5DN2A

Human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
MFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin-2 reveal a zinc ion binding site remote from the vascular endothelial growth factor binding pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dn2A00
2WO2A 1DP0A 2J1UA 5C71A 1W9TA 1CZVA 1W9SA 1XNTA 1US3A 2E31A 2W1UA 1T2XA 2W5FA 4CUBA 2C4XA 3IB3A 1JYXA 2QBXA 4CU7A 4QX3A 4DEQA 5IJRA 2EIBA 1J84A 3ZM8A 3UETA 3P6BA 4BXSV 4W50A 3HNMA 2Z4FA 1L7QA 2YFZA 3F2ZA 3SEPA 1OF3A 1H6YA 4MADA 4AAXA 2HLEA 1HN1A 2ZEZA 1OT5A 4OMCA 2XOMA 3P1IA 2BERA 3DYMA 3LE0A 3ACHA 1I5PA 2EIDA 3ECQA 2VZ1A 4DXSA 5J1XA 3J7HA 1CZTA 2W47A 5LA2A 3ETPA 2QQKA 3WNPA 3OG2A 3WF1A 2VQUA 2E33A 3OGSA 3UNPA 3K4DA 2W1QA 4OMDA 3I2JA 3DECA 1EUTA 4XUOA 3DYOA 3A22A 4QX2A 4E8DA 5DMYA 1W8NA 2VZSA 4QB6A 4LQRA 2VZVA 3K75B 2B9VA 2VMFA 2WAOA 1K12A 2VZQA 2JKXA 1JYVA 5HPOA 2E26A 2BBAA 1P8JA 1UYZA 2W91A 2QQMA 2J1EA 3WF3A 2E32A 1JZ2A 4D8MA 3WF0A 4JX0A 2EIEA 3K46A 4IUGA 4A45A 3SKJE 4A6OA 5JMOA 3HJRA 4UI9L 3FN9A 2VCBA 1GOFA 4JKKA 2J7MA 3FL7A 3SKVA 1W99A 3I2HA 5DQ0A 2VQTA 2WBKA 3W5MA 2VL4A 3HNBM 4RN5A 3I2IA 4KWUA 2QQNA 3T0DA 2XHNA 3WEZA 5JXJA 2J22A 2WYSA 4L0PA 1D7PM 4CVUA 2X10A 2EICA 4ZY9A 4XZUG 1OF4A 1XNAA 3IAQA 2VMDA 3VD9A 5LA1A 3C7FA 2Y6HA 2JE8A 2RJ2A 4OYUA 1BHGA 2B4KA 4BK4A 2W3JA 3I97A 1UY1A 3IAPA 1K45A 4UOJA 5EIYB 5IYYA 5LA0A 5G05L 5LCWL 3LEIA 4DXTA 1GNYA 3AC0A 1GQPA 3A23A 1ULOA 2J1VA 4QDQA 2CDPA 4QDRA 3T0BA 4ARXA 1LNSA 2X09A 3NQHA 2QQIA 4QDSA 2YG0A 4QPWA 2Y6JA 3I2GA 1K3IA 3EB7A 1UYYA 1SHWB 1W8OA 4A3ZA 4P00B 2Y8KA 1DLCA 3CIHA 4GWIA 4GZ9A 4RYDA 3MUY1 1RYYA 3THDA 2QQJA 4M4RA 4BK5A 4JHZA 4ET7A 4E8CA 3C7EA 3LQCA 1YQ2A 2W1WA 3OEAA 1CIYA 2VZOA 2KD7A 5JXIA 4QX1A 2BGPA 2WAAA 2WABA 4KI5M 1JU4A 3I3DA 1WCQA 1OH4A 2DDUA 1TVGA 4TXWA 2ID4A 3WNOA 1PMJX 3I2FA 4Z2AA 3CDZB 2WQ8A 5F7UA 2YC2A 4MO3M 1NKGA 3FHAA 1JZ3A 2BZDA 4LKSA 4QX0A 4A41A 5I0DA 3CKHA 2V5DA 1UY2A 2WO3A 3GGLA 1OD3A 3IIIA 3WNNA 3BN6A 1GMMA 3K4AA 1EUUA 2VJXA 4CU8A 2J1RA 3OEBA 2YB7A 4BDVB 1H6XA 4XUTA 1F4AA 2XQXA 3CMGA 1JI6A 2VCCA 2Y6GA 5IFTA 3NJVA 5JR2A 2C9KA 2ORZA 1GU3A 1SG3A 2WUHA 3FHQA 3VDAA 2WO1A 2LW8A 2ZEWA 3NRUA 5IHRA 3GM8A 1UYXA 2QQLA 2J1SA 1JYWA 3C7OA 4JKMA 4OUEA 4PF1A 2VZ3A 1UMIA 4MOAA 1GOHA 1UX7A 4W8JA 4DEVA 3T2OA 4P02B 4ZZ8A 2W9XA 3HPNA 2V72A 3VD5A 4DUWA 1UY3A 3OGRA 3ABZA 2VM9A 2VMCA 4HG6B 2VZTA 3MBWA 3THCA 1JZ8A 3VD3A 3T2QA 4ZXEA 1JU3A 3NJXA 3D3AA 1SDDB 4OZOA 4QB2A 3DYPA 2WN2A 2J1AA 3SEEA 3CQOA 2J1TA 5JXHA 2VR4A 1XPWA 2WZ8A 1PMHX 5B4NA 3WF4A 1PX3A 3OB8A 3MV01 1O8SA 4DUXA 4GWJA 4PT6A 2HYXA 2JDAA 5FUIA 1KGYA 3C7HA 4FI9A 1F4HA 2V4VA 3K4ZA 5C70A 4LHSA 2VO5A 3HNYM 4M4PA 5A1AA 4QAWA 2JD9A 3ACGA 5EJZB 2W94A 3WNMA 4TTGA 1DYOA 4XUQA 2L9LA 2VZRA 2BGOA 2W1SA 2CDOA 3I3EA 5EJ1B 1KEXA 3C8XA 3T0AA 2VZPA 1UXZA 4MGQA 4CU6A 1NX9A 3I3BA 2ZEYA 1PX4A 1UXXX 3LPFA 4CUAA 5CYYA 1ULPA 2ORXA 2W92A 2W46A 3A21A 3ACFA 2VTFA 1J83A 3K77A 2WZEA 4JKLA 3MUZ1 1WKYA 3ACIA 2DCKA 2X05A 4ARYA 1MPXA 1JHJA 2LS6A 3CZJA 4D0QA 1O59A 5DPNA 4AG4A 3OBAA 2Y64A 1TG7A 1W0NA 4KMQA 4QB1A 3C7GA 2YFUA 3WNLA 2ZXQA 1UZ0A 3UESA 1O8PA 5DN2A 3PUIA 3LPGA 4DXRA 2W95A 4LPLA 1GOGA 3WF2A 4A42A 1UMHA 4A44A 2VMEA 3E1F1 1JZ6A 5HXMA 2DCJA 3WQBA 1US2A 1IQDC 3EYPA 1XC6A 3OGVA 3T2PA 4PQQA 1UY4A 2ZEXA 3VDBA 2R7EB 3PUHA 3HOBA 3NNGA 1K42A 2PQSA 1CX1A 1CZSA 4ZZ5A 2W87A 3A7QA 5CZKA 4P08A 3LEKA 1W9WA 3IDAA 4P5YA 2QQOA 2WDBA 3W5NA 2C26A 2WN3A 3BGAA 2Y6KA 3HEIA 1UWWA 3U37A 1JZ4A 3WSOA 3GXUA 3HN3A 4W4ZA 4XUNA 4XUPA 4YPJA 4XVHA 3LEGA 1UY0A 3VD4A 3VD7A 3MO4A 2RV9A 1GUIA 3WNKA 3T08A 1JYNA 5IFPA 4XURA 1NAEA 5JUVA 5JXGA 2VZUA 5B4XA 2XONA 2Y6LA 3GDBA 2OKXA 4UAPA 5G04L 3CZUA 1R64A 4CU9A 4A4AA 4CUCA 2RVAA 3I2KA 4BJ0A 4DUVA 3VDCA 1JZ5A 3JXSA 2VCAA 2VC9A 2YC4A 4MGSA 1L7RA 1NUKA 2VOTA 3T09A 5C7GA 3MV11 1JZ7A
chains in the Genus database with same CATH superfamily
2WO2A 4YGCA 1DP0A 1JMUB 4LIUA 1UZYA 1H1AA 3POEA 1W9TA 1AR62 1TME1 1W9YA 1SPPA 5A3MA 4YWAA 5CVRA 1ZBE2 1CONA 2E31A 1W9FA 3IZOA 3RDIA 4QPGA 4C8DA 2GMPA 2SBAA 2W5FA 4CUBA 3KD4A 4XILA 4LOTA 2C4XA 3LB9A 4N8MA 5FY0A 1LESA 2IVJA 3W9AA 1JYXA 4NRQA 4PLOA 4DEQA 3TBDA 4DNYA 1J84A 5FY5A 1GZTA 3VHRA 4LHNA 4K40A 3UETA 3PIJA 5FP8A 4BXSV 2Y33A 4W50A 5JOWA 3HNMA 3M3OA 1W6NB 2ILMA 2EF6A 3ZYIB 2PA7A 1LHVA 1PK6B 2VW1A 5BY5A 3ZXEA 3V0BA 3AXDA 2ZA9A 1BK1A 3KCYA 5FFOC 3SEPA 4MADA 4AAXA 4MGYE 3SQOA 5F3EA 1AXZA 1HN1A 5FYUA 3AKPA 3AP5A 2YHJA 2ZJCA 1KDMA 1EV12 2XOMA 1NLRA 2A6XA 3PURA 2DUPA 4OMCA 4XBLA 2HWF3 4DFSA 1I5PA 4AI3A 4HK9A 3WP6A 4BPZA 3ZFEB 3JQXA 4XAEA 5CEHA 5LA9A 1GANA 3DKQA 5FCCA 3H8UA 4DXSA 3VDDC 4EN9B 1PNFA 4LT5A 4JDOA 2VTXJ 4FOYA 4N90A 4KU7A 4LE4A 1ND3B 4XQWA 1IKQA 3OGSA 5A3OA 4FXKB 4Q5OA 4RHV3 3H1MA 3K4DA 4YNIA 5EXOA 2R32A 3UV9A 1C8NA 5T54A 4AGVA 1D4M2 5IW0A 1XU2A 2W1QA 1H9WA 2H0VA 1BKZA 2A70A 1NZIA 5FYSA 2H0BA 1W8NA 2NMNA 3FUOA 3LZZA 5EPAA 1N3QA 2IXHA 1W6NA 5DDJ3 1UU6A 3AMHA 3I3QA 1K12A 1IG0A 2VZQA 3N9NA 4N7IA 4MUVA 1TME2 1WBFA 3NJZA 4WM7B 2P1BA 5FLHA 1UYZA 3RS6A 4FTBA 2HBTA 2J1EA 1HXS3 1MZEA 2Q8CA 2D97A 5JLVA 1BBT3 3WF0A 4JX0A 1OFNA 2G19A 4AOCA 3VHNA 3KF5A 3VL9A 1G6NA 1YO8A 1TMF1 1QOSA 3HJRA 5J7MA 4UI9L 1C8M2 3HBKA 2ZHKA 4NPRA 3POBA 4JKKA 4YM0A 2J7MA 3PJQA 1W8ZA 3VUOA 4JRAA 5IAVA 4IV3A 2JDZA 2JD4A 3ZFGB 5FO7B 2VH9A 2WBKA 4LKFA 4DPNA 3W5MA 4LUMA 2W0XA 3H3LA 1AZDA 3BTAA 3RG0A 3UKVA 2UU8A 2ZS6B 2GC0A 3I2IA 4AFBA 1AR63 2GNTA 5EQUA 5JSPA 3OGGA 2WYSA 2AREA 5EP9A 5FLJA 1KS5A 3GJAA 1V9U1 5E1RA 1WW5A 4KWKA 4RR3B 1AR72 4WVMB 4BLIA 4BCUA 4EZ4A 5FYMA 3RZKA 1F15A 2XKOA 1AR81 4KBZA 2EICA 1KDKA 1PIV2 3PMEA 2YZ4A 3U07A 3ZXAC 4D7SA 1AF9A 2XPJA 1OF4A 1XNAA 2VMDA 4X8NA 3VD9A 5LA1A 1HRI3 4IEOA 4KG8A 4CDUC 3OYWA 3KV6A 4LBQB 4A7KA 2DUQA 5CKQA 4PI2A 2CGNA 3OD4A 4M3CE 3RQ0A 4Q4W1 1ZM1A 1O91A 1GQHA 2ADEA 2W3JA 2OX0A 4UOJA 2FDKA 2ET1A 4B3NA 2Y0IA 5DZEA 1WMDA 4YZ5A 4L8QA 1FATA 2XWJB 4YSFA 1EAH3 3JD71 3MF9A 3O7OA 1T6BX 3JQWA 4QDQA 4DB5A 4QDRA 2GNMA 3RFRA 4QDSA 2YC0A 1VBE2 2YG0A 3LIHA 2Y6JA 2IUWA 1IKPA 5DAWA 2GH8A 4Y26A 4KGQA 4CP0A 1BBT2 3EB7A 2D43A 4LIVA 1RITA 2WZPP 1SHWB 1LENA 1WA6X 3RSJA 1PO13 3VZLA 4MHRA 1ENQA 3I59B 1QDOA 4HKOA 4S2DA 2VQ0A 2ATFA 2BNNA 1DLCA 2Y8KA 3CIHA 4GZ9A 4A7ZA 1W28A 1RUG3 4IESA 1D4M3 3THDA 4YW3A 4EE2A 2FZ2A 1COV3 3VBFA 3HBZA 3C7EA 2XR4A 2W1WA 2WWSA 3LQCA 5A32A 3FFQA 5HV0A 3I8TA 5IT6A 1DBNA 4J6GA 5FPBA 2KD7A 1W6MB 1GFF2 4KI5M 2WABA 1FT9A 3M2MA 1QJX3 4K7JA 3R4UA 1WW7A 4D69A 5I93A 1DHKB 2HWF2 1WCQA 2PAMA 4JGZA 1GP4A 5FYTA 1Y4WA 2VG9A 4Y20A 4P9IA 1OSGA 2BQPA 2ID4A 3CJXA 4QWNA 1AR82 2W39A 3WR0A 5HCAA 3V64A 2AGSA 3CDZB 3H50A 5FZAA 4ZONA 2ZAHA 4CDWA 3CHXA 1POQA 3VDDA 2XL7A 4CTEA 2WNUA 1CR7A 1APNA 2HWB1 1QWRA 5C8WA 2HKXA 3FHAA 5LASA 4WVVA 4CDWC 4XABA 4LKSA 4Y22B 4ZPIA 1MR5A 1PMIA 5APAA 1QOTA 1NY72 1IS3A 3D5OA 4WZFA 3WP4A 4JCKA 1YRZA 4XBQA 4XCBA 2PXJA 4B29A 5F5QA 1AR83 1MQTB 3B94A 5LBEA 3K4AA 1AYN2 2RG4A 1W8HA 5KHKA 2B8MA 1X8EA 4QKNA 4Y1ZA 2DYCA 4GH4B 3ZLIA 2RDSA 3AMNA 5FY1A 1F4AA 2LTNA 4CCJA 4DQAA 1ZNPA 2X5IA 1Q3EA 1ZRCA 2CTVA 5AVAA 2IZWA 4N43C 4AHZA 3BUCA 2QCSB 4PDWC 5DAQA 3WCSA 4ASMB 3URFA 1XNCA 2ORZA 3H1WA 2WUHA 4IEPA 4UFJA 1GNZA 2A7AA 2WSVA 3O12A 1DQ5A 4AI1A 4K1YA 1XOYA 2LW8A 2WO1A 2XJUA 5FZFA 1JYWA 1WCKA 1JODA 1OXCA 5D8AC 1RUF1 2QDNA 1HW5A 3PVEA 4HSJA 1JTZX 1CAWA 1Z78A 2NPIA 1HDKA 3GM8A 5FZEA 3AP4A 3LA2A 2HEWF 2ZMLA 5FZHA 2VU9A 2GC1A 1HIXA 5BNPB 2CHHA 5JMCA 4XHXA 1RVF3 1W2OA 2YXSA 2VQAA 1KS4A 2EVXA 1BBT1 1S0CA 1B35C 2Y26A 1UMIA 1YCIA 2FDFA 4EWDA 3W58A 1UOBA 4L2NA 1Q56A 1LEDA 3PU8A 4UFMA 2WNUC 3FLRA 3R05A 4NOTA 1J3RA 2E63A 2W9XA 3FUQA 1N1VA 1W6OB 2RS13 4I0WB 5CBLA 1DQ6A 2OXBA 2RMU3 2WSUA 3VD5A 5IVVA 1XQNA 3RVHA 1UY3A 3N7MA 3ABZA 4YLZA 1CAXB 4B4QA 2VMCA 5FYCA 1SZBA 3V0AB 5F2SA 1JZ8A 1D0HA 1IZ3A 3T2QA 1NA1A 4PCRA 1NY71 4Q26A 3AP9A 3D3AA 1OHFA 3J7LA 4CP9A 1SDDB 5ACA1 1FPN2 4QB2A 2ZZJA 2XBO3 2WFF2 2C24A 2WS91 5GKAC 2HWF1 1U12A 1XE0A 3ZYGA 3O1VA 3U4XA 2HWE1 5BNOB 1MACA 3KMHA 1AR91 1TEIA 2VR4A 2O8OA 1SPPB 4FTEA 1ZBA1 5BNNB 4CPBD 1N3OA 1PMHX 2JDNA 5JDBA 3WF4A 1YI9A 2A6VA 2R061 1AR93 2UYAA 3MW2A 2PQQA 4LLFA 1ODMA 3MV01 1S1AA 4HONA 4EZHA 3E6CC 4XCAA 4H7LA 2JDAA 1OVSA 4R4ZA 4RGKA 2BFUL 3ALQA 3KF3A 4SLIA 4N7UA 1F4HA 2PMWB 4CEYC 4LA3A 3K4ZA 2ZBJA 3AL6A 1C8M3 5FZLA 2QQUA 2QQWA 2XHKA 4GALA 2FMDA 3HNYM 1FOD2 4AQ6A 3B93A 4M4PA 4YZ2A 5FMDA 1UN1A 4QX8A 2JECA 5HCFA 5EJZB 4TTGA 1WMXA 4RQPA 4AEKA 4XF1A 5FXWA 4JGYB 4XUQA 2Q1ZB 2L9LA 1LKNA 5DUVA 5T52A 3VZMA 1RUOA 2VZRA 3SNMA 5IK4A 1LOAA 1UPSA 4P9YA 3WQ1A 2BGOA 4R4XA 3LCPA 4AWDA 2CDOA 4GA9A 4TLGA 3QLQA 1KEXA 3NNMA 2BWCA 4PBOA 5FZ4A 3VHPA 4CU6A 1MS0A 2P37A 1S0BA 5A1FA 2HJIA 2JX9A 3I3BA 2ZEYA 1ZA4A 4IDZA 3I49A 2XJQA 2D3PA 2YUEA 1YXWA 1QIQA 2CV6A 3WW4A 4AI2A 3EQEA 3D4KA 3VHOA 2KA3A 4NUBA 2KR2A 3J9SA 1RJ8A 4FT8A 4CUAA 5KHGA 2V4AA 3GZUC 1ULPA 2ORXA 5CFCB 5AC92 5IWFA 1QJU3 3CL1A 5JCTA 4M0HA 1FAYA 2DTWA 4R9AA 3MUZ1 3HD8B 1NCQC 1DZQA 2MHFA 4D6SA 1NOVA 1EV13 4FPCA 4JGYA 2DWRA 4H7MA 2R49A 5GLUA 3RZJA 4LO8A 3IMMA 4NHXA 1MPXA 4A3XA 2LS6A 4YZ3A 5A80A 5FY7A 1U5IA 3CZJA 4BLJA 1PO23 4D0QA 1O59A 1PVC3 1SDWA 1ZRRA 1VLNA 1IPKA 2CYFA 4NE9A 5A7PA 1AX0A 3ETQA 4LBLA 3S57A 2XJVA 3C7GA 4LBQD 5FZ6A 4X6QB 3N9QA 4QQLA 4AL9A 1UZ0A 1V6LA 3CF6E 1VALA 2BGCA 4GWNA 3DGTA 5DN2A 3ZDVA 4F3JA 4DXRA 1REEA 3L2YA 4BZ4A 5JSOA 3ZFFA 4CP2A 2ZGOA 5DAXA 4YW6A 2ENRA 2DFCA 2D6LX 4E9KA 5FPLA 3CLPA 4ES8A 3POJA 1US2A 1OOPA 3OGVA 4NJ4A 4PQQA 2A5ZA 1YJKA 2C5DA 3LDRA 2A6WA 1X7NA 3NKGA 1HV1A 2JDKA 4HVRA 4GJYA 2R062 4QHOA 3UKTA 3B9IA 1K42A 1KJLA 1R093 5J36A 1CX1A 2QE3A 2YGLA 3CNAA 4QQOA 1CN1A 4XFIA 5FREA 4HT1T 1VAKA 3A7QA 4QQHA 2XH6A 5A7WA 2UY9A 5BV6A 5CZKA 4OHWA 5A7NA 2PAEA 1KFUL 3OUJA 4UF0B 3U78A 3UGGA 4DIQA 3VBSB 4C1WA 2Z5WA 3IDAA 3KCXA 2Y60A 3PU3A 1J3PA 2QQOA 1DGLA 4FP3A 3SMHA 5SV8A 1VJ2A 2WN3A 1LHOA 5JOXA 2XBO2 3AXEA 3P3PA 5TSWA 5AC91 5C3QA 1BMV1 3HEIA 3O5SA 3DXUA 1K5MC 1QJY1 3U37A 1FMD1 3WSOA 3GXUA 3VBHB 4A2UA 2ZGSA 4MGZE 4PIXA 1X50A 4WM8B 1V6KA 1XE8A 4RHV1 4XUPA 4YPJA 1UOJA 2ZTNA 3S6PA 2RS12 5F37A 2OZJA 4I3GA 5L9VA 3VD7A 3MYXA 3POYA 2CL2A 3ST7A 3O0WA 4K9SA 3T08A 1NAEA 2FCTA 3VKFC 4CP9B 1HJGA 2VUJA 4PLNA 4FPHA 1A6CA 1XNKA 2P3IA 1AYM1 3PJYA 2XONA 3GDBA 4UW5A 2YDEA 3C2UA 5DDJ2 3ITQA 1R64A 1RUC3 4RS5C 1HB3A 3I2KA 4DUVA 3KV4A 5K9YA 3SXWA 2QNKA 4QX5A 1W3XA 1WWYA 3OBRA 3U14A 2VCAA 1X9TA 4Q4V3 3OPZA 5L36A 2TNFA 2Y6FA 1D0GA 2DVGA 4COYA 4OUMA 1YNAA 4Y4RA 1NUKA 3U0ZA 1LTEA 3J8F2 2TEPA 2VOTA 4IEUA 4PIYA 4RFT0 4Q4Y2 2WNVB 5DAPA 5C7GA 3BTZA 3MLJA 1RMU2 2FDGA 4XOGA 2J1UA 3DEMA 4N9HA 