1T22A 2X1WL 2AKRA 3SHSA 4YEEA 3MLWL 2NZIA 1A14H 2ZP0T 2AJSH 1CE6A 5EULV 4UINH 4XNMA 4MA1B 3KPRB 1KCRL 3LEXA 3Q1SL 5L2KE 1T2QL 4MAYD 2OTUB 4MQSB 1NGWB 1UEYA 1A7OL 4X6CE 3OKOA 5E56A 3X13A 1NUDA 1RUAH 1KEGL 2BNRB 3LPGA 1RURL 1F58L 4Y5XB 4ZYKA 2EZ0C 4QY8B 4EXKA 1KIQA 4KTEH 4KKBC 4S10A 5E9DB 2IBZX 2XT1B 3DX8B 3BPNC 4PBVC 4PLNC 4KFZC 4FQLH 4JZJB 1GXEA 4LLUB 3TV3L 4LMQI 3MLTA 1J18A 3L3OB 3IGAB 5I1LB 4ELMF 2ORBL 2ZJSL 3DI3B 3TO4B 2ZNXA 2ICES 1F3DH 1HSBA 3F12A 5EA0L 5EBLB 1JE6A 3MRIA 1UVQB 2VH5H 1I9RL 1WQVT 2GIYA 5H94A 2B2XL 1A7RL 2PYFB 3X12B 5I1DA 2V2TA 1I1AC 1RZJL 1OP9A 4UTBH 1WITA 1CLZL 1AGDA 2IPKA 3MRFA 4I5BB 5E8PA 3S88L 5KOVC 4XVUC 2UYLB 4PJ8D 1MJJA 1MCRA 1FVEB 4ZDHB 4WUKH 2P47B 3NCMA 1FNEB 4Y4HA 2D0HA 3TZVD 5EPMA 5HYSA 3T0BA 2IFFL 1CFBA 1U36A 4JM2C 5J6HA 5IJKA 1XH3B 5DO2C 3KHQA 3I3DA 4YGAB 5HGHB 5BMFL 5GHWL 5I1HL 5KSAB 3NFNB 4CMHB 5C9JB 3RBSA 5DD5H 2YBRB 1EVTC 1WFTA 2DD8H 3OAYH 5F7NC 2F5BH 4FP8L 3FB8B 3DX7A 1D6VL 1XF1A 4P46A 1AH1A 4H1LH 4LLDA 1U8LB 3BJLA 4WHCA 3SJVB 4XWGL 1OAZL 2KPNA 3P77B 4XCNA 2NNAA 3O6LL 5HTSA 3S3PA 3MCLH 3QZWA 3U6RA 2Y9RT 4Y4KA 4EBQH 2X4NA 1TZIA 1TNNA 1YEIL 3DECA 4CN1A 3T04D 1Y6MR 5T1KB 4M1CC 5DUBB 4UQ2A 3NPSC 1IQWL 1RK0B 2VXVH 4PV8B 5HXMA 1F4XL 4M7ZC 2X09A 1UXSA 3TN0B 1CGWA 4PJ5E 1U8KA 1L6ZA 5D2NA 4UV4H 3H9ZA 1T80A 4LPCA 5EZOH 4R6UA 3MREA 5ACLA 1S9WB 4G42A 3T8XB 2R9HC 5D5MF 3UYPA 1Y6KR 4JRYB 3S35L 1ZT7B 4S2SB 4ODTL 3ZZ1A 4TSAL 4JFDB 2DIAA 5BOZG 3G6JA 2VLJA 2MQ0A 1UH4A 1J11A 1I9IH 1QO3B 1ZSDA 3THML 4OJFL 3ULVL 2XWBB 3P4MB 4Q9BA 4Z7VB 2PCPA 3KXFD 3KYKL 2YPKA 3AU1A 3B83A 3MV7A 5JIIA 4NPYB 2OXHA 2A9NH 2DAVA 3TNNB 1I3UA 4HIJB 3V5DA 2SEBB 5JLZA 3GSQB 1QFPA 2P43B 3BGFB 4XMLH 4PGJA 3F7RA 3ULVF 3GIVB 2P45B 2NX5E 2YD2A 1MRDH 2CLVB 4WO4B 5J13C 2P7TB 4DN3H 1X5GA 4LARL 4ZTPH 3GMOB 3L9RA 4ZODA 2CKNA 2J5LC 4B7LA 3L5IA 1CDHA 4P2OA 3QB7C 5FYJD 5BO1H 3SQBA 5FYKL 4HKJA 4PRAA 2Q76A 5KVDL 1P6FA 4HXAH 4EEEA 3SGKC 2LAGB 3GB7A 4G6ML 1H0DA 3S34H 4YUEL 