5DN2A

Human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
MFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin-2 reveal a zinc ion binding site remote from the vascular endothelial growth factor binding pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dn2A00
3ACFA 3A21A 3BN6A 3MO4A 2VZ3A 4CU7A 1UY1A 1TVGA 2VL4A 2ZEWA 2BZDA 2E26A 2V4VA 2WABA 2XONA 2Y6HA 2J1AA 3JXSA 1JZ3A 4BK5A 3OGVA 3OGRA 1GNYA 3OG2A 4RN5A 4XUQA 3HJRA 4M4RA 2VM9A 2W87A 2YC4A 5EJZB 2QQLA 3ECQA 1CZVA 1OH4A 1SG3A 3F2ZA 2JD9A 3WNKA 2J1EA 2BGPA 3VD3A 2VOTA 3VD9A 1EUTA 3HOBA 2VCCA 2EIEA 2VQTA 1P8JA 3ACHA 1J84A 5LA1A 1US2A 3T08A 4CVUA 4KI5M 2QQNA 5JXJA 1JI6A 2V5DA 3UNPA 3EB7A 4DEVA 4HG6B 1UY3A 2C4XA 3C7FA 1UYXA 4QX2A 3VD5A 3THCA 3SKVA 3FHQA 2Y6JA 2VTFA 3C7GA 3MBWA 1W9TA 1SHWB 4DEQA 2W46A 4UAPA 3WNLA 4LKSA 1NX9A 3WF1A 2C9KA 2WN2A 2Y64A 5A1AA 1F4HA 1TG7A 2VZ1A 1SDDB 3NJVA 4JKKA 3IIIA 2W1WA 2W1SA 5IJRA 2XHNA 4MADA 2LW8A 1RYYA 3LEKA 4AAXA 2JE8A 4CU8A 3WF2A 4A4AA 3I2JA 2RJ2A 1UXZA 1J83A 2OKXA 3FL7A 1PX4A 5DMYA 4DXSA 4DUVA 4CUAA 2KD7A 1ULPA 4JHZA 1PMJX 1W9SA 4CU9A 4XUNA 4A45A 4DXRA 4MGQA 3MV11 2J1VA 2Z4FA 2VCBA 3CIHA 3GGLA 4XUTA 2WYSA 5DN2A 2J1SA 3PUHA 1EUUA 2WN3A 4JX0A 2VCAA 4P02B 3WNOA 3I2KA 3W5MA 4E8DA 1K3IA 3IB3A 4QX0A 2ZEYA 2V72A 3NNGA 4E8CA 3MUZ1 3IDAA 1JZ8A 1T2XA 4ARYA 1PMHX 1WKYA 1IQDC 4IUGA 1K42A 3ACGA 2W47A 5IHRA 3U37A 3WF0A 3VD4A 1KEXA 3OEBA 1O8SA 2W3JA 2J1UA 2QQKA 2J1TA 3NRUA 1PX3A 3E1F1 2WO2A 4LQRA 4PF1A 1BHGA 4A41A 3LEGA 4GWIA 1UYZA 4QB1A 5EIYB 4DUWA 3C8XA 3LPGA 4A3ZA 4D0QA 2WZEA 4BXSV 5J1XA 4JKLA 1UX7A 2W5FA 3DECA 3J7HA 4W50A 1UMHA 3LQCA 1JU3A 2VZVA 4PT6A 3T2PA 4KWUA 2W91A 3UETA 2VMCA 2EIDA 4QX1A 3HN3A 4YPJA 2JKXA 2RVAA 4JKMA 3NJXA 5I0DA 3I97A 3DYOA 2W1QA 1W99A 1W8NA 5C7GA 2QQMA 3OBAA 1JZ7A 2ZEZA 2VJXA 1W0NA 5F7UA 1K12A 3BGAA 5IFTA 3I2FA 4P00B 1DYOA 4DUXA 2Y8KA 5JXGA 2QQOA 3EYPA 4BK4A 2WO1A 4UOJA 1KGYA 2VMEA 2Y6KA 4XVHA 5JR2A 3I3DA 3HNYM 4BJ0A 1HN1A 1WCQA 4TXWA 4W4ZA 2ID4A 2LS6A 5CZKA 2R7EB 2DCJA 4P08A 3ABZA 4OMCA 1UY2A 5C70A 3T0AA 2DCKA 4LPLA 4QX3A 2BGOA 2B4KA 1GMMA 4OZOA 3WEZA 2W92A 2CDPA 2VZTA 2W9XA 3WF3A 1XNTA 4CUBA 4MOAA 5LA0A 2W95A 5LCWL 4ZZ5A 2XOMA 3C7OA 5B4XA 3MV01 1JZ4A 3AC0A 2VZPA 1L7QA 4L0PA 3I2GA 2WUHA 3THDA 2HYXA 4CUCA 3D3AA 4XUOA 1OT5A 5EJ1B 1CIYA 3P1IA 4MO3M 4TTGA 3SEPA 1UYYA 5CYYA 4LHSA 3T0BA 2E32A 1UXXX 2BBAA 2ORZA 3A23A 3OEAA 1D7PM 2VZOA 1UY4A 5FUIA 4Z2AA 1JZ6A 3CZJA 2VR4A 4PQQA 1UWWA 4QB2A 1US3A 2QBXA 3DYPA 2ZXQA 2C26A 3I3EA 2YB7A 2VO5A 3WNPA 4ARXA 2VMFA 2L9LA 2RV9A 2WDBA 3HNMA 1XPWA 4P5YA 2VQUA 3T0DA 1W8OA 2WZ8A 1W9WA 4OMDA 5G05L 1JZ2A 3P6BA 3C7HA 2EIBA 3VD7A 2Y6GA 2YFUA 2YG0A 3CMGA 3IAPA 2XQXA 1JU4A 4A6OA 3VDBA 3K4DA 2WBKA 4GZ9A 4ZXEA 4A44A 1F4AA 1GU3A 1JHJA 4OUEA 2B9VA 2Y6LA 5IYYA 3FN9A 5DQ0A 3I3BA 5JXIA 4D8MA 4QDQA 3K46A 1DP0A 2WAAA 1H6YA 2EICA 2YFZA 4M4PA 4QAWA 3WQBA 3WNNA 3A22A 3HNBM 2VMDA 5HXMA 2W1UA 2J22A 1JYVA 5LA2A 2PQSA 3CKHA 1OF3A 3WF4A 2BERA 1MPXA 3ACIA 3K4AA 4ET7A 1GOGA 5B4NA 4QPWA 1JYWA 5JUVA 2VC9A 3WNMA 1UY0A 4XURA 2VZQA 2QQJA 2X10A 3LE0A 3LEIA 1NUKA 3C7EA 5IFPA 4BDVB 3K4ZA 2X05A 1UMIA 3T2OA 1I5PA 4XUPA 4KMQA 3FHAA 4RYDA 3A7QA 4QDSA 3HEIA 3NQHA 4QDRA 4ZZ8A 3CDZB 2CDOA 2QQIA 4UI9L 2ZEXA 3LPFA 1CX1A 1O8PA 4A42A 3GM8A 5G04L 3DYMA 1L7RA 1DLCA 1NKGA 1K45A 3K77A 1XNAA 3HPNA 3I2IA 3PUIA 1CZSA 2WQ8A 2JDAA 3VDAA 4MGSA 4QB6A 2E31A 3GXUA 1JZ5A 1O59A 3OB8A 3MUY1 3SEEA 5C71A 2W94A 1ULOA 3SKJE 5HPOA 1GOHA 3T2QA 1GOFA 1LNSA 3VDCA 2WO3A 4AG4A 1H6XA 4CU6A 3CQOA 4OYUA 4W8JA 1UZ0A 1XC6A 1JYXA 1NAEA 3UESA 4DXTA 1GQPA 1OF4A 2YC2A 3WSOA 2X09A 4FI9A 1YQ2A 3OGSA 3T09A 1GUIA 2VZRA 4XZUG 4ZY9A 1JYNA 2J7MA 2DDUA 2VZUA 2HLEA 3W5NA 5DPNA 3IAQA 2J1RA 3GDBA 3I2HA 2ORXA 2E33A 5JXHA 2WAOA 3K75B 1CZTA 3ZM8A 2VZSA 5JMOA 1R64A 3ETPA 4GWJA 3CZUA 1OD3A
chains in the Genus database with same CATH superfamily
1W8FA 4M00A 5LEKA 3ATGA 4ASMB 1AHSA 5AC92 3ZYRA 2ZGQA 1XYNA 4CDQB 4KQ7A 4B29A 5FYIA 2OYZA 2Y6HA 3E5XA 2XJQA 3JXSA 5A80A 2J1AA 3VDDC 3W58A 3B93A 3OGRA 3OGVA 4IEVA 2WS93 2WWJA 1W8WA 4NE9A 4QPIB 3WINE 5BYNA 3OG2A 4OUSA 3JQXA 2RR11 2DVBA 1LHOA 2VG9A 4RN5A 1QIQA 4KL1A 2XB6C 2RDRA 3S5QA 1YIPA 1W6PA 1BK1A 1UZZA 4CE8A 1FOD2 1VBD3 2WINB 4XILA 1VRH3 2WC2A 1HRI3 2BGPA 2VOTA 3VD9A 2P6HA 3CNAA 4MXVA 1RXGA 4R9DA 5FKBA 4CP1A 1IGOA 3ACHA 4AVBA 2OVUA 3GZUC 4GULA 2BFUL 3SISA 1NZCA 1Z0HA 2I07B 1ENRA 4FFHA 4FQZA 1UIKA 2PAMA 2E51A 3DKWA 3ZX7A 2V5DA 2DF7A 4FPGA 3CJIB 4DEVA 2K2SA 1UY3A 2OS2A 1H4HA 2D6PA 3POSA 4OHZA 1H4GA 3E6CC 4CTEA 4MGKE 2A6ZA 4AQSA 2WNUC 4FOWA 4YW4A 4BOWA 5FZBA 4CDWA 3C7FA 2K9ZA 2FDIA 2ENRA 4FTSA 2R32A 3C3VA 4N7IA 3UJOA 2PLV1 5EV7A 2D40A 3WDYA 3RYKA 1REEA 3I4IA 3SKVA 2W0XA 1ZZ7A 1UNBA 2NN8A 1MVQA 4QGNA 2DFBA 2Y6JA 5FZHA 3QD6A 1WLDA 3C7GA 3MBWA 4XCBA 1W9TA 3TNPB 4AFCA 4DEQA 3B94A 2W46A 4F3JA 4BQXA 4ISRA 2JE7A 1RUI1 4Q8KA 4XETA 3WW1A 4LKSA 2W39A 3B9CA 3ALQA 2EXJA 1C5HA 3T4VA 2Y64A 4LE3A 3T2TA 3OJBA 3WDVA 4N53A 5IWFA 2JG9A 1H30A 4XBNA 2PFWA 4XHBA 4DRRA 3H1YA 1MS8A 1SDDB 1W3XA 3K3NA 3NJVA 4NMIA 5FLHA 4RQPA 1LB2A 1QHDA 3M3OA 1JYTA 3WP5A 4GWNA 1CWPA 1COV1 3OYWA 3AYAA 1WMEA 1UZWA 3NMBA 5D8AA 2LW8A 4AFAA 4XMAA 2JE8A 1W6QA 4WVMB 2YPJA 3AKPA 1KFUL 3DV8A 3SMHA 1RUJ3 4CSWA 3JBG1 1NCRB 2J42A 2YGMA 5JIAA 5FY5A 2Q0AA 5I0TA 4DXSA 5A3WA 1W28A 1FPN1 3POWA 3DPRC 5FMCA 5A7NA 3W20A 1ULPA 4DUVA 1I1EA 3BTYA 1F9KA 3NKTA 1S0CA 1ULDA 2HBUA 4NHLA 4FO9A 2GC1A 2ZX4A 4C8DA 4Z1VA 2Z4FA 4FPEA 2ZGOA 4NPLA 3FJSA 1WA4A 3NV4A 4XUTA 2ZX3A 2WYSA 4IEWA 2HWE1 5AVPA 4EV0A 2GH8A 5GZGA 3P5BA 1B35B 1EUUA 4CCKA 2VCAA 3EO6A 1EAH3 2GNBA 2HWC2 4NUBA 3TEZA 5F39A 4D7TA 1H2NA 5L7OA 3I2KA 2D97A 3B5LB 4RFRB 1JYCA 2XJTA 5HCAA 1PM4A 1SFYA 3UJQA 4HMZA 3KF5A 3MUZ1 4BXFA 1T2XA 3AFGA 1V00A 4K9SA 3WDXA 2BW8A 3KGLA 1WLWA 2RMU3 2P1BA 2JDZA 1UCXA 1RXFA 4CCMA 2DVFA 1G9FA 2W47A 5IHRA 4CDWC 3U37A 3WF0A 1ZVFA 5FUPA 2OUHA 3HWJA 1OUSA 4Q26A 4XF3A 2ZACA 1O8SA 1SZBA 2QQWA 4Y3OA 3IN9A 1VBB2 3DN7A 2J1TA 1FV3A 1QH7A 5ABJC 2XHKA 2FQPA 4BE3A 5JOYA 3L9JT 1UW8A 1G86A 2DUOA 4IE5A 1Q8VA 3AP9A 3ZFFC 5F1RA 2NZ9A 1YQ5A 2JB8A 3WQ1A 4A41A 4CXYA 4P5HA 1R082 4HZFA 1MEC3 4K1YA 4NHMA 2A6YA 4DUWA 1DDLA 3LPGA 1QU0A 3B69A 3CF6E 4K21A 4YARA 1WMXA 4UW3A 5J1XA 4N53C 1UX7A 3FBMA 3GZAA 1NLQA 3ST7A 2CAVA 2EAKA 4O65A 1CD3G 2ZPXA 3BODA 3LQCA 4S2DA 2A3XA 2VZVA 3RWKX 3USUA 3UETA 4YZ1A 2BRTA 3SC7X 1RJ7A 2VMCA 3NKGA 1ND2A 2QTWB 4QHZA 2JENA 2PA7A 2ZBJA 5D8AC 3HN3A 2A71A 3LA3A 2OIIA 5FZ4A 5K0UA 2IXLA 1RUH3 1UKRA 1YFXA 2D98A 2G1MA 3V65A 3DYOA 3ILRA 1OOPC 3E6BA 3J8F2 4QQHA 3OBAA 2WNVB 4P9XA 4ITCA 1AR92 4BM8A 2ZEZA 2ZOEB 1BBT1 5KHJA 5FCCA 1VALA 1W0NA 4B1LA 5F7UA 1K12A 1PGW1 1QDCA 5IFTA 3I2FA 4PLMA 3N9NA 4DUXA 4Q4Y3 2JIJA 3ZXEA 4YM2A 3OTFA 4PJYA 3URFA 4NPRA 1LOGA 1JYIA 2XLGA 4XIKA 3EYPA 1OBNA 3V0AB 1WMDA 4BK4A 4IEPA 4CCJA 2BU9A 1AZDA 3BOPA 4LBMA 4WZFA 2Q8DA 3WLUA 4CPBD 4YFZA 2XUEA 3DF0A 4CEYC 2VW1A 4Y26A 1WGPA 1PMIA 5DZEA 4TLFA 4ZS2A 5CFCA 2IC1A 4F8AA 2LS6A 2B9UA 3AZZA 2ZZJA 4L2NA 5DUVA 2FBEA 5E1RA 5CBLA 4IERA 2DCJA 4P08A 3ABZA 4JDMA 3T0AA 4TZDA 3N3HA 3JCIA 4LPLA 2JB4A 4LNVA 5HCFA 2DVGA 5APAA 2Z2SB 1XB9A 3ZVXA 2CGPA 1GMMA 4MVTA 3D5OA 2F4PA 2R042 3GHMA 4YWAA 2V5YA 3U4SA 4BQYA 2W92A 5C33A 5F37A 2VZTA 2WZR2 1XNTA 2VVDA 4FXKB 1UU6A 1RITA 3RZGA 4HKLA 4DINB 5AC91 4R4ZA 1KXGA 4ZZ5A 1AXYA 1QXRA 1NE4A 3OPTA 1A8DA 3SXWA 5FDBA 4DZGA 4GAZA 1RHI3 4N8MA 3DEMA 4AVAA 4IETA 1VIWB 1BXHA 1DYKA 2VZPA 4LJHA 4H7MA 3VBHB 1SACA 2BP6A 2DVAA 4EN7B 1LESA 3CLPA 1HXS1 4NHKA 5DUXA 4IEZA 5DG1A 2D3PA 4AAPA 3BIWE 3R4SA 4E4ZA 3D3AA 1OT5A 1CIYA 1DF0A 4NIAA 4PBOA 1ZX5A 1WW4A 2D5HA 4K1ZA 2E7AA 3AJZA 3SEPA 2HWB3 3ZR5A 1CN1A 3ME2A 3QOPA 4RHV1 4UW4A 2P3KA 1N47A 4LHLA 2BBAA 3PVOA 3PTYA 3A23A 3Q8BA 1TME2 4JCKA 4AEDC 5FO7B 2VZOA 1AYN2 1ND2C 5SV8A 1H8TC 4QPYA 3ZMOA 3OUIA 4NO4A 2XMLA 4MGIE 4BIOA 5F6LB 2IFRA 4E27A 2VUJA 2AENA 2NYYA 3Q8EA 3PVNA 5DAPA 2QZ2A 5JMCA 1US3A 4Q8LA 2ET7A 1QF3A 1TE1B 1KJLA 2C26A 4CCNA 3RZKA 1QH6A 2ES3A 4XZPA 2VECA 4PHZA 3RDIA 3IBMA 3AXDA 3WY6A 3LDBA 2Q8CA 3UT0A 3ZXJA 1DCSA 2EVXA 5LASA 4ARXA 3NNJA 4K7JA 1RUE3 3AM2A 4HFSA 4NRQA 1X50A 2L9LA 1CPMA 1O91A 1SLTA 4TWTA 3IT8A 4Q5OA 4LUMA 1LOAA 1MS4A 3PU3A 4XQDA 1APNA 3RGBA 3ZSMA 1LHVA 4FAHA 2XJSA 4J25A 1JS9A 5FYSA 1YQ8A 1FMD2 1GICA 2A73B 1JTZX 4HONA 1W8OA 4XFAA 2WT2A 1JBCA 5CFCC 2CWMA 1POV3 4Q4X3 1MQTB 1RUF2 1IPKA 1W6NB 2WIIB 2WA3A 4R9AA 1VRBA 5FMOS 1CX4A 4LLFA 3P6BA 4D6SA 2E6VA 4DPNA 3BKZA 1CAWA 3P3PA 4L99A 1PHMA 2EIBA 3D4KA 1Z7S2 3ZKUA 5FPZA 3WDWA 4ZPIA 2JEMA 4I0AA 1JU4A 5JLVA 4QU2A 1HQLA 3GBFA 3VDBA 3Q8CA 4Q1RA 5H9RA 4XACA 1AJOA 1S0EA 2GC3A 2QNKA 1AXKA 4FOQA 4PF5A 4XHXA 4ZXEA 1YLLA 4LO4B 3H3LA 4AHWA 4OUEA 4GKXA 5I0RA 3NV2A 5JIUA 5IYYA 3M3QA 1QJFA 1Y9MA 2RR13 4YVSA 2WAAA 4YW3A 5CG9A 4GH4B 1H6YA 2EICA 4M4PA 1L7LA 2WSUA 3WQBA 3WNNA 5L36A 1BYHA 2VMDA 5CB7A 3SCGA 1QJZA 4FFGA 4Y22B 5KXCA 1YFYA 4RS5B 4C91A 3CKHA 4IEUA 3L2HA 5JOWA 1OF3A 1GKBA 1RC6A 1SBEA 3ILNA 2VAUA 2BERA 4QMAA 4NRPA 3N35A 2VUAA 1U0AA 1UZVA 5IVJA 4LOSA 1GOGA 2OX0A 4DB5A 4GALA 1LGCA 1OVPA 1FXZA 2X5IB 2I45A 3KSCA 3LFMA 2VMIA 2HWC1 4QPWA 2F6BA 4D7YA 1O4ZA 5JUVA 3KT4A 3DXUA 5KXEA 2CGOA 2BPA2 4XURA 4O61A 1NA1C 2A1XA 4QQPA 5FPUA 2ILMA 3LE0A 4JC1A 5FXZA 2JE9A 1KQRA 3BU7A 3UGHA 1JOJA 4CXXA 2MEV2 2JDNA 3K4ZA 4OI2A 2EXIA 3LKJA 4XOGA 5FZIA 2W08A 4XABA 2P4EA 1K5MA 4XUPA 2YZ4A 4Y33A 4KMQA 4URAA 2FZ2A 2PLV3 4Q27A 2H6CA 4YW1A 1ZZ9A 1VAMA 1NQJA 1VBB1 2PHWA 3NNMA 3NQHA 4NN0A 4LBLA 4QKDA 4AZZA 2QQIA 4MXWB 3MI8A 3ZYJB 1JH5A 3O1VA 3GF6A 3S5AA 1LOCA 5LY1A 1F35A 1G6NA 1GLHA 1RUI3 3UGGA 4LIVA 1QY4A 4CXWA 2FDGA 1PO12 3AK0A 5T55A 1XNAA 3HPNA 1R081 5FTTC 3MW4A 3MIEA 3ZN5A 4CEWB 3O1PA 4SBVA 3VBOA 2JDYA 3PIJA 3T4HB 3ZXLA 1HW5A 1UPIA 2XXZA 1H9WA 5J36A 5HI0A 1X8EA 3D8CA 3PLQA 1COV3 3ASIA 5FPLA 2W52A 3VB9A 1BQPA 3VBUC 3SEEA 3ZN4A 1RUD2 2ETEA 5FZ7A 1XE0A 4LBKA 4JRLA 2BNMA 4Y5SA 3SKJE 3N7KA 1ZZ8A 1CVNA 1JOBA 3ZKYA 2A7AA 3JBG3 3ZDVA 4WZCA 2A75A 1J59A 4B3NA 4Q0VA 2VNGA 3J8F1 1FPN3 2WO3A 1FNZA 1H6XA 1NXD1 2FZ1A 2Y26A 3ZYIB 4AG4A 1F8VA 1AR91 1DZTA 5ISLA 3VKFC 4LHKA 4MSVA 3V0BB 1ZBA2 2R1BA 2JG8B 3S30A 2X09A 2C5DA 2OW4A 3N7LA 4FI9A 4GB32 3GZEA 5FXVA 3WW4A 2R062 5C9AC 2GMMA 2QDNA 2HEVF 2O8OA 2VTXJ 1Y3TA 1X9PA 4AQ2A 4DFSA 4BMEA 5C5UA 