5DN2A

Human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
MFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of neuropilin-2 reveal a zinc ion binding site remote from the vascular endothelial growth factor binding pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neuropilin-2
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dn2A00
2VL4A 4A6OA 3SKJE 3LPFA 2VJXA 3SEPA 4DXRA 2J1TA 2VO5A 3I97A 3MBWA 3HPNA 4JKKA 2W1UA 3I3EA 2QQOA 4KMQA 1J84A 4E8CA 1JHJA 2YG0A 4MGQA 2EIBA 4CU9A 2EICA 5A1AA 1JU4A 1W9SA 5EJ1B 2J1SA 2YFZA 1W9TA 2B9VA 2VZ3A 3P6BA 3WF0A 1JZ4A 1ULOA 4TXWA 5HXMA 4QDRA 3PUHA 3MUZ1 2ZEYA 2L9LA 1US2A 3THDA 2W9XA 3LE0A 3T2PA 4QDSA 2LS6A 4AAXA 5FUIA 1W8NA 2VZOA 2YC2A 4QAWA 4KI5M 4OMDA 3W5MA 1UZ0A 2RV9A 2W94A 3HEIA 3I2KA 4QX2A 4GZ9A 4KWUA 3IDAA 2C4XA 2W1WA 1SHWB 1NAEA 4A45A 2WDBA 1DLCA 2J1EA 3K4DA 2HYXA 5C71A 1LNSA 3ABZA 2Z4FA 2J1AA 3A7QA 5JXJA 5CZKA 4BJ0A 1UXZA 5IFTA 4A41A 4LPLA 2VZPA 3I2HA 1JYXA 4BK4A 3D3AA 3BGAA 1GU3A 1O8SA 3CZUA 1PMJX 1CZTA 4XUNA 1NKGA 2V4VA 3LPGA 2JE8A 2Y6LA 3ZM8A 3EYPA 2W95A 3OGSA 2BBAA 3HOBA 2JDAA 2WQ8A 1F4HA 1YQ2A 1JYVA 4CUAA 2VM9A 4XUTA 4ZY9A 3T0AA 2CDOA 1IQDC 4GWJA 3ACIA 5DQ0A 1O59A 1CIYA 1L7RA 4RN5A 3VD3A 2V5DA 2R7EB 2WUHA 1GOHA 3GGLA 4LHSA 4QB1A 4ZZ5A 2HLEA 2QQKA 2XHNA 3NQHA 1JZ8A 1JYWA 3CMGA 2W46A 2E31A 2RJ2A 3DYPA 3P1IA 3A23A 4W50A 2C26A 3IB3A 3OEBA 5C70A 4CU7A 1JZ7A 4LQRA 4PT6A 1US3A 1T2XA 4DEVA 1OF4A 1UY2A 1RYYA 1I5PA 3VD5A 2E33A 3WSOA 3IAQA 5DPNA 1KEXA 1OH4A 4QPWA 2J1UA 3CZJA 2VZUA 2Y6HA 3MV01 4FI9A 1CX1A 2J1RA 4ZXEA 1UX7A 2WN2A 3WNMA 2BGPA 4XZUG 2Y8KA 4LKSA 5HPOA 2VZRA 4CVUA 1OF3A 2DCJA 3I2IA 2LW8A 3C7GA 1UMHA 3NRUA 3THCA 5IHRA 1UYXA 2YC4A 3A21A 1UY4A 1MPXA 1W9WA 1CZSA 5F7UA 3T09A 3HJRA 3HN3A 1W0NA 2WN3A 1UWWA 1K3IA 3OBAA 3F2ZA 1D7PM 2W87A 5EJZB 2WBKA 4A3ZA 4UAPA 5LCWL 1UY0A 4XURA 5G05L 4YPJA 3IIIA 3C7FA 5I0DA 1JI6A 2WZ8A 1UY1A 4BK5A 5G04L 4P08A 2X05A 3VDBA 1XNTA 3K75B 4CUCA 5IJRA 2C9KA 3WNKA 4BDVB 2YB7A 1XNAA 2ZEWA 2DCKA 3CDZB 4ZZ8A 2Y6JA 1JZ3A 1EUTA 1KGYA 3OGVA 5CYYA 3WF1A 3WEZA 1HN1A 3J7HA 5DMYA 1DYOA 2E32A 1R64A 2Y64A 4QX3A 3FHQA 3FHAA 4GWIA 4HG6B 1WCQA 3T0BA 2W1SA 3T08A 1BHGA 1UYZA 4MOAA 5IYYA 3WQBA 3MV11 1L7QA 2VZSA 2WO2A 5B4NA 3SEEA 3MO4A 1GOFA 2W5FA 4JHZA 1XPWA 1JZ5A 4RYDA 3OB8A 4MADA 3HNBM 4QDQA 3WF2A 1W99A 3FN9A 4QX0A 3WNNA 4D0QA 1UYYA 2B4KA 3WF4A 3T2QA 4TTGA 3I2JA 3K4AA 3T2OA 1CZVA 2WABA 2JKXA 4P02B 4W4ZA 3UETA 4ET7A 3GM8A 4OZOA 4QB6A 1OT5A 2V72A 3I2FA 3ACFA 4OMCA 2ORXA 3K46A 5JXHA 3ACGA 2ID4A 3C7EA 2Y6GA 1GNYA 2J7MA 1WKYA 2EIEA 4JX0A 2QQJA 3VD7A 2VCBA 2QQLA 3C8XA 2ORZA 2BZDA 2KD7A 2CDPA 3EB7A 3I2GA 2VR4A 2VTFA 2W3JA 3I3BA 4DEQA 5LA0A 5JXIA 4W8JA 1K45A 1H6XA 2VQUA 5IFPA 1ULPA 3ACHA 1PX4A 4DUXA 2YFUA 1JYNA 4P00B 5B4XA 5JR2A 2WZEA 4QB2A 3SKVA 3NJXA 2QBXA 1K42A 4PF1A 2OKXA 1XC6A 4ARXA 5LA1A 2W47A 2ZEXA 5JMOA 1SG3A 2X10A 2VZVA 3VD4A 4DXTA 2WO3A 2QQNA 4XUPA 4XUQA 2J1VA 2VMCA 1JZ6A 4A4AA 3OEAA 3OGRA 3LQCA 2ZEZA 4UI9L 1J83A 4M4PA 4PQQA 2EIDA 2VMFA 2WAOA 3GXUA 3NJVA 2W91A 4E8DA 2XONA 2XOMA 2JD9A 4DUWA 5DN2A 1GUIA 4UOJA 3OG2A 1F4AA 4M4RA 3CQOA 1UMIA 2VZ1A 3WF3A 4P5YA 2VMEA 1PX3A 2WO1A 2W1QA 4JKLA 2PQSA 3WNOA 1P8JA 1TG7A 3CKHA 4CU6A 4CU8A 5EIYB 1SDDB 3MUY1 4QX1A 3U37A 2RVAA 4BXSV 5JXGA 2Y6KA 4XUOA 2X09A 4L0PA 3CIHA 3NNGA 3WNPA 3UNPA 4JKMA 3WNLA 4A42A 5LA2A 4MO3M 3HNMA 4ARYA 3K4ZA 2WYSA 2QQMA 4DXSA 3E1F1 2E26A 5C7GA 2WAAA 2W92A 1O8PA 4Z2AA 4XVHA 1W8OA 3AC0A 1JZ2A 3C7OA 2VQTA 3ECQA 4D8MA 1NUKA 3DYOA 2BERA 3C7HA 3FL7A 3LEIA 3VDAA 2J22A 2VZTA 1OD3A 2VC9A 2ZXQA 2VZQA 3PUIA 3JXSA 1EUUA 4OYUA 1GOGA 1GQPA 4AG4A 2VMDA 4DUVA 3A22A 1UY3A 3IAPA 2BGOA 1H6YA 2DDUA 2VCAA 3VD9A 3GDBA 4OUEA 3LEKA 3LEGA 1DP0A 3UESA 5J1XA 2VCCA 3DYMA 3ETPA 1TVGA 1K12A 1NX9A 4IUGA 3VDCA 3T0DA 1UXXX 4CUBA 2QQIA 2VOTA 3HNYM 3K77A 3DECA 1GMMA 1JU3A 5JUVA 3I3DA 4A44A 2XQXA 3BN6A 3W5NA 4MGSA 1PMHX
chains in the Genus database with same CATH superfamily
1ZBA2 4ATEA 3LPFA 3SCHA 2R0HA 1VBA2 5DDJ1 1C8NA 2IUWA 1BXHA 3RFRA 5AFBA 1XSRA 1S0DA 4DXRA 3LEMA 3JQXA 3MIDA 1HRI1 2P4EA 1VRH3 2OS2A 1RTVA 2D6KA 4QPGA 5FY9A 4ZS2A 5L19A 4MG2A 3I3EA 4NAMA 3VHPA 2WQ4A 1RVF1 1JHJA 1YXWA 2Q4SA 4P14A 4D94A 2YG0A 4MGQA 4C0HA 5I8YA 1JN2P 3ZIWA 2JIJA 2YV8A 4BA6A 5EJ1B 1OUSA 3EQEA 4Q0VA 5FZ8A 4YARA 5CFDB 5FO9B 1RJ8A 2YFZA 4WBBA 1EPWA 1W9TA 2B9VA 1DQ2A 4Y1UA 4HMZA 3P6BA 3FJSA 1JOBA 3H0OA 4N43B 1N1VA 4TXWA 5HXMA 2XGXA 3F95A 3RYKA 1W0PA 4BQXA 5BNOB 1OURA 1QNYA 4IV3B 4ZXKA 3PUHA 4R9DA 4B7KA 5LBBA 1VRH2 5FZKA 4GB32 3MUZ1 4A6SA 3LA2A 5SV8A 1ZM1A 2ZEYA 5A1LA 1US2A 1DBNA 1LHWA 1X33A 3JBG1 3KT4A 1JS9A 2DFBA 2QZ3A 4KWJA 3SH4A 2DUPA 4RHV1 3LE0A 4COYA 4YW4A 1NOVA 4QPIA 1VMJA 5A32A 2BVVA 4QMAA 4Q26A 5A3MA 3O12A 3S30A 4ASLA 4XF9A 4CRQA 2GALA 4AVSA 4OMDA 4B29A 3W5MA 1RB8G 1HKDA 2JKBA 4L11A 4HXCA 3HEIA 3SHRA 1RUG3 1RUE3 2XR4A 4CYDA 4M0HA 1NAEA 1RL3A 2WDBA 3MW2A 2E63A 2WS92 4IXLA 4X8NA 2YGLA 4RS5C 2J1EA 3OYWB 2HYXA 3D5OA 4N8MA 3ABZA 2JDZA 3DUIA 1OLQA 2J1AA 2A3WA 2CNAA 1QMJA 4FTBA 3A7QA 5GJ6A 3D4KA 3MIEA 5JXJA 4BJ0A 4YNIA 5EZWA 1TME3 4A41A 1OVPA 2B39A 2WL1A 3OGJA 5IT6A 5C8CA 4ISQA 3D3AA 2D6LX 1WZXA 4CDQA 4OHVA 4YFWA 3ZXJA 3VL8A 1JH5A 2AZ5A 5FPAA 2JDPA 3R4UA 2CV6A 1G9FA 4I09A 2WNUA 4B4PA 2DVGA 1XE8A 3TWIA 5JSRA 1O3TA 1BMV1 4A7KA 2BQPA 3VDDB 2ZHLA 4YVSB 5A1FA 5FV3A 2DVFA 1OLRA 1ZZ7A 1NKGA 5CFCB 3KCCA 1LHOA 5F3IA 2XHKA 4IEZA 1RUJ1 3OD0A 5HCBA 3WHTA 2Y6LA 4BMEA 1NXD1 5LRRA 1YFUA 2I07B 1PMIA 5L9VA 1DQ6A 2JD4A 1OHFA 3EYPA 4A7ZA 2ZA9A 3OGSA 5ACA1 3FLRA 4K7JA 2ZABA 5FMDA 2YU2A 4ZU4A 1RUJ3 4Z2WA 2G9FA 5F5QA 5E88A 3HAGA 1RUNA 4YLZA 3NO8A 1O3QA 4XQWA 1V70A 4LMFA 1MZEA 3M3OA 4M0NA 2BBVA 5DQ0A 5CG9A 4L2NA 2HWD2 1A6CA 4UFHA 5I8SA 2EXJA 2YBKA 3I8TA 2CL2A 3KHBA 4BQ2A 5A3PA 4OHYA 4L99A 5FY8A 4JGZC 1D2QA 5CAZA 3P5BA 1ZZ6A 2PELA 2ZAAA 1SLBA 4I0WB 4LORA 4OCTA 3S0MA 4YW6A 4FPEA 5K0UC 2HWE1 1R083 3O0VA 1MVQA 4WZCA 1PK6A 1RVF3 4NHXA 2XHNA 1YWKA 2CGPA 1BKZA 2ZGLA 3CMGA 2W46A 1IS4A 3DYPA 1OA2A 1UU6A 1YC61 1SDWA 2OA2A 4Y22A 3IB3A 3OEBA 4GWMA 1RUH3 1KJRA 4FP3A 4NRMA 4CU7A 4F83A 4PT6A 3UKVA 5IAVA 1QQP3 3FBMA 1UMZA 1UY2A 3O1PA 4N9IA 4CEWC 2A6XA 2RHPA 1MS8A 3TOJA 3IN9A 3JD72 1LENA 5FRAA 3VD5A 2CAVA 4E4DX 2E53A 3IAQA 3JBG3 1CR7A 2HWD1 3AYEA 3FBYA 5IVFA 4UFLA 3TEYA 1VBE1 1UZVA 2XJQA 4YM1A 1HRI2 2ZHNA 4LE4A 3H8XA 4BHPA 2VZUA 3BVCA 5FYHA 2GH8A 4N9HA 1UYPA 2PLV3 5A32B 2Y0IA 2BPA2 2J1RA 3WVJA 3EBRA 3ILRA 3VHOA 2QUOA 4K9SA 4LKSA 4Y1XA 1R1A3 2YDEA 2R6QA 2RR12 3CBNA 1OF3A 3RI8A 3T1MA 5LY1A 3BTYA 3U1XA 1VBD1 3E6CC 3O1SA 1OOPA 2IXKA 3VN4A 3I2IA 2LW8A 4Y3OA 3I3MA 4FAGA 5FPXA 1UMHA 2WFF1 3AYDA 1WW5A 4QPGC 1CAWA 1RUF2 3HBZA 3KWVA 2FDGA 1DGLA 1XNBA 1BEV2 1RUC2 1VB2A 2G9GA 2DFCA 1MPXA 1TME1 2WNOA 1ONAA 1QJEA 5F7UA 5C4WC 3VKOA 4N43C 2ZGKA 2WN3A 2O14A 5FZGA 1SQ4A 1T6BX 4NO4A 2O0OA 4CEYC 3ZYGA 3KF5A 3N9PA 4MHRA 3DV8A 2O8QA 1CGPA 3OBRA 4AVTA 5C3PA 4MX3A 1AXYA 2WQZC 3J7NA 4XFBA 2ATFA 1QJU2 3IT8A 4UAPA 5I0RA 2R061 5LCWL 2EVXA 4GJYA 2V73A 1UOFA 3BODA 3QACA 3ORJA 4J1XA 2WNVC 1YLLA 2DU1A 5G05L 4IL7A 1OXCA 3A0KA 1CJPA 5E8AA 3IIIA 4YZ3A 1BEV3 2VG9A 1TMF3 3C7FA 3WG2A 1PVC1 2Q1MA 2DVBA 4IETA 3ZN4A 1J58A 3ME2A 4BK5A 5G04L 4K8RB 4UBGA 4JRLA 1C28A 1HB4A 4IEOA 3WNKA 3VBRC 2P1BA 2YB7A 3NV4A 2DBNA 4QXCA 3WZ1A 3RI9A 1WW4A 3JQWA 2BU9A 2TBVA 3B01A 2RS13 1NY71 3PIJA 3ZMNA 4I3PA 2Y6JA 1UPSA 4Q4Y2 3OGVA 2OZ6A 5DMYA 1PZ8A 5FIXA 4MGTA 3DN7A 2WJSA 2HWF2 1I5ZA 4YGCA 1TME2 4AF9A 3KCXA 4GWIA 3WP3A 3U11A 4HG6B 4OI1A 2R32A 3T0BA 2JIGA 2R062 2VUJA 5F3EA 3ZSLA 3VBRB 2CWSA 2MPFA 2FCVA 2F4PA 4Y20B 2RDRA 4RS5B 2XJRA 2O1QA 1Q3EA 4Z07A 3WQBA 4XAAA 1W39A 1NT0A 1RGSA 1H1AA 5B4NA 4B1MA 3M2MA 5A7WA 3SEEA 3KZ4C 5DUUA 2W5FA 4JHZA 4Y4YA 3N9NA 1WD3A 5K7PA 2ET7A 5H9RA 3WF2A 1S2EA 3WDUA 4CE8A 1COV2 2ET1A 4IEWA 4FOYA 3L2YA 4TZDA 4MGIE 4QX0A 4DNYA 4D0QA 1POV0 1UYYA 2B4KA 3SXWA 1QQP1 1BVP1 1UU5A 2GMMA 4FXGB 1Q8OA 2JXAA 3PU3A 3I2JA 4P9XA 5CNAA 1SFPA 3TEWA 5FK7A 3J7MA 1U5XA 1XNKA 4P02B 5FKBA 4GH4A 1FT9A 3CU7A 3IBMA 4OZOA 4P9JA 4XBNA 2V72A 1OLME 5BNOC 1V00A 3Q9OA 1PM4A 3VKFC 4OMCA 2X53S 5T5PA 5J37A 2ORXA 3K46A 2PHFA 3ZXEA 2ID4A 4HFSA 4O9GA 3C7EA 3IPVB 2J7MA 2P3JA 1WKYA 4YGDA 1GLHA 3SITA 2R30A 4Y1VA 1REFA 1X50A 2QQJA 2WRAA 3VD7A 2QQLA 4IEXA 2MNGA 4OI4A 2KD7A 2ZMLA 4YW1A 1RUOA 5FYIA 1BVVA 1C57A 4AFAA 4IE0A 3H3LA 4JGZA 4MGKE 2HWE2 2YXSA 1X9PA 5FP8A 5FO8B 5LA0A 2FDJA 5JXIA 1OH3A 4XOGA 1VBB2 4H7LA 2A7AA 4Q2FA 2JB4A 1ND3A 3ASIA 1PX4A 2D93A 4PDWA 4Q1PA 5F32A 5JSPA 1N1YA 5HCHA 5FQ0B 4GWNA 3O1RA 3N3HA 3VLBB 1BYHA 1YIFA 3WG4A 4CZSA 3S7IA 3MLLA 4J25A 2HH9A 3SKVA 1FPN3 4WM7A 3WW3A 2QBXA 4PF1A 1DG6A 3RVHA 3VZNA 1FATA 1HXS3 1UF2C 4ARXA 4BIFA 1EP0A 1GWMA 5CA6A 3BPZA 2Q8CA 2W47A 1N3OA 1SZBA 4JDNA 3UGFA 3WHUA 4BMBA 1R091 1EV11 1PO22 2SBAA 4IW3A 4Q4X3 4XUPA 3BIWE 4AI9A 4CDUC 2DYCA 5GZCA 1JZ6A 4BQ4A 2VW2A 2RDQA 1PZ7A 3KVBA 3RWKX 4A4AA 4AI8A 3ZFFB 4YZ1A 1YEWA 3KCYA 4PCRA 1HLCA 1HRI3 2Q5TA 3POYA 2ZEZA 5FZHA 4EZ4A 1AX2A 1KFXL 1V6KA 3LGRA 5DAVA 4E2QA 3G7DA 4XJ9A 1TEIA 3P3NA 2WFPA 1L7LA 4M4PA 5BNQA 2GC1A 1CAXB 5L9RA 4Q4W2 3ZO0B 3GXUA 5LEKA 2XOMA 4NWVA 4R9AA 2N7GA 5JIUA 4UFIA 1CQ9A 3S5AA 5FZCA 1F4AA 1AJKA 3GZEA 1TQ5A 3MGUA 1IG3A 2GMPA 3O0WA 4M4RA 5GZFA 4C1XA 1C8M2 1YFYA 3RZKA 1W9YA 3IKWA 4YRDA 2VZ1A 4WVWA 3GALA 4P5YA 5FYVA 4BU2A 5FWEA 5KC5A 1PX3A 1XE0A 3M1HA 2VXJA 2WO1A 2H6CA 1AL0G 2WT0A 1PIV3 4JKLA 5C4WA 1W8TA 5C9AC 3WNXA 3S57A 1ND3B 3WD5A 2LM3A 1N1TA 3T30A 5EIYB 1YI9A 3KS7A 1CPNA 3ROUA 4C91A 5FZIA 3SC7X 3CNAA 5FLIA 3AKSA 3AP7A 1PO21 3U37A 4BXSV 2RMU3 1E57A 4AR2A 2D3RA 5BNPA 4XF0A 5IK7A 1LU1A 1H2LA 1SMVA 1DIWA 4M3CA 1W6MA 4YGEA 5EWSA 3NNGA 4CEYA 1NA1B 1RUC3 1QXJA 2CTVA 3BOPA 3OY8A 5LZ6A 5FYYA 3UNPA 4BLIA 1S0FA 1AVBA 3IPVA 5GLWA 2W52A 3PDQA 3ZSMA 1OVSA 1PNFA 3VL9A 1N3PA 1OC1A 2NQYA 2W2IA 1UO9A 4N53C 1FV2A 4QXKA 4OULA 2BEOA 2OUHA 3AX4A 4A42A 4FPKA 3LOBA 3MIBA 2ARBA 2WYSA 4P9GA 1AR72 4JAAA 2QQMA 3E1F1 2PHWA 4R9BA 1NY72 1UOGA 4D7TA 2LUWA 2WAAA 5AFEA 4QKBA 1CAXA 4Y5Z0 4I3GA 2WT1A 1Y3TA 1OA3A 1XQNA 5FO7B 3JB8A 5FOJB 3C7OA 3FFQA 3Q8BA 4D8MA 2PAEA 1MVEA 3DYOA 3C7HA 1W8UA 3LEIA 3WP5A 3RZGA 3VDAA 1PO12 3H1YA 4IGQA 1F8VA 1WLCA 4XFAA 1O4YA 1IGOA 1KS5A 5A80A 2VC9A 4OFGA 1E5IA 1URXA 1RUI1 4PBOA 1EUUA 1H9PA 3N35A 4I0BA 1GOGA 4OYUA 5EJ3A 1WCUA 4GB31 2VMDA 3WXPA 4AG4A 3UV9A 4QU1A 3A22A 1UY3A 5F1RA 1PGSA 4H14A 5FK8A 1H6YA 5CEHA 2ZKLA 2PHRA 3PJYA 4BIOA 1MS5A 3A0NA 1QNWA 3LEGA 5JOXA 2NMOA 3BU7A 3AZZA 1YCIA 2VCCA 4LLFA 3ETPA 5LK5A 3ZYIB 4XMIA 3VDCA 3T0DA 3NNJA 1UXXX 1OMIA 4UYBA 2QQIA 4CUBA 1BEV1 4YM3A 