1S9VB 3HI5H 4Q6IA 1E4KA 3BWAA 4LHUA 5ID0B 3N1GC 3CDYA 5A2KH 3BEVB 2FB4L 2H1PL 4F7CA 1CFNB 3BKCH 3QNYA 2FH6A 5DD0L 4WJ5B 4PRHE 2FJGB 3BJ91 4WWID 1P2CB 4OLXL 2AJZA 5K33A 3STBA 4POZD 4AQOA 3QQ3B 5C0EA 1OTTD 2PR4H 4F3FB 3U36B 3QWOA 1GZPA 3OHXB 4JG0H 2APWA 5C7XH 3QDGD 4R26H 2C1PA 4BELD 1BD2E 1FJ1A 1YEKL 4BA8A 4UU9A 3TYGH 2OK0H 3GUTA 5D1ZD 2HT3C 4NQEE 5BCAA 5FB8B 4MNGA 1NFKA 3C6LC 1HDMB 3TIDB 2AVGA 2ZCHH 4UTAL 4HIEA 4XMKL 2Q6WB 1ZGLA 1L0XA 5KZCD 2I27N 3CD4A 2G9HB 2NY7L 2C3GA 1MCBA 1NMBH 2R0WL 4GUPB 4X80L 3CZFA 2YD6A 1HKFA 1X5HA 5LWYL 1JNNH 3O9WD 3Q6FA 2W0LA 4F7PA 2H26B 3B6SB 1EFQA 4MNQB 4M7LH 1AO7D 4PJ7F 4JO4H 4DZ8A 2A6IB 3D39E 4KI5E 3MA9H 4ODVL 1OSZB 2EDFA 4HK0B 4B7IA 1ETZA 4RA0C 1TNMA 2MFNA 2QJDA 3T2NH 3QA3A 3CFEA 4FS0A 3FB5A 5CZKA 3A6BL 2VR9A 1PX3A 2W59A 5IGXL 4B50A 4X7TA 2ZUQC 2I07B 3L5HA 2CQVA 1EXUA 1QSFE 3RUGE 3I02B 3WIHA 1D5BB 1QFOA 3UEZA 1D6EA 2HH0H 4P2RD 1NMCC 1W72B 2VERN 1I8LC 3HE6A 4GS7C 3D25A 5ID1B 1MY5A 4OAWA 5D7SL 3WFCL 2EYRB 1VENA 1FL3A 3VI3F 3GJFA 1RVFL 3AFLA 1D5ZA 1DQQB 4XVUD 3UJJH 1EA9C 4FQHB 1BQHB 3QH3A 4MGXA 3BP6A 3HMXA 5DMJB 4JM2D 3RWGA 2A2QT 5DO2D 3GRWL 1N5YH 1TITA 5HDQL 4M5YL 3IXAA 2W65A 3UZQA 4PJFF 1P53A 4YHKL 3U9UB 4ERSL 5F9DC 1GL4B 5DWUH 2Y5TA 4WRLA 2FJHB 2EIZB 3WJLC 3SCMB 3F62A 4BUGA 1K4DB 4OT1H 3CVHB 1Q9KA 1QD0A 2A83B 2H3NA 4HMDA 3LRGA 5L6YH 1TZHA 4PJGB 3RJDA 2VE6B 3BOVA 2ZUWA 2KKQA 1JF5A 2DQCH 3VFVA 5TDPB 3UJTL 5DK2B 3G5YA 5L2KD 3WS3A 3MMEA 3RX7A 5BZWA 1ODAA 4LIQL 4NT6B 1QQDA 4KI5C 3HAEG 4M1CD 4AY0A 3UDWA 2H8PA 3T4AB 2J3SA 4MCYB 5L7XH 3MFFA 4ODSL 3LRSA 3STLA 5EUOA 2WW8A 1NDMB 1JGLH 2QKIA 5I66A 3IDXH 2FJFB 3GSOB 2D03H 2GJ6A 2BVEA 5C0GA 1O5DT 5EOCL 4I1NB 2DDQH 2X4UA 4XNZC 2G2RA 4TNVF 3P4OB 4Q97A 5BVPL 3CH8A 2GSGB 1FH5L 1XAUA 2BVQB 5F7DB 5JO5B 4ENED 4AJ0A 5GS2H 25C8H 3FB6B 2OXGA 3MGAA 3MJ8B 3ESVF 4WW1B 3WFBL 3HI6H 1I1YA 2A0LD 3PQYB 3QSKB 4X7DC 3I9GH 1MJ8H 4M1DL 4YBLC 1JGDA 4F2MA 3QNXB 4P2YA 2JJSA 2CLRB 3OR7B 4KY1L 2ZSWB 