1GZWB 3DL3A 3O0XA 4ZU5A 1ZRIA 1NCQA 5DUWA 4HK8A 1CZVA 5IATA 1JYTA 4E2SA 1PZ7A 4LKDA 3N36A 1VMJA 1XNBA 1W0OA 2I45A 2W1UA 4RGAA 1V6JA 2MNGA 2VPVA 1X36A 1UKGA 1YHFA 4CDWB 4QQPA 3ZXFA 3IB3A 1PZ8A 1VBC3 4Q4W3 1QKQA 3VBOA 4A6SA 2XJTA 4XZPA 4CU7A 4NROA 4META 1PGW1 4QX3A 1RB8G 2D6OX 3RNSA 5I8YA 3MGUA 1PZ9A 4JGZB 2KM2A 3NV3A 1MQTA 1FMD2 3LIGA 3WOGA 1RHI1 1AXKA 2Q8OA 4AZZA 3N9LA 3GCXA 4LMFA 3MIGA 5CG8A 1W8WA 1CJDA 2XJPA 3GF6A 3ZSMA 5C8CC 2RM23 4HN0A 3R4DB 4MH0E 1MVQA 1YQ6A 4IE6A 1UKRA 5GM0A 4CCDA 3POSA 2ZMKA 1NLQA 2XDVA 2BERA 3OBZA 1EV11 4Q1PA 5CNAA 1FV2A 2ARCA 4P9LA 5DZFA 4C90A 3WDWA 5FR3A 5J1XA 2JE9A 2Q5TA 5CB7A 3ETPA 5J37A 5DDJ1 3WNPA 4PI0A 3ZXJA 4Z1VA 1W8TA 1UNBA 3NV1A 4XTMA 2E33A 3PL0A 3N7LA 2DCTA 3MIEA 1ST8A 2P6CA 1OLME 2ZGTA 1BQPA 4OMDA 2HEYF 4EN6B 3DECA 3AB0A 2IXCA 4OCTA 5GZFA 4WM7C 1MZFA 1PO21 3ZX7A 3IDCB 2JG9C 4E8DA 4Y20B 5C8CA 1CIWA 4ORFA 4AYUA 1Q8SA 1CWPA 1BEV2 2VMFA 2A75A 1PO12 3ZPOA 1PK6C 2IXIA 1JYVA 5HPOA 2E26A 4LEJA 2XLFA 1ZA7A 3BYWA 5LBCA 3B5LB 2W91A 4FO9A 4LITA 3VZOA 2E32A 1S4CA 4RFRB 5FAXA 3KLSA 1JZ2A 1JUHA 3JBG1 3WDXA 3AYDA 4D8MA 5LW9A 5KC6A 1ND2C 3K46A 5FMBA 1HN0A 2NQYA 5FUPA 5JMOA 4WVWA 3POIA 1SLCA 3WD5A 3I3MA 1BYHA 2VCBA 2YV8A 1C8M1 1Y9GA 2ZGQA 3WZ1A 4B4RA 3KHCA 1W99A 5FZ1A 4GULA 4MSVA 5DQ0A 3VBSC 2VQTA 3AKSA 3UGHA 3HNBM 2EAKA 4LUKA 1SACA 4B7KA 1C4RA 2E51A 2PN5A 4M00A 4KWUA 4UFLA 4FPLA 5DG2A 4F83A 1ZRFA 2J22A 4I30A 4Q4X3 2PHTA 2ZGNA 1NLSA 2OQ7A 1W2UA 4LORA 2D93A 3O0VA 1LB2A 2WZR3 2F17A 1O3RA 2OA2A 2VULA 3L2HA 2AEZA 4XZUG 3ZOIA 3IMNA 4L99A 3B9CA 3MFAA 4IGOA 4AGRA 4O61A 2QDRA 5FP9A 1FYUA 1N1YA 1PVC2 3OUHA 4FPEA 3IBMA 1CAXA 4F7ZA 1VBA1 1XSQA 1G9BA 1CAUA 4I3PA 4JTOA 1MEC3 2RJ2A 4MYEA 2BPA2 1BHGA 3O14A 2RS51 1UY1A 1K45A 1RUE1 5EIYB 5C4WB 5LA0A 2W2IA 1W8FA 4G9SB 1GNYA 3JD72 1Y9MA 3A23A 5CFCA 2PHFA 1H8VA 4JZRA 5J98B 1VRH3 2WINB 3ATGA 2CDPA 1C1LA 3T0BA 4ARXA 2X09A 1Y43B 2GH2A 3KS7A 5CIRA 2GAUA 3VL8A 5JI9A 4YFZA 3I2GA 4B8EA 1DQ0A 3U1XA 2VOKA 1K3IA 2PYTA 2IWGB 2VOVA 3ILNA 3KQRA 3J8F3 4XHBA 5FK7A 3NWKA 1JYCA 1UYYA 1QXRA 3I2DA 1VBB1 5JZGC 3AMPA 4CXYA 5ACA3 4LBKA 4P00B 3LGRA 4GWIA 3ZFEA 4RYDA 2VGDA 3MUY1 1RUF3 1RYYA 2IXJA 2IFRA 1OA3A 1YWKA 5C3SA 4BK5A 2GALA 3FJSA 4OFGA 3ZXLA 3S30A 4FVVA 1S0DA 3RZMA 4AGGA 4E8CA 1A3KA 4B7EA 1BVVA 1DFQA 5A7QA 3AVSA 1WMEA 4GKYA 5ANNA 5IVBA 5A6ZA 1K5MB 1UZVA 2V5YA 4EROA 1IQAA 2WAAA 4FFGA 4WM7A 3POWA 3N3HA 4AVAA 3IT8A 4XMAA 4Y22A 1BEV1 3N7JA 2J42A 1MEC2 4JRLA 1W2TA 4LNVA 1OH4A 2WKKA 4WM8C 4QKBA 3WHTA 4IV1A 4QQ2A 4D6RA 3GZTB 1CAWB 3B7MA 4Z2AA 3I2FA 5K7PA 4CDXB 2JE7A 1OKOA 4V1PA 4LA2A 4OI1A 3RJRA 3KZ4C 4XEZA 4FTSA 1NT0A 2HWB2 4MO3M 5GZCA 5HBAA 2NN8A 2MEV1 5BYNA 1JZ3A 1LAJA 3ZN4A 2PELA 1BXHA 5T5OA 4I0BA 2VW2A 4CEYB 2W68A 1SBDA 1RUI3 2V5DA 4ZS2A 1RUH1 4K8RB 2WT0A 2WO3A 5C9AA 3GGLA 3IIIA 4Q8KA 3LKJA 2DFBA 3WNNA 3ROUA 4NIGA 3K3NA 2IXLA 3ZXKA 1GMMA 3HQRA 3Q8EA 1ULDA 3USUB 5DZGA 4UW3A 2E7AA 4AFDA 2BVVA 4FPJA 1IHMA 4CU8A 1KXGA 2J1RA 5BNNC 1R092 2YY1A 3OEBA 5FPXA 4YRDA 1H6XA 1ZBE3 3B00A 1O3TA 1SFYA 3TYJA 1KITA 2XQXA 4AR2A 3N35A 3CMGA 4IL7A 4Q0QA 4OHYA 1JI6A 2VCCA 1H2NA 1N47A 1Q8QA 2VUAA 2VTXA 3APBA 4YW7A 5IFTA 5J48A 2QKDA 5GLTA 3QD6A 2OIIA 1UIJA 2RS33 4BM8A 1PVC1 1GU3A 1SG3A 5IK5A 1URXA 3BTYA 2RJLA 4HETA 1AL0G 1ZZBA 2LALA 3OOXA 2OQ6A 2F6BA 4RL7A 4XDQA 4CDUA 1RUE2 2IVIB 1OOPB 4HFSA 1D4M1 3VBUA 1J1TA 2VECA 4OHVA 5C5TA 5E88A 2XQRA 3NRUA 2JB8A 3MDPA 2D7FA 2GNBA 4FAGA 5FIXA 1ALYA 4Z07A 3C7OA 2HBUA 5CFCC 4PF1A 1GQGA 4UBHA 1MEC1 5I8SA 5FZBA 1HJFA 1ZRDA 2B5HA 2PHRA 5GLVA 4CA9A 4RQPB 4AI0A 4FPGA 1M06G 2JICA 4EWEA 1UX7A 3Q8CA 4W8JA 2XJSA 1OURA 3H3ZA 2G9FA 3IPVA 4PHZA 3AYCA 4EJRA 1QJFA 4I01A 4DUWA 2DVFA 3JB4C 4CEYA 2UWBA 2OS2A 3N4MA 3PVBB 3T4VA 1OUSA 2O14A 2R0FA 2VZTA 4YVWC 3ZN5A 3VD3A 1JH5A 1RUH2 2RM22 3NJXA 4ZXEA 5K0UB 2LRPA 1OLMA 2A1XA 3RYKA 5ACA2 2J1AA 4DMIA 3RPQA 3KHBA 3TN91 5IUQA 5KXCA 2WA4A 5A33A 5FXVA 4ZKTB 4P9JA 2ZPXA 1U5YA 4IEVA 5FYIA 1GNHA 4UFHA 2ZMNA 3EBRA 3VBRA 1R091 5JXHA 2P34A 1U5XA 2CWMA 1XPWA 1LU2A 1DQ2A 1V9U3 4XTPA 2WRAA 1UD1A 5B4NA 1W2NA 4QX7A 3UGFA 2WIIB 3OB8A 1EAH1 3JD73 4CDUB 5KBFA 4BISA 3AJYA 4M3CF 1LGCA 1MVEA 4P9WA 5FZIA 2AZ5A 1S0GA 3SCGA 4AEDB 4AEDC 1GBGA 2BRTA 2P2KA 1YFXA 3KSCA 3WUDA 2W52A 3WV6A 2HH9A 5FUIA 1KGYA 1Z0HA 1ODNA 2MEV2 5FZMA 5IVEA 2V4VA 4DZGA 5T3NA 4Q4W2 3PUQA 4BQ4A 4KBBA 1NYWA 5A1AA 4QAWA 2JD9A 3ACGA 1KD7A 5JI7A 3M4FA 4Y5Z0 1D4VB 1DYOA 3VKLA 4DINB 1JOPA 4QHBA 1RUD3 3IDEA 1POV3 3SISA 2D6PA 3ILRA 1OQDA 4LULA 5DAVA 1DZRA 5FPUA 1VBE1 1IG3A 3NAPB 4QPIA 2R0HA 5EJ1B 1RUC2 1X8MA 5FYVA 5CISA 1ZREA 2EXKA 2VBPA 1VIWB 3EJKA 4GJZA 4AXOA 1WW4A 1NCQB 1NX9A 1PGL1 4QD2A 1S2KA 2JB4A 3LEMA 4W6YA 2JENA 5K4LA 3MZHA 4CCKA 4XFFA 2E6VA 1YI7A 2A6ZA 4LE3A 3H9AA 2DF7A 3JUUA 1VBE3 3CJIB 3TWIA 2W92A 2RM21 1OH3A 1PM4A 1Q8PA 3A21A 2JDHA 3ACFA 3E6DA 3LA3A 2RR12 1C3HA 3JZVA 4JKLA 3KT7A 4GH4A 1REDA 1WKYA 5FZOB 2NMOA 4CCOA 1PHMA 3VBSA 1UYPA 4M3CA 5JIUA 2Y38A 3K2OA 2VUCA 2DU0A 5KR7A 1LGBA 2G9GA 1BEV3 4NHYA 1BVP1 5FP7A 5A70A 4Q0SA 3RMYA 4B1MA 1MQTC 2YBKA 4NN0A 2Y64A 3D6EA 3PDQA 1TG7A 1OBNA 1WUVA 5L7OC 1W0NA 4FBFA 5JSRA 1VMHA 3QH7A 4LLOA 4NAMA 3K48A 3ZFEC 1RUE3 5T55A 5I0UA 3E5QA 4PIZA 5L7OA 3ZYPA 4AFCA 3R6SA 3LPGA 4Q4X2 2X53S 3QOPA 1R1A2 1GOGA 4LPLA 3VKNA 3WF2A 4A42A 5FV3A 3TOJA 1GSLA 2OPKA 3PMSA 2WLPA 2H6CA 1RUJ1 2VMGA 2JG9A 2WA3A 3WQBA 1LOFC 2VXJA 3OUIA 3KB5A 2P17A 4M01A 3T2PA 4DOUA 5L9BA 4P14A 2R7EB 3PUHA 2WO7A 5FK8A 1SLTA 2JJ6A 2WFPA 3RMXA 4ZZ5A 5HCBA 4CEWB 1NE4A 2W87A 2ZX2A 3IN9A 1ZYBA 4ATEA 1UF2C 2RHPA 3AJZA 3CBNA 1PM7A 4P08A 4AW7A 3BPZA 4XC9A 3LF7A 3IPVB 2KXLA 4P5YA 3JB8A 1ASJ3 1GZ9A 5FPVA 3EXUA 3ZPYA 3W20A 5F2WA 1QU0A 2RDNA 2WWJA 4YVSC 5EHDA 1W6QA 3HIFA 2C26A 2PAKA 3TNPB 3FBYA 2XBO1 4N53A 2D6KA 3LFMA 2RR11 3BOWA 4QXHA 3TN93 4IE7A 3N9PA 1C1FA 1CJPA 5EYXA 2GNDA 1JZ4A 1X9PA 5JZGB 1SCRA 1ULFA 1XRUA 2AUYA 1AYM3 1EYBA 2BTVC 2GC2A 3HN3A 4UT5A 5F3GA 4IGPA 5FZ9A 3WX5A 3O1OA 1UU5A 3FBMA 4XUNA 4CRQA 1RUC1 2DVBA 2A73B 4KL1A 4XVHA 1SLAA 2PHDA 1GZWA 4LO5B 3VD4A 4IETA 1GUIA 4XPVA 3WG4A 4AVBA 2ZCWA 3N9OA 4JC1A 3H8RA 4KNCA 5JUVA 2ZABA 3BU7A 3WQ0A 1DGRA 2OPWA 5B4XA 2Y6LA 4L92A 3GCWA 1W6PA 2RVAA 4BJ0A 4E4SA 1A78A 5SV5A 3W59A 3VZJA 2GN3A 1W2AX 2CNAA 4QXBA 2R16A 3Q8BA 5M0TA 2VC9A 3MIDA 1FNZA 2WS92 4OZXA 1W0PA 4CEWA 2YC4A 3NV2A 1L7RA 2DURA 4LXLA 2A71A 1XYOA 1JUIA 4JGZC 2EA7A 2TUNA 3MV11 3RGBA 3TEWA 2BYVE 4Q8LA 3VV1A 1D2SA 4RS5A 5A6QA 5LZ6A 1UCXA 4JQTA 4CCLA 1QNYA 5C71A 4CCEA 1O3QA 2VCMA 3B69A 3OTFA 1TQ5A 4IE4A 3WP5A 1DQ4A 3MICA 1XNTA 2FBEA 1H8TB 1YFYA 2RJKA 5C4WA 1W6QB 1BCXA 2QJVA 1GV9A 3LAGA 3ZO0B 4GWMA 1I1EA 2P3KA 4QU2A 4NWWA 1FI2A 3OPWA 4XFCA 4X6RB 4ITCA 4IEYA 1AUYA 2EIBA 2JDUA 3O1PA 1U5ZA 4YM1A 5LBBA 4BXFA 3IIAA 3ZM8A 4BIOA 1RHI2 1UL9A 1C57A 5FYBA 5C9AB 3RZHA 1K5MA 1Q8VA 1XSRA 2VBDA 3OPTA 1L7QA 1V70A 1W8UA 3D0SA 2QVSB 5IVJA 2VVDA 2O1QA 1H6YA 3KQ4B 3ZSJA 2HLEA 1TMF3 2VVEA 4NIDA 3H3UA 3HQXA 2WFF3 2JG9B 3QH6A 3P1IA 3DYMA 3LE0A 3MFCA 5JIAA 4RGGA 4AQSA 3ZFGC 2EIDA 2HWC3 1DF0A 5FQ0B 4BB3A 5FO8B 4OHXA 4FCAA 1KFXL 4MV2A 1AXYA 5FPZA 4E4DX 1CZTA 1WMFA 4GIQA 1YEWA 5LA2A 2JIJA 2BW8A 2QQKA 5DXDA 5GJ6A 4LJHA 3WF1A 1IOAA 2LM3A 2V73A 4E4ZA 2VQUA 1ND2B 3O1TA 1UOGA 2WNVC 5F5IA 5LRRA 1S0JA 3UNPA 5IK8A 5FPAA 2PHUA 5J09A 4XIOA 4AQ2A 3I2JA 2X29A 3BALA 1EUTA 2HWC2 1ONAA 2O0OA 4XUOA 1VE0A 3DYOA 1QGLA 1PO22 1XJAA 3D82A 3E5XA 4HXCA 4QB6A 3T1MA 4GMP0 3K75B 4PLMA 3U10A 1QHDA 1VBA3 2B9VA 2PTMA 2Z2SB 4HSLA 3ZKUA 1PO11 4I02A 1NZCA 3AP6A 1P8JA 1XNDA 3TNQA 2D98A 2QQMA 4Z92B 3RWKX 3H8OA 2P6HA 4BMEA 2GZWA 2GN7A 3I4IA 4LHKA 2GDFA 2EIEA 5FZKA 2SLIA 4QU1A 5AC93 5LY1A 4IUGA 2WLQA 3IM0A 4A45A 3HT2A 5EV7A 4P9GA 3SKJE 4HZFA 2BP6A 2AYHA 2D3SA 3FN9A 4MVTA 1R083 4LK7A 3NW4A 3AZYA 3EHKA 1AVBA 5A3PA 5A33B 2GU9A 3I2HA 5F5AA 3KGLA 5LB6A 1G9FA 2VL4A 3N9MA 4HPKA 5FMCA 3T0DA 4BQ1A 3WEZA 5JXJA 3DV8A 3WW3A 1VBD2 2HWD2 5FMOS 3AZWA 1ZZCA 4OI2A 3G7DA 4Z82A 5LY2A 3VBRB 1YLLA 2JKBA 1ULCA 3TEYA 4LKEA 4MLOA 1AJKA 3OJBA 2QQPA 2ZGPA 3LD8A 3E5UA 4CVUA 2X10A 5C3RA 4ZY9A 3I54A 5L9RA 4GXLA 4XF9A 1QNWA 3IAQA 5ABJC 4OUSA 1W6MA 5FBZA 5ISLA 2EAAA 4FPYA 2FHRA 3C7FA 1WBLA 3VZKA 2JE8A 1UQXA 5D2AA 2Z79A 1R082 5GZEA 4LBMA 1UOFA 2B4KA 4BK4A 3I97A 3IAPA 2RS52 4Y1YA 4AI8A 2ZX1A 1N3PA 3M7AA 5IYYA 3LSDA 2UYBA 2WYFA 1CAVA 4LBJA 1NXD1 3JBG3 3ZDSA 4W6XA 1ND3A 1F5FA 2OW4A 2TBVA 3KCCA 3LEIA 4H55A 4RHV2 5CKNA 5LCWL 4XF0A 2FD8A 3F95A 3AZZA 1ULOA 4LO4B 2J1VA 1ZZ9A 3MF6A 1OC1A 1A8MA 2WWUA 4BYYA 4CE8A 1SLIA 4QPWA 4KU8A 5T5LA 4CPBA 4Z8BA 5FWEA 5ANQA 2BEOA 3WHUA 2D5HA 1AYM2 2A6YA 3GBGA 1WCUA 3O1RA 1AX1A 1W8OA 2EXJA 4IGQA 4Y5TA 5A6YA 4CXXA 5IAXA 4XQ4A 5FZ0A 3SCFA 4RS5B 4XFBA 3WY6A 1CAVB 2YGMA 4H3WA 2QQJA 4M4RA 2LROA 1LGNA 2QZ3A 4L97A 2P3YA 1L7LA 5FZ7A 4GB33 5FJHA 1QMJA 4QPGC 1NCRC 1YQ2A 3TRSB 2FCUA 2RMU2 4EWAA 2X5IC 1QOOA 4GMP1 5DG1A 4UFIA 3OYWB 4LBQA 5LEKA 4JGYC 2DV9A 4OVEA 4QX1A 4PQ9A 1WZXA 2BGPA 2DU1A 4TYSA 5HCHA 1JU4A 2B45X 2YBSA 1D2QA 1S55A 3NNFA 4YFWA 4CYDA 4XE9A 5C8CB 4YGBA 3WNOA 1PMJX 1PVXA 3MI8A 2FCVA 1HRI2 1GWMA 4Y24A 3VBUB 3QBQA 4HKLA 3ELNA 4QGMA 3T30A 1OFSA 4YG0A 4COVA 2VXRA 2YC2A 3QACA 4RSUA 5D1IA 4YW4A 1SEFA 5KWRA 1SBEA 1V6NA 3I7DA 3ZFGA 1PGW2 1RUI2 1JBCA 1R1A3 5DUUA 5F32A 4BOWA 5I0SA 5FZDA 4QX0A 4BQWA 4A41A 4BE3A 4QXCA 3CKHA 5FZ8A 5JZGA 1V6OA 3DXTA 4KWJA 1RHI3 1OVPA 5CA6A 3NNJA 3DPRB 1QXPA 3WVJA 1W6PB 1RXGA 4ISQA 4FOQA 3IKWA 1EUUA 3H0OA 4Y4YA 4FFIA 2YB7A 4BDVB 1TNRA 4JQRA 3J4UH 3ZR5A 1VAVA 3BI3A 5A7SA 1ULEA 4RD7A 4COWA 4DS0A 5LWBA 4FQ4A 2X8KA 2VNVA 1QQP3 1UZWA 2R042 2OUHA 5AFBA 4MGIE 1SCSA 2CAUA 5F3CA 2C9KA 2YPDA 4CDXC 3D0JA 4XBNA 4NO4A 3WNXA 3FHQA 3NV4A 3CJIC 3N7KA 3VBOB 1ZZ6A 3VDAA 1SQ4A 3ZYHA 3GBWA 4XXPA 2F4LA 5FMOL 1IPJA 3H42B 1O6UA 1YYNA 2G1MA 3VLBB 2VNGA 4JDNA 3A0NA 4AEMA 1F31A 2WNOA 4QHZA 4R9DA 1QDCA 4N53B 4Q0VA 4Q4V1 1UYXA 2WNUB 1TME3 2J1SA 3KV9A 3SH3A 4JTNA 4YGDA 1LODA 4OUEA 4AVVA 2ZHLA 3AP7A 3BODA 4QMAA 1OI6A 2VZ3A 4R9CA 2QFEA 3QCWA 3VBOC 4UW4A 3MIHA 4XXAA 5FP4A 1H2KA 3M70A 4XDPA 2JG8C 2R6QA 5CFDC 3JBG2 5A3WA 4NPLA 3T2OA 2FDJA 4ZZ8A 4C91A 4QM8A 1HQNA 1QQP1 5CU1A 1DGRN 3GJBA 3OGRA 2E53A 5A7WB 1H1IA 2VM9A 4FQZA 4HG6B 1COV2 4OI4A 3V65A 4MGKE 1J3QA 4EV0A 3MBWA 3ZIWA 4AEDA 1B35A 3HWJA 3SLIA 4AK3A 2AACA 2D3RA 3AFKA 4CDQB 1JU3A 3T3YA 2D6NA 2WC2A 3LOIA 4OZOA 3VBHA 3DYPA 3WCRA 2XMLA 3CQOA 2AENA 2J1TA 3TN92 3GYDA 4V2WA 3M3CA 5FOJB 1E5HA 4W65A 4YW5A 2C1FA 2WZ8A 4NIHA 3EO6A 1RUNA 1HRI1 2RS31 1ACCA 1PX3A 3P5BA 3GBFA 4IV3C 4MXVA 3DPRC 1BK0A 2B46X 4XJWA 4NHMA 5C33A 4IEXA 2HYXA 3ZYRA 1NQDA 4BHPA 3ILFA 