2DDUA 4MGZE 2VZUA 2HLEA 4YG3A 4ZU7A 5A33A 3W5NA 1LEDA 5L19A 5C8CA 1DFQA 2J1RA 3GDBA 3Q8AA 5FZGA 1YCIA 1QMJA 4JTOA 2B42B 3B00A 3HBKA 4I0BA 1CZTA 4AFDA 3DCQA 1D4M2 3HAGA 1D2QA 2AEYA 3NAPA 1CAXB 4A3XA 3M1HA 1R64A 2R041 4FFIA 4PBPA 4CP9B 2CV6A 4COZA 1W8ZA 3MIBA 2QDRA 4GWJA 4UF0A 1BCXA 1E5SA 5ANNA 4EYUA 1K5JA 2UYBA 1VBC2 1YHFA 3WD5A 1UOFA 3V56A 1KITA 4AR2A 1UY1A 4IEOA 2VL4A 2E26A 2V4VA 2XONA 5FYCA 4BK5A 4AQ6A 4CDUB 3OY8B 5LATA 1KDKA 2JD4A 3EBRA 3RPQA 1XSQA 1Q8QA 3WDTA 5BNPC 3AP4A 3U10A 4G4FA 1AYM2 1AR63 3HJRA 5FBJA 5FRAA 3VBOC 2W87A 2HEWF 4FFFA 2B45X 2YC4A 4WVZA 5JSPA 4B4QA 4DRVA 1IG3A 2BTVC 3ECQA 3KVBA 3AMMA 1DLLA 1OH4A 5T54A 2LM3A 5ERLA 2PHDA 4XFFA 3F2ZA 2JD9A 2GNDA 1MZ6A 2J1EA 1YYNA 1C28A 3FLTA 3VD3A 1TME1 1WLTA 4LITA 3SITA 1R092 2VCCA 1AYN1 4AVSA 4NHYA 2VQTA 4L11A 2OA2A 1S0JA 4V2VA 1OLQA 3ORJA 4KWLA 1LKNA 1OMIA 1RMU2 3CBNA 4AI2A 4NIHA 1GZ9A 1BBT3 3IPVB 5FWEA 3T3YA 2QFEA 3MF6A 5I93A 4KI5M 2D44A 2QQNA 1X82A 1JI6A 3MICA 1J1TA 3VBRC 3J7MA 4QXKA 4UFHA 2RS51 4YG0A 5LRSA 1RL3A 1W2UA 1RGSA 4I3PA 3UYJA 4XC9A 2YHJA 1ODNA 4QX2A 3VD5A 1WZXA 1BEV1 3PU8A 2DCTA 4JVAA 3THCA 4EJRA 5FP3A 2RJKA 1MVEA 3PUSA 3NNLA 3POYA 1QQP2 2XG3A 4EN0A 4CCCA 3FHQA 4YW7A 5F8PA 1FMD1 2WLPA 3QLQA 1JUIA 2PQQA 3AVRA 3H7JA 1VB2A 1WCDJ 3VDDA 1H8VA 3LA7A 5FUNA 2D5FA 4PIZA 3EQEA 2ARXA 1Y4WA 1ACCA 1YQ6A 2A3YA 4LO5B 2GAUA 2C9KA 1JN2P 3KVAA 3WF1A 1QJU2 1S0DA 5HBAA 2ZX1A 5A1AA 4XJZA 1WCSA 1Z7S1 1TG7A 2VOXA 2VZ1A 3QACA 2D43A 2XBO1 1W6QB 3ACLA 2AACA 1B09A 4CPBA 4P9WA 5AC93 4JKKA 4QT6A 3IIIA 1U5YA 1W6OA 2JDUA 4NHXA 4MADA 5IJRA 1CAVA 1O4YA 2P6CA 3AKQA 2NPIA 1RYYA 2NM1A 4AAXA 2G4IA 4OI1A 2UWBA 3WF2A 3WOGA 5C8WA 1HXS3 4UFIA 2QE3A 3I2JA 2Y34A 4Y5TA 4BQWA 2EXKA 5C4WA 4DQAA 5FZFA 1UXZA 2LALA 2QUOA 3FL7A 5GZDA 1E5IA 3J7LA 2GMPA 4R8HA 3OGJA 5LBBA 3BIEA 1LHUA 4DS0A 4CUAA 4QPGB 1DQ4A 4XXAA 2FMYA 4XE9A 1NLSA 5CNAA 1NLRA 2WNEA 4XUNA 5F5QA 2YUEA 5IVVA 4COYA 4DIQA 4RHV3 1OLRA 2D3RA 4WM8B 1QWRA 3ITQA 3JB4C 1MQTC 5FYHA 4XFBA 4QM8A 1G9DA 2X53S 1YRZA 1KS5A 3M3CA 5DN2A 1QJEA 2KR2A 1PO22 2Y60A 3MIGA 4JX0A 5ANQA 1SEFA 3VL9A 1RVF2 3W5MA 3KT1A 4E8DA 5FZ6A 4FSJA 1K3IA 4QX0A 2B8MA 5K7PA 1YFUA 1SLCA 1XYPA 3TOJA 4CDXB 1WBFA 5FBZA 4E8CA 4YYOA 1HRV2 2MEV1 3IDAA 3U75A 4YG6A 5A1FA 1TMF2 3ZDSA 3VZMA 3I7DA 4YZ4A 4BZ4A 4CUGA 5FQ0A 1W39A 2Q30A 2E7QA 4IUGA 4AI9A 2XLFA 3B02A 4XDOA 2HBTA 5IT6A 1OSGA 3KCCA 1AUYA 3OEBA 4FT8A 5CFDB 1VBE2 4UBGA 5FPVA 3RZMA 3MFCA 2YGLA 2QQKA 3NV1A 3J26N 1S0BA 2C0ZA 3OCPA 2R16A 2ARAA 2WJSA 1NXMA 4N90A 4FP2A 4OZXA 4AHXA 2YU1A 1PO11 2RHPA 1ZA4A 4P9GA 4PF1A 1BHGA 3O0WA 5DAWA 3LEGA 3M8LA 1LOFA 3DPRA 1RIRA 4IDZA 4ATEA 2VUCA 3S6PA 5JI9A 4CCOA 4QM9A 4JKLA 5F3CA 4S2GA 1QOTA 2QCSB 5K0UB 3VBFB 2ZGSA 3J7HA 1UMHA 1S2BA 5FYBA 1AR72 2GN3A 2VGDA 4NIGA 1NY72 3GALA 4QX1A 2YBKA 3NJXA 4COVA 4K20A 2DBIA 1SCRA 3I97A 4WVWA 3ZYHA 4COWA 2EA7A 4FOYA 1W99A 1W8NA 4M0HA 5C7GA 2FDHA 2QQMA 3I59A 5HXVA 1I3HA 3AZXA 2WQ4A 2JJ6A 5C4WC 5I8TA 4H55A 4PDWA 2BYVE 4S2FA 1JZ7A 4AWDA 1MS0A 4YW5A 1YNAA 5FYZA 1U5XA 2HJIA 3FLRA 4GB31 4JDOA 5FYTA 1V9U2 2R061 4P00B 1DYOA 3ZSJA 5JXGA 5FZCA 2LROA 5EFUA 4E4DX 1HN0A 4FBFA 2HWC3 1WW7A 5A6ZA 1EV12 2BUKA 3WT3A 4QGLA 5FP4A 1KGYA 1RINA 4RFT0 5ABJA 5KHGA 1YO8A 4XVHA 2R49A 1BMV1 2WRAA 4Y1ZA 3ZFFA 4W4ZA 4QXHA 4BWOA 1ULFA 1MZFA 2Y0IA 4RD7A 5CZKA 4YM3A 5GKAC 3RI8A 3OGGA 4OMCA 1DHKB 2JX9A 4RGGA 5T5PA 3O14A 4NR1A 1DQ0A 2V4AA 1QNWA 3MF9A 4W6XA 4CZSA 1MZ5A 2I74A 5E16A 1VBB3 2CDPA 3U1XA 4RR3A 2JG8C 3KF3A 1UF2C 3KHCA 2GNTA 2HEYF 1MACA 3C7OA 4UW6A 4YM1A 3G6JB 5B4XA 3MV01 3EMRA 1R083 1OOPA 5D21A 1L7QA 1OLME 1ZREA 3S7IA 5E6HA 5AVAA 1CAUA 1ENXA 4LO6B 3GNEA 4LKDA 2WS92 1AYM1 4SLIA 4XUOA 3P1IA 1LOFC 4P9JA 1VB4A 3TYJA 3IDCB 1N1VA 3LCPA 5I0UA 5AFBA 4FOVA 1DQ2A 1UYYA 1F5JA 2IWGB 1O7FA 4LKEA 4NAMA 5CYYA 2RS32 1V6LA 1LEMA 2SBAA 4LHSA 1OFNA 3T0BA 4K3UA 3LD8A 2E32A 3CHXA 3PMSA 3SQOA 2ORZA 3A0NA 3OEAA 4EZ4A 2WT0A 3I8TA 2C6SA 3FE5A 4J1WA 5IVYA 4CEYA 4YVWB 3TEXA 1PZ8A 1OQEA 3O0VA 4FTBA 1RMU1 1XBFA 3B3QE 3LAGA 4YGEA 1AR93 3WDUA 5AFEA 2VR4A 4JAAA 3SHRA 4PQQA 1FV2A 5IATA 2DCYA 1G7YA 1F15A 4Q4V2 4PDWC 1H2MA 2XKPA 2OQ6A 4QX5A 4Y20B 3NV3A 4CDUC 3Q9OA 5KBFA 2FCTA 4G9SB 3WNPA 1W6MB 2ZGNA 3VBSA 1GR3A 4LK7A 1GZTA 3UKNA 4YSFA 4JGZB 3O7OA 2QJVA 2UY9A 1PK6C 2HWF1 5KXBA 1G9AA 4P5YA 1IKQA 2DTYA 1AVBA 2HWD2 4UT5A 2GALA 2PAEA 1SPPB 5FZLA 1AX0A 5EP9A 1W9WA 3D6EA 1LU2A 1HJGA 1XSRA 5G05L 2XGXA 1QJU1 1C5IA 5BNNA 1WW5A 1FAYA 2R043 2ZMLA 4WBBA 1MR5A 3C7HA 4AVTA 5IK7A 2WO7A 1H9PA 2Y6FA 2YFUA 5DZGA 3CMGA 5J98B 1QDOA 4A6OA 4BIFA 1O5UA 5KXDA 5DUUA 4RR3C 4QWNA 1S1AA 1AXZA 4AEDA 5T50A 3W21A 1F4AA 1H8TA 3PTRB 4BMBA 1Q8OA 3ZR6A 3FN9A 5DQ0A 1KS4A 2ARBA 3ZYGA 3FWEA 4D8MA 4XFHA 5FOJB 2GH2A 1PVC2 5EYYA 4Q4W1 1RUJ2 2JIGA 2XJPA 3OD4A 4I0WB 4QAWA 3HNBM 3PURA 4C0HA 4GMP0 5F2WA 4CDQA 5HXMA 1SBDA 2VQ0A 1EPWA 3KHBA 3J4UH 4GA9A 4XJ8A 3HVDA 2RDQA 2PQSA 4QPIA 4X6QB 5LA2A 2ADEA 4XYXA 3AMQA 2EAAA 3RWNA 2GNMA 3BTAA 5CKMA 3WF4A 3AKTA 3HD8B 1TME3 2UURA 1MPXA 3ACIA 4YRDA 2D7FA 1A8MA 1AYN3 3AXEA 3QH6A 4KU7A 1ZNPA 1PO21 4CP2A 4Y1UA 5TSWA 3WUDA 5FIXA 1RVF1 4Y1YA 3WNMA 5BNOB 1UY0A 3RVHA 2B7YA 1GP4A 1K5MB 1VE0A 1I6XA 2VZQA 5A7PA 3ZFEB 2ZX0A 3LEIA 1GZCA 3S0MA 3ZIWA 3H42B 1HRV1 3FC0A 1DGLA 2VTXA 3C7EA 4DMIA 1XNBA 5JDBA 2RS53 3BU0A 4XF0A 4EROA 1TMF1 2WFPA 3CJXA 3ZSKA 4IV3B 5BPXA 5FY7A 5BXXA 1UMIA 4XJAA 3ZN6B 1DQ1A 1BEV3 2XVLA 5FY9A 3H8RA 2JECA 2IFWA 3CJIA 4QPGC 3ZOIA 2ZHKA 1D2SA 4RYDA 3VBSC 4WV8A 3A7QA 3NSTA 1Q8PA 3HEIA 5BY5A 4ZZ8A 1YWKA 3CDZB 1FMD3 4M01A 5FZKA 1O3TA 3LPFA 1CX1A 3NJZA 3ZFGC 4A42A 4FTEA 5G04L 1W3VA 5L9VA 3K51A 1DLCA 3H9AA 5FREA 4KBZA 3VZNA 3PHMA 1ZM1A 3KV6A 3PUIA 2XWJB 2BWCA 1W04A 5F3EA 2VE1A 1KFXL 2JDAA 2OQ7A 2PHXA 4PI0A 1JW6A 2VOWA 1Z7S3 4MGSA 2XJVA 1MEC2 2PHTA 2XBO3 2ZABA 1MS1A 4Q29A 5BNNC 2E31A 3JUUA 4WM7C 3LWCA 3LIHA 1FOD1 4EQVA 4A2UA 4IV1C 4XTMA 1DGRN 4JZRA 5IVFA 1ULGA 1AR71 4DOUA 5FMOL 3WP3A 2Z5WA 1AL22 4LLOA 4AVCA 3FX3A 1ULOA 3KB5A 4B1MA 5J3UA 5DAVA 1QXPA 2XVKA 3IZOA 3M70A 1ASJ2 2XVGA 4D6QA 1GANA 2P3IA 1YJKA 5DUWA 1LNSA 1NA1A 3RZZA 1NT0A 2BBVA 3WHUA 2XJUA 1WBLA 2WA4A 5CFDC 2WSVA 4I01A 4IGQA 5FZ8A 5GLUA 1VAKA 4NVPA 1XC6A 3KZ4C 4PLOA 5FZOA 1NAEA 1JYXA 5KHKA 4WVMA 1GQGA 1GQPA 4CDQC 3WSOA 2WQZC 2Q4SA 4JHTA 1V9U1 1HLCA 2BNNA 1YQ2A 3OGSA 3N7JA 4QPIC 3H8XA 3AJYA 2JKBA 2YXSA 1W8TA 4AXOA 4LO7A 3FHIB 4Q4Y2 1NE6A 5F3GA 5F5IA 2BOIA 4AYUA 3OPZA 1JYNA 1OD5A 3I49A 4P9LA 1HB4A 1IZ3A 1WLCA 1LGNA 3VBFC 5CEHA 2MHFA 5JZGB 1GV9A 5A6XA 4BQ1A 5C3SA 3NAPB 3N9MA 1IS4A 5C3QA 1WUVA 3TEYA 2MEV3 5FZDA 4YW2A 5FZAA 1IKPA 1W2TA 3K75B 1CQ9A 2AEZA 5LRRA 3WG1A 2F17A 5FYYA 2ZZQA 3MIDA 5JAXA 1XE8A 3SH4A 3LSEA 5KC5A 1J1LA 4MUVA 5A3UA 4BB3A 3ETPA 4J1XA 3BVCA 3VBUA 3CZUA 5L73A 3SCHA 3CJIC 5HCHA 4N43B 3A21A 1C1LA 3GBGA 3BN6A 5H9QA 3MO4A 2VZ3A 3UK9A 4UFMA 2AUYA 4P9IA 1PO13 4F7ZA 3N9LA 2BZDA 3N7MA 4JGYB 3ENRA 1RHI2 1FT9A 1MS5A 1RUG2 3VZOA 5M0TA 4COUA 2RDNA 2WS91 3VGIA 2K46A 3W59A 1ZZ6A 2DFCA 2QQVA 1OURA 5DAXA 1NCQB 2UYAA 5FXXA 1LTEA 3IDBB 4ISQA 1G9CA 2RS31 3ILFA 5C9AA 3ZXFA 4FXGB 3RZHA 1SG3A 3VKLA 3KT7A 5LW9A 1OA3A 2IXCA 3KMHA 4QQ2A 1LRHA 3DUIA 3WNKA 3QCWA 1EUTA 3HOBA 2FMDA 4YFWA 5D1IA 3WQ0A 1P8JA 2WFF2 1J84A 1ZRIA 5BUVA 2ZAHA 5LA1A 2K0GA 1XU2A 4KG0A 2ZJCA 4OLLA 5C3PA 1UX6A 3T08A 4EWAA 5KR7A 4AEKA 5FPXA 5I8YA 4Q4V1 5IK4A 3HQXA 3H8UA 1YC61 4GB33 2VH9A 3AMPA 1A6CA 4HT1T 2R063 3KGZA 1PNGA 1UPSA 4XJUA 1RB8G 1OHFA 2WNVA 1NCRC 4ZXKA 1M06G 1UYXA 4J6GA 3BTZA 2OPWA 3VV1A 5L9RA 3GHNA 2FCUA 3MFAA 2WKKA 1UN1A 4BPZA 3F95A 3TN92 1RUE2 2WLQA 4ZU4A 1TNRA 4HOOA 3RS6A 1LU1A 3MIHA 5C3RA 4MHRA 2HWD1 2VTFA 3M7AA 3OOXA 5A32A 1SHWB 3V0AA 3M3IA 1ND3B 2XLAA 1V0AA 1LJ7A 3H50A 3T30A 5CISA 4UAPA 4I30A 5BNPA 2Q1FA 1B35C 1AF9A 1W2OA 3KLSA 4YVWC 2ZA9A 2WN2A 4IE0A 5A7OA 4HPKA 1JOPA 2YC0A 2GMEA 3O0XA 3H3UA 1F4HA 2CTVA 1WD3A 1ZRCA 3AYEA 3VHPA 3WZ1A 5A70A 2XHNA 2JDPA 5DABA 1ZZCA 2ZKNA 3POJA 4BYYA 2JDMA 3AKRA 3AZVA 3AVSA 3MDPA 1QNYA 2RJ2A 4LOTA 4QKNA 1FYUA 2WNUB 1PVC1 1AYM3 4JQRA 2OKXA 1PX4A 5DMYA 1RUNA 2DURA 4INDA 1HQWA 1OH3A 1R1A2 2RR12 2KD7A 5FV3A 3VBRA 3ZPYA 4JHZA 1PMJX 4YW6A 3IWZA 4CU9A 1HV0A 5H9PA 3VBHA 5GJ6A 3ZYPA 3IKWA 5FR3A 1DYPA 3EJKA 4A45A 1HIXA 4DXRA 2FDKA 2QQUA 2IXKA 2J1VA 4N7UA 2VCBA 4XJ9A 4X6RB 5HV0A 5FYUA 2HWE3 4MHUA 3GBWA 1XYOA 2EXHA 4LBQB 2CSGA 4XEZA 1UZYA 3PUHA 1RMU3 3MHZA 1T6GC 2WN3A 4HSLA 5A7WB 3AX4A 1F31A 4P02B 2QZ3A 2YU2A 4X8PA 5LB6A 3OUJA 3IB3A 1L3JA 4HN1A 5C3OA 5JSRA 1WD4A 4FPOB 1JZ8A 4IE7A 3LF7A 3OPWA 1W8UA 2VMHA 3H3ZA 2JDHA 3KQRA 3KV4A 4L9BA 3TRSB 3GZTB 3CU7A 4BU2A 2VVFA 1XNKA 1IS6A 3PUAA 3SH3A 1K42A 1BZWA 3ACGA 2WNVC 1AR82 3I54A 4QGMA 2LUWA 5JOXA 2DU1A 2R072 3BUCA 4FVVA 3VD4A 1REFA 1GWKA 2WZR1 4JQTA 2ZCWA 1LHWA 2AREA 2HWF3 1A3KA 1DGWA 1BK0A 2W3JA 1Y7BA 3T1LA 4Q0UA 1FX5A 4LBOA 3WCRA 5T5JA 2OXBA 4D94A 2VU9A 1PX3A 2GSYA 2PMWB 1C57A 2PYTA 4DXZA 4LQRA 5IUQA 1W6PB 5HV4A 4MH0E 5FWJA 2VBBA 1QJU3 3UKTA 1LHNA 1UYZA 2Q1MA 5LWBA 4QB1A 4AEJA 4OHXA 5BNOC 2XQRA 2Z69A 4L8QA 3C8XA 1SFNA 2VQAA 3ZFEC 2WZEA 3B7MA 4MGTA 4NPMA 3JU9A 5FMBA 2WR9A 5GLTA 4W50A 1MQTA 2VBDA 2TEPA 1W6NA 4H14A 3T2PA 1AL21 1COV2 1SQ4A 2FDJA 2W91A 3I59B 3INAA 4K40A 1AX2A 4LE4A 4KWUA 3ZYFA 4FAGA 1H2LA 2EIDA 1ASJ1 2Q8OA 1TNFA 4YPJA 5I0DA 2NQYA 1URXA 5A1LA 4MG2A 3VZLA 4Q4W3 5FP9A 2BNOA 2TBVA 1JUHA 2ZGUA 4CDWB 2VJXA 5JPNB 2CL2A 1VP6A 1MZEA 1RUC2 1X36A 2DVDA 3BGAA 3ON7A 1ZRFA 5LBFA 4KNCA 3RNSA 3FZ3A 3VBHC 2FD8A 4GH4A 2ZGTA 4ASKA 5A3LA 3EHKA 1N1YA 1PO23 2QQOA 3R6SA 2VVEA 4AGGA 2IZWA 4Y22A 3SCFA 4IL7A 5FOBB 1RVF3 1VBA2 4RS5A 4B4RA 2YY1A 2ZGPA 4GMP1 1CJDA 2Y6KA 2Z79A 3I3DA 3KM5A 3AL6A 4BJ0A 1HRV3 1W2NA 2SLIA 4TXWA 2ID4A 4N53B 5GZEA 2JG9B 4Q2FA 1TMF3 1VMHA 2X5IA 3OBTA 4IE4A 2R7EB 4QXBA 4LEJA 1RUF1 5FAXA 3QH7A 4RQPB 3K48A 2IUWA 5C70A 3O5SA 4NRMA 2DCKA 2ADDA 3AYDA 3OYWB 4TLGA 5FYMA 5D8AB 1UO9A 1MS9A 1DQ6A 5FY8A 3WEZA 2W9XA 1OOPB 4BISA 3JD72 2BVVA 1ZRDA 4CUBA 5SV5A 4MOAA 2UU8A 2XPJA 2OUJA 2G9FA 1CAUB 2W95A 2Y0OA 4BQ2A 5LCWL 2XOMA 1RTVA 1V6KA 3WCSA 3H1WA 2ZMKA 2VXJA 1PZ9A 3T1MA 4B7EA 3AC0A 1RUG1 3S57A 4IGOA 3I2GA 5FPAA 2CAUA 2WUHA 4MXWA 2HYXA 1OC1A 4XAEA 4CUCA 1CONA 5EJ1B 3RMXA 5JZGC 3EXUA 3DXTA 5FO9B 4MO3M 3R4UA 3U0ZA 4TTGA 1FOD3 3AP7A 1AR62 2RM22 1C4RA 4R9CA 4AI3A 1AR73 2Q8EA 1OQ1A 3HT2A 