4MQ7B 3QHZH 1JV5A 4HXBH 1I7TA 1L6XA 2R0KL 1NGQL 4U1GC 3LQAL 5CS7A 2GCYB 1N6QL 4PJCB 4M7KH 5D7IF 5EIQA 2XY2A 3SE9L 1IJ9A 3EYOA 3GSNH 1VGKB 4MDJA 3BN3B 2C3WA 4FQPA 4F8QA 5B3NA 1WT5A 1B90A 5D96B 1UJ3A 1DBKL 4LKCA 3L7EB 2X4SA 1PG7L 3OBAA 3ZHDA 2ITDA 3I50H 4OGAD 4X98B 4YQXL 3HPLB 4CU6A 4CNIA 4PJDE 4L9LA 3GNMH 5FHAL 4Y5VC 3QFJB 3RTQD 1BVLB 1ZHBA 3PL6A 2LU7A 2AJVH 5IW6B 3OB0H 1AHWC 4AEHH 3IAGC 1G7MA 2VLKA 2FIKB 3BDYH 3NIFF 1W8OA 4Z77B 3FO2A 4PJ5D 2I5YH 4TRPH 5HGDB 3DOSA 3RFZC 2DJUA 1CL7I 1OT2A 1FFNA 4N1HB 3WEXB 5JXEC 1JTPA 5IHUL 3NTCH 2HT3D 1NAML 3C6LD 5KS9B 4FQCH 5KSUB 3ARBC 2R2HA 2OM5A 5FYJU 1FVCA 1JGEA 4P57B 1X5IA 2PTTB 1UB6B 4MAYA 2C7UA 1JCKA 5F44A 4ONGL 4YDJA 1KN4H 5I30L 4UV7H 3LV3A 3O4OB 4OZIF 2AKRB 3S96A 2P8PB 3RVXC 5BRZE 3QEHB 4H8WL 4KVNH 4LCCA 4LF3A 1G6RH 12E8H 1X9QA 1CE6B 1U58B 3B43A 2NX5D 1KXQE 3LEXB 4XAWL 3HZMA 3NA4A 3QBTB 3B3IB 3LN5A 3GMLA 4KRMB 4CRPA 43CAA 4JO2L 5I18L 1OQOA 3P0VL 1DZBA 2DS4A 2IC2A 4GRWE 4ZYKB 1X4XA 4LMQE 1KIQB 2Y07H 1M7DA 1MLCA 4OI8A 5BOPA 5CD3A 3F6LA 4DKEL 1ZA3B 3EOAB 4OLWH 4D8PA 1V7NL 4PJ8A 3MLTB 4H26A 3TZVA 4HKXA 3BKML 4G8IA 3M17A 4PY7A 3ZTNL 3BKYH 3F12B 1HSBB 3LS4H 3ORJA 4IRSB 3MRIB 4RGOL 4PRHD 3VD3A 3G5XA 4NQTA 3VWKA 3GSUA 4K8RL 3TJHC 1MF2L 5J12B 2DWEB 3L6FA 5I1DB 3HLAB 3WHE1 4Y1AE 4K7PL 1AGDB 5GISL 3MRFB 3JVGA 1BD2D 1JHLL 5A43C 1AXSA 2LTQC 3MFGB 2OI9C 4ZNEA 5T5FH 5JR1L 3PP4H 3NGBC 4N8VA 4NQED 5HYSB 1I3RA 5T3ZE 1HYRC 2NXZD 5GGVH 5ETUA 5CJOL 1YPZF 4NC1E 1VKXA 1BQUA 4R9HA 3RZWA 2E6JA 5EUKB 3C60C 1PY9A 5TE7H 4MJ2A 1N8ZB 2VDOL 4QRRE 1Z3GL 5C8JB 3F7YA 1A1NA 4RZCA 3T2OA 3ARFB 4H1LA 3DX7B 2AGJL 3MXVL 1OAKH 4LEXH 1KN2L 3EDDA 3D39D 4KI5D 3AM8A 4JPWH 4HEPG 3FN9A 2JCCB 2NNAB 3FTGB 3H9SE 4WI4A 4YAQA 1K6QH 5ILTH 4BZ1H 1KCLA 2Z35A 4Y4KB 4KK8C 2X4NB 4CDGC 4ZS7H 2QHLA 2D7OA 3O6KH 4W81A 3V6OA 3V7MA 4HX1B 1QA9A 5EC2A 1QSFD 4NFDA 2AJYH 2ZCKL 4JPKL 4NZJA 1UXSB 1U8KB 5D2NB 1DUZB 2BFVH 3KXFA 3NACL 3AUVA 3MREB 3FO0L 4GMSH 4MD0B 3QJHA 3U1SL 