2VOTA 5E89A 2A6WA 3TB0A 1AL23 1NLSA 3TAYA 2HEVF 4QKDA 4OQ9A 1W6PB 2WT2A 4GMP1 4RQPB 3L2HA 1GMMA 1LKNA 4KU7A 2BFUL 3N7JA 3PIGA 5JUVA 2JG8A 1MS3A 3BN6A 1EPZA 2ZKNA 3IIAA 2EIGA 2GMEA 2UWCA 2PHTA 4HETA 1GANA 4MGSA 5CIRA 5HXVA 4Z92B 5A70A 2E9QA 1PMHX 5F2WA 1Q8VA 4HPKB 3ITQA 4JZRA 4XYXA 3PUAA 4B1LA 4GH4C 3NMBA 1RC6A 2XLGA 2R49A 5A33A 3RZHA 3SEPA 4UFJA 2VO5A 4AFBA 1GQHA 2FBEA 1UNBA 4GB33 5FZBA 1U5IA 4FQZA 1C4RA 3CJIA 2RS32 4B8EA 1YFXA 3HPNA 1W6NA 4JKKA 2W1UA 3DPRB 5FPVA 1FOD2 1GZWB 2QQOA 2WLQA 1J84A 5IVYA 4XIKA 2WSVA 4CPBD 4NR1A 1ND3C 5A7SA 4BM8A 1J3RA 3UJQA 2WA3A 4JGYA 4V2WA 5A1AA 2RS52 5A3OA 5FZOB 1GICA 4KQ7A 1BBT1 1ZBE1 3TNQA 4WM7C 4K1YA 2DUQA 3VB9A 3UK9A 1JZ4A 2CU5A 1S1AA 4CDUB 2G9ZA 1A8DA 2ZZQA 5ABJB 4RL7A 1VAMA 4M01A 2D6OX 1XU2A 5C5TA 5FYCA 5FZFA 5FZAA 1AR92 1CIWA 2W0XA 5FPBA 3AK0A 1VBC3 1WMFA 2L9LA 5FKCA 1APNA 3I3QA 3ZKYA 1DYPA 4KWLA 4AHZA 2P34A 1NLQA 5KBFA 3PHMA 1VRBA 4LA2A 3T2PA 5LW9A 3MW4A 2VULA 1VBB1 2IXIA 2PAKA 1O7FA 2R063 3VDDC 5D8AB 4FPFA 3ZFFC 1HJFA 3NWKA 1ASJ3 1K5MB 2DBIA 2MEV3 4QAWA 1UZ0A 5A3NA 2W94A 1UOJA 3I2KA 5C8CB 4RQPA 4EZHA 2NPIA 2VVFA 4H55A 2RS31 3FWEA 2W1WA 3POWA 3ENRA 3Q8EA 1SHWB 4PJYA 3POIA 1Z7S1 3R6SA 4DQAA 1LRHA 3BTAA 1NE6A 1HXS2 1ZX5A 2RR11 3K4DA 5FP4A 1DHKB 1LNSA 1REEA 4XBLA 1VMHA 2Z4FA 5JAXA 2EF6A 1M4WA 4YWAA 1I1EA 2BFUS 1VAKA 2XBO1 3NKGA 1CAUA 4HN0A 5LRSA 1GR3A 3ZFEC 5EFUA 2WS93 1MS9A 1UXZA 4GXLA 1MEC1 4FVVA 2VZPA 1LOAA 1OQEA 3NSTA 3R4SA 1H4HA 4O7XA 4PIYA 4YVWB 2XL9A 1ENSA 4NPMA 4EROA 2XQRA 1WMDA 2UU8A 2ZX3A 1GU3A 4D69A 1QEXA 1Y43B 4G3YC 4LIUA 5JOYA 1IS6A 3JD71 5J48A 2WLPA 4FFGA 1FAYA 1PMJX 2C9AA 1ENQA 3OUHA 3VBOB 5CFDC 1CZTA 4M3CF 4AI2A 1DU3D 2HBTA 2BNMA 3MIFA 3OCPA 4IE6A 4RA0A 4H2AA 3LIHA 3U10A 1VBD2 3WW4A 2UURA 3QCWA 2VECA 1H4GA 1FYUA 1NZCA 1X8EA 3WDWA 4COUA 2JDAA 5C3OA 2WQ8A 3N4MA 3V0AA 3KD4A 1LHNA 1SFNA 1YQ2A 2P17A 3AYCA 4CCLA 1JYVA 1W6OA 1W0OA 1R082 4JQTA 2AREA 4JGYB 2VAUA 2VM9A 3OTFA 4QGNA 2ZGPA 1LOFC 2BJSA 1YUDA 3T0AA 3U4XA 2CDOA 5JI7A 2XKPA 4YSFA 3AL6A 3VKMA 3ACIA 2F17A 2BOIA 1REDA 1Y9MA 3ZSKA 4E2GA 5F5CA 1JUIA 1VBC2 1PHMA 5IVCA 3WW1A 5IWFA 2ZX4A 3THPA 3MLJA 3VD3A 3CJIC 1QJZA 4WVMA 1AUYA 2J42A 1OQ1A 2PHXA 4I02A 4QU2A 2Q8OA 3RJRA 2X8KA 5D8AC 2WNUB 3ZVXA 3E5XA 5K0UA 3AZVA 4JGYC 3ZXLA 2IXJA 3K51A 3Q8FA 4MUVA 2Z42A 4RFT0 5DABA 5F9TA 2JJ6A 2BNNA 5ANNA 1JYWA 4KU8A 5KHJA 3P1IA 4JGZB 3CO2A 3RPQA 3H8RA 5FY4A 3B5LB 4UXAA 2C26A 3C2UA 3MFAA 1WA6X 4QGLA 2A73B 3B00A 4LQRA 3UT0A 2XWJB 3B9CA 5HBAA 4DEVA 2WSUA 2IXLA 4COVA 5L7OB 1VAVA 3U14A 5I0UA 2A6ZA 2P3KA 3RQ0A 1RVF2 1NE4A 1CVNA 1LEDA 2Y6FA 4NE9A 5GM0A 3WSOA 1PGL2 2QQVA 1QOSA 2GC2A 4FP2A 3WV6A 3BTXA 4QPWA 5EP9A 5FZ0A 1V6OA 3AKRA 3INAA 5D2AA 3BTZA 4XEZA 5FYMA 1RUH2 3RZJA 2XWBB 3O1VA 1W28A 1S4CA 5A6QA 4QPGB 4Z8BA 1CX1A 2QJVA 4DS0A 1SLTA 3AVRA 4ZXEA 5KC6A 3O14A 3BU0A 1SBEA 1W06A 1UX7A 3B9IA 1PNGA 3GHNA 2BGPA 2JEMA 1BLZA 1KDKA 3NNMA 5DUVA 5A3LA 2BVBA 3GZTB 4LBMA 3NL1A 1NCQC 2GP3A 3O5SA 3OY8B 2ZGMA 3THCA 4P5HA 3VBSA 1Z0HA 4LBOA 1TMF2 5L36A 3OPWA 2VY0A 2VW1A 2VD7A 4PIZA 3T09A 1R092 4TYSA 4Q0SA 3HN3A 1W8WA 4EQVA 1DF0A 4F3JA 2GH2A 1UWWA 1K3IA 1H1MA 5FPLA 2TEPA 2QQPA 2RM22 2YZ4A 3F2ZA 4XPVA 2W87A 3K3NA 2ZGNA 3NW4A 3OF1A 4HT1T 3HN1A 1PGL1 4TLFA 1PO13 1WLDA 3U4SA 5J3UA 4IV1C 1NA1A 1PIV2 4E27A 4AI1A 2G4IA 4LBJA 1AZDA 4YPJA 1ULGA 3B93A 4UW6A 4XDQA 1XB9A 1PVXA 1MZ5A 1XBFA 1YIPA 1HQWA 1K5MC 3N36A 1UY1A 3I59B 3UYJA 3WINE 3VDBA 1W8FA 1XNTA 1M06G 4IERA 1AR63 1WBFA 4CUCA 2C9KA 5GLVA 2R043 1W9FA 3S6PA 5FYBA 4X8PA 4QPIB 3VBRA 5FR3A 1HN0A 1LOFA 3AZWA 3POGA 4N7IA 4E4SA 2OPWA 4CCJA 1XRUA 3UKTA 4CDXB 3W21A 1IS3A 3CDZB 3PMSA 4H3WA 4ZONA 4CDWC 4ZZ8A 4CXXA 3MICA 2NP0A 1AR83 1V0AA 1EUTA 1KGYA 3I54A 4GKYA 1NCRB 1H2NA 4Y26A 1D0GA 1W8HA 3ZFGA 3ZMOA 5JI9A 3D82A 1YQ5A 1IG0A 1K5JA 2P3YA 2Y64A 2ZHMA 4QX3A 4XFCA 1BBT3 1V6MA 4Z1VA 3ZSEA 1DGWA 1VRH1 1QJY3 1JBCA 2JWPA 2VPVA 4RR3C 3SQOA 5ACA2 3BUCA 5F37A 1MR5A 2EXKA 1YI7A 1LHUA 3O0XA 2D98A 4Q0UA 2HWF3 4WM8C 2AR6A 4LEJA 4M00A 2UWBA 2ADEA 4AFMA 2XJPA 2W68A 3IDEA 3MV11 4Q4Y3 1L7QA 2P37A 2ZMKA 2XLFA 5CKMA 2WO2A 3MO4A 3MF9A 1RUE2 5LBCA 3B69A 1GOFA 2LTNA 4HSJA 1CX4A 1KQRA 2OQ6A 3AB0A 1ZVFA 4RYDA 3GJBA 1LAJA 2ETEA 1U5ZA 2HWB1 1VPHA 4NOTA 1SBFA 1VE0A 4OHZA 1GP4A 3RZZA 2UYBA 1OOPC 3BALA 4AQ2A 1AYM2 3E6BA 4JVAA 1F31A 3T2QA 1G86A 3MHZA 1RMU1 1W6NB 3RSJA 5KHKA 2FZ2A 3K4AA 3T2OA 1CZVA 3FLPA 1W6QB 4PI2A 4JQRA 4W4ZA 3UETA 4ET7A 1J3QA 1OLMA 2A3YA 3GM8A 2ZHKA 3IDCB 1W6PA 4QB6A 1C5HA 4IEPA 5JXHA 3ZDSA 1RUF3 2CWMA 3ACGA 3M7AA 3TBDA 3KQ4B 2Y6GA 5GZEA 4LLOA 3IDBB 5CFCC 4RFRB 3RYPA 1G8WA 1ENXA 1VALA 3D0JA 3H9AA 4A3XA 2WNVA 2PLV1 1MZ6A 3KSCA 1ULFA 2VR4A 2H0VA 2VTFA 3U07A 2W3JA 3VHRA 2AGSA 2HWF1 4DEQA 2E51A 5L9BA 2D5FA 4JV4A 1PVC2 3ES4A 2RG4A 3HBKA 1K45A 1W05A 3HR9A 1ULPA 3FZ3A 2ZBJA 1LULA 3DGTA 5D8AA 3APBA 1AYN2 2YFUA 1FNZA 3AKPA 4DIQA 2B8MA 5AVAA 4AEJA 2WZEA 5LB6A 4HVRA 2FCUA 2K0GA 4ES9A 5LA1A 2QDNA 2JG9B 3HQUA 3QH6A 2PXJA 2VUCA 2V09A 5C33A 1V6NA 2VZVA 2JENA 4DFSA 4DXTA 1BBT2 2LROA 2WO3A 4AK3A 4XE9A 4C0BA 5IVEA 2XPJA 1POQA 2GC0A 1TE1B 3V65A 3BCWA 2RS12 5FLJA 1QDCA 5JWPA 3HD8B 3OEAA 5JPNB 3OGRA 2EA7A 2AEZA 3H1MA 1OFSA 1SLCA 4UI9L 5JVVA 2WFF2 1KS4A 1J83A 5E16A 4PQQA 4Y24A 1W6QA 3OD4A 1UZYA 3AFKA 2NZ9A 2WAOA 3NJVA 2R041 1VLNA 4HK8A 4K20A 5C4WB 1NCRC 3B94A 5DN2A 2HEYF 3SISA 4AEDC 4COZA 3LA7A 4DY5A 2WWUA 4DUWA 1E5RA 3CQOA 3LKJA 3ZN6A 2DCTA 2I2SA 2OX0A 4FFHA 4MZUA 4XW3A 5CBLA 1W2OA 3CHXA 2V5YA 4FPCA 4OVEA 5FZ1A 4CDXA 2R073 4DPNA 4J1WA 5DAPA 2FZ1A 1MS1A 1NXMA 1WCKA 4MGZE 4UW3A 4YW3A 4EJRA 1P8JA 4WZFA 1TG7A 1XU1A 5FZMA 2VNVA 4CU8A 4XACA 1DDLA 1FV3A 2D6NA 1QOTA 1SDDB 5FZ4A 1RUI3 2IVIB 3WUDA 4DOUA 1OKOA 5JZGA 3LZZA 3USSA 5JXGA 3T4VA 4UBHA 5KXCA 2XVLA 2PAMA 3ZYRA 1YQ6A 3B02A 5FFOC 1SLLA 3CIHA 3EMRA 1GNHA 4BQWA 3J8F2 1ZBA3 1KXGA 1H2KA 4PI0A 5CKNA 4AVCA 1AX1A 3QBQA 5DUXA 4EN9B 4MYEA 1LEMA 5ISLA 4IV1A 2FMDA 4BH9A 4NIGA 5LA2A 1ZA7A 3WP4A 1IZ3A 1J1TA 1COV3 1WW6A 3HNMA 5BY5A 2RR13 4ARYA 3K4ZA 5IK5A 2YPDA 4K21A 1AHSA 1S0IA 1ND2C 3OSDA 4AQSA 3LAGA 2E26A 2GDFA 1HRV2 2WO7A 3ZYJB 1AL21 4IV3A 3KT7A 2ENRA 2Q1ZB 5LBEA 5EYXA 4Z2AA 1ZYBA 4TWTA 4AI0A 1JZ2A 2XJTA 2ZZJA 1CWPA 3NJZA 2WZR3 4N43A 5FP7A 1OD5A 4HBNA 3M3CA 3VBUB 4AVVA 3ZX7A 1LGBA 2P6HA 1W6OB 1DZTA 1S0EA 2R071 3Q8AA 5FDBA 1MQTC 2VMIA 2J22A 2HYKA 2XJVA 3CLPA 3WG3A 4CCCA 1V9U2 1W03A 1X7NA 2O8OA 4AOCA 3V0BB 2ZXQA 3POBA 3JD73 3PUIA 2IWGB 1DZQA 4GQ7A 3ZXAC 4XBQA 3PURA 1GQPA 1MS4A 4AVBA 4RSUA 2WZR2 5HV4A 5JR7B 3IAPA 3M3QA 4FPJA 2TUNA 4G4FA 4EN8B 2K2SA 4NVPA 2DDUA 2VCAA 2IXHA 5IK8A 1V9U3 1ST8A 1JTZX 3LEKA 1HJGA 4INDA 4JC1A 2ILMA 4JTNA 4WM8A 3UESA 4E4ZA 2EXIA 4XZPA 5K0UB 1HV0A 2CGOA 1R081 1JUHA 1R1A2 4L8QA 2IFWA 2VW0A 1IS5A 5ACA3 3JU9A 1SCSA 5F8PA 1OSGA 2DUOA 1DGRA 1R1ZA 5D1IA 2PN5A 3K77A 3LDRA 1NQJA 1FI2A 3J8F3 5FZ6A 4FPGA 3UGHA 2E6VA 4A44A 3M4FA 1WCDJ 1CAVA 4K8FA 3RMYA 1EV13 2VL4A 4ITCA 2AH2A 5CFCA 3E5QA 3P3PA 1ZRRA 1UPIA 2B42B 2ARCA 3N9LA 2J1TA 3I97A 3FMGA 4NAOA 1JOJA 1VR3A 1XE7A 5BNNC 3E6DA 3MBWA 3AFGA 4FO9A 4LR4A 1RUD2 2R1BA 2XBO2 4KMQA 4E8CA 1BZWA 1QGLA 4Y5TA 3VZLA 4CXYA 2EIBA 2PMWB 3WP6A 3AP6A 4QKFA 4CU9A 5JMCA 2D6PA 1W9SA 4SBVA 3OBTA 5J96B 1AR62 3NNFA 2JDYA 4KL1A 2YBPA 3B3QE 3OUIA 2WZPP 2VZ3A 1FOD3 2JDKA 4XQDA 5KWRA 1UQXA 4B4RA 3BIEA 2WS91 1UIKA 2EALA 4P9IA 2FDFA 4RHV3 4BYYA 1AR91 2Y38A 1UL9A 1PGW2 4LO8A 4HONA 4UW4A 5A6ZA 1YRZA 3NV1A 3KV4A 3WR0A 5CU1A 1E5SA 2ES3A 2KA3A 2UYAA 4XDPA 1OBNA 4NUBA 3THDA 3U75A 4A2UA 1GWKA 3E5UA 1PZ9A 1VP6A 5J98B 3THTA 1CONA 2NN8A 1O91A 2LS6A 3AJZA 1H0BA 2ZGOA 4YZ4A 5FUIA 5LBFA 1W8NA 2BDRA 2VZOA 4KI5M 4AHXA 2ZGSA 1OI6A 4IEYA 4ONUA 4QX2A 2DF7A 4KWUA 4I2OA 4NMIA 3MIGA 1XYNA 4PQ9A 2P6CA 2R16A 2XL7A 4IV3C 1GWLA 4YVWC 4AHWA 4X6QB 3NV3A 3N7KA 1ASJ2 2MEV2 1O3SA 1AR61 1DLCA 2D44A 3UKNA 4DMIA 2VTXA 5C71A 1CAWB 1MS0A 1U5YA 3WOGA 1CJDA 3SCFA 5IVBA 1G9AA 1OOPB 1E5HA 4LTAA 1AYN3 3H7JA 4ES8A 4O61A 2ZX1A 4QHBA 3VHNA 2QVSB 2WNEA 4DRRA 2A3XA 5JLVA 1FOD1 1MZFA 4P9WA 1IPKA 4D7YA 4LHNA 5A7NA 2RMU1 1GQGA 3BGAA 1F5FA 1UW8A 1ZRDA 4QM8A 3CZUA 3UJOA 4LBKA 5LWBA 4ZU7A 2QTWB 4CP9B 4Y4RA 2Z79A 4AFDA 3ZFEB 4QHZA 2DU0A 2ZX2A 3K3OA 3MEPA 3N7MA 4URTA 4XUNA 4LHKA 1H8VA 5FXWA 2V4VA 2YC0A 1ASJ1 2MEV1 1X82A 3LPGA 5T5OA 4Q4V3 1XJAA 1QY4A 4AYUA 1QQP2 3K2OA 4YZ5A 4RR3B 2JE8A 4FCAA 1I9RA 4IGPA 4LOTA 4LUMA 3ZM8A 3CEWA 4GD4A 2BBAA 3HOBA 5DAXA 4URAA 4MXVA 3I49A 1CN1A 1LODA 5F5IA 4L9BA 4P9YA 5GZDA 4E2SA 2YUEA 4XJUA 1ND2B 3ZR6A 5CVRA 5I0SA 4XETA 4JDMA 5FCCA 4XUTA 4XJ8A 2WNUC 4UT5A 1IQDC 3TN92 4GWJA 3GBWA 3VBUC 1GZ9A 1O59A 2BP6A 1L7RA 3J9SA 1F5JA 3V64A 4AAPA 4HN1A 5F6LB 3OGGA 5BNPC 2YY1A 5JPMB 4IE4A 4XDOA 5FJKA 3KF3A 4YG0A 1RJ7A 2V5DA 4CEWA 3BYWA 2R7EB 3RG0A 5HV0A 1V9U1 2WNVB 5KHIA 3GGLA 4Q4Y1 4EE2A 1DLLA 1S0BA 2Q8DA 3EO6A 3ZLIA 3OBZA 5FY7A 1QXRA 3N7LA 4ZZ5A 4UF0B 1JYTA 3RS6A 2DCZA 3NQHA 2WFF3 1W6MB 3OPZA 4R9CA 1PGW1 3DPRC 2YPJA 4TN7A 4CXWA 2E31A 2RJ2A 5K8SA 1DQ0A 4FPLA 2D97A 3VGIA 2GAUA 1W8ZA 4W50A 4WVZA 1QJX2 2SLIA 2QQUA 1JZ7A 1LCLA 4QX8A 4PLNA 2GNMA 5FYTA 5EHDA 4CP2A 4D6QA 1VB4A 1Y4WA 2R1DA 3D0SA 4AGGA 1RYYA 1I5PA 3B7MA 4XF4A 4LNVA 5IK4A 1RUC1 4GIQA 3VUOA 1QF3A 1RUH1 2E33A 3L9JT 1RUF1 3OJBA 1ENRA 5DG2A 3N9QA 1W2TA 2GP5A 4LK6A 1KEXA 5DPNA 1OH4A 4I01A 4DXZA 3FLTA 2J1UA 3CZJA 1WWYA 2Y6HA 3HMYA 5D21A 1R093 4FI9A 2KXLA 4Q8LA 1EY2A 3IM0A 3WDTA 1DYKA 2RDSA 4Q27A 1KFUL 4OHWA 4CCEA 4E9KA 1RUE1 2HWD3 5C5UA 2RM23 4Q4W1 4GJZA 5T3NA 2P3IA 4HVQA 5HPOA 2FDKA 1D4M1 2JECA 2VZRA 3O1UA 1TNFA 1Q8PA 3BKZA 1QIQA 2FHRA 2VNGA 5KXBA 2D40A 3T4HB 1UCXA 5FY0A 4BE3A 3C7GA 3DEMA 3BOWA 3NRUA 5BNNA 3KMHA 1C8M1 2YC4A 5J36A 3A21A 4M3CE 1UY4A 3GYDA 4Z82A 2BYVE 1HB1A 3LSEA 1OA4A 3HJRA 3AKQA 1HV1A 1VBD3 3KLSA 3ZXFA 3IMNA 1JYCA 3MI8A 3NAPB 4Q4V2 5L7OA 3OBAA 1O5UA 3UGGA 4LUKA 5EJZB 4OZXA 3WY6A 4CP0A 4QGMA 5JOWA 2R072 3I59A 3WW2A 4BXFA 4NIIA 1AXZA 5FYSA 5A3UA 3ETQA 2GNDA 2YROA 3NNLA 4XHXA 4XURA 2QNKA 1SEFA 3IMMA 3RZLA 2D7FA 5M0TA 2VOKA 2ZACA 4RHV2 1LHVA 3FHIB 3CJXA 3JBG2 5I0DA 1JI6A 4YG3A 1BCXA 1S2KA 4Q29A 4EWDA 4P08A 2X05A 3PVOA 5LATA 4K6BA 1ZRIA 1H1IA 1SLIA 5DUWA 4FFIA 2A6VA 2LALA 4FTSA 1LECA 1XNAA 1AYN1 2ZEWA 3CL1A 2DCKA 1WD4A 4ZHNA 3VBHB 1QJFA 4LO6B 2XBO3 2NMNA 1TZOA 1C1FA 5FZLA 2A75A 3D6EA 3GBFA 1RHI3 3KV5A 2H0BA 2WWSA 3MFCA 4XJWA 3J7HA 2G19A 1VBA1 2UWAA 5CYYA 5DDJ2 1DYOA 1UKGA 3WEZA 3ZPOA 2E32A 5KXDA 1R64A 3IZOA 3PTRB 1DZRA 3FHQA 4CCMA 3FHAA 2ZJCA 1DGRN 1C1LA 4HVOA 4NHMA 1UOBA 4YVSC 5T52A 2W1SA 3VBFB 4U2AA 4YW5A 1BK0A 2VBBA 1BHGA 1UYZA 3H1WA 4MOAA 4Q4V1 4FOQA 2VOXA 2BWAA 2JDUA 3VBSB 3HT1A 