4YLZA 3WG3A 1S55A 2A70A 1FNYA 3E97A 2HKXA 2ZGLA 5L7OB 1UU4A 1G9BA 1VJ2A 1ALYA 1XU1A 1UXXX 2VNOA 3U07A 1XOYA 1W0OA 4TN7A 1GNZA 4XBLA 2X29A 1D7PM 1VLNA 2EF6A 4UWDA 2WFF1 3AP6A 5FUIA 2HYKA 4AHZA 1CR7A 4QU1A 1JZ6A 1PIV2 1QGLA 4EN6B 3ZXAC 1GZWA 4N43C 2QBXA 2XDVA 1BBT2 1UYPA 4HN0A 2ZXQA 1DQ5A 1V9U3 1QJY2 3D0JA 2NMOA 4QQOA 5KWRA 2RS12 1DZQA 3I3EA 2D93A 4XXPA 5FJHA 2VO5A 4M3CF 3VZJA 3CL1A 4GH4C 1W05A 1DZRA 3KQ4B 4QX8A 5IVCA 3V0BA 2VMFA 4GQ7A 5GLWA 2WL1A 2JG8A 3TN91 2VXRA 1BJQA 1GWLA 3ZO0B 1QJX2 3WG2A 1XPWA 4RS5C 3V64A 4IEXA 3SLIA 4FPHA 3ZIXA 5JSOA 1CESA 1J3PA 2QVSB 2NP0A 4AFMA 1SCSA 1X8MA 5JWPA 1C8M2 1UOJA 1J3QA 3I2OA 1EYBA 3PDQA 4LXLA 3PJQA 2IVJA 4HK8A 4QX7A 3WXPA 1HKDA 1GP5A 1S0FA 2X5IC 4K6BA 5I0SA 3POFA 4OMDA 3AYCA 3POIA 5JOZA 4S2HA 4XFGA 3USUB 4HBNA 5F9TA 1JZ2A 2G9GA 1N3PA 1ND2B 3VD7A 1H8TB 1S2KA 2Y6GA 5J37A 3NNFA 2YG0A 3HN1A 3RZJA 2Y33A 3ZMNA 1RUD1 3K4DA 1CAXA 1V6MA 4GZ9A 5FLJA 1W2AX 2MPFA 4C90A 3WX5A 4YM0A 1S0GA 4D69A 3FUOA 2RG4A 4CP9A 3BALA 1GWMA 1GSLA 2B9VA 5FMDA 4FPLA 1HDKA 2C9AA 4BLIA 1D4VB 4O9GA 2VOKA 5JXIA 4LMFA 1S4CA 3K46A 1DP0A 4QDQA 1HXS2 1X33A 4E4SA 5CADA 2YFZA 5FK7A 1R1A1 3RYPA 4FPKA 4UFJA 1YJLA 1LCLA 1ZBA1 2RS33 2J22A 2TUNA 2W1UA 3D82A 4CDUA 3OY8A 3R05A 3MYXA 1ND3C 4I2OA 4PI2A 3W9AA 1ZBE2 4AF9A 1WCKA 2VW0A 4RHV2 3PVEA 1J3RA 4CEWC 2YBSA 4FPYA 4ET7A 1HB1A 1SLBA 5FJKA 5LBCA 2A5ZA 4B7KA 3AMHA 4CA9A 1Y43B 5CFCB 4AE2A 5B2GB 1PK6A 3VL8A 5DDJ2 2WZPP 1JYWA 3WV6A 1QOOA 5T5LA 2BJSA 2GZWA 4I3GA 5C5TA 4Q4V3 4MX3A 2VMGA 4V2WA 2OZ6A 4TSVA 3J7NA 1NUKA 4KU8A 5IFPA 2QKDA 4ZU5A 3CO2A 2RJLA 2P3YA 4XIOA 2D6LX 3E5QA 3IM0A 2P3JA 3ETQA 3UGFA 1D4M1 4KH9A 4AHYA 2OZJA 3IPVA 5FYVA 4B4PA 3MEPA 4HVQA 3MLKA 1I5PA 5ACA2 2FHRA 1AR81 2PAKA 1U5IA 1O4TA 3TBDA 4UXAA 1LECA 2R071 1HQNA 4YGDA 3FHAA 2FCVA 1YUDA 5DXDA 5A3MA 4OHWA 4QDSA 5H9SA 1VBC1 3B01A 3BPZA 4QDRA 3WW2A 2YMZA 1E5RA 2CDOA 2HWD3 4HK9A 4UI9L 5IVEA 2ZEXA 2JXAA 3WUCA 4EZHA 4XBQA 2W68A 5A3NA 3GM8A 5EJ3A 1L7RA 2YYOA 1WMFA 2DUQA 4PLNA 1NKGA 5FZ3A 1K45A 4YZ5A 1ULCA 1OVSA 3I2IA 5FFOC 4OHYA 2Z42A 2OT7A 5GZFA 2DUPA 3VDAA 2VD7A 4DNYA 5D2AA 2PHUA 4NAOA 4LULA 1O59A 4JTNA 1PVXA 4ORFA 3OB8A 1LGBA 3GJAA 2BFUS 1NA1B 2ZHMA 1W0PA 2H0VA 1FATA 1PNFA 1VBD2 1FI2A 4M3CA 4QKFA 5HPOA 4LIUA 3P3NA 1R091 1S0IA 5FZOB 1VRH2 1GOHA 1GOFA 1HRI2 3ZPOA 4AFBA 2WYFA 1PVC3 3J8F3 1E57A 2VULA 1V6NA 2O14A 3VDCA 4CU6A 1KJRA 4W8JA 4E4HA 2AR6A 5FK8A 3ZXDA 5L9BA 2V09A 1RUC1 4DXTA 1UOGA 4LR4A 2P5BA 4E9KA 3WHTA 4E2QA 3THTA 4YZ3A 1O6UA 4NWWA 4Z07A 5GM0A 1GUIA 1QOSA 4QPGA 3PVBB 1I9RA 2ZGKA 4ZY9A 3N4MA 1VBA1 1BVVA 2XUMA 1GNHA 4WM8A 3R0RA 2AYHA 1QQP1 3FFQA 3ZFGA 2CHHA 5F32A 2GC0A 4YZ2A 4KGGA 2E33A 5JXHA 4NIDA 4CCEA 1CAWB 1O5LA 2WWSA 1YQCA 4WVVA 2PXJA 2YROA 5K8SA 3AP5A 3WG4A 3VBUB 2XH6A 1WWYA 1ULEA 4Y1XA 1O3RA 3B9IA 3A4UA 3KS7A 3ZM8A 4D7SA 2VNRA 1IS5A 1DBNA 4A7YA 5CA6A 5JMOA 3ZSLA 4CDXA 2WZR3 4GKYA 4WM7A 2PELA 3KD4A 4IV1A 1UAIA 3NW4A 3POBA 3JD71 1OPMA 4OCTA 3VHNA 2XKOA 3ACFA 5J09A 4BQ4A 5LZ6A 3VUOA 4XPVA 4YVSB 1DIWA 4PIYA 4AI8A 4CU7A 1OQDA 1IQAA 1STMA 3PNAA 4A6SA 5J96B 1TVGA 2ZEWA 4MYEA 1OA2A 2WABA 4ZS3A 1JZ3A 5CFDA 5FZEA 4BA6A 1QXJA 1OI6A 1NG0A 2PHLA 5A3OA 3OSDA 1TEIA 4H7LA 5C9AB 1GNYA 2DTWA 2E9QA 1OPOA 3N9QA 4MV2A 4O9EA 2BVBA 1DG6A 4Y24A 1DGRA 4XUQA 4M4RA 2VM9A 1W8HA 2BGCA 1AR61 2KA3A 2JG9C 2RM21 5GLVA 2AGSA 5EJZB 2QQLA 2UY8A 4NWVA 1AL23 1CZVA 4RQPC 4HKWA 1ASJ3 3PIGA 4GXLA 1RUOA 1PM7A 3SH5A 4AEMA 2H6BA 3M3EA 3LEMA 5DZFA 2EIEA 3VBFA 4EN8B 1HX6A 4P14A 1GQHA 1PIV1 1UKGA 1US2A 2VPVA 5FZ1A 4XAAA 1HJFA 2D6MA 1EAH2 1KD7A 1R1ZA 2G19A 1C3HA 2ERFA 3HQUA 4IQPA 3RJ2X 3S7EA 4CVUA 5F3IA 5JXJA 1QJY1 3H1MA 3UNPA 2RS11 1PGL2 3EB7A 3JQWA 4HG6B 4PQ9A 3WP4A 4PCRA 2WWUA 2YBPA 2ZS6B 4QD2A 4KWKA 5IK5A 3O1MA 2C4XA 5GZCA 2RMU2 2ZKLA 3PJYA 1OLMA 4RSUA 4LHNA 3FBYA 2O1QA 5A32B 4GMP3 3HBZA 1VBE1 3TEWA 1QJX1 1EPZA 4LO8A 3ZXKA 4C0BA 1UOBA 5BNPB 4IXLA 3MGUA 3WQ7A 1Z78A 2PN5A 2YV8A 4FPJA 4WM8C 5E89A 3RG0A 4R9BA 4HPKB 3VBOB 4AI0A 4MZUA 5L7OC 1C8M1 2AZ5A 1YEWA 1ZRRA 4AQTA 1SLAA 1RUF3 3AZWA 3APBA 2P34A 1I5ZA 3WNLA 3U4XA 4N9HA 1NX9A 4XW3A 1N1SA 3BB6A 1D0GA 4MGYE 1XXNA 3U14A 1HV1A 1UD1A 4AGRA 1QKQA 2GDFA 2FDFA 4Y4YA 3RSJA 4CDXC 3GYDA 2WT1A 4X8NA 5FY0A 2ZGMA 4AW7A 1XQNA 3NL1A 4IW3A 3GJBA 3M4FA 2W1WA 2W1SA 4EE2A 2G9ZA 1O3QA 3I3MA 1H2KA 4Q0QA 4IE6A 2A6WA 1NY71 2X8KA 3LEKA 3VBRB 1RUG3 4XJWA 4BH9A 4CU8A 3FMGA 1Q56A 1ST8A 3VKOA 4META 4GJYA 1YI9A 4A4AA 3BTXA 2YDEA 1A34A 5T5OA 1RUH2 1J83A 4QXCA 5J7MA 4LTAA 4BHPA 1N3OA 5FXWA 1M4WA 4QKBA 5FP8A 1W9SA 4H2AA 3HMYA 3PMEA 4LBQD 4QQLA 3TNQA 3WVJA 1TQ5A 3BYWA 1NYWA 1ZBE1 4MGQA 5A7SA 1NCRA 3MV11 2DCZA 4W6WA 5A33B 3CIHA 4KGQA 3GGLA 5C8CB 3HIFA 4HXCA 2MNGA 2WFF3 5DAQA 2J1SA 1POV0 3WNXA 1EV11 5DDJ1 2N7GA 1OKQA 2CU5A 1Q3EA 2R6QA 5K0UC 3CEWA 5C6CA 4Y1VA 2IXHA 3WNOA 5A6QA 3Q8FA 3ES1A 2ZEYA 3E6DA 3O12A 4OVEA 4RL7A 1UU5A 4ES9A 4ES8A 2V72A 3NNGA 4EWDA 1DU3D 1B35A 2YPDA 3NWKA 3IMMA 3H7YA 2TNFA 3G7DA 4YVWA 2PHFA 1PMHX 3ZSEA 4ARYA 4BQ3A 4UF0B 4HANA 4C1WA 4ASLA 2DU0A 2RS52 1WKYA 1IQDC 5CKNA 5ACA1 3MW2A 5KC6A 1YI7A 1SMVA 3LSDA 3TN93 4JRAA 4OFGA 5CAZA 2CWSA 4IEYA 3RMYA 3NVCA 1BEV2 4D3WA 4EN9B 1SDWA 4HL0A 1KEXA 2ET1A 4Y20A 2QQPA 2UWCA 2RDSA 4K8RB 2D3SA 2J1UA 4CYDA 3RYRA 1C1FA 4ZHNA 4RA0A 1W6MA 1V6JA 2JWPA 3NRUA 5GLZA 2AC1A 3LDKA 1GYKA 4NIIA 3RFRA 2O0OA 3E1F1 4JGZA 1ZYBA 2WO2A 4Y5Z0 4A7KA 3BPSA 3ZYBA 2IXIA 4GWIA 2BEOA 4NOTA 3ZLIA 4Q0SA 3BCWA 5EIYB 5I91A 4A3ZA 4LKFA 2KM2A 4D0QA 1SPPA 1W06A 4BXSV 2W5FA 2IVIB 2XBO2 1RUD3 2BWAA 2BOJA 3DECA 2ZAAA 5JVVA 2HWB2 1JU3A 2OPKA 4PT6A 3FUQA 1V6IA 2VW2A 1IPJA 1VBD1 4R52A 5IAXA 5FKCA 1VRH1 4UW5A 1HRI1 4BCUA 2JKXA 2RVAA 4FP3A 4JKMA 5FZMA 3H8OA 1YFWA 1KRIA 3RZLA 1SLLA 4XDQA 4XTPA 2W1QA 1XJAA 4E2SA 1R1A3 5E8AA 5A6YA 4BQ5A 3KV9A 2ZX2A 1ZBA3 4GWMA 1LENA 1V6OA 5LY2A 3LOIA 5GALA 3TWIA 3VHRA 1U12A 4BLJA 2CY6A 3LFIA 1VR3A 5LK7B 1AX1A 1ENQA 3I3QA 3DL3A 3GCXA 1IG0A 4CCLA 1IPSA 4QHBA 2Y8KA 1XE7A 1GBGA 2JICA 3VDDB 2A6XA 4CCDA 5CKQA 1TZOA 1OA4A 2D6OX 1XNCA 2WO1A 4UOJA 4U2AA 4DY3A 1H0BA 2VMEA 3PL0A 2C24A 2B46X 2Y38A 5JR2A 1N1TA 1OFSA 4L97A 2VUDA 3HNYM 1HN1A 1WCQA 4YGCA 3O1SA 4YNIA 1LAJA 2R0FA 3UKVA 1UMZA 5F6KA 4Q1PA 4HSJA 1D4M3 2B39A 5BNOA 5J48A 1UY2A 3LB9A 4DO0A 1AR83 3ZFEA 3DKQA 1W6OB 5KHIA 2R073 4Q4X2 2R30A 3OBRA 2BGOA 1CAVB 2B4KA 4QX3A 3X29B 4KWJA 1BVP1 2B5HA 4OZOA 3MLJA 1HB3A 1VBC3 3JB8A 5EQUA 3WF3A 4IV3A 1W9FA 1Q43A 2NLRA 2ZTNA 3VN4A 1ZZBA 5C4WB 4URTA 4IESA 1XNDA 3ZN6A 1BLZA 3MW3A 5LA0A 2HH9A 5JR7B 2D6KA 1H1AA 1ZA7A 1JZ4A 1E5HA 1W03A 4XFCA 2GN7A 1S2EA 2GP3A 4L0PA 1G8WA 4JGZC 3ROUA 1W90A 2RE9A 3R4DB 3THDA 3H0OA 1RUJ1 3MLLA 5EPAA 4AI1A 4HETA 1VMFA 3E5UA 3MIFA 2R1DA 4G3YC 4UFLA 2ZHLA 1H1IA 2BV4A 4OHVA 1SFPA 4GIQA 5F5AA 3O1UA 1GZWB 4HKOA 2ZHNA 5CVRA 1R093 3PUQA 4OQ9A 5FY1A 2ARCA 2DWRA 2GU9A 5BNQA 1JMUB 1CJPA 4I09A 4NJ4A 5CG8A 3A0KA 4XF9A 4HVOA 3U78A 3LIGA 1UY4A 3HT1A 4OI4A 1ENSA 4Z2AA 2H0BA 4LUKA 3O1TA 3CZJA 3L2YA 1EAH1 3BI3A 5FQ0B 3DGTA 1UWWA 1RUC3 3GCWA 3M2MA 4QB2A 4YVSC 5DG2A 4OI0A 5F2SA 3DYPA 1CIWA 5FZ0A 1PGL1 5IK8A 1JXNA 1Q5OA 1Q8SA 2XJRA 3O1OA 1EP0A 2VCMA 4ZONA 3SNMA 1WCUA 2YB7A 2RMU1 1WA6X 3OD0A 3AB0A 4OUMA 5IVBA 1VBA3 1T6BX 1LODA 3AFKA 2D6NA 1RJ8A 1QQP3 2DBNA 2E53A 2RV9A 2WDBA 1JHNA 2PLV2 4P9YA 1GFF2 5EXOA 2KXLA 3HNMA 3VKNA 4XF4A 2A3WA 4U36A 3QBQA 3DPRB 1BMV2 2VQUA 2PTMA 4AVVA 5E88A 4OULA 2CNAA 5EZWA 3T0DA 4GJZA 4UBHA 2WZ8A 3KV5A 1LR5A 3VLBB 4LT5A 4AGVA 3LA2A 3RQ0A 3NO8A 1UIJA 1CPNA 1RUI2 2NMNA 4HVRA 3KCXA 1SLIA 5JZGA 1UL9A 3LDRA 4N9IA 2I2SA 4LK6A 1NOVA 4Z8BA 1X9TA 1MEC1 4Z82A 1NZIA 2P17A 1K5MC 2VOVA 3VKMA 1V70A 4XMIA 4F83A 2V73A 3WP6A 1Y9GA 3JD73 3TAYA 1MS3A 2CGNA 5KHHA 3IAPA 1GP6A 1C8NA 1LULA 2ATFA 2XQXA 3O1RA 1LOBA 3RJRA 4IV3C 1NQDA 1XRUA 2WBKA 5A3PA 4PDWB 4A44A 4KBBA 1GU3A 1REDA 1JHJA 5A3TA 4E2GA 2EIGA 2O8QA 3AMNA 2Y6LA 1AL0G 4XF1A 5CIRA 1BKZA 2WNOA 3BOWA 2XR4A 5FO8B 3I3BA 1ODMA 4N43A 1RUH1 5IW0A 1OKOA 3JBG2 4H3WA 4ZKTB 2BDRA 4PIXA 4XDPA 5K4LA 1X7NA 3A22A 1FPN2 2RM23 4W65A 1OXCA 4QHOA 4B8EA 4JGYA 5LBEA 3I2DA 1Y9QA 4IEQA 5JI7A 4CRQA 2AH2A 5K9YA 5FY4A 2P37A 1JYVA 1PK6B 1AJKA 1H1MA 3IMNA 5ABJB 1J58A 4D6RA 3K4AA 4YGBA 3ZFFB 5JPMB 2EALA 3WW3A 1NCQA 4Q4Y1 5B4NA 5JCTA 2HWE2 2UWAA 1PIV3 1OUXA 2VC9A 4Z2WA 1VAVA 5T52A 5F5CA 4V1PA 3LGRA 1F5FA 3UV9A 1WW6A 1IS3A 5IAVA 2QQJA 3RRDA 1QJY3 2X10A 5EWSA 2GP5A 2RS13 2VBPA 3AL5A 3K3OA 1DGWX 4BDVB 1U5ZA 3HR9A 2GC2A 5FLIA 2X05A 3C2UA 2LRPA 4RR3B 1VMJA 1UQXA 4AL9A 2XL7A 3T2OA 4KG8A 4Q0PA 2VY0A 5LA9A 4A7ZA 3KWVA 1VBE3 1CGPA 1QJX3 1F2NA 3MPPG 5FP7A 5LK5A 4DY5A 1N3QA 3U11A 2DYCA 5I8SA 2HWF2 1C8M3 3LZZA 4FPCA 1O8PA 2E63A 3ELNA 3IDEA 3UL2A 2P2KA 3DYMA 5C8CC 1QEXA 2IXJA 2PHRA 3LOBA 1IOAA 3MPBA 4XQ4A 3K77A 4JDNA 1RHI1 2ZMNA 2VNVA 4ATFA 1LOEA 5FPBA 1IHMA 1CZSA 2W2IA 5EHDA 3VZKA 3THPA 2WQ8A 1SBFA 1PZ7A 2XWBB 4FCAA 4JV4A 1D0HA 2XL9A 3D0SA 3NAPC 4M3CB 4MLOA 1W9YA 4QB6A 1ND3A 1YIFA 3GXUA 4I02A 3POEA 1JZ5A 5EYXA 3JZVA 4UYBA 4CEYB 2HWB1 3N9OA 4CEWA 3MUY1 3RI9A 5C71A 3J9SA 1HB2A 2W94A 3ES4A 3FLPA 4AOCA 4XQWA 3T2QA 2R0HA 3OUHA 3OBZA 3N9PA 3KCYA 3AKSA 3K2OA 1YXWA 4O7XA 2C1FA 2DV9A 4ONUA 4UFKA 4L92A 4HLTA 5HCBA 3CQOA 4OYUA 4OQ8A 4Q4W2 1UZ0A 4EWEA 1VPHA 2F4LA 4K8FA 4LBJA 3UESA 5CU1A 3VBSB 2JDKA 4LA2A 1ZBE3 4FPFA 4LBNA 2ZGRA 1OF4A 2YC2A 1PGW2 1JODA 3VHOA 4C1XA 2WNUA 4NROA 2Q1ZB 4JGYC 4AK3A 5LEJA 4XCAA 3ZFGB 4Z92B 3HQRA 3T09A 3WR0A 3ZXGA 4LA3A 2CYFA 2LTNA 2VZRA 1EV13 4XZUG 5T3NA 3TB0A 5DDJ3 5BV6A 1O3SA 4M0NA 4TYSA 1KDMA 1NCQC 1RUE1 4W6YA 4XFIA 2J7MA 1POQA 1PGSA 2Q5TA 5FZ9A 1EY2A 5DPNA 3IAQA 3MZHA 3I2HA 3IIAA 5BNNB 2ORXA 4LBQA 2BQPA 2A6VA 2WAOA 3FFZA 4LORA 4WM7B 5A7WA 3N36A 4M3CE 2E7TA 3OF1A 4IGPA 4FQ4A 4IV1B 4RGKA 5ACA3 3USSA 3POGA 4RGAA 1POV1 4Q4X1 4CP0A 2VZSA 3AZYA 1ONAA 5A7QA 4AEDB 4Y4RA 4R4XA 1A78A 4GD4A 3NJYA 1OD3A
chains in the Genus database with same CATH topology