4X7SH 3B4NA 3BO8A 3W0WE 4I48B 2A38A 4R4BB 5C0RH 4AEIL 1FFOA 5E2UH 5ADOL 2R8SH 5DFVC 3G6JB 4ZFGH 2VLJB 4OD1H 4XPGH 4G7VH 4F7EA 2UVFA 2WMPA 1CLCA 1ZSDB 3MRRA 2ICWA 2VL4A 2O5YL 4FZ8L 3JWDC 5FUOH 4P9HL 4TQEH 4XPBH 4RDQF 3DRQA 5GGRY 4U2ZA 4WI9A 2YPKB 3AU1B 5IBUG 3MV7B 4OCRL 1BQLL 4ELMB 2F54E 2WINA 3V5DB 4NC1C 3N50A 1J9CT 4CDHA 1IFHH 1T4KA 1YY8A 4NDMB 5EDXA 4NHUA 4HLJA 3CFCH 2UY7A 1BPVA 1CIDA 2VSDA 3L9RB 1P4IL 2AEWA 1INDL 4QT5A 4KKLC 1GCFA 5D93C 5IFHH 5F96H 4P2OB 3LKSA 1C7TA 2XTLA 2ZUYA 1WEJL 4PJBE 4HKJB 4PRAB 1AD9A 2Q76B 1LO5A 2EICA 2UZYB 3N85L 1NGPL 3QDGA 5C07A 1NBVL 1J5OL 1H0DB 4OF0A 4U1NA 1AIFA 1UFUA 5D1ZA 5BV7L 5IUSA 2HTLC 1ITCA 2R0ZL 3BWAB 4LHUB 1S7VA 5FGCE 5JXED 4OF5A 5B38A 5F1KC 1T1ZA 4F7CB 3CJJA 3QNYB 1DBMH 2E7CA 1RUML 2AJZB 1FFPA 3ARBD 1ACYL 1PD6A 5DD3L 3QWOB 4ZS6D 4GXVL 3ARXA 3DSFL 1TCMA 2D4FA 5SV4A 2C1PB 1CICB 1FJ1B 1AO7A 5HHVL 4UU9B 3C8HA 1CE1H 1JRHH 2NY6B 3GUTB 2JJUA 1SJHA 1TETH 4LHQB 4C83A 1CLYH 4S1QH 5CSGA 3O2VH 1JZ5A 4HIEB 2CH8A 3WXVL 1U3HB 4JN1L 4YPGA 1KCVL 2HJFA 5D7JB 1ZGLB 3RVXD 2AEQH 3IU4H 3MLYH 3CZFB 4K3DL 4TUOA 2CMRH 3DV6A 3PWNA 1A7QH 4J2XA 4TNWF 4F7PB 5J1AA 1TTFA 4P2RA 1NAKH 3LKRA 4WTZA 1UM6H 1ETZB 3IDYB 1NCTA 3IDGA 2P8LA 3FFDA 1IGYA 2E7LC 1ADQH 3ES6A 3CFEB 1YJDC 1I1AA 1UM5H 4YDKH 1E6OL 2DQUL 3RPKA 4F57L 4ELKB 4HUWB 1YEJL 4X7TB 5GRWA 4MLSA 1CZ8L 5TH2A 1RK1B 2B1HH 3GK8H 3NH7L 5CZXC 4A6YB 5MERB 5EZJA 3D0LA 4JM2A 2YA2A 4ZPVA 5D7KE 3WUWA 5E8DH 2RIKA 5ESAA 1B6UA 3R06A 3D25B 4LEOA 2A9MH 3TJHD 5E08H 4OAWB 1E4WH 2P5EE 2D4DA 5HPOA 1NCDH 1A1OA 1OP5H 1GPOH 1FL3B 2DICA 3GHEH 5CEZL 1BOGA 1JF1A 1CR9L 1D5ZB 1V3JA 4J1UA 4Q0XH 1LEKA 1NLBH 4YNYB 3K2UL 4DW2L 2XTJB 3MGOA 4ODHH 3L95B 3B2UC 3KJ4C 1KPRA 3BP6B 3QHTC 4MJIE 1IBGL 1BBDH 1CDGA 3RWGB 3O2DL 1A3LL 1DUYB 5DT1H 4JFZH 3C60D 5L2KA 5IFAL 4BSJA 5C3LD 4QHUA 3GI9H 5I1KL 2DTSA 4X6CA 3ARZA 5C3TA 3V52L 4KKCC 3U0WL 4DAGH 2VLME 4XPHL 1Q9KB 3BDBA 3OAYK 2C3VA 2H3NB 1BVKA 1GC1L 5BRZD 4HGWA 3DHJA 4IRJC 5DUPL 