3S5AA 1RUH3 3C7HA 4UFKA 4Q27A 2V09A 4DY3A 4D6QA 1VBD3 2HWD3 3VB9A 4BH9A 1REFA 4W6WA 2ZKNA 1TE1B 3S5QA 4LHSA 4XDOA 2D6MA 3BKZA 2ARXA 1AX2A 1LULA 3IDBB 3LFIA 2DVAA 2GMMA 2W94A 1GR3A 2NZ9A 5FY9A 1WLCA 5A1LA 1LHUA 4QKDA 4LBNA 4XJUA 4NHKA 1HXS1 1LOFA 4QPIC 2CAVA 4JV4A 3OBTA 4NAOA 1DGWX 4O65A 1F9KA 3S0MA 4CCNA 1I6XA 3POGA 4KQ7A 3T0AA 1SBFA 1UXZA 2VZPA 2YU1A 4RA0A 4RR3A 3WUCA 3WG3A 1RINA 2DVDA 2G4IA 4L11A 1MS8A 3WQ7A 3K3OA 3T1LA 3UJQA 1PGL2 1TZOA 5ABJA 3AKTA 1M4WA 1PX4A 1X82A 4Q0UA 4DXZA 4LTAA 1S2BA 1Y9QA 4YVWB 2JXAA 1W39A 4XFHA 3WT3A 2RR13 3B02A 3LPFA 2B42B 2GMEA 2OYZA 3DF0A 5HI0A 5CYYA 3LDKA 4AI9A 4AHXA 2W46A 4YZ4A 2VTFA 1J83A 3HVDA 4PDWB 2BU9A 2XG3A 3AMMA 4N43B 5JWPA 2JG8B 1QJU1 3NSTA 1RXFA 2X05A 3WDVA 3RYRA 3T2TA 1LR5A 1G9CA 1QJEA 4GH4C 1GP5A 1WLDA 1O4YA 3JU9A 1WGPA 3H7YA 4ARYA 3ZFFC 4NIIA 4IERA 2DTYA 4AHYA 1UW8A 5BNPA 5J3UA 4QM9A 4XJ8A 4C1XA 5DPNA 1HRV2 5T5PA 1PIV3 1QJY3 3KT1A 4HANA 4Y1UA 4MZUA 5GLZA 4QB1A 5HV4A 2ZGRA 4MG2A 3UJOA 2I74A 3WNLA 2ZXQA 4ZU7A 1COV1 1A8DA 2VVFA 4CCMA 1CQ9A 2W95A 3MW3A 3KT4A 2DCZA 2OUJA 4LBOA 4Q4X1 5FJKA 1CESA 1R1A1 3M1HA 1OPMA 2HWE3 4CXWA 1UPIA 3THPA 4AVSA 3V56A 1RUD2 3ZMOA 2VMIA 2VMEA 1AJOA 1VBC2 4IW3A 4QKFA 2C6SA 1L3JA 1J1LA 3ZSEA 3CEWA 1XC6A 3EYPA 2Q30A 1Q43A 4AVCA 1UY4A 2G9ZA 1XXNA 1YUDA 3NKTA 2OT7A 1AYN3 4S2HA 5T50A 2ZX4A 3HOBA 3SH5A 2WNVA 3ES1A 5FO9B 5FQ0A 1W03A 2JDMA 2PQSA 5KXDA 1V9U2 5FYYA 3PNAA 5JAXA 1AR71 2BWAA 3V0BB 1H8TC 2WS93 1S0EA 3VBUC 1PIV1 1W9WA 3Q9OA 4LO6B 1EPWA 3J7MA 3AVRA 3NNLA 1F35A 4UYBA 3HMYA 4XJZA 1GLHA 4A7YA 2XB6C 3DCQA 2FZ1A 4RR3C 4ZU4A 1RTVA 1VP6A 4HKWA 1Z7S2 3WXPA 3OSDA 1LHNA 1YC61 4NPMA 5I8TA 1LOBA 1VB4A 3GZAA 3R4SA 3VKOA 1E57A 3U75A 3MHZA 1G9AA 4NRPA 2FDHA 2Q8EA 4RQPC 5H9SA 1DLLA 4YM3A 3RI9A 1PGSA 5BNNA 2CY6A 1ZZ8A 2QUOA 5FXZA 4WBBA 2ET7A 3MLKA 1UY0A 1DYKA 1RGSA 4JAAA 4FAHA 1IGOA 1LOGA 2C0ZA 1FNYA 4LR4A 1HRV1 2RV9A 4XQDA 3WNKA 5A3NA 3BU0A 2ADDA 5IFPA 4N53C 4XURA 1YQCA 5H9PA 2P4EA 1O5LA 5E16A 2AC1A 5C4WC 3RYPA 4GMP3 4QGLA 4P5HA 1DG6A 3GHMA 2VZUA 1QXJA 5ERLA 4IV1B 5IK7A 1QEXA 4UAPA 1IS4A 3USUA 3WW1A 4CU9A 4A4AA 2B39A 4Y1VA 1OMIA 3AL5A 3BOPA 2VNOA 4TWTA 3SC7X 4AVTA 3VDCA 3BCWA 1JZ5A 1V00A 3WINE 3PHMA 4Y1XA 5LK5A 2ZGLA 5A7OA 1W05A 3AZXA 3I59A 1VB2A 3MPPG 4MGSA 1QH6A 2QQVA 4GB31 4JDMA 4G3YC 4EN8B 4WM8A 3T09A 4FOVA 4SBVA 2NM1A 4NR1A 3RZZA 2ZEZA 1GWLA 3ASIA 1YFWA 2WT1A 1EAH2 4HL0A 4XFAA 3FMGA 3B3QE 1O3SA 4XF3A 5FY4A 5K8SA 4OI0A 1FV3A 5F3IA 1W9SA 1V0AA 3GZEA 4K6BA 4CUCA 1US3A 1WD3A 1T2XA 3M3IA 5FP3A 5JR7B 1AL21 1LJ7A 1G86A 5LBFA 1C5HA 1Z7S1 2QBXA 2VW0A 4FOWA 5AFEA 2PLV2 2O8QA 4L9BA 1RUD1 4YW2A 1GWKA 4QPYA 5BNQA 5IJRA 1VBC1 2VNRA 4YZ1A 4YG3A 4ATFA 4ASKA 2ERFA 2HWB3 3UT0A 4WVZA 3P6BA 4BA6A 1HX6A 1PK6A 2CGOA 2ZGUA 3UK9A 5CAZA 4K21A 4AFMA 1AR73 3IWZA 2Z4FA 4Q0PA 1YQ5A 3UYJA 1F2NA 2RE9A 1IS5A 1ZBA3 2YFZA 3F2ZA 1OF3A 4IQPA 5A6XA 1FXZA 1QJZA 5DABA 1AYN1 5B2GB 2VAUA 1OT5A 4BQXA 3ACHA 3R0RA 2BBVA 1YQ8A 4FPKA 4PDWA 2EXHA 2BVBA 3MIFA 3ECQA 4MX3A 2VZ1A 3INAA 4QPGB 2BDRA 1NQJA 2OZ6A 3J7HA 2W47A 1RIRA 3A4UA 3AZVA 3PVNA 4GQ7A 1G7YA 4XJ9A 4CSWA 1HKDA 3HN1A 1SLLA 3OG2A 3FLPA 4F8AA 5EFUA 1G8WA 5H9QA 1I3HA 4X8PA 1G9DA 5LRSA 4IV1C 3KM5A 4OLLA 3VDDB 4FFFA 3ZN6B 3SH4A 1ULGA 5CADA 5A3UA 4CZSA 1RUF2 3Q8FA 1XYPA 4GB32 2HWC1 1VMFA 4JHTA 2PFWA 3A22A 4QX2A 5DMYA 5J96B 4OQ8A 1V6MA 3BTXA 2UY8A 4OQ9A 2VZSA 1RL3A 4LQRA 2A3XA 3LSEA 2VZVA 5BPXA 1OA4A 2WAOA 4HMZA 2JKXA 2RDRA 1CX4A 1VPHA 4YVSB 1HB4A 2FMYA 2BBAA 4UF0A 3VBHC 2XVKA 5F8PA 3TB0A 5I91A 4BMBA 3WF3A 3MIBA 3WDTA 5A32B 5JPMB 1QY4A 1AL22 4MXWB 4WZCA 1AHSA 4Q1RA 2P3JA 1KJRA 1TNFA 4FPFA 3J7NA 4A6OA 2PLV1 1ND2A 3ZIXA 3FWEA 5FYHA 1GOFA 5C3OA 3ZXDA 3D8CA 2DCYA 1RUJ2 1FOD3 3FL7A 3Q8AA 4K3UA 4N9IA 3SKVA 5ABJB 4LHLA 5FBJA 1UU4A 1NE6A 1S0FA 2YROA 3X29B 4H14A 2RDQA 4HVOA 3FE5A 1S2EA 3NJYA 4FSJA 4RN5A 1WA4A 4QGNA 4XACA 1FPN1 3OCPA 2LUWA 2QQNA 2Z42A 2XHNA 3E6BA 3VBRC 2WFF1 2JIGA 2XUMA 4L0PA 3ZYJB 1HB2A 1UO9A 1VBD1 2HWD1 4AE2A 2ZHMA 5IVCA 1RMU3 1JS9A 1Q5OA 3VBFC 4BQ2A 5CG9A 1ASJ2 3WG1A 1AL23 1ZX5A 2DBIA 3AMQA 4AQTA 1KRIA 2NYYA 1D7PM 1LECA 5FZGA 1OD5A 3NO8A 1WW6A 3PTRB 4YVSA 4XFGA 2GSYA 1MS5A 3M8LA 4GKXA 2H6BA 4CDQA 3S7IA 5I0TA 2WZR2 4H2AA 2E7TA 3ON7A 5FYZA 1DIWA 3BB6A 1HRV3 1IPSA 1LHWA 3OY8A 5FRAA 2Y6HA 3CJIA 4NRMA 2PLV3 4JVAA 4OYUA 1GZCA 4AFAA 1H4GA 5LK7B 1SLBA 3BVCA 2QZ2A 3PUSA 2PHXA 1NG0A 3K51A 5BUVA 4N43A 1XYNA 1C5IA 4O7XA 5G05L 4B1LA 2Q1MA 1JOBA 4HBNA 4DXTA 1DDLA 3AC0A 1GQPA 3FX3A 4NHLA 2K2SA 2ZHNA 4P9XA 2ZAAA 1LNSA 1WLWA 2BUKA 2QQIA 3NQHA 1LOEA 1N1SA 2BNMA 1ENSA 4QXKA 4HPKB 1CD3G 3H7JA 1H9PA 1O4TA 1RVF2 4ZXKA 4I0AA 3T4HB 1JYIA 3KV5A 5FXXA 1KQRA 4K8FA 4GAZA 2VD7A 3WDUA 4A3ZA 5L7OB 3O1MA 4XIKA 4FXGB 3W21A 5F9TA 1YFUA 1POV0 4CUGA 5D21A 1JW6A 5K0UA 3FHIB 1VRH1 4U36A 1W6OA 3MEPA 3NAPC 4I09A 4JHZA 3U4SA 3ENRA 2R1DA 4ET7A 4UW6A 4R52A 5F5CA 5FUNA 3OEAA 5FZ3A 1CIYA 2VZOA 3GALA 3MLLA 4Q2FA 1OUXA 1K5JA 3M3QA 2Q0AA 4URTA 3RWNA 5L19A 3DKWA 3MPBA 5A3TA 4ES9A 5C6CA 5I0RA 5JXIA 4NWVA 1LCLA 5LATA 2IC1A 1XB9A 2ZKLA 4Y5SA 2ETEA 2D40A 3BPSA 3I3DA 5FZOA 4NIAA 3I2OA 1A34A 1OKQA 1OOPC 2XUEA 1VAMA 1YIFA 2R063 3BIEA 1DZTA 1ASJ1 4XJAA 5C3PA 2DDUA 3GHNA 1HV0A 1TVGA 4O9EA 2Z69A 4TXWA 3ZSLA 1X33A 4AF9A 1JOJA 4BQ3A 1ENRA 2YPJA 5C9AC 4E2GA 3HR9A 1BJQA 5F1RA 3VZNA 4B4PA 3FFZA 5E8AA 2N7GA 2WQ8A 2WZR1 5F7UA 1B09A 1OLRA 1N1TA 3FLTA 1NKGA 2BFUS 1JHNA 1ZZ7A 3H1YA 2BZDA 5GLWA 3RRDA 3VGIA 1F8VA 4XF4A 1W06A 3USSA 3O1UA 1H2MA 5I0DA 1QH7A 2A3YA 2DUOA 5T5JA 1UY2A 4ZHNA 1OD3A 4HLTA 5A3LA 1NA1B 3BN6A 2JWPA 4Z2WA 1MZ5A 2R071 4PBPA 3TEXA 5FDBA 5IVFA 4EN7B 2VJXA 3PVOA 1CPMA 1V6IA 4XUTA 1HB1A 5EWSA 1GKBA 4J1WA 5AVPA 5JVVA 1H0BA 2YU2A 2Y6GA 1JXNA 3C3VA 3NJVA 2CU5A 3POFA 5KHIA 5IVYA 5JR2A 5FOBB 2D44A 2R041 1JN2P 3ACLA 5K0UC 5BXXA 5CFDB 2QTWB 2A3WA 1MZ6A 1F5JA 2CSGA 2BOIA 3OF1A 1XE7A 1DCSA 2ZEWA 1EP0A 1H4HA 4S2FA 2Y34A 5CKMA 1H8TA 4IXLA 3WP3A 4DRRA 5IHRA 4KH9A 2F4PA 1DYPA 1FX5A 2QQLA 5F6KA 1QJY2 4IEWA 2AH2A 4XYXA 2IFWA 2VOWA 3J26N 4YYOA 4BQYA 4JKMA 4HVQA 4LK6A 3G6JB 5FY8A 3KVAA 3S7EA 4MXWA 3WG2A 2XLGA 3ZFFB 4TLFA 4DY5A 4AHWA 4EQVA 4CCCA 4FP2A 5KXBA 2HEVF 3KWVA 4MOAA 1RVF1 5C5UA 2RS11 1GOHA 1U0AA 1WCSA 4M3CB 2FDIA 3UKNA 2ZGKA 4DEVA 4YM2A 1CVNA 4P02B 3HPNA 3ZYFA 3AK0A 2V72A 4AAPA 2I07B 2NLRA 1VRH2 2BJSA 4V2VA 5F6LB 5F39A 1E5SA 1WCDJ 2W08A 3THCA 3KGZA 4C0HA 3PIGA 4M0NA 3DPRA 3ZN6A 4KGGA 4EYUA 2FQPA 3AYEA 2WN2A 4CEWC 2YBPA 4S2GA 3SEEA 1HLCA 1STMA 1YIPA 3RZLA 4IV3B 1XU1A 2HWE2 4YW1A 3AKRA 1LEMA 1AR92 2OVUA 3FC0A 4UBGA 2GP5A 2WJSA 2MPFA 1ZBA2 2JEMA 4Q4Y1 1YJLA 3NAPA 4QPIB 1UIKA 5E89A 4E4HA 1ENXA 3VN4A 1RMU1 2R073 4COUA 3O1SA 3MW4A 2BNOA 2WNEA 1R1ZA 4YGEA 5FTTC 1NA1C 1HQWA 3U11A 2NP0A 1O8SA 4J1XA 4DUXA 3V0AA 4BQ5A 4WV8A 2UURA 1FPN3 4GWJA 3NVCA 4PT6A 5H9RA 1C28A 3NL1A 4R9BA 5GZGA 1Q8OA 2Q1FA 4AEJA 1SMVA 4FI9A 4IE0A 2B7YA 2E9QA 5C70A 1R081 1O5UA 1FOD1 2VO5A 1MS3A 3NMBA 1SFNA 4INDA 4Y33A 3SITA 1O4ZA 2CGPA 5FZCA 5JOZA 3PTYA 3L9JT 2Q4SA 3KVBA 3WNMA 1RUG1 2ZOEB 4URAA 2PHWA 4WVMA 4BU2A 3ZXGA 2R072 1UAIA 2WL1A 1LOCA 2ARAA 2WQZC 4U2AA 1EY2A 1HXS2 2W1SA 4Q29A 1GP6A 2EIGA 4E27A 1DGWA 3I3EA 5EYYA 3C8XA 3ME2A 4MGQA 4MHUA 2ZACA 1QJX1 4I2OA 1Y7BA 5D8AA 4XAAA 1LU1A 2XWBB 2VBBA 4CDQC 1I9RA 2YYOA 2WR9A 2XVLA 1UXXX 4R8HA 2YMZA 1SFPA 2JDPA 5FKCA 3ZYBA 4IEQA 4CDXA 3H8XA 2IXKA 3DUIA 3PUAA 5BNOA 1CAUB 3ORJA 2RMU1 5BNPC 3CO2A 1UMZA 4K20A 5KHJA 1BZWA 3AYAA 1J59A 3K77A 4J25A 3OD0A 2WZEA 3E97A 2XGXA 3LA7A 4PF5A 4TZDA 3ACIA 2DCKA 1QJU2 1B35B 2AR6A 3RI8A 1NXMA 1WLTA 2RS53 3EMRA 3WDYA 1MS4A 4K1ZA 3WLUA 5JPNB 2VMHA 3BIWE 1JHJA 4BWOA 5FLIA 1Z7S3 4EN0A 4CP1A 2JDYA 1OLQA 1E5IA 4COZA 4AG4A 1VRBA 3OBAA 1IS6A 2PHLA 1Y3TA 2Y0OA 2XKPA 3A0KA 4KMQA 5DUXA 1T6GC 5FWJA 5D8AB 5HXVA 2ES3A 1ZBE1 2YFUA 1RUI1 4FFHA 4XMIA 3UESA 3ZVXA 1O8PA 1O7FA 3PUIA 4GD4A 1PNGA 2WT2A 4BIFA 4PJYA 3GNEA 2XVGA 3ZSKA 3M3EA 1UMHA 4A44A 2B9UA 3SCHA 2AEYA 3RJ2X 2P5BA 3LWCA 2K46A 3OGJA 1FMD3 2VOXA 4OULA 5CFDA 3E1F1 1JZ6A 5HXMA 1QF3A 2DCJA 1IQDC 3B01A 2BV4A 1CGPA 3CU7A 1RUJ3 2GC3A 1HQLA 2VY0A 4TN7A 2MEV3 2ZEXA 3VDBA 1BLZA 3AX4A 5EJ3A 3LOBA 5BNOC 3DN7A 3NNGA 1OPOA 2ZX0A 2WQ4A 1CZSA 1QJX2 5EZWA 1AR61 5JOYA 1MS1A 1NCRA 4YARA 3OY8B 3WW2A 3LEKA 4NVPA 3P3NA 4UWDA 1OQ1A 3HAGA 4ASLA 2R30A 1LRHA 2C9AA 2X5IB 4O9GA 4ONUA 5GZDA 1GYKA 4DRVA 5LEJA 2WDBA 1MS9A 4Q4Y3 3ZKYA 3W5NA 1UZZA 2Q8DA 1E5RA 1ZVFA 3ZMNA 3BGAA 4D7YA 1BMV2 1VBA2 4E2QA 3FZ3A 1H1MA 3ZR6A 2Y6KA 1RUG2 3AKQA 4DO0A 5KC5A 4OHZA 3HT1A 2DBNA 1DQ1A 1UWWA 3LDBA 1J58A 4Q4V2 1RC6A 2K9ZA 4D94A 1VBB3 3ES4A 5GALA 4W4ZA 1H30A 4IEZA 3THTA 1W3VA 2ARBA 2VUDA 2I2SA 1XBFA 2VE1A 3TAYA 1RJ7A 2D5FA 1ND3C 3LEGA 4ISRA 5FKBA 4D3WA 5L73A 3SHRA 4ZS3A 3MO4A 2ZX3A 3UL2A 1UX6A 2XJRA 5KHHA 4D7TA 1JYNA 1QQP2 2R043 2UWAA 2XLAA 3JCIA 1GICA 2R1BA 2GP3A 2XL9A 4IE5A 2HYKA 1I5ZA 4KWLA 4XW3A 5JXGA 1NCRB 3RZGA 1VBB2 2EXIA 2EALA 4XETA 2OKXA 4Y3OA 5E6HA 5G04L 1EPZA 1S0IA 1W04A 3CZUA 4LOSA 2ZGMA 2E7QA 1VR3A 2JG8A 4LO7A 1TMF2 2BOJA 4YG6A 2ZZQA 3JXSA 1CPNA 1H2LA 1POV1 2XXZA 3AFGA 2UWCA 4KG0A 1W90A 3AM2A 4TSVA 1DU3D 4C0BA 3VKMA 4G4FA 4QT6A 4NMIA 4MGTA 3J8F1 3PLQA 4HN1A 2CWSA 5KXEA 3HQUA 2K0GA 4HOOA 1OA2A 4UXAA 3VBFB 1WD4A 4FPOB 4YVWA 3TEZA 1OQEA 1JZ7A 2RS32
chains in the Genus database with same CATH topology
