5DMXA

Crystal structure of d-alanine-d-alanine ligase from acinetobacter baumannii, space group p212121
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
305
structure length
234
Chain Sequence
b'MSNATKFGKVAVLLGGKSAERAVSLDSGQAVLDALLRSGVQAEAFDPQDRSVTELVNYDRAFIVLHGRGGEDGQIQGVLEWLNIPYTGTGVQGSAIGMDKVKTKQIWQGSDLPTAPYRIIVVMAEKWITGREFTISFLNGQPLPVIRLQYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTSHSLVPKAAKAVGYSFDELCVAILEQTLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-alanine--D-alanine ligase
publication title The crystal structure of the D-alanine-D-alanine ligase from Acinetobacter baumannii suggests a flexible conformational change in the central domain before nucleotide binding
pubmed doi rcsb
source organism Acinetobacter baumannii acicu
molecule tags Ligase
total genus 73
structure length 234
sequence length 305
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.3.2.4: D-alanine--D-alanine ligase.
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01820 Dala_Dala_lig_N D-ala D-ala ligase N-terminus
A PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 5dmxA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dmxA01
2IP4A 5HV6A 4O7RA 3SE7A 1IOVA 4IWXA 3ORQA 3AW8A 3VMMA 3JZFA 1KJ9A 1JLLB 4MV6A 4XYMB 2PBZA 4O4JF 3VPBA 2R87A 2NPOA 4M99A 5CB4F 1I7NA 3GIDA 3K5HA 4FU0A 3V4SA 4FE2A 1EUCB 4M98A 1DV1A 1GSHA 2V59A 4WD3A 4C5CA 2C00A 3VPCA 4C5BA 1EHIA 3RV4A 1B6RA 2W6OA 1A48A 2FP4B 3HBLA 1CE8A 3RV3A 4HNTA 3U55A 4O4HF 5IYZF 4C5AA 4J6EA 3BG5A 3G8CA 1KBLA 1CQJB 4L1KA 1KUTA 3QFFA 4HR7A 5C1PA 4M9CA 1M0TA 3R9RA 3HB9A 1UC8A 2R7KA 4XZ3B 4FFNA 5JQGF 2HJWA 4EG0A 3MWDA 2GPSA 2R85A 1KJJA 2XCLA 1A9XA 5J2TF 1DV2A 1VKZA 1KJIA 3MJFA 3GLKA 1OBGA 4DLKA 2V58A 4NYEA 3R5FA 4YBZB 5LP6F 4XX0B 3U54A 2CNQA 3BSSA 3R23A 4IZOA 3BSYA 3RFCA 4ZHQF 5C8YF 2YS7A 3MWEA 4O7ZA 1Z2OX 2W6MA 2YRWA 3LWBA 1C30A 2R7MA 3WNZA 2WYOA 4GGMX 4O82A 2ZDGA 4FFRA 1GGOA 2VR1A 3NUAA 2W6ZA 2GQSA 3TIIA 5LOVF 3V4ZA 4O2AF 5K2MA 2VPQA 4TUYF 5H80A 1KJ8A 1W96A 1T36A 4I55F 5BPFA 3BFPA 3I12A 2W6PA 2SCUB 2ZDQA 3K3PA 1GSOA 4FFLA 5JVLA 2W6NA 2VQDA 4FFPA 3LP8A 4YB8B 3R5HA 3JZIA 4FFOA 2DZDA 4MV7A 4FFMA 4O81A 3N6RA 2CNUA 2Z02A 5HBRB 2DIKA 1M6VA 2GQRA 4MV8A 3E5NA 5KX5F 4IHJF 3N8DA 3ETHA 2QK4A 4EAAA 3U9SA 2OLSA 3DF7A 5CA0F 5LYJF 5BMVF 5C1OA 4MV9A 4MA5A 2R86A 3JRXA 4EGJA 5JH7F 4YJ2F 4YAJB 3TW6A 1AUVA 2Z04A 4O4LF 1EYZA 5I47A 2YZNA 5CA1F 4RZQA 4O7WA 1W93A 1BNCA 4YJ3F 2W70A 3KREA 1Z2PX 4TV9F 3BSWA 2R84A 1CS0A 4IWYA 1OBDA 4MAMA 4O7LA 4TV8F 2NUAB 5DMXA 2X0SA 4EA8A 4O84A 4FGRA 3OUZA 4IIJF 4I50F 4MV3A 5JVDF 4I4TF 2P0AA 1BXRA 4EABA 1JKJB 4EGQA 4ZI7F 4O7TA 1EZ1A 5KKNB 3KALA 2R82A 3JRWA 5D8DA 2ZDHA 3G8DA 4O7VA 2CNVA 5LA6F 2NU9B 3UFXB 4ME6A 2FB9A 2DLNA 4O83A 1E4EB 5EZYF 1ULZA 3R5XA 4O86A 3ETJA 3VA7A 1IOWA 4HNUA 1PX2A 2I87A 2CZGA 2V5AA 2I80A 4WBNF 2YYAA 4XYLB 1KEEA 2HGSA 3KAKA 3TQTA 1UC9A 5LXTF 2XD4A 4DIMA 2YL2A 4MV4A 1I7LA 3Q2OA 1Z2NX 1EUDB 3WO0A 5GONF 3Q1KA 3HO8A 2NU8B 3RUPA 2I8CA 1M0WA 3ORRA 4E4TA 3U9TA 1GLVA 3TINA 1KC7A 1B6SA 1SCUB 4YAKB 5CAEB 2PN1A 2FPPB 4MA0A 1AUXA 3OUUA 2FPGB 2YZGA 3KAJA 1WR2A 2GLTA 4QSHA 2YZLA 2VHEA 5J2UF 1GSAA 1E4EA 3K5IA 1VBGA 4Y8VB 2R7LA 3VPDA 4EA7A 4O7SA 5BPHA 1C3OA 2PVPA 4EA9A 1PK8A 1DIKA 4O2BF 1KJQA 2NU7B 4HNVA 2YS6A 2NU6B 3AX6A 2YW2A 4M9UA 4ZQIA 2W71A 1VBHA 5FNVF 4O7YA 3WO1A 2QF7A 1JDEA 2DWCA 2YWVA 4HQ6A 3TIGA 4MV1A 2J9GA 2R7NA 4ZOLF 2YRXA 2GPWA 2W6QA 1CQIB 5JQWA 2FPIB 2YZMA 3VOTA 1JDBB 4O7NA 4O4IF
chains in the Genus database with same CATH superfamily
4GT1A 4QTYA 5GOTA 3MWYW 3V33A 1IPHA 4PX3A 1N2OA 2O2GA 1J9EA 1J25A 4R68A 4HVTA 1FRFS 3VR1A 4EF4A 1NVWQ 4IDBA 2F7SA 1EDEA 1FDUA 1NNLA 4F0JA 1PP4A 3DMHA 1JJVA 2ZBRA 3L0IB 1OBHA 3T4PA 1G42A 1EDOA 1N5LA 5EESA 3WWJA 2PZEA 4CV3A 1NP6A 5CAEA 1G20B 3S27A 1ZW6A 3CUVA 3VPGA 1WPRA 5LZ5A 1CQZA 4N18A 1I7NA 5IJWA 1ZK2A 2QNIA 1JNXX 4EKYA 5C5EA 1Z6ZA 5ICGA 1UCFA 4MWGA 4WXPA 3RVQA 1Q6ZA 5JS6A 2QW8A 4FE2A 1P1HA 3PIIA 4OQXA 5I7AA 3TQSA 4EO4A 3GCGA 5LDDC 3ZCTA 2CEKA 2J3KA 3M3HA 4UUGA 3F4BA 3OQIB 3T52A 3I5XA 3GMTA 2Q7DA 1JV2B 1E1DA 1JDJA 2OFPA 1QE0A 1OBFO 2MDTA 4AS2A 4XTCS 3HO1A 1PL7A 1G6Q1 3HB5X 5HPYB 3JQAB 4IOJA 1S3FA 5DX1A 4INOA 1HDCA 3MIIA 5ECDA 3QWAA 2PZMA 2FOXA 2X4IA 1IY8A 1JAHA 2Q4BA 2WVHA 1XZPA 1NW4A 2HO4A 2QS9A 1IBKB 1HBJA 4FHCA 4K5QA 1DI0A 3V1LA 4P35A 1BXGA 1HOTA 2FJ0A 5E6SA 1KDVA 1AF7A 1ZC4A 4HGOA 4MINA 2B36A 2Q4OA 4L07A 4FGJA 1SUIA 1A9YA 4UQLA 3I4CA 2B78A 4S1WA 1NUAA 3H7AA 2JGLA 4O8CA 4ZO9A 3NBXX 1IC6A 2ZXEA 1L7OA 2OV6A 2XT0A 3HRKA 2E87A 4HS9A 1BSVA 4NH0A 5DM60 5EQFA 2LR0A 1T15A 4GP6A 1JQKA 1MQAA 1PWEA 1V4NA 3K0AB 1QYVA 2Q6IA 4FR5A 4Q6BA 3FR8A 4AS1A 4DT1B 2CLIB 5AKEA 4PHTA 3LX6A 3IT0A 3IAXA 3OM0A 4U3JB 1GRCA 1W5BA 1FJGB 4Q7EA 1I13A 4HX9A 2JASA 2Q21A 1XZGA 1V8DA 5K45A 5IVIA 5JS1A 3SHTA 4G1EB 2F00A 4LYDA 5JPCA 3AEKA 4FNGA 4QULA 4NPAA 3B1KA 1KMHA 1UMBB 5GOZA 2JIDA 4LDAA 4BJHB 4A4DA 3I0MA 5JC1A 1L4NA 3E9RA 2JGIA 4DQLA 1T1IA 1YRWA 1CUFA 4GOOD 3VZQA 5CA0A 5H8WA 2H2WA 4GLWA 2JCVA 4TS9A 3ZCXA 3B51X 3ZLTA 4HPWA 3IKJA 4R84A 2K2WA 2Q0SA 3FCOA 1C7RA 2ONCA 3RARA 3KHTA 2MU1A 5JZMA 4U7DA 5JISA 1D2RA 4F86A 1RRFA 