3ACFA 3A21A 3BN6A 3MO4A 2VZ3A 4CU7A 1UY1A 1TVGA 2VL4A 2ZEWA 2BZDA 2E26A 2V4VA 2WABA 2XONA 2Y6HA 2J1AA 3JXSA 1JZ3A 4BK5A 3OGVA 3OGRA 1GNYA 3OG2A 4RN5A 4XUQA 3HJRA 4M4RA 2VM9A 2W87A 2YC4A 5EJZB 2QQLA 3ECQA 1CZVA 1OH4A 1SG3A 3F2ZA 2JD9A 3WNKA 2J1EA 2BGPA 3VD3A 2VOTA 3VD9A 1EUTA 3HOBA 2VCCA 2EIEA 2VQTA 1P8JA 3ACHA 1J84A 5LA1A 1US2A 3T08A 4CVUA 4KI5M 2QQNA 5JXJA 1JI6A 2V5DA 3UNPA 3EB7A 4DEVA 4HG6B 1UY3A 2C4XA 3C7FA 1UYXA 4QX2A 3VD5A 3THCA 3SKVA 3FHQA 2Y6JA 2VTFA 3C7GA 3MBWA 1W9TA 1SHWB 4DEQA 2W46A 4UAPA 3WNLA 4LKSA 1NX9A 3WF1A 2C9KA 2WN2A 2Y64A 5A1AA 1F4HA 1TG7A 2VZ1A 1SDDB 3NJVA 4JKKA 3IIIA 2W1WA 2W1SA 5IJRA 2XHNA 4MADA 2LW8A 1RYYA 3LEKA 4AAXA 2JE8A 4CU8A 3WF2A 4A4AA 3I2JA 2RJ2A 1UXZA 1J83A 2OKXA 3FL7A 1PX4A 5DMYA 4DXSA 4DUVA 4CUAA 2KD7A 1ULPA 4JHZA 1PMJX 1W9SA 4CU9A 4XUNA 4A45A 4DXRA 4MGQA 3MV11 2J1VA 2Z4FA 2VCBA 3CIHA 3GGLA 4XUTA 2WYSA 5DN2A 2J1SA 3PUHA 1EUUA 2WN3A 4JX0A 2VCAA 4P02B 3WNOA 3I2KA 3W5MA 4E8DA 1K3IA 3IB3A 4QX0A 2ZEYA 2V72A 3NNGA 4E8CA 3MUZ1 3IDAA 1JZ8A 1T2XA 4ARYA 1PMHX 1WKYA 1IQDC 4IUGA 1K42A 3ACGA 2W47A 5IHRA 3U37A 3WF0A 3VD4A 1KEXA 3OEBA 1O8SA 2W3JA 2J1UA 2QQKA 2J1TA 3NRUA 1PX3A 3E1F1 2WO2A 4LQRA 4PF1A 1BHGA 4A41A 3LEGA 4GWIA 1UYZA 4QB1A 5EIYB 4DUWA 3C8XA 3LPGA 4A3ZA 4D0QA 2WZEA 4BXSV 5J1XA 4JKLA 1UX7A 2W5FA 3DECA 3J7HA 4W50A 1UMHA 3LQCA 1JU3A 2VZVA 4PT6A 3T2PA 4KWUA 2W91A 3UETA 2VMCA 2EIDA 4QX1A 3HN3A 4YPJA 2JKXA 2RVAA 4JKMA 3NJXA 5I0DA 3I97A 3DYOA 2W1QA 1W99A 1W8NA 5C7GA 2QQMA 3OBAA 1JZ7A 2ZEZA 2VJXA 1W0NA 5F7UA 1K12A 3BGAA 5IFTA 3I2FA 4P00B 1DYOA 4DUXA 2Y8KA 5JXGA 2QQOA 3EYPA 4BK4A 2WO1A 4UOJA 1KGYA 2VMEA 2Y6KA 4XVHA 5JR2A 3I3DA 3HNYM 4BJ0A 1HN1A 1WCQA 4TXWA 4W4ZA 2ID4A 2LS6A 5CZKA 2R7EB 2DCJA 4P08A 3ABZA 4OMCA 1UY2A 5C70A 3T0AA 2DCKA 4LPLA 4QX3A 2BGOA 2B4KA 1GMMA 4OZOA 3WEZA 2W92A 2CDPA 2VZTA 2W9XA 3WF3A 1XNTA 4CUBA 4MOAA 5LA0A 2W95A 5LCWL 4ZZ5A 2XOMA 3C7OA 5B4XA 3MV01 1JZ4A 3AC0A 2VZPA 1L7QA 4L0PA 3I2GA 2WUHA 3THDA 2HYXA 4CUCA 3D3AA 4XUOA 1OT5A 5EJ1B 1CIYA 3P1IA 4MO3M 4TTGA 3SEPA 1UYYA 5CYYA 4LHSA 3T0BA 2E32A 1UXXX 2BBAA 2ORZA 3A23A 3OEAA 1D7PM 2VZOA 1UY4A 5FUIA 4Z2AA 1JZ6A 3CZJA 2VR4A 4PQQA 1UWWA 4QB2A 1US3A 2QBXA 3DYPA 2ZXQA 2C26A 3I3EA 2YB7A 2VO5A 3WNPA 4ARXA 2VMFA 2L9LA 2RV9A 2WDBA 3HNMA 1XPWA 4P5YA 2VQUA 3T0DA 1W8OA 2WZ8A 1W9WA 4OMDA 5G05L 1JZ2A 3P6BA 3C7HA 2EIBA 3VD7A 2Y6GA 2YFUA 2YG0A 3CMGA 3IAPA 2XQXA 1JU4A 4A6OA 3VDBA 3K4DA 2WBKA 4GZ9A 4ZXEA 4A44A 1F4AA 1GU3A 1JHJA 4OUEA 2B9VA 2Y6LA 5IYYA 3FN9A 5DQ0A 3I3BA 5JXIA 4D8MA 4QDQA 3K46A 1DP0A 2WAAA 1H6YA 2EICA 2YFZA 4M4PA 4QAWA 3WQBA 3WNNA 3A22A 3HNBM 2VMDA 5HXMA 2W1UA 2J22A 1JYVA 5LA2A 2PQSA 3CKHA 1OF3A 3WF4A 2BERA 1MPXA 3ACIA 3K4AA 4ET7A 1GOGA 5B4NA 4QPWA 1JYWA 5JUVA 2VC9A 3WNMA 1UY0A 4XURA 2VZQA 2QQJA 2X10A 3LE0A 3LEIA 1NUKA 3C7EA 5IFPA 4BDVB 3K4ZA 2X05A 1UMIA 3T2OA 1I5PA 4XUPA 4KMQA 3FHAA 4RYDA 3A7QA 4QDSA 3HEIA 3NQHA 4QDRA 4ZZ8A 3CDZB 2CDOA 2QQIA 4UI9L 2ZEXA 3LPFA 1CX1A 1O8PA 4A42A 3GM8A 5G04L 3DYMA 1L7RA 1DLCA 1NKGA 1K45A 3K77A 1XNAA 3HPNA 3I2IA 3PUIA 1CZSA 2WQ8A 2JDAA 3VDAA 4MGSA 4QB6A 2E31A 3GXUA 1JZ5A 1O59A 3OB8A 3MUY1 3SEEA 5C71A 2W94A 1ULOA 3SKJE 5HPOA 1GOHA 3T2QA 1GOFA 1LNSA 3VDCA 2WO3A 4AG4A 1H6XA 4CU6A 3CQOA 4OYUA 4W8JA 1UZ0A 1XC6A 1JYXA 1NAEA 3UESA 4DXTA 1GQPA 1OF4A 2YC2A 3WSOA 2X09A 4FI9A 1YQ2A 3OGSA 3T09A 1GUIA 2VZRA 4XZUG 4ZY9A 1JYNA 2J7MA 2DDUA 2VZUA 2HLEA 3W5NA 5DPNA 3IAQA 2J1RA 3GDBA 3I2HA 2ORXA 2E33A 5JXHA 2WAOA 3K75B 1CZTA 3ZM8A 2VZSA 5JMOA 1R64A 3ETPA 4GWJA 3CZUA 1OD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACF A;  3A21 A;  3BN6 A;  3MO4 A;  2VZ3 A;  4CU7 A;  1UY1 A;  1TVG A;  2VL4 A;  2ZEW A;  2BZD A;  2E26 A;  2V4V A;  2WAB A;  2XON A;  2Y6H A;  2J1A A;  3JXS A;  1JZ3 A;  4BK5 A;  3OGV A;  3OGR A;  1GNY A;  3OG2 A;  4RN5 A;  4XUQ A;  3HJR A;  4M4R A;  2VM9 A;  2W87 A;  2YC4 A;  5EJZ B;  2QQL A;  3ECQ A;  1CZV A;  1OH4 A;  1SG3 A;  3F2Z A;  2JD9 A;  3WNK A;  2J1E A;  2BGP A;  3VD3 A;  2VOT A;  3VD9 A;  1EUT A;  3HOB A;  2VCC A;  2EIE A;  2VQT A;  1P8J A;  3ACH A;  1J84 A;  5LA1 A;  1US2 A;  3T08 A;  4CVU A;  4KI5 M;  2QQN A;  5JXJ A;  1JI6 A;  2V5D A;  3UNP A;  3EB7 A;  4DEV A;  4HG6 B;  1UY3 A;  2C4X A;  3C7F A;  1UYX A;  4QX2 A;  3VD5 A;  3THC A;  3SKV A;  3FHQ A;  2Y6J A;  2VTF A;  3C7G A;  3MBW A;  1W9T A;  1SHW B;  4DEQ A;  2W46 A;  4UAP A;  3WNL A;  4LKS A;  1NX9 A;  3WF1 A;  2C9K A;  2WN2 A;  2Y64 A;  5A1A A;  1F4H A;  1TG7 A;  2VZ1 A;  1SDD B;  3NJV A;  4JKK A;  3III A;  2W1W A;  2W1S A;  5IJR A;  2XHN A;  4MAD A;  2LW8 A;  1RYY A;  3LEK A;  4AAX A;  2JE8 A;  4CU8 A;  3WF2 A;  4A4A A;  3I2J A;  2RJ2 A;  1UXZ A;  1J83 A;  2OKX A;  3FL7 A;  1PX4 A;  5DMY A;  4DXS A;  4DUV A;  4CUA A;  2KD7 A;  1ULP A;  4JHZ A;  1PMJ X;  1W9S A;  4CU9 A;  4XUN A;  4A45 A;  4DXR A;  4MGQ A;  3MV1 1;  2J1V A;  2Z4F A;  2VCB A;  3CIH A;  3GGL A;  4XUT A;  2WYS A;  5DN2 A;  2J1S A;  3PUH A;  1EUU A;  2WN3 A;  4JX0 A;  2VCA A;  4P02 B;  3WNO A;  3I2K A;  3W5M A;  4E8D A;  1K3I A;  3IB3 A;  4QX0 A;  2ZEY A;  2V72 A;  3NNG A;  4E8C A;  3MUZ 1;  3IDA A;  1JZ8 A;  1T2X A;  4ARY A;  1PMH X;  1WKY A;  1IQD C;  4IUG A;  1K42 A;  3ACG A;  2W47 A;  5IHR A;  3U37 A;  3WF0 A;  3VD4 A;  1KEX A;  3OEB A;  1O8S A;  2W3J A;  2J1U A;  2QQK A;  2J1T A;  3NRU A;  1PX3 A;  3E1F 1;  2WO2 A;  4LQR A;  4PF1 A;  1BHG A;  4A41 A;  3LEG A;  4GWI A;  1UYZ A;  4QB1 A;  5EIY B;  4DUW A;  3C8X A;  3LPG A;  4A3Z A;  4D0Q A;  2WZE A;  4BXS V;  5J1X A;  4JKL A;  1UX7 A;  2W5F A;  3DEC A;  3J7H A;  4W50 A;  1UMH A;  3LQC A;  1JU3 A;  2VZV A;  4PT6 A;  3T2P A;  4KWU A;  2W91 A;  3UET A;  2VMC A;  2EID A;  4QX1 A;  3HN3 A;  4YPJ A;  2JKX A;  2RVA A;  4JKM A;  3NJX A;  5I0D A;  3I97 A;  3DYO A;  2W1Q A;  1W99 A;  1W8N A;  5C7G A;  2QQM A;  3OBA A;  1JZ7 A;  2ZEZ A;  2VJX A;  1W0N A;  5F7U A;  1K12 A;  3BGA A;  5IFT A;  3I2F A;  4P00 B;  1DYO A;  4DUX A;  2Y8K A;  5JXG A;  2QQO A;  3EYP A;  4BK4 A;  2WO1 A;  4UOJ A;  1KGY A;  2VME A;  2Y6K A;  4XVH A;  5JR2 A;  3I3D A;  3HNY M;  4BJ0 A;  1HN1 A;  1WCQ A;  4TXW A;  4W4Z A;  2ID4 A;  2LS6 A;  5CZK A;  2R7E B;  2DCJ A;  4P08 A;  3ABZ A;  4OMC A;  1UY2 A;  5C70 A;  3T0A A;  2DCK A;  4LPL A;  4QX3 A;  2BGO A;  2B4K A;  1GMM A;  4OZO A;  3WEZ A;  2W92 A;  2CDP A;  2VZT A;  2W9X A;  3WF3 A;  1XNT A;  4CUB A;  4MOA A;  5LA0 A;  2W95 A;  5LCW L;  4ZZ5 A;  2XOM A;  3C7O A;  5B4X A;  3MV0 1;  1JZ4 A;  3AC0 A;  2VZP A;  1L7Q A;  4L0P A;  3I2G A;  2WUH A;  3THD A;  2HYX A;  4CUC A;  3D3A A;  4XUO A;  1OT5 A;  5EJ1 B;  1CIY A;  3P1I A;  4MO3 M;  4TTG A;  3SEP A;  1UYY A;  5CYY A;  4LHS A;  3T0B A;  2E32 A;  1UXX X;  2BBA A;  2ORZ A;  3A23 A;  3OEA A;  1D7P M;  2VZO A;  1UY4 A;  5FUI A;  4Z2A A;  1JZ6 A;  3CZJ A;  2VR4 A;  4PQQ A;  1UWW A;  4QB2 A;  1US3 A;  2QBX A;  3DYP A;  2ZXQ A;  2C26 A;  3I3E A;  2YB7 A;  2VO5 A;  3WNP A;  4ARX A;  2VMF A;  2L9L A;  2RV9 A;  2WDB A;  3HNM A;  1XPW A;  4P5Y A;  2VQU A;  3T0D A;  1W8O A;  2WZ8 A;  1W9W A;  4OMD A;  5G05 L;  1JZ2 A;  3P6B A;  3C7H A;  2EIB A;  3VD7 A;  2Y6G A;  2YFU A;  2YG0 A;  3CMG A;  3IAP A;  2XQX A;  1JU4 A;  4A6O A;  3VDB A;  3K4D A;  2WBK A;  4GZ9 A;  4ZXE A;  4A44 A;  1F4A A;  1GU3 A;  1JHJ A;  4OUE A;  2B9V A;  2Y6L A;  5IYY A;  3FN9 A;  5DQ0 A;  3I3B A;  5JXI A;  4D8M A;  4QDQ A;  3K46 A;  1DP0 A;  2WAA A;  1H6Y A;  2EIC A;  2YFZ A;  4M4P A;  4QAW A;  3WQB A;  3WNN A;  3A22 A;  3HNB M;  2VMD A;  5HXM A;  2W1U A;  2J22 A;  1JYV A;  5LA2 A;  2PQS A;  3CKH A;  1OF3 A;  3WF4 A;  2BER A;  1MPX A;  3ACI A;  3K4A A;  4ET7 A;  1GOG A;  5B4N A;  4QPW A;  1JYW A;  5JUV A;  2VC9 A;  3WNM A;  1UY0 A;  4XUR A;  2VZQ A;  2QQJ A;  2X10 A;  3LE0 A;  3LEI A;  1NUK A;  3C7E A;  5IFP A;  4BDV B;  3K4Z A;  2X05 A;  1UMI A;  3T2O A;  1I5P A;  4XUP A;  4KMQ A;  3FHA A;  4RYD A;  3A7Q A;  4QDS A;  3HEI A;  3NQH A;  4QDR A;  4ZZ8 A;  3CDZ B;  2CDO A;  2QQI A;  4UI9 L;  2ZEX A;  3LPF A;  1CX1 A;  1O8P A;  4A42 A;  3GM8 A;  5G04 L;  3DYM A;  1L7R A;  1DLC A;  1NKG A;  1K45 A;  3K77 A;  1XNA A;  3HPN A;  3I2I A;  3PUI A;  1CZS A;  2WQ8 A;  2JDA A;  3VDA A;  4MGS A;  4QB6 A;  2E31 A;  3GXU A;  1JZ5 A;  1O59 A;  3OB8 A;  3MUY 1;  3SEE A;  5C71 A;  2W94 A;  1ULO A;  3SKJ E;  5HPO A;  1GOH A;  3T2Q A;  1GOF A;  1LNS A;  3VDC A;  2WO3 A;  4AG4 A;  1H6X A;  4CU6 A;  3CQO A;  4OYU A;  4W8J A;  1UZ0 A;  1XC6 A;  1JYX A;  1NAE A;  3UES A;  4DXT A;  1GQP A;  1OF4 A;  2YC2 A;  3WSO A;  2X09 A;  4FI9 A;  1YQ2 A;  3OGS A;  3T09 A;  1GUI A;  2VZR A;  4XZU G;  4ZY9 A;  1JYN A;  2J7M A;  2DDU A;  2VZU A;  2HLE A;  3W5N A;  5DPN A;  3IAQ A;  2J1R A;  3GDB A;  3I2H A;  2ORX A;  2E33 A;  5JXH A;  2WAO A;  3K75 B;  1CZT A;  3ZM8 A;  2VZS A;  5JMO A;  1R64 A;  3ETP A;  4GWJ A;  3CZU A;  1OD3 A; 
#chains in the Genus database with same CATH topology
 1W8F A;  4M00 A;  5LEK A;  3ATG A;  4ASM B;  1AHS A;  5AC9 2;  3ZYR A;  2ZGQ A;  1XYN A;  4CDQ B;  4KQ7 A;  4B29 A;  5FYI A;  2OYZ A;  2Y6H A;  3E5X A;  2XJQ A;  3JXS A;  5A80 A;  2J1A A;  3VDD C;  3W58 A;  3B93 A;  3OGR A;  3OGV A;  4IEV A;  2WS9 3;  2WWJ A;  1W8W A;  4NE9 A;  4QPI B;  3WIN E;  5BYN A;  3OG2 A;  4OUS A;  3JQX A;  2RR1 1;  2DVB A;  1LHO A;  2VG9 A;  4RN5 A;  1QIQ A;  4KL1 A;  2XB6 C;  2RDR A;  3S5Q A;  1YIP A;  1W6P A;  1BK1 A;  1UZZ A;  4CE8 A;  1FOD 2;  1VBD 3;  2WIN B;  4XIL A;  1VRH 3;  2WC2 A;  1HRI 3;  2BGP A;  2VOT A;  3VD9 A;  2P6H A;  3CNA A;  4MXV A;  1RXG A;  4R9D A;  5FKB A;  4CP1 A;  1IGO A;  3ACH A;  4AVB A;  2OVU A;  3GZU C;  4GUL A;  2BFU L;  3SIS A;  1NZC A;  1Z0H A;  2I07 B;  1ENR A;  4FFH A;  4FQZ A;  1UIK A;  2PAM A;  2E51 A;  3DKW A;  3ZX7 A;  2V5D A;  2DF7 A;  4FPG A;  3CJI B;  4DEV A;  2K2S A;  1UY3 A;  2OS2 A;  1H4H A;  2D6P A;  3POS A;  4OHZ A;  1H4G A;  3E6C C;  4CTE A;  4MGK E;  2A6Z A;  4AQS A;  2WNU C;  4FOW A;  4YW4 A;  4BOW A;  5FZB A;  4CDW A;  3C7F A;  2K9Z A;  2FDI A;  2ENR A;  4FTS A;  2R32 A;  3C3V A;  4N7I A;  3UJO A;  2PLV 1;  5EV7 A;  2D40 A;  3WDY A;  3RYK A;  1REE A;  3I4I A;  3SKV A;  2W0X A;  1ZZ7 A;  1UNB A;  2NN8 A;  1MVQ A;  4QGN A;  2DFB A;  2Y6J A;  5FZH A;  3QD6 A;  1WLD A;  3C7G A;  3MBW A;  4XCB A;  1W9T A;  3TNP B;  4AFC A;  4DEQ A;  3B94 A;  2W46 A;  4F3J A;  4BQX A;  4ISR A;  2JE7 A;  1RUI 1;  4Q8K A;  4XET A;  3WW1 A;  4LKS A;  2W39 A;  3B9C A;  3ALQ A;  2EXJ A;  1C5H A;  3T4V A;  2Y64 A;  4LE3 A;  3T2T A;  3OJB A;  3WDV A;  4N53 A;  5IWF A;  2JG9 A;  1H30 A;  4XBN A;  2PFW A;  4XHB A;  4DRR A;  3H1Y A;  1MS8 