2WO2A 1DP0A 2J1UA 5C71A 1W9TA 1CZVA 1W9SA 1XNTA 1US3A 2E31A 2W1UA 1T2XA 2W5FA 4CUBA 2C4XA 3IB3A 1JYXA 2QBXA 4CU7A 4QX3A 4DEQA 5IJRA 2EIBA 1J84A 3ZM8A 3UETA 3P6BA 4BXSV 4W50A 3HNMA 2Z4FA 1L7QA 2YFZA 3F2ZA 3SEPA 1OF3A 1H6YA 4MADA 4AAXA 2HLEA 1HN1A 2ZEZA 1OT5A 4OMCA 2XOMA 3P1IA 2BERA 3DYMA 3LE0A 3ACHA 1I5PA 2EIDA 3ECQA 2VZ1A 4DXSA 5J1XA 3J7HA 1CZTA 2W47A 5LA2A 3ETPA 2QQKA 3WNPA 3OG2A 3WF1A 2VQUA 2E33A 3OGSA 3UNPA 3K4DA 2W1QA 4OMDA 3I2JA 3DECA 1EUTA 4XUOA 3DYOA 3A22A 4QX2A 4E8DA 5DMYA 1W8NA 2VZSA 4QB6A 4LQRA 2VZVA 3K75B 2B9VA 2VMFA 2WAOA 1K12A 2VZQA 2JKXA 1JYVA 5HPOA 2E26A 2BBAA 1P8JA 1UYZA 2W91A 2QQMA 2J1EA 3WF3A 2E32A 1JZ2A 4D8MA 3WF0A 4JX0A 2EIEA 3K46A 4IUGA 4A45A 3SKJE 4A6OA 5JMOA 3HJRA 4UI9L 3FN9A 2VCBA 1GOFA 4JKKA 2J7MA 3FL7A 3SKVA 1W99A 3I2HA 5DQ0A 2VQTA 2WBKA 3W5MA 2VL4A 3HNBM 4RN5A 3I2IA 4KWUA 2QQNA 3T0DA 2XHNA 3WEZA 5JXJA 2J22A 2WYSA 4L0PA 1D7PM 4CVUA 2X10A 2EICA 4ZY9A 4XZUG 1OF4A 1XNAA 3IAQA 2VMDA 3VD9A 5LA1A 3C7FA 2Y6HA 2JE8A 2RJ2A 4OYUA 1BHGA 2B4KA 4BK4A 2W3JA 3I97A 1UY1A 3IAPA 1K45A 4UOJA 5EIYB 5IYYA 5LA0A 5G05L 5LCWL 3LEIA 4DXTA 1GNYA 3AC0A 1GQPA 3A23A 1ULOA 2J1VA 4QDQA 2CDPA 4QDRA 3T0BA 4ARXA 1LNSA 2X09A 3NQHA 2QQIA 4QDSA 2YG0A 4QPWA 2Y6JA 3I2GA 1K3IA 3EB7A 1UYYA 1SHWB 1W8OA 4A3ZA 4P00B 2Y8KA 1DLCA 3CIHA 4GWIA 4GZ9A 4RYDA 3MUY1 1RYYA 3THDA 2QQJA 4M4RA 4BK5A 4JHZA 4ET7A 4E8CA 3C7EA 3LQCA 1YQ2A 2W1WA 3OEAA 1CIYA 2VZOA 2KD7A 5JXIA 4QX1A 2BGPA 2WAAA 2WABA 4KI5M 1JU4A 3I3DA 1WCQA 1OH4A 2DDUA 1TVGA 4TXWA 2ID4A 3WNOA 1PMJX 3I2FA 4Z2AA 3CDZB 2WQ8A 5F7UA 2YC2A 4MO3M 1NKGA 3FHAA 1JZ3A 2BZDA 4LKSA 4QX0A 4A41A 5I0DA 3CKHA 2V5DA 1UY2A 2WO3A 3GGLA 1OD3A 3IIIA 3WNNA 3BN6A 1GMMA 3K4AA 1EUUA 2VJXA 4CU8A 2J1RA 3OEBA 2YB7A 4BDVB 1H6XA 4XUTA 1F4AA 2XQXA 3CMGA 1JI6A 2VCCA 2Y6GA 5IFTA 3NJVA 5JR2A 2C9KA 2ORZA 1GU3A 1SG3A 2WUHA 3FHQA 3VDAA 2WO1A 2LW8A 2ZEWA 3NRUA 5IHRA 3GM8A 1UYXA 2QQLA 2J1SA 1JYWA 3C7OA 4JKMA 4OUEA 4PF1A 2VZ3A 1UMIA 4MOAA 1GOHA 1UX7A 4W8JA 4DEVA 3T2OA 4P02B 4ZZ8A 2W9XA 3HPNA 2V72A 3VD5A 4DUWA 1UY3A 3OGRA 3ABZA 2VM9A 2VMCA 4HG6B 2VZTA 3MBWA 3THCA 1JZ8A 3VD3A 3T2QA 4ZXEA 1JU3A 3NJXA 3D3AA 1SDDB 4OZOA 4QB2A 3DYPA 2WN2A 2J1AA 3SEEA 3CQOA 2J1TA 5JXHA 2VR4A 1XPWA 2WZ8A 1PMHX 5B4NA 3WF4A 1PX3A 3OB8A 3MV01 1O8SA 4DUXA 4GWJA 4PT6A 2HYXA 2JDAA 5FUIA 1KGYA 3C7HA 4FI9A 1F4HA 2V4VA 3K4ZA 5C70A 4LHSA 2VO5A 3HNYM 4M4PA 5A1AA 4QAWA 2JD9A 3ACGA 5EJZB 2W94A 3WNMA 4TTGA 1DYOA 4XUQA 2L9LA 2VZRA 2BGOA 2W1SA 2CDOA 3I3EA 5EJ1B 1KEXA 3C8XA 3T0AA 2VZPA 1UXZA 4MGQA 4CU6A 1NX9A 3I3BA 2ZEYA 1PX4A 1UXXX 3LPFA 4CUAA 5CYYA 1ULPA 2ORXA 2W92A 2W46A 3A21A 3ACFA 2VTFA 1J83A 3K77A 2WZEA 4JKLA 3MUZ1 1WKYA 3ACIA 2DCKA 2X05A 4ARYA 1MPXA 1JHJA 2LS6A 3CZJA 4D0QA 1O59A 5DPNA 4AG4A 3OBAA 2Y64A 1TG7A 1W0NA 4KMQA 4QB1A 3C7GA 2YFUA 3WNLA 2ZXQA 1UZ0A 3UESA 1O8PA 5DN2A 3PUIA 3LPGA 4DXRA 2W95A 4LPLA 1GOGA 3WF2A 4A42A 1UMHA 4A44A 2VMEA 3E1F1 1JZ6A 5HXMA 2DCJA 3WQBA 1US2A 1IQDC 3EYPA 1XC6A 3OGVA 3T2PA 4PQQA 1UY4A 2ZEXA 3VDBA 2R7EB 3PUHA 3HOBA 3NNGA 1K42A 2PQSA 1CX1A 1CZSA 4ZZ5A 2W87A 3A7QA 5CZKA 4P08A 3LEKA 1W9WA 3IDAA 4P5YA 2QQOA 2WDBA 3W5NA 2C26A 2WN3A 3BGAA 2Y6KA 3HEIA 1UWWA 3U37A 1JZ4A 3WSOA 3GXUA 3HN3A 4W4ZA 4XUNA 4XUPA 4YPJA 4XVHA 3LEGA 1UY0A 3VD4A 3VD7A 3MO4A 2RV9A 1GUIA 3WNKA 3T08A 1JYNA 5IFPA 4XURA 1NAEA 5JUVA 5JXGA 2VZUA 5B4XA 2XONA 2Y6LA 3GDBA 2OKXA 4UAPA 5G04L 3CZUA 1R64A 4CU9A 4A4AA 4CUCA 2RVAA 3I2KA 4BJ0A 4DUVA 3VDCA 1JZ5A 3JXSA 2VCAA 2VC9A 2YC4A 4MGSA 1L7RA 1NUKA 2VOTA 3T09A 5C7GA 3MV11 1JZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO2 A;  1DP0 A;  2J1U A;  5C71 A;  1W9T A;  1CZV A;  1W9S A;  1XNT A;  1US3 A;  2E31 A;  2W1U A;  1T2X A;  2W5F A;  4CUB A;  2C4X A;  3IB3 A;  1JYX A;  2QBX A;  4CU7 A;  4QX3 A;  4DEQ A;  5IJR A;  2EIB A;  1J84 A;  3ZM8 A;  3UET A;  3P6B A;  4BXS V;  4W50 A;  3HNM A;  2Z4F A;  1L7Q A;  2YFZ A;  3F2Z A;  3SEP A;  1OF3 A;  1H6Y A;  4MAD A;  4AAX A;  2HLE A;  1HN1 A;  2ZEZ A;  1OT5 A;  4OMC A;  2XOM A;  3P1I A;  2BER A;  3DYM A;  3LE0 A;  3ACH A;  1I5P A;  2EID A;  3ECQ A;  2VZ1 A;  4DXS A;  5J1X A;  3J7H A;  1CZT A;  2W47 A;  5LA2 A;  3ETP A;  2QQK A;  3WNP A;  3OG2 A;  3WF1 A;  2VQU A;  2E33 A;  3OGS A;  3UNP A;  3K4D A;  2W1Q A;  4OMD A;  3I2J A;  3DEC A;  1EUT A;  4XUO A;  3DYO A;  3A22 A;  4QX2 A;  4E8D A;  5DMY A;  1W8N A;  2VZS A;  4QB6 A;  4LQR A;  2VZV A;  3K75 B;  2B9V A;  2VMF A;  2WAO A;  1K12 A;  2VZQ A;  2JKX A;  1JYV A;  5HPO A;  2E26 A;  2BBA A;  1P8J A;  1UYZ A;  2W91 A;  2QQM A;  2J1E A;  3WF3 A;  2E32 A;  1JZ2 A;  4D8M A;  3WF0 A;  4JX0 A;  2EIE A;  3K46 A;  4IUG A;  4A45 A;  3SKJ E;  4A6O A;  5JMO A;  3HJR A;  4UI9 L;  3FN9 A;  2VCB A;  1GOF A;  4JKK A;  2J7M A;  3FL7 A;  3SKV A;  1W99 A;  3I2H A;  5DQ0 A;  2VQT A;  2WBK A;  3W5M A;  2VL4 A;  3HNB M;  4RN5 A;  3I2I A;  4KWU A;  2QQN A;  3T0D A;  2XHN A;  3WEZ A;  5JXJ A;  2J22 A;  2WYS A;  4L0P A;  1D7P M;  4CVU A;  2X10 A;  2EIC A;  4ZY9 A;  4XZU G;  1OF4 A;  1XNA A;  3IAQ A;  2VMD A;  3VD9 A;  5LA1 A;  3C7F A;  2Y6H A;  2JE8 A;  2RJ2 A;  4OYU A;  1BHG A;  2B4K A;  4BK4 A;  2W3J A;  3I97 A;  1UY1 A;  3IAP A;  1K45 A;  4UOJ A;  5EIY B;  5IYY A;  5LA0 A;  5G05 L;  5LCW L;  3LEI A;  4DXT A;  1GNY A;  3AC0 A;  1GQP A;  3A23 A;  1ULO A;  2J1V A;  4QDQ A;  2CDP A;  4QDR A;  3T0B A;  4ARX A;  1LNS A;  2X09 A;  3NQH A;  2QQI A;  4QDS A;  2YG0 A;  4QPW A;  2Y6J A;  3I2G A;  1K3I A;  3EB7 A;  1UYY A;  1SHW B;  1W8O A;  4A3Z A;  4P00 B;  2Y8K A;  1DLC A;  3CIH A;  4GWI A;  4GZ9 A;  4RYD A;  3MUY 1;  1RYY A;  3THD A;  2QQJ A;  4M4R A;  4BK5 A;  4JHZ A;  4ET7 A;  4E8C A;  3C7E A;  3LQC A;  1YQ2 A;  2W1W A;  3OEA A;  1CIY A;  2VZO A;  2KD7 A;  5JXI A;  4QX1 A;  2BGP A;  2WAA A;  2WAB A;  4KI5 M;  1JU4 A;  3I3D A;  1WCQ A;  1OH4 A;  2DDU A;  1TVG A;  4TXW A;  2ID4 A;  3WNO A;  1PMJ X;  3I2F A;  4Z2A A;  3CDZ B;  2WQ8 A;  5F7U A;  2YC2 A;  4MO3 M;  1NKG A;  3FHA A;  1JZ3 A;  2BZD A;  4LKS A;  4QX0 A;  4A41 A;  5I0D A;  3CKH A;  2V5D A;  1UY2 A;  2WO3 A;  3GGL A;  1OD3 A;  3III A;  3WNN A;  3BN6 A;  1GMM A;  3K4A A;  1EUU A;  2VJX A;  4CU8 A;  2J1R A;  3OEB A;  2YB7 A;  4BDV B;  1H6X A;  4XUT A;  1F4A A;  2XQX A;  3CMG A;  1JI6 A;  2VCC A;  2Y6G A;  5IFT A;  3NJV A;  5JR2 A;  2C9K A;  2ORZ A;  1GU3 A;  1SG3 A;  2WUH A;  3FHQ A;  3VDA A;  2WO1 A;  2LW8 A;  2ZEW A;  3NRU A;  5IHR A;  3GM8 A;  1UYX A;  2QQL A;  2J1S A;  1JYW A;  3C7O A;  4JKM A;  4OUE A;  4PF1 A;  2VZ3 A;  1UMI A;  4MOA A;  1GOH A;  1UX7 A;  4W8J A;  4DEV A;  3T2O A;  4P02 B;  4ZZ8 A;  2W9X A;  3HPN A;  2V72 A;  3VD5 A;  4DUW A;  1UY3 A;  3OGR A;  3ABZ A;  2VM9 A;  2VMC A;  4HG6 B;  2VZT A;  3MBW A;  3THC A;  1JZ8 A;  3VD3 A;  3T2Q A;  4ZXE A;  1JU3 A;  3NJX A;  3D3A A;  1SDD B;  4OZO A;  4QB2 A;  3DYP A;  2WN2 A;  2J1A A;  3SEE A;  3CQO A;  2J1T A;  5JXH A;  2VR4 A;  1XPW A;  2WZ8 A;  1PMH X;  5B4N A;  3WF4 A;  1PX3 A;  3OB8 A;  3MV0 1;  1O8S A;  4DUX A;  4GWJ A;  4PT6 A;  2HYX A;  2JDA A;  5FUI A;  1KGY A;  3C7H A;  4FI9 A;  1F4H A;  2V4V A;  3K4Z A;  5C70 A;  4LHS A;  2VO5 A;  3HNY M;  4M4P A;  5A1A A;  4QAW A;  2JD9 A;  3ACG A;  5EJZ B;  2W94 A;  3WNM A;  4TTG A;  1DYO A;  4XUQ A;  2L9L A;  2VZR A;  2BGO A;  2W1S A;  2CDO A;  3I3E A;  5EJ1 B;  1KEX A;  3C8X A;  3T0A A;  2VZP A;  1UXZ A;  4MGQ A;  4CU6 A;  1NX9 A;  3I3B A;  2ZEY A;  1PX4 A;  1UXX X;  3LPF A;  4CUA A;  5CYY A;  1ULP A;  2ORX A;  2W92 A;  2W46 A;  3A21 A;  3ACF A;  2VTF A;  1J83 A;  3K77 A;  2WZE A;  4JKL A;  3MUZ 1;  1WKY A;  3ACI A;  2DCK A;  2X05 A;  4ARY A;  1MPX A;  1JHJ A;  2LS6 A;  3CZJ A;  4D0Q A;  1O59 A;  5DPN A;  4AG4 A;  3OBA A;  2Y64 A;  1TG7 A;  1W0N A;  4KMQ A;  4QB1 A;  3C7G A;  2YFU A;  3WNL A;  2ZXQ A;  1UZ0 A;  3UES A;  1O8P A;  5DN2 A;  3PUI A;  3LPG A;  4DXR A;  2W95 A;  4LPL A;  1GOG A;  3WF2 A;  4A42 A;  1UMH A;  4A44 A;  2VME A;  3E1F 1;  1JZ6 A;  5HXM A;  2DCJ A;  3WQB A;  1US2 A;  1IQD C;  3EYP A;  1XC6 A;  3OGV A;  3T2P A;  4PQQ A;  1UY4 A;  2ZEX A;  3VDB A;  2R7E B;  3PUH A;  3HOB A;  3NNG A;  1K42 A;  2PQS A;  1CX1 A;  1CZS A;  4ZZ5 A;  2W87 A;  3A7Q A;  5CZK A;  4P08 A;  3LEK A;  1W9W A;  3IDA A;  4P5Y A;  2QQO A;  2WDB A;  3W5N A;  2C26 A;  2WN3 A;  3BGA A;  2Y6K A;  3HEI A;  1UWW A;  3U37 A;  1JZ4 A;  3WSO A;  3GXU A;  3HN3 A;  4W4Z A;  4XUN A;  4XUP A;  4YPJ A;  4XVH A;  3LEG A;  1UY0 A;  3VD4 A;  3VD7 A;  3MO4 A;  2RV9 A;  1GUI A;  3WNK A;  3T08 A;  1JYN A;  5IFP A;  4XUR A;  1NAE A;  5JUV A;  5JXG A;  2VZU A;  5B4X A;  2XON A;  2Y6L A;  3GDB A;  2OKX A;  4UAP A;  5G04 L;  3CZU A;  1R64 A;  4CU9 A;  4A4A A;  4CUC A;  2RVA A;  3I2K A;  4BJ0 A;  4DUV A;  3VDC A;  1JZ5 A;  3JXS A;  2VCA A;  2VC9 A;  2YC4 A;  4MGS A;  1L7R A;  1NUK A;  2VOT A;  3T09 A;  5C7G A;  3MV1 1;  1JZ7 A; 
#chains in the Genus database with same CATH topology
 2WO2 A;  4YGC A;  1DP0 A;  1JMU B;  4LIU A;  1UZY A;  1H1A A;  3POE A;  1W9T A;  1AR6 2;  1TME 1;  1W9Y A;  1SPP A;  5A3M A;  4YWA A;  5CVR A;  1ZBE 2;  1CON A;  2E31 A;  1W9F A;  3IZO A;  3RDI A;  4QPG A;  4C8D A;  2GMP A;  2SBA A;  2W5F A;  4CUB A;  3KD4 A;  4XIL A;  4LOT A;  2C4X A;  3LB9 A;  4N8M A;  5FY0 A;  1LES A;  2IVJ A;  3W9A A;  1JYX A;  4NRQ A;  4PLO A;  4DEQ A;  3TBD A;  4DNY A;  1J84 A;  5FY5 A;  1GZT A;  3VHR A;  4LHN A;  4K40 A;  3UET A;  3PIJ A;  5FP8 A;  4BXS V;  2Y33 A;  4W50 A;  5JOW A;  3HNM A;  3M3O A;  1W6N B;  2ILM A;  2EF6 A;  3ZYI B;  2PA7 A;  1LHV A;  1PK6 B;  2VW1 A;  5BY5 A;  3ZXE A;  3V0B A;  3AXD A;  2ZA9 A;  1BK1 A;  3KCY A;  5FFO C;  3SEP A;  4MAD A;  4AAX A;  4MGY E;  3SQO A;  5F3E A;  1AXZ A;  1HN1 A;  5FYU A;  3AKP A;  3AP5 A;  2YHJ A;  2ZJC A;  1KDM A;  1EV1 2;  2XOM A;  1NLR A;  2A6X A;  3PUR A;  2DUP A;  4OMC A;  4XBL A;  2HWF 3;  4DFS A;  1I5P A;  4AI3 A;  4HK9 A;  3WP6 A;  4BPZ A;  3ZFE B;  3JQX A;  4XAE A;  5CEH A;  5LA9 A;  1GAN A;  3DKQ A;  5FCC A;  3H8U A;  4DXS A;  3VDD C;  4EN9 B;  1PNF A;  4LT5 A;  4JDO A;  2VTX J;  4FOY A;  4N90 A;  4KU7 A;  4LE4 A;  1ND3 B;  4XQW A;  1IKQ A;  3OGS A;  5A3O A;  4FXK B;  4Q5O A;  4RHV 3;  3H1M A;  3K4D A;  4YNI A;  5EXO A;  2R32 A;  3UV9 A;  1C8N A;  5T54 A;  4AGV A;  1D4M 2;  5IW0 A;  1XU2 A;  2W1Q A;  1H9W A;  2H0V A;  1BKZ A;  2A70 A;  1NZI A;  5FYS A;  2H0B A;  1W8N A;  2NMN A;  3FUO A;  3LZZ A;  5EPA A;  1N3Q A;  2IXH A;  1W6N A;  5DDJ 3;  1UU6 A;  3AMH A;  3I3Q A;  1K12 A;  1IG0 A;  2VZQ A;  3N9N A;  4N7I A;  4MUV A;  1TME 2;  1WBF A;  3NJZ A;  4WM7 B;  2P1B A;  5FLH A;  1UYZ A;  3RS6 A;  4FTB A;  2HBT A;  2J1E A;  1HXS 3;  1MZE A;  2Q8C A;  2D97 A;  5JLV A;  1BBT 3;  3WF0 A;  4JX0 A;  1OFN A;  2G19 A;  4AOC A;  3VHN A;  3KF5 A;  3VL9 A;  1G6N A;  1YO8 A;  1TMF 1;  1QOS A;  3HJR A;  5J7M A;  4UI9 L;  1C8M 2;  3HBK A;  2ZHK A;  4NPR A;  3POB A;  4JKK A;  4YM0 A;  2J7M A;  3PJQ A;  1W8Z A;  3VUO A;  4JRA A;  5IAV A;  4IV3 A;  2JDZ A;  2JD4 A;  3ZFG B;  5FO7 B;  2VH9 A;  2WBK A;  4LKF A;  4DPN A;  3W5M A;  4LUM A;  2W0X A;  3H3L A;  1AZD A;  3BTA A;  3RG0 A;  3UKV A;  2UU8 A;  2ZS6 B;  2GC0 A;  3I2I A;  4AFB A;  1AR6 3;  2GNT A;  5EQU A;  5JSP A;  3OGG A;  2WYS A;  2ARE A;  5EP9 A;  5FLJ A;  1KS5 A;  3GJA A;  1V9U 1;  5E1R A;  1WW5 A;  4KWK A;  4RR3 B;  1AR7 2;  4WVM B;  4BLI A;  4BCU A;  4EZ4 A;  5FYM A;  3RZK A;  1F15 A;  2XKO A;  1AR8 1;  4KBZ A;  2EIC A;  1KDK A;  1PIV 2;  3PME A;  2YZ4 A;  3U07 A;  3ZXA C;  4D7S A;  1AF9 A;  2XPJ A;  1OF4 A;  1XNA A;  2VMD A;  4X8N A;  3VD9 A;  5LA1 A;  1HRI 3;  4IEO A;  4KG8 A;  4CDU C;  3OYW A;  3KV6 A;  4LBQ B;  4A7K A;  2DUQ A;  5CKQ A;  4PI2 A;  2CGN A;  3OD4 A;  4M3C E;  3RQ0 A;  4Q4W 1;  1ZM1 A;  1O91 A;  1GQH