2X40A 3P11L 2ZUTA 3QIBC 5E2TL 1RIHL 3G5YB 3WS3B 3MMEB 2W91A 5BZWB 1R5WB 1OTUC 4KK8D 2Y06L 3P0GB 1QQDB 4BSVA 2HKFH 5GPRA 1KFAL 2WWKT 1DSFH 4WEBH 5IROC 1CD0A 2AW2A 3KYOA 4NQXA 5E7FA 3MFFB 3LRSB 1A1MB 3LSOB 3STLB 4CKVX 5EUOB 3VGDA 2GSIA 1BMGA 1JBJA 1UCBH 5I66B 4YXLH 5FO7B 1ZVYA 1M05A 5BQ7A 3SKNB 5DJDA 2BVUA 1N0XL 1K4CA 1QRNB 2F9BT 2GJ6B 4KK5D 4F37F 5C0GB 1RULH 3UTPE 3CH1A 1QYGH 5CEYA 5TQ2H 1K85A 4LLMA 3KPSE 1NUFA 3QWRA 3EO1A 5DFVD 5IVOA 3BH8B 4ZFOA 4RIRA 5T3ZH 4RGMC 5F6IB 4RWYH 4N9GA 1DEEA 1I9JL 4HS8L 4BQ9A 1DLFH 3CVIL 4G8EA 5JOFA 3LN4B 4OM1H 4KDTC 4YIQA 2X1OA 5HHOE 4ZUUA 1I1YB 1MWAH 4Y1AD 1CXLA 5C1MB 4YLQT 1XR8A 4XPFH 4LVEA 4NZTL 4JFQA 4Y19E 4POUB 1JGDB 2IQ9L 1LEGA 1YN7B 2BY0A 2X1XR 3S6CA 1ZT1A 5T3ZD 3F7PC 4OLUL 3OKNA 1JV5B 2YC1B 1I7TB 1KJVA 3D9AH 3GBNH 3SGKA 4GAYA 5MEPA 4Z7NE 1F3DJ 2DL9A 3EYOB 4QRRD 4UILH 4CN4A 5JW4N 2BC4B 1F8TH 4MDJB 1MSPA 3DGCR 1U8HA 1V7ML 4G9FE 3D6GA 1LO3L 1WICA 4KKLD 4XXCC 5EO9A 4LKCB 4PJ5A 2X4SB 4WCYH 5MEOA 4AEEA 4R3SA 3QUZD 1CGSL 1WWCA 3VGAC 4YHYB 2G5RA 3SO5A 3H9SD 4U6YA 3VD5A 3SE3C 2EIEA 2UWEF 4QF1A 4CNIB 4YDIL 2FL5A 4G43A 1IAII 3C6LA 4K3HA 1ZHBB 2VKWA 3PL6B 4IMKC 2FCBA 4NBXB 3JXAA 4GQ9L 1R0AL 4FG6C 1G7MB 2VLKB 1QKZH 3VXTA 3L1OH 4GRMB 5B8CC 1KB9K 2O26U 3FO2B 5CD5D 3LS5H 3RBGA 2IWGA 1FYHB 1A3RL 3L5XL 2JJTC 1A64A 1RHHA 3BUYB 4TUKL 4KRPD 4LRNH 1A6PA 3D85D 1DQDL 5E1HB 2QL1A 1KTRL 5FDYA 4U6VH 5GRUL 1J7VR 4GAJH 4N0YH 3W0WD 4HBQA 3BPOC 1SY6H 1VADA 2AV1A 1FV1A 1I7UB 3NZ8A 4WU7B 5EH1A 1RU9H 2R2HB 2A74B 1FVCB 1JGEB 4Z7OE 2NX5A 4MAYB 5AEAA 2LU3A 2ID5A 2DQGL 4YDJB 4CMMA 4ZPTA 1KSRA 5EU4B 1CTNA 1MFDL 3C6SB 1EVUA 1YQVL 3LV3B 2F54D 1KACB 2VQTA 3S96B 3L3DA 1G6RA 3AS2A 4LF3B 5ECJE 2OR9H 1I8LA 2H9GA 5CEXA 4HZLA 5I73B 5ISZE 4NQUA 4CJ0A 3HZMB 3TGXA 1TJIH 5D1QC 3LN5B 3WHE0 5I2IA 4F15C 3SE8L 3B2VH 2DKMA 3SDAC 1U91A 4LU5H 4KJQD 1KC5H 2ICWJ 2V5RA 4PRHA 1BHGA 3CDFA 5CZXD 1MLCB 1ZOXA 1EH9A 1KTLA 5HYFA 5D7IB 1HN1A 4D8PB 3T3PE 5K9QG 1BD2A 5ENWA 1CS6A 