A;  1SDD B;  1W3X A;  3K3N A;  3NJV A;  4NMI A;  5FLH A;  4RQP A;  1LB2 A;  1QHD A;  3M3O A;  1JYT A;  3WP5 A;  4GWN A;  1CWP A;  1COV 1;  3OYW A;  3AYA A;  1WME A;  1UZW A;  3NMB A;  5D8A A;  2LW8 A;  4AFA A;  4XMA A;  2JE8 A;  1W6Q A;  4WVM B;  2YPJ A;  3AKP A;  1KFU L;  3DV8 A;  3SMH A;  1RUJ 3;  4CSW A;  3JBG 1;  1NCR B;  2J42 A;  2YGM A;  5JIA A;  5FY5 A;  2Q0A A;  5I0T A;  4DXS A;  5A3W A;  1W28 A;  1FPN 1;  3POW A;  3DPR C;  5FMC A;  5A7N A;  3W20 A;  1ULP A;  4DUV A;  1I1E A;  3BTY A;  1F9K A;  3NKT A;  1S0C A;  1ULD A;  2HBU A;  4NHL A;  4FO9 A;  2GC1 A;  2ZX4 A;  4C8D A;  4Z1V A;  2Z4F A;  4FPE A;  2ZGO A;  4NPL A;  3FJS A;  1WA4 A;  3NV4 A;  4XUT A;  2ZX3 A;  2WYS A;  4IEW A;  2HWE 1;  5AVP A;  4EV0 A;  2GH8 A;  5GZG A;  3P5B A;  1B35 B;  1EUU A;  4CCK A;  2VCA A;  3EO6 A;  1EAH 3;  2GNB A;  2HWC 2;  4NUB A;  3TEZ A;  5F39 A;  4D7T A;  1H2N A;  5L7O A;  3I2K A;  2D97 A;  3B5L B;  4RFR B;  1JYC A;  2XJT A;  5HCA A;  1PM4 A;  1SFY A;  3UJQ A;  4HMZ A;  3KF5 A;  3MUZ 1;  4BXF A;  1T2X A;  3AFG A;  1V00 A;  4K9S A;  3WDX A;  2BW8 A;  3KGL A;  1WLW A;  2RMU 3;  2P1B A;  2JDZ A;  1UCX A;  1RXF A;  4CCM A;  2DVF A;  1G9F A;  2W47 A;  5IHR A;  4CDW C;  3U37 A;  3WF0 A;  1ZVF A;  5FUP A;  2OUH A;  3HWJ A;  1OUS A;  4Q26 A;  4XF3 A;  2ZAC A;  1O8S A;  1SZB A;  2QQW A;  4Y3O A;  3IN9 A;  1VBB 2;  3DN7 A;  2J1T A;  1FV3 A;  1QH7 A;  5ABJ C;  2XHK A;  2FQP A;  4BE3 A;  5JOY A;  3L9J T;  1UW8 A;  1G86 A;  2DUO A;  4IE5 A;  1Q8V A;  3AP9 A;  3ZFF C;  5F1R A;  2NZ9 A;  1YQ5 A;  2JB8 A;  3WQ1 A;  4A41 A;  4CXY A;  4P5H A;  1R08 2;  4HZF A;  1MEC 3;  4K1Y A;  4NHM A;  2A6Y A;  4DUW A;  1DDL A;  3LPG A;  1QU0 A;  3B69 A;  3CF6 E;  4K21 A;  4YAR A;  1WMX A;  4UW3 A;  5J1X A;  4N53 C;  1UX7 A;  3FBM A;  3GZA A;  1NLQ A;  3ST7 A;  2CAV A;  2EAK A;  4O65 A;  1CD3 G;  2ZPX A;  3BOD A;  3LQC A;  4S2D A;  2A3X A;  2VZV A;  3RWK X;  3USU A;  3UET A;  4YZ1 A;  2BRT A;  3SC7 X;  1RJ7 A;  2VMC A;  3NKG A;  1ND2 A;  2QTW B;  4QHZ A;  2JEN A;  2PA7 A;  2ZBJ A;  5D8A C;  3HN3 A;  2A71 A;  3LA3 A;  2OII A;  5FZ4 A;  5K0U A;  2IXL A;  1RUH 3;  1UKR A;  1YFX A;  2D98 A;  2G1M A;  3V65 A;  3DYO A;  3ILR A;  1OOP C;  3E6B A;  3J8F 2;  4QQH A;  3OBA A;  2WNV B;  4P9X A;  4ITC A;  1AR9 2;  4BM8 A;  2ZEZ A;  2ZOE B;  1BBT 1;  5KHJ A;  5FCC A;  1VAL A;  1W0N A;  4B1L A;  5F7U A;  1K12 A;  1PGW 1;  1QDC A;  5IFT A;  3I2F A;  4PLM A;  3N9N A;  4DUX A;  4Q4Y 3;  2JIJ A;  3ZXE A;  4YM2 A;  3OTF A;  4PJY A;  3URF A;  4NPR A;  1LOG A;  1JYI A;  2XLG A;  4XIK A;  3EYP A;  1OBN A;  3V0A B;  1WMD A;  4BK4 A;  4IEP A;  4CCJ A;  2BU9 A;  1AZD A;  3BOP A;  4LBM A;  4WZF A;  2Q8D A;  3WLU A;  4CPB D;  4YFZ A;  2XUE A;  3DF0 A;  4CEY C;  2VW1 A;  4Y26 A;  1WGP A;  1PMI A;  5DZE A;  4TLF A;  4ZS2 A;  5CFC A;  2IC1 A;  4F8A A;  2LS6 A;  2B9U A;  3AZZ A;  2ZZJ A;  4L2N A;  5DUV A;  2FBE A;  5E1R A;  5CBL A;  4IER A;  2DCJ A;  4P08 A;  3ABZ A;  4JDM A;  3T0A A;  4TZD A;  3N3H A;  3JCI A;  4LPL A;  2JB4 A;  4LNV A;  5HCF A;  2DVG A;  5APA A;  2Z2S B;  1XB9 A;  3ZVX A;  2CGP A;  1GMM A;  4MVT A;  3D5O A;  2F4P A;  2R04 2;  3GHM A;  4YWA A;  2V5Y A;  3U4S A;  4BQY A;  2W92 A;  5C33 A;  5F37 A;  2VZT A;  2WZR 2;  1XNT A;  2VVD A;  4FXK B;  1UU6 A;  1RIT A;  3RZG A;  4HKL A;  4DIN B;  5AC9 1;  4R4Z A;  1KXG A;  4ZZ5 A;  1AXY A;  1QXR A;  1NE4 A;  3OPT A;  1A8D A;  3SXW A;  5FDB A;  4DZG A;  4GAZ A;  1RHI 3;  4N8M A;  3DEM A;  4AVA A;  4IET A;  1VIW B;  1BXH A;  1DYK A;  2VZP A;  4LJH A;  4H7M A;  3VBH B;  1SAC A;  2BP6 A;  2DVA A;  4EN7 B;  1LES A;  3CLP A;  1HXS 1;  4NHK A;  5DUX A;  4IEZ A;  5DG1 A;  2D3P A;  4AAP A;  3BIW E;  3R4S A;  4E4Z A;  3D3A A;  1OT5 A;  1CIY A;  1DF0 A;  4NIA A;  4PBO A;  1ZX5 A;  1WW4 A;  2D5H A;  4K1Z A;  2E7A A;  3AJZ A;  3SEP A;  2HWB 3;  3ZR5 A;  1CN1 A;  3ME2 A;  3QOP A;  4RHV 1;  4UW4 A;  2P3K A;  1N47 A;  4LHL A;  2BBA A;  3PVO A;  3PTY A;  3A23 A;  3Q8B A;  1TME 2;  4JCK A;  4AED C;  5FO7 B;  2VZO A;  1AYN 2;  1ND2 C;  5SV8 A;  1H8T C;  4QPY A;  3ZMO A;  3OUI A;  4NO4 A;  2XML A;  4MGI E;  4BIO A;  5F6L B;  2IFR A;  4E27 A;  2VUJ A;  2AEN A;  2NYY A;  3Q8E A;  3PVN A;  5DAP A;  2QZ2 A;  5JMC A;  1US3 A;  4Q8L A;  2ET7 A;  1QF3 A;  1TE1 B;  1KJL A;  2C26 A;  4CCN A;  3RZK A;  1QH6 A;  2ES3 A;  4XZP A;  2VEC A;  4PHZ A;  3RDI A;  3IBM A;  3AXD A;  3WY6 A;  3LDB A;  2Q8C A;  3UT0 A;  3ZXJ A;  1DCS A;  2EVX A;  5LAS A;  4ARX A;  3NNJ A;  4K7J A;  1RUE 3;  3AM2 A;  4HFS A;  4NRQ A;  1X50 A;  2L9L A;  1CPM A;  1O91 A;  1SLT A;  4TWT A;  3IT8 A;  4Q5O A;  4LUM A;  1LOA A;  1MS4 A;  3PU3 A;  4XQD A;  1APN A;  3RGB A;  3ZSM A;  1LHV A;  4FAH A;  2XJS A;  4J25 A;  1JS9 A;  5FYS A;  1YQ8 A;  1FMD 2;  1GIC A;  2A73 B;  1JTZ X;  4HON A;  1W8O A;  4XFA A;  2WT2 A;  1JBC A;  5CFC C;  2CWM A;  1POV 3;  4Q4X 3;  1MQT B;  1RUF 2;  1IPK A;  1W6N B;  2WII B;  2WA3 A;  4R9A A;  1VRB A;  5FMO S;  1CX4 A;  4LLF A;  3P6B A;  4D6S A;  2E6V A;  4DPN A;  3BKZ A;  1CAW A;  3P3P A;  4L99 A;  1PHM A;  2EIB A;  3D4K A;  1Z7S 2;  3ZKU A;  5FPZ A;  3WDW A;  4ZPI A;  2JEM A;  4I0A A;  1JU4 A;  5JLV A;  4QU2 A;  1HQL A;  3GBF A;  3VDB A;  3Q8C A;  4Q1R A;  5H9R A;  4XAC A;  1AJO A;  1S0E A;  2GC3 A;  2QNK A;  1AXK A;  4FOQ A;  4PF5 A;  4XHX A;  4ZXE A;  1YLL A;  4LO4 B;  3H3L A;  4AHW A;  4OUE A;  4GKX A;  5I0R A;  3NV2 A;  5JIU A;  5IYY A;  3M3Q A;  1QJF A;  1Y9M A;  2RR1 3;  4YVS A;  2WAA A;  4YW3 A;  5CG9 A;  4GH4 B;  1H6Y A;  2EIC A;  4M4P A;  1L7L A;  2WSU A;  3WQB A;  3WNN A;  5L36 A;  1BYH A;  2VMD A;  5CB7 A;  3SCG A;  1QJZ A;  4FFG A;  4Y22 B;  5KXC A;  1YFY A;  4RS5 B;  4C91 A;  3CKH A;  4IEU A;  3L2H A;  5JOW A;  1OF3 A;  1GKB A;  1RC6 A;  1SBE A;  3ILN A;  2VAU A;  2BER A;  4QMA A;  4NRP A;  3N35 A;  2VUA A;  1U0A A;  1UZV A;  5IVJ A;  4LOS A;  1GOG A;  2OX0 A;  4DB5 A;  4GAL A;  1LGC A;  1OVP A;  1FXZ A;  2X5I B;  2I45 A;  3KSC A;  3LFM A;  2VMI A;  2HWC 1;  4QPW A;  2F6B A;  4D7Y A;  1O4Z A;  5JUV A;  3KT4 A;  3DXU A;  5KXE A;  2CGO A;  2BPA 2;  4XUR A;  4O61 A;  1NA1 C;  2A1X A;  4QQP A;  5FPU A;  2ILM A;  3LE0 A;  4JC1 A;  5FXZ A;  2JE9 A;  1KQR A;  3BU7 A;  3UGH A;  1JOJ A;  4CXX A;  2MEV 2;  2JDN A;  3K4Z A;  4OI2 A;  2EXI A;  3LKJ A;  4XOG A;  5FZI A;  2W08 A;  4XAB A;  2P4E A;  1K5M A;  4XUP A;  2YZ4 A;  4Y33 A;  4KMQ A;  4URA A;  2FZ2 A;  2PLV 3;  4Q27 A;  2H6C A;  4YW1 A;  1ZZ9 A;  1VAM A;  1NQJ A;  1VBB 1;  2PHW A;  3NNM A;  3NQH A;  4NN0 A;  4LBL A;  4QKD A;  4AZZ A;  2QQI A;  4MXW B;  3MI8 A;  3ZYJ B;  1JH5 A;  3O1V A;  3GF6 A;  3S5A A;  1LOC A;  5LY1 A;  1F35 A;  1G6N A;  1GLH A;  1RUI 3;  3UGG A;  4LIV A;  1QY4 A;  4CXW A;  2FDG A;  1PO1 2;  3AK0 A;  5T55 A;  1XNA A;  3HPN A;  1R08 1;  5FTT C;  3MW4 A;  3MIE A;  3ZN5 A;  4CEW B;  3O1P A;  4SBV A;  3VBO A;  2JDY A;  3PIJ A;  3T4H B;  3ZXL A;  1HW5 A;  1UPI A;  2XXZ A;  1H9W A;  5J36 A;  5HI0 A;  1X8E A;  3D8C A;  3PLQ A;  1COV 3;  3ASI A;  5FPL A;  2W52 A;  3VB9 A;  1BQP A;  3VBU C;  3SEE A;  3ZN4 A;  1RUD 2;  2ETE A;  5FZ7 A;  1XE0 A;  4LBK A;  4JRL A;  2BNM A;  4Y5S A;  3SKJ E;  3N7K A;  1ZZ8 A;  1CVN A;  1JOB A;  3ZKY A;  2A7A A;  3JBG 3;  3ZDV A;  4WZC A;  2A75 A;  1J59 A;  4B3N A;  4Q0V A;  2VNG A;  3J8F 1;  1FPN 3;  2WO3 A;  1FNZ A;  1H6X A;  1NXD 1;  2FZ1 A;  2Y26 A;  3ZYI B;  4AG4 A;  1F8V A;  1AR9 1;  1DZT A;  5ISL A;  3VKF C;  4LHK A;  4MSV A;  3V0B B;  1ZBA 2;  2R1B A;  2JG8 B;  3S30 A;  2X09 A;  2C5D A;  2OW4 A;  3N7L A;  4FI9 A;  4GB3 2;  3GZE A;  5FXV A;  3WW4 A;  2R06 2;  5C9A C;  2GMM A;  2QDN A;  2HEV F;  2O8O A;  2VTX J;  1Y3T A;  1X9P A;  4AQ2 A;  4DFS A;  4BME A;  5C5U A;  2DDU A;  4MGZ E;  2VZU A;  2HLE A;  4YG3 A;  4ZU7 A;  5A33 A;  3W5N A;  1LED A;  5L19 A;  5C8C A;  1DFQ A;  2J1R A;  3GDB A;  3Q8A A;  5FZG A;  1YCI A;  1QMJ A;  4JTO A;  2B42 B;  3B00 A;  3HBK A;  4I0B A;  1CZT A;  4AFD A;  3DCQ A;  1D4M 2;  3HAG A;  1D2Q A;  2AEY A;  3NAP A;  1CAX B;  4A3X A;  3M1H A;  1R64 A;  2R04 1;  4FFI A;  4PBP A;  4CP9 B;  2CV6 A;  4COZ A;  1W8Z A;  3MIB A;  2QDR A;  4GWJ A;  4UF0 A;  1BCX A;  1E5S A;  5ANN A;  4EYU A;  1K5J A;  2UYB A;  1VBC 2;  1YHF A;  3WD5 A;  1UOF A;  3V56 A;  1KIT A;  4AR2 A;  1UY1 A;  4IEO A;  2VL4 A;  2E26 A;  2V4V A;  2XON A;  5FYC A;  4BK5 A;  4AQ6 A;  4CDU B;  3OY8 B;  5LAT A;  1KDK A;  2JD4 A;  3EBR A;  3RPQ A;  1XSQ A;  1Q8Q A;  3WDT A;  5BNP C;  3AP4 A;  3U10 A;  4G4F A;  1AYM 2;  1AR6 3;  3HJR A;  5FBJ A;  5FRA A;  3VBO C;  2W87 A;  2HEW F;  4FFF A;  2B45 X;  2YC4 A;  4WVZ A;  5JSP A;  4B4Q A;  4DRV A;  1IG3 A;  2BTV C;  3ECQ A;  3KVB A;  3AMM A;  1DLL A;  1OH4 A;  5T54 A;  2LM3 A;  5ERL A;  2PHD A;  4XFF A;  3F2Z A;  2JD9 A;  2GND A;  1MZ6 A;  2J1E A;  1YYN A;  1C28 A;  3FLT A;  3VD3 A;  1TME 1;  1WLT A;  4LIT A;  3SIT A;  1R09 2;  2VCC A;  1AYN 1;  4AVS A;  4NHY A;  2VQT A;  4L11 A;  2OA2 A;  1S0J A;  4V2V A;  1OLQ A;  3ORJ A;  4KWL A;  1LKN A;  1OMI A;  1RMU 2;  3CBN A;  4AI2 A;  4NIH A;  1GZ9 A;  1BBT 3;  3IPV B;  5FWE A;  3T3Y A;  2QFE A;  3MF6 A;  5I93 A;  4KI5 M;  2D44 A;  2QQN A;  1X82 A;  1JI6 A;  3MIC A;  1J1T A;  3VBR C;  3J7M A;  4QXK A;  4UFH A;  2RS5 1;  4YG0 A;  5LRS A;  1RL3 A;  1W2U A;  1RGS A;  4I3P A;  3UYJ A;  4XC9 A;  2YHJ A;  1ODN A;  4QX2 A;  3VD5 A;  1WZX A;  1BEV 1;  3PU8 A;  2DCT A;  4JVA A;  3THC A;  4EJR A;  5FP3 A;  2RJK A;  1MVE A;  3PUS A;  3NNL A;  3POY A;  1QQP 2;  2XG3 A;  4EN0 A;  4CCC A;  3FHQ A;  4YW7 A;  5F8P A;  1FMD 1;  2WLP A;  3QLQ A;  1JUI A;  2PQQ A;  3AVR A;  3H7J A;  1VB2 A;  1WCD J;  3VDD A;  1H8V A;  3LA7 A;  5FUN A;  2D5F A;  4PIZ A;  3EQE A;  2ARX A;  1Y4W A;  1ACC A;  1YQ6 A;  2A3Y A;  4LO5 B;  2GAU A;  2C9K A;  1JN2 P;  3KVA A;  3WF1 A;  1QJU 2;  1S0D A;  5HBA A;  2ZX1 A;  5A1A A;  4XJZ A;  1WCS A;  1Z7S 1;  1TG7 A;  2VOX A;  2VZ1 A;  3QAC A;  2D43 A;  2XBO 1;  1W6Q B;  3ACL A;  2AAC A;  1B09 A;  4CPB A;  4P9W A;  5AC9 3;  4JKK A;  4QT6 A;  3III A;  1U5Y A;  1W6O A;  2JDU A;  4NHX A;  4MAD A;  5IJR A;  1CAV A;  1O4Y A;  2P6C A;  