A;  2ADE A;  2W3J A;  2OX0 A;  4UOJ A;  2FDK A;  2ET1 A;  4B3N A;  2Y0I A;  5DZE A;  1WMD A;  4YZ5 A;  4L8Q A;  1FAT A;  2XWJ B;  4YSF A;  1EAH 3;  3JD7 1;  3MF9 A;  3O7O A;  1T6B X;  3JQW A;  4QDQ A;  4DB5 A;  4QDR A;  2GNM A;  3RFR A;  4QDS A;  2YC0 A;  1VBE 2;  2YG0 A;  3LIH A;  2Y6J A;  2IUW A;  1IKP A;  5DAW A;  2GH8 A;  4Y26 A;  4KGQ A;  4CP0 A;  1BBT 2;  3EB7 A;  2D43 A;  4LIV A;  1RIT A;  2WZP P;  1SHW B;  1LEN A;  1WA6 X;  3RSJ A;  1PO1 3;  3VZL A;  4MHR A;  1ENQ A;  3I59 B;  1QDO A;  4HKO A;  4S2D A;  2VQ0 A;  2ATF A;  2BNN A;  1DLC A;  2Y8K A;  3CIH A;  4GZ9 A;  4A7Z A;  1W28 A;  1RUG 3;  4IES A;  1D4M 3;  3THD A;  4YW3 A;  4EE2 A;  2FZ2 A;  1COV 3;  3VBF A;  3HBZ A;  3C7E A;  2XR4 A;  2W1W A;  2WWS A;  3LQC A;  5A32 A;  3FFQ A;  5HV0 A;  3I8T A;  5IT6 A;  1DBN A;  4J6G A;  5FPB A;  2KD7 A;  1W6M B;  1GFF 2;  4KI5 M;  2WAB A;  1FT9 A;  3M2M A;  1QJX 3;  4K7J A;  3R4U A;  1WW7 A;  4D69 A;  5I93 A;  1DHK B;  2HWF 2;  1WCQ A;  2PAM A;  4JGZ A;  1GP4 A;  5FYT A;  1Y4W A;  2VG9 A;  4Y20 A;  4P9I A;  1OSG A;  2BQP A;  2ID4 A;  3CJX A;  4QWN A;  1AR8 2;  2W39 A;  3WR0 A;  5HCA A;  3V64 A;  2AGS A;  3CDZ B;  3H50 A;  5FZA A;  4ZON A;  2ZAH A;  4CDW A;  3CHX A;  1POQ A;  3VDD A;  2XL7 A;  4CTE A;  2WNU A;  1CR7 A;  1APN A;  2HWB 1;  1QWR A;  5C8W A;  2HKX A;  3FHA A;  5LAS A;  4WVV A;  4CDW C;  4XAB A;  4LKS A;  4Y22 B;  4ZPI A;  1MR5 A;  1PMI A;  5APA A;  1QOT A;  1NY7 2;  1IS3 A;  3D5O A;  4WZF A;  3WP4 A;  4JCK A;  1YRZ A;  4XBQ A;  4XCB A;  2PXJ A;  4B29 A;  5F5Q A;  1AR8 3;  1MQT B;  3B94 A;  5LBE A;  3K4A A;  1AYN 2;  2RG4 A;  1W8H A;  5KHK A;  2B8M A;  1X8E A;  4QKN A;  4Y1Z A;  2DYC A;  4GH4 B;  3ZLI A;  2RDS A;  3AMN A;  5FY1 A;  1F4A A;  2LTN A;  4CCJ A;  4DQA A;  1ZNP A;  2X5I A;  1Q3E A;  1ZRC A;  2CTV A;  5AVA A;  2IZW A;  4N43 C;  4AHZ A;  3BUC A;  2QCS B;  4PDW C;  5DAQ A;  3WCS A;  4ASM B;  3URF A;  1XNC A;  2ORZ A;  3H1W A;  2WUH A;  4IEP A;  4UFJ A;  1GNZ A;  2A7A A;  2WSV A;  3O12 A;  1DQ5 A;  4AI1 A;  4K1Y A;  1XOY A;  2LW8 A;  2WO1 A;  2XJU A;  5FZF A;  1JYW A;  1WCK A;  1JOD A;  1OXC A;  5D8A C;  1RUF 1;  2QDN A;  1HW5 A;  3PVE A;  4HSJ A;  1JTZ X;  1CAW A;  1Z78 A;  2NPI A;  1HDK A;  3GM8 A;  5FZE A;  3AP4 A;  3LA2 A;  2HEW F;  2ZML A;  5FZH A;  2VU9 A;  2GC1 A;  1HIX A;  5BNP B;  2CHH A;  5JMC A;  4XHX A;  1RVF 3;  1W2O A;  2YXS A;  2VQA A;  1KS4 A;  2EVX A;  1BBT 1;  1S0C A;  1B35 C;  2Y26 A;  1UMI A;  1YCI A;  2FDF A;  4EWD A;  3W58 A;  1UOB A;  4L2N A;  1Q56 A;  1LED A;  3PU8 A;  4UFM A;  2WNU C;  3FLR A;  3R05 A;  4NOT A;  1J3R A;  2E63 A;  2W9X A;  3FUQ A;  1N1V A;  1W6O B;  2RS1 3;  4I0W B;  5CBL A;  1DQ6 A;  2OXB A;  2RMU 3;  2WSU A;  3VD5 A;  5IVV A;  1XQN A;  3RVH A;  1UY3 A;  3N7M A;  3ABZ A;  4YLZ A;  1CAX B;  4B4Q A;  2VMC A;  5FYC A;  1SZB A;  3V0A B;  5F2S A;  1JZ8 A;  1D0H A;  1IZ3 A;  3T2Q A;  1NA1 A;  4PCR A;  1NY7 1;  4Q26 A;  3AP9 A;  3D3A A;  1OHF A;  3J7L A;  4CP9 A;  1SDD B;  5ACA 1;  1FPN 2;  4QB2 A;  2ZZJ A;  2XBO 3;  2WFF 2;  2C24 A;  2WS9 1;  5GKA C;  2HWF 1;  1U12 A;  1XE0 A;  3ZYG A;  3O1V A;  3U4X A;  2HWE 1;  5BNO B;  1MAC A;  3KMH A;  1AR9 1;  1TEI A;  2VR4 A;  2O8O A;  1SPP B;  4FTE A;  1ZBA 1;  5BNN B;  4CPB D;  1N3O A;  1PMH X;  2JDN A;  5JDB A;  3WF4 A;  1YI9 A;  2A6V A;  2R06 1;  1AR9 3;  2UYA A;  3MW2 A;  2PQQ A;  4LLF A;  1ODM A;  3MV0 1;  1S1A A;  4HON A;  4EZH A;  3E6C C;  4XCA A;  4H7L A;  2JDA A;  1OVS A;  4R4Z A;  4RGK A;  2BFU L;  3ALQ A;  3KF3 A;  4SLI A;  4N7U A;  1F4H A;  2PMW B;  4CEY C;  4LA3 A;  3K4Z A;  2ZBJ A;  3AL6 A;  1C8M 3;  5FZL A;  2QQU A;  2QQW A;  2XHK A;  4GAL A;  2FMD A;  3HNY M;  1FOD 2;  4AQ6 A;  3B93 A;  4M4P A;  4YZ2 A;  5FMD A;  1UN1 A;  4QX8 A;  2JEC A;  5HCF A;  5EJZ B;  4TTG A;  1WMX A;  4RQP A;  4AEK A;  4XF1 A;  5FXW A;  4JGY B;  4XUQ A;  2Q1Z B;  2L9L A;  1LKN A;  5DUV A;  5T52 A;  3VZM A;  1RUO A;  2VZR A;  3SNM A;  5IK4 A;  1LOA A;  1UPS A;  4P9Y A;  3WQ1 A;  2BGO A;  4R4X A;  3LCP A;  4AWD A;  2CDO A;  4GA9 A;  4TLG A;  3QLQ A;  1KEX A;  3NNM A;  2BWC A;  4PBO A;  5FZ4 A;  3VHP A;  4CU6 A;  1MS0 A;  2P37 A;  1S0B A;  5A1F A;  2HJI A;  2JX9 A;  3I3B A;  2ZEY A;  1ZA4 A;  4IDZ A;  3I49 A;  2XJQ A;  2D3P A;  2YUE A;  1YXW A;  1QIQ A;  2CV6 A;  3WW4 A;  4AI2 A;  3EQE A;  3D4K A;  3VHO A;  2KA3 A;  4NUB A;  2KR2 A;  3J9S A;  1RJ8 A;  4FT8 A;  4CUA A;  5KHG A;  2V4A A;  3GZU C;  1ULP A;  2ORX A;  5CFC B;  5AC9 2;  5IWF A;  1QJU 3;  3CL1 A;  5JCT A;  4M0H A;  1FAY A;  2DTW A;  4R9A A;  3MUZ 1;  3HD8 B;  1NCQ C;  1DZQ A;  2MHF A;  4D6S A;  1NOV A;  1EV1 3;  4FPC A;  4JGY A;  2DWR A;  4H7M A;  2R49 A;  5GLU A;  3RZJ A;  4LO8 A;  3IMM A;  4NHX A;  1MPX A;  4A3X A;  2LS6 A;  4YZ3 A;  5A80 A;  5FY7 A;  1U5I A;  3CZJ A;  4BLJ A;  1PO2 3;  4D0Q A;  1O59 A;  1PVC 3;  1SDW A;  1ZRR A;  1VLN A;  1IPK A;  2CYF A;  4NE9 A;  5A7P A;  1AX0 A;  3ETQ A;  4LBL A;  3S57 A;  2XJV A;  3C7G A;  4LBQ D;  5FZ6 A;  4X6Q B;  3N9Q A;  4QQL A;  4AL9 A;  1UZ0 A;  1V6L A;  3CF6 E;  1VAL A;  2BGC A;  4GWN A;  3DGT A;  5DN2 A;  3ZDV A;  4F3J A;  4DXR A;  1REE A;  3L2Y A;  4BZ4 A;  5JSO A;  3ZFF A;  4CP2 A;  2ZGO A;  5DAX A;  4YW6 A;  2ENR A;  2DFC A;  2D6L X;  4E9K A;  5FPL A;  3CLP A;  4ES8 A;  3POJ A;  1US2 A;  1OOP A;  3OGV A;  4NJ4 A;  4PQQ A;  2A5Z A;  1YJK A;  2C5D A;  3LDR A;  2A6W A;  1X7N A;  3NKG A;  1HV1 A;  2JDK A;  4HVR A;  4GJY A;  2R06 2;  4QHO A;  3UKT A;  3B9I A;  1K42 A;  1KJL A;  1R09 3;  5J36 A;  1CX1 A;  2QE3 A;  2YGL A;  3CNA A;  4QQO A;  1CN1 A;  4XFI A;  5FRE A;  4HT1 T;  1VAK A;  3A7Q A;  4QQH A;  2XH6 A;  5A7W A;  2UY9 A;  5BV6 A;  5CZK A;  4OHW A;  5A7N A;  2PAE A;  1KFU L;  3OUJ A;  4UF0 B;  3U78 A;  3UGG A;  4DIQ A;  3VBS B;  4C1W A;  2Z5W A;  3IDA A;  3KCX A;  2Y60 A;  3PU3 A;  1J3P A;  2QQO A;  1DGL A;  4FP3 A;  3SMH A;  5SV8 A;  1VJ2 A;  2WN3 A;  1LHO A;  5JOX A;  2XBO 2;  3AXE A;  3P3P A;  5TSW A;  5AC9 1;  5C3Q A;  1BMV 1;  3HEI A;  3O5S A;  3DXU A;  1K5M C;  1QJY 1;  3U37 A;  1FMD 1;  3WSO A;  3GXU A;  3VBH B;  4A2U A;  2ZGS A;  4MGZ E;  4PIX A;  1X50 A;  4WM8 B;  1V6K A;  1XE8 A;  4RHV 1;  4XUP A;  4YPJ A;  1UOJ A;  2ZTN A;  3S6P A;  2RS1 2;  5F37 A;  2OZJ A;  4I3G A;  5L9V A;  3VD7 A;  3MYX A;  3POY A;  2CL2 A;  3ST7 A;  3O0W A;  4K9S A;  3T08 A;  1NAE A;  2FCT A;  3VKF C;  4CP9 B;  1HJG A;  2VUJ A;  4PLN A;  4FPH A;  1A6C A;  1XNK A;  2P3I A;  1AYM 1;  3PJY A;  2XON A;  3GDB A;  4UW5 A;  2YDE A;  3C2U A;  5DDJ 2;  3ITQ A;  1R64 A;  1RUC 3;  4RS5 C;  1HB3 A;  3I2K A;  4DUV A;  3KV4 A;  5K9Y A;  3SXW A;  2QNK A;  4QX5 A;  1W3X A;  1WWY A;  3OBR A;  3U14 A;  2VCA A;  1X9T A;  4Q4V 3;  3OPZ A;  5L36 A;  2TNF A;  2Y6F A;  1D0G A;  2DVG A;  4COY A;  4OUM A;  1YNA A;  4Y4R A;  1NUK A;  3U0Z A;  1LTE A;  3J8F 2;  2TEP A;  2VOT A;  4IEU A;  4PIY A;  4RFT 0;  4Q4Y 2;  2WNV B;  5DAP A;  5C7G A;  3BTZ A;  3MLJ A;  1RMU 2;  2FDG A;  4XOG A;  2J1U A;  3DEM A;  4N9H A;  1GZW B;  3DL3 A;  3O0X A;  4ZU5 A;  1ZRI A;  1NCQ A;  5DUW A;  4HK8 A;  1CZV A;  5IAT A;  1JYT A;  4E2S A;  1PZ7 A;  4LKD A;  3N36 A;  1VMJ A;  1XNB A;  1W0O A;  2I45 A;  2W1U A;  4RGA A;  1V6J A;  2MNG A;  2VPV A;  1X36 A;  1UKG A;  1YHF A;  4CDW B;  4QQP A;  3ZXF A;  3IB3 A;  1PZ8 A;  1VBC 3;  4Q4W 3;  1QKQ A;  3VBO A;  4A6S A;  2XJT A;  4XZP A;  4CU7 A;  4NRO A;  4MET A;  1PGW 1;  4QX3 A;  1RB8 G;  2D6O X;  3RNS A;  5I8Y A;  3MGU A;  1PZ9 A;  4JGZ B;  2KM2 A;  3NV3 A;  1MQT A;  1FMD 2;  3LIG A;  3WOG A;  1RHI 1;  1AXK A;  2Q8O A;  4AZZ A;  3N9L A;  3GCX A;  4LMF A;  3MIG A;  5CG8 A;  1W8W A;  1CJD A;  2XJP A;  3GF6 A;  3ZSM A;  5C8C C;  2RM2 3;  4HN0 A;  3R4D B;  4MH0 E;  1MVQ A;  1YQ6 A;  4IE6 A;  1UKR A;  5GM0 A;  4CCD A;  3POS A;  2ZMK A;  1NLQ A;  2XDV A;  2BER A;  3OBZ A;  1EV1 1;  4Q1P A;  5CNA A;  1FV2 A;  2ARC A;  4P9L A;  5DZF A;  4C90 A;  3WDW A;  5FR3 A;  5J1X A;  2JE9 A;  2Q5T A;  5CB7 A;  3ETP A;  5J37 A;  5DDJ 1;  3WNP A;  4PI0 A;  3ZXJ A;  4Z1V A;  1W8T A;  1UNB A;  3NV1 A;  4XTM A;  2E33 A;  3PL0 A;  3N7L A;  2DCT A;  3MIE A;  1ST8 A;  2P6C A;  1OLM E;  2ZGT A;  1BQP A;  4OMD A;  2HEY F;  4EN6 B;  3DEC A;  3AB0 A;  2IXC A;  4OCT A;  5GZF A;  4WM7 C;  1MZF A;  1PO2 1;  3ZX7 A;  3IDC B;  2JG9 C;  4E8D A;  4Y20 B;  5C8C A;  1CIW A;  4ORF A;  4AYU A;  1Q8S A;  1CWP A;  1BEV 2;  2VMF A;  2A75 A;  1PO1 2;  3ZPO A;  1PK6 C;  2IXI A;  1JYV A;  5HPO A;  2E26 A;  4LEJ A;  2XLF A;  1ZA7 A;  3BYW A;  5LBC A;  3B5L B;  2W91 A;  4FO9 A;  4LIT A;  3VZO A;  2E32 A;  1S4C A;  4RFR B;  5FAX A;  3KLS A;  1JZ2 A;  1JUH A;  3JBG 1;  3WDX A;  3AYD A;  4D8M A;  5LW9 A;  5KC6 A;  1ND2 C;  3K46 A;  5FMB A;  1HN0 A;  2NQY A;  5FUP A;  5JMO A;  4WVW A;  3POI A;  1SLC A;  3WD5 A;  3I3M A;  1BYH A;  2VCB A;  2YV8 A;  1C8M 1;  1Y9G A;  2ZGQ A;  3WZ1 A;  4B4R A;  3KHC A;  1W99 A;  5FZ1 A;  4GUL A;  4MSV A;  5DQ0 A;  3VBS C;  2VQT A;  3AKS A;  3UGH A;  3HNB M;  2EAK A;  4LUK A;  1SAC A;  4B7K A;  1C4R A;  2E51 A;  2PN5 A;  4M00 A;  4KWU A;  4UFL A;  4FPL A;  5DG2 A;  4F83 A;  1ZRF A;  2J22 A;  4I30 A;  4Q4X 3;  2PHT A;  2ZGN A;  1NLS A;  2OQ7 A;  1W2U A;  4LOR A;  2D93 A;  3O0V A;  1LB2 A;  2WZR 3;  2F17 A;  1O3R A;  2OA2 A;  2VUL A;  3L2H A;  2AEZ A;  4XZU G;  3ZOI A;  3IMN A;  4L99 A;  3B9C A;  3MFA A;  4IGO A;  4AGR A;  4O61 A;  2QDR A;  5FP9 A;  1FYU A;  1N1Y A;  1PVC 2;  3OUH A;  4FPE A;  3IBM A;  1CAX A;  4F7Z A;  1VBA 1;  1XSQ A;  1G9B A;  1CAU A;  4I3P A;  4JTO A;  1MEC 3;  2RJ2 A;  4MYE A;  2BPA 2;  1BHG A;  3O14 A;  2RS5 1;  1UY1 A;  1K45 A;  1RUE 1;  5EIY B;  5C4W B;  5LA0 A;  2W2I A;  1W8F A;  4G9S B;  1GNY A;  3JD7 2;  1Y9M A;  3A23 A;  5CFC A;  2PHF A;  1H8V A;  4JZR A;  5J98 B;  1VRH 3;  2WIN B;  3ATG A;  2CDP A;  1C1L A;  3T0B A;  4ARX A;  2X09 A;  1Y43 B;  2GH2 A;  3KS7 A;  5CIR A;  2GAU A;  3VL8 A;  5JI9 A;  4YFZ A;  3I2G A;  4B8E A;  1DQ0 A;  3U1X A;  2VOK A;  1K3I A;  2PYT A;  2IWG B;  2VOV A;  3ILN A;  3KQR A;  3J8F 3;  4XHB A;  5FK7 A;  3NWK A;  1JYC A;  1UYY A;  1QXR A;  3I2D A;  1VBB 1;  5JZG C;  3AMP A;  4CXY A;  5ACA 3;  4LBK A;  4P00 B;  3LGR A;  4GWI A;  3ZFE A;  4RYD A;  2VGD A;  3MUY 1;  1RUF 3;  1RYY A;  2IXJ A;  2IFR A;  1OA3 A;  1YWK A;  5C3S A;  4BK5 A;  2GAL A;  3FJS A;  4OFG A;  3ZXL A;  3S30 A;  4FVV A;  1S0D A;  3RZM A;  4AGG A;  4E8C A;  