1MACA 3ZFFA 5IYYA 2RE9A 5EYYA 5FBJA 1WBLA 5BNOA 4UW5A 4FOVA 4KGGA 3BI3A 4MLOA 4ISRA 4XILA 3PUSA 4IE7A 5FXZA 5FJHA 1QDOA 1XPWA 5I8TA 1ULDA 3OB8A 4MADA 3USUA 3HNBM 5JOZA 1TMF1 1W99A 3WX5A 2WA4A 1RUD1 4OHXA 1Z7S2 2BTVC 3T1LA 1IQAA 3VBOA 4O9EA 1RUJ2 1RUG1 3AMPA 1QHDA 4OQ8A 3RZMA 4TTGA 3M8LA 3WQ0A 5IAXA 1B35C 3LIGA 1D4M2 2WABA 1F2NA 1A78A 3ACLA 3GCWA 3H50A 3SMHA 2Y60A 3ZYBA 5F3GA 4XAEA 3SNMA 2Y34A 1OT5A 1ACCA 3I2FA 1ULEA 1OQDA 1QJU3 3KVAA 4AI3A 5C8WA 5FTTC 4NIDA 2P2KA 3WLUA 4LBLA 5LA9A 3WUCA 3H8UA 1H2MA 2PYTA 2ERFA 5DAQA 4CCKA 4LKDA 5GALA 4LO7A 1AYM3 3FC0A 4BWOA 5IATA 3VV1A 2EIEA 3N9MA 4QPIC 4JX0A 1Z7S3 2OVUA 2PHLA 4MXWA 2ORZA 2PHUA 2CDPA 1SCRA 2JX9A 2VGDA 3EB7A 3I2GA 1N1SA 4FXKB 4LULA 4N53B 3ZYHA 2IC1A 5ERLA 5BYNA 1ZZBA 4D6SA 4CP9A 5KXEA 1R1A1 3RRDA 5FUNA 5FMBA 5AC91 1POV1 3ZN6B 2VQUA 3KM5A 4S2FA 1DQ4A 4V2VA 5IFPA 3ACHA 4AEDB 4LBQD 4DUXA 3EJKA 4RS5A 2AYHA 5C6CA 4P00B 5B4XA 1JYNA 2BUKA 2HJIA 2VU9A 5T50A 4Q4X1 4JHTA 4K1ZA 4DINB 2FDIA 2XUEA 3NJXA 5IVJA 2DVAA 1H8TB 1W3XA 1K42A 3USUB 2CYFA 1G6NA 1T6GC 1XYOA 5T5JA 3SH5A 3WT3A 4D6RA 1UKRA 3WG1A 2ZEXA 4EV0A 1KDMA 1SG3A 2X10A 4LA3A 4DZGA 5A7WB 3VD4A 4YM0A 4AXOA 2VQAA 3ELNA 2QQNA 4IESA 4LIVA 4EWEA 1ZRCA 4W6WA 3J7LA 2QDRA 4RR3A 1G9BA 3TEXA 1S2BA 1QJX3 1YJKA 3TN93 5A33B 1FMD2 2RM21 2JG9A 4TLGA 1AR82 3LQCA 5SV5A 2OXBA 2Q30A 1NCQB 1QH7A 2TNFA 5BPXA 4COWA 1RMU2 3PVEA 4HPKA 2AEYA 3VBHC 1TNRA 4XTMA 1MQTB 4PHZA 2D3SA 3QLQA 4S2DA 2EIDA 1QWRA 2ZGTA 1GZWA 4XF1A 5IW0A 1YQCA 2VMFA 3ZIXA 2BGCA 1JHNA 1LTEA 2W91A 5FY1A 4AZZA 4E8DA 3A4UA 4WVVA 2AUYA 2FMYA 2BWCA 1FMD3 1W3VA 3TEZA 1EAH1 2RS33 1POV3 2QKDA 1NYWA 2ZCWA 1UMIA 2AC1A 1HDKA 4N53A 4QPYA 2B46X 1XNCA 1V6JA 4CDXC 3GCXA 5HCAA 2W1QA 1VBA3 3AM2A 5ABJA 3K48A 2HBUA 2VQ0A 5FY5A 3WNOA 1AR81 1A34A 3CKHA 2Z2SB 5L7OC 2WWJA 3MUY1 4QX1A 3AMQA 3ES1A 3GNEA 5FBZA 2XJSA 5FMOL 4MH0E 1XNDA 4XUOA 2XVGA 2ZGQA 1IKQA 2X09A 1ZA4A 4LBNA 4L0PA 4LHLA 4LO5B 4XFFA 5BUVA 2GC3A 4V1PA 4UWDA 5E1RA 3RNSA 3WNPA 4Y20A 1LESA 2X5IC 4JRAA 3RYRA 4CP1A 1EAH2 5FWJA 2QZ2A 2LRPA 3VBOC 3RDIA 3RJ2X 5FZOA 5T55A 1I6XA 4CCDA 1QU0A 2PTMA 5F2SA 4Y5SA 4DXSA 5GKAC 2UY8A 3TNPB 2VTXJ 3TYJA 2VOVA 5C7GA 5I0TA 2W92A 1O8PA 2AENA 1W8OA 2ZGUA 3AC0A 5BXXA 2Q1FA 3ECQA 4NROA 3WDYA 1NUKA 1WCSA 1HQNA 2RDNA 3FL7A 3GBGA 4GKXA 2FDHA 2VZTA 1OD3A 1SFYA 2RJLA 3GHMA 3LF7A 2VZQA 4AHYA 1OPMA 1LB2A 3AJYA 5A7PA 1WMXA 2JDMA 1X9TA 3ATGA 4DUVA 2XKOA 2XDVA 1N47A 2OUJA 2Y26A 5I91A 1PM7A 1QH6A 2BGOA 1LGCA 3WQ1A 1HQLA 4PLMA 2JE7A 1NG0A 3H3UA 2BV4A 1JYIA 4FPOB 1OPOA 4L92A 4OUEA 5APAA 5J1XA 3WCSA 5ANQA 1IHMA 3ZYPA 1X36A 1TVGA 2PHDA 1NCRA 4AE2A 3U0ZA 3O1OA 1NX9A 4IUGA 4AEDA 3ZPYA 2CGNA 1YQ8A 2GU9A 4KG8A 4WV8A 3LSDA 4CPBA 2ZGRA 1FPN1 1LOCA 3HNYM 4M3CB 1H30A 1S55A 2E7AA 5DZEA 3VKLA 1WLTA 4NHKA 5FZ3A 5FZ7A 4BOWA 3S5QA 4CDWB 1B35B 4QT6A 1UAIA 5C8CC 4NRPA 2OQ7A 2RMU2 4Q5OA 4BQ5A 3W5NA 2JG9C 4GAZA 4LXLA 5K9YA 3T2TA 2RS11 4WM8B 4EYUA 4GA9A 4S2HA 4IEUA 5EPAA 1QJY2 4FOWA 4BZ4A 5JZGC 3J4UH 4A6OA 2C0ZA 3SKJE 3HVDA 4CEWB 1AJOA 3TRSB 3GJAA 1EYBA 4LOSA 2OZJA 3DXUA 2VJXA 4OI2A 4AL9A 3DKWA 4FQ4A 4QQOA 1Y9QA 1DQ5A 2VH9A 2ZPXA 3VZMA 1O3RA 1W2AX 2YU1A 4LO4B 1W04A 1W90A 3NAPA 1XXNA 1D4M3 5L73A 3POSA 4ASKA 3O7OA 2EICA 4CCNA 1JU4A 1WGPA 2JG8C 1BQPA 4MGYE 1HXS1 3PU8A 3VZJA 2J1SA 1J3PA 3ST7A 3V0AB 1MEC3 4XJAA 4W6YA 3WF0A 4AGVA 3AP9A 1GNZA 2KR2A 4E4HA 1G9DA 1ULOA 5BNNB 3ZXKA 1FXZA 5CADA 3FX3A 4QDRA 1WUVA 4XCAA 3MW3A 1RUD3 4NN0A 3TN91 3FE5A 2KM2A 2VVEA 3H3ZA 3AXDA 3HT2A 3M3IA 1PO23 2FCTA 4Q4X2 4C1WA 4QQHA 1H9WA 1EV12 2W9XA 3ZFEA 1RXGA 5GLZA 1RINA 3PVBB 1AR71 4QDSA 2D3PA 2ZAHA 2HWB3 4AAXA 2YC2A 2B7YA 4JDOA 5T54A 4CEYB 4HANA 1PO11 4IGOA 4YM2A 5BV6A 4YGBA 5LEJA 2RV9A 4BQ1A 3AMHA 4NIHA 3WQ7A 4GZ9A 5H9QA 2E7QA 3IDAA 1FNYA 1QOOA 2C4XA 3LCPA 1ZBE2 5EQUA 3UL2A 1JOPA 2QE3A 4A45A 3PUQA 4KGQA 3AKTA 4BISA 5FXXA 4ASMB 5KHHA 1AL22 1JMUB 4EN7B 4AQ6A 3FUQA 2DTYA 4ZS3A 3D8CA 3HQXA 1VMFA 4P9LA 5CZKA 4YW7A 3VKNA 1DQ1A 4CUGA 5IFTA 1U0AA 4HSLA 3I7DA 2DTWA 1ZBE3 1DCSA 1RHI1 3I2HA 4LPLA 2OYZA 3W9AA 4BQ3A 3C3VA 1ZRFA 1JYXA 3VDDA 4BK4A 5HCFA 4KH9A 2CAUA 5EV7A 4NHLA 5H9SA 5FQ0A 1O8SA 1DFQA 3AXEA 4KG0A 4EN6B 1HRV3 4XMAA 4Q0PA 1ZBA1 5FLHA 2B9UA 3URFA 1DGWX 5LY2A 4XXPA 2DWRA 2NM1A 1GSLA 1HB3A 1GBGA 1N3QA 4YFZA 5FYZA 2W95A 1S0GA 1ZNPA 2HWC3 3CJIB 4PDWC 2X5IA 1F4HA 4NRQA 4U36A 2X29A 3SCGA 5F5AA 2E7TA 2ZS6B 2QFEA 3E97A 1RITA 2WZR1 5JZGB 3I2DA 5F6KA 5LK7B 4CUAA 3MF6A 4GH4B 4R52A 4MXWB 1ODNA 4XIOA 4ZY9A 2A1XA 1UU4A 3KHCA 1EAH3 1NA1C 4ZU5A 3POJA 2HKXA 3POFA 1CIYA 1NZIA 1VBE3 2JE9A 3H42B 3KGZA 3T3YA 4RN5A 3LA3A 4GALA 4Y22B 2XVKA 5I93A 4YYOA 1RUI2 3ILNA 5JIAA 2WUHA 2HWC2 2VVDA 1GP6A 1GOHA 1O4ZA 2VNRA 2RS51 1YJLA 4LHSA 4QB1A 4CA9A 3ZXGA 3LD8A 5A6XA 4GMP0 4Q4W3 2F6BA 2HLEA 5DZFA 1JODA 2QQKA 3KV9A 2V4AA 1X8MA 4KWKA 4B4QA 2GZWA 4HK9A 3M70A 5AVPA 1WA4A 1JZ8A 1OKQA 4YVWA 2VE1A 2DVDA 1HB2A 3A23A 3I2OA 4LBQA 4RQPC 4K3UA 2DV9A 5C70A 1CAUB 4H7MA 4XABA 1US3A 3HQRA 1T2XA 2OW4A 2VMGA 4ORFA 2CHHA 2Y33A 4JCKA 1OF4A 5JCTA 5C3RA 1IPSA 3U78A 3PMEA 4LKFA 5IUQA 5JSOA 4BQYA 1MQTA 3I4IA 4MV2A 1VIWB 3EXUA 3ZR5A 1D0HA 3MLKA 1VBC1 3PNAA 1AXKA 3X29B 1UZWA 3OOXA 3GF6A 4NWWA 1D2SA 5KHGA 1AYM1 2A6YA 3MV01 1UD1A 4QKNA 3O1MA 1ALYA 2VOWA 2GSYA 4PF5A 3VZKA 5FZ9A 1RIRA 4G9SB 3NKTA 3LFMA 2IVJA 3IWZA 2WN2A 1O5LA 4XXAA 1YYNA 4XZUG 3WNMA 2Y8KA 2RS53 3VZOA 5CFDA 5FZEA 3NAPC 4CVUA 5DZGA 4BPZA 3FFZA 2DCJA 2ZX0A 1PK6B 3ZFGB 4AVAA 1SBDA 2WIIB 1BK1A 1FMD1 5IHRA 1LR5A 1CAVB 3DL3A 4F8AA 5TSWA 2YHJA 1UYXA 4FAHA 1J1LA 1AR93 4UFKA 1AF9A 1W9WA 1RXFA 1CZSA 4X6RB 4D3WA 1W0NA 3JB4C 4L97A 1B09A 1A3KA 2VCMA 1D7PM 4A7YA 5LASA 2WBKA 4A3ZA 1QJX1 4XCBA 4Y33A 3VBFC 4XF3A 2DURA 2B5HA 2YMZA 1UY0A 2I74A 3SH3A 1F15A 5FXVA 2ZMNA 1NCQA 4C90A 1LOGA 4QHOA 3KV6A 1STMA 2GN3A 3AL5A 1YNAA 4LJHA 2WZ8A 3VBSC 3MIHA 2GNBA 2OT7A 2VBDA 4LITA 5IVVA 4ZKTB 4CCOA 3K75B 3ZDVA 3WDVA 4D7SA 2HWC1 5IJRA 1RMU3 2W08A 4BDVB 4HZFA 4QQPA 2QCSB 4EN0A 2WKKA 4XTPA 4BLJA 4PIXA 5E6HA 1XSQA 1HW5A 1C8M3 4KNCA 4PLOA 3RWNA 3W59A 2IFRA 2XG3A 3NV2A 4HL0A 1JZ3A 3WF1A 1HN1A 3MPPG 1UIJA 1UZZA 2Q8EA 5AC92 4IE5A 3PL0A 2JB8A 4IEVA 4Q1RA 1LGNA 4S2GA 1Q8QA 4DY3A 1ZREA 3MZHA 1KRIA 1SLAA 1WCQA 1V6IA 3G6JB 4QX5A 2FD8A 3KT1A 4AGRA 4YVSA 3ZKUA 3AZYA 1S0JA 1Q56A 1ULCA 2YBSA 3T08A 4IQPA 5FYUA 1OUXA 4R4ZA 5K4LA 2CY6A 3AMNA 2HEWF 3HIFA 3R05A 5F3CA 2PA7A 2JDHA 2VZSA 4MVTA 1F35A 3LWCA 3Q8CA 4PDWB 4CDQB 4LKEA 2P5BA 2HWE3 4R4XA 5A6YA 4YW2A 4CDWA 3HWJA 1JZ5A 1AR73 2FQPA 3BPSA 5F39A 4GULA 3BB6A 1VBB3 2ADDA 4QDQA 1GZTA 2WC2A 3AP4A 1A8MA 4WM7B 3FN9A 3NVCA 2Z5WA 1H8TA 4IV1B 1GFF2 3FUOA 3ZFGC 1O6UA 2A71A 3MDPA 3WNNA 4QWNA 1SPPB 4W65A 3WF4A 5FP3A 1XOYA 2JDNA 1B35A 2JKXA 2VUAA 1BJQA 3MPBA 1F9KA 1LOBA 3KB5A 4GMP3 4O65A 4ZPIA 4NIAA 1GYKA 3S7EA 3GZUC 5FP9A 2VNOA 2UY9A 3WCRA 2OPKA 2Z69A 4FPYA 3ACFA 1I3HA 4FTEA 2D43A 2R0FA 1WLWA 2BNOA 3ON7A 4RGGA 4BB3A 1GNYA 4QD2A 3LDBA 1Q8SA 1C3HA 4FBFA 3QOPA 5FMCA 4RGAA 2VCBA 4YG6A 3C8XA 5C9AB 1CD3G 1V6LA 2BZDA 1IPJA 1Z78A 4Y1YA 2EAAA 5CKQA 3I3BA 1W2UA 1ND2A 1WMEA 3JZVA 3LOIA 3AYAA 1J59A 4CSWA 1ZZCA 4W8JA 2XXZA 5KR7A 1H6XA 5FREA 3W58A 1LU2A 4FFFA 4I30A 4OUSA 1JW6A 2OIIA 1XYPA 2ARXA 1K5MA 1LOEA 1QXPA 2JICA 3QD6A 3ZSJA 5FPUA 1GP5A 5JR2A 2XLAA 2I45A 3AZXA 2IZWA 4QB2A 5A3WA 4OLLA 2D5HA 1PIV1 3DXTA 1UX6A 2OKXA 1XC6A 5FPZA 3KGLA 3DKQA 4XJZA 5H9PA 1GV9A 3VBUA 1CPMA 5JMOA 3W20A 4QXBA 2XH6A 1U12A 1NLRA 4CDUA 4ATFA 1QJU1 1HIXA 1O4TA 2C6SA 4XUQA 2J1VA 2PLV2 2VMCA 3V0BA 3OPTA 4FPHA 2Y0OA 1KD7A 4QXHA 3ALQA 3NJYA 2F4LA 4OUMA 4HKOA 4I0AA 2XB6C 2WR9A 1VJ2A 1COV1 2A5ZA 4DB5A 4NPLA 4HKLA 2X5IB 5GZGA 5DG1A 1KITA 4LK7A 5A7QA 2H6BA 3SLIA 4NPRA 4DO0A 2D6MA 3DPRA 4IEQA 4RD7A 2XONA 3MYXA 4F7ZA 5AC93 2JD9A 1BMV2 2K46A 5GLTA 1FX5A 1GUIA 3OG2A 2GNTA 1NQDA 1YHFA 4TSVA 4XFGA 2ZTNA 4UOJA 1CESA 1SACA 4WVMB 2WINB 1QKQA 2G1MA 2C5DA 3WF3A 4K40A 2VMEA 4AWDA 4AEKA 5A3TA 5J7MA 5C9AA 1ODMA 2PQSA 3J26N 4HLTA 3LB9A 4META 1SPPA 4B7EA 4UF0A 1Q43A 5A7OA 2YGMA 4CU6A 2DCYA 5DAWA 2A70A 3O1TA 1QJY1 4HKWA 1Y9GA 3ZYFA 5C3SA 5CG8A 1WW7A 2RVAA 5CB7A 3VBFA 3JUUA 4FSJA 2Y6KA 3ZN5A 1VBE2 2PQQA 3ZXDA 3PVNA 4XFIA 1JXNA 3RMXA 1GZCA 1W2NA 1C5IA 4Q8KA 2AACA 1ZZ8A 4XFHA 2Q0AA 5FUPA 1G9CA 1PVC3 1YFWA 1LJ7A 4LT5A 5GLUA 3M3EA 4JKMA 4MSVA 3WNLA 1FPN2 1H8TC 4J6GA 2NYYA 3V56A 4OI0A 1IKPA 2GN7A 4MO3M 2XJUA 2R042 1HX6A 2EXHA 4QM9A 1OFNA 1G7YA 4XQ4A 1D4VB 2IXCA 4KBZA 2QQWA 2CSGA 5HI0A 1YO8A 4RGKA 4XVHA 2ZOEB 4BCUA 2VMHA 3R4DB 3LFIA 5FZDA 4B3NA 2VQTA 2WYFA 2VBPA 3WDXA 2W39A 3AMMA 4JTOA 4N7UA 4W6XA 4XC9A 2BERA 5JDBA 4DRVA 3AP5A 5CISA 3CF6E 2ARAA 3PTYA 5FMOS 1UN1A 5EXOA 5J09A 3OUJA 5B2GB 4AQTA 4YZ2A 1HRV1 3N9OA 4QX7A 5T5LA 3JXSA 2C24A 3JCIA 4C8DA 2BOJA 4N90A 4AW7A 2YYOA 3RGBA 4EWAA 4SLIA 4Y1ZA 2XMLA 4CDQC 4LE3A 2K9ZA 4XHBA 3H7YA 5BNPB 1Y7BA 2BW8A 2NLRA 2PFWA 3QH7A 1ZZ9A 3ZOIA 5C3QA 5FOBB 3VBHA 2B45X 3POEA 1KJLA 1RUG2 1IOAA 2EAKA 3DF0A 4NHYA 3VD9A 3GDBA 5DXDA 3J8F1 1PK6C 1Q5OA 2VXRA 3LDKA 3PLQA 1S0CA 1DP0A 4IDZA 4UFMA 3PJQA 3DYMA 4Q0QA 2HWB2 2BRTA 1K12A 1AX0A 3DCQA 3KQRA 4HOOA 4PBPA 2JG8B 2XUMA 3H8OA 4AEMA 4AFCA 2MHFA 3AVSA 3DECA 4LBQB 4MHUA 4R8HA 5FAXA 4KBBA 4QQ2A 5ABJC 1JU3A 3GZAA 3R0RA 5DDJ3 2VUDA 3I3DA 4CTEA 2XQXA 4FT8A 1RHI2 3ILFA 4QQLA 1GKBA 2RJKA 1L3JA 2C1FA 3OYWA 3EHKA 1MEC2 4NJ4A
chains in the Genus database with same CATH topology