3AKQ A;  2NPI A;  1RYY A;  2NM1 A;  4AAX A;  2G4I A;  4OI1 A;  2UWB A;  3WF2 A;  3WOG A;  5C8W A;  1HXS 3;  4UFI A;  2QE3 A;  3I2J A;  2Y34 A;  4Y5T A;  4BQW A;  2EXK A;  5C4W A;  4DQA A;  5FZF A;  1UXZ A;  2LAL A;  2QUO A;  3FL7 A;  5GZD A;  1E5I A;  3J7L A;  2GMP A;  4R8H A;  3OGJ A;  5LBB A;  3BIE A;  1LHU A;  4DS0 A;  4CUA A;  4QPG B;  1DQ4 A;  4XXA A;  2FMY A;  4XE9 A;  1NLS A;  5CNA A;  1NLR A;  2WNE A;  4XUN A;  5F5Q A;  2YUE A;  5IVV A;  4COY A;  4DIQ A;  4RHV 3;  1OLR A;  2D3R A;  4WM8 B;  1QWR A;  3ITQ A;  3JB4 C;  1MQT C;  5FYH A;  4XFB A;  4QM8 A;  1G9D A;  2X53 S;  1YRZ A;  1KS5 A;  3M3C A;  5DN2 A;  1QJE A;  2KR2 A;  1PO2 2;  2Y60 A;  3MIG A;  4JX0 A;  5ANQ A;  1SEF A;  3VL9 A;  1RVF 2;  3W5M A;  3KT1 A;  4E8D A;  5FZ6 A;  4FSJ A;  1K3I A;  4QX0 A;  2B8M A;  5K7P A;  1YFU A;  1SLC A;  1XYP A;  3TOJ A;  4CDX B;  1WBF A;  5FBZ A;  4E8C A;  4YYO A;  1HRV 2;  2MEV 1;  3IDA A;  3U75 A;  4YG6 A;  5A1F A;  1TMF 2;  3ZDS A;  3VZM A;  3I7D A;  4YZ4 A;  4BZ4 A;  4CUG A;  5FQ0 A;  1W39 A;  2Q30 A;  2E7Q A;  4IUG A;  4AI9 A;  2XLF A;  3B02 A;  4XDO A;  2HBT A;  5IT6 A;  1OSG A;  3KCC A;  1AUY A;  3OEB A;  4FT8 A;  5CFD B;  1VBE 2;  4UBG A;  5FPV A;  3RZM A;  3MFC A;  2YGL A;  2QQK A;  3NV1 A;  3J26 N;  1S0B A;  2C0Z A;  3OCP A;  2R16 A;  2ARA A;  2WJS A;  1NXM A;  4N90 A;  4FP2 A;  4OZX A;  4AHX A;  2YU1 A;  1PO1 1;  2RHP A;  1ZA4 A;  4P9G A;  4PF1 A;  1BHG A;  3O0W A;  5DAW A;  3LEG A;  3M8L A;  1LOF A;  3DPR A;  1RIR A;  4IDZ A;  4ATE A;  2VUC A;  3S6P A;  5JI9 A;  4CCO A;  4QM9 A;  4JKL A;  5F3C A;  4S2G A;  1QOT A;  2QCS B;  5K0U B;  3VBF B;  2ZGS A;  3J7H A;  1UMH A;  1S2B A;  5FYB A;  1AR7 2;  2GN3 A;  2VGD A;  4NIG A;  1NY7 2;  3GAL A;  4QX1 A;  2YBK A;  3NJX A;  4COV A;  4K20 A;  2DBI A;  1SCR A;  3I97 A;  4WVW A;  3ZYH A;  4COW A;  2EA7 A;  4FOY A;  1W99 A;  1W8N A;  4M0H A;  5C7G A;  2FDH A;  2QQM A;  3I59 A;  5HXV A;  1I3H A;  3AZX A;  2WQ4 A;  2JJ6 A;  5C4W C;  5I8T A;  4H55 A;  4PDW A;  2BYV E;  4S2F A;  1JZ7 A;  4AWD A;  1MS0 A;  4YW5 A;  1YNA A;  5FYZ A;  1U5X A;  2HJI A;  3FLR A;  4GB3 1;  4JDO A;  5FYT A;  1V9U 2;  2R06 1;  4P00 B;  1DYO A;  3ZSJ A;  5JXG A;  5FZC A;  2LRO A;  5EFU A;  4E4D X;  1HN0 A;  4FBF A;  2HWC 3;  1WW7 A;  5A6Z A;  1EV1 2;  2BUK A;  3WT3 A;  4QGL A;  5FP4 A;  1KGY A;  1RIN A;  4RFT 0;  5ABJ A;  5KHG A;  1YO8 A;  4XVH A;  2R49 A;  1BMV 1;  2WRA A;  4Y1Z A;  3ZFF A;  4W4Z A;  4QXH A;  4BWO A;  1ULF A;  1MZF A;  2Y0I A;  4RD7 A;  5CZK A;  4YM3 A;  5GKA C;  3RI8 A;  3OGG A;  4OMC A;  1DHK B;  2JX9 A;  4RGG A;  5T5P A;  3O14 A;  4NR1 A;  1DQ0 A;  2V4A A;  1QNW A;  3MF9 A;  4W6X A;  4CZS A;  1MZ5 A;  2I74 A;  5E16 A;  1VBB 3;  2CDP A;  3U1X A;  4RR3 A;  2JG8 C;  3KF3 A;  1UF2 C;  3KHC A;  2GNT A;  2HEY F;  1MAC A;  3C7O A;  4UW6 A;  4YM1 A;  3G6J B;  5B4X A;  3MV0 1;  3EMR A;  1R08 3;  1OOP A;  5D21 A;  1L7Q A;  1OLM E;  1ZRE A;  3S7I A;  5E6H A;  5AVA A;  1CAU A;  1ENX A;  4LO6 B;  3GNE A;  4LKD A;  2WS9 2;  1AYM 1;  4SLI A;  4XUO A;  3P1I A;  1LOF C;  4P9J A;  1VB4 A;  3TYJ A;  3IDC B;  1N1V A;  3LCP A;  5I0U A;  5AFB A;  4FOV A;  1DQ2 A;  1UYY A;  1F5J A;  2IWG B;  1O7F A;  4LKE A;  4NAM A;  5CYY A;  2RS3 2;  1V6L A;  1LEM A;  2SBA A;  4LHS A;  1OFN A;  3T0B A;  4K3U A;  3LD8 A;  2E32 A;  3CHX A;  3PMS A;  3SQO A;  2ORZ A;  3A0N A;  3OEA A;  4EZ4 A;  2WT0 A;  3I8T A;  2C6S A;  3FE5 A;  4J1W A;  5IVY A;  4CEY A;  4YVW B;  3TEX A;  1PZ8 A;  1OQE A;  3O0V A;  4FTB A;  1RMU 1;  1XBF A;  3B3Q E;  3LAG A;  4YGE A;  1AR9 3;  3WDU A;  5AFE A;  2VR4 A;  4JAA A;  3SHR A;  4PQQ A;  1FV2 A;  5IAT A;  2DCY A;  1G7Y A;  1F15 A;  4Q4V 2;  4PDW C;  1H2M A;  2XKP A;  2OQ6 A;  4QX5 A;  4Y20 B;  3NV3 A;  4CDU C;  3Q9O A;  5KBF A;  2FCT A;  4G9S B;  3WNP A;  1W6M B;  2ZGN A;  3VBS A;  1GR3 A;  4LK7 A;  1GZT A;  3UKN A;  4YSF A;  4JGZ B;  3O7O A;  2QJV A;  2UY9 A;  1PK6 C;  2HWF 1;  5KXB A;  1G9A A;  4P5Y A;  1IKQ A;  2DTY A;  1AVB A;  2HWD 2;  4UT5 A;  2GAL A;  2PAE A;  1SPP B;  5FZL A;  1AX0 A;  5EP9 A;  1W9W A;  3D6E A;  1LU2 A;  1HJG A;  1XSR A;  5G05 L;  2XGX A;  1QJU 1;  1C5I A;  5BNN A;  1WW5 A;  1FAY A;  2R04 3;  2ZML A;  4WBB A;  1MR5 A;  3C7H A;  4AVT A;  5IK7 A;  2WO7 A;  1H9P A;  2Y6F A;  2YFU A;  5DZG A;  3CMG A;  5J98 B;  1QDO A;  4A6O A;  4BIF A;  1O5U A;  5KXD A;  5DUU A;  4RR3 C;  4QWN A;  1S1A A;  1AXZ A;  4AED A;  5T50 A;  3W21 A;  1F4A A;  1H8T A;  3PTR B;  4BMB A;  1Q8O A;  3ZR6 A;  3FN9 A;  5DQ0 A;  1KS4 A;  2ARB A;  3ZYG A;  3FWE A;  4D8M A;  4XFH A;  5FOJ B;  2GH2 A;  1PVC 2;  5EYY A;  4Q4W 1;  1RUJ 2;  2JIG A;  2XJP A;  3OD4 A;  4I0W B;  4QAW A;  3HNB M;  3PUR A;  4C0H A;  4GMP 0;  5F2W A;  4CDQ A;  5HXM A;  1SBD A;  2VQ0 A;  1EPW A;  3KHB A;  3J4U H;  4GA9 A;  4XJ8 A;  3HVD A;  2RDQ A;  2PQS A;  4QPI A;  4X6Q B;  5LA2 A;  2ADE A;  4XYX A;  3AMQ A;  2EAA A;  3RWN A;  2GNM A;  3BTA A;  5CKM A;  3WF4 A;  3AKT A;  3HD8 B;  1TME 3;  2UUR A;  1MPX A;  3ACI A;  4YRD A;  2D7F A;  1A8M A;  1AYN 3;  3AXE A;  3QH6 A;  4KU7 A;  1ZNP A;  1PO2 1;  4CP2 A;  4Y1U A;  5TSW A;  3WUD A;  5FIX A;  1RVF 1;  4Y1Y A;  3WNM A;  5BNO B;  1UY0 A;  3RVH A;  2B7Y A;  1GP4 A;  1K5M B;  1VE0 A;  1I6X A;  2VZQ A;  5A7P A;  3ZFE B;  2ZX0 A;  3LEI A;  1GZC A;  3S0M A;  3ZIW A;  3H42 B;  1HRV 1;  3FC0 A;  1DGL A;  2VTX A;  3C7E A;  4DMI A;  1XNB A;  5JDB A;  2RS5 3;  3BU0 A;  4XF0 A;  4ERO A;  1TMF 1;  2WFP A;  3CJX A;  3ZSK A;  4IV3 B;  5BPX A;  5FY7 A;  5BXX A;  1UMI A;  4XJA A;  3ZN6 B;  1DQ1 A;  1BEV 3;  2XVL A;  5FY9 A;  3H8R A;  2JEC A;  2IFW A;  3CJI A;  4QPG C;  3ZOI A;  2ZHK A;  1D2S A;  4RYD A;  3VBS C;  4WV8 A;  3A7Q A;  3NST A;  1Q8P A;  3HEI A;  5BY5 A;  4ZZ8 A;  1YWK A;  3CDZ B;  1FMD 3;  4M01 A;  5FZK A;  1O3T A;  3LPF A;  1CX1 A;  3NJZ A;  3ZFG C;  4A42 A;  4FTE A;  5G04 L;  1W3V A;  5L9V A;  3K51 A;  1DLC A;  3H9A A;  5FRE A;  4KBZ A;  3VZN A;  3PHM A;  1ZM1 A;  3KV6 A;  3PUI A;  2XWJ B;  2BWC A;  1W04 A;  5F3E A;  2VE1 A;  1KFX L;  2JDA A;  2OQ7 A;  2PHX A;  4PI0 A;  1JW6 A;  2VOW A;  1Z7S 3;  4MGS A;  2XJV A;  1MEC 2;  2PHT A;  2XBO 3;  2ZAB A;  1MS1 A;  4Q29 A;  5BNN C;  2E31 A;  3JUU A;  4WM7 C;  3LWC A;  3LIH A;  1FOD 1;  4EQV A;  4A2U A;  4IV1 C;  4XTM A;  1DGR N;  4JZR A;  5IVF A;  1ULG A;  1AR7 1;  4DOU A;  5FMO L;  3WP3 A;  2Z5W A;  1AL2 2;  4LLO A;  4AVC A;  3FX3 A;  1ULO A;  3KB5 A;  4B1M A;  5J3U A;  5DAV A;  1QXP A;  2XVK A;  3IZO A;  3M70 A;  1ASJ 2;  2XVG A;  4D6Q A;  1GAN A;  2P3I A;  1YJK A;  5DUW A;  1LNS A;  1NA1 A;  3RZZ A;  1NT0 A;  2BBV A;  3WHU A;  2XJU A;  1WBL A;  2WA4 A;  5CFD C;  2WSV A;  4I01 A;  4IGQ A;  5FZ8 A;  5GLU A;  1VAK A;  4NVP A;  1XC6 A;  3KZ4 C;  4PLO A;  5FZO A;  1NAE A;  1JYX A;  5KHK A;  4WVM A;  1GQG A;  1GQP A;  4CDQ C;  3WSO A;  2WQZ C;  2Q4S A;  4JHT A;  1V9U 1;  1HLC A;  2BNN A;  1YQ2 A;  3OGS A;  3N7J A;  4QPI C;  3H8X A;  3AJY A;  2JKB A;  2YXS A;  1W8T A;  4AXO A;  4LO7 A;  3FHI B;  4Q4Y 2;  1NE6 A;  5F3G A;  5F5I A;  2BOI A;  4AYU A;  3OPZ A;  1JYN A;  1OD5 A;  3I49 A;  4P9L A;  1HB4 A;  1IZ3 A;  1WLC A;  1LGN A;  3VBF C;  5CEH A;  2MHF A;  5JZG B;  1GV9 A;  5A6X A;  4BQ1 A;  5C3S A;  3NAP B;  3N9M A;  1IS4 A;  5C3Q A;  1WUV A;  3TEY A;  2MEV 3;  5FZD A;  4YW2 A;  5FZA A;  1IKP A;  1W2T A;  3K75 B;  1CQ9 A;  2AEZ A;  5LRR A;  3WG1 A;  2F17 A;  5FYY A;  2ZZQ A;  3MID A;  5JAX A;  1XE8 A;  3SH4 A;  3LSE A;  5KC5 A;  1J1L A;  4MUV A;  5A3U A;  4BB3 A;  3ETP A;  4J1X A;  3BVC A;  3VBU A;  3CZU A;  5L73 A;  3SCH A;  3CJI C;  5HCH A;  4N43 B;  3A21 A;  1C1L A;  3GBG A;  3BN6 A;  5H9Q A;  3MO4 A;  2VZ3 A;  3UK9 A;  4UFM A;  2AUY A;  4P9I A;  1PO1 3;  4F7Z A;  3N9L A;  2BZD A;  3N7M A;  4JGY B;  3ENR A;  1RHI 2;  1FT9 A;  1MS5 A;  1RUG 2;  3VZO A;  5M0T A;  4COU A;  2RDN A;  2WS9 1;  3VGI A;  2K46 A;  3W59 A;  1ZZ6 A;  2DFC A;  2QQV A;  1OUR A;  5DAX A;  1NCQ B;  2UYA A;  5FXX A;  1LTE A;  3IDB B;  4ISQ A;  1G9C A;  2RS3 1;  3ILF A;  5C9A A;  3ZXF A;  4FXG B;  3RZH A;  1SG3 A;  3VKL A;  3KT7 A;  5LW9 A;  1OA3 A;  2IXC A;  3KMH A;  4QQ2 A;  1LRH A;  3DUI A;  3WNK A;  3QCW A;  1EUT A;  3HOB A;  2FMD A;  4YFW A;  5D1I A;  3WQ0 A;  1P8J A;  2WFF 2;  1J84 A;  1ZRI A;  5BUV A;  2ZAH A;  5LA1 A;  2K0G A;  1XU2 A;  4KG0 A;  2ZJC A;  4OLL A;  5C3P A;  1UX6 A;  3T08 A;  4EWA A;  5KR7 A;  4AEK A;  5FPX A;  5I8Y A;  4Q4V 1;  5IK4 A;  3HQX A;  3H8U A;  1YC6 1;  4GB3 3;  2VH9 A;  3AMP A;  1A6C A;  4HT1 T;  2R06 3;  3KGZ A;  1PNG A;  1UPS A;  4XJU A;  1RB8 G;  1OHF A;  2WNV A;  1NCR C;  4ZXK A;  1M06 G;  1UYX A;  4J6G A;  3BTZ A;  2OPW A;  3VV1 A;  5L9R A;  3GHN A;  2FCU A;  3MFA A;  2WKK A;  1UN1 A;  4BPZ A;  3F95 A;  3TN9 2;  1RUE 2;  2WLQ A;  4ZU4 A;  1TNR A;  4HOO A;  3RS6 A;  1LU1 A;  3MIH A;  5C3R A;  4MHR A;  2HWD 1;  2VTF A;  3M7A A;  3OOX A;  5A32 A;  1SHW B;  3V0A A;  3M3I A;  1ND3 B;  2XLA A;  1V0A A;  1LJ7 A;  3H50 A;  3T30 A;  5CIS A;  4UAP A;  4I30 A;  5BNP A;  2Q1F A;  1B35 C;  1AF9 A;  1W2O A;  3KLS A;  4YVW C;  2ZA9 A;  2WN2 A;  4IE0 A;  5A7O A;  4HPK A;  1JOP A;  2YC0 A;  2GME A;  3O0X A;  3H3U A;  1F4H A;  2CTV A;  1WD3 A;  1ZRC A;  3AYE A;  3VHP A;  3WZ1 A;  5A70 A;  2XHN A;  2JDP A;  5DAB A;  1ZZC A;  2ZKN A;  3POJ A;  4BYY A;  2JDM A;  3AKR A;  3AZV A;  3AVS A;  3MDP A;  1QNY A;  2RJ2 A;  4LOT A;  4QKN A;  1FYU A;  2WNU B;  1PVC 1;  1AYM 3;  4JQR A;  2OKX A;  1PX4 A;  5DMY A;  1RUN A;  2DUR A;  4IND A;  1HQW A;  1OH3 A;  1R1A 2;  2RR1 2;  2KD7 A;  5FV3 A;  3VBR A;  3ZPY A;  4JHZ A;  1PMJ X;  4YW6 A;  3IWZ A;  4CU9 A;  1HV0 A;  5H9P A;  3VBH A;  5GJ6 A;  3ZYP A;  3IKW A;  5FR3 A;  1DYP A;  3EJK A;  4A45 A;  1HIX A;  4DXR A;  2FDK A;  2QQU A;  2IXK A;  2J1V A;  4N7U A;  2VCB A;  4XJ9 A;  4X6R B;  5HV0 A;  5FYU A;  2HWE 3;  4MHU A;  3GBW A;  1XYO A;  2EXH A;  4LBQ B;  2CSG A;  4XEZ A;  1UZY A;  3PUH A;  1RMU 3;  3MHZ A;  1T6G C;  2WN3 A;  4HSL A;  5A7W B;  3AX4 A;  1F31 A;  4P02 B;  2QZ3 A;  2YU2 A;  4X8P A;  5LB6 A;  3OUJ A;  3IB3 A;  1L3J A;  4HN1 A;  5C3O A;  5JSR A;  1WD4 