3DZIA 1Y7IA 4MYUA 4NBRA 4EG0A 1GQRA 3NETA 4CKZA 4POOA 3Q3GE 2NQ2C 1K8XB 2OUKA 3QX8A 4H6WA 2FPMA 1R9GA 3E1GA 3TTVA 3IDAA 4J7AA 4MQMA 2FI1A 4KQHA 1EG7A 5C5DA 1GGNA 3BWDD 4LYAA 4GICA 4HUQA 2ADFA 2D2VA 3ESXA 3MSXA 4WK0B 4WRRA 3LT1A 5EKUA 2FU5C 3BMQA 4PX9A 1P74A 3PXBA 5IAKA 2ILVA 3C6MA 3ZCSA 2AFHE 2PUGA 3OO0A 2G28A 4O25A 2Q3EA 3CGGA 1RJFA 1KL7A 4YV2A 2IBSA 2WZCA 4UCOA 4P83A 2ZCJA 1QV6A 2WG1A 1QCDA 5DULA 3ZE0B 5U4QA 4COKA 4YC7A 4IQ4A 5FPYA 5HF6A 2V4ZA 4UM9B 2B0CA 4E22A 2ZU0C 4UVHA 4HLUC 4ZYTA 4Q02A 3RJMA 1KA9H 2H3EA 2NZ8A 3BSSA 3CEMA 2CC2A 3DHYA 3WLIA 5IT4A 2EX4A 2XRZA 2R9VA 3N2GA 3NOQA 3EPPA 3O38A 1G2OA 1C1XB 2CFOA 5BSRA 4A8JA 1UJ6A 4NMMA 2W2OA 4OLBA 1Y3BE 3L79A 1E7RA 4MUYA 3SOZA 3G1UA 4DV5B 1IZZA 1N7GA 1TRKA 4MARA 4W9MC 1KXZA 2FUG6 3LNTA 4R2HA 2BR3A 1VSBA 3OX1A 2OXEA 4Z7QB 5KYGA 2BMAA 2VKQA 4D80A 5LQDA 3PC6A 2FVXA 4KO8A 3D59A 4DV3B 3QVSA 4MKFA 1Y6RA 2EP7A 4JBNA 3RYIA 3DT9A 1FMLA 3PDIB 2OKGA 5FNZA 4EUNA 3QVMA 3DEYX 3T1YB 4S1NA 3B6EA 3L9XA 2VR1A 3PQ3A 5K0GA 3ZVKA 1QQBA 3TJZA 3N8IA 1Z2AA 1Q1GA 2C4WA 4MRNA 4YRKA 5KYYA 3QTBA 5TT1A 3OPYA 3LCUA 1PT5A 1AXEA 2BV3A 3KOOA 3R3WA 3UCFA 1AV6A 5H3LA 1PL8A 2FQ1A 1QH9A 4B17A 1T91A 5BR7A 2BRUA 1Z2CA 1E0SA 1OIVA 1UM8A 3HDHA 4LJ7A 3UVEA 5JSHA 4PO9A 4QUHA 1GXSA 1RLOA 3IC5A 3ON5A 1DWOA 3WG9A 3K0HA 2ZLBA 4JGIA 4ZMRA 3GV0A 3FF4A 3OE7D 2NYUA 4WZBB 4AJJA 1TIBA 2WU1A 4HTFB 3BMCA 3OWXA 3DDZX 3I28A 3P71T 4CHIA 3QU5A 2I4MA 1GKKA 2BZ0A 5FL7A 5K8TA 3BGOS 1TM5E 3DOFA 3IESA 1YTUA 4PAWA 4HAYA 2HCJB 5DM0A 5C53B 1RHRA 2R96A 4YB8B 3AQ4A 3M9LA 1FFDA 2Q4TA 1PV2A 3EQ9A 3PNPA 2ZAGA 4Z9YA 5KTYA 4LX0A 2JARA 5A6SB 4NJEA 5GIOE 2XKBA 2IYQA 4QXOA 3K15A 2IXFA 3ELDA 1QV7A 3FKSA 2HMAA 3V8RA 4OL9A 5KYWA 4OI4A 2CNBA 3MXTA 1Z6GA 4AO6A 1U0NA 3K1ZA 2QRVA 3V2UA 1M83A 4G63A 2EBUA 1JMYA 4Y9UA 2GBIA 1P1IA 3IP9A 1AZSC 3IT2A 3WWDA 1Z3IX 4MV8A 3B38A 2QQEA 5E2BA 5EHQA 3ZD8A 5LXTA 2HWKA 2ZIZA 4Y1FA 1G4HA 1OZFA 1M8JA 3DE7X 3MCVA 3E5NA 1PWYE 3VNQA 4EJSC 2FMFA 4KPGA 1P0MA 1X94A 3A0RB 5EXXA 1KDPA 5M3BA 1GL6A 2B25A 2JJ1A 1M2HA 2G09A 4IPTA 3ZWPA 2IBMA 1Y6FA 3U6KA 2P3SA 1DC3A 2IHBA 1E1YA 1UBJS 2R6AA 5FPQA 2ZM5A 1KZ4A 4QATA 3NGXA 1G8MA 4QRDA 1T6NA 1HMPA 1JAZA 4RGBA 2R8ZA 4YJGB 4EDFA 2KMLA 4OHYA 1PF7E 5KTKA 1KS2A 5KYUA 1GQSA 2OWDA 4L0CA 5I7WA 5TF4A 2XUKA 5EKTA 4EK9A 4BMZA 5ILOA 2WWIA 3FI0A 1J1IA 1G2IA 1GITA 2FZVA 4GKJB 5I5YA 5KQRA 1V8ZA 4RXMA 2NQTA 1DBWA 3GCZA 2ZWVA 5IKPA 2H9YA 5JAMA 1QGUB 4FBGA 1FLAA 1NX6A 2CYBA 3PYLA 5FUWA 821PA 3GW8A 3T1TA 4PVDA 5SYNA 3FOZA 4UD2A 4L2IB 3RO7A 4C7KA 4YJ2A 2QTRA 1WB6A 4Q9DA 1Z15A 4BC1A 5JWRA 1I7PA 5FYDA 1M10A 1BG6A 3SVLA 1X2BA 5C8ZA 5HX7A 1SOMA 4L85A 3W0LB 3WHIA 5LDHA 5KHAA 2OFFA 3ISVA 3PRKE 2ZRNA 1XNGA 4TVBA 4IWYA 4NWIA 1M7HA 1OBDA 4QO7A 3CTMA 2O2YA 3ME5A 4H9GA 3UGJA 4LAFA 5FO0A 2VG8A 3HHEA 4H7KA 2UXDB 1NDQA 2JFFA 2C7OA 1SCDA 3NVMB 4B0PA 4NCXA 4JT2A 4NVRA 5DEOA 4BNWA 5IKEA 2FJPA 1QIHA 3UKJA 1O8BA 1ZK4A 5DSTA 5ER9A 3EISA 4A0RA 3TIFA 4R9VA 2PTGA 1GT6A 2B34A 2QD2A 1VHJA 5F5NA 3M6MD 4B6GA 5F33A 3G0OA 3DMFA 3FYDA 4FEGA 1FRNA 2CLMB 4JNKA 3LLMA 2HSDA 2IOQA 3UCXA 1WNTA 4WHMA 3CF0A 5IJXA 2K5UA 2WIBA 1G7SA 3A04A 4GI1A 1RW4A 1GG2A 2JGRA 4LOIA 4MR9B 1YACA 1A88A 1Q22A 3LT0A 4DMRA 5FLXA 2DRIA 3NJ8A 3A9UA 3HDQA 3SX0A 2IXBA 3BMNB 1L5KA 1JIQA 2GUGA 2Y4RA 1PFKA 2O6LA 2X0RA 3Q2KA 3TD9A 4FUTA 3ZZ0A 4JLOA 5FOXA 2B8JA 1P80A 3P45A 5DN9A 1ZBQA 4IDQA 1ZCJA 5B3JA 2R6JA 5AOCA 1Y1PA 1JSCA 5HWSA 4J0DA 1JXAA 2A9JA 4KR0A 1M33A 4PG7A 1M6HA 1GPJA 1TNDA 1W4RA 4QUKA 4ANFA 2QPLA 4OX9Y 5K2OA 4EHKA 1X14A 1Z17A 2AFVA 3N8KA 3QNUA 2VH2A 5KWSA 4RD6A 1N3IA 1Q2XA 4J2OA 2V96A 2VPWA 2X3YA 4LJKA 4BKMA 1AA6A 3BGIA 3BXOA 4MRVA 5FX2A 3B2QA 3NHUA 1YHZA 3QUBA 1V6AA 3BFKA 1G5IA 3JAKA 5D1NA 4YRGA 3T5AA 3KDSE 10MHA 1FMJA 4Z49A 2I80A 1AS0A 5HF5A 4BDTA 2PSFA 3R3UA 2A2ZA 1VYTA 5A7FA 3ZTTA 5IH3A 1ORWA 5K6AA 2C5SA 5JNUA 3ZWXA 1NAIA 3N53A 1T5LA 3EQZA 1DCFA 2I6UA 2PUFA 4RTSA 4NATA 1J2YA 4GPIB 1KU0A 1E2PA 1DARA 4DGQA 3LL7A 2HO5A 4NCNA 2WAXA 3KEGA 1ZM3A 3IV9A 1V7CA 3M70A 3OJ0A 3NPAA 4E4RA 3L8GA 2PIDA 4MZXA 2PSHA 4NCHA 4B8YA 2Q62A 4OXKA 1X8JA 3VDRA 2OCDA 3ECCA 1XJ0A 2JF0A 1U0GA 4DAAA 1PWXA 1Q14A 4B6RA 2HRBA 3IDOA 2LCFA 3QXSA 4H3VA 4R40A 4ZQEA 3D6HA 3RG8A 1U1FA 1CZLA 2OHGA 1GO2A 2VAVA 1E0JA 3UGTA 1T2CA 3BMOA 2ECFA 5BSMA 1I4DD 5EMNA 2PCLA 3G0GA 1NZFA 4OGGA 4F9GA 5IVHA 4Z9XA 4CLXA 4ZHQB 2PQ2A 3UYYA 1T8TA 2CUNA 8OHMA 3PEFA 2L42A 3VU0A 3C4QA 4FLFA 2WIFA 4NAHA 2GK3A 3FSRA 3PJRA 3EMDA 2Q9CA 3AM5A 4GPZA 4ML3A 1H2AS 1RYZA 3LY5A 2HN9A 1E9FA 1Z6PA 2ORED 1CZHA 1ZH4A 1Q2UA 3CWQA 2VUTA 3MQFA 4WCDA 5K3AA 3LZDA 3EG9B 3KAQA 3STWA 1XRPA 4C0SA 1SQ6A 4MB6A 3ROMA 2NU7A 1W0CA 5K0LA 2ZSJA 2QTZA 1GUBA 2ZUDA 3OTWA 2ZJZA 4A0SA 1DKLA 2JW5A 3E3MA 1VXRA 3DLAA 5GP1A 3H5WA 3ZKWB 5T4FA 2O2ZA 3SM9A 2KB0A 2PD3A 3DFIA 4IH9A 3SCZA 2WK1A 3O6VA 4M6WA 3VZCA 2JHFA 2NAFA 3L0PA 4C07A 3I9OA 1Z4QA 1DX6A 2OMKA 3DMNA 3DLPX 3FR7A 4G84A 4AMVA 2X5KO 1XDSA 2WIDA 4XAQA 4GL2A 1XHEA 4EUFA 5GVSA 3ZHTA 4WQMA 5DNVA 3DWIA 5C3MA 1FE8A 3X1YA 1K75A 2P1DA 5L3QA 3QWHA 1YKGA 2H16A 3RI3A 4BAZA 4P3KA 1E4EA 3FRJA 3IAEA 1O0SA 3IP7A 1SELA 4BRWA 1XVIA 1E58A 1T3LA 3UM9A 1T4BA 1W29A 5CLHA 1Y6ZA 1E8DA 2PZ8A 5FTJA 1E1RA 