1EO8H 4PJ8B 4OCYH 3HHRB 2OTWA 3EAKA 4ZUTA 4H26B 5DVOA 1JI1A 4HKXB 4NQEA 3TZVB 3WJLA 4G8IB 1U3JA 3M17B 4R2GC 4OZHE 2VC2H 5IP4A 4OFPA 4JAMA 4JGMA 1J1OL 3P30L 3QIWD 3RIFK 1X5YA 2WUBL 5D2LF 3FB7A 1JHTA 2CIIA 4KV5F 2MTPA 1WWAX 1AXSB 1HKLL 3ULUL 3DJ9A 4XVTH 4AH2A 4N8VB 2B7DT 5L2JA 1IGJA 3QO1A 5CINL 3GGWA 4KKCD 1BEYH 3W9EB 3X14A 5ETUB 5C0NC 2WBJC 3NVQA 1T20A 1I3VA 3GKWL 4IRJD 5IG7A 3QIBD 1KB9J 1IT9L 1TFHA 5CIPH 1KNOB 4JANA 3MNWA 3VE0B 3F7YB 4RZCB 3QDAA 4H1LB 1OTUD 1ZEAL 3S5LA 4OCSL 2X4RA 1QSFA 1M7IA 1RUKL 1ZS8A 1OPGH 4UDTA 4LHUG 3QXAA 1T1XB 4P23D 3MQIA 4JDZA 3TLRA 4IDLA 4EUPH 2R2BA 4QHMA 3UC0H 3ZL4L 4YAQB 3KPMB 1K5NA 2Q8AH 2Z35B 1DN0A 2XV6B 4AMKH 4OLVL 5IM7A 3HZKA 2ED9A 2PTUA 1QA9B 2J88H 5EC2B 5ACZB 3VWJC 1VPOL 3A0OA 3RVTC 4XZUA 4CW1B 2QQNL 4EI5D 4KVCH 5D7KD 3KXFB 4TOYH 4QRSB 1PKQE 3N1QC 1SJEA 2GT9A 4PJDF 4YE4H 3PNWA 4I18C 2P5ED 3QJHB 2VN7A 5IMKB 5A3IC 1FFOB 5C6WH 2R0LH 5I0ZA 1MREL 4RNRA 4F7EB 3MRBB 5AZ2H 4Z7WF 1A2YA 2B0SH 3MRRB 2EH7H 2ICWB 4MJID 1QR1B 1FBIL 4LGRB 3F7VB 5F7EL 5F9OL 2AJXH 3DRQB 4U6XA 3WXWL 3Q3GA 3UYRL 3ZSSA 3G9AB 4DKDC 1MJUL 4KTYA 4PLKD 4Y5VA 3WSQH 3MLVH 5IMMA 4ZO6A 1AHWA 4YJZL 3GMPA 2DQIH 3M45A 2VLMD 5E6ZA 3TA3B 1EEZB 1CDCA 1YY8B 2FECI 4NHUB 2XFXB 5JXEA 2WV3A 2VZ3A 3TT3L 4Q9QL 4M6NL 4UB0H 2DWDB 4HKBB 1BFSA 1FHGA 1NCWL 3ARBA 3LKSB 4OI9A 3ARDD 1Z0NA 3MCKA 4FG6D 1AD9B 1LO5B 3V6BR 1SYSB 2EE2A 3QDGB 3GKZA 3SEPA 3UTTE 1DANT 2OL3B 3OB0K 1QBLH 5CILL 5E4IA 3KLDA 4U1NB 1AIFB 5D1ZB 1LK2B 1LEIA 5E00A 1S7VB 3UTPD 2IGFH 3T0DA 3LDBC 4HKZB 4PP1C 1OY3B 5B38B 4LSSH 2JB5L 4OGYH 3KPSD 4V1DE 4OZGF 3NAAL 2P49B 5DEGA 5I6XC 1FFPB 3IDUA 4Z0BH 1LP9F 3F58L 3V9FA 2V9RA 1RIVL 3DI2B 3O9WB 1Z9MA 4ZOAA 3VRLF 1R3LA 1L0YA 5HHOD 1R24A 2IANA 1AO7B 3DV4A 2EE9A 3TBTB 1S78C 4JQIH 5TFSH 1SJHB 4Y19D 3BI9X 5EZLB 4MMZC 5EC1A 1K3ZA 1OW0C 4EN3C 4YPGB 4YHLH 5DMKA 1EHLH 2HJFB 3U9PH 3MRCA 1X5KA 1QFHA 2A6KA 2FEEI 2Q1EA 4MZ2A 2BVPA 2HP4A 4XP6L 4NM8L 3MC0A 5DVLA 4U31A 1MCCA 2NTFA 