A;  4FPO B;  1JZ8 A;  4IE7 A;  3LF7 A;  3OPW A;  1W8U A;  2VMH A;  3H3Z A;  2JDH A;  3KQR A;  3KV4 A;  4L9B A;  3TRS B;  3GZT B;  3CU7 A;  4BU2 A;  2VVF A;  1XNK A;  1IS6 A;  3PUA A;  3SH3 A;  1K42 A;  1BZW A;  3ACG A;  2WNV C;  1AR8 2;  3I54 A;  4QGM A;  2LUW A;  5JOX A;  2DU1 A;  2R07 2;  3BUC A;  4FVV A;  3VD4 A;  1REF A;  1GWK A;  2WZR 1;  4JQT A;  2ZCW A;  1LHW A;  2ARE A;  2HWF 3;  1A3K A;  1DGW A;  1BK0 A;  2W3J A;  1Y7B A;  3T1L A;  4Q0U A;  1FX5 A;  4LBO A;  3WCR A;  5T5J A;  2OXB A;  4D94 A;  2VU9 A;  1PX3 A;  2GSY A;  2PMW B;  1C57 A;  2PYT A;  4DXZ A;  4LQR A;  5IUQ A;  1W6P B;  5HV4 A;  4MH0 E;  5FWJ A;  2VBB A;  1QJU 3;  3UKT A;  1LHN A;  1UYZ A;  2Q1M A;  5LWB A;  4QB1 A;  4AEJ A;  4OHX A;  5BNO C;  2XQR A;  2Z69 A;  4L8Q A;  3C8X A;  1SFN A;  2VQA A;  3ZFE C;  2WZE A;  3B7M A;  4MGT A;  4NPM A;  3JU9 A;  5FMB A;  2WR9 A;  5GLT A;  4W50 A;  1MQT A;  2VBD A;  2TEP A;  1W6N A;  4H14 A;  3T2P A;  1AL2 1;  1COV 2;  1SQ4 A;  2FDJ A;  2W91 A;  3I59 B;  3INA A;  4K40 A;  1AX2 A;  4LE4 A;  4KWU A;  3ZYF A;  4FAG A;  1H2L A;  2EID A;  1ASJ 1;  2Q8O A;  1TNF A;  4YPJ A;  5I0D A;  2NQY A;  1URX A;  5A1L A;  4MG2 A;  3VZL A;  4Q4W 3;  5FP9 A;  2BNO A;  2TBV A;  1JUH A;  2ZGU A;  4CDW B;  2VJX A;  5JPN B;  2CL2 A;  1VP6 A;  1MZE A;  1RUC 2;  1X36 A;  2DVD A;  3BGA A;  3ON7 A;  1ZRF A;  5LBF A;  4KNC A;  3RNS A;  3FZ3 A;  3VBH C;  2FD8 A;  4GH4 A;  2ZGT A;  4ASK A;  5A3L A;  3EHK A;  1N1Y A;  1PO2 3;  2QQO A;  3R6S A;  2VVE A;  4AGG A;  2IZW A;  4Y22 A;  3SCF A;  4IL7 A;  5FOB B;  1RVF 3;  1VBA 2;  4RS5 A;  4B4R A;  2YY1 A;  2ZGP A;  4GMP 1;  1CJD A;  2Y6K A;  2Z79 A;  3I3D A;  3KM5 A;  3AL6 A;  4BJ0 A;  1HRV 3;  1W2N A;  2SLI A;  4TXW A;  2ID4 A;  4N53 B;  5GZE A;  2JG9 B;  4Q2F A;  1TMF 3;  1VMH A;  2X5I A;  3OBT A;  4IE4 A;  2R7E B;  4QXB A;  4LEJ A;  1RUF 1;  5FAX A;  3QH7 A;  4RQP B;  3K48 A;  2IUW A;  5C70 A;  3O5S A;  4NRM A;  2DCK A;  2ADD A;  3AYD A;  3OYW B;  4TLG A;  5FYM A;  5D8A B;  1UO9 A;  1MS9 A;  1DQ6 A;  5FY8 A;  3WEZ A;  2W9X A;  1OOP B;  4BIS A;  3JD7 2;  2BVV A;  1ZRD A;  4CUB A;  5SV5 A;  4MOA A;  2UU8 A;  2XPJ A;  2OUJ A;  2G9F A;  1CAU B;  2W95 A;  2Y0O A;  4BQ2 A;  5LCW L;  2XOM A;  1RTV A;  1V6K A;  3WCS A;  3H1W A;  2ZMK A;  2VXJ A;  1PZ9 A;  3T1M A;  4B7E A;  3AC0 A;  1RUG 1;  3S57 A;  4IGO A;  3I2G A;  5FPA A;  2CAU A;  2WUH A;  4MXW A;  2HYX A;  1OC1 A;  4XAE A;  4CUC A;  1CON A;  5EJ1 B;  3RMX A;  5JZG C;  3EXU A;  3DXT A;  5FO9 B;  4MO3 M;  3R4U A;  3U0Z A;  4TTG A;  1FOD 3;  3AP7 A;  1AR6 2;  2RM2 2;  1C4R A;  4R9C A;  4AI3 A;  1AR7 3;  2Q8E A;  1OQ1 A;  3HT2 A;  4YLZ A;  3WG3 A;  1S55 A;  2A70 A;  1FNY A;  3E97 A;  2HKX A;  2ZGL A;  5L7O B;  1UU4 A;  1G9B A;  1VJ2 A;  1ALY A;  1XU1 A;  1UXX X;  2VNO A;  3U07 A;  1XOY A;  1W0O A;  4TN7 A;  1GNZ A;  4XBL A;  2X29 A;  1D7P M;  1VLN A;  2EF6 A;  4UWD A;  2WFF 1;  3AP6 A;  5FUI A;  2HYK A;  4AHZ A;  1CR7 A;  4QU1 A;  1JZ6 A;  1PIV 2;  1QGL A;  4EN6 B;  3ZXA C;  1GZW A;  4N43 C;  2QBX A;  2XDV A;  1BBT 2;  1UYP A;  4HN0 A;  2ZXQ A;  1DQ5 A;  1V9U 3;  1QJY 2;  3D0J A;  2NMO A;  4QQO A;  5KWR A;  2RS1 2;  1DZQ A;  3I3E A;  2D93 A;  4XXP A;  5FJH A;  2VO5 A;  4M3C F;  3VZJ A;  3CL1 A;  4GH4 C;  1W05 A;  1DZR A;  3KQ4 B;  4QX8 A;  5IVC A;  3V0B A;  2VMF A;  4GQ7 A;  5GLW A;  2WL1 A;  2JG8 A;  3TN9 1;  2VXR A;  1BJQ A;  1GWL A;  3ZO0 B;  1QJX 2;  3WG2 A;  1XPW A;  4RS5 C;  3V64 A;  4IEX A;  3SLI A;  4FPH A;  3ZIX A;  5JSO A;  1CES A;  1J3P A;  2QVS B;  2NP0 A;  4AFM A;  1SCS A;  1X8M A;  5JWP A;  1C8M 2;  1UOJ A;  1J3Q A;  3I2O A;  1EYB A;  3PDQ A;  4LXL A;  3PJQ A;  2IVJ A;  4HK8 A;  4QX7 A;  3WXP A;  1HKD A;  1GP5 A;  1S0F A;  2X5I C;  4K6B A;  5I0S A;  3POF A;  4OMD A;  3AYC A;  3POI A;  5JOZ A;  4S2H A;  4XFG A;  3USU B;  4HBN A;  5F9T A;  1JZ2 A;  2G9G A;  1N3P A;  1ND2 B;  3VD7 A;  1H8T B;  1S2K A;  2Y6G A;  5J37 A;  3NNF A;  2YG0 A;  3HN1 A;  3RZJ A;  2Y33 A;  3ZMN A;  1RUD 1;  3K4D A;  1CAX A;  1V6M A;  4GZ9 A;  5FLJ A;  1W2A X;  2MPF A;  4C90 A;  3WX5 A;  4YM0 A;  1S0G A;  4D69 A;  3FUO A;  2RG4 A;  4CP9 A;  3BAL A;  1GWM A;  1GSL A;  2B9V A;  5FMD A;  4FPL A;  1HDK A;  2C9A A;  4BLI A;  1D4V B;  4O9G A;  2VOK A;  5JXI A;  4LMF A;  1S4C A;  3K46 A;  1DP0 A;  4QDQ A;  1HXS 2;  1X33 A;  4E4S A;  5CAD A;  2YFZ A;  5FK7 A;  1R1A 1;  3RYP A;  4FPK A;  4UFJ A;  1YJL A;  1LCL A;  1ZBA 1;  2RS3 3;  2J22 A;  2TUN A;  2W1U A;  3D82 A;  4CDU A;  3OY8 A;  3R05 A;  3MYX A;  1ND3 C;  4I2O A;  4PI2 A;  3W9A A;  1ZBE 2;  4AF9 A;  1WCK A;  2VW0 A;  4RHV 2;  3PVE A;  1J3R A;  4CEW C;  2YBS A;  4FPY A;  4ET7 A;  1HB1 A;  1SLB A;  5FJK A;  5LBC A;  2A5Z A;  4B7K A;  3AMH A;  4CA9 A;  1Y43 B;  5CFC B;  4AE2 A;  5B2G B;  1PK6 A;  3VL8 A;  5DDJ 2;  2WZP P;  1JYW A;  3WV6 A;  1QOO A;  5T5L A;  2BJS A;  2GZW A;  4I3G A;  5C5T A;  4Q4V 3;  4MX3 A;  2VMG A;  4V2W A;  2OZ6 A;  4TSV A;  3J7N A;  1NUK A;  4KU8 A;  5IFP A;  2QKD A;  4ZU5 A;  3CO2 A;  2RJL A;  2P3Y A;  4XIO A;  2D6L X;  3E5Q A;  3IM0 A;  2P3J A;  3ETQ A;  3UGF A;  1D4M 1;  4KH9 A;  4AHY A;  2OZJ A;  3IPV A;  5FYV A;  4B4P A;  3MEP A;  4HVQ A;  3MLK A;  1I5P A;  5ACA 2;  2FHR A;  1AR8 1;  2PAK A;  1U5I A;  1O4T A;  3TBD A;  4UXA A;  1LEC A;  2R07 1;  1HQN A;  4YGD A;  3FHA A;  2FCV A;  1YUD A;  5DXD A;  5A3M A;  4OHW A;  4QDS A;  5H9S A;  1VBC 1;  3B01 A;  3BPZ A;  4QDR A;  3WW2 A;  2YMZ A;  1E5R A;  2CDO A;  2HWD 3;  4HK9 A;  4UI9 L;  5IVE A;  2ZEX A;  2JXA A;  3WUC A;  4EZH A;  4XBQ A;  2W68 A;  5A3N A;  3GM8 A;  5EJ3 A;  1L7R A;  2YYO A;  1WMF A;  2DUQ A;  4PLN A;  1NKG A;  5FZ3 A;  1K45 A;  4YZ5 A;  1ULC A;  1OVS A;  3I2I A;  5FFO C;  4OHY A;  2Z42 A;  2OT7 A;  5GZF A;  2DUP A;  3VDA A;  2VD7 A;  4DNY A;  5D2A A;  2PHU A;  4NAO A;  4LUL A;  1O59 A;  4JTN A;  1PVX A;  4ORF A;  3OB8 A;  1LGB A;  3GJA A;  2BFU S;  1NA1 B;  2ZHM A;  1W0P A;  2H0V A;  1FAT A;  1PNF A;  1VBD 2;  1FI2 A;  4M3C A;  4QKF A;  5HPO A;  4LIU A;  3P3N A;  1R09 1;  1S0I A;  5FZO B;  1VRH 2;  1GOH A;  1GOF A;  1HRI 2;  3ZPO A;  4AFB A;  2WYF A;  1PVC 3;  3J8F 3;  1E57 A;  2VUL A;  1V6N A;  2O14 A;  3VDC A;  4CU6 A;  1KJR A;  4W8J A;  4E4H A;  2AR6 A;  5FK8 A;  3ZXD A;  5L9B A;  2V09 A;  1RUC 1;  4DXT A;  1UOG A;  4LR4 A;  2P5B A;  4E9K A;  3WHT A;  4E2Q A;  3THT A;  4YZ3 A;  1O6U A;  4NWW A;  4Z07 A;  5GM0 A;  1GUI A;  1QOS A;  4QPG A;  3PVB B;  1I9R A;  2ZGK A;  4ZY9 A;  3N4M A;  1VBA 1;  1BVV A;  2XUM A;  1GNH A;  4WM8 A;  3R0R A;  2AYH A;  1QQP 1;  3FFQ A;  3ZFG A;  2CHH A;  5F32 A;  2GC0 A;  4YZ2 A;  4KGG A;  2E33 A;  5JXH A;  4NID A;  4CCE A;  1CAW B;  1O5L A;  2WWS A;  1YQC A;  4WVV A;  2PXJ A;  2YRO A;  5K8S A;  3AP5 A;  3WG4 A;  3VBU B;  2XH6 A;  1WWY A;  1ULE A;  4Y1X A;  1O3R A;  3B9I A;  3A4U A;  3KS7 A;  3ZM8 A;  4D7S A;  2VNR A;  1IS5 A;  1DBN A;  4A7Y A;  5CA6 A;  5JMO A;  3ZSL A;  4CDX A;  2WZR 3;  4GKY A;  4WM7 A;  2PEL A;  3KD4 A;  4IV1 A;  1UAI A;  3NW4 A;  3POB A;  3JD7 1;  1OPM A;  4OCT A;  3VHN A;  2XKO A;  3ACF A;  5J09 A;  4BQ4 A;  5LZ6 A;  3VUO A;  4XPV A;  4YVS B;  1DIW A;  4PIY A;  4AI8 A;  4CU7 A;  1OQD A;  1IQA A;  1STM A;  3PNA A;  4A6S A;  5J96 B;  1TVG A;  2ZEW A;  4MYE A;  1OA2 A;  2WAB A;  4ZS3 A;  1JZ3 A;  5CFD A;  5FZE A;  4BA6 A;  1QXJ A;  1OI6 A;  1NG0 A;  2PHL A;  5A3O A;  3OSD A;  1TEI A;  4H7L A;  5C9A B;  1GNY A;  2DTW A;  2E9Q A;  1OPO A;  3N9Q A;  4MV2 A;  4O9E A;  2BVB A;  1DG6 A;  4Y24 A;  1DGR A;  4XUQ A;  4M4R A;  2VM9 A;  1W8H A;  2BGC A;  1AR6 1;  2KA3 A;  2JG9 C;  2RM2 1;  5GLV A;  2AGS A;  5EJZ B;  2QQL A;  2UY8 A;  4NWV A;  1AL2 3;  1CZV A;  4RQP C;  4HKW A;  1ASJ 3;  3PIG A;  4GXL A;  1RUO A;  1PM7 A;  3SH5 A;  4AEM A;  2H6B A;  3M3E A;  3LEM A;  5DZF A;  2EIE A;  3VBF A;  4EN8 B;  1HX6 A;  4P14 A;  1GQH A;  1PIV 1;  1UKG A;  1US2 A;  2VPV A;  5FZ1 A;  4XAA A;  1HJF A;  2D6M A;  1EAH 2;  1KD7 A;  1R1Z A;  2G19 A;  1C3H A;  2ERF A;  3HQU A;  4IQP A;  3RJ2 X;  3S7E A;  4CVU A;  5F3I A;  5JXJ A;  1QJY 1;  3H1M A;  3UNP A;  2RS1 1;  1PGL 2;  3EB7 A;  3JQW A;  4HG6 B;  4PQ9 A;  3WP4 A;  4PCR A;  2WWU A;  2YBP A;  2ZS6 B;  4QD2 A;  4KWK A;  5IK5 A;  3O1M A;  2C4X A;  5GZC A;  2RMU 2;  2ZKL A;  3PJY A;  1OLM A;  4RSU A;  4LHN A;  3FBY A;  2O1Q A;  5A32 B;  4GMP 3;  3HBZ A;  1VBE 1;  3TEW A;  1QJX 1;  1EPZ A;  4LO8 A;  3ZXK A;  4C0B A;  1UOB A;  5BNP B;  4IXL A;  3MGU A;  3WQ7 A;  1Z78 A;  2PN5 A;  2YV8 A;  4FPJ A;  4WM8 C;  5E89 A;  3RG0 A;  4R9B A;  4HPK B;  3VBO B;  4AI0 A;  4MZU A;  5L7O C;  1C8M 1;  2AZ5 A;  1YEW A;  1ZRR A;  4AQT A;  1SLA A;  1RUF 3;  3AZW A;  3APB A;  2P34 A;  1I5Z A;  3WNL A;  3U4X A;  4N9H A;  1NX9 A;  4XW3 A;  1N1S A;  3BB6 A;  1D0G A;  4MGY E;  1XXN A;  3U14 A;  1HV1 A;  1UD1 A;  4AGR A;  1QKQ A;  2GDF A;  2FDF A;  4Y4Y A;  3RSJ A;  4CDX C;  3GYD A;  2WT1 A;  4X8N A;  5FY0 A;  2ZGM A;  4AW7 A;  1XQN A;  3NL1 A;  4IW3 A;  3GJB A;  3M4F A;  2W1W A;  2W1S A;  4EE2 A;  2G9Z A;  1O3Q A;  3I3M A;  1H2K A;  4Q0Q A;  4IE6 A;  2A6W A;  1NY7 1;  2X8K A;  3LEK A;  3VBR B;  1RUG 3;  4XJW A;  4BH9 A;  4CU8 A;  3FMG A;  1Q56 A;  1ST8 A;  3VKO A;  4MET A;  4GJY A;  1YI9 A;  4A4A A;  3BTX A;  2YDE A;  1A34 A;  5T5O A;  1RUH 2;  1J83 A;  4QXC A;  5J7M A;  4LTA A;  4BHP A;  1N3O A;  5FXW A;  1M4W A;  4QKB A;  5FP8 A;  1W9S A;  4H2A A;  3HMY A;  3PME A;  4LBQ D;  4QQL A;  3TNQ A;  3WVJ A;  1TQ5 A;  3BYW A;  1NYW A;  1ZBE 1;  4MGQ A;  5A7S A;  1NCR A;  3MV1 1;  2DCZ A;  4W6W A;  5A33 B;  3CIH A;  4KGQ A;  3GGL A;  5C8C B;  3HIF A;  4HXC A;  2MNG A;  2WFF 3;  5DAQ A;  2J1S A;  1POV 0;  3WNX A;  1EV1 1;  5DDJ 1;  2N7G A;  1OKQ A;  2CU5 A;  1Q3E A;  2R6Q A;  5K0U C;  3CEW A;  5C6C A;  4Y1V A;  2IXH A;  3WNO A;  5A6Q A;  3Q8F A;  3ES1 A;  2ZEY A;  3E6D A;  3O12 A;  4OVE A;  4RL7 A;  1UU5 A;  4ES9 A;  4ES8 A;  2V72 A;  3NNG A;  4EWD A;  1DU3 D;  1B35 A;  2YPD A;  3NWK A;  3IMM A;  3H7Y A;  2TNF A;  3G7D A;  4YVW A;  2PHF A;  1PMH X;  3ZSE A;  4ARY A;  4BQ3 A;  4UF0 B;  4HAN A;  4C1W A;  4ASL A;  2DU0 A;  2RS5 2;  1WKY