1ZGGA 3CX7A 1Y8AA 3HU2A 1HFKA 2PT5A 5BPHA 2X14A 2G5TA 3AVPA 1HLGA 3D31A 1RJ9A 3I6MA 1FRVA 3L1JA 4JFAA 4W1PA 5KNDA 2W0MA 3C3YA 5CDTA 3BCUA 3G1WA 2HA5A 5EIAA 3PBKA 2QBYB 1KI9A 4IXWA 2QTVB 5H5JA 5T3UA 1YD7A 4Z0PA 4QXAA 3QLVA 4DSUA 2A5LA 4P34A 3O8RA 3PHHA 1UBOS 2AOXA 2UVPA 3M3DA 1KQNA 2ZQZA 3F97A 3C98A 4JMPA 4F8YA 3WYCA 1O8CA 4TKUB 2EF1A 1JSZA 3L0ZA 3OFND 5D1HA 2QPTA 3DPUA 4KR7A 3OT5A 1NP7A 3T7SA 4ILEA 1OI4A 1GCAA 1M1YB 3CZRA 3BTSA 5K7SA 2OY0A 4FR2A 2ZR0A 3STVA 3KO8A 2DJ5A 2ZVJA 4HGPA 2JIPA 4HDAA 5M29A 5ALGA 2WTEA 1GHTA 4CW7A 2LBPA 4B2IA 5C5IA 5I7UA 3KTOA 2IIVA 4FGSA 4B44A 2QN6A 1CQIB 1XEAA 4HNHA 4LXGA 3REQA 1B4DA 4HGZA 5LNK6 1ISIA 3T7TA 3QPCA 1L5GB 2FWJA 1SVKA 1YI0A 3KJIA 1B8OA 2VHVA 1GZVA 1WMBA 1R0RE 4K9DA 2ZJ0A 3ZDZB 1DEHA 1Q1ZA 4IO1A 4DQUA 1A82A 1MA3A 4ZJUA 5GWXA 1RAIA 4XIYA 1JDUA 1IOLA 1F8XA 1L3IA 2CDBA 3HKCA 4R3NA 1P4GA 3W4JA 2G1PA 4CEJB 5DF1A 2IELA 3Q40A 3JZFA 2H4XA 2LVBA 5CB6A 3VPBA 2YH2A 1NN3A 4UAGA 2XUJA 1ZLYA 3K9FC 4EGFA 1G5RA 3VXKA 3DBRB 2OP0A 5AHXA 3NVKI 5IUKC 3DCJA 1Y89A 2XCSB 1HFJA 4QM6A 1L0BA 2G5PA 1KJWA 1V9PA 2D2XA 3DDOA 4LK3A 3IURA 3SX4A 1Y7HA 3MS2A 4CF7A 1QRTA 3NC0C 1N0IA 2FJUA 2HVRA 2C2OA 1UBGA 3EBPA 1CUGA 1NE7A 3JQ9C 3P19A 2IV3A 3EGXB 3E9DA 3VYSB 1A9SA 1MB4A 1GU1A 4QICA 4UU0A 4QFBA 2IGBA 4FYMA 2J9FA 5GV8A 3V4SA 1BD4A 2IOYA 4BO9A 4E08A 2HCRA 4MB2A 2YHIA 3GHYA 2XNKA 4LYYA 5B58C 1NBMA 3E23A 3H0EA 2HBYA 4OQZA 3ABIA 3KDAA 3WA7A 3JQ8A 3MWEB 5F3RA 3L4JA 1ZXXA 2VDJA 2OD2A 4J0KA 1MC8A 1UFQA 2ODQA 4FOTA 1R9MA 3E2PA 5JASA 1ACLA 4PS0A 1QVWA 3WLOA 3IEUA 3THWB 5D51S 4G81A 4UNNA 1MT0A 1B00A 5E25A 3SQNA 1FFXA 4DIUA 1GTVA 3GC6A 3GXBA 3NHPA 3PYMA 3GQBA 3IXQA 4BX9A 4HQKA 4MV5A 4XUEA 1K5PA 1EH5A 1C9YA 1DAFA 1R3UA 1Q12A 2XTAA 4GYKA 2O6HA 5DISB 4LJLA 3P97A 4B76A 2HHCA 3RV3A 1H1LB 1E5LA 5I9BA 2XA9A 4DA6A 2C59A 2OVBA 3U55A 4MQBA 1GVHA 5CX4A 1GZ5A 5HUHA 1GR1A 1GY8A 1LQTA 2DULA 2NU6A 4QOHA 4CKEA 2Y1KA 4ABTA 2GHTA 3RC9A 2BIFA 2XT9A 3ZI7A 1NI4B 1VSQA 2MR5A 4P7GA 3VTZA 4FE4A 1YZ3A 4QRIA 4CFZA 3QHAA 4RADA 3CLTD 2SECE 4D8XA 1CY1A 3CF4G 4X90A 3IFSA 1MAUA 3HRHA 2BKEA 3PB3A 3V1TC 3F1KA 5IPFA 4JHXA 1QJCA 1M2VA 1NPDA 3LC2O 3R0QA 4HMPA 5IM5A 2WWYA 3I9V1 3TB6A 2FN9A 4F3CA 2P2DA 3X44A 3GPCA 3A10A 3IIKA 4UTRA 3WFZA 5HK9A 2XCIA 2G83A 3AO0B 3MINB 3NJRA 2R7KA 1G1AA 3TBFA 3CONA 3UK0A 1ODSA 5D3KA 4BZQA 2XZPA 1MX3A 1YSCA 2G9NA 3O31A 5JU6A 2GPBA 1PV4A 1TJNA 4ON9A 2C9YA 1SFRA 4LC1A 3PCTA 2X2EA 3EZNA 4U8HA 3W1BA 1XTZA 2I7CA 3GRRA 2ZUBA 3VVLA 4A16A 5KYXA 3BRQA 4N6NA 3IV7A 1ADFA 5FBRB 5CM8B 3BAAA 1WPXA 1KR5A 4KGXA 2IZ1A 1HH4A 1EJ2A 1U1DA 3HCEA 3L8EA 3O1JC 4A8PA 2BUCA 1Z6TA 2QR2A 3QX3A 2JFHA 1TK9A 3CPHA 5ALIA 3UT6A 1J9GA 1YQXA 2NG1A 2C5LA 3OLQA 4ZC1A 2CBZA 2J7PA 3SLGA 1HE1C 3WMRA 2I4OA 3SEZA 2MINB 4KXXA 3VNRA 1X1EA 1QU3A 3GRZA 1TXGA 4RJ2A 3WADA 3BZWA 3C1AA 5J59A 4CV1A 4BGDA 1WSDA 2Q8QA 1EGAA 2J4FA 2JCBA 2BMJA 4L6AA 2JAWA 3P2JA 1U94A 4O29A 2QX8A 1I7SB 3DBHA 2GNOA 5CD1A 4TPKA 4EY6A 1E5TA 4RS4A 2D3WA 4TL6A 4YYZA 1TT5A 1NGSA 3ZUGA 1E92A 3LK6A 2OA0A 5JW6A 2R4QA 1X9HA 1NC1A 3CV3A 2EFEB 3LRXA 5JBNA 2QXYA 1PTJA 1WXEA 2EQ5A 5JDIA 3QEOA 2YS7A 5TE9A 4MWTA 2FEOA 4G5SA 4KWEA 2FH5B 1GPMA 4WOJA 3UW3A 4J9VA 4N48A 1YDFA 3CVVA 2GYYA 1Q0LA 2QSZA 3D3NA 3UB3A 1G16A 4I66A 1IZ0A 2BE9A 2RHGB 1T2EA 4ZV9A 3TNJA 3A7DA 3DZHA 1DINA 5EJ7A 4DLPA 1ZL2A 4UHFA 4GGMX 1XD2B 3VYRB 1WXHA 4I5EA 1XPUA 2IHZA 5FAKA 4FOLA 3EA0A 4E4YA 4KITB 4EHHA 2SNIE 5HUQA 3LM8A 3B6ZA 3JVIA 1XKQA 3WWHA 5K8UA 1O9HA 1ZN2A 1N6IA 4LJ5A 3TTWA 1RYMA 4JUCA 3TLAA 1TTQB 4M9RA 2ZBDA 1I6LA 2GXSA 4X6YA 1E94E 2JFXA 3K72B 4UCVA 1CUIA 1RLJA 1WMDA 4KR2A 3L7JA 2W6CX 3OZ7A 1MH9A 1T2VA 3RFFA 2J5RA 1KFCB 1HYBA 1Y9JA 2GARA 2QJRA 3HJRA 4IJWA 4R9UC 3B53X 5CDFA 1E7SA 1KYTA 1Z39A 3FB4A 2DP4E 1XVUA 4LX8A 3PC8C 1EP1B 4F5YA 1D6JA 4CLOA 3QXHA 3ANXA 1QG6A 3QU4A 4UAVA 5KMGB 3GDEA 2EDCA 3IXMA 4MQFA 4WSOA 5ILQA 4GR9A 3P52A 2XMDA 1U5AA 3HFSA 3NM6B 4M0KA 3FWPA 1Q0RA 1L7QA 2IGTA 4BMPB 1DUIA 1OWPA 2C4NA 2Q3CA 4GM4A 4QQ8A 3VNUA 4UTVA 1PZEA 1SUPA 4IV0A 5HCUA 3KT0A 3CSSA 1L8QA 3BX1A 3G2IA 5ITSA 4JSTA 1IRXA 2NZYA 2H2IA 3KQUA 2HADA 4XEHA 4XDZA 4M1SA 5KTOA 2ZRQA 3IIMA 4I8IA 4QQKA 1EVYA 2FPUA 3PR1A 4RY9A 3EQ2A 3D7SA 3R8CA 4M0CA 1M6VA 3J81A 2FFHA 3EXFB 3C97A 4PW0A 4WEOA 4GVXA 4YMWA 4FZJA 2N9UA 5I5WA 1NONA 2ZBUA 2BGMA 2F4VB 1NL3A 3EVBA 2F43B 4JU9A 4IHQA 4M22A 4Y67A 3DP7A 1TTHA 3PD7A 3BDAA 4PGHA 1DJLA 3S0JA 3TL6A 1DKMA 4RM2A 1MUUA 2AYZA 3CH7A 2VP0A 1QC5A 2TRSB 4R7GA 5E7IA 4MDYA 1OX6A 3NOVA 1STOA 2P67A 3EGDB 4ITVA 4KN8A 5CA0F 1L8XA 1KAHA 1T3SA 1VMEA 4WXRA 3HUFA 4JL5A 2F3PA 3A4VA 3STXA 4B75A 4PLPA 3FW1A 4Q4HA 3F90A 1KE2A 4C4RA 2GTIA 4DIFA 1LC3A 3WKAA 1MABB 1NULA 1KVRA 3ABSB 1VRVA 3D7KA 3QKSA 1YS9A 4HAOA 4LE2A 4S1VA 3SQDA 2MT9A 1TMYA 3VV2A 4KQMA 1CQXA 5ILGA 2ACEA 4AD8A 4BBAA 1F2TB 4CKYA 1AC5A 4B3BA 2VDRB 3LT4A 4IP0A 3ZK8A 1T6BY 3WR5A 1M74A 2PO5A 4HDMB 3VU3A 4WKBA 2A94A 3DDSA 3DV2A 4F4UA 5I48A 2HAEA 4NE2A 4K1LA 1MV5A 4I1OA 1J2UA 5CH8A 1MDFA 2AC7A 5AVWA 3KNZA 1GQOA 3LGSA 1UP6A 1ITZA 3HL4A 3X2SA 3V5NA 2LV8A 2QRPA 3ONEA 1Y48E 5G4LA 1FSZA 2ZATA 5EYPB 3QJ5A 4QVIA 1G5PA 2CCKA 4B82A 1RXCA 4BVFA 2REOA 4XGQA 3TOSA 3AGPA 4IIUA 4LQLA 3X43A 1CS0A 3DL7A 