1A3K A;  4B7E A;  1BVV A;  1DFQ A;  5A7Q A;  3AVS A;  1WME A;  4GKY A;  5ANN A;  5IVB A;  5A6Z A;  1K5M B;  1UZV A;  2V5Y A;  4ERO A;  1IQA A;  2WAA A;  4FFG A;  4WM7 A;  3POW A;  3N3H A;  4AVA A;  3IT8 A;  4XMA A;  4Y22 A;  1BEV 1;  3N7J A;  2J42 A;  1MEC 2;  4JRL A;  1W2T A;  4LNV A;  1OH4 A;  2WKK A;  4WM8 C;  4QKB A;  3WHT A;  4IV1 A;  4QQ2 A;  4D6R A;  3GZT B;  1CAW B;  3B7M A;  4Z2A A;  3I2F A;  5K7P A;  4CDX B;  2JE7 A;  1OKO A;  4V1P A;  4LA2 A;  4OI1 A;  3RJR A;  3KZ4 C;  4XEZ A;  4FTS A;  1NT0 A;  2HWB 2;  4MO3 M;  5GZC A;  5HBA A;  2NN8 A;  2MEV 1;  5BYN A;  1JZ3 A;  1LAJ A;  3ZN4 A;  2PEL A;  1BXH A;  5T5O A;  4I0B A;  2VW2 A;  4CEY B;  2W68 A;  1SBD A;  1RUI 3;  2V5D A;  4ZS2 A;  1RUH 1;  4K8R B;  2WT0 A;  2WO3 A;  5C9A A;  3GGL A;  3III A;  4Q8K A;  3LKJ A;  2DFB A;  3WNN A;  3ROU A;  4NIG A;  3K3N A;  2IXL A;  3ZXK A;  1GMM A;  3HQR A;  3Q8E A;  1ULD A;  3USU B;  5DZG A;  4UW3 A;  2E7A A;  4AFD A;  2BVV A;  4FPJ A;  1IHM A;  4CU8 A;  1KXG A;  2J1R A;  5BNN C;  1R09 2;  2YY1 A;  3OEB A;  5FPX A;  4YRD A;  1H6X A;  1ZBE 3;  3B00 A;  1O3T A;  1SFY A;  3TYJ A;  1KIT A;  2XQX A;  4AR2 A;  3N35 A;  3CMG A;  4IL7 A;  4Q0Q A;  4OHY A;  1JI6 A;  2VCC A;  1H2N A;  1N47 A;  1Q8Q A;  2VUA A;  2VTX A;  3APB A;  4YW7 A;  5IFT A;  5J48 A;  2QKD A;  5GLT A;  3QD6 A;  2OII A;  1UIJ A;  2RS3 3;  4BM8 A;  1PVC 1;  1GU3 A;  1SG3 A;  5IK5 A;  1URX A;  3BTY A;  2RJL A;  4HET A;  1AL0 G;  1ZZB A;  2LAL A;  3OOX A;  2OQ6 A;  2F6B A;  4RL7 A;  4XDQ A;  4CDU A;  1RUE 2;  2IVI B;  1OOP B;  4HFS A;  1D4M 1;  3VBU A;  1J1T A;  2VEC A;  4OHV A;  5C5T A;  5E88 A;  2XQR A;  3NRU A;  2JB8 A;  3MDP A;  2D7F A;  2GNB A;  4FAG A;  5FIX A;  1ALY A;  4Z07 A;  3C7O A;  2HBU A;  5CFC C;  4PF1 A;  1GQG A;  4UBH A;  1MEC 1;  5I8S A;  5FZB A;  1HJF A;  1ZRD A;  2B5H A;  2PHR A;  5GLV A;  4CA9 A;  4RQP B;  4AI0 A;  4FPG A;  1M06 G;  2JIC A;  4EWE A;  1UX7 A;  3Q8C A;  4W8J A;  2XJS A;  1OUR A;  3H3Z A;  2G9F A;  3IPV A;  4PHZ A;  3AYC A;  4EJR A;  1QJF A;  4I01 A;  4DUW A;  2DVF A;  3JB4 C;  4CEY A;  2UWB A;  2OS2 A;  3N4M A;  3PVB B;  3T4V A;  1OUS A;  2O14 A;  2R0F A;  2VZT A;  4YVW C;  3ZN5 A;  3VD3 A;  1JH5 A;  1RUH 2;  2RM2 2;  3NJX A;  4ZXE A;  5K0U B;  2LRP A;  1OLM A;  2A1X A;  3RYK A;  5ACA 2;  2J1A A;  4DMI A;  3RPQ A;  3KHB A;  3TN9 1;  5IUQ A;  5KXC A;  2WA4 A;  5A33 A;  5FXV A;  4ZKT B;  4P9J A;  2ZPX A;  1U5Y A;  4IEV A;  5FYI A;  1GNH A;  4UFH A;  2ZMN A;  3EBR A;  3VBR A;  1R09 1;  5JXH A;  2P34 A;  1U5X A;  2CWM A;  1XPW A;  1LU2 A;  1DQ2 A;  1V9U 3;  4XTP A;  2WRA A;  1UD1 A;  5B4N A;  1W2N A;  4QX7 A;  3UGF A;  2WII B;  3OB8 A;  1EAH 1;  3JD7 3;  4CDU B;  5KBF A;  4BIS A;  3AJY A;  4M3C F;  1LGC A;  1MVE A;  4P9W A;  5FZI A;  2AZ5 A;  1S0G A;  3SCG A;  4AED B;  4AED C;  1GBG A;  2BRT A;  2P2K A;  1YFX A;  3KSC A;  3WUD A;  2W52 A;  3WV6 A;  2HH9 A;  5FUI A;  1KGY A;  1Z0H A;  1ODN A;  2MEV 2;  5FZM A;  5IVE A;  2V4V A;  4DZG A;  5T3N A;  4Q4W 2;  3PUQ A;  4BQ4 A;  4KBB A;  1NYW A;  5A1A A;  4QAW A;  2JD9 A;  3ACG A;  1KD7 A;  5JI7 A;  3M4F A;  4Y5Z 0;  1D4V B;  1DYO A;  3VKL A;  4DIN B;  1JOP A;  4QHB A;  1RUD 3;  3IDE A;  1POV 3;  3SIS A;  2D6P A;  3ILR A;  1OQD A;  4LUL A;  5DAV A;  1DZR A;  5FPU A;  1VBE 1;  1IG3 A;  3NAP B;  4QPI A;  2R0H A;  5EJ1 B;  1RUC 2;  1X8M A;  5FYV A;  5CIS A;  1ZRE A;  2EXK A;  2VBP A;  1VIW B;  3EJK A;  4GJZ A;  4AXO A;  1WW4 A;  1NCQ B;  1NX9 A;  1PGL 1;  4QD2 A;  1S2K A;  2JB4 A;  3LEM A;  4W6Y A;  2JEN A;  5K4L A;  3MZH A;  4CCK A;  4XFF A;  2E6V A;  1YI7 A;  2A6Z A;  4LE3 A;  3H9A A;  2DF7 A;  3JUU A;  1VBE 3;  3CJI B;  3TWI A;  2W92 A;  2RM2 1;  1OH3 A;  1PM4 A;  1Q8P A;  3A21 A;  2JDH A;  3ACF A;  3E6D A;  3LA3 A;  2RR1 2;  1C3H A;  3JZV A;  4JKL A;  3KT7 A;  4GH4 A;  1RED A;  1WKY A;  5FZO B;  2NMO A;  4CCO A;  1PHM A;  3VBS A;  1UYP A;  4M3C A;  5JIU A;  2Y38 A;  3K2O A;  2VUC A;  2DU0 A;  5KR7 A;  1LGB A;  2G9G A;  1BEV 3;  4NHY A;  1BVP 1;  5FP7 A;  5A70 A;  4Q0S A;  3RMY A;  4B1M A;  1MQT C;  2YBK A;  4NN0 A;  2Y64 A;  3D6E A;  3PDQ A;  1TG7 A;  1OBN A;  1WUV A;  5L7O C;  1W0N A;  4FBF A;  5JSR A;  1VMH A;  3QH7 A;  4LLO A;  4NAM A;  3K48 A;  3ZFE C;  1RUE 3;  5T55 A;  5I0U A;  3E5Q A;  4PIZ A;  5L7O A;  3ZYP A;  4AFC A;  3R6S A;  3LPG A;  4Q4X 2;  2X53 S;  3QOP A;  1R1A 2;  1GOG A;  4LPL A;  3VKN A;  3WF2 A;  4A42 A;  5FV3 A;  3TOJ A;  1GSL A;  2OPK A;  3PMS A;  2WLP A;  2H6C A;  1RUJ 1;  2VMG A;  2JG9 A;  2WA3 A;  3WQB A;  1LOF C;  2VXJ A;  3OUI A;  3KB5 A;  2P17 A;  4M01 A;  3T2P A;  4DOU A;  5L9B A;  4P14 A;  2R7E B;  3PUH A;  2WO7 A;  5FK8 A;  1SLT A;  2JJ6 A;  2WFP A;  3RMX A;  4ZZ5 A;  5HCB A;  4CEW B;  1NE4 A;  2W87 A;  2ZX2 A;  3IN9 A;  1ZYB A;  4ATE A;  1UF2 C;  2RHP A;  3AJZ A;  3CBN A;  1PM7 A;  4P08 A;  4AW7 A;  3BPZ A;  4XC9 A;  3LF7 A;  3IPV B;  2KXL A;  4P5Y A;  3JB8 A;  1ASJ 3;  1GZ9 A;  5FPV A;  3EXU A;  3ZPY A;  3W20 A;  5F2W A;  1QU0 A;  2RDN A;  2WWJ A;  4YVS C;  5EHD A;  1W6Q A;  3HIF A;  2C26 A;  2PAK A;  3TNP B;  3FBY A;  2XBO 1;  4N53 A;  2D6K A;  3LFM A;  2RR1 1;  3BOW A;  4QXH A;  3TN9 3;  4IE7 A;  3N9P A;  1C1F A;  1CJP A;  5EYX A;  2GND A;  1JZ4 A;  1X9P A;  5JZG B;  1SCR A;  1ULF A;  1XRU A;  2AUY A;  1AYM 3;  1EYB A;  2BTV C;  2GC2 A;  3HN3 A;  4UT5 A;  5F3G A;  4IGP A;  5FZ9 A;  3WX5 A;  3O1O A;  1UU5 A;  3FBM A;  4XUN A;  4CRQ A;  1RUC 1;  2DVB A;  2A73 B;  4KL1 A;  4XVH A;  1SLA A;  2PHD A;  1GZW A;  4LO5 B;  3VD4 A;  4IET A;  1GUI A;  4XPV A;  3WG4 A;  4AVB A;  2ZCW A;  3N9O A;  4JC1 A;  3H8R A;  4KNC A;  5JUV A;  2ZAB A;  3BU7 A;  3WQ0 A;  1DGR A;  2OPW A;  5B4X A;  2Y6L A;  4L92 A;  3GCW A;  1W6P A;  2RVA A;  4BJ0 A;  4E4S A;  1A78 A;  5SV5 A;  3W59 A;  3VZJ A;  2GN3 A;  1W2A X;  2CNA A;  4QXB A;  2R16 A;  3Q8B A;  5M0T A;  2VC9 A;  3MID A;  1FNZ A;  2WS9 2;  4OZX A;  1W0P A;  4CEW A;  2YC4 A;  3NV2 A;  1L7R A;  2DUR A;  4LXL A;  2A71 A;  1XYO A;  1JUI A;  4JGZ C;  2EA7 A;  2TUN A;  3MV1 1;  3RGB A;  3TEW A;  2BYV E;  4Q8L A;  3VV1 A;  1D2S A;  4RS5 A;  5A6Q A;  5LZ6 A;  1UCX A;  4JQT A;  4CCL A;  1QNY A;  5C71 A;  4CCE A;  1O3Q A;  2VCM A;  3B69 A;  3OTF A;  1TQ5 A;  4IE4 A;  3WP5 A;  1DQ4 A;  3MIC A;  1XNT A;  2FBE A;  1H8T B;  1YFY A;  2RJK A;  5C4W A;  1W6Q B;  1BCX A;  2QJV A;  1GV9 A;  3LAG A;  3ZO0 B;  4GWM A;  1I1E A;  2P3K A;  4QU2 A;  4NWW A;  1FI2 A;  3OPW A;  4XFC A;  4X6R B;  4ITC A;  4IEY A;  1AUY A;  2EIB A;  2JDU A;  3O1P A;  1U5Z A;  4YM1 A;  5LBB A;  4BXF A;  3IIA A;  3ZM8 A;  4BIO A;  1RHI 2;  1UL9 A;  1C57 A;  5FYB A;  5C9A B;  3RZH A;  1K5M A;  1Q8V A;  1XSR A;  2VBD A;  3OPT A;  1L7Q A;  1V70 A;  1W8U A;  3D0S A;  2QVS B;  5IVJ A;  2VVD A;  2O1Q A;  1H6Y A;  3KQ4 B;  3ZSJ A;  2HLE A;  1TMF 3;  2VVE A;  4NID A;  3H3U A;  3HQX A;  2WFF 3;  2JG9 B;  3QH6 A;  3P1I A;  3DYM A;  3LE0 A;  3MFC A;  5JIA A;  4RGG A;  4AQS A;  3ZFG C;  2EID A;  2HWC 3;  1DF0 A;  5FQ0 B;  4BB3 A;  5FO8 B;  4OHX A;  4FCA A;  1KFX L;  4MV2 A;  1AXY A;  5FPZ A;  4E4D X;  1CZT A;  1WMF A;  4GIQ A;  1YEW A;  5LA2 A;  2JIJ A;  2BW8 A;  2QQK A;  5DXD A;  5GJ6 A;  4LJH A;  3WF1 A;  1IOA A;  2LM3 A;  2V73 A;  4E4Z A;  2VQU A;  1ND2 B;  3O1T A;  1UOG A;  2WNV C;  5F5I A;  5LRR A;  1S0J A;  3UNP A;  5IK8 A;  5FPA A;  2PHU A;  5J09 A;  4XIO A;  4AQ2 A;  3I2J A;  2X29 A;  3BAL A;  1EUT A;  2HWC 2;  1ONA A;  2O0O A;  4XUO A;  1VE0 A;  3DYO A;  1QGL A;  1PO2 2;  1XJA A;  3D82 A;  3E5X A;  4HXC A;  4QB6 A;  3T1M A;  4GMP 0;  3K75 B;  4PLM A;  3U10 A;  1QHD A;  1VBA 3;  2B9V A;  2PTM A;  2Z2S B;  4HSL A;  3ZKU A;  1PO1 1;  4I02 A;  1NZC A;  3AP6 A;  1P8J A;  1XND A;  3TNQ A;  2D98 A;  2QQM A;  4Z92 B;  3RWK X;  3H8O A;  2P6H A;  4BME A;  2GZW A;  2GN7 A;  3I4I A;  4LHK A;  2GDF A;  2EIE A;  5FZK A;  2SLI A;  4QU1 A;  5AC9 3;  5LY1 A;  4IUG A;  2WLQ A;  3IM0 A;  4A45 A;  3HT2 A;  5EV7 A;  4P9G A;  3SKJ E;  4HZF A;  2BP6 A;  2AYH A;  2D3S A;  3FN9 A;  4MVT A;  1R08 3;  4LK7 A;  3NW4 A;  3AZY A;  3EHK A;  1AVB A;  5A3P A;  5A33 B;  2GU9 A;  3I2H A;  5F5A A;  3KGL A;  5LB6 A;  1G9F A;  2VL4 A;  3N9M A;  4HPK A;  5FMC A;  3T0D A;  4BQ1 A;  3WEZ A;  5JXJ A;  3DV8 A;  3WW3 A;  1VBD 2;  2HWD 2;  5FMO S;  3AZW A;  1ZZC A;  4OI2 A;  3G7D A;  4Z82 A;  5LY2 A;  3VBR B;  1YLL A;  2JKB A;  1ULC A;  3TEY A;  4LKE A;  4MLO A;  1AJK A;  3OJB A;  2QQP A;  2ZGP A;  3LD8 A;  3E5U A;  4CVU A;  2X10 A;  5C3R A;  4ZY9 A;  3I54 A;  5L9R A;  4GXL A;  4XF9 A;  1QNW A;  3IAQ A;  5ABJ C;  4OUS A;  1W6M A;  5FBZ A;  5ISL A;  2EAA A;  4FPY A;  2FHR A;  3C7F A;  1WBL A;  3VZK A;  2JE8 A;  1UQX A;  5D2A A;  2Z79 A;  1R08 2;  5GZE A;  4LBM A;  1UOF A;  2B4K A;  4BK4 A;  3I97 A;  3IAP A;  2RS5 2;  4Y1Y A;  4AI8 A;  2ZX1 A;  1N3P A;  3M7A A;  5IYY A;  3LSD A;  2UYB A;  2WYF A;  1CAV A;  4LBJ A;  1NXD 1;  3JBG 3;  3ZDS A;  4W6X A;  1ND3 A;  1F5F A;  2OW4 A;  2TBV A;  3KCC A;  3LEI A;  4H55 A;  4RHV 2;  5CKN A;  5LCW L;  4XF0 A;  2FD8 A;  3F95 A;  3AZZ A;  1ULO A;  4LO4 B;  2J1V A;  1ZZ9 A;  3MF6 A;  1OC1 A;  1A8M A;  2WWU A;  4BYY A;  4CE8 A;  1SLI A;  4QPW A;  4KU8 A;  5T5L A;  4CPB A;  4Z8B A;  5FWE A;  5ANQ A;  2BEO A;  3WHU A;  2D5H A;  1AYM 2;  2A6Y A;  3GBG A;  1WCU A;  3O1R A;  1AX1 A;  1W8O A;  2EXJ A;  4IGQ A;  4Y5T A;  5A6Y A;  4CXX A;  5IAX A;  4XQ4 A;  5FZ0 A;  3SCF A;  4RS5 B;  4XFB A;  3WY6 A;  1CAV B;  2YGM A;  4H3W A;  2QQJ A;  4M4R A;  2LRO A;  1LGN A;  2QZ3 A;  4L97 A;  2P3Y A;  1L7L A;  5FZ7 A;  4GB3 3;  5FJH A;  1QMJ A;  4QPG C;  1NCR C;  1YQ2 A;  3TRS B;  2FCU A;  2RMU 2;  4EWA A;  2X5I C;  1QOO A;  4GMP 1;  5DG1 A;  4UFI A;  3OYW B;  4LBQ A;  5LEK A;  4JGY C;  2DV9 A;  4OVE A;  4QX1 A;  4PQ9 A;  1WZX A;  2BGP A;  2DU1 A;  4TYS A;  5HCH A;  1JU4 A;  2B45 X;  2YBS A;  1D2Q A;  1S55 A;  3NNF A;  4YFW A;  4CYD A;  4XE9 A;  5C8C B;  4YGB A;  3WNO A;  1PMJ X;  1PVX A;  3MI8 A;  2FCV A;  1HRI 2;  1GWM A;  4Y24 A;  3VBU B;  3QBQ A;  4HKL A;  3ELN A;  4QGM A;  3T30 A;  1OFS A;  4YG0 A;  4COV A;  2VXR A;  2YC2 A;  3QAC A;  4RSU A;  5D1I A;  4YW4 A;  1SEF A;  5KWR A;  1SBE A;  1V6N A;  3I7D A;  3ZFG A;  1PGW 2;  1RUI 2;  1JBC A;  1R1A 3;  5DUU A;  5F32 A;  4BOW A;  5I0S A;  5FZD A;  4QX0 A;  4BQW A;  4A41 A;  4BE3 A;  4QXC A;  3CKH A;  5FZ8 A;  5JZG A;  1V6O A;  3DXT A;  4KWJ A;  1RHI 3;  1OVP