3ELAT 3MV8A 4GW1A 4TUOB 3PWNB 5SWSA 4HWUA 4HJJL 1QFWI 2CR6A 3DYMA 5D1QD 2FATL 1U8NA 4ZAKC 4EOWH 5J1AB 1PW3A 4G9FD 1IGIH 3SDAD 4P2RB 2VQUA 4HCRL 4C4KO 2HWZH 4OI7A 3QUMB 3RY4A 1ADQA 3IDGB 1FORL 4PLJC 2P8LB 4PJAE 4WI6A 4M43L 3ES6B 3SN6N 3TPUA 1EEUA 4XTRC 5C0BE 3HUJF 4Y5YC 5GJSH 4YX2H 4XCFH 4ZOBA 4YHOL 2HKHH 1K8IA 4U3XA 2AABH 3KNBA 4O58H 3Q6GH 2HVKA 5TH2B 3MLUL 4R2GD 3CSYB 5J57B 4PRPE 4JM2B 5LCVH 5T1MB 5ALBL 2R29H 4FFYL 4N1EA 5ESAB 1AGCA 3C60A 3R06B 43C9A 3BZEA 1A7PH 4LEOB 5SWZA 2WUCL 3IRPX 4Z0XA 1A1OB 1QFUH 4U1KA 1FNSL 1JF1B 1YYLL 1LEKB 4J1UB 5CWSB 1C1EL 1NGYA 3K74B 3BPLC 3MGOB 3QHFH 3O6FC 5BRZA 1FE8L 2WBJD 5JQ6L 1ITBB 3QJFA 4N8CL 2X4TA 5I76A 1KLFA 1SBSH 5BVJA 5TPWL 4F7TA 4PYGA 3OJMB 1HWGB 1EERB 3BT2H 4X6CB 3N1FC 2MPAH 1QVOB 2HFEA 4H20H 3AS1A 2BSED 3NPSB 4DCQA 5GGSA 1LGVA 1OSPL 5DR5L 3D18A 1EJOH 4HGWB 4F33B 2LV4A 4TSBL 1EBPA 1XF5A 1RJYA 1Q0XH 1QLFB 1Q9LA 1MEXH 3DO7A 1FZKA 5ISZD 3U7WH 2DLHA 2NTSP 4WUUE 4UBDC 3D48R 1MFBH 1I4FA 5TF1H 4XP1H 1KULA 3GMMA 2X4QB 2VITA 4Y4FC 4OM0L 5I8EA 3ZKND 1BIIB 3WDIA 3K4ZA 3KYOB 4NQXB 2GSIB 3RRQA 3RVTD 4KDWA 2W9DL 3ROLA 1M05B 3OZ9L 5DJDB 2XI9A 3PGDA 2VZUA 4ETQA 4CN6A 1EHAA 3V7AG 4XNXH 4M3JA 4JN2A 3MNZA 5CEYB 4KJPC 4LLMB 6FABH 5DRWA 3LMJH 2ZZUT 5A3ID 3EO9H 3EO1B 5DFWH 4ZFOB 1LNUA 4RIRB 2IEPA 1OT1A 5C6TL 3U4BL 4N9GB 5E4EC 7CGTA 1WC7A 2FD6L 4DN4H 4G8EB 5JOFB 4QRRA 4YIQB 5J13B 4LSVH 1JYNA 4IIQC 5GS0L 4ZUUB 2A6JA 2EDWA 1F4AA 1JF6A 2RR3A 2ICEA 2NY5C 2EO1A 4WY7L 4JFQB 2AI0L 2YPVL 1RFDH 1UWEH 1R3IL 1YEEH 1LEGB 4DOHE 1JUFA 1LILA 5FK9A 4PJXE 2FYYA 1IAOB 2NYYC 3H9SA 3IAQA 5MEPB 2R23A 5AWNL 1Y0LB 35C8L 4ONOA 3RTQB 1U8HB 2COQA 4H25A 1OARH 3PXJA 4JCLA 4PJ5B 2HFGL 2YHGA 5EU7E 1BM3L 3GJEA 4R3SB 2L7JA 1CU4H 2I24N 3C09C 2GTWB 5ITFA 3D85A 3RWJA 4HJGB 2AJSL 3N9GL 4G43B 5IB2A 2W60A 2YUWA 2NLJA 3SDCC 4KUZL 1JWMB 4PP1D 3TESA 3PJSA 3LPFA 2DYPD 1A6AA 2E9JA 2APTA 2N1KA 4OZ4B 5AUMB 4KPHL 4YDVA 1EHNA 5E8OA 4HPYL 1WAAF 4JFPA 1UT9A 4BSWA 3DIFB 5F7YC 