1ELOA 2PH1A 4EW2A 1JT2A 2XA1A 1I30A 4M87A 4PAQA 4C20A 2O1WA 3VZPA 1II8B 4BRUA 2Z6UA 5ENZA 3FTNA 1SXJB 3EQ8A 2D7JA 4TLAA 3Q3HA 5AJUA 2BTQA 3PFBA 2I6SA 2WSSD 4IL5A 1N57A 4XLZA 3UIEA 3K0SA 1P6QA 4OMDA 1N5IA 4ZVSA 3TEKA 1XLVA 2W6JA 3D1LA 3SC3A 3LXMA 4D7AA 1T9DA 2P68A 3WFIA 4IOMA 3SX2A 2HSEA 3BE6A 4ZEXA 4DADA 3DV9A 5IASA 2PJRA 4C22A 1JQEA 2P41A 4Y9RA 1L6IA 1S3SA 2QUAA 5DXFA 3V4LA 1DHRA 1XMOB 1FDOA 4M0DA 1NLZA 1HZZA 5DBEX 2BDUA 5CXXA 3K31A 4A1FA 5KQGA 6AT1A 3DMTA 3G8DA 4ZT2A 1JPUA 1ZUWA 1JR3A 1RPAA 4JH0A 4NE7A 3MCUA 3UY4A 1UPUA 1UZLA 2IOFK 2V7VA 2GEJA 3FVWA 1PDVA 1UPCA 3NHKA 3R6WA 1Z7BA 1A8QA 1A5SB 4Z7JA 4HN4B 2IVZA 3FCYA 2XDYA 5EEHA 3WLNA 3KQOA 1RLIA 4OQFA 4B46A 2YDYA 4IUBS 5FD8A 1MOPA 2ES4A 3SYMA 4DR3B 3MS4A 4D92A 3AKCA 3T5BA 4QWMA 1WQ4A 2Q3HA 1WKCA 2VHWA 2DWPA 1PX2A 3L92A 4EWLA 3FTFA 1EKPA 3ZDAA 1T8UA 2C5GA 4PSAA 2E4ZA 4ZVTA 4DBLE 1VCIA 5FUBA 3I61A 1GRRA 3RYHA 1K3FA 3EUAA 1CDDA 1U7HA 4Q3DA 4QJ3A 4U2KA 4Q7KA 4KAJA 2QYOA 2GKGA 4RGQA 1SQFA 1X1BA 2PY6A 3FVRA 3MTBA 5T67A 1WUKS 4L5IA 5IN5A 1HXHA 4D6XA 4EB3A 2R66A 1X1DA 2X0EA 5B4VA 3ZHSA 1WBBA 4NU8X 4ZIRB 2XWQA 3CLRC 3IBCA 4QT0A 2FMUA 5JTUA 2AXNA 3GEMA 3ITDA 1PR9A 1U8ZA 2W2VA 3FZQA 5LXTF 4RQUA 5JLAA 5HKKA 3F47A 5REQA 4F9FA 4D5GA 1GUFA 1CF2O 2XUGA 4J16A 4G0UA 2TECE 3QELB 3UHPA 5K3EA 2PV0A 1XQXA 5D6NA 1BFKA 1TMGE 2HQSA 2OGUA 5DYYA 4X3CA 5J1TB 1NNEA 4W1SA 1FZQA 4EBBA 3AZOA 4A8TA 4RA9B 3HKDA 4LGVA 1R6XA 1V9SA 2EJVA 3DZCA 5KAMA 3C87A 2EX1A 1JPVA 1Z74A 4W5RA 3QNWA 4D99A 1CKMA 4BKUA 1VZ2A 3MGBA 3PHJA 3PX2A 5K3BA 3L5OA 4PAOA 3QA3E 4B6SA 4GM1A 1AQIA 2PYZA 5DO9A 2J0SA 1OKKD 1GGMA 3E6AA 3SK0A 2WVJA 1KY2A 2VUUA 1A3CA 2AFIA 4XCVA 3RUHA 1N75A 2VZ8A 3VO1A 2GLXA 4R54A 3EVNA 4RTOA 1P2UA 4IDPA 1VM6A 1AM4D 3CRW1 3ONWA 4IQFA 4PZUA 1GLVA 4B6FA 1Q74A 2ZTHA 4ER6A 4PZ0A 3FI9A 3WNCA 2VYNA 5DM4A 5JO9A 4LVUA 3NATA 3SBEA 4NK5A 4CM8B 4Z54A 4YUAA 3LVRE 2G0NA 4C0BA 1UH5A 1V9CA 5LQAA 1VJCA 3O4JA 1Z26A 3D6TB 1LS6A 2OYCA 3M1YA 4JYMA 1PD0A 2FX3A 4QPJC 5FBQB 1K3UB 3FSGA 3U7HB 1ZD5A 2W90A 1HG1A 5KWVA 2X8WA 1HL3A 4EM6A 1PR0A 2C61A 1FUKA 3CNQS 2H7YA 1C7EA 1T5DX 2RSLA 4Z1MA 3GJRA 1WP9A 2ZWOA 1BE6A 3FPHA 1T13A 1RBZA 1WR2A 1NYQA 3GBSA 3MCZA 2ZSDA 4TGLA 2ZQ5A 5E0OA 2DEUA 3BT7A 3KB1A 3M4YA 4RC9A 3UHAA 3IMCA 1U4SA 2RAVA 2EJTA 1GUZA 5J2UF 1NTOA 5AJYA 1H2ZA 3VZRA 2UYGA 1JWAB 1CFJA 1XEFA 2B21A 3QW2A 3R74A 1RLTA 1UJNA 2BYTA 2A3NA 1CJVC 1IJKA 5JADA 1ID8A 4ZN6A 3RSSA 1AN9A 3A27A 5H3HA 4DV0B 1WCYA 1IATA 4HUTA 5DCWA 1X7XA 3ZEAA 1U9ZA 4QDTA 4I6EA 5KOJB 1IJBA 1ZK3A 3PFWO 1K0UA 5B6JA 1RXWA 4MVWA 1JSRA 3ZCVA 1BEEA 2BBWA 3L7BA 4Y2QA 1Z35A 1M2EA 4WXMA 3W2TA 1ULAA 4JI1B 5FB3A 4G1BA 1GIAA 1PZNA 3H2KA 1AKUA 4RMIA 4GMFA 2JGNA 2QLNA 5D5HA 4RENA 4D9IA 4KFUA 3TRIA 4JC8A 4JI0B 4OXXA 2H8KA 3DCIA 4B4WA 1L8LA 4C7BA 421PA 4UUOA 5INTA 2O20A 2GDJA 3ZGXA 3DMPA 1DUVG 2YUIA 3UTCA 3P2IA 1KWKA 3N7AA 1EVQA 3EY4A 3FYHA 4DAOA 1YOVA 4Q21A 1EGVB 3W1WA 2YRXA 3V8QA 5J4KA 3ADDA 2Z4RA 4MQ4A 2W6QA 2C96A 1LSSA 2AZ4A 2FCAA 2J0UB 1QRAA 3D9QX 3VOTA 3GDFA 3GEHA 3IQHX 2XZLA 3OM1A 1NVKA 1P62B 2X4GA 2PJZA 4FKMA 1DUSA 3SDBA 1CUWA 4DJ5X 2ZYSA 2AG1A 1U0FA 3EODA 3QV1A 4UNIA 3DBLA 2Q4DA 2QTWB 1WBDA 1FCJA 1RVDA 2J0VA 3EIUA 3AUYA 1EX7A 5ICMA 3I8XA 3PJFA 4IDCA 1BWSA 2ZIUB 4PZ7A 1ISPA 2CNDA 3E1KA 3O2JA 4K3UA 4PSKA 4AXBA 3T5PA 3AESB 5FPTA 5FT9A 3G85A 3ZHOA 4CKXA 1ZIDA 4UFOA 1T8YA 1U2TA 3JSAA 4YP9A 2IZ0A 5KQSA 2BRUC 1SCUA 4X8HA 5AR1A 3WISA 3GMDA 5F1OA 4AY3A 4B73A 4GFDA 5IAOA 3JARB 1RWBA 2PKYX 4M99A 1UC5B 3T3NA 3C7CB 2JLUA 3NOOA 1O94D 2FHPA 2TMDA 4CF4A 2P4UA 3ANSA 4YMIA 1K7SN 3I8OA 3LPMA 1JEYB 2ONJA 3LHDA 2H5IA 5C7IO 1E2MA 5IVKA 3TW8A 1Z34A 4ITRC 3CU5A 4L74A 2BFFA 2OQ2A 5FADA 3VKWA 4RCNA 3K6RA 2VJLA 5B2ZA 4MAFA 1AVTA 1FS4A 1XE3A 3O8OA 3UMSA 2NP7A 1WOMA 2VJOA 3ZXXA 4W9RA 3SXPA 1ZITA 5F7OA 2PD4A 3V1NA 3E7XA 4EHBA 3A2LA 3X0DA 5K0BA 1EXDA 4GPEA 2JLCA 4MVCA 1ECFA 3M5DA 3T38A 4CTMA 2DBQA 4IVPA 4XRGA 1P7YA 2O2HA 3TJMA 1OHHA 4PHGA 1JP7A 3RHFA 1E6WA 3ZE8A 2CFMA 1K4MA 1WTAA 2I6XA 4G85A 5DTIA 4ZP1A 4MTLA 1GRVA 5C80A 4I7EA 3GGJA 3B9RA 3G3EA 1WE2A 1YVRA 2AEFA 4DB2A 4PZ6A 3MLAA 3S2YA 1JQ5A 3DFMA 4DCSA 3ZWKA 1UPAA 2WKPA 1FDWA 5KKAA 5P8WA 3OFJA 2PZLA 1JZSA 3H05A 2RMKA 2XBLA 3MCTA 1ZMOA 3ECSA 2EIHA 3BG5A 1V5WA 3W79A 5IT0A 1TA0A 3UPDA 1VG0B 4P3PA 1XF1A 4RCZA 4JEHA 2I76A 1DVRA 2QRNA 4L1KA 3Q9NA 2RGNC 4IDOA 3R9IA 1KMMA 1OU4A 4HN9A 4OYRA 3NEJA 5HA5A 4IFEA 4ZVLA 2BMEA 3FUWA 3ZW9A 2K4MA 1SCBA 2UDPA 3HU5A 3PUKA 1EKFA 1NYRA 5TRTA 2AWOA 5JMOA 1PFWA 5JPIA 1DTWA 2HA6A 5UKDA 1WUJS 3GJXB 2EYUA 1VHTA 2G06A 1OE0A 2HMWA 4FS8A 4Q19A 5FEUA 3PLAE 1BA3A 3UWPA 4BQSA 4URVR 3WB2A 1Q84A 3MM4A 5CBPB 5JEDA 2UXCB 4F4FA 4RGVA 4Q3KA 1KU6A 3F5QA 1M54A 2Z56A 3SJUA 3H86A 5JXGA 3RFTA 2WZQA 1BXGB 3IEIA 3KTDA 5DDIP 5E6SB 5A5VA 5JFOA 1ILWA 1B42A 1Y81A 3RTXA 1M34E 4E1VA 4MJ3A 3WSWA 3HZOA 1N3BA 5L95A 1A69A 2JIBA 4YVFA 1W88A 4PF1A 4GU5A 4QKQA 1CFZA 2BFBA 1UJBA 4O4LA 4ND6A 2Y0EA 4RHXA 4JA0A 3WTCA 1XZIA 5C46F 5HM6A 3AK4A 1BHQ1 1FEZA 1V95A 2DTXA 3E48A 5BV8A 1EWVA 2HRZA 2NSJA 3GDHA 3I01A 3W6OA 5EJAA 1KJIA 1LI4A 3MZ0A 3LQYA 3DNPA 4FKZA 5D5PA 1MZPA 3O3MB 4GOND 4IIGA 4H3HB 4YALA 3Q6MA 4F06A 2ID4A 5FBZA 2UZAA 2DAPA 2P2ZA 4DA7A 