2VL4A 4A6OA 3SKJE 3LPFA 2VJXA 3SEPA 4DXRA 2J1TA 2VO5A 3I97A 3MBWA 3HPNA 4JKKA 2W1UA 3I3EA 2QQOA 4KMQA 1J84A 4E8CA 1JHJA 2YG0A 4MGQA 2EIBA 4CU9A 2EICA 5A1AA 1JU4A 1W9SA 5EJ1B 2J1SA 2YFZA 1W9TA 2B9VA 2VZ3A 3P6BA 3WF0A 1JZ4A 1ULOA 4TXWA 5HXMA 4QDRA 3PUHA 3MUZ1 2ZEYA 2L9LA 1US2A 3THDA 2W9XA 3LE0A 3T2PA 4QDSA 2LS6A 4AAXA 5FUIA 1W8NA 2VZOA 2YC2A 4QAWA 4KI5M 4OMDA 3W5MA 1UZ0A 2RV9A 2W94A 3HEIA 3I2KA 4QX2A 4GZ9A 4KWUA 3IDAA 2C4XA 2W1WA 1SHWB 1NAEA 4A45A 2WDBA 1DLCA 2J1EA 3K4DA 2HYXA 5C71A 1LNSA 3ABZA 2Z4FA 2J1AA 3A7QA 5JXJA 5CZKA 4BJ0A 1UXZA 5IFTA 4A41A 4LPLA 2VZPA 3I2HA 1JYXA 4BK4A 3D3AA 3BGAA 1GU3A 1O8SA 3CZUA 1PMJX 1CZTA 4XUNA 1NKGA 2V4VA 3LPGA 2JE8A 2Y6LA 3ZM8A 3EYPA 2W95A 3OGSA 2BBAA 3HOBA 2JDAA 2WQ8A 1F4HA 1YQ2A 1JYVA 4CUAA 2VM9A 4XUTA 4ZY9A 3T0AA 2CDOA 1IQDC 4GWJA 3ACIA 5DQ0A 1O59A 1CIYA 1L7RA 4RN5A 3VD3A 2V5DA 2R7EB 2WUHA 1GOHA 3GGLA 4LHSA 4QB1A 4ZZ5A 2HLEA 2QQKA 2XHNA 3NQHA 1JZ8A 1JYWA 3CMGA 2W46A 2E31A 2RJ2A 3DYPA 3P1IA 3A23A 4W50A 2C26A 3IB3A 3OEBA 5C70A 4CU7A 1JZ7A 4LQRA 4PT6A 1US3A 1T2XA 4DEVA 1OF4A 1UY2A 1RYYA 1I5PA 3VD5A 2E33A 3WSOA 3IAQA 5DPNA 1KEXA 1OH4A 4QPWA 2J1UA 3CZJA 2VZUA 2Y6HA 3MV01 4FI9A 1CX1A 2J1RA 4ZXEA 1UX7A 2WN2A 3WNMA 2BGPA 4XZUG 2Y8KA 4LKSA 5HPOA 2VZRA 4CVUA 1OF3A 2DCJA 3I2IA 2LW8A 3C7GA 1UMHA 3NRUA 3THCA 5IHRA 1UYXA 2YC4A 3A21A 1UY4A 1MPXA 1W9WA 1CZSA 5F7UA 3T09A 3HJRA 3HN3A 1W0NA 2WN3A 1UWWA 1K3IA 3OBAA 3F2ZA 1D7PM 2W87A 5EJZB 2WBKA 4A3ZA 4UAPA 5LCWL 1UY0A 4XURA 5G05L 4YPJA 3IIIA 3C7FA 5I0DA 1JI6A 2WZ8A 1UY1A 4BK5A 5G04L 4P08A 2X05A 3VDBA 1XNTA 3K75B 4CUCA 5IJRA 2C9KA 3WNKA 4BDVB 2YB7A 1XNAA 2ZEWA 2DCKA 3CDZB 4ZZ8A 2Y6JA 1JZ3A 1EUTA 1KGYA 3OGVA 5CYYA 3WF1A 3WEZA 1HN1A 3J7HA 5DMYA 1DYOA 2E32A 1R64A 2Y64A 4QX3A 3FHQA 3FHAA 4GWIA 4HG6B 1WCQA 3T0BA 2W1SA 3T08A 1BHGA 1UYZA 4MOAA 5IYYA 3WQBA 3MV11 1L7QA 2VZSA 2WO2A 5B4NA 3SEEA 3MO4A 1GOFA 2W5FA 4JHZA 1XPWA 1JZ5A 4RYDA 3OB8A 4MADA 3HNBM 4QDQA 3WF2A 1W99A 3FN9A 4QX0A 3WNNA 4D0QA 1UYYA 2B4KA 3WF4A 3T2QA 4TTGA 3I2JA 3K4AA 3T2OA 1CZVA 2WABA 2JKXA 4P02B 4W4ZA 3UETA 4ET7A 3GM8A 4OZOA 4QB6A 1OT5A 2V72A 3I2FA 3ACFA 4OMCA 2ORXA 3K46A 5JXHA 3ACGA 2ID4A 3C7EA 2Y6GA 1GNYA 2J7MA 1WKYA 2EIEA 4JX0A 2QQJA 3VD7A 2VCBA 2QQLA 3C8XA 2ORZA 2BZDA 2KD7A 2CDPA 3EB7A 3I2GA 2VR4A 2VTFA 2W3JA 3I3BA 4DEQA 5LA0A 5JXIA 4W8JA 1K45A 1H6XA 2VQUA 5IFPA 1ULPA 3ACHA 1PX4A 4DUXA 2YFUA 1JYNA 4P00B 5B4XA 5JR2A 2WZEA 4QB2A 3SKVA 3NJXA 2QBXA 1K42A 4PF1A 2OKXA 1XC6A 4ARXA 5LA1A 2W47A 2ZEXA 5JMOA 1SG3A 2X10A 2VZVA 3VD4A 4DXTA 2WO3A 2QQNA 4XUPA 4XUQA 2J1VA 2VMCA 1JZ6A 4A4AA 3OEAA 3OGRA 3LQCA 2ZEZA 4UI9L 1J83A 4M4PA 4PQQA 2EIDA 2VMFA 2WAOA 3GXUA 3NJVA 2W91A 4E8DA 2XONA 2XOMA 2JD9A 4DUWA 5DN2A 1GUIA 4UOJA 3OG2A 1F4AA 4M4RA 3CQOA 1UMIA 2VZ1A 3WF3A 4P5YA 2VMEA 1PX3A 2WO1A 2W1QA 4JKLA 2PQSA 3WNOA 1P8JA 1TG7A 3CKHA 4CU6A 4CU8A 5EIYB 1SDDB 3MUY1 4QX1A 3U37A 2RVAA 4BXSV 5JXGA 2Y6KA 4XUOA 2X09A 4L0PA 3CIHA 3NNGA 3WNPA 3UNPA 4JKMA 3WNLA 4A42A 5LA2A 4MO3M 3HNMA 4ARYA 3K4ZA 2WYSA 2QQMA 4DXSA 3E1F1 2E26A 5C7GA 2WAAA 2W92A 1O8PA 4Z2AA 4XVHA 1W8OA 3AC0A 1JZ2A 3C7OA 2VQTA 3ECQA 4D8MA 1NUKA 3DYOA 2BERA 3C7HA 3FL7A 3LEIA 3VDAA 2J22A 2VZTA 1OD3A 2VC9A 2ZXQA 2VZQA 3PUIA 3JXSA 1EUUA 4OYUA 1GOGA 1GQPA 4AG4A 2VMDA 4DUVA 3A22A 1UY3A 3IAPA 2BGOA 1H6YA 2DDUA 2VCAA 3VD9A 3GDBA 4OUEA 3LEKA 3LEGA 1DP0A 3UESA 5J1XA 2VCCA 3DYMA 3ETPA 1TVGA 1K12A 1NX9A 4IUGA 3VDCA 3T0DA 1UXXX 4CUBA 2QQIA 2VOTA 3HNYM 3K77A 3DECA 1GMMA 1JU3A 5JUVA 3I3DA 4A44A 2XQXA 3BN6A 3W5NA 4MGSA 1PMHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL4 A;  4A6O A;  3SKJ E;  3LPF A;  2VJX A;  3SEP A;  4DXR A;  2J1T A;  2VO5 A;  3I97 A;  3MBW A;  3HPN A;  4JKK A;  2W1U A;  3I3E A;  2QQO A;  4KMQ A;  1J84 A;  4E8C A;  1JHJ A;  2YG0 A;  4MGQ A;  2EIB A;  4CU9 A;  2EIC A;  5A1A A;  1JU4 A;  1W9S A;  5EJ1 B;  2J1S A;  2YFZ A;  1W9T A;  2B9V A;  2VZ3 A;  3P6B A;  3WF0 A;  1JZ4 A;  1ULO A;  4TXW A;  5HXM A;  4QDR A;  3PUH A;  3MUZ 1;  2ZEY A;  2L9L A;  1US2 A;  3THD A;  2W9X A;  3LE0 A;  3T2P A;  4QDS A;  2LS6 A;  4AAX A;  5FUI A;  1W8N A;  2VZO A;  2YC2 A;  4QAW A;  4KI5 M;  4OMD A;  3W5M A;  1UZ0 A;  2RV9 A;  2W94 A;  3HEI A;  3I2K A;  4QX2 A;  4GZ9 A;  4KWU A;  3IDA A;  2C4X A;  2W1W A;  1SHW B;  1NAE A;  4A45 A;  2WDB A;  1DLC A;  2J1E A;  3K4D A;  2HYX A;  5C71 A;  1LNS A;  3ABZ A;  2Z4F A;  2J1A A;  3A7Q A;  5JXJ A;  5CZK A;  4BJ0 A;  1UXZ A;  5IFT A;  4A41 A;  4LPL A;  2VZP A;  3I2H A;  1JYX A;  4BK4 A;  3D3A A;  3BGA A;  1GU3 A;  1O8S A;  3CZU A;  1PMJ X;  1CZT A;  4XUN A;  1NKG A;  2V4V A;  3LPG A;  2JE8 A;  2Y6L A;  3ZM8 A;  3EYP A;  2W95 A;  3OGS A;  2BBA A;  3HOB A;  2JDA A;  2WQ8 A;  1F4H A;  1YQ2 A;  1JYV A;  4CUA A;  2VM9 A;  4XUT A;  4ZY9 A;  3T0A A;  2CDO A;  1IQD C;  4GWJ A;  3ACI A;  5DQ0 A;  1O59 A;  1CIY A;  1L7R A;  4RN5 A;  3VD3 A;  2V5D A;  2R7E B;  2WUH A;  1GOH A;  3GGL A;  4LHS A;  4QB1 A;  4ZZ5 A;  2HLE A;  2QQK A;  2XHN A;  3NQH A;  1JZ8 A;  1JYW A;  3CMG A;  2W46 A;  2E31 A;  2RJ2 A;  3DYP A;  3P1I A;  3A23 A;  4W50 A;  2C26 A;  3IB3 A;  3OEB A;  5C70 A;  4CU7 A;  1JZ7 A;  4LQR A;  4PT6 A;  1US3 A;  1T2X A;  4DEV A;  1OF4 A;  1UY2 A;  1RYY A;  1I5P A;  3VD5 A;  2E33 A;  3WSO A;  3IAQ A;  5DPN A;  1KEX A;  1OH4 A;  4QPW A;  2J1U A;  3CZJ A;  2VZU A;  2Y6H A;  3MV0 1;  4FI9 A;  1CX1 A;  2J1R A;  4ZXE A;  1UX7 A;  2WN2 A;  3WNM A;  2BGP A;  4XZU G;  2Y8K A;  4LKS A;  5HPO A;  2VZR A;  4CVU A;  1OF3 A;  2DCJ A;  3I2I A;  2LW8 A;  3C7G A;  1UMH A;  3NRU A;  3THC A;  5IHR A;  1UYX A;  2YC4 A;  3A21 A;  1UY4 A;  1MPX A;  1W9W A;  1CZS A;  5F7U A;  3T09 A;  3HJR A;  3HN3 A;  1W0N A;  2WN3 A;  1UWW A;  1K3I A;  3OBA A;  3F2Z A;  1D7P M;  2W87 A;  5EJZ B;  2WBK A;  4A3Z A;  4UAP A;  5LCW L;  1UY0 A;  4XUR A;  5G05 L;  4YPJ A;  3III A;  3C7F A;  5I0D A;  1JI6 A;  2WZ8 A;  1UY1 A;  4BK5 A;  5G04 L;  4P08 A;  2X05 A;  3VDB A;  1XNT A;  3K75 B;  4CUC A;  5IJR A;  2C9K A;  3WNK A;  4BDV B;  2YB7 A;  1XNA A;  2ZEW A;  2DCK A;  3CDZ B;  4ZZ8 A;  2Y6J A;  1JZ3 A;  1EUT A;  1KGY A;  3OGV A;  5CYY A;  3WF1 A;  3WEZ A;  1HN1 A;  3J7H A;  5DMY A;  1DYO A;  2E32 A;  1R64 A;  2Y64 A;  4QX3 A;  3FHQ A;  3FHA A;  4GWI A;  4HG6 B;  1WCQ A;  3T0B A;  2W1S A;  3T08 A;  1BHG A;  1UYZ A;  4MOA A;  5IYY A;  3WQB A;  3MV1 1;  1L7Q A;  2VZS A;  2WO2 A;  5B4N A;  3SEE A;  3MO4 A;  1GOF A;  2W5F A;  4JHZ A;  1XPW A;  1JZ5 A;  4RYD A;  3OB8 A;  4MAD A;  3HNB M;  4QDQ A;  3WF2 A;  1W99 A;  3FN9 A;  4QX0 A;  3WNN A;  4D0Q A;  1UYY A;  2B4K A;  3WF4 A;  3T2Q A;  4TTG A;  3I2J A;  3K4A A;  3T2O A;  1CZV A;  2WAB A;  2JKX A;  4P02 B;  4W4Z A;  3UET A;  4ET7 A;  3GM8 A;  4OZO A;  4QB6 A;  1OT5 A;  2V72 A;  3I2F A;  3ACF A;  4OMC A;  2ORX A;  3K46 A;  5JXH A;  3ACG A;  2ID4 A;  3C7E A;  2Y6G A;  1GNY A;  2J7M A;  1WKY A;  2EIE A;  4JX0 A;  2QQJ A;  3VD7 A;  2VCB A;  2QQL A;  3C8X A;  2ORZ A;  2BZD A;  2KD7 A;  2CDP A;  3EB7 A;  3I2G A;  2VR4 A;  2VTF A;  2W3J A;  3I3B A;  4DEQ A;  5LA0 A;  5JXI A;  4W8J A;  1K45 A;  1H6X A;  2VQU A;  5IFP A;  1ULP A;  3ACH A;  1PX4 A;  4DUX A;  2YFU A;  1JYN A;  4P00 B;  5B4X A;  5JR2 A;  2WZE A;  4QB2 A;  3SKV A;  3NJX A;  2QBX A;  1K42 A;  4PF1 A;  2OKX A;  1XC6 A;  4ARX A;  5LA1 A;  2W47 A;  2ZEX A;  5JMO A;  1SG3 A;  2X10 A;  2VZV A;  3VD4 A;  4DXT A;  2WO3 A;  2QQN A;  4XUP A;  4XUQ A;  2J1V A;  2VMC A;  1JZ6 A;  4A4A A;  3OEA A;  3OGR A;  3LQC A;  2ZEZ A;  4UI9 L;  1J83 A;  4M4P A;  4PQQ A;  2EID A;  2VMF A;  2WAO A;  3GXU A;  3NJV A;  2W91 A;  4E8D A;  2XON A;  2XOM A;  2JD9 A;  4DUW A;  5DN2 A;  1GUI A;  4UOJ A;  3OG2 A;  1F4A A;  4M4R A;  3CQO A;  1UMI A;  2VZ1 A;  3WF3 A;  4P5Y A;  2VME A;  1PX3 A;  2WO1 A;  2W1Q A;  4JKL A;  2PQS A;  3WNO A;  1P8J A;  1TG7 A;  3CKH A;  4CU6 A;  4CU8 A;  5EIY B;  1SDD B;  3MUY 1;  4QX1 A;  3U37 A;  2RVA A;  4BXS V;  5JXG A;  2Y6K A;  4XUO A;  2X09 A;  4L0P A;  3CIH A;  3NNG A;  3WNP A;  3UNP A;  4JKM A;  3WNL A;  4A42 A;  5LA2 A;  4MO3 M;  3HNM A;  4ARY A;  3K4Z A;  2WYS A;  2QQM A;  4DXS A;  3E1F 1;  2E26 A;  5C7G A;  2WAA A;  2W92 A;  1O8P A;  4Z2A A;  4XVH A;  1W8O A;  3AC0 A;  1JZ2 A;  3C7O A;  2VQT A;  3ECQ A;  4D8M A;  1NUK A;  3DYO A;  2BER A;  3C7H A;  3FL7 A;  3LEI A;  3VDA A;  2J22 A;  2VZT A;  1OD3 A;  2VC9 A;  2ZXQ A;  2VZQ A;  3PUI A;  3JXS A;  1EUU A;  4OYU A;  1GOG A;  1GQP A;  4AG4 A;  2VMD A;  4DUV A;  3A22 A;  1UY3 A;  3IAP A;  2BGO A;  1H6Y A;  2DDU A;  2VCA A;  3VD9 A;  3GDB A;  4OUE A;  3LEK A;  3LEG A;  1DP0 A;  3UES A;  5J1X A;  2VCC A;  3DYM A;  3ETP A;  1TVG A;  1K12 A;  1NX9 A;  4IUG A;  3VDC A;  3T0D A;  1UXX X;  4CUB A;  2QQI A;  2VOT A;  3HNY M;  3K77 A;  3DEC A;  1GMM A;  1JU3 A;  5JUV A;  3I3D A;  4A44 A;  2XQX A;  3BN6 A;  3W5N A;  4MGS A;  1PMH X; 
#chains in the Genus database with same CATH topology
 1ZBA 2;  4ATE A;  3LPF A;  3SCH A;  2R0H A;  1VBA 2;  5DDJ 1;  1C8N A;  2IUW A;  1BXH A;  3RFR A;  5AFB A;  1XSR A;  1S0D A;  4DXR A;  3LEM A;  3JQX A;  3MID A;  1HRI 1;  2P4E A;  1VRH 3;  2OS2 A;  1RTV A;  2D6K A;  4QPG A;  5FY9 A;  4ZS2 A;  5L19 A;  4MG2 A;  3I3E A;  4NAM A;  3VHP A;  2WQ4 A;  1RVF 1;  1JHJ A;  1YXW A;  2Q4S A;  4P14 A;  4D94 A;  2YG0 A;  4MGQ A;  4C0H A;  5I8Y A;  1JN2 P;  3ZIW A;  2JIJ A;  2YV8 A;  4BA6 A;  5EJ1 B;  1OUS A;  3EQE A;  4Q0V A;  5FZ8 A;  4YAR A;  5CFD B;  5FO9 B;  1RJ8 A;  2YFZ A;  4WBB A;  1EPW A;  1W9T A;  2B9V A;  1DQ2 A;  4Y1U A;  4HMZ A;  3P6B A;  3FJS A;  1JOB A;  3H0O A;  4N43 B;  1N1V A;  4TXW A;  5HXM A;  2XGX A;  3F95 A;  3RYK A;  1W0P A;  4BQX A;  5BNO B;  1OUR A;  1QNY A;  4IV3 B;  4ZXK A;  3PUH A;  4R9D A;  4B7K A;  5LBB A;  1VRH 2;  5FZK A;  4GB3 2;  3MUZ 1;  4A6S A;  3LA2 A;  5SV8 A;  1ZM1 A;  2ZEY A;  5A1L A;  1US2 A;  1DBN A;  1LHW A;  1X33 A;  3JBG 1;  3KT4 A;  1JS9 A;  2DFB A;  2QZ3 A;  4KWJ A;  3SH4 A;  2DUP A;  4RHV 1;  3LE0 A;  4COY A;  4YW4 A;  1NOV A;  4QPI A;  1VMJ A;  5A32 A;  2BVV A;  4QMA A;  4Q26 A;  5A3M A;  3O12 A;  3S30 A;  4ASL A;  4XF9 A;  4CRQ A;  2GAL A;  4AVS A;  4OMD A;  4B29 A;  3W5M A;  1RB8 G;  1HKD A;  2JKB A;  4L11 A;  4HXC A;  3HEI A;  3SHR A;  1RUG 3;  1RUE 3;  2XR4 A;  4CYD A;  4M0H A;  1NAE A;  1RL3 A;  2WDB A;  3MW2 A;  2E63 A;  2WS9 2;  4IXL A;  4X8N A;  2YGL A;  4RS5 C;  2J1E A;  3OYW B;  2HYX A;  3D5O A;  4N8M A;  3ABZ A;  2JDZ A;  3DUI A;  1OLQ A;  2J1A A;  2A3W A;  2CNA A;  1QMJ A;  4FTB A;  3A7Q A;  5GJ6 A;  3D4K A;  3MIE A;  5JXJ A;  4BJ0 A;  4YNI A;  5EZW A;  1TME 3;  4A41 A;  1OVP A;  2B39 A;  2WL1 A;  3OGJ A;  5IT6 A;  5C8C A;  4ISQ A;  3D3A A;  2D6L X;  1WZX A;  4CDQ A;  4OHV A;  4YFW A;  3ZXJ A;  3VL8 A;  1JH5 A;  2AZ5 A;  5FPA A;  2JDP A;  3R4U A;  2CV6 A;  1G9F A;  4I09 A;  2WNU A;  4B4P A;  2DVG A;  1XE8 A;  3TWI A;  5JSR A;  1O3T A;  1BMV 1;  4A7K A;  2BQP A;  3VDD B;  2ZHL A;  4YVS B;  5A1F A;  5FV3 A;  2DVF A;  1OLR A;  1ZZ7 A;  1NKG A;  5CFC B;  3KCC A;  1LHO A;  5F3I A;  2XHK A;  4IEZ A;  1RUJ 1;  3OD0 A;  5HCB A;  3WHT A;  2Y6L A;  4BME A;  1NXD 1;  5LRR A;  1YFU A;  2I07 B;  1PMI A;  5L9V A;  1DQ6 A;  2JD4 A;  1OHF A;  3EYP A;  4A7Z A;  2ZA9 A;  3OGS A;  5ACA 1;  3FLR A;  4K7J A;  2ZAB A;  5FMD A;  2YU2 A;  4ZU4 A;  1RUJ 3;  4Z2W A;  2G9F A;  5F5Q A;  5E88 A;  3HAG A;  1RUN A;  4YLZ A;  3NO8 A;  1O3Q A;  4XQW A;  1V70 A;  4LMF A;  1MZE A;  3M3O A;  4M0N A;  2BBV A;  5DQ0 A;  5CG9 A;  4L2N A;  2HWD 2;  1A6C A;  4UFH A;  5I8S A;  2EXJ A;  2YBK A;  3I8T A;  2CL2 A;  3KHB A;  4BQ2 A;  5A3P A;  4OHY A;  4L99 A;  5FY8 A;  4JGZ C;  1D2Q A;  5CAZ A;  3P5B A;  1ZZ6 A;  2PEL A;  2ZAA A;  1SLB A;  4I0W B;  