1J1XH 1SY6A 2JK5B 2F54A 1QLEL 3U46A 4IJ3C 4P3DA 1FZJA 1S78D 1VADB 2AV1B 5D6DC 3NZ8B 4G6AC 4LHJB 4FMKA 3ALXA 1QEWA 5KSBF 2E7LA 2DIBA 3V6ZA 4QXTA 4X6DE 5MP6L 3H3BC 3C5ZC 5IOPA 3HS0B 3VG0H 1KV3A 3SKMB 1RUPL 2VYRE 2NPLX 1KB5H 3RWEA 1QTYT 3P4LA 1ZANH 1CG9B 4ZAKD 1IL1A 5FUZH 1WBXA 4I3RH 1H3XA 3L3DB 2IPUK 4L1HA 1G6RB 1UYWH 3RJQB 4PJBA 1ONQA 4ONFH 4ACPA 4WUKL 3PWVA 2H9GB 4GS7B 3IB4A 4TVPL 5CEXB 4PLJD 5IBTH 3V5KA 4XTRD 3KPPB 1OM3L 3H6JA 4QXUH 1RZ7H 1U2HA 1ORQB 2HG5B 1GYAA 1ND0A 1BJ1H 1GGTA 2IALA 4PRHB 5DD5L 2R4SH 2AJUH 2V9TA 1BQSA 4QRQA 5L9DH 2F5BL 4I4WA 4TUJA 1R3KA 1KTLB 4YXHH 3UTTD 4LCIL 4PRBA 1BD2B 4G8FB 4JGJA 4QTHA 5ENWB 4U1MA 3ZSTA 2OTWB 3ILPA 5HHPA 1RHFA 4LQ1A 4NQEB 3REVB 4K94C 4RMWA 2NXZB 4M93C 5IVXE 4EBQL 5F3HA 2CKBB 2YEZA 5GQBA 1OP5K 3O6FD 4V1DD 1MFNA 4IRJA 4JAMB 4LDOB 3SDXE 1FGNH 1YEDA 3QIBA 3RL2A 3VXOB 3X3GL 3ZKSD 2X70A 4ZG1A 5F1IA 5SWQB 2VXVL 1MFAH 4PGDA 3VMPA 4YHZH 5LGJB 2BNQE 3FB7B 1JHTB 3O3AA 4X9GA 3QUKA 3DUUA 5EZOL 3D39B 5IROA 1IGJB 3JUYA 4P23A 1DBJH 3GGWB 3X14B 3QG7L 1T20B 3RHWK 5IW1B 4IOIA 1V3KA 5CIPA 3E8UL 3G6DH 3EOBB 2F15A 1I9IL 4JANB 3MNWB 3MNVA 5FCUL 4JZJC 3QUXC 5KVFL 4F7MA 4IHOA 5DHYA 3S5LB 3VGHA 2X4RB 5IJVA 1QSFB 1M7IB 4Y4FD 3RUGB 2Y7QA 4Z7QE 5JW4Q 3I75A 3TO4C 1KEML 3IDMA 3BIKA 4JFOA 3S37L 1JHKH 4EUPA 4JDZB 4KDTA 2B20A 3BHBA 4XXDB 1Q0YH 4IOSD 5KVEH 2XKNA 2P5EA 1K5NB 3FRUA 5C0BD 1MRFH 1DN0B 3RY5A 4XMLL 3DMMD 3DETC 4NZUL 4HFUL 1MRDL 2NY5H 5K9QI 4KJPD 1J12A 4HZAA 4YEFA 4MJIA 4XZUB 4PRPD 2BVOA 4MAUL 4U1GB 1TJHH 4L4VE 1A22B 3VH8A 4Z7UE 1SJEB 3K3QA 5KSAC 2EKSA 3PNWB 4JJ5A 3TJEH 3P3YA 5AAMA 1ED3A 1HYSD 3S34L 4YHNB 1R3HA 1CI5A 3HI5L 4XXCA 5EB9A 4RNRB 5T1DH 5DXWA 2D9CA 2J8UF 2E7MA 4YHMH 1I8IA 4M5ZH 4NO3A 3HNSL 3BKCL 4X7CC 2NYYD 4JR9H 4MXWH 1TQCC 3SE3A 4U6XB 3Q3GB 1JFQL 4Y5VB 2GAZB 4AQ1B 4JG0L 4IMKA 4RDQG 2YSSA 5C7XL 4R26L 2BP3A 1AHWB 3GMPB 3QEQE 2OK0L 5B8CA 5JPMA 2M26A 1P5UA 1S7WA 3VXRE 1OD9A 3OKLB 4G6JL 5JW4M 5EG6C 2JJTA 4MCZA 2PN5A 5D2LB