1GL9B 1HWYA 1S96A 4M9QA 3AEKB 1E59A 4HLNA 1CF4A 2HREA 4C78A 2O8VA 2FNAA 2B2XA 3K9CA 3KQPA 3LXXA 5IBPA 1DWUA 1YO6A 5A3SA 2FWIA 4BX3A 5FPKA 2HY7A 3VBEA 3R23A 5B3AA 4YRTA 3K5WA 4IDEA 4JEIA 4G5XA 4AWAA 3JCZA 1LZLA 1N6NA 1QHSA 2Q49A 1JR3D 5IAGA 3TCXB 2OHFA 2DQKA 3AHJA 4HNGA 1JFFA 3PENA 3HPRA 1JDPA 2E18A 4RLQA 5LM3A 4LI3X 1QRDA 2Y0CA 2FWNA 3CSUA 1YONA 5K8CA 4ZKEA 1Q16A 4Y7CA 1VZ3A 1UKBA 4A0QA 2OTCA 3NIBA 2DF8A 4O82A 3BAFA 3P0RA 3A6HA 3BD6A 5C31A 4PYJA 3L4SO 4I2VA 2H5LA 4ZO7A 4IIXA 4HUQB 4Q00A 1UOQA 5HQJA 4ESOA 1DRUA 1P5JA 3VKGA 1QYRA 2JAUA 2BFNA 4WY8A 2W4QA 5DNCA 1ZAUA 1XB2A 3PEWA 3DTGA 2XY4A 4R1MA 2QXUA 4QUEA 2QM0A 1F1JA 1PJRA 2Y1GA 1YQQA 2A35A 3NEAA 5BUZA 1RRCA 1HT3A 1TVKB 1NFQA 3OQJA 4CMFA 2Y2UA 2CXSA 1XVVA 4FGWA 2WWRA 4QFCA 3IQWA 2BEWB 4RAQA 1XYYA 2WHRA 2IU0A 5MDHA 4HQRA 1S89A 2FUCA 3O9ZA 4EGSA 3Q9UA 2BCJQ 4U7HA 3N2GB 4IIVA 4A8JB 5BXQC 4Q3EA 3ZZTA 3DD1A 3PC3A 3LLUA 4IGEA 4QVKA 3REGA 1SJ9A 3LP8A 4Y2JA 3CUUA 3ZTYA 3SJCA 4CR6A 2BUAA 3L8DA 3PF8A 5K6AC 2WJVA 4JI7B 1J0AA 2GPNA 3E9EA 1J6UA 1QFJA 2PFSA 5K0FA 1KSHA 1X3LA 4WADA 3L1UA 4EPRA 4M0UA 4XFJA 3RYIB 2ABJA 4RL4A 1F12A 4L3VA 5HZKA 2PZJA 4OK3A 3UUGA 3SHFA 2OGZA 1T9BA 3PZRA 4QTTB 3B2EA 1RI3A 3TVDA 2FXIA 1DBVO 3IO3A 1A8HA 1G7RA 2QTFA 5FBLB 2YBEA 2DBYA 2HU7A 4INAA 2FSPA 5GM2A 5KJFA 3I23A 4K46A 4XWGA 5SZHB 4BFUA 1T29A 2PRYA 4YJDA 1AF4A 5DLYA 2ZRMA 3I01M 3QPAA 5E9WA 4NSNA 1NIJA 3MRXA 5DHRA 3BHJA 4HDSB 5LBIA 4CETA 1TUEA 1DIHA 1FSFA 3DT8A 3IE2A 4I81A 1R0ZA 5DSZA 3UAWA 5KTPA 1DJOA 2ECOA 2QJFA 4L4ZA 5FF9A 1ZUIA 3OOEA 4RF3A 3FDZA 4LV6A 4Y6GB 1QH8B 3LYHA 3CWCA 1KI6B 3DHNA 4HUJA 4TSRA 2ODBA 1KZ7B 4BB0A 1VPTA 1PGNA 3BWXA 1Z5VA 3BF7A 1MJNA 3W3AD 3KWJA 4OMCA 4QNNA 3VPAA 4HN2A 1WF3A 1UKAA 2PXAA 4RZXA 2EJ3A 2C9CA 4Z1MD 1BGWA 2FFQA 3KKEA 5A9RA 1W36C 4ZAVA 2I4TA 4EW1A 3NC1C 3RTGA 2ORYA 3KUDA 3OBIA 4MVXA 4X24A 4HZIA 5HR5A 1P16A 2C7RA 4TKVB 4H18A 3ORSA 4JHLA 4QYSA 5D2CA 3ZHUA 5KYWB 3EX7C 1Z68A 3BOSA 1G8FA 5TGDA 2HGWA 2XYHA 3LDUA 3VJKA 1U3TA 4C6TA 3PTAA 4TXJA 5DLEA 4TLDA 2JHPA 2KI5A 3LSYA 3M8KA 521PA 1LQ2A 3TL2A 2CXOA 3QU9A 1I4TD 4O7WA 5LXTB 1ZH2A 5F52A 4DDTA 3FY4A 4N3BA 3OSZA 2BKXA 1CRQA 3AYZB 2VJKA 3MGGA 1JA9A 4IAOA 5F4ZA 2OMEA 5B36A 1W4CA 2PEYA 2NU9A 4L3WA 3JATB 4E33A 4MQEB 3MJTA 4CI0B 1T4CA 4GZ3A 4OXYA 1Q91A 1EIZA 2V1XA 1C8BA 3AKYA 3KJXA 4BPBA 3QFRA 3IDSA 3LHIA 3TKAA 5IM4A 4GR5A 2H1OA 4KE9A 4XTRA 4O02B 3VJLA 4MS3A 2ZYVX 5DMXA 4HEQA 2DKNA 4KQXA 4N8EA 2B98A 5BSWA 5KOHA 4DRZA 4BFZA 1DP4A 3LX8A 1FJ2A 2WJ6A 9ATCA 3EHEA 4RTQA 2BI4A 3GOHA 1Q3TA 5EJFA 4Z4CA 5CGQB 1MX1A 4GG1A 4DR4B 2ZTMA 3NHRA 2RGGA 1JX6A 2CXTA 3OT4A 4X6UA 1XQ6A 3VV3A 2DR0A 1EE1A 2OC9A 5DYNA 1W7AA 1YNOA 2WYWA 1U63A 2VDWA 4AU1A 5KKNB 2RCNA 2XHZA 4EY7A 4M76B 4DCNA 1X42A 2J9ZB 3PK0A 1QFZA 2HXYA 3PYXA 3IERA 4EITA 3IVAA 1AG9A 4ZCSA 1E1CA 1EP9A 2Q3JA 2EJBA 3M7IA 3MPOA 3LL4A 1ECJA 1MX9A 2QV0A 4N01A 4A5SA 1PWZA 2AG0A 2Z9DA 5E4YA 5ETJA 2QHXA 5BOSA 3VUFA 2VVTA 2FZLA 1U7WA 4ABYA 3OCUA 3NHWA 1G3MA 2W8BA 4O83A 3MB5A 2I8LA 1Z5PA 4MP8A 3KG2A 1KTIA 4QO8A 2QIPA 1A27A 2VP6A 5CDYA 3M4JA 1P18A 3KBBA 4P31A 2FQXA 3Q4GA 1YZKA 4N0EA 2CCGA 4OD0A 1DKNA 4XUDA 5J2UB 3K4QA 3NWBA 2SKEA 2Z08A 1U3VA 1L9KA 1SUFA 2HRRA 3GBVA 3LW7A 1LB1B 1DIGA 4RV9A 1JIKA 3UBMA 3VHXB 3U4MA 4Y6SA 4GI5A 2J5KA 3SZLA 2EZ4A 2O06A 2RBKA 2C0QA 4K6MA 3K1AA 1KEUA 4WOBA 2XWPA 3W04A 3D8NA 4ZU6X 4KXUA 3C7AA 2VWGA 3F5MA 3D4PA 5SICE 3OUTA 4CDGA 3E9MA 2AFHA 1TQHA 4QVGA 4XYLB 1JHZA 1GU0A 1Q7CA 1YCGA 2R8XA 2VS1A 3EXEB 4JN6B 4LA4A 2HGSA 1WETA 1X0VA 1QUFA 1FRQA 3KAKA 2D59A 2CXUA 1D7AA 2QD4A 1K8QA 2B9EA 2V97A 4FSHA 3CKYA 4HEA6 3RVBA 3TFOA 5I9LA 1UKZA 3JD1A 4F1KA 3VO9A 4IGIA 5ITZA 3LDHA 2A9OA 1OHHD 3EC7A 1I7LA 4KBYA 4PS1A 5CH5A 4E12A 5EE5B 3Q3CA 4F8JA 2Q0HA 5CB4A 2Y67A 4QGSA 2PS9A 3AR2A 3GLHE 3MVEA 3V8NA 2BFMA 3VZSA 3OKAA 3S2UA 3T41A 2DBVO 2ZJAA 1Z2NX 2QZJA 3BFJA 2RK3A 2XUZA 1SXJD 3DT6A 2F8SA 2IK8A 4TL8A 3QFCA 1PK9A 5EQDA 5IJZA 3IMFA 2WT8A 1SHLA 4KJXA 2IE8A 4D4HA 4RVDA 2AN1A 4D0RA 1N6HA 1BHSA 2AR7A 4AKTA 3COWA 4OQDA 2X9LA 3NDRA 4UZSA 5KHOC 2CVQA 2HVQA 2QZ9A 2WD7A 4BTVA 2DBRA 1PG2A 1M7BA 3OIDA 2AOTA 4P32A 2XI4A 4EHLA 5HNEA 4KFCA 2I54A 4RWEA 4YJKA 3COZA 2ZIXA 1BX1A 4JVSB 3ZGYA 4F21A 1JE1A 3SICE 5GY7A 3C5EA 2QN3A 4B3CA 2V7UA 5LOVB 1N5MA 1OTHA 5JI3E 2Z8ZA 4HBGA 2P75A 2HGXA 3NFRA 2Z58A 3SJAA 1WCXA 5FI5A 1D4FA 4TTQA 5CW2A 1LPOA 3T61A 3P9CA 1EMDA 1GPDG 2Q27A 3LVBA 1P0CA 3KAJA 2WJ3A 3NWEA 4I55B 5GV7A 2YX1A 3OZXA 3RANA 2X7JA 2HR1A 2AJBA 1E9CA 1ZIPA 1TQ6A 1XEXA 2P5YA 2XCOA 3QF4A 1NR1A 2HJRA 1LPMA 1QH0A 2C3OA 3O82A 4JS0A 5KNCD 5A06A 3RQIA 4EECA 4FYVA 5DFAA 1K2VN 3UFXA 4D5EA 3JX9A 5DN6A 3C7DB 1ZNWA 4TZ6A 1SH7A 3ZNOA 1Q77A 2EL9A 3E18A 3CUTA 4U02A 3EF1A 2B5OA 3KXDA 3RVKA 3BXZA 1BDHA 3RS5A 1QIDA 3V6LA 1F6DA 1NN0A 4KGZA 3UWDA 4EB6A 3VKUA 3EFHA 1H4VB 2G1UA 3NBAA 3K4PA 1CE8B 4TL7A 3HWSA 2V4UA 4LE1A 5JYEA 4UUAA 4PYOA 1D1PA 1L5LA 5LIRA 1DGQA 1I6KA 4PN7A 2NU7B 1YR7A 4EEXA 5FOTA 1LF5A 1ZR2A 1WL8A 4HNVA 3H9GA 4DDKA 4MULA 4F6CA 5FUXA 3IP3A 1ZUHA 2CXPA 2WUEA 4QPCA 3WNDA 4ENUA 1W1WA 2VDKB 2H2HA 1Y98A 2XVYA 4EKIA 5TQ2A 3OQBA 5F2KA 4E14A 1RC8A 1PVDA 2ZYRA 5K5EA 1K86A 4RK5A 4PLCA 4DWVA 2B6NA 2A57A 2Q6VA 5J2TA 4LJYA 