4LOR A;  4OCT A;  3S0M A;  4YW6 A;  4FPE A;  5K0U C;  2HWE 1;  1R08 3;  3O0V A;  1MVQ A;  4WZC A;  1PK6 A;  1RVF 3;  4NHX A;  2XHN A;  1YWK A;  2CGP A;  1BKZ A;  2ZGL A;  3CMG A;  2W46 A;  1IS4 A;  3DYP A;  1OA2 A;  1UU6 A;  1YC6 1;  1SDW A;  2OA2 A;  4Y22 A;  3IB3 A;  3OEB A;  4GWM A;  1RUH 3;  1KJR A;  4FP3 A;  4NRM A;  4CU7 A;  4F83 A;  4PT6 A;  3UKV A;  5IAV A;  1QQP 3;  3FBM A;  1UMZ A;  1UY2 A;  3O1P A;  4N9I A;  4CEW C;  2A6X A;  2RHP A;  1MS8 A;  3TOJ A;  3IN9 A;  3JD7 2;  1LEN A;  5FRA A;  3VD5 A;  2CAV A;  4E4D X;  2E53 A;  3IAQ A;  3JBG 3;  1CR7 A;  2HWD 1;  3AYE A;  3FBY A;  5IVF A;  4UFL A;  3TEY A;  1VBE 1;  1UZV A;  2XJQ A;  4YM1 A;  1HRI 2;  2ZHN A;  4LE4 A;  3H8X A;  4BHP A;  2VZU A;  3BVC A;  5FYH A;  2GH8 A;  4N9H A;  1UYP A;  2PLV 3;  5A32 B;  2Y0I A;  2BPA 2;  2J1R A;  3WVJ A;  3EBR A;  3ILR A;  3VHO A;  2QUO A;  4K9S A;  4LKS A;  4Y1X A;  1R1A 3;  2YDE A;  2R6Q A;  2RR1 2;  3CBN A;  1OF3 A;  3RI8 A;  3T1M A;  5LY1 A;  3BTY A;  3U1X A;  1VBD 1;  3E6C C;  3O1S A;  1OOP A;  2IXK A;  3VN4 A;  3I2I A;  2LW8 A;  4Y3O A;  3I3M A;  4FAG A;  5FPX A;  1UMH A;  2WFF 1;  3AYD A;  1WW5 A;  4QPG C;  1CAW A;  1RUF 2;  3HBZ A;  3KWV A;  2FDG A;  1DGL A;  1XNB A;  1BEV 2;  1RUC 2;  1VB2 A;  2G9G A;  2DFC A;  1MPX A;  1TME 1;  2WNO A;  1ONA A;  1QJE A;  5F7U A;  5C4W C;  3VKO A;  4N43 C;  2ZGK A;  2WN3 A;  2O14 A;  5FZG A;  1SQ4 A;  1T6B X;  4NO4 A;  2O0O A;  4CEY C;  3ZYG A;  3KF5 A;  3N9P A;  4MHR A;  3DV8 A;  2O8Q A;  1CGP A;  3OBR A;  4AVT A;  5C3P A;  4MX3 A;  1AXY A;  2WQZ C;  3J7N A;  4XFB A;  2ATF A;  1QJU 2;  3IT8 A;  4UAP A;  5I0R A;  2R06 1;  5LCW L;  2EVX A;  4GJY A;  2V73 A;  1UOF A;  3BOD A;  3QAC A;  3ORJ A;  4J1X A;  2WNV C;  1YLL A;  2DU1 A;  5G05 L;  4IL7 A;  1OXC A;  3A0K A;  1CJP A;  5E8A A;  3III A;  4YZ3 A;  1BEV 3;  2VG9 A;  1TMF 3;  3C7F A;  3WG2 A;  1PVC 1;  2Q1M A;  2DVB A;  4IET A;  3ZN4 A;  1J58 A;  3ME2 A;  4BK5 A;  5G04 L;  4K8R B;  4UBG A;  4JRL A;  1C28 A;  1HB4 A;  4IEO A;  3WNK A;  3VBR C;  2P1B A;  2YB7 A;  3NV4 A;  2DBN A;  4QXC A;  3WZ1 A;  3RI9 A;  1WW4 A;  3JQW A;  2BU9 A;  2TBV A;  3B01 A;  2RS1 3;  1NY7 1;  3PIJ A;  3ZMN A;  4I3P A;  2Y6J A;  1UPS A;  4Q4Y 2;  3OGV A;  2OZ6 A;  5DMY A;  1PZ8 A;  5FIX A;  4MGT A;  3DN7 A;  2WJS A;  2HWF 2;  1I5Z A;  4YGC A;  1TME 2;  4AF9 A;  3KCX A;  4GWI A;  3WP3 A;  3U11 A;  4HG6 B;  4OI1 A;  2R32 A;  3T0B A;  2JIG A;  2R06 2;  2VUJ A;  5F3E A;  3ZSL A;  3VBR B;  2CWS A;  2MPF A;  2FCV A;  2F4P A;  4Y20 B;  2RDR A;  4RS5 B;  2XJR A;  2O1Q A;  1Q3E A;  4Z07 A;  3WQB A;  4XAA A;  1W39 A;  1NT0 A;  1RGS A;  1H1A A;  5B4N A;  4B1M A;  3M2M A;  5A7W A;  3SEE A;  3KZ4 C;  5DUU A;  2W5F A;  4JHZ A;  4Y4Y A;  3N9N A;  1WD3 A;  5K7P A;  2ET7 A;  5H9R A;  3WF2 A;  1S2E A;  3WDU A;  4CE8 A;  1COV 2;  2ET1 A;  4IEW A;  4FOY A;  3L2Y A;  4TZD A;  4MGI E;  4QX0 A;  4DNY A;  4D0Q A;  1POV 0;  1UYY A;  2B4K A;  3SXW A;  1QQP 1;  1BVP 1;  1UU5 A;  2GMM A;  4FXG B;  1Q8O A;  2JXA A;  3PU3 A;  3I2J A;  4P9X A;  5CNA A;  1SFP A;  3TEW A;  5FK7 A;  3J7M A;  1U5X A;  1XNK A;  4P02 B;  5FKB A;  4GH4 A;  1FT9 A;  3CU7 A;  3IBM A;  4OZO A;  4P9J A;  4XBN A;  2V72 A;  1OLM E;  5BNO C;  1V00 A;  3Q9O A;  1PM4 A;  3VKF C;  4OMC A;  2X53 S;  5T5P A;  5J37 A;  2ORX A;  3K46 A;  2PHF A;  3ZXE A;  2ID4 A;  4HFS A;  4O9G A;  3C7E A;  3IPV B;  2J7M A;  2P3J A;  1WKY A;  4YGD A;  1GLH A;  3SIT A;  2R30 A;  4Y1V A;  1REF A;  1X50 A;  2QQJ A;  2WRA A;  3VD7 A;  2QQL A;  4IEX A;  2MNG A;  4OI4 A;  2KD7 A;  2ZML A;  4YW1 A;  1RUO A;  5FYI A;  1BVV A;  1C57 A;  4AFA A;  4IE0 A;  3H3L A;  4JGZ A;  4MGK E;  2HWE 2;  2YXS A;  1X9P A;  5FP8 A;  5FO8 B;  5LA0 A;  2FDJ A;  5JXI A;  1OH3 A;  4XOG A;  1VBB 2;  4H7L A;  2A7A A;  4Q2F A;  2JB4 A;  1ND3 A;  3ASI A;  1PX4 A;  2D93 A;  4PDW A;  4Q1P A;  5F32 A;  5JSP A;  1N1Y A;  5HCH A;  5FQ0 B;  4GWN A;  3O1R A;  3N3H A;  3VLB B;  1BYH A;  1YIF A;  3WG4 A;  4CZS A;  3S7I A;  3MLL A;  4J25 A;  2HH9 A;  3SKV A;  1FPN 3;  4WM7 A;  3WW3 A;  2QBX A;  4PF1 A;  1DG6 A;  3RVH A;  3VZN A;  1FAT A;  1HXS 3;  1UF2 C;  4ARX A;  4BIF A;  1EP0 A;  1GWM A;  5CA6 A;  3BPZ A;  2Q8C A;  2W47 A;  1N3O A;  1SZB A;  4JDN A;  3UGF A;  3WHU A;  4BMB A;  1R09 1;  1EV1 1;  1PO2 2;  2SBA A;  4IW3 A;  4Q4X 3;  4XUP A;  3BIW E;  4AI9 A;  4CDU C;  2DYC A;  5GZC A;  1JZ6 A;  4BQ4 A;  2VW2 A;  2RDQ A;  1PZ7 A;  3KVB A;  3RWK X;  4A4A A;  4AI8 A;  3ZFF B;  4YZ1 A;  1YEW A;  3KCY A;  4PCR A;  1HLC A;  1HRI 3;  2Q5T A;  3POY A;  2ZEZ A;  5FZH A;  4EZ4 A;  1AX2 A;  1KFX L;  1V6K A;  3LGR A;  5DAV A;  4E2Q A;  3G7D A;  4XJ9 A;  1TEI A;  3P3N A;  2WFP A;  1L7L A;  4M4P A;  5BNQ A;  2GC1 A;  1CAX B;  5L9R A;  4Q4W 2;  3ZO0 B;  3GXU A;  5LEK A;  2XOM A;  4NWV A;  4R9A A;  2N7G A;  5JIU A;  4UFI A;  1CQ9 A;  3S5A A;  5FZC A;  1F4A A;  1AJK A;  3GZE A;  1TQ5 A;  3MGU A;  1IG3 A;  2GMP A;  3O0W A;  4M4R A;  5GZF A;  4C1X A;  1C8M 2;  1YFY A;  3RZK A;  1W9Y A;  3IKW A;  4YRD A;  2VZ1 A;  4WVW A;  3GAL A;  4P5Y A;  5FYV A;  4BU2 A;  5FWE A;  5KC5 A;  1PX3 A;  1XE0 A;  3M1H A;  2VXJ A;  2WO1 A;  2H6C A;  1AL0 G;  2WT0 A;  1PIV 3;  4JKL A;  5C4W A;  1W8T A;  5C9A C;  3WNX A;  3S57 A;  1ND3 B;  3WD5 A;  2LM3 A;  1N1T A;  3T30 A;  5EIY B;  1YI9 A;  3KS7 A;  1CPN A;  3ROU A;  4C91 A;  5FZI A;  3SC7 X;  3CNA A;  5FLI A;  3AKS A;  3AP7 A;  1PO2 1;  3U37 A;  4BXS V;  2RMU 3;  1E57 A;  4AR2 A;  2D3R A;  5BNP A;  4XF0 A;  5IK7 A;  1LU1 A;  1H2L A;  1SMV A;  1DIW A;  4M3C A;  1W6M A;  4YGE A;  5EWS A;  3NNG A;  4CEY A;  1NA1 B;  1RUC 3;  1QXJ A;  2CTV A;  3BOP A;  3OY8 A;  5LZ6 A;  5FYY A;  3UNP A;  4BLI A;  1S0F A;  1AVB A;  3IPV A;  5GLW A;  2W52 A;  3PDQ A;  3ZSM A;  1OVS A;  1PNF A;  3VL9 A;  1N3P A;  1OC1 A;  2NQY A;  2W2I A;  1UO9 A;  4N53 C;  1FV2 A;  4QXK A;  4OUL A;  2BEO A;  2OUH A;  3AX4 A;  4A42 A;  4FPK A;  3LOB A;  3MIB A;  2ARB A;  2WYS A;  4P9G A;  1AR7 2;  4JAA A;  2QQM A;  3E1F 1;  2PHW A;  4R9B A;  1NY7 2;  1UOG A;  4D7T A;  2LUW A;  2WAA A;  5AFE A;  4QKB A;  1CAX A;  4Y5Z 0;  4I3G A;  2WT1 A;  1Y3T A;  1OA3 A;  1XQN A;  5FO7 B;  3JB8 A;  5FOJ B;  3C7O A;  3FFQ A;  3Q8B A;  4D8M A;  2PAE A;  1MVE A;  3DYO A;  3C7H A;  1W8U A;  3LEI A;  3WP5 A;  3RZG A;  3VDA A;  1PO1 2;  3H1Y A;  4IGQ A;  1F8V A;  1WLC A;  4XFA A;  1O4Y A;  1IGO A;  1KS5 A;  5A80 A;  2VC9 A;  4OFG A;  1E5I A;  1URX A;  1RUI 1;  4PBO A;  1EUU A;  1H9P A;  3N35 A;  4I0B A;  1GOG A;  4OYU A;  5EJ3 A;  1WCU A;  4GB3 1;  2VMD A;  3WXP A;  4AG4 A;  3UV9 A;  4QU1 A;  3A22 A;  1UY3 A;  5F1R A;  1PGS A;  4H14 A;  5FK8 A;  1H6Y A;  5CEH A;  2ZKL A;  2PHR A;  3PJY A;  4BIO A;  1MS5 A;  3A0N A;  1QNW A;  3LEG A;  5JOX A;  2NMO A;  3BU7 A;  3AZZ A;  1YCI A;  2VCC A;  4LLF A;  3ETP A;  5LK5 A;  3ZYI B;  4XMI A;  3VDC A;  3T0D A;  3NNJ A;  1UXX X;  1OMI A;  4UYB A;  2QQI A;  4CUB A;  1BEV 1;  4YM3 A;  2VOT A;  5E89 A;  2A6W A;  3TB0 A;  1AL2 3;  1NLS A;  3TAY A;  2HEV F;  4QKD A;  4OQ9 A;  1W6P B;  2WT2 A;  4GMP 1;  4RQP B;  3L2H A;  1GMM A;  1LKN A;  4KU7 A;  2BFU L;  3N7J A;  3PIG A;  5JUV A;  2JG8 A;  1MS3 A;  3BN6 A;  1EPZ A;  2ZKN A;  3IIA A;  2EIG A;  2GME A;  2UWC A;  2PHT A;  4HET A;  1GAN A;  4MGS A;  5CIR A;  5HXV A;  4Z92 B;  5A70 A;  2E9Q A;  1PMH X;  5F2W A;  1Q8V A;  4HPK B;  3ITQ A;  4JZR A;  4XYX A;  3PUA A;  4B1L A;  4GH4 C;  3NMB A;  1RC6 A;  2XLG A;  2R49 A;  5A33 A;  3RZH A;  3SEP A;  4UFJ A;  2VO5 A;  4AFB A;  1GQH A;  2FBE A;  1UNB A;  4GB3 3;  5FZB A;  1U5I A;  4FQZ A;  1C4R A;  3CJI A;  2RS3 2;  4B8E A;  1YFX A;  3HPN A;  1W6N A;  4JKK A;  2W1U A;  3DPR B;  5FPV A;  1FOD 2;  1GZW B;  2QQO A;  2WLQ A;  1J84 A;  5IVY A;  4XIK A;  2WSV A;  4CPB D;  4NR1 A;  1ND3 C;  5A7S A;  4BM8 A;  1J3R A;  3UJQ A;  2WA3 A;  4JGY A;  4V2W A;  5A1A A;  2RS5 2;  5A3O A;  5FZO B;  1GIC A;  4KQ7 A;  1BBT 1;  1ZBE 1;  3TNQ A;  4WM7 C;  4K1Y A;  2DUQ A;  3VB9 A;  3UK9 A;  1JZ4 A;  2CU5 A;  1S1A A;  4CDU B;  2G9Z A;  1A8D A;  2ZZQ A;  5ABJ B;  4RL7 A;  1VAM A;  4M01 A;  2D6O X;  1XU2 A;  5C5T A;  5FYC A;  5FZF A;  5FZA A;  1AR9 2;  1CIW A;  2W0X A;  5FPB A;  3AK0 A;  1VBC 3;  1WMF A;  2L9L A;  5FKC A;  1APN A;  3I3Q A;  3ZKY A;  1DYP A;  4KWL A;  4AHZ A;  2P34 A;  1NLQ A;  5KBF A;  3PHM A;  1VRB A;  4LA2 A;  3T2P A;  5LW9 A;  3MW4 A;  2VUL A;  1VBB 1;  2IXI A;  2PAK A;  1O7F A;  2R06 3;  3VDD C;  5D8A B;  4FPF A;  3ZFF C;  1HJF A;  3NWK A;  1ASJ 3;  1K5M B;  2DBI A;  2MEV 3;  4QAW A;  1UZ0 A;  5A3N A;  2W94 A;  1UOJ A;  3I2K A;  5C8C B;  4RQP A;  4EZH A;  2NPI A;  2VVF A;  4H55 A;  2RS3 1;  3FWE A;  2W1W A;  3POW A;  3ENR A;  3Q8E A;  1SHW B;  4PJY A;  3POI A;  1Z7S 1;  3R6S A;  4DQA A;  1LRH A;  3BTA A;  1NE6 A;  1HXS 2;  1ZX5 A;  2RR1 1;  3K4D A;  5FP4 A;  1DHK B;  1LNS A;  1REE A;  4XBL A;  1VMH A;  2Z4F A;  5JAX A;  2EF6 A;  1M4W A;  4YWA A;  1I1E A;  2BFU S;  1VAK A;  2XBO 1;  3NKG A;  1CAU A;  4HN0 A;  5LRS A;  1GR3 A;  3ZFE C;  5EFU A;  2WS9 3;  1MS9 A;  1UXZ A;  4GXL A;  1MEC 1;  4FVV A;  2VZP A;  1LOA A;  1OQE A;  3NST A;  3R4S A;  1H4H A;  4O7X A;  4PIY A;  4YVW B;  2XL9 A;  1ENS A;  4NPM A;  4ERO A;  2XQR A;  1WMD A;  2UU8 A;  2ZX3 A;  1GU3 A;  4D69 A;  1QEX A;  1Y43 B;  4G3Y C;  4LIU A;  5JOY A;  1IS6 A;  3JD7 1;  5J48 A;  2WLP A;  4FFG A;  1FAY A;  1PMJ X;  2C9A A;  1ENQ A;  3OUH A;  3VBO B;  5CFD C;  1CZT A;  4M3C F;  4AI2 A;  1DU3 D;  2HBT A;  2BNM A;  3MIF A;  3OCP A;  4IE6 A;  4RA0 A;  4H2A A;  3LIH A;  3U10 A;  1VBD 2;  3WW4 A;  2UUR A;  3QCW A;  2VEC A;  1H4G A;  1FYU A;  1NZC A;  1X8E A;  3WDW A;  4COU A;  2JDA A;  5C3O A;  2WQ8 A;  3N4M A;  3V0A A;  3KD4 A;  1LHN A;  1SFN A;  1YQ2 A;  2P17 A;  3AYC A;  4CCL A;  1JYV A;  1W6O A;  1W0O A;  1R08 2;  4JQT A;  2ARE A;  4JGY B;  2VAU A;  2VM9 A;  3OTF A;  4QGN A;  2ZGP A;  1LOF C;  2BJS A;  1YUD A;  3T0A A;  3U4X A;  2CDO A;  5JI7 A;  2XKP A;  4YSF A;  3AL6 A;  3VKM A;  3ACI A;  2F17 A;  2BOI A;  1RED A;  1Y9M A;  3ZSK A;  4E2G A;  5F5C A;  1JUI A;  1VBC 2;  1PHM A;  5IVC A;  3WW1 A;  5IWF A;  2ZX4 A;  3THP A;  3MLJ A;  3VD3 A;  3CJI C;  1QJZ A;  4WVM A;  1AUY A;  2J42 A;  1OQ1 A;  2PHX A;  4I02 A;  4QU2 A;  2Q8O A;  3RJR A;  2X8K A;  5D8A C;  2WNU B;  3ZVX A;  3E5X A;  5K0U A;  3AZV A;  4JGY C;  3ZXL A;  2IXJ A;  3K51 A;  3Q8F A;  4MUV A;  2Z42 A;  4RFT 0;  5DAB A;  