A;  5CA6 A;  3NNJ A;  3DPR B;  1QXP A;  3WVJ A;  1W6P B;  1RXG A;  4ISQ A;  4FOQ A;  3IKW A;  1EUU A;  3H0O A;  4Y4Y A;  4FFI A;  2YB7 A;  4BDV B;  1TNR A;  4JQR A;  3J4U H;  3ZR5 A;  1VAV A;  3BI3 A;  5A7S A;  1ULE A;  4RD7 A;  4COW A;  4DS0 A;  5LWB A;  4FQ4 A;  2X8K A;  2VNV A;  1QQP 3;  1UZW A;  2R04 2;  2OUH A;  5AFB A;  4MGI E;  1SCS A;  2CAU A;  5F3C A;  2C9K A;  2YPD A;  4CDX C;  3D0J A;  4XBN A;  4NO4 A;  3WNX A;  3FHQ A;  3NV4 A;  3CJI C;  3N7K A;  3VBO B;  1ZZ6 A;  3VDA A;  1SQ4 A;  3ZYH A;  3GBW A;  4XXP A;  2F4L A;  5FMO L;  1IPJ A;  3H42 B;  1O6U A;  1YYN A;  2G1M A;  3VLB B;  2VNG A;  4JDN A;  3A0N A;  4AEM A;  1F31 A;  2WNO A;  4QHZ A;  4R9D A;  1QDC A;  4N53 B;  4Q0V A;  4Q4V 1;  1UYX A;  2WNU B;  1TME 3;  2J1S A;  3KV9 A;  3SH3 A;  4JTN A;  4YGD A;  1LOD A;  4OUE A;  4AVV A;  2ZHL A;  3AP7 A;  3BOD A;  4QMA A;  1OI6 A;  2VZ3 A;  4R9C A;  2QFE A;  3QCW A;  3VBO C;  4UW4 A;  3MIH A;  4XXA A;  5FP4 A;  1H2K A;  3M70 A;  4XDP A;  2JG8 C;  2R6Q A;  5CFD C;  3JBG 2;  5A3W A;  4NPL A;  3T2O A;  2FDJ A;  4ZZ8 A;  4C91 A;  4QM8 A;  1HQN A;  1QQP 1;  5CU1 A;  1DGR N;  3GJB A;  3OGR A;  2E53 A;  5A7W B;  1H1I A;  2VM9 A;  4FQZ A;  4HG6 B;  1COV 2;  4OI4 A;  3V65 A;  4MGK E;  1J3Q A;  4EV0 A;  3MBW A;  3ZIW A;  4AED A;  1B35 A;  3HWJ A;  3SLI A;  4AK3 A;  2AAC A;  2D3R A;  3AFK A;  4CDQ B;  1JU3 A;  3T3Y A;  2D6N A;  2WC2 A;  3LOI A;  4OZO A;  3VBH A;  3DYP A;  3WCR A;  2XML A;  3CQO A;  2AEN A;  2J1T A;  3TN9 2;  3GYD A;  4V2W A;  3M3C A;  5FOJ B;  1E5H A;  4W65 A;  4YW5 A;  2C1F A;  2WZ8 A;  4NIH A;  3EO6 A;  1RUN A;  1HRI 1;  2RS3 1;  1ACC A;  1PX3 A;  3P5B A;  3GBF A;  4IV3 C;  4MXV A;  3DPR C;  1BK0 A;  2B46 X;  4XJW A;  4NHM A;  5C33 A;  4IEX A;  2HYX A;  3ZYR A;  1NQD A;  4BHP A;  3ILF A;  3S5A A;  1RUH 3;  3C7H A;  4UFK A;  4Q27 A;  2V09 A;  4DY3 A;  4D6Q A;  1VBD 3;  2HWD 3;  3VB9 A;  4BH9 A;  1REF A;  4W6W A;  2ZKN A;  1TE1 B;  3S5Q A;  4LHS A;  4XDO A;  2D6M A;  3BKZ A;  2ARX A;  1AX2 A;  1LUL A;  3IDB B;  3LFI A;  2DVA A;  2GMM A;  2W94 A;  1GR3 A;  2NZ9 A;  5FY9 A;  1WLC A;  5A1L A;  1LHU A;  4QKD A;  4LBN A;  4XJU A;  4NHK A;  1HXS 1;  1LOF A;  4QPI C;  2CAV A;  4JV4 A;  3OBT A;  4NAO A;  1DGW X;  4O65 A;  1F9K A;  3S0M A;  4CCN A;  1I6X A;  3POG A;  4KQ7 A;  3T0A A;  1SBF A;  1UXZ A;  2VZP A;  2YU1 A;  4RA0 A;  4RR3 A;  3WUC A;  3WG3 A;  1RIN A;  2DVD A;  2G4I A;  4L11 A;  1MS8 A;  3WQ7 A;  3K3O A;  3T1L A;  3UJQ A;  1PGL 2;  1TZO A;  5ABJ A;  3AKT A;  1M4W A;  1PX4 A;  1X82 A;  4Q0U A;  4DXZ A;  4LTA A;  1S2B A;  1Y9Q A;  4YVW B;  2JXA A;  1W39 A;  4XFH A;  3WT3 A;  2RR1 3;  3B02 A;  3LPF A;  2B42 B;  2GME A;  2OYZ A;  3DF0 A;  5HI0 A;  5CYY A;  3LDK A;  4AI9 A;  4AHX A;  2W46 A;  4YZ4 A;  2VTF A;  1J83 A;  3HVD A;  4PDW B;  2BU9 A;  2XG3 A;  3AMM A;  4N43 B;  5JWP A;  2JG8 B;  1QJU 1;  3NST A;  1RXF A;  2X05 A;  3WDV A;  3RYR A;  3T2T A;  1LR5 A;  1G9C A;  1QJE A;  4GH4 C;  1GP5 A;  1WLD A;  1O4Y A;  3JU9 A;  1WGP A;  3H7Y A;  4ARY A;  3ZFF C;  4NII A;  4IER A;  2DTY A;  4AHY A;  1UW8 A;  5BNP A;  5J3U A;  4QM9 A;  4XJ8 A;  4C1X A;  5DPN A;  1HRV 2;  5T5P A;  1PIV 3;  1QJY 3;  3KT1 A;  4HAN A;  4Y1U A;  4MZU A;  5GLZ A;  4QB1 A;  5HV4 A;  2ZGR A;  4MG2 A;  3UJO A;  2I74 A;  3WNL A;  2ZXQ A;  4ZU7 A;  1COV 1;  1A8D A;  2VVF A;  4CCM A;  1CQ9 A;  2W95 A;  3MW3 A;  3KT4 A;  2DCZ A;  2OUJ A;  4LBO A;  4Q4X 1;  5FJK A;  1CES A;  1R1A 1;  3M1H A;  1OPM A;  2HWE 3;  4CXW A;  1UPI A;  3THP A;  4AVS A;  3V56 A;  1RUD 2;  3ZMO A;  2VMI A;  2VME A;  1AJO A;  1VBC 2;  4IW3 A;  4QKF A;  2C6S A;  1L3J A;  1J1L A;  3ZSE A;  3CEW A;  1XC6 A;  3EYP A;  2Q30 A;  1Q43 A;  4AVC A;  1UY4 A;  2G9Z A;  1XXN A;  1YUD A;  3NKT A;  2OT7 A;  1AYN 3;  4S2H A;  5T50 A;  2ZX4 A;  3HOB A;  3SH5 A;  2WNV A;  3ES1 A;  5FO9 B;  5FQ0 A;  1W03 A;  2JDM A;  2PQS A;  5KXD A;  1V9U 2;  5FYY A;  3PNA A;  5JAX A;  1AR7 1;  2BWA A;  3V0B B;  1H8T C;  2WS9 3;  1S0E A;  3VBU C;  1PIV 1;  1W9W A;  3Q9O A;  4LO6 B;  1EPW A;  3J7M A;  3AVR A;  3NNL A;  1F35 A;  4UYB A;  3HMY A;  4XJZ A;  1GLH A;  4A7Y A;  2XB6 C;  3DCQ A;  2FZ1 A;  4RR3 C;  4ZU4 A;  1RTV A;  1VP6 A;  4HKW A;  1Z7S 2;  3WXP A;  3OSD A;  1LHN A;  1YC6 1;  4NPM A;  5I8T A;  1LOB A;  1VB4 A;  3GZA A;  3R4S A;  3VKO A;  1E57 A;  3U75 A;  3MHZ A;  1G9A A;  4NRP A;  2FDH A;  2Q8E A;  4RQP C;  5H9S A;  1DLL A;  4YM3 A;  3RI9 A;  1PGS A;  5BNN A;  2CY6 A;  1ZZ8 A;  2QUO A;  5FXZ A;  4WBB A;  2ET7 A;  3MLK A;  1UY0 A;  1DYK A;  1RGS A;  4JAA A;  4FAH A;  1IGO A;  1LOG A;  2C0Z A;  1FNY A;  4LR4 A;  1HRV 1;  2RV9 A;  4XQD A;  3WNK A;  5A3N A;  3BU0 A;  2ADD A;  5IFP A;  4N53 C;  4XUR A;  1YQC A;  5H9P A;  2P4E A;  1O5L A;  5E16 A;  2AC1 A;  5C4W C;  3RYP A;  4GMP 3;  4QGL A;  4P5H A;  1DG6 A;  3GHM A;  2VZU A;  1QXJ A;  5ERL A;  4IV1 B;  5IK7 A;  1QEX A;  4UAP A;  1IS4 A;  3USU A;  3WW1 A;  4CU9 A;  4A4A A;  2B39 A;  4Y1V A;  1OMI A;  3AL5 A;  3BOP A;  2VNO A;  4TWT A;  3SC7 X;  4AVT A;  3VDC A;  3BCW A;  1JZ5 A;  1V00 A;  3WIN E;  3PHM A;  4Y1X A;  5LK5 A;  2ZGL A;  5A7O A;  1W05 A;  3AZX A;  3I59 A;  1VB2 A;  3MPP G;  4MGS A;  1QH6 A;  2QQV A;  4GB3 1;  4JDM A;  4G3Y C;  4EN8 B;  4WM8 A;  3T09 A;  4FOV A;  4SBV A;  2NM1 A;  4NR1 A;  3RZZ A;  2ZEZ A;  1GWL A;  3ASI A;  1YFW A;  2WT1 A;  1EAH 2;  4HL0 A;  4XFA A;  3FMG A;  3B3Q E;  1O3S A;  4XF3 A;  5FY4 A;  5K8S A;  4OI0 A;  1FV3 A;  5F3I A;  1W9S A;  1V0A A;  3GZE A;  4K6B A;  4CUC A;  1US3 A;  1WD3 A;  1T2X A;  3M3I A;  5FP3 A;  5JR7 B;  1AL2 1;  1LJ7 A;  1G86 A;  5LBF A;  1C5H A;  1Z7S 1;  2QBX A;  2VW0 A;  4FOW A;  5AFE A;  2PLV 2;  2O8Q A;  4L9B A;  1RUD 1;  4YW2 A;  1GWK A;  4QPY A;  5BNQ A;  5IJR A;  1VBC 1;  2VNR A;  4YZ1 A;  4YG3 A;  4ATF A;  4ASK A;  2ERF A;  2HWB 3;  3UT0 A;  4WVZ A;  3P6B A;  4BA6 A;  1HX6 A;  1PK6 A;  2CGO A;  2ZGU A;  3UK9 A;  5CAZ A;  4K21 A;  4AFM A;  1AR7 3;  3IWZ A;  2Z4F A;  4Q0P A;  1YQ5 A;  3UYJ A;  1F2N A;  2RE9 A;  1IS5 A;  1ZBA 3;  2YFZ A;  3F2Z A;  1OF3 A;  4IQP A;  5A6X A;  1FXZ A;  1QJZ A;  5DAB A;  1AYN 1;  5B2G B;  2VAU A;  1OT5 A;  4BQX A;  3ACH A;  3R0R A;  2BBV A;  1YQ8 A;  4FPK A;  4PDW A;  2EXH A;  2BVB A;  3MIF A;  3ECQ A;  4MX3 A;  2VZ1 A;  3INA A;  4QPG B;  2BDR A;  1NQJ A;  2OZ6 A;  3J7H A;  2W47 A;  1RIR A;  3A4U A;  3AZV A;  3PVN A;  4GQ7 A;  1G7Y A;  4XJ9 A;  4CSW A;  1HKD A;  3HN1 A;  1SLL A;  3OG2 A;  3FLP A;  4F8A A;  5EFU A;  1G8W A;  5H9Q A;  1I3H A;  4X8P A;  1G9D A;  5LRS A;  4IV1 C;  3KM5 A;  4OLL A;  3VDD B;  4FFF A;  3ZN6 B;  3SH4 A;  1ULG A;  5CAD A;  5A3U A;  4CZS A;  1RUF 2;  3Q8F A;  1XYP A;  4GB3 2;  2HWC 1;  1VMF A;  4JHT A;  2PFW A;  3A22 A;  4QX2 A;  5DMY A;  5J96 B;  4OQ8 A;  1V6M A;  3BTX A;  2UY8 A;  4OQ9 A;  2VZS A;  1RL3 A;  4LQR A;  2A3X A;  3LSE A;  2VZV A;  5BPX A;  1OA4 A;  2WAO A;  4HMZ A;  2JKX A;  2RDR A;  1CX4 A;  1VPH A;  4YVS B;  1HB4 A;  2FMY A;  2BBA A;  4UF0 A;  3VBH C;  2XVK A;  5F8P A;  3TB0 A;  5I91 A;  4BMB A;  3WF3 A;  3MIB A;  3WDT A;  5A32 B;  5JPM B;  1QY4 A;  1AL2 2;  4MXW B;  4WZC A;  1AHS A;  4Q1R A;  2P3J A;  1KJR A;  1TNF A;  4FPF A;  3J7N A;  4A6O A;  2PLV 1;  1ND2 A;  3ZIX A;  3FWE A;  5FYH A;  1GOF A;  5C3O A;  3ZXD A;  3D8C A;  2DCY A;  1RUJ 2;  1FOD 3;  3FL7 A;  3Q8A A;  4K3U A;  4N9I A;  3SKV A;  5ABJ B;  4LHL A;  5FBJ A;  1UU4 A;  1NE6 A;  1S0F A;  2YRO A;  3X29 B;  4H14 A;  2RDQ A;  4HVO A;  3FE5 A;  1S2E A;  3NJY A;  4FSJ A;  4RN5 A;  1WA4 A;  4QGN A;  4XAC A;  1FPN 1;  3OCP A;  2LUW A;  2QQN A;  2Z42 A;  2XHN A;  3E6B A;  3VBR C;  2WFF 1;  2JIG A;  2XUM A;  4L0P A;  3ZYJ B;  1HB2 A;  1UO9 A;  1VBD 1;  2HWD 1;  4AE2 A;  2ZHM A;  5IVC A;  1RMU 3;  1JS9 A;  1Q5O A;  3VBF C;  4BQ2 A;  5CG9 A;  1ASJ 2;  3WG1 A;  1AL2 3;  1ZX5 A;  2DBI A;  3AMQ A;  4AQT A;  1KRI A;  2NYY A;  1D7P M;  1LEC A;  5FZG A;  1OD5 A;  3NO8 A;  1WW6 A;  3PTR B;  4YVS A;  4XFG A;  2GSY A;  1MS5 A;  3M8L A;  4GKX A;  2H6B A;  4CDQ A;  3S7I A;  5I0T A;  2WZR 2;  4H2A A;  2E7T A;  3ON7 A;  5FYZ A;  1DIW A;  3BB6 A;  1HRV 3;  1IPS A;  1LHW A;  3OY8 A;  5FRA A;  2Y6H A;  3CJI A;  4NRM A;  2PLV 3;  4JVA A;  4OYU A;  1GZC A;  4AFA A;  1H4G A;  5LK7 B;  1SLB A;  3BVC A;  2QZ2 A;  3PUS A;  2PHX A;  1NG0 A;  3K51 A;  5BUV A;  4N43 A;  1XYN A;  1C5I A;  4O7X A;  5G05 L;  4B1L A;  2Q1M A;  1JOB A;  4HBN A;  4DXT A;  1DDL A;  3AC0 A;  1GQP A;  3FX3 A;  4NHL A;  2K2S A;  2ZHN A;  4P9X A;  2ZAA A;  1LNS A;  1WLW A;  2BUK A;  2QQI A;  3NQH A;  1LOE A;  1N1S A;  2BNM A;  1ENS A;  4QXK A;  4HPK B;  1CD3 G;  3H7J A;  1H9P A;  1O4T A;  1RVF 2;  4ZXK A;  4I0A A;  3T4H B;  1JYI A;  3KV5 A;  5FXX A;  1KQR A;  4K8F A;  4GAZ A;  2VD7 A;  3WDU A;  4A3Z A;  5L7O B;  3O1M A;  4XIK A;  4FXG B;  3W21 A;  5F9T A;  1YFU A;  1POV 0;  4CUG A;  5D21 A;  1JW6 A;  5K0U A;  3FHI B;  1VRH 1;  4U36 A;  1W6O A;  3MEP A;  3NAP C;  4I09 A;  4JHZ A;  3U4S A;  3ENR A;  2R1D A;  4ET7 A;  4UW6 A;  4R52 A;  5F5C A;  5FUN A;  3OEA A;  5FZ3 A;  1CIY A;  2VZO A;  3GAL A;  3MLL A;  4Q2F A;  1OUX A;  1K5J A;  3M3Q A;  2Q0A A;  4URT A;  3RWN A;  5L19 A;  3DKW A;  3MPB A;  5A3T A;  4ES9 A;  5C6C A;  5I0R A;  5JXI A;  4NWV A;  1LCL A;  5LAT A;  2IC1 A;  1XB9 A;  2ZKL A;  4Y5S A;  2ETE A;  2D40 A;  3BPS A;  3I3D A;  5FZO A;  4NIA A;  3I2O A;  1A34 A;  1OKQ A;  1OOP C;  2XUE A;  1VAM A;  1YIF A;  2R06 3;  3BIE A;  1DZT A;  1ASJ 1;  4XJA A;  5C3P A;  2DDU A;  3GHN A;  1HV0 A;  1TVG A;  4O9E A;  2Z69 A;  4TXW A;  3ZSL A;  1X33 A;  4AF9 A;  1JOJ A;  4BQ3 A;  1ENR A;  2YPJ A;  5C9A C;  4E2G A;  3HR9 A;  1BJQ A;  5F1R A;  3VZN A;  4B4P A;  3FFZ A;  5E8A A;  2N7G A;  2WQ8 A;  2WZR 1;  5F7U A;  1B09 A;  1OLR A;  1N1T A;  3FLT A;  1NKG A;  2BFU S;  1JHN A;  1ZZ7 A;  3H1Y A;  2BZD A;  5GLW A;  3RRD A;  3VGI A;  1F8V A;  4XF4 A;  1W06 A;  3USS A;  3O1U A;  1H2M A;  5I0D A;  1QH7 A;  2A3Y A;  2DUO A;  5T5J A;  1UY2 A;  4ZHN A;  1OD3 A;  4HLT A;  5A3L A;  1NA1 B;  3BN6 A;  2JWP A;  4Z2W A;  1MZ5 A;  2R07 1;  4PBP A;  3TEX A;  5FDB A;  5IVF A;  4EN7 B;  2VJX A;  3PVO A;  1CPM A;  1V6I A;  4XUT A;  1HB1 A;  5EWS A;  1GKB A;  4J1W A;  5AVP A;  5JVV A;  1H0B A;  2YU2 A;  2Y6G A;  1JXN A;  3C3V A;  3NJV A;  2CU5 A;  3POF A;  5KHI A;  5IVY A;  5JR2 A;  5FOB B;  2D44 A;  2R04 1;  1JN2 P;  3ACL A;  5K0U C;  5BXX A;  5CFD B;  