3LDFA 4RIIA 4RVHA 1JXQA 1RWKA 4ARVA 1QF9A 4GI2A 5EPOA 1XU9A 2C29D 2AS0A 3CF6R 2I9KA 3LC7O 2V9CA 5TLSA 3IUYA 3O5AA 4XDHA 4DN6A 5AVOA 4F04A 3NDIA 2GDZA 3ABRB 4J90A 5IJAA 5KCZA 1W2GA 3CZMA 2P9JA 2IFTA 2YNMA 3JWEA 1PTJC 5L3QB 5LYJB 1ZXLA 1XO1A 5JDIC 3W5BA 4D9CA 2EFYA 2X0DA 4CNQA 3NBYB 5JQWA 1I6MA 2PDAA 3UGQA 2Q7XA 4CWAA 4ECAA 2X22A 2OHIA 1A72A 5FUVA 3SR4A 5DPMA 1S2IA 4DZZA 3KPVA 2LD4A 5CFZA 2I6QA 3STTA 1RJ9B 3EGOA 3AGQA 3IEVA 1HYEA 1UK9A 4UU7A 1JJFA 2ZW9A 3WL5A 1QK3A 3W2FA 4BBZA 3EMVA 1PNTA 2YFQA 4R0MA 5I7RA 3D6AA 1P1CA 1QMPA 2DHCA 3OZCA 5EXPA 5FUMA 5A4AA 2P1ZA 4EPYA 1CUDA 5L3RA 4R2XA 4YONB 1P44A 1KVTA 2C5FA 3ORFA 1UXGA 1T2FA 2GETA 3H6GA 3ND9A 4MROA 4UHEA 3AM1A 3DSRA 4B3TB 2XMZA 1O58A 4E94A 4NMXB 1YDGA 1ZQ1A 3AEQA 1MP0A 4LSWA 4R2KA 1YB5A 4ZMSA 1ZOPA 1JEQA 2GM9A 2NXCA 3BQ9A 4JLUA 4I4CA 3RJ9A 4KE7A 5ECGC 1YUMA 3PKJA 2WA2A 4OJNA 1QVAA 2VP3A 1R88A 2EFDB 1K1EA 5CNJA 1Y7TA 2Y68A 1BGXT 4L5JA 1X87A 4MIKA 3HN7A 4G8CA 3AVXA 1IHPA 4LNUA 2QJOA 2O7SA 1DC6A 2PMFA 3OEHA 3BGVA 1C3JA 4IV5A 4II3A 4NZZA 4U63A 3SVZA 5HTOA 4BKPA 3D4IA 4XFKA 1FNDA 1KMCA 4X1KB 3REQB 3KBOA 2X1LA 5A6VA 3HVIA 2OC4A 1LTKA 3CINA 2RGBA 3P9QA 4I50B 4KDRA 3WGIA 3EDQA 1HA3A 1PU2A 3NT2A 4B31A 4BMNA 1U0EA 3EDYA 4KRGA 2XYPA 2XZTA 3SVTA 4KRFA 5FV4A 3GPDG 3M6IA 1P4RA 1NLMA 2GN4A 1T9CA 1N3YA 4JQSA 2G1KA 2JLZA 1NKTA 2F64A 1WUIS 3UG6A 3TGLA 1QFXA 3PQ7A 2J3EA 4NBNA 4YLEA 1E3LA 2ZB7A 3GQVA 1L5SA 5AKHA 1O54A 3ZS9A 4IS2A 3ZV4A 2DPYA 1C2TA 2FY8A 3MRTA 3OCVA 1T4DA 2P91A 3IODA 4F7DA 1E5DA 1CNMA 1KTAA 3VNVA 3LUPA 2E7ZA 2LKCA 3SFTA 1O7JA 1FVIA 1WEHA 1XPJA 1LDNA 2HMSA 2AXEA 4N0PA 4NCJA 1V1RA 1WDLA 3CJTA 3FDXA 4MITA 4OP2A 4P3YA 4PLZA 4P84A 4XVHA 3CRQA 5H9VA 3U7EB 1J8FA 2C5BA 1NVTA 2RGUA 3CG0A 1B73A 4YA6A 2QMOA 3OE4A 1FPMA 3H8JA 1IYDA 3PS9A 2RH5A 2WWGA 5F3WB 1VJTA 4MCJA 3DO5A 3VX3A 3WB1A 4DVJA 2ZUEA 2UUAB 2HD4A 5FUYA 3KOWA 4C04A 1UANA 2ZJOA 3KZXA 4D4IA 4IH4A 2XWJI 4MRMB 4XIJA 4UOEA 1TW3A 3KVNA 4KO4S 3HR7A 4Q4LA 5CBKA 2QM8A 4GZMA 2PAFA 3RNOA 3PSHA 3WBKA 5L45A 3ZCUA 3EWIA 3HJFA 5J4LA 2AVNA 4X6XA 3VHLB 5F7XA 1V7ZA 2CF5A 1KDRA 2EP5A 4FSXA 2GRAA 2OO5A 1SEPA 4LF6B 5KI6A 5ALTA 3WWIA 2EATA 3BWYA 1ORVA 2HA4A 2YBDA 4UEJA 4B4UA 1I6WA 1S1MA 3KWMA 4IMJB 3AUAA 1HT0A 2QE7A 5B37A 3WYBA 2B1RA 4CIVA 4IOLA 3ZBTA 1KH1A 3LUDA 1KEVA 5H1YA 5AI0A 4B85A 3L8HA 3C5VA 2PUEA 1OYWA 2R8EA 1AXRA 4P54A 1GR0A 5AVXA 1IAQA 2GPSA 1HRDA 3KLNA 3D3EA 3KYCA 5JV5A 7MHTA 5JY6A 5T8KA 3DS8A 3IEPA 3RS8A 2BKUA 5K1ZA 1Z88A 3SIPA 1KWGA 1N25A 3LWNA 4KFSA 4LKOA 1ISJA 2ATIA 5JXWA 1SC4A 1Q1NA 3NBUA 4KRXA 2KJQA 2FQYA 5IT9A 1C7IA 1UZAA 1WDTA 5CYGA 1U7OA 4CZ2A 3WE7A 3P27A 3RTBA 2B37A 3K70C 1M2VB 1H9AA 1PDWA 4J6FA 5IF3A 4KMMA 5IEBA 1YBAA 4CC6A 3GFRA 3TLMA 2WB4A 1Z7WA 4FDTA 1R8XA 4KW7A 4EYKA 4FMDB 1I7QB 1MO2A 2V65A 4RULA 5E6RA 1M3SA 1E63A 1Z0SA 2D6FA 3ILYA 4JKYA 1Z12A 4G5YA 1SXGA 5L6LB 1JNYA 2B4YA 2VRNA 1YZQA 3TE7A 4XI9A 5LN1A 5KZMB 5G2OA 5EEGA 1QLJA 1R0XA 4LRQA 1CG6A 3QLJA 5D3MB 4EFNA 5JHGB 4GRIA 5CIWA 4AQ7A 1FDRA 1R4AA 1UDWA 1CDZA 4RQAA 3ITKA 2W11A 5F5LA 4GS5A 1XMJA 1Z0KA 2N47A 1G17A 4PCUA 4US1R 4W7HA 3IR5A 2J6CA 2IH5A 3DMTC 2WYOA 4PLFA 2O7NA 3W6NA 4NECA 3FNIA 4PZCA 4D4GA 2JBWA 4PC6A 3DFUA 2Q07A 3M4XA 2QDXA 2JCGA 3O90A 1JFSA 4DL9A 1Z5GA 3JYLA 2PGAA 3N0WA 2QGZA 3QUAA 4FXPA 4KFRA 4R2JA 5BY2A 3NDBB 1TUGA 3AHFA 4CM4A 2QAGB 2A1UA 1YCDA 1RQ2A 2DU8A 3IP6A 4NYMQ 1T36A 1ZCFA 3CH6A 2ZU6A 4ZU1X 1ZQ9A 4LBZA 4PCVA 4BKRA 2W2KB 1LBEA 1Q7TA 4XOIA 4RORA 2I8AA 2VHXA 1TT5B 3U31A 5A5FA 5A05A 1R50A 1QKIA 5MFZA 1Y5IA 1GSOA 4CM7A 4OFZA 4GNRA 2G40A 4FFPA 4HDRB 2JD2A 2Z98A 3RVPA 4C89A 3GHHA 3TDKA 1J24A 2PUTA 4MQUA 1C0LA 2X5JO 3TSAA 4K9OA 1TM4E 4UASA 3ZVNA 2DFVA 3INGA 4WCVA 3HTXA 1J8MF 2PKQP 4IKOA 4ZO6A 4RHFA 5KJEA 3JALA 2HBZA 3IA7A 1SC9A 1ZN9A 3BD8A 1GA4A 2WPNA 4IDNA 1Z4PX 2EKLA 2QRLA 3VZDA 4G0ZA 1HLPA 4Z4FA 3KZKA 4G1VA 4DLRA 5JZSA 3JZ6A 1NW8A 2H1WA 1FP6A 5ERGB 3IJRA 3HXKA 4Q15A 1TF7A 2DFPA 5LJLA 1R16A 5CDGA 2IKQA 2SBTA 3OU6A 5IFLA 3U44B 3AWIA 4BBPA 1MN6A 2HXSA 1KY4A 2FKNA 1EP3B 2LTAA 4BGIA 4R7ZA 2JS7A 4L8LA 5I5XA 2I7DA 4EAAA 3T7IA 2G3YA 4D0GA 4E5DA 5BWUA 3HFGA 5JALA 5GONA 4FIZA 1FLDA 1N9GA 1DCTA 3PR2B 4MQFB 1AUQA 1EA5A 4JYBA 5KSPA 4NARA 3FGPA 5K0JA 3I39X 4XD2A 3NTVA 4XX0A 5J9FA 3CSDA 5J5CA 4D8VA 2M32A 3P2YA 5ALYA 4EGCB 1THZA 1JA1A 3ORHA 1XD8A 1HY3A 2BH2A 3B85A 2LPMA 2ZIFA 3RRXA 3COSA 5JTTA 4CLRA 3DEZA 2B94A 3I6ZA 3R8XA 5DYIA 3UJNA 4JODA 2GAJA 2RHTA 5D01A 5BWOA 1CQWA 1QS0B 3AB8A 1EVJA 1JG6A 4INZA 1HEIA 1WMAA 2AZDA 2WWXA 3MOSA 1E1QA 2PGIA 3DFKA 3IP5A 3PUZA 3QQ5A 4Q1FA 5DN6D 4ZT5A 2HSZA 5AHKA 4O4LF 2CNWD 3BK1A 3B1YA 3I83A 1EGMB 1KAOA 2A7XA 4JEMA 4TX1A 5FFMA 3QBEA 4DCPA 5LQKA 3N86A 4RZQA 5TARA 1TTPB 2WIKA 2P4QA 3JV7A 5LCXA 3C6KA 2O23A 1ZJJA 1BX0A 2PSDA 1TOAA 3HMKA 3TIVA 4Z51A 5C2JB 1VE3A 1ZK1A 2R48A 3X1ZA 3EWAA 2HMUA 4NBWA 3GPLA 2OECA 3BSWA 1S3GA 3HZRA 4KZKA 4BWYA 1MJ5A 3LVFO 4Q47A 1G41A 2ECKA 3G13A 3BTUA 1TCUA 1KVQA 1TDJA 4O7LA 2NUAB 3CNNA 5FAXA 1SZDA 1QHHB 2GA8A 3H9QA 4DIKA 2G71A 2CXRA 2YMQA 1DIOB 2QRGA 2HH9A 4PZDA 2PLNA 4WNCA 4FGRA 1YIAA 3F3YA 4EFDA 2IYXA 3V3KA 4A2CA 1J0XO 1F06A 2GCOA 4MV3A 3HN6A 1FTQA 4RLSA 2XGJA 1J4AA 4QYMA 1PJTA 4C0QC 1OREA 