5F9T A;  2JJ6 A;  2BNN A;  5ANN A;  1JYW A;  4KU8 A;  5KHJ A;  3P1I A;  4JGZ B;  3CO2 A;  3RPQ A;  3H8R A;  5FY4 A;  3B5L B;  4UXA A;  2C26 A;  3C2U A;  3MFA A;  1WA6 X;  4QGL A;  2A73 B;  3B00 A;  4LQR A;  3UT0 A;  2XWJ B;  3B9C A;  5HBA A;  4DEV A;  2WSU A;  2IXL A;  4COV A;  5L7O B;  1VAV A;  3U14 A;  5I0U A;  2A6Z A;  2P3K A;  3RQ0 A;  1RVF 2;  1NE4 A;  1CVN A;  1LED A;  2Y6F A;  4NE9 A;  5GM0 A;  3WSO A;  1PGL 2;  2QQV A;  1QOS A;  2GC2 A;  4FP2 A;  3WV6 A;  3BTX A;  4QPW A;  5EP9 A;  5FZ0 A;  1V6O A;  3AKR A;  3INA A;  5D2A A;  3BTZ A;  4XEZ A;  5FYM A;  1RUH 2;  3RZJ A;  2XWB B;  3O1V A;  1W28 A;  1S4C A;  5A6Q A;  4QPG B;  4Z8B A;  1CX1 A;  2QJV A;  4DS0 A;  1SLT A;  3AVR A;  4ZXE A;  5KC6 A;  3O14 A;  3BU0 A;  1SBE A;  1W06 A;  1UX7 A;  3B9I A;  1PNG A;  3GHN A;  2BGP A;  2JEM A;  1BLZ A;  1KDK A;  3NNM A;  5DUV A;  5A3L A;  2BVB A;  3GZT B;  4LBM A;  3NL1 A;  1NCQ C;  2GP3 A;  3O5S A;  3OY8 B;  2ZGM A;  3THC A;  4P5H A;  3VBS A;  1Z0H A;  4LBO A;  1TMF 2;  5L36 A;  3OPW A;  2VY0 A;  2VW1 A;  2VD7 A;  4PIZ A;  3T09 A;  1R09 2;  4TYS A;  4Q0S A;  3HN3 A;  1W8W A;  4EQV A;  1DF0 A;  4F3J A;  2GH2 A;  1UWW A;  1K3I A;  1H1M A;  5FPL A;  2TEP A;  2QQP A;  2RM2 2;  2YZ4 A;  3F2Z A;  4XPV A;  2W87 A;  3K3N A;  2ZGN A;  3NW4 A;  3OF1 A;  4HT1 T;  3HN1 A;  1PGL 1;  4TLF A;  1PO1 3;  1WLD A;  3U4S A;  5J3U A;  4IV1 C;  1NA1 A;  1PIV 2;  4E27 A;  4AI1 A;  2G4I A;  4LBJ A;  1AZD A;  4YPJ A;  1ULG A;  3B93 A;  4UW6 A;  4XDQ A;  1XB9 A;  1PVX A;  1MZ5 A;  1XBF A;  1YIP A;  1HQW A;  1K5M C;  3N36 A;  1UY1 A;  3I59 B;  3UYJ A;  3WIN E;  3VDB A;  1W8F A;  1XNT A;  1M06 G;  4IER A;  1AR6 3;  1WBF A;  4CUC A;  2C9K A;  5GLV A;  2R04 3;  1W9F A;  3S6P A;  5FYB A;  4X8P A;  4QPI B;  3VBR A;  5FR3 A;  1HN0 A;  1LOF A;  3AZW A;  3POG A;  4N7I A;  4E4S A;  2OPW A;  4CCJ A;  1XRU A;  3UKT A;  4CDX B;  3W21 A;  1IS3 A;  3CDZ B;  3PMS A;  4H3W A;  4ZON A;  4CDW C;  4ZZ8 A;  4CXX A;  3MIC A;  2NP0 A;  1AR8 3;  1V0A A;  1EUT A;  1KGY A;  3I54 A;  4GKY A;  1NCR B;  1H2N A;  4Y26 A;  1D0G A;  1W8H A;  3ZFG A;  3ZMO A;  5JI9 A;  3D82 A;  1YQ5 A;  1IG0 A;  1K5J A;  2P3Y A;  2Y64 A;  2ZHM A;  4QX3 A;  4XFC A;  1BBT 3;  1V6M A;  4Z1V A;  3ZSE A;  1DGW A;  1VRH 1;  1QJY 3;  1JBC A;  2JWP A;  2VPV A;  4RR3 C;  3SQO A;  5ACA 2;  3BUC A;  5F37 A;  1MR5 A;  2EXK A;  1YI7 A;  1LHU A;  3O0X A;  2D98 A;  4Q0U A;  2HWF 3;  4WM8 C;  2AR6 A;  4LEJ A;  4M00 A;  2UWB A;  2ADE A;  4AFM A;  2XJP A;  2W68 A;  3IDE A;  3MV1 1;  4Q4Y 3;  1L7Q A;  2P37 A;  2ZMK A;  2XLF A;  5CKM A;  2WO2 A;  3MO4 A;  3MF9 A;  1RUE 2;  5LBC A;  3B69 A;  1GOF A;  2LTN A;  4HSJ A;  1CX4 A;  1KQR A;  2OQ6 A;  3AB0 A;  1ZVF A;  4RYD A;  3GJB A;  1LAJ A;  2ETE A;  1U5Z A;  2HWB 1;  1VPH A;  4NOT A;  1SBF A;  1VE0 A;  4OHZ A;  1GP4 A;  3RZZ A;  2UYB A;  1OOP C;  3BAL A;  4AQ2 A;  1AYM 2;  3E6B A;  4JVA A;  1F31 A;  3T2Q A;  1G86 A;  3MHZ A;  1RMU 1;  1W6N B;  3RSJ A;  5KHK A;  2FZ2 A;  3K4A A;  3T2O A;  1CZV A;  3FLP A;  1W6Q B;  4PI2 A;  4JQR A;  4W4Z A;  3UET A;  4ET7 A;  1J3Q A;  1OLM A;  2A3Y A;  3GM8 A;  2ZHK A;  3IDC B;  1W6P A;  4QB6 A;  1C5H A;  4IEP A;  5JXH A;  3ZDS A;  1RUF 3;  2CWM A;  3ACG A;  3M7A A;  3TBD A;  3KQ4 B;  2Y6G A;  5GZE A;  4LLO A;  3IDB B;  5CFC C;  4RFR B;  3RYP A;  1G8W A;  1ENX A;  1VAL A;  3D0J A;  3H9A A;  4A3X A;  2WNV A;  2PLV 1;  1MZ6 A;  3KSC A;  1ULF A;  2VR4 A;  2H0V A;  2VTF A;  3U07 A;  2W3J A;  3VHR A;  2AGS A;  2HWF 1;  4DEQ A;  2E51 A;  5L9B A;  2D5F A;  4JV4 A;  1PVC 2;  3ES4 A;  2RG4 A;  3HBK A;  1K45 A;  1W05 A;  3HR9 A;  1ULP A;  3FZ3 A;  2ZBJ A;  1LUL A;  3DGT A;  5D8A A;  3APB A;  1AYN 2;  2YFU A;  1FNZ A;  3AKP A;  4DIQ A;  2B8M A;  5AVA A;  4AEJ A;  2WZE A;  5LB6 A;  4HVR A;  2FCU A;  2K0G A;  4ES9 A;  5LA1 A;  2QDN A;  2JG9 B;  3HQU A;  3QH6 A;  2PXJ A;  2VUC A;  2V09 A;  5C33 A;  1V6N A;  2VZV A;  2JEN A;  4DFS A;  4DXT A;  1BBT 2;  2LRO A;  2WO3 A;  4AK3 A;  4XE9 A;  4C0B A;  5IVE A;  2XPJ A;  1POQ A;  2GC0 A;  1TE1 B;  3V65 A;  3BCW A;  2RS1 2;  5FLJ A;  1QDC A;  5JWP A;  3HD8 B;  3OEA A;  5JPN B;  3OGR A;  2EA7 A;  2AEZ A;  3H1M A;  1OFS A;  1SLC A;  4UI9 L;  5JVV A;  2WFF 2;  1KS4 A;  1J83 A;  5E16 A;  4PQQ A;  4Y24 A;  1W6Q A;  3OD4 A;  1UZY A;  3AFK A;  2NZ9 A;  2WAO A;  3NJV A;  2R04 1;  1VLN A;  4HK8 A;  4K20 A;  5C4W B;  1NCR C;  3B94 A;  5DN2 A;  2HEY F;  3SIS A;  4AED C;  4COZ A;  3LA7 A;  4DY5 A;  2WWU A;  4DUW A;  1E5R A;  3CQO A;  3LKJ A;  3ZN6 A;  2DCT A;  2I2S A;  2OX0 A;  4FFH A;  4MZU A;  4XW3 A;  5CBL A;  1W2O A;  3CHX A;  2V5Y A;  4FPC A;  4OVE A;  5FZ1 A;  4CDX A;  2R07 3;  4DPN A;  4J1W A;  5DAP A;  2FZ1 A;  1MS1 A;  1NXM A;  1WCK A;  4MGZ E;  4UW3 A;  4YW3 A;  4EJR A;  1P8J A;  4WZF A;  1TG7 A;  1XU1 A;  5FZM A;  2VNV A;  4CU8 A;  4XAC A;  1DDL A;  1FV3 A;  2D6N A;  1QOT A;  1SDD B;  5FZ4 A;  1RUI 3;  2IVI B;  3WUD A;  4DOU A;  1OKO A;  5JZG A;  3LZZ A;  3USS A;  5JXG A;  3T4V A;  4UBH A;  5KXC A;  2XVL A;  2PAM A;  3ZYR A;  1YQ6 A;  3B02 A;  5FFO C;  1SLL A;  3CIH A;  3EMR A;  1GNH A;  4BQW A;  3J8F 2;  1ZBA 3;  1KXG A;  1H2K A;  4PI0 A;  5CKN A;  4AVC A;  1AX1 A;  3QBQ A;  5DUX A;  4EN9 B;  4MYE A;  1LEM A;  5ISL A;  4IV1 A;  2FMD A;  4BH9 A;  4NIG A;  5LA2 A;  1ZA7 A;  3WP4 A;  1IZ3 A;  1J1T A;  1COV 3;  1WW6 A;  3HNM A;  5BY5 A;  2RR1 3;  4ARY A;  3K4Z A;  5IK5 A;  2YPD A;  4K21 A;  1AHS A;  1S0I A;  1ND2 C;  3OSD A;  4AQS A;  3LAG A;  2E26 A;  2GDF A;  1HRV 2;  2WO7 A;  3ZYJ B;  1AL2 1;  4IV3 A;  3KT7 A;  2ENR A;  2Q1Z B;  5LBE A;  5EYX A;  4Z2A A;  1ZYB A;  4TWT A;  4AI0 A;  1JZ2 A;  2XJT A;  2ZZJ A;  1CWP A;  3NJZ A;  2WZR 3;  4N43 A;  5FP7 A;  1OD5 A;  4HBN A;  3M3C A;  3VBU B;  4AVV A;  3ZX7 A;  1LGB A;  2P6H A;  1W6O B;  1DZT A;  1S0E A;  2R07 1;  3Q8A A;  5FDB A;  1MQT C;  2VMI A;  2J22 A;  2HYK A;  2XJV A;  3CLP A;  3WG3 A;  4CCC A;  1V9U 2;  1W03 A;  1X7N A;  2O8O A;  4AOC A;  3V0B B;  2ZXQ A;  3POB A;  3JD7 3;  3PUI A;  2IWG B;  1DZQ A;  4GQ7 A;  3ZXA C;  4XBQ A;  3PUR A;  1GQP A;  1MS4 A;  4AVB A;  4RSU A;  2WZR 2;  5HV4 A;  5JR7 B;  3IAP A;  3M3Q A;  4FPJ A;  2TUN A;  4G4F A;  4EN8 B;  2K2S A;  4NVP A;  2DDU A;  2VCA A;  2IXH A;  5IK8 A;  1V9U 3;  1ST8 A;  1JTZ X;  3LEK A;  1HJG A;  4IND A;  4JC1 A;  2ILM A;  4JTN A;  4WM8 A;  3UES A;  4E4Z A;  2EXI A;  4XZP A;  5K0U B;  1HV0 A;  2CGO A;  1R08 1;  1JUH A;  1R1A 2;  4L8Q A;  2IFW A;  2VW0 A;  1IS5 A;  5ACA 3;  3JU9 A;  1SCS A;  5F8P A;  1OSG A;  2DUO A;  1DGR A;  1R1Z A;  5D1I A;  2PN5 A;  3K77 A;  3LDR A;  1NQJ A;  1FI2 A;  3J8F 3;  5FZ6 A;  4FPG A;  3UGH A;  2E6V A;  4A44 A;  3M4F A;  1WCD J;  1CAV A;  4K8F A;  3RMY A;  1EV1 3;  2VL4 A;  4ITC A;  2AH2 A;  5CFC A;  3E5Q A;  3P3P A;  1ZRR A;  1UPI A;  2B42 B;  2ARC A;  3N9L A;  2J1T A;  3I97 A;  3FMG A;  4NAO A;  1JOJ A;  1VR3 A;  1XE7 A;  5BNN C;  3E6D A;  3MBW A;  3AFG A;  4FO9 A;  4LR4 A;  1RUD 2;  2R1B A;  2XBO 2;  4KMQ A;  4E8C A;  1BZW A;  1QGL A;  4Y5T A;  3VZL A;  4CXY A;  2EIB A;  2PMW B;  3WP6 A;  3AP6 A;  4QKF A;  4CU9 A;  5JMC A;  2D6P A;  1W9S A;  4SBV A;  3OBT A;  5J96 B;  1AR6 2;  3NNF A;  2JDY A;  4KL1 A;  2YBP A;  3B3Q E;  3OUI A;  2WZP P;  2VZ3 A;  1FOD 3;  2JDK A;  4XQD A;  5KWR A;  1UQX A;  4B4R A;  3BIE A;  2WS9 1;  1UIK A;  2EAL A;  4P9I A;  2FDF A;  4RHV 3;  4BYY A;  1AR9 1;  2Y38 A;  1UL9 A;  1PGW 2;  4LO8 A;  4HON A;  4UW4 A;  5A6Z A;  1YRZ A;  3NV1 A;  3KV4 A;  3WR0 A;  5CU1 A;  1E5S A;  2ES3 A;  2KA3 A;  2UYA A;  4XDP A;  1OBN A;  4NUB A;  3THD A;  3U75 A;  4A2U A;  1GWK A;  3E5U A;  1PZ9 A;  1VP6 A;  5J98 B;  3THT A;  1CON A;  2NN8 A;  1O91 A;  2LS6 A;  3AJZ A;  1H0B A;  2ZGO A;  4YZ4 A;  5FUI A;  5LBF A;  1W8N A;  2BDR A;  2VZO A;  4KI5 M;  4AHX A;  2ZGS A;  1OI6 A;  4IEY A;  4ONU A;  4QX2 A;  2DF7 A;  4KWU A;  4I2O A;  4NMI A;  3MIG A;  1XYN A;  4PQ9 A;  2P6C A;  2R16 A;  2XL7 A;  4IV3 C;  1GWL A;  4YVW C;  4AHW A;  4X6Q B;  3NV3 A;  3N7K A;  1ASJ 2;  2MEV 2;  1O3S A;  1AR6 1;  1DLC A;  2D44 A;  3UKN A;  4DMI A;  2VTX A;  5C71 A;  1CAW B;  1MS0 A;  1U5Y A;  3WOG A;  1CJD A;  3SCF A;  5IVB A;  1G9A A;  1OOP B;  1E5H A;  4LTA A;  1AYN 3;  3H7J A;  4ES8 A;  4O61 A;  2ZX1 A;  4QHB A;  3VHN A;  2QVS B;  2WNE A;  4DRR A;  2A3X A;  5JLV A;  1FOD 1;  1MZF A;  4P9W A;  1IPK A;  4D7Y A;  4LHN A;  5A7N A;  2RMU 1;  1GQG A;  3BGA A;  1F5F A;  1UW8 A;  1ZRD A;  4QM8 A;  3CZU A;  3UJO A;  4LBK A;  5LWB A;  4ZU7 A;  2QTW B;  4CP9 B;  4Y4R A;  2Z79 A;  4AFD A;  3ZFE B;  4QHZ A;  2DU0 A;  2ZX2 A;  3K3O A;  3MEP A;  3N7M A;  4URT A;  4XUN A;  4LHK A;  1H8V A;  5FXW A;  2V4V A;  2YC0 A;  1ASJ 1;  2MEV 1;  1X82 A;  3LPG A;  5T5O A;  4Q4V 3;  1XJA A;  1QY4 A;  4AYU A;  1QQP 2;  3K2O A;  4YZ5 A;  4RR3 B;  2JE8 A;  4FCA A;  1I9R A;  4IGP A;  4LOT A;  4LUM A;  3ZM8 A;  3CEW A;  4GD4 A;  2BBA A;  3HOB A;  5DAX A;  4URA A;  4MXV A;  3I49 A;  1CN1 A;  1LOD A;  5F5I A;  4L9B A;  4P9Y A;  5GZD A;  4E2S A;  2YUE A;  4XJU A;  1ND2 B;  3ZR6 A;  5CVR A;  5I0S A;  4XET A;  4JDM A;  5FCC A;  4XUT A;  4XJ8 A;  2WNU C;  4UT5 A;  1IQD C;  3TN9 2;  4GWJ A;  3GBW A;  3VBU C;  1GZ9 A;  1O59 A;  2BP6 A;  1L7R A;  3J9S A;  1F5J A;  3V64 A;  4AAP A;  4HN1 A;  5F6L B;  3OGG A;  5BNP C;  2YY1 A;  5JPM B;  4IE4 A;  4XDO A;  5FJK A;  3KF3 A;  4YG0 A;  1RJ7 A;  2V5D A;  4CEW A;  3BYW A;  2R7E B;  3RG0 A;  5HV0 A;  1V9U 1;  2WNV B;  5KHI A;  3GGL A;  4Q4Y 1;  4EE2 A;  1DLL A;  1S0B A;  2Q8D A;  3EO6 A;  3ZLI A;  3OBZ A;  5FY7 A;  1QXR A;  3N7L A;  4ZZ5 A;  4UF0 B;  1JYT A;  3RS6 A;  2DCZ A;  3NQH A;  2WFF 3;  1W6M B;  3OPZ A;  4R9C A;  1PGW 1;  3DPR C;  2YPJ A;  4TN7 A;  4CXW A;  2E31 A;  2RJ2 A;  5K8S A;  1DQ0 A;  4FPL A;  2D97 A;  3VGI A;  2GAU A;  1W8Z A;  4W50 A;  4WVZ A;  1QJX 2;  2SLI A;  2QQU A;  1JZ7 A;  1LCL A;  4QX8 A;  4PLN A;  2GNM A;  5FYT A;  5EHD A;  4CP2 A;  4D6Q A;  1VB4 A;  1Y4W A;  2R1D A;  3D0S A;  4AGG A;  1RYY A;  1I5P A;  3B7M A;  4XF4 A;  4LNV A;  5IK4 A;  1RUC 1;  4GIQ A;  3VUO A;  1QF3 A;  1RUH 1;  2E33 A;  3L9J T;  1RUF 1;  3OJB A;  1ENR A;  5DG2 A;  3N9Q A;  1W2T A;  2GP5 A;  4LK6 A;  1KEX A;  5DPN A;  1OH4 A;  4I01 A;  4DXZ A;  3FLT A;  2J1U A;  3CZJ A;  1WWY A;  2Y6H A;  3HMY A;  5D21 A;  1R09 3;  4FI9 A;  2KXL A;  4Q8L A;  1EY2 A;  3IM0 A;  3WDT A;  1DYK A;  2RDS A;  4Q27 A;  1KFU L;  4OHW