2QTW B;  2A3W A;  1MZ6 A;  1F5J A;  2CSG A;  2BOI A;  3OF1 A;  1XE7 A;  1DCS A;  2ZEW A;  1EP0 A;  1H4H A;  4S2F A;  2Y34 A;  5CKM A;  1H8T A;  4IXL A;  3WP3 A;  4DRR A;  5IHR A;  4KH9 A;  2F4P A;  1DYP A;  1FX5 A;  2QQL A;  5F6K A;  1QJY 2;  4IEW A;  2AH2 A;  4XYX A;  2IFW A;  2VOW A;  3J26 N;  4YYO A;  4BQY A;  4JKM A;  4HVQ A;  4LK6 A;  3G6J B;  5FY8 A;  3KVA A;  3S7E A;  4MXW A;  3WG2 A;  2XLG A;  3ZFF B;  4TLF A;  4DY5 A;  4AHW A;  4EQV A;  4CCC A;  4FP2 A;  5KXB A;  2HEV F;  3KWV A;  4MOA A;  1RVF 1;  5C5U A;  2RS1 1;  1GOH A;  1U0A A;  1WCS A;  4M3C B;  2FDI A;  3UKN A;  2ZGK A;  4DEV A;  4YM2 A;  1CVN A;  4P02 B;  3HPN A;  3ZYF A;  3AK0 A;  2V72 A;  4AAP A;  2I07 B;  2NLR A;  1VRH 2;  2BJS A;  4V2V A;  5F6L B;  5F39 A;  1E5S A;  1WCD J;  2W08 A;  3THC A;  3KGZ A;  4C0H A;  3PIG A;  4M0N A;  3DPR A;  3ZN6 A;  4KGG A;  4EYU A;  2FQP A;  3AYE A;  2WN2 A;  4CEW C;  2YBP A;  4S2G A;  3SEE A;  1HLC A;  1STM A;  1YIP A;  3RZL A;  4IV3 B;  1XU1 A;  2HWE 2;  4YW1 A;  3AKR A;  1LEM A;  1AR9 2;  2OVU A;  3FC0 A;  4UBG A;  2GP5 A;  2WJS A;  2MPF A;  1ZBA 2;  2JEM A;  4Q4Y 1;  1YJL A;  3NAP A;  4QPI B;  1UIK A;  5E89 A;  4E4H A;  1ENX A;  3VN4 A;  1RMU 1;  2R07 3;  4COU A;  3O1S A;  3MW4 A;  2BNO A;  2WNE A;  1R1Z A;  4YGE A;  5FTT C;  1NA1 C;  1HQW A;  3U11 A;  2NP0 A;  1O8S A;  4J1X A;  4DUX A;  3V0A A;  4BQ5 A;  4WV8 A;  2UUR A;  1FPN 3;  4GWJ A;  3NVC A;  4PT6 A;  5H9R A;  1C28 A;  3NL1 A;  4R9B A;  5GZG A;  1Q8O A;  2Q1F A;  4AEJ A;  1SMV A;  4FI9 A;  4IE0 A;  2B7Y A;  2E9Q A;  5C70 A;  1R08 1;  1O5U A;  1FOD 1;  2VO5 A;  1MS3 A;  3NMB A;  1SFN A;  4IND A;  4Y33 A;  3SIT A;  1O4Z A;  2CGP A;  5FZC A;  5JOZ A;  3PTY A;  3L9J T;  2Q4S A;  3KVB A;  3WNM A;  1RUG 1;  2ZOE B;  4URA A;  2PHW A;  4WVM A;  4BU2 A;  3ZXG A;  2R07 2;  1UAI A;  2WL1 A;  1LOC A;  2ARA A;  2WQZ C;  4U2A A;  1EY2 A;  1HXS 2;  2W1S A;  4Q29 A;  1GP6 A;  2EIG A;  4E27 A;  1DGW A;  3I3E A;  5EYY A;  3C8X A;  3ME2 A;  4MGQ A;  4MHU A;  2ZAC A;  1QJX 1;  4I2O A;  1Y7B A;  5D8A A;  4XAA A;  1LU1 A;  2XWB B;  2VBB A;  4CDQ C;  1I9R A;  2YYO A;  2WR9 A;  2XVL A;  1UXX X;  4R8H A;  2YMZ A;  1SFP A;  2JDP A;  5FKC A;  3ZYB A;  4IEQ A;  4CDX A;  3H8X A;  2IXK A;  3DUI A;  3PUA A;  5BNO A;  1CAU B;  3ORJ A;  2RMU 1;  5BNP C;  3CO2 A;  1UMZ A;  4K20 A;  5KHJ A;  1BZW A;  3AYA A;  1J59 A;  3K77 A;  4J25 A;  3OD0 A;  2WZE A;  3E97 A;  2XGX A;  3LA7 A;  4PF5 A;  4TZD A;  3ACI A;  2DCK A;  1QJU 2;  1B35 B;  2AR6 A;  3RI8 A;  1NXM A;  1WLT A;  2RS5 3;  3EMR A;  3WDY A;  1MS4 A;  4K1Z A;  3WLU A;  5JPN B;  2VMH A;  3BIW E;  1JHJ A;  4BWO A;  5FLI A;  1Z7S 3;  4EN0 A;  4CP1 A;  2JDY A;  1OLQ A;  1E5I A;  4COZ A;  4AG4 A;  1VRB A;  3OBA A;  1IS6 A;  2PHL A;  1Y3T A;  2Y0O A;  2XKP A;  3A0K A;  4KMQ A;  5DUX A;  1T6G C;  5FWJ A;  5D8A B;  5HXV A;  2ES3 A;  1ZBE 1;  2YFU A;  1RUI 1;  4FFH A;  4XMI A;  3UES A;  3ZVX A;  1O8P A;  1O7F A;  3PUI A;  4GD4 A;  1PNG A;  2WT2 A;  4BIF A;  4PJY A;  3GNE A;  2XVG A;  3ZSK A;  3M3E A;  1UMH A;  4A44 A;  2B9U A;  3SCH A;  2AEY A;  3RJ2 X;  2P5B A;  3LWC A;  2K46 A;  3OGJ A;  1FMD 3;  2VOX A;  4OUL A;  5CFD A;  3E1F 1;  1JZ6 A;  5HXM A;  1QF3 A;  2DCJ A;  1IQD C;  3B01 A;  2BV4 A;  1CGP A;  3CU7 A;  1RUJ 3;  2GC3 A;  1HQL A;  2VY0 A;  4TN7 A;  2MEV 3;  2ZEX A;  3VDB A;  1BLZ A;  3AX4 A;  5EJ3 A;  3LOB A;  5BNO C;  3DN7 A;  3NNG A;  1OPO A;  2ZX0 A;  2WQ4 A;  1CZS A;  1QJX 2;  5EZW A;  1AR6 1;  5JOY A;  1MS1 A;  1NCR A;  4YAR A;  3OY8 B;  3WW2 A;  3LEK A;  4NVP A;  3P3N A;  4UWD A;  1OQ1 A;  3HAG A;  4ASL A;  2R30 A;  1LRH A;  2C9A A;  2X5I B;  4O9G A;  4ONU A;  5GZD A;  1GYK A;  4DRV A;  5LEJ A;  2WDB A;  1MS9 A;  4Q4Y 3;  3ZKY A;  3W5N A;  1UZZ A;  2Q8D A;  1E5R A;  1ZVF A;  3ZMN A;  3BGA A;  4D7Y A;  1BMV 2;  1VBA 2;  4E2Q A;  3FZ3 A;  1H1M A;  3ZR6 A;  2Y6K A;  1RUG 2;  3AKQ A;  4DO0 A;  5KC5 A;  4OHZ A;  3HT1 A;  2DBN A;  1DQ1 A;  1UWW A;  3LDB A;  1J58 A;  4Q4V 2;  1RC6 A;  2K9Z A;  4D94 A;  1VBB 3;  3ES4 A;  5GAL A;  4W4Z A;  1H30 A;  4IEZ A;  3THT A;  1W3V A;  2ARB A;  2VUD A;  2I2S A;  1XBF A;  2VE1 A;  3TAY A;  1RJ7 A;  2D5F A;  1ND3 C;  3LEG A;  4ISR A;  5FKB A;  4D3W A;  5L73 A;  3SHR A;  4ZS3 A;  3MO4 A;  2ZX3 A;  3UL2 A;  1UX6 A;  2XJR A;  5KHH A;  4D7T A;  1JYN A;  1QQP 2;  2R04 3;  2UWA A;  2XLA A;  3JCI A;  1GIC A;  2R1B A;  2GP3 A;  2XL9 A;  4IE5 A;  2HYK A;  1I5Z A;  4KWL A;  4XW3 A;  5JXG A;  1NCR B;  3RZG A;  1VBB 2;  2EXI A;  2EAL A;  4XET A;  2OKX A;  4Y3O A;  5E6H A;  5G04 L;  1EPZ A;  1S0I A;  1W04 A;  3CZU A;  4LOS A;  2ZGM A;  2E7Q A;  1VR3 A;  2JG8 A;  4LO7 A;  1TMF 2;  2BOJ A;  4YG6 A;  2ZZQ A;  3JXS A;  1CPN A;  1H2L A;  1POV 1;  2XXZ A;  3AFG A;  2UWC A;  4KG0 A;  1W90 A;  3AM2 A;  4TSV A;  1DU3 D;  4C0B A;  3VKM A;  4G4F A;  4QT6 A;  4NMI A;  4MGT A;  3J8F 1;  3PLQ A;  4HN1 A;  2CWS A;  5KXE A;  3HQU A;  2K0G A;  4HOO A;  1OA2 A;  4UXA A;  3VBF B;  1WD4 A;  4FPO B;  4YVW A;  3TEZ A;  1OQE A;  1JZ7 A;  2RS3 2; 
#chains in the Genus database with same CATH homology
 2WO2 A;  1DP0 A;  2J1U A;  5C71 A;  1W9T A;  1CZV A;  1W9S A;  1XNT A;  1US3 A;  2E31 A;  2W1U A;  1T2X A;  2W5F A;  4CUB A;  2C4X A;  3IB3 A;  1JYX A;  2QBX A;  4CU7 A;  4QX3 A;  4DEQ A;  5IJR A;  2EIB A;  1J84 A;  3ZM8 A;  3UET A;  3P6B A;  4BXS V;  4W50 A;  3HNM A;  2Z4F A;  1L7Q A;  2YFZ A;  3F2Z A;  3SEP A;  1OF3 A;  1H6Y A;  4MAD A;  4AAX A;  2HLE A;  1HN1 A;  2ZEZ A;  1OT5 A;  4OMC A;  2XOM A;  3P1I A;  2BER A;  3DYM A;  3LE0 A;  3ACH A;  1I5P A;  2EID A;  3ECQ A;  2VZ1 A;  4DXS A;  5J1X A;  3J7H A;  1CZT A;  2W47 A;  5LA2 A;  3ETP A;  2QQK A;  3WNP A;  3OG2 A;  3WF1 A;  2VQU A;  2E33 A;  3OGS A;  3UNP A;  3K4D A;  2W1Q A;  4OMD A;  3I2J A;  3DEC A;  1EUT A;  4XUO A;  3DYO A;  3A22 A;  4QX2 A;  4E8D A;  5DMY A;  1W8N A;  2VZS A;  4QB6 A;  4LQR A;  2VZV A;  3K75 B;  2B9V A;  2VMF A;  2WAO A;  1K12 A;  2VZQ A;  2JKX A;  1JYV A;  5HPO A;  2E26 A;  2BBA A;  1P8J A;  1UYZ A;  2W91 A;  2QQM A;  2J1E A;  3WF3 A;  2E32 A;  1JZ2 A;  4D8M A;  3WF0 A;  4JX0 A;  2EIE A;  3K46 A;  4IUG A;  4A45 A;  3SKJ E;  4A6O A;  5JMO A;  3HJR A;  4UI9 L;  3FN9 A;  2VCB A;  1GOF A;  4JKK A;  2J7M A;  3FL7 A;  3SKV A;  1W99 A;  3I2H A;  5DQ0 A;  2VQT A;  2WBK A;  3W5M A;  2VL4 A;  3HNB M;  4RN5 A;  3I2I A;  4KWU A;  2QQN A;  3T0D A;  2XHN A;  3WEZ A;  5JXJ A;  2J22 A;  2WYS A;  4L0P A;  1D7P M;  4CVU A;  2X10 A;  2EIC A;  4ZY9 A;  4XZU G;  1OF4 A;  1XNA A;  3IAQ A;  2VMD A;  3VD9 A;  5LA1 A;  3C7F A;  2Y6H A;  2JE8 A;  2RJ2 A;  4OYU A;  1BHG A;  2B4K A;  4BK4 A;  2W3J A;  3I97 A;  1UY1 A;  3IAP A;  1K45 A;  4UOJ A;  5EIY B;  5IYY A;  5LA0 A;  5G05 L;  5LCW L;  3LEI A;  4DXT A;  1GNY A;  3AC0 A;  1GQP A;  3A23 A;  1ULO A;  2J1V A;  4QDQ A;  2CDP A;  4QDR A;  3T0B A;  4ARX A;  1LNS A;  2X09 A;  3NQH A;  2QQI A;  4QDS A;  2YG0 A;  4QPW A;  2Y6J A;  3I2G A;  1K3I A;  3EB7 A;  1UYY A;  1SHW B;  1W8O A;  4A3Z A;  4P00 B;  2Y8K A;  1DLC A;  3CIH A;  4GWI A;  4GZ9 A;  4RYD A;  3MUY 1;  1RYY A;  3THD A;  2QQJ A;  4M4R A;  4BK5 A;  4JHZ A;  4ET7 A;  4E8C A;  3C7E A;  3LQC A;  1YQ2 A;  2W1W A;  3OEA A;  1CIY A;  2VZO A;  2KD7 A;  5JXI A;  4QX1 A;  2BGP A;  2WAA A;  2WAB A;  4KI5 M;  1JU4 A;  3I3D A;  1WCQ A;  1OH4 A;  2DDU A;  1TVG A;  4TXW A;  2ID4 A;  3WNO A;  1PMJ X;  3I2F A;  4Z2A A;  3CDZ B;  2WQ8 A;  5F7U A;  2YC2 A;  4MO3 M;  1NKG A;  3FHA A;  1JZ3 A;  2BZD A;  4LKS A;  4QX0 A;  4A41 A;  5I0D A;  3CKH A;  2V5D A;  1UY2 A;  2WO3 A;  3GGL A;  1OD3 A;  3III A;  3WNN A;  3BN6 A;  1GMM A;  3K4A A;  1EUU A;  2VJX A;  4CU8 A;  2J1R A;  3OEB A;  2YB7 A;  4BDV B;  1H6X A;  4XUT A;  1F4A A;  2XQX A;  3CMG A;  1JI6 A;  2VCC A;  2Y6G A;  5IFT A;  3NJV A;  5JR2 A;  2C9K A;  2ORZ A;  1GU3 A;  1SG3 A;  2WUH A;  3FHQ A;  3VDA A;  2WO1 A;  2LW8 A;  2ZEW A;  3NRU A;  5IHR A;  3GM8 A;  1UYX A;  2QQL A;  2J1S A;  1JYW A;  3C7O A;  4JKM A;  4OUE A;  4PF1 A;  2VZ3 A;  1UMI A;  4MOA A;  1GOH A;  1UX7 A;  4W8J A;  4DEV A;  3T2O A;  4P02 B;  4ZZ8 A;  2W9X A;  3HPN A;  2V72 A;  3VD5 A;  4DUW A;  1UY3 A;  3OGR A;  3ABZ A;  2VM9 A;  2VMC A;  4HG6 B;  2VZT A;  3MBW A;  3THC A;  1JZ8 A;  3VD3 A;  3T2Q A;  4ZXE A;  1JU3 A;  3NJX A;  3D3A A;  1SDD B;  4OZO A;  4QB2 A;  3DYP A;  2WN2 A;  2J1A A;  3SEE A;  3CQO A;  2J1T A;  5JXH A;  2VR4 A;  1XPW A;  2WZ8 A;  1PMH X;  5B4N A;  3WF4 A;  1PX3 A;  3OB8 A;  3MV0 1;  1O8S A;  4DUX A;  4GWJ A;  4PT6 A;  2HYX A;  2JDA A;  5FUI A;  1KGY A;  3C7H A;  4FI9 A;  1F4H A;  2V4V A;  3K4Z A;  5C70 A;  4LHS A;  2VO5 A;  3HNY M;  4M4P A;  5A1A A;  4QAW A;  2JD9 A;  3ACG A;  5EJZ B;  2W94 A;  3WNM A;  4TTG A;  1DYO A;  4XUQ A;  2L9L A;  2VZR A;  2BGO A;  2W1S A;  2CDO A;  3I3E A;  5EJ1 B;  1KEX A;  3C8X A;  3T0A A;  2VZP A;  1UXZ A;  4MGQ A;  4CU6 A;  1NX9 A;  3I3B A;  2ZEY A;  1PX4 A;  1UXX X;  3LPF A;  4CUA A;  5CYY A;  1ULP A;  2ORX A;  2W92 A;  2W46 A;  3A21 A;  3ACF A;  2VTF A;  1J83 A;  3K77 A;  2WZE A;  4JKL A;  3MUZ 1;  1WKY A;  3ACI A;  2DCK A;  2X05 A;  4ARY A;  1MPX A;  1JHJ A;  2LS6 A;  3CZJ A;  4D0Q A;  1O59 A;  5DPN A;  4AG4 A;  3OBA A;  2Y64 A;  1TG7 A;  1W0N A;  4KMQ A;  4QB1 A;  3C7G A;  2YFU A;  3WNL A;  2ZXQ A;  1UZ0 A;  3UES A;  1O8P A;  5DN2 A;  3PUI A;  3LPG A;  4DXR A;  2W95 A;  4LPL A;  1GOG A;  3WF2 A;  4A42 A;  1UMH A;  4A44 A;  2VME A;  3E1F 1;  1JZ6 A;  5HXM A;  2DCJ A;  3WQB A;  1US2 A;  1IQD C;  3EYP A;  1XC6 A;  3OGV A;  3T2P A;  4PQQ A;  1UY4 A;  2ZEX A;  3VDB A;  2R7E B;  3PUH A;  3HOB A;  3NNG A;  1K42 A;  2PQS A;  1CX1 A;  1CZS A;  4ZZ5 A;  2W87 A;  3A7Q A;  5CZK A;  4P08 A;  3LEK A;  1W9W A;  3IDA A;  4P5Y A;  2QQO A;  2WDB A;  3W5N A;  2C26 A;  2WN3 A;  3BGA A;  2Y6K A;  3HEI A;  1UWW A;  3U37 A;  1JZ4 A;  3WSO A;  3GXU A;  3HN3 A;  4W4Z A;  4XUN A;  4XUP A;  4YPJ A;  4XVH A;  3LEG A;  1UY0 A;  3VD4 A;  3VD7 A;  3MO4 A;  2RV9 A;  1GUI A;  3WNK A;  3T08 A;  1JYN A;  5IFP A;  4XUR A;  1NAE A;  5JUV A;  5JXG A;  2VZU A;  5B4X A;  2XON A;  2Y6L A;  3GDB A;  2OKX A;  4UAP A;  5G04 L;  3CZU A;  1R64 A;  4CU9 A;  4A4A A;  4CUC A;  2RVA A;  3I2K A;  4BJ0 A;  4DUV A;  3VDC A;  1JZ5 A;  3JXS A;  2VCA A;  2VC9 A;  2YC4 A;  4MGS A;  1L7R A;  1NUK A;  2VOT A;  3T09 A;  5C7G A;  3MV1 1;  1JZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...