5BSVA 2VXOA 5DCUA 4EABA 3VNBA 1JKJB 1PSWA 4JI4B 1YJAA 2NZWA 3F2IA 2Y1OA 4O7TA 1FX0B 3GA5A 1EZ1A 1JPNA 1TO2E 3ND5A 1PZGA 3G7SA 4WH0A 3GWGA 1JYSA 4YWHA 3WK8A 3QWBA 3KVOA 2NVOA 4ZOBA 4G0OA 2ZR7A 2J5XA 4MVJM 1Z5ZA 2E55A 3T7CA 4BNGA 3ADKA 1UXIA 4G4JA 2CNVA 1VE5A 2AMYA 3HSYA 3R3SA 4JOSA 3OECA 3RBXA 3GJ0A 4JLSA 1L7EA 1L5MA 1OZ0A 1QANA 3C8HA 2HWXA 3EPRA 4KVZA 3TRKA 1FXWA 4AULA 1OGIA 2C5AA 5KEIA 4I1UA 4NQZA 3RRNA 1PVVA 1HDGO 2J3QA 4RPCA 2WHPA 3JQGA 1A8PA 3Q7SA 5DASA 3HBJA 3NYQA 3VA7A 5E6UA 4G07A 5ALQA 1ZCZA 4BZZA 3IAM6 2O8FB 2JIOA 3BMXA 1IAVA 1XRMA 5HTKA 4PNPA 1G59A 1PJBA 5KJCA 3PPYA 1O1YA 3UCEA 2WMYA 2ODTX 3D0QA 3L0YA 4GOMD 5K0EA 3K8QA 3AUUA 2WYUA 8LDHA 4XIFA 4TWRA 3R9KA 2GM3A 1U2PA 1E5XA 4MPTA 2VNJA 5J3JA 2JDID 3GRYA 4MR8A 4NR0A 4MWCA 1G5HA 3B48A 5LQMA 4Z6KA 3F6CA 2WTAA 3NHFA 3ZPXA 3Q11A 1KNQA 1ZVVA 1IBRA 1QRUA 4H27A 4JLVA 5C4IA 2Z6VA 4G36A 2EGGA 4F91B 1LX6A 4EKEA 1JQDA 4D74A 1IFXA 1R5JA 5J4HA 2AZXA 1DQYA 1VPVA 3WGLA 3GG2A 1ONOA 3NVDA 1KAMA 1YQUA 3NYRA 4GLLA 5A0VA 1YZHA 1HI9A 4F60A 3NM4A 5TEVA 3CNOA 1TK3A 3IUQA 2PKWA 1TU0A 3EOZA 4X61A 4PLVA 2EIXA 2HJSA 3JU3A 1WPGA 3OEEA 5KUTA 5AK0A 5JCXA 2RBGA 1Y3HA 4XSGA 1Z18A 2QV7A 4ZAZA 3RS2A 4X65B 3BFXA 2QRUA 2HRQA 2H54A 2DCMA 3ESYA 3D8BA 2PO7A 3UANA 4BIIA 4FMPA 4Y1RB 1Y0BA 3RYHB 2HIXA 4E4TA 4AQYB 1P91A 4QODA 3NW9A 4L22A 2JBAB 1WMSA 3IUPA 3QMVA 1FL9A 4D0SA 2HB6A 2VNKA 4R0VA 1K4KA 2PM8A 1IBLB 1J33A 3K20A 4IKPA 1FTGA 4FPXA 3V34A 2PN1A 3HFRA 3X2EA 1AXGA 1CR4A 1JT9A 2VH1A 2ZAYA 1EFRA 4PXYA 5G3YA 1T24A 3I34X 4P2BA 4O4HA 2V8BA 4JKIA 1JN0A 2I6FA 4TUYB 3PUWA 3Q41A 3GJTA 1JEJA 4XQEA 1SKAA 2NTYC 4IWNA 1A7UA 1YT5A 3NM5A 4P7KA 4DB4A 1NT4A 5B12A 1LLCA 1R0CA 1D2EA 3LYUA 3AIOA 3G79A 3HKDB 3Q3VA 3FPLA 3R4VA 4QXQA 3WNBA 4NXNB 3GELA 3VR6A 5IM4F 3WXMA 5IJ0A 3L5KA 1FSPA 3M6LA 2EFHB 2H00A 3DDUA 4UATA 3O3OB 5CCBA 4OCZA 3AOGA 1GFIA 3BIJA 3KHUA 4NV1A 4OGWA 1XJQA 4ZCQA 2BGNA 3R75A 3TR6A 5CVCA 4UCSA 4DHWA 1UK7A 3KPYA 2JRCA 1GAWA 2JH3A 2VDMB 3FVTA 1F8YA 2NZ2A 3U40A 5IANA 1JFRA 3KYDA 4EI9A 2LCIA 1F8GA 3TQRA 3ZD9A 5HGXA 4C2UA 2J07A 5AKGA 1BROA 4K26A 3ND7A 2JJQA 5BUSA 3THYA 4MVJA 3ZBUA 1ZH6A 1DT5A 4BMXA 5B1EA 1CUXA 5K01A 1GPYA 2HZ7A 2YJ4A 3GB8B 2QZ4A 4F85A 1EWTA 2QT0A 2W71A 2XTMA 5AM5A 4YTEA 2Z5LA 3LIIA 1HE5A 2CJFA 3DMRA 5JSQA 3AI7A 4C0AC 1VPDA 5TGTA 5E9JA 3CUYA 3A1EA 3MMZA 1JDEA 2YWHA 4JOQA 3SHVA 3QU7A 4ZI5A 1TZCA 1EK1A 3NUQA 1WW8A 2FSFA 3EXG2 3T34A 3TIGA 5JECA 4G4IA 1LBSA 3CPJB 3G68A 5SV2A 1OJ7A 3WAKA 1QGED 1TTTA 1VPEA 4UAJA 3ZI0A 1NXTA 2VZ9A 1L4GA 1EUQA 3IRUA 4MCHA 4Z2AA 1TMOA 4PV7A 1THTA 3NG1A 3TBKA 4CM9A 4BNMA 4J7CA 6ADHA 4B6OA 1YRHA 5DCLA 4CMAA 1YUNA 1YQWA 3DTFA 2C95A 2ZRAA 3P0IA 5COAA 5ULLA 4ZD6A 4YP1A 5D1PA 5HZMA 4I4NA 2C2WA 3I5YA 3V8MA 5CG2A 5LP6A 4FMBB 4JYPA 3RF6A 2F48A 4MW6A 3GFVA 3GWZA 4KQWA 3HJNA 4EY5A 1E0AA 3E82A 5JATA 4RY2A 4CMIB 2IP4A 1JPJA 1Y5LA 1M5RA 4O7RA 1TVEA 2D54A 3VR5D 1B7GO 2OBFA 1AHHA 1ZX1A 3DAHA 1VBKA 4G26A 3NRBA 5ADWA 5LZ9A 1JR4A 1YS7A 2UVDA 4QU0A 4P1ZA 5G02A 1KJ9A 1U8YA 1TJPB 1WZNA 2B6HA 2FLVA 3KEMA 1RC1A 3L1HA 3OA0A 5D87A 2XAAA 5BQ3A 5JSUA 3DAPA 3OOHA 4RD3A 3O84A 4HT3B 2R87A 2XE6A 4TM8A 5TDHA 1WZUA 2FRDA 1QWSA 2QMUA 4ZZ2A 3CZAA 3TLYA 3WGOA 4AUMA 1EM8B 2P40A 3PNSA 1TFRA 4JC0A 4Q4DA 3CNHA 3FAZA 1L1RA 2H5JA 3NP7A 2W00A 4P5DA 4CR7A 2AZMA 5CB4F 1A4XA 1YR1A 2HNAA 2QRKA 4BQOA 4QUDA 2V5VA 5G0TA 3EZLA 2BFOA 4L3OA 3A9SA 1N0WA 5AI8A 5IN4A 4YAKA 3KIPA 5BSFA 5A4JA 4R8MA 3M83A 3URMA 3ZVMA 1C2YA 3WLAA 1PFVA 2YV1A 2ADOA 4QT4A 2XUOA 3EPHA 4O1HA 3KKZA 1ZJWA 4LHWA 4CMGA 1YBMA 1H0HA 1QFSA 3WSVA 1TLTA 5EJEA 4BFWA 4JXKA 3HP4A 2QRZA 1E2LA 1R0WA 1ZMXA 3RU2A 5CEJA 5DLDA 4N0MA 2ZRIA 1QIIA 1JHPA 1U0OC 4KRYA 4BV9A 2OXIA 2O8DB 3RV4A 2GA9A 1NQAO 3VHQA 4G0QA 2RHWA 3PD0A 4E51A 5C5CA 4LQDA 4A6EA 4DUYB 1Y80A 4JT8A 1TT7A 1LNZA 3FGOA 3KSRA 4WJKB 2VDPB 2X76A 3HBLA 5ALUA 5JD3A 1C7FA 2WIAA 4RZHA 2WA1A 4KIGA 1PT7A 3T06B 1NMZA 4UZEA 3AY3A 3V1KA 2BCEA 1NQXA 4Y1EA 1FB5A 3EW7A 1X7ZA 1RR6A 2IY8A 2NTVA 3EZYA 4QGHA 3ZJTA 5CK5A 3IUEA 4MHOA 4YJFA 2R4TA 5JG7A 5KNBD 1M34B 3QMWA 3C3BA 1I3KA 5EIBC 1CEEA 1KUTA 2WJZB 3H3FA 3P9RA 4IJQA 2PTHA 3FCUB 4GOXA 4Q3CA 4DWWA 4KQJA 1GPKA 3L4BC 2MSDB 4JBYA 5AVRA 5GIPE 4PWYA 1E1QD 1UC8A 4M86A 3O8OB 1UMDB 3PWZA 3HJHA 1L5RA 1W94A 1G9TA 2RCYA 4YHHB 2UUCB 5FI0B 1ZVJA 5HNKA 1KSGA 2REQA 3NBZC 5IK2A 4BHTA 4WY2A 5FHQA 1A50B 1MZVA 4J75A 1PG0A 2WQ7A 3V4VB 1G60A 3JY6A 3NAQA 4D8TA 2HC9A 3FDFA 3S24A 5CNKA 3E7PA 3IOMA 4EW3A 1VS0A 1FNBA 1NG1A 1P81A 4ZT7A 4BVLA 3CJQA 1RT9A 2RHRA 1YA4A 4M21A 3DUFB 5JWHA 3TM5A 4AJEA 3T54A 1QO7A 1ZD3A 2ONKA 1SOUA 3BUSA 3PE4A 1I4EB 4G9BA 4UU8A 3OQMA 1JG2A 1NNSA 1F51E 1OF1A 4JSYA 3VU1A 4C4XA 3HJUA 4MPRA 2EC5A 2AV6A 5ICSA 5J2TF 4DV2B 2D8MA 2CVPA 3ER8A 1GCGA 5AJVB 4IILA 4BMOB 2A7QA 3SMVA 4Y2PA 2WWFA 3R5JA 1F7UA 4JUBA 4ZOAA 4BV3A 1XVTA 2OHVA 1WPQA 1YRBA 3IKTA 4UCWA 3JYNA 2WSBA 3FNFA 1OBGA 1A1SA 2IS4A 1ZSYA 4W1QA 4A2QA 1CR2A 1YI8A 1ST2A 1SZPA 4FI3F 3EWSA 1XLUA 2NV0A 1DTWB 4XARA 3ZXUB 4QPNA 1QIJA 2EFGA 3NHMA 2RAPA 1BDJA 4IUCS 2QPOA 3RRJA 1FNMA 4RO0A 4HH0A 3WWOA 4MUMA 4AJHA 2WI8A 3ACBA 1EUCA 2P35A 2HFKA 3LYLA 1NJGA 3VVBA 1ESEA 1XXLA 621PA 3WLFA 2YJNA 3R0IA 3PL1A 2O4UX 3RC7A 2WF6A 