A;  4CCE A;  4E9K A;  1RUE 1;  2HWD 3;  5C5U A;  2RM2 3;  4Q4W 1;  4GJZ A;  5T3N A;  2P3I A;  4HVQ A;  5HPO A;  2FDK A;  1D4M 1;  2JEC A;  2VZR A;  3O1U A;  1TNF A;  1Q8P A;  3BKZ A;  1QIQ A;  2FHR A;  2VNG A;  5KXB A;  2D40 A;  3T4H B;  1UCX A;  5FY0 A;  4BE3 A;  3C7G A;  3DEM A;  3BOW A;  3NRU A;  5BNN A;  3KMH A;  1C8M 1;  2YC4 A;  5J36 A;  3A21 A;  4M3C E;  1UY4 A;  3GYD A;  4Z82 A;  2BYV E;  1HB1 A;  3LSE A;  1OA4 A;  3HJR A;  3AKQ A;  1HV1 A;  1VBD 3;  3KLS A;  3ZXF A;  3IMN A;  1JYC A;  3MI8 A;  3NAP B;  4Q4V 2;  5L7O A;  3OBA A;  1O5U A;  3UGG A;  4LUK A;  5EJZ B;  4OZX A;  3WY6 A;  4CP0 A;  4QGM A;  5JOW A;  2R07 2;  3I59 A;  3WW2 A;  4BXF A;  4NII A;  1AXZ A;  5FYS A;  5A3U A;  3ETQ A;  2GND A;  2YRO A;  3NNL A;  4XHX A;  4XUR A;  2QNK A;  1SEF A;  3IMM A;  3RZL A;  2D7F A;  5M0T A;  2VOK A;  2ZAC A;  4RHV 2;  1LHV A;  3FHI B;  3CJX A;  3JBG 2;  5I0D A;  1JI6 A;  4YG3 A;  1BCX A;  1S2K A;  4Q29 A;  4EWD A;  4P08 A;  2X05 A;  3PVO A;  5LAT A;  4K6B A;  1ZRI A;  1H1I A;  1SLI A;  5DUW A;  4FFI A;  2A6V A;  2LAL A;  4FTS A;  1LEC A;  1XNA A;  1AYN 1;  2ZEW A;  3CL1 A;  2DCK A;  1WD4 A;  4ZHN A;  3VBH B;  1QJF A;  4LO6 B;  2XBO 3;  2NMN A;  1TZO A;  1C1F A;  5FZL A;  2A75 A;  3D6E A;  3GBF A;  1RHI 3;  3KV5 A;  2H0B A;  2WWS A;  3MFC A;  4XJW A;  3J7H A;  2G19 A;  1VBA 1;  2UWA A;  5CYY A;  5DDJ 2;  1DYO A;  1UKG A;  3WEZ A;  3ZPO A;  2E32 A;  5KXD A;  1R64 A;  3IZO A;  3PTR B;  1DZR A;  3FHQ A;  4CCM A;  3FHA A;  2ZJC A;  1DGR N;  1C1L A;  4HVO A;  4NHM A;  1UOB A;  4YVS C;  5T52 A;  2W1S A;  3VBF B;  4U2A A;  4YW5 A;  1BK0 A;  2VBB A;  1BHG A;  1UYZ A;  3H1W A;  4MOA A;  4Q4V 1;  4FOQ A;  2VOX A;  2BWA A;  2JDU A;  3VBS B;  3HT1 A;  1MAC A;  3ZFF A;  5IYY A;  2RE9 A;  5EYY A;  5FBJ A;  1WBL A;  5BNO A;  4UW5 A;  4FOV A;  4KGG A;  3BI3 A;  4MLO A;  4ISR A;  4XIL A;  3PUS A;  4IE7 A;  5FXZ A;  5FJH A;  1QDO A;  1XPW A;  5I8T A;  1ULD A;  3OB8 A;  4MAD A;  3USU A;  3HNB M;  5JOZ A;  1TMF 1;  1W99 A;  3WX5 A;  2WA4 A;  1RUD 1;  4OHX A;  1Z7S 2;  2BTV C;  3T1L A;  1IQA A;  3VBO A;  4O9E A;  1RUJ 2;  1RUG 1;  3AMP A;  1QHD A;  4OQ8 A;  3RZM A;  4TTG A;  3M8L A;  3WQ0 A;  5IAX A;  1B35 C;  3LIG A;  1D4M 2;  2WAB A;  1F2N A;  1A78 A;  3ACL A;  3GCW A;  3H50 A;  3SMH A;  2Y60 A;  3ZYB A;  5F3G A;  4XAE A;  3SNM A;  2Y34 A;  1OT5 A;  1ACC A;  3I2F A;  1ULE A;  1OQD A;  1QJU 3;  3KVA A;  4AI3 A;  5C8W A;  5FTT C;  4NID A;  2P2K A;  3WLU A;  4LBL A;  5LA9 A;  3WUC A;  3H8U A;  1H2M A;  2PYT A;  2ERF A;  5DAQ A;  4CCK A;  4LKD A;  5GAL A;  4LO7 A;  1AYM 3;  3FC0 A;  4BWO A;  5IAT A;  3VV1 A;  2EIE A;  3N9M A;  4QPI C;  4JX0 A;  1Z7S 3;  2OVU A;  2PHL A;  4MXW A;  2ORZ A;  2PHU A;  2CDP A;  1SCR A;  2JX9 A;  2VGD A;  3EB7 A;  3I2G A;  1N1S A;  4FXK B;  4LUL A;  4N53 B;  3ZYH A;  2IC1 A;  5ERL A;  5BYN A;  1ZZB A;  4D6S A;  4CP9 A;  5KXE A;  1R1A 1;  3RRD A;  5FUN A;  5FMB A;  5AC9 1;  1POV 1;  3ZN6 B;  2VQU A;  3KM5 A;  4S2F A;  1DQ4 A;  4V2V A;  5IFP A;  3ACH A;  4AED B;  4LBQ D;  4DUX A;  3EJK A;  4RS5 A;  2AYH A;  5C6C A;  4P00 B;  5B4X A;  1JYN A;  2BUK A;  2HJI A;  2VU9 A;  5T50 A;  4Q4X 1;  4JHT A;  4K1Z A;  4DIN B;  2FDI A;  2XUE A;  3NJX A;  5IVJ A;  2DVA A;  1H8T B;  1W3X A;  1K42 A;  3USU B;  2CYF A;  1G6N A;  1T6G C;  1XYO A;  5T5J A;  3SH5 A;  3WT3 A;  4D6R A;  1UKR A;  3WG1 A;  2ZEX A;  4EV0 A;  1KDM A;  1SG3 A;  2X10 A;  4LA3 A;  4DZG A;  5A7W B;  3VD4 A;  4YM0 A;  4AXO A;  2VQA A;  3ELN A;  2QQN A;  4IES A;  4LIV A;  4EWE A;  1ZRC A;  4W6W A;  3J7L A;  2QDR A;  4RR3 A;  1G9B A;  3TEX A;  1S2B A;  1QJX 3;  1YJK A;  3TN9 3;  5A33 B;  1FMD 2;  2RM2 1;  2JG9 A;  4TLG A;  1AR8 2;  3LQC A;  5SV5 A;  2OXB A;  2Q30 A;  1NCQ B;  1QH7 A;  2TNF A;  5BPX A;  4COW A;  1RMU 2;  3PVE A;  4HPK A;  2AEY A;  3VBH C;  1TNR A;  4XTM A;  1MQT B;  4PHZ A;  2D3S A;  3QLQ A;  4S2D A;  2EID A;  1QWR A;  2ZGT A;  1GZW A;  4XF1 A;  5IW0 A;  1YQC A;  2VMF A;  3ZIX A;  2BGC A;  1JHN A;  1LTE A;  2W91 A;  5FY1 A;  4AZZ A;  4E8D A;  3A4U A;  4WVV A;  2AUY A;  2FMY A;  2BWC A;  1FMD 3;  1W3V A;  3TEZ A;  1EAH 1;  2RS3 3;  1POV 3;  2QKD A;  1NYW A;  2ZCW A;  1UMI A;  2AC1 A;  1HDK A;  4N53 A;  4QPY A;  2B46 X;  1XNC A;  1V6J A;  4CDX C;  3GCX A;  5HCA A;  2W1Q A;  1VBA 3;  3AM2 A;  5ABJ A;  3K48 A;  2HBU A;  2VQ0 A;  5FY5 A;  3WNO A;  1AR8 1;  1A34 A;  3CKH A;  2Z2S B;  5L7O C;  2WWJ A;  3MUY 1;  4QX1 A;  3AMQ A;  3ES1 A;  3GNE A;  5FBZ A;  2XJS A;  5FMO L;  4MH0 E;  1XND A;  4XUO A;  2XVG A;  2ZGQ A;  1IKQ A;  2X09 A;  1ZA4 A;  4LBN A;  4L0P A;  4LHL A;  4LO5 B;  4XFF A;  5BUV A;  2GC3 A;  4V1P A;  4UWD A;  5E1R A;  3RNS A;  3WNP A;  4Y20 A;  1LES A;  2X5I C;  4JRA A;  3RYR A;  4CP1 A;  1EAH 2;  5FWJ A;  2QZ2 A;  2LRP A;  3VBO C;  3RDI A;  3RJ2 X;  5FZO A;  5T55 A;  1I6X A;  4CCD A;  1QU0 A;  2PTM A;  5F2S A;  4Y5S A;  4DXS A;  5GKA C;  2UY8 A;  3TNP B;  2VTX J;  3TYJ A;  2VOV A;  5C7G A;  5I0T A;  2W92 A;  1O8P A;  2AEN A;  1W8O A;  2ZGU A;  3AC0 A;  5BXX A;  2Q1F A;  3ECQ A;  4NRO A;  3WDY A;  1NUK A;  1WCS A;  1HQN A;  2RDN A;  3FL7 A;  3GBG A;  4GKX A;  2FDH A;  2VZT A;  1OD3 A;  1SFY A;  2RJL A;  3GHM A;  3LF7 A;  2VZQ A;  4AHY A;  1OPM A;  1LB2 A;  3AJY A;  5A7P A;  1WMX A;  2JDM A;  1X9T A;  3ATG A;  4DUV A;  2XKO A;  2XDV A;  1N47 A;  2OUJ A;  2Y26 A;  5I91 A;  1PM7 A;  1QH6 A;  2BGO A;  1LGC A;  3WQ1 A;  1HQL A;  4PLM A;  2JE7 A;  1NG0 A;  3H3U A;  2BV4 A;  1JYI A;  4FPO B;  1OPO A;  4L92 A;  4OUE A;  5APA A;  5J1X A;  3WCS A;  5ANQ A;  1IHM A;  3ZYP A;  1X36 A;  1TVG A;  2PHD A;  1NCR A;  4AE2 A;  3U0Z A;  3O1O A;  1NX9 A;  4IUG A;  4AED A;  3ZPY A;  2CGN A;  1YQ8 A;  2GU9 A;  4KG8 A;  4WV8 A;  3LSD A;  4CPB A;  2ZGR A;  1FPN 1;  1LOC A;  3HNY M;  4M3C B;  1H30 A;  1S55 A;  2E7A A;  5DZE A;  3VKL A;  1WLT A;  4NHK A;  5FZ3 A;  5FZ7 A;  4BOW A;  3S5Q A;  4CDW B;  1B35 B;  4QT6 A;  1UAI A;  5C8C C;  4NRP A;  2OQ7 A;  2RMU 2;  4Q5O A;  4BQ5 A;  3W5N A;  2JG9 C;  4GAZ A;  4LXL A;  5K9Y A;  3T2T A;  2RS1 1;  4WM8 B;  4EYU A;  4GA9 A;  4S2H A;  4IEU A;  5EPA A;  1QJY 2;  4FOW A;  4BZ4 A;  5JZG C;  3J4U H;  4A6O A;  2C0Z A;  3SKJ E;  3HVD A;  4CEW B;  1AJO A;  3TRS B;  3GJA A;  1EYB A;  4LOS A;  2OZJ A;  3DXU A;  2VJX A;  4OI2 A;  4AL9 A;  3DKW A;  4FQ4 A;  4QQO A;  1Y9Q A;  1DQ5 A;  2VH9 A;  2ZPX A;  3VZM A;  1O3R A;  1W2A X;  2YU1 A;  4LO4 B;  1W04 A;  1W90 A;  3NAP A;  1XXN A;  1D4M 3;  5L73 A;  3POS A;  4ASK A;  3O7O A;  2EIC A;  4CCN A;  1JU4 A;  1WGP A;  2JG8 C;  1BQP A;  4MGY E;  1HXS 1;  3PU8 A;  3VZJ A;  2J1S A;  1J3P A;  3ST7 A;  3V0A B;  1MEC 3;  4XJA A;  4W6Y A;  3WF0 A;  4AGV A;  3AP9 A;  1GNZ A;  2KR2 A;  4E4H A;  1G9D A;  1ULO A;  5BNN B;  3ZXK A;  1FXZ A;  5CAD A;  3FX3 A;  4QDR A;  1WUV A;  4XCA A;  3MW3 A;  1RUD 3;  4NN0 A;  3TN9 1;  3FE5 A;  2KM2 A;  2VVE A;  3H3Z A;  3AXD A;  3HT2 A;  3M3I A;  1PO2 3;  2FCT A;  4Q4X 2;  4C1W A;  4QQH A;  1H9W A;  1EV1 2;  2W9X A;  3ZFE A;  1RXG A;  5GLZ A;  1RIN A;  3PVB B;  1AR7 1;  4QDS A;  2D3P A;  2ZAH A;  2HWB 3;  4AAX A;  2YC2 A;  2B7Y A;  4JDO A;  5T54 A;  4CEY B;  4HAN A;  1PO1 1;  4IGO A;  4YM2 A;  5BV6 A;  4YGB A;  5LEJ A;  2RV9 A;  4BQ1 A;  3AMH A;  4NIH A;  3WQ7 A;  4GZ9 A;  5H9Q A;  2E7Q A;  3IDA A;  1FNY A;  1QOO A;  2C4X A;  3LCP A;  1ZBE 2;  5EQU A;  3UL2 A;  1JOP A;  2QE3 A;  4A45 A;  3PUQ A;  4KGQ A;  3AKT A;  4BIS A;  5FXX A;  4ASM B;  5KHH A;  1AL2 2;  1JMU B;  4EN7 B;  4AQ6 A;  3FUQ A;  2DTY A;  4ZS3 A;  3D8C A;  3HQX A;  1VMF A;  4P9L A;  5CZK A;  4YW7 A;  3VKN A;  1DQ1 A;  4CUG A;  5IFT A;  1U0A A;  4HSL A;  3I7D A;  2DTW A;  1ZBE 3;  1DCS A;  1RHI 1;  3I2H A;  4LPL A;  2OYZ A;  3W9A A;  4BQ3 A;  3C3V A;  1ZRF A;  1JYX A;  3VDD A;  4BK4 A;  5HCF A;  4KH9 A;  2CAU A;  5EV7 A;  4NHL A;  5H9S A;  5FQ0 A;  1O8S A;  1DFQ A;  3AXE A;  4KG0 A;  4EN6 B;  1HRV 3;  4XMA A;  4Q0P A;  1ZBA 1;  5FLH A;  2B9U A;  3URF A;  1DGW X;  5LY2 A;  4XXP A;  2DWR A;  2NM1 A;  1GSL A;  1HB3 A;  1GBG A;  1N3Q A;  4YFZ A;  5FYZ A;  2W95 A;  1S0G A;  1ZNP A;  2HWC 3;  3CJI B;  4PDW C;  2X5I A;  1F4H A;  4NRQ A;  4U36 A;  2X29 A;  3SCG A;  5F5A A;  2E7T A;  2ZS6 B;  2QFE A;  3E97 A;  1RIT A;  2WZR 1;  5JZG B;  3I2D A;  5F6K A;  5LK7 B;  4CUA A;  3MF6 A;  4GH4 B;  4R52 A;  4MXW B;  1ODN A;  4XIO A;  4ZY9 A;  2A1X A;  1UU4 A;  3KHC A;  1EAH 3;  1NA1 C;  4ZU5 A;  3POJ A;  2HKX A;  3POF A;  1CIY A;  1NZI A;  1VBE 3;  2JE9 A;  3H42 B;  3KGZ A;  3T3Y A;  4RN5 A;  3LA3 A;  4GAL A;  4Y22 B;  2XVK A;  5I93 A;  4YYO A;  1RUI 2;  3ILN A;  5JIA A;  2WUH A;  2HWC 2;  2VVD A;  1GP6 A;  1GOH A;  1O4Z A;  2VNR A;  2RS5 1;  1YJL A;  4LHS A;  4QB1 A;  4CA9 A;  3ZXG A;  3LD8 A;  5A6X A;  4GMP 0;  4Q4W 3;  2F6B A;  2HLE A;  5DZF A;  1JOD A;  2QQK A;  3KV9 A;  2V4A A;  1X8M A;  4KWK A;  4B4Q A;  2GZW A;  4HK9 A;  3M70 A;  5AVP A;  1WA4 A;  1JZ8 A;  1OKQ A;  4YVW A;  2VE1 A;  2DVD A;  1HB2 A;  3A23 A;  3I2O A;  4LBQ A;  4RQP C;  4K3U A;  2DV9 A;  5C70 A;  1CAU B;  4H7M A;  4XAB A;  1US3 A;  3HQR A;  1T2X A;  2OW4 A;  2VMG A;  4ORF A;  2CHH A;  2Y33 A;  4JCK A;  1OF4 A;  5JCT A;  5C3R A;  1IPS A;  3U78 A;  3PME A;  4LKF A;  5IUQ A;  5JSO A;  4BQY A;  1MQT A;  3I4I A;  4MV2 A;  1VIW B;  3EXU A;  3ZR5 A;  1D0H A;  3MLK A;  1VBC 1;  3PNA A;  1AXK A;  3X29 B;  1UZW A;  3OOX A;  3GF6 A;  4NWW A;  1D2S A;  5KHG A;  1AYM 1;  2A6Y A;  3MV0 1;  1UD1 A;  4QKN A;  3O1M A;  1ALY A;  2VOW A;  2GSY A;  4PF5 A;  3VZK A;  5FZ9 A;  1RIR A;  4G9S B;  3NKT A;  3LFM A;  2IVJ A;  3IWZ A;  2WN2 A;  1O5L A;  4XXA A;  1YYN A;  4XZU G;  3WNM A;  2Y8K A;  2RS5 3;  3VZO A;  5CFD A;  5FZE A;  3NAP C;  4CVU A;  5DZG A;  4BPZ A;  3FFZ A;  2DCJ A;  2ZX0 A;  1PK6 B;  3ZFG B;  4AVA A;  1SBD A;  2WII B;  1BK1 A;  1FMD 1;  5IHR A;  1LR5 A;  1CAV B;  3DL3 A;  4F8A A;  5TSW A;  2YHJ A;  1UYX A;  4FAH A;  1J1L A;  1AR9 3;  4UFK A;  1AF9 A;  1W9W A;  1RXF A;  1CZS A;  4X6R B;  4D3W A;  1W0N A;  3JB4 C;  4L97 A;  1B09 A;  1A3K A;  2VCM A;  1D7P M;  4A7Y A;  5LAS A;  2WBK A;  4A3Z A;  1QJX 1;  4XCB A;  4Y33 A;  3VBF C;  4XF3 A;  2DUR A;  2B5H A;  2YMZ A;  1UY0 A;  2I74 A;  3SH3 A;  1F15 A;  5FXV A;  2ZMN A;  1NCQ A;  4C90 A;  1LOG A;  4QHO A;  3KV6 A;  1STM A;  2GN3 A;  3AL5 A;  1YNA A;  4LJH A;  2WZ8 A;  3VBS C;  3MIH A;  2GNB A;  2OT7 A;  2VBD A;  4LIT A;  5IVV A;  4ZKT B;  4CCO A;  3K75 B;  3ZDV A;  3WDV A;  4D7S A;  2HWC 1;  5IJR A;  1RMU 3;  2W08 A;  4BDV B;  4HZF A;  4QQP A;  2QCS B;  4EN0 A;  2WKK A;  4XTP A;  4BLJ A;  4PIX A;  5E6H A;  1XSQ A;  1HW5 A;  1C8M 3;  4KNC A;  4PLO A;  3RWN A;  3W59 A;  2IFR A;  2XG3 A;  3NV2 A;  4HL0 A;  1JZ3 A;  3WF1 A;  1HN1 A;  3MPP G;  1UIJ A;  1UZZ A;  2Q8E A;  5AC9 2;  4IE5 A;  3PL0 A;  2JB8 A;  4IEV A;  4Q1R A;  1LGN A;  4S2G A;  1Q8Q A;  4DY3 A;  1ZRE A;  3MZH A;  1KRI A;  1SLA A;  1WCQ A;  1V6I A;  3G6J B;  4QX5 A;  2FD8 A;  3KT1 A;  4AGR A;  4YVS A;  3ZKU A;  3AZY A;  1S0J A;  1Q56 A;  1ULC A;  2YBS A;  3T08 A;  4IQP A;  5FYU A;  1OUX A;  4R4Z A;  5K4L A;  2CY6 A;  3AMN A;  2HEW F;  3HIF A;  3R05 A;  5F3C A;  2PA7 A;  2JDH A;  2VZS A;  4MVT A;  1F35 A;  3LWC A;  3Q8C A;  4PDW B;  4CDQ B;  4LKE A;  2P5B A;  2HWE 3;  4R4X A;  5A6Y A;  4YW2 A;  4CDW A;  3HWJ A;  1JZ5 A;  1AR7 3;  2FQP A;  3BPS A;  5F39 A;  4GUL A;  3BB6 A;  1VBB 3;  2ADD A;  4QDQ A;  1GZT A;  2WC2 A;  3AP4 A;  1A8M A;  4WM7 B;  3FN9 A;  3NVC A;  2Z5W A;  1H8T A;  4IV1 B;  1GFF 2;  3FUO A;  3ZFG C;  1O6U A;  2A71 A;  3MDP A;  3WNN A;  4QWN A;  1SPP B;  4W65 A;  3WF4 A;  5FP3 A;  1XOY A;  2JDN A;  1B35 A;  2JKX A;  2VUA A;  1BJQ A;  3MPB A;  1F9K A;  1LOB A;  3KB5 A;  4GMP 3;  4O65 A;  4ZPI A;  4NIA A;  1GYK A;  3S7E A;  3GZU C;  5FP9 A;  2VNO A;  2UY9 A;  3WCR A;  2OPK A;  2Z69 A;  4FPY A;  3ACF A;  1I3H A;  4FTE A;  2D43 A;  2R0F A;  1WLW A;  2BNO A;  3ON7 A;  4RGG A;  4BB3 A;  1GNY A;  4QD2 A;  3LDB A;  1Q8S A;  1C3H A;  4FBF A;  3QOP A;  5FMC A;  4RGA A;  2VCB A;  4YG6 A;  3C8X A;  5C9A B;  1CD3 G;  1V6L A;  2BZD A;  1IPJ A;  1Z78 A;  4Y1Y A;  2EAA A;  5CKQ A;  3I3B A;  1W2U A;  1ND2 A;  1WME A;  3JZV A;  3LOI A;  3AYA A;  1J59 A;  4CSW A;  1ZZC A;  4W8J A;  2XXZ A;  5KR7 A;  1H6X A;  5FRE A;  3W58 A;  1LU2 A;  4FFF A;  4I30 A;  4OUS A;  1JW6 A;  2OII A;  1XYP A;  2ARX A;  1K5M A;  1LOE A;  1QXP A;  2JIC A;  3QD6 A;  3ZSJ A;  5FPU A;  1GP5 A;  5JR2 A;  2XLA A;  2I45 A;  3AZX A;  2IZW A;  4QB2 A;  5A3W A;  4OLL A;  2D5H A;  1PIV 1;  3DXT A;  1UX6 A;  2OKX A;  1XC6 A;  5FPZ A;  3KGL A;  3DKQ A;  4XJZ A;  5H9P A;  1GV9 A;  3VBU A;  1CPM A;  5JMO A;  3W20 A;  4QXB A;  2XH6 A;  1U12 A;  1NLR A;  4CDU A;  4ATF A;  1QJU 1;  1HIX A;  1O4T A;  2C6S A;  4XUQ A;  2J1V A;  2PLV 2;  2VMC A;  3V0B A;  3OPT A;  4FPH A;  2Y0O A;  1KD7 A;  4QXH A;  3ALQ A;  3NJY A;  2F4L A;  4OUM A;  4HKO A;  4I0A A;  2XB6 C;  2WR9 A;  1VJ2 A;  1COV 1;  2A5Z A;  4DB5 A;  4NPL A;  4HKL A;  2X5I B;  5GZG A;  5DG1 A;  1KIT A;  4LK7 A;  5A7Q A;  2H6B A;  3SLI A;  4NPR A;  4DO0 A;  2D6M A;  3DPR A;  4IEQ A;  4RD7 A;  2XON A;  3MYX A;  4F7Z A;  5AC9 3;  2JD9 A;  1BMV 2;  2K46 A;  5GLT A;  1FX5 A;  1GUI A;  3OG2 A;  2GNT A;  1NQD A;  1YHF A;  4TSV A;  4XFG A;  2ZTN A;  4UOJ A;  1CES A;  1SAC A;  4WVM B;  2WIN B;  1QKQ A;  2G1M A;  2C5D A;  3WF3 A;  4K40 A;  2VME A;  4AWD A;  4AEK A;  5A3T A;  5J7M A;  5C9A A;  1ODM A;  2PQS A;  3J26 N;  4HLT A;  3LB9 A;  4MET A;  1SPP A;  4B7E A;  4UF0 A;  1Q43 A;  5A7O A;  2YGM A;  4CU6 A;  2DCY A;  5DAW A;  2A70 A;  3O1T A;  1QJY 1;  4HKW A;  1Y9G A;  3ZYF A;  5C3S A;  5CG8 A;  1WW7 A;  2RVA A;  5CB7 A;  3VBF A;  3JUU A;  4FSJ A;  2Y6K A;  3ZN5 A;  1VBE 2;  2PQQ A;  3ZXD A;  3PVN A;  4XFI A;  1JXN A;  3RMX A;  1GZC A;  1W2N A;  1C5I A;  4Q8K A;  2AAC A;  1ZZ8 A;  4XFH A;  2Q0A A;  5FUP A;  1G9C A;  1PVC 3;  1YFW A;  1LJ7 A;  4LT5 A;  5GLU A;  3M3E A;  4JKM A;  4MSV A;  3WNL A;  1FPN 2;  1H8T C;  4J6G A;  2NYY A;  3V56 A;  4OI0 A;  1IKP A;  2GN7 A;  4MO3 M;  2XJU A;  2R04 2;  1HX6 A;  2EXH A;  4QM9 A;  1OFN A;  1G7Y A;  4XQ4 A;  1D4V B;  2IXC A;  4KBZ A;  2QQW A;  2CSG A;  5HI0 A;  1YO8 A;  4RGK A;  4XVH A;  2ZOE B;  4BCU A;  2VMH A;  3R4D B;  3LFI A;  5FZD A;  4B3N A;  2VQT A;  2WYF A;  2VBP A;  3WDX A;  2W39 A;  3AMM A;  4JTO A;  4N7U A;  4W6X A;  4XC9 A;  2BER A;  5JDB A;  4DRV A;  3AP5 A;  5CIS A;  3CF6 E;  2ARA A;  3PTY A;  5FMO S;  1UN1 A;  5EXO A;  5J09 A;  3OUJ A;  5B2G B;  4AQT A;  4YZ2 A;  1HRV 1;  3N9O A;  4QX7 A;  5T5L A;  3JXS A;  2C24 A;  3JCI A;  4C8D A;  2BOJ A;  4N90 A;  4AW7 A;  2YYO A;  3RGB A;  4EWA A;  4SLI A;  4Y1Z A;  2XML A;  4CDQ C;  4LE3 A;  2K9Z A;  4XHB A;  3H7Y A;  5BNP B;  1Y7B A;  2BW8 A;  2NLR A;  2PFW A;  3QH7 A;  1ZZ9 A;  3ZOI A;  5C3Q A;  5FOB B;  3VBH A;  2B45 X;  3POE A;  1KJL A;  1RUG 2;  1IOA A;  2EAK A;  3DF0 A;  4NHY A;  3VD9 A;  3GDB A;  5DXD A;  3J8F 1;  1PK6 C;  1Q5O A;  2VXR A;  3LDK A;  3PLQ A;  1S0C A;  1DP0 A;  4IDZ A;  4UFM A;  3PJQ A;  3DYM A;  4Q0Q A;  2HWB 2;  2BRT A;  1K12 A;  1AX0 A;  3DCQ A;  3KQR A;  4HOO A;  4PBP A;  2JG8 B;  2XUM A;  3H8O A;  4AEM A;  4AFC A;  2MHF A;  3AVS A;  3DEC A;  4LBQ B;  4MHU A;  4R8H A;  5FAX A;  4KBB A;  4QQ2 A;  5ABJ C;  1JU3 A;  3GZA A;  3R0R A;  5DDJ 3;  2VUD A;  3I3D A;  4CTE A;  2XQX A;  4FT8 A;  1RHI 2;  3ILF A;  4QQL A;  1GKB A;  2RJK A;  1L3J A;  2C1F A;  3OYW A;  3EHK A;  1MEC 2;  4NJ4 A; 
#chains in the Genus database with same CATH homology
 2VL4 A;  4A6O A;  3SKJ E;  3LPF A;  2VJX A;  3SEP A;  4DXR A;  2J1T A;  2VO5 A;  3I97 A;  3MBW A;  3HPN A;  4JKK A;  2W1U A;  3I3E A;  2QQO A;  4KMQ A;  1J84 A;  4E8C A;  1JHJ A;  2YG0 A;  4MGQ A;  2EIB A;  4CU9 A;  2EIC A;  5A1A A;  1JU4 A;  1W9S A;  5EJ1 B;  2J1S A;  2YFZ A;  1W9T A;  2B9V A;  2VZ3 A;  3P6B A;  3WF0 A;  1JZ4 A;  1ULO A;  4TXW A;  5HXM A;  4QDR A;  3PUH A;  3MUZ 1;  2ZEY A;  2L9L A;  1US2 A;  3THD A;  2W9X A;  3LE0 A;  3T2P A;  4QDS A;  2LS6 A;  4AAX A;  5FUI A;  1W8N A;  2VZO A;  2YC2 A;  4QAW A;  4KI5 M;  4OMD A;  3W5M A;  1UZ0 A;  2RV9 A;  2W94 A;  3HEI A;  3I2K A;  4QX2 A;  4GZ9 A;  4KWU A;  3IDA A;  2C4X A;  2W1W A;  1SHW B;  1NAE A;  4A45 A;  2WDB A;  1DLC A;  2J1E A;  3K4D A;  2HYX A;  5C71 A;  1LNS A;  3ABZ A;  2Z4F A;  2J1A A;  3A7Q A;  5JXJ A;  5CZK A;  4BJ0 A;  1UXZ A;  5IFT A;  4A41 A;  4LPL A;  2VZP A;  3I2H A;  1JYX A;  4BK4 A;  3D3A A;  3BGA A;  1GU3 A;  1O8S A;  3CZU A;  1PMJ X;  1CZT A;  4XUN A;  1NKG A;  2V4V A;  3LPG A;  2JE8 A;  2Y6L A;  3ZM8 A;  3EYP A;  2W95 A;  3OGS A;  2BBA A;  3HOB A;  2JDA A;  2WQ8 A;  1F4H A;  1YQ2 A;  1JYV A;  4CUA A;  2VM9 A;  4XUT A;  4ZY9 A;  3T0A A;  2CDO A;  1IQD C;  4GWJ A;  3ACI A;  5DQ0 A;  1O59 A;  1CIY A;  1L7R A;  4RN5 A;  3VD3 A;  2V5D A;  2R7E B;  2WUH A;  1GOH A;  3GGL A;  4LHS A;  4QB1 A;  4ZZ5 A;  2HLE A;  2QQK A;  2XHN A;  3NQH A;  1JZ8 A;  1JYW A;  3CMG A;  2W46 A;  2E31 A;  2RJ2 A;  3DYP A;  3P1I A;  3A23 A;  4W50 A;  2C26 A;  3IB3 A;  3OEB A;  5C70 A;  4CU7 A;  1JZ7 A;  4LQR A;  4PT6 A;  1US3 A;  1T2X A;  4DEV A;  1OF4 A;  1UY2 A;  1RYY A;  1I5P A;  3VD5 A;  2E33 A;  3WSO A;  3IAQ A;  5DPN A;  1KEX A;  1OH4 A;  4QPW A;  2J1U A;  3CZJ A;  2VZU A;  2Y6H A;  3MV0 1;  4FI9 A;  1CX1 A;  2J1R A;  4ZXE A;  1UX7 A;  2WN2 A;  3WNM A;  2BGP A;  4XZU G;  2Y8K A;  4LKS A;  5HPO A;  2VZR A;  4CVU A;  1OF3 A;  2DCJ A;  3I2I A;  2LW8 A;  3C7G A;  1UMH A;  3NRU A;  3THC A;  5IHR A;  1UYX A;  2YC4 A;  3A21 A;  1UY4 A;  1MPX A;  1W9W A;  1CZS A;  5F7U A;  3T09 A;  3HJR A;  3HN3 A;  1W0N A;  2WN3 A;  1UWW A;  1K3I A;  3OBA A;  3F2Z A;  1D7P M;  2W87 A;  5EJZ B;  2WBK A;  4A3Z A;  4UAP A;  5LCW L;  1UY0 A;  4XUR A;  5G05 L;  4YPJ A;  3III A;  3C7F A;  5I0D A;  1JI6 A;  2WZ8 A;  1UY1 A;  4BK5 A;  5G04 L;  4P08 A;  2X05 A;  3VDB A;  1XNT A;  3K75 B;  4CUC A;  5IJR A;  2C9K A;  3WNK A;  4BDV B;  2YB7 A;  1XNA A;  2ZEW A;  2DCK A;  3CDZ B;  4ZZ8 A;  2Y6J A;  1JZ3 A;  1EUT A;  1KGY A;  3OGV A;  5CYY A;  3WF1 A;  3WEZ A;  1HN1 A;  3J7H A;  5DMY A;  1DYO A;  2E32 A;  1R64 A;  2Y64 A;  4QX3 A;  3FHQ A;  3FHA A;  4GWI A;  4HG6 B;  1WCQ A;  3T0B A;  2W1S A;  3T08 A;  1BHG A;  1UYZ A;  4MOA A;  5IYY A;  3WQB A;  3MV1 1;  1L7Q A;  2VZS A;  2WO2 A;  5B4N A;  3SEE A;  3MO4 A;  1GOF A;  2W5F A;  4JHZ A;  1XPW A;  1JZ5 A;  4RYD A;  3OB8 A;  4MAD A;  3HNB M;  4QDQ A;  3WF2 A;  1W99 A;  3FN9 A;  4QX0 A;  3WNN A;  4D0Q A;  1UYY A;  2B4K A;  3WF4 A;  3T2Q A;  4TTG A;  3I2J A;  3K4A A;  3T2O A;  1CZV A;  2WAB A;  2JKX A;  4P02 B;  4W4Z A;  3UET A;  4ET7 A;  3GM8 A;  4OZO A;  4QB6 A;  1OT5 A;  2V72 A;  3I2F A;  3ACF A;  4OMC A;  2ORX A;  3K46 A;  5JXH A;  3ACG A;  2ID4 A;  3C7E A;  2Y6G A;  1GNY A;  2J7M A;  1WKY A;  2EIE A;  4JX0 A;  2QQJ A;  3VD7 A;  2VCB A;  2QQL A;  3C8X A;  2ORZ A;  2BZD A;  2KD7 A;  2CDP A;  3EB7 A;  3I2G A;  2VR4 A;  2VTF A;  2W3J A;  3I3B A;  4DEQ A;  5LA0 A;  5JXI A;  4W8J A;  1K45 A;  1H6X A;  2VQU A;  5IFP A;  1ULP A;  3ACH A;  1PX4 A;  4DUX A;  2YFU A;  1JYN A;  4P00 B;  5B4X A;  5JR2 A;  2WZE A;  4QB2 A;  3SKV A;  3NJX A;  2QBX A;  1K42 A;  4PF1 A;  2OKX A;  1XC6 A;  4ARX A;  5LA1 A;  2W47 A;  2ZEX A;  5JMO A;  1SG3 A;  2X10 A;  2VZV A;  3VD4 A;  4DXT A;  2WO3 A;  2QQN A;  4XUP A;  4XUQ A;  2J1V A;  2VMC A;  1JZ6 A;  4A4A A;  3OEA A;  3OGR A;  3LQC A;  2ZEZ A;  4UI9 L;  1J83 A;  4M4P A;  4PQQ A;  2EID A;  2VMF A;  2WAO A;  3GXU A;  3NJV A;  2W91 A;  4E8D A;  2XON A;  2XOM A;  2JD9 A;  4DUW A;  5DN2 A;  1GUI A;  4UOJ A;  3OG2 A;  1F4A A;  4M4R A;  3CQO A;  1UMI A;  2VZ1 A;  3WF3 A;  4P5Y A;  2VME A;  1PX3 A;  2WO1 A;  2W1Q A;  4JKL A;  2PQS A;  3WNO A;  1P8J A;  1TG7 A;  3CKH A;  4CU6 A;  4CU8 A;  5EIY B;  1SDD B;  3MUY 1;  4QX1 A;  3U37 A;  2RVA A;  4BXS V;  5JXG A;  2Y6K A;  4XUO A;  2X09 A;  4L0P A;  3CIH A;  3NNG A;  3WNP A;  3UNP A;  4JKM A;  3WNL A;  4A42 A;  5LA2 A;  4MO3 M;  3HNM A;  4ARY A;  3K4Z A;  2WYS A;  2QQM A;  4DXS A;  3E1F 1;  2E26 A;  5C7G A;  2WAA A;  2W92 A;  1O8P A;  4Z2A A;  4XVH A;  1W8O A;  3AC0 A;  1JZ2 A;  3C7O A;  2VQT A;  3ECQ A;  4D8M A;  1NUK A;  3DYO A;  2BER A;  3C7H A;  3FL7 A;  3LEI A;  3VDA A;  2J22 A;  2VZT A;  1OD3 A;  2VC9 A;  2ZXQ A;  2VZQ A;  3PUI A;  3JXS A;  1EUU A;  4OYU A;  1GOG A;  1GQP A;  4AG4 A;  2VMD A;  4DUV A;  3A22 A;  1UY3 A;  3IAP A;  2BGO A;  1H6Y A;  2DDU A;  2VCA A;  3VD9 A;  3GDB A;  4OUE A;  3LEK A;  3LEG A;  1DP0 A;  3UES A;  5J1X A;  2VCC A;  3DYM A;  3ETP A;  1TVG A;  1K12 A;  1NX9 A;  4IUG A;  3VDC A;  3T0D A;  1UXX X;  4CUB A;  2QQI A;  2VOT A;  3HNY M;  3K77 A;  3DEC A;  1GMM A;  1JU3 A;  5JUV A;  3I3D A;  4A44 A;  2XQX A;  3BN6 A;  3W5N A;  4MGS A;  1PMH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...