1M76A 1SOWA 2PG3A 2GNAA 1TYEB 5DTQA 1Q0TA 5L3SB 3UKOA 5JRDS 2MTBA 1VCMA 2XDAA 3MERA 2VFAA 2JLBA 1Q17A 2AH5A 3JTMA 3T9BA 1S02A 4O4LB 2GQ0A 3AR9A 4GKBA 4AZ0B 4FD3A 3OU7A 3H8SA 1E96A 2I3BA 3O8DA 3DMDA 3PWKA 4U7GA 1MQ8B 1MO6A 2VEDA 3A3PA 5KS2A 2Q5EA 3E1SA 3S7TA 1T1EA 3L1VA 3OOYA 3GRUA 4HWTA 1I1LA 1G2PA 2V03A 2XEDA 1BJTA 3GK3A 4CR8A 2Z4SA 5KTMA 1E3QA 3BEOA 1NI3A 2C3YA 3OWOA 3QBDA 1OI7A 2G63A 4HG2A 4ZCMA 1HEUA 1GNRA 1UFVA 4ZEOA 4NYIR 4NNJA 2O3SA 1CZOA 2AN5A 3NBQA 1DQPA 1X2EA 4XGNA 2GN9A 1Z7YA 5A3JA 2EJWA 1TGYA 3DOCA 4YDSA 1EU1A 4AZ3A 1X3SA 4D9JA 4FE3A 1KHHA 3UJHA 2I6TA 3KB2A 3OU2A 4EJ6A 5BN1A 3FFBA 5TMPA 2Q0XA 5ES3A 2AA3A 1XMQB 4NESA 2W2NA 1GFSA 1IN8A 2D7CA 3OT1B 1MIOA 1BMQA 2WE7A 3OZSA 4LY6A 3FJOA 3ZWDA 4X63A 1VRCA 3B7WA 1H2YA 1H23A 1K8YB 1Z37A 2XMGA 3M6VA 3PWTA 3W05A 2HHFA 1B8VA 1G21E 3TY9A 1WXWA 4NJMA 4RK1A 3A28A 4D43A 3GLQA 2IL1A 5E3HA 1UAGA 1XJ5A 5I9IA 1LBQA 1VB3A 2XUAA 4Q3NA 3D5EA 2G82A 3N87A 1XRQA 5EVCA 3RW9A 4L02A 2GN0A 2PXCA 2R8PA 2PUAA 1FMTA 4KAAA 5JAUA 3CTPA 4DNFA 4C30A 2IKSA 4M55A 4W99A 4EVQA 4CL2A 1XROA 5JSFA 2XVMA 4OI2A 3UHJA 1NV8A 4PHHA 3N8DA 5BW4A 4UCQA 1QR2A 4V0OA 3K4HA 3OCYA 4JLNA 1COWD 4XPIA 1EFRD 2ZIAA 2O2JA 3TY8A 1FNSA 3C3EA 1H1TA 3FHJA 1U8XX 3SDZA 4ID9A 1RADA 1BMFD 2ZJ1A 2FMTA 2ZS8A 3HBFA 1W1UA 4CMDA 2HK7A 4IICA 4JJFA 1ZM9A 2KLBA 3ADOA 2PZBA 4CKWA 1CBUA 4KTVE 4DZRA 1M1NA 3N2EA 4AQDA 1VPLA 1NV9A 2B30A 3JAWA 4EIWA 1CRWG 4DC9A 3WAGA 2CLOB 5AW9A 3UAOA 3UT5A 2BMDA 2NO0A 5LUBA 3GNLA 4I46A 3DE5X 4KBFA 3I3OA 2BOVA 3UHFA 1OLOA 1P2SA 4GYYA 4Y2SA 3THRA 3AL0C 1PT8A 1O9GA 5JYDA 2P5UA 1QB7A 2ATCA 2ZE8A 3E2MA 3GT3A 4L4RA 3RIMA 4KVFA 4BO0A 3D8UA 2IXDA 4BGEA 4BMSA 1KKUA 1YRYE 1LLQA 1AZTA 1NJSA 1UEJA 3DHVA 1MEOA 1ZC3A 1KI8A 1OTYA 2AMFA 2OENG 3HKEB 4LJ4A 4ZCIA 2XHEA 4NFHA 4BV2A 1S8NA 3PSAA 3A37A 4DM7A 2OCIA 4LQCA 4HDKA 4NNPA 5G0WA 4Y2VA 5HJ5A 5JC8A 1U11A 2WU8A 3DAOA 3N28A 3THXA 1IOZA 2H63A 3L84A 1WA5A 4WCFA 3U61B 3DE0X 1RM4A 3A58B 3B1WA 4FS3A 4DIEA 4AKEA 2JJ2D 2WFMA 4UVDA 3R7SA 4EA8A 5LUAA 5IEJA 3N70A 4OFXA 4O84A 1IXZA 5AUNB 2VPTA 2RGRA 5T6MA 3UAZA 2DXIA 1KFJB 3DWFA 2LE0A 1ACMA 2IEBA 4P6VF 1PJAA 1XP8A 2WV7A 4RPHA 5JXHA 1G8PA 2VTBA 5IS2A 1YFKA 3OZAA 1EB8A 3A1TA 4HWRA 4IF4A 4Q7MB 1PE0A 2GMWA 2HU2A 2QGNA 2AK2A 1BKYA 4B6QA 4BEJA 4JP5A 3EYWA 4O2BA 2IUEA 1V41E 3GNSA 3QE3A 1HE2A 1XKXA 2EKDA 4FZVA 4NS1A 4YN3A 3K6SA 2BR5A 3IHKA 4X1IA 4J0QA 2EW1A 4DSNA 3EVCA 4G5HA 3A70A 3VI3B 1BOFA 4PNHA 3K53A 1AS3A 4YRJA 1UZNA 4FWIB 3VC7A 3KRTA 1NF9A 2XADA 2I7TA 4FCCA 5IHXA 2NU9B 3FPAA 2Q2VA 3PD1A 2CNKA 4RA6A 4X1YA 3RVJA 2AJTA 3AMVA 3KJHA 1D2HA 1AB5A 1X80A 4RHUA 4OI1A 1H3EA 2O59A 4U9HS 1H2WA 1LWOA 1VP9A 5IWCA 4Z99A 3QM1A 1O5IA 1GNQA 1VYVA 1O6CA 4RJIA 4E0BA 5FQOA 2BELA 2Y1DA 3L7CA 1FP1D 1AJEA 3ZWBA 3KSAC 3CW8X 3KB8A 2DHQA 4J8PA 1T9AA 3BH0A 4CDRA 1CY4A 1FP7A 2QUKA 1XZCA 1K89A 2EKBA 2PGNA 1BQEA 3KZCA 4JLJA 3KZNA 2FFBA 4GE0A 5L8VA 4DLSA 4EPTA 2L17A 1TI7A 3GRPA 1CW2B 1JTEA 2V4MA 3N76A 4X1OA 1K5HA 1JI0A 2EKZA 4C0LA 1I0IA 3OA2A 5FLYA 1P5RA 2JATA 2WDPA 3THSA 4CC5A 2WYIA 2WPDD 4MS1B 1KEEA 2BCGY 3T12A 2QROA 3WWCA 2CXXA 2VK4A 2VCEA 3DQQA 4WLFA 1N9ZA 2GEVA 2OBMA 1E1CB 1J0EA 4Q48A 3Q0TA 1A0OA 4DR2B 1X77A 2YYZA 3HA5A 4MVJI 3WQBA 1ZAYA 3NIWA 2HWUA 3O3NB 4UBKA 4WBSA 3RKUA 3LECA 4DA9A 4CKCA 4X66B 4LKRA 4PG6A 2CDCA 4R01A 2W8BB 4NV0A 1IB0A 4MPPA 2OPHA 3RJTA 2LUOA 3D8HA 1UQTA 3NAMA 3O4GA 1VKOA 4H0NA 4ZAWA 3TE6A 5I6DA 2RHMA 4IOKA 2YINC 4QOGA 1PKEA 3QKIA 4N6OA 4B3HA 3L7KA 3MS7A 4RHCA 2APJA 5GONF 3Q1KA 2VF5X 5DHSA 2A1IA 3NH9A 4RY0A 5BSTA 5ANRB 2P9EA 3GI1A 2O0JA 5K8JB 3CBQA 4MIEA 1MPTA 2HWWA 3Q5EA 1TA4A 3WBBA 2FDXA 2ZB3A 3WV4A 4RV4A 1G5FA 1Y1QA 4FHEA 4WNAB 4I3HA 1AKNA 2C2MA 5B5SA 5MGNA 1P7WA 1X9IA 2J59A 2GD1O 1OI3A 2H17A 3HL0A 2H4FA 4EQZA 1KAEA 2COKA 2J1LA 2XGGA 4MR7A 1Y5RA 1JVSA 1ICEA 1R4NA 2A0XA 1NBIA 2C58A 3DVAA 1QO0D 4KUHA 4Q9AA 1HK7A 3VVMA 1CTQA 4YAKB 2WY2D 1SWWA 5IMSA 2WINI 1M75A 1I3LA 3UJ6A 3E53A 3CS3A 4TMFA 1U3UA 4MS4A 5HFAA 1RI2A 2PUVA 4YQZA 3RC3A 5K0NA 3FMVA 4XEUA 1G19A 1VL0A 1FK8A 3CMMA 3DOIA 1DC5A 1S7CA 4XB2A 4WL0A 1ULTA 1ZJZA 1QBGA 5CCDA 4YCBA 3H5VA 3CEPB 3ICPA 3ZIUA 5E1OA 5JJKA 1W30A 1NUSA 1NUHA 1PQ4A 2D1FA 2GVDC 4OLFA 3RS9A 1RXYA 4EKNB 1E2IA 3FOCA 2P1RA 4H35A 1NW6A 1UK8A 2OPBA 2JRLA 2IYAA 4WV3A 1XMVA 3LGAA 2D4AA 2NYAA 2W9XA 1EGHA 3LG2A 3WMFA 1I2CA 3G5TA 2OO5C 4E70A 5B7PA 1OR8A 1UL1X 3CUKA 1IZYA 2Z30A 3HVKA 3UH0A 4B2PA 4WESA 3VR0A 1XRSB 2IXTA 1O5OA 1RTKA 4JBXA 2VL7A 1EBFA 2JNWA 5FFFA 4ARSA 5L53A 2JCYA 2VRCA 5KTTA 3GLUA 1NSFA 1WAMA 5B1YA 4L27A 4IIYA 2CVFA 1KPIA 2E4UA 1RCUA 4ZEVA 4TLLB 1RQLA 4AUEA 1R5NA 2H9IA 4ED9A 3HM9A 2AOTB 4KG7A 4B7CA 2Q46A 2YIJA 3PNYA 5T8KC 3MRSA 3T4UA 5HKAA 2UZ1B 4Y6LA 2IU3A 2GD0A 2ZIXB 4M1QA 3AG5A 5K3FB 4L4XA 4QAJA 1QPBA 3DV0B 4W8OA 4BN0A 1N6PA 1FUUA 3UZUA 1RRKA 1QLHA 2A0WA 4YROA 3T95A 5EP2A 4TMZA 2R1TA 4FR0A 1RIIA 2OLJA 4QYIB 2O8NA 3QA9A 4BEBA 4U2BA 5CLQA 3PXUA 2B2CA 2AG6A 1M2JA 1WIWA 3DPSA 5AW5A 5A7HA 2C9OA 4QPPA 4X64B 3AILA 1IHOA 1ZGAA 2NZXA 3VFDA 3DM5A 4YRRA 4RK7A 2VHQA 1FXWF 5JSZB 2I1QA 3U7QB 3I1IA 3QF4B 2DHEA 2C42A 3WNVA 3TSOA 2O8CA 3HSSA 4G97A 1J22A 1VLJA 4YCNA 2XH8A 4XWAA 1CHNA 1TA8A 3WDLA 1GNVA 2ZEJA 4BFCA