A;  1IQD C;  5CKN A;  5ACA 1;  3MW2 A;  5KC6 A;  1YI7 A;  1SMV A;  3LSD A;  3TN9 3;  4JRA A;  4OFG A;  5CAZ A;  2CWS A;  4IEY A;  3RMY A;  3NVC A;  1BEV 2;  4D3W A;  4EN9 B;  1SDW A;  4HL0 A;  1KEX A;  2ET1 A;  4Y20 A;  2QQP A;  2UWC A;  2RDS A;  4K8R B;  2D3S A;  2J1U A;  4CYD A;  3RYR A;  1C1F A;  4ZHN A;  4RA0 A;  1W6M A;  1V6J A;  2JWP A;  3NRU A;  5GLZ A;  2AC1 A;  3LDK A;  1GYK A;  4NII A;  3RFR A;  2O0O A;  3E1F 1;  4JGZ A;  1ZYB A;  2WO2 A;  4Y5Z 0;  4A7K A;  3BPS A;  3ZYB A;  2IXI A;  4GWI A;  2BEO A;  4NOT A;  3ZLI A;  4Q0S A;  3BCW A;  5EIY B;  5I91 A;  4A3Z A;  4LKF A;  2KM2 A;  4D0Q A;  1SPP A;  1W06 A;  4BXS V;  2W5F A;  2IVI B;  2XBO 2;  1RUD 3;  2BWA A;  2BOJ A;  3DEC A;  2ZAA A;  5JVV A;  2HWB 2;  1JU3 A;  2OPK A;  4PT6 A;  3FUQ A;  1V6I A;  2VW2 A;  1IPJ A;  1VBD 1;  4R52 A;  5IAX A;  5FKC A;  1VRH 1;  4UW5 A;  1HRI 1;  4BCU A;  2JKX A;  2RVA A;  4FP3 A;  4JKM A;  5FZM A;  3H8O A;  1YFW A;  1KRI A;  3RZL A;  1SLL A;  4XDQ A;  4XTP A;  2W1Q A;  1XJA A;  4E2S A;  1R1A 3;  5E8A A;  5A6Y A;  4BQ5 A;  3KV9 A;  2ZX2 A;  1ZBA 3;  4GWM A;  1LEN A;  1V6O A;  5LY2 A;  3LOI A;  5GAL A;  3TWI A;  3VHR A;  1U12 A;  4BLJ A;  2CY6 A;  3LFI A;  1VR3 A;  5LK7 B;  1AX1 A;  1ENQ A;  3I3Q A;  3DL3 A;  3GCX A;  1IG0 A;  4CCL A;  1IPS A;  4QHB A;  2Y8K A;  1XE7 A;  1GBG A;  2JIC A;  3VDD B;  2A6X A;  4CCD A;  5CKQ A;  1TZO A;  1OA4 A;  2D6O X;  1XNC A;  2WO1 A;  4UOJ A;  4U2A A;  4DY3 A;  1H0B A;  2VME A;  3PL0 A;  2C24 A;  2B46 X;  2Y38 A;  5JR2 A;  1N1T A;  1OFS A;  4L97 A;  2VUD A;  3HNY M;  1HN1 A;  1WCQ A;  4YGC A;  3O1S A;  4YNI A;  1LAJ A;  2R0F A;  3UKV A;  1UMZ A;  5F6K A;  4Q1P A;  4HSJ A;  1D4M 3;  2B39 A;  5BNO A;  5J48 A;  1UY2 A;  3LB9 A;  4DO0 A;  1AR8 3;  3ZFE A;  3DKQ A;  1W6O B;  5KHI A;  2R07 3;  4Q4X 2;  2R30 A;  3OBR A;  2BGO A;  1CAV B;  2B4K A;  4QX3 A;  3X29 B;  4KWJ A;  1BVP 1;  2B5H A;  4OZO A;  3MLJ A;  1HB3 A;  1VBC 3;  3JB8 A;  5EQU A;  3WF3 A;  4IV3 A;  1W9F A;  1Q43 A;  2NLR A;  2ZTN A;  3VN4 A;  1ZZB A;  5C4W B;  4URT A;  4IES A;  1XND A;  3ZN6 A;  1BLZ A;  3MW3 A;  5LA0 A;  2HH9 A;  5JR7 B;  2D6K A;  1H1A A;  1ZA7 A;  1JZ4 A;  1E5H A;  1W03 A;  4XFC A;  2GN7 A;  1S2E A;  2GP3 A;  4L0P A;  1G8W A;  4JGZ C;  3ROU A;  1W90 A;  2RE9 A;  3R4D B;  3THD A;  3H0O A;  1RUJ 1;  3MLL A;  5EPA A;  4AI1 A;  4HET A;  1VMF A;  3E5U A;  3MIF A;  2R1D A;  4G3Y C;  4UFL A;  2ZHL A;  1H1I A;  2BV4 A;  4OHV A;  1SFP A;  4GIQ A;  5F5A A;  3O1U A;  1GZW B;  4HKO A;  2ZHN A;  5CVR A;  1R09 3;  3PUQ A;  4OQ9 A;  5FY1 A;  2ARC A;  2DWR A;  2GU9 A;  5BNQ A;  1JMU B;  1CJP A;  4I09 A;  4NJ4 A;  5CG8 A;  3A0K A;  4XF9 A;  4HVO A;  3U78 A;  3LIG A;  1UY4 A;  3HT1 A;  4OI4 A;  1ENS A;  4Z2A A;  2H0B A;  4LUK A;  3O1T A;  3CZJ A;  3L2Y A;  1EAH 1;  3BI3 A;  5FQ0 B;  3DGT A;  1UWW A;  1RUC 3;  3GCW A;  3M2M A;  4QB2 A;  4YVS C;  5DG2 A;  4OI0 A;  5F2S A;  3DYP A;  1CIW A;  5FZ0 A;  1PGL 1;  5IK8 A;  1JXN A;  1Q5O A;  1Q8S A;  2XJR A;  3O1O A;  1EP0 A;  2VCM A;  4ZON A;  3SNM A;  1WCU A;  2YB7 A;  2RMU 1;  1WA6 X;  3OD0 A;  3AB0 A;  4OUM A;  5IVB A;  1VBA 3;  1T6B X;  1LOD A;  3AFK A;  2D6N A;  1RJ8 A;  1QQP 3;  2DBN A;  2E53 A;  2RV9 A;  2WDB A;  1JHN A;  2PLV 2;  4P9Y A;  1GFF 2;  5EXO A;  2KXL A;  3HNM A;  3VKN A;  4XF4 A;  2A3W A;  4U36 A;  3QBQ A;  3DPR B;  1BMV 2;  2VQU A;  2PTM A;  4AVV A;  5E88 A;  4OUL A;  2CNA A;  5EZW A;  3T0D A;  4GJZ A;  4UBH A;  2WZ8 A;  3KV5 A;  1LR5 A;  3VLB B;  4LT5 A;  4AGV A;  3LA2 A;  3RQ0 A;  3NO8 A;  1UIJ A;  1CPN A;  1RUI 2;  2NMN A;  4HVR A;  3KCX A;  1SLI A;  5JZG A;  1UL9 A;  3LDR A;  4N9I A;  2I2S A;  4LK6 A;  1NOV A;  4Z8B A;  1X9T A;  1MEC 1;  4Z82 A;  1NZI A;  2P17 A;  1K5M C;  2VOV A;  3VKM A;  1V70 A;  4XMI A;  4F83 A;  2V73 A;  3WP6 A;  1Y9G A;  3JD7 3;  3TAY A;  1MS3 A;  2CGN A;  5KHH A;  3IAP A;  1GP6 A;  1C8N A;  1LUL A;  2ATF A;  2XQX A;  3O1R A;  1LOB A;  3RJR A;  4IV3 C;  1NQD A;  1XRU A;  2WBK A;  5A3P A;  4PDW B;  4A44 A;  4KBB A;  1GU3 A;  1RED A;  1JHJ A;  5A3T A;  4E2G A;  2EIG A;  2O8Q A;  3AMN A;  2Y6L A;  1AL0 G;  4XF1 A;  5CIR A;  1BKZ A;  2WNO A;  3BOW A;  2XR4 A;  5FO8 B;  3I3B A;  1ODM A;  4N43 A;  1RUH 1;  5IW0 A;  1OKO A;  3JBG 2;  4H3W A;  4ZKT B;  2BDR A;  4PIX A;  4XDP A;  5K4L A;  1X7N A;  3A22 A;  1FPN 2;  2RM2 3;  4W65 A;  1OXC A;  4QHO A;  4B8E A;  4JGY A;  5LBE A;  3I2D A;  1Y9Q A;  4IEQ A;  5JI7 A;  4CRQ A;  2AH2 A;  5K9Y A;  5FY4 A;  2P37 A;  1JYV A;  1PK6 B;  1AJK A;  1H1M A;  3IMN A;  5ABJ B;  1J58 A;  4D6R A;  3K4A A;  4YGB A;  3ZFF B;  5JPM B;  2EAL A;  3WW3 A;  1NCQ A;  4Q4Y 1;  5B4N A;  5JCT A;  2HWE 2;  2UWA A;  1PIV 3;  1OUX A;  2VC9 A;  4Z2W A;  1VAV A;  5T52 A;  5F5C A;  4V1P A;  3LGR A;  1F5F A;  3UV9 A;  1WW6 A;  1IS3 A;  5IAV A;  2QQJ A;  3RRD A;  1QJY 3;  2X10 A;  5EWS A;  2GP5 A;  2RS1 3;  2VBP A;  3AL5 A;  3K3O A;  1DGW X;  4BDV B;  1U5Z A;  3HR9 A;  2GC2 A;  5FLI A;  2X05 A;  3C2U A;  2LRP A;  4RR3 B;  1VMJ A;  1UQX A;  4AL9 A;  2XL7 A;  3T2O A;  4KG8 A;  4Q0P A;  2VY0 A;  5LA9 A;  4A7Z A;  3KWV A;  1VBE 3;  1CGP A;  1QJX 3;  1F2N A;  3MPP G;  5FP7 A;  5LK5 A;  4DY5 A;  1N3Q A;  3U11 A;  2DYC A;  5I8S A;  2HWF 2;  1C8M 3;  3LZZ A;  4FPC A;  1O8P A;  2E63 A;  3ELN A;  3IDE A;  3UL2 A;  2P2K A;  3DYM A;  5C8C C;  1QEX A;  2IXJ A;  2PHR A;  3LOB A;  1IOA A;  3MPB A;  4XQ4 A;  3K77 A;  4JDN A;  1RHI 1;  2ZMN A;  2VNV A;  4ATF A;  1LOE A;  5FPB A;  1IHM A;  1CZS A;  2W2I A;  5EHD A;  3VZK A;  3THP A;  2WQ8 A;  1SBF A;  1PZ7 A;  2XWB B;  4FCA A;  4JV4 A;  1D0H A;  2XL9 A;  3D0S A;  3NAP C;  4M3C B;  4MLO A;  1W9Y A;  4QB6 A;  1ND3 A;  1YIF A;  3GXU A;  4I02 A;  3POE A;  1JZ5 A;  5EYX A;  3JZV A;  4UYB A;  4CEY B;  2HWB 1;  3N9O A;  4CEW A;  3MUY 1;  3RI9 A;  5C71 A;  3J9S A;  1HB2 A;  2W94 A;  3ES4 A;  3FLP A;  4AOC A;  4XQW A;  3T2Q A;  2R0H A;  3OUH A;  3OBZ A;  3N9P A;  3KCY A;  3AKS A;  3K2O A;  1YXW A;  4O7X A;  2C1F A;  2DV9 A;  4ONU A;  4UFK A;  4L92 A;  4HLT A;  5HCB A;  3CQO A;  4OYU A;  4OQ8 A;  4Q4W 2;  1UZ0 A;  4EWE A;  1VPH A;  2F4L A;  4K8F A;  4LBJ A;  3UES A;  5CU1 A;  3VBS B;  2JDK A;  4LA2 A;  1ZBE 3;  4FPF A;  4LBN A;  2ZGR A;  1OF4 A;  2YC2 A;  1PGW 2;  1JOD A;  3VHO A;  4C1X A;  2WNU A;  4NRO A;  2Q1Z B;  4JGY C;  4AK3 A;  5LEJ A;  4XCA A;  3ZFG B;  4Z92 B;  3HQR A;  3T09 A;  3WR0 A;  3ZXG A;  4LA3 A;  2CYF A;  2LTN A;  2VZR A;  1EV1 3;  4XZU G;  5T3N A;  3TB0 A;  5DDJ 3;  5BV6 A;  1O3S A;  4M0N A;  4TYS A;  1KDM A;  1NCQ C;  1RUE 1;  4W6Y A;  4XFI A;  2J7M A;  1POQ A;  1PGS A;  2Q5T A;  5FZ9 A;  1EY2 A;  5DPN A;  3IAQ A;  3MZH A;  3I2H A;  3IIA A;  5BNN B;  2ORX A;  4LBQ A;  2BQP A;  2A6V A;  2WAO A;  3FFZ A;  4LOR A;  4WM7 B;  5A7W A;  3N36 A;  4M3C E;  2E7T A;  3OF1 A;  4IGP A;  4FQ4 A;  4IV1 B;  4RGK A;  5ACA 3;  3USS A;  3POG A;  4RGA A;  1POV 1;  4Q4X 1;  4CP0 A;  2VZS A;  3AZY A;  1ONA A;  5A7Q A;  4AED B;  4Y4R A;  4R4X A;  1A78 A;  4GD4 A;  3NJY A;  1OD3 A; 
#chains in the Genus database with same CATH homology
 3ACF A;  3A21 A;  3BN6 A;  3MO4 A;  2VZ3 A;  4CU7 A;  1UY1 A;  1TVG A;  2VL4 A;  2ZEW A;  2BZD A;  2E26 A;  2V4V A;  2WAB A;  2XON A;  2Y6H A;  2J1A A;  3JXS A;  1JZ3 A;  4BK5 A;  3OGV A;  3OGR A;  1GNY A;  3OG2 A;  4RN5 A;  4XUQ A;  3HJR A;  4M4R A;  2VM9 A;  2W87 A;  2YC4 A;  5EJZ B;  2QQL A;  3ECQ A;  1CZV A;  1OH4 A;  1SG3 A;  3F2Z A;  2JD9 A;  3WNK A;  2J1E A;  2BGP A;  3VD3 A;  2VOT A;  3VD9 A;  1EUT A;  3HOB A;  2VCC A;  2EIE A;  2VQT A;  1P8J A;  3ACH A;  1J84 A;  5LA1 A;  1US2 A;  3T08 A;  4CVU A;  4KI5 M;  2QQN A;  5JXJ A;  1JI6 A;  2V5D A;  3UNP A;  3EB7 A;  4DEV A;  4HG6 B;  1UY3 A;  2C4X A;  3C7F A;  1UYX A;  4QX2 A;  3VD5 A;  3THC A;  3SKV A;  3FHQ A;  2Y6J A;  2VTF A;  3C7G A;  3MBW A;  1W9T A;  1SHW B;  4DEQ A;  2W46 A;  4UAP A;  3WNL A;  4LKS A;  1NX9 A;  3WF1 A;  2C9K A;  2WN2 A;  2Y64 A;  5A1A A;  1F4H A;  1TG7 A;  2VZ1 A;  1SDD B;  3NJV A;  4JKK A;  3III A;  2W1W A;  2W1S A;  5IJR A;  2XHN A;  4MAD A;  2LW8 A;  1RYY A;  3LEK A;  4AAX A;  2JE8 A;  4CU8 A;  3WF2 A;  4A4A A;  3I2J A;  2RJ2 A;  1UXZ A;  1J83 A;  2OKX A;  3FL7 A;  1PX4 A;  5DMY A;  4DXS A;  4DUV A;  4CUA A;  2KD7 A;  1ULP A;  4JHZ A;  1PMJ X;  1W9S A;  4CU9 A;  4XUN A;  4A45 A;  4DXR A;  4MGQ A;  3MV1 1;  2J1V A;  2Z4F A;  2VCB A;  3CIH A;  3GGL A;  4XUT A;  2WYS A;  5DN2 A;  2J1S A;  3PUH A;  1EUU A;  2WN3 A;  4JX0 A;  2VCA A;  4P02 B;  3WNO A;  3I2K A;  3W5M A;  4E8D A;  1K3I A;  3IB3 A;  4QX0 A;  2ZEY A;  2V72 A;  3NNG A;  4E8C A;  3MUZ 1;  3IDA A;  1JZ8 A;  1T2X A;  4ARY A;  1PMH X;  1WKY A;  1IQD C;  4IUG A;  1K42 A;  3ACG A;  2W47 A;  5IHR A;  3U37 A;  3WF0 A;  3VD4 A;  1KEX A;  3OEB A;  1O8S A;  2W3J A;  2J1U A;  2QQK A;  2J1T A;  3NRU A;  1PX3 A;  3E1F 1;  2WO2 A;  4LQR A;  4PF1 A;  1BHG A;  4A41 A;  3LEG A;  4GWI A;  1UYZ A;  4QB1 A;  5EIY B;  4DUW A;  3C8X A;  3LPG A;  4A3Z A;  4D0Q A;  2WZE A;  4BXS V;  5J1X A;  4JKL A;  1UX7 A;  2W5F A;  3DEC A;  3J7H A;  4W50 A;  1UMH A;  3LQC A;  1JU3 A;  2VZV A;  4PT6 A;  3T2P A;  4KWU A;  2W91 A;  3UET A;  2VMC A;  2EID A;  4QX1 A;  3HN3 A;  4YPJ A;  2JKX A;  2RVA A;  4JKM A;  3NJX A;  5I0D A;  3I97 A;  3DYO A;  2W1Q A;  1W99 A;  1W8N A;  5C7G A;  2QQM A;  3OBA A;  1JZ7 A;  2ZEZ A;  2VJX A;  1W0N A;  5F7U A;  1K12 A;  3BGA A;  5IFT A;  3I2F A;  4P00 B;  1DYO A;  4DUX A;  2Y8K A;  5JXG A;  2QQO A;  3EYP A;  4BK4 A;  2WO1 A;  4UOJ A;  1KGY A;  2VME A;  2Y6K A;  4XVH A;  5JR2 A;  3I3D A;  3HNY M;  4BJ0 A;  1HN1 A;  1WCQ A;  4TXW A;  4W4Z A;  2ID4 A;  2LS6 A;  5CZK A;  2R7E B;  2DCJ A;  4P08 A;  3ABZ A;  4OMC A;  1UY2 A;  5C70 A;  3T0A A;  2DCK A;  4LPL A;  4QX3 A;  2BGO A;  2B4K A;  1GMM A;  4OZO A;  3WEZ A;  2W92 A;  2CDP A;  2VZT A;  2W9X A;  3WF3 A;  1XNT A;  4CUB A;  4MOA A;  5LA0 A;  2W95 A;  5LCW L;  4ZZ5 A;  2XOM A;  3C7O A;  5B4X A;  3MV0 1;  1JZ4 A;  3AC0 A;  2VZP A;  1L7Q A;  4L0P A;  3I2G A;  2WUH A;  3THD A;  2HYX A;  4CUC A;  3D3A A;  4XUO A;  1OT5 A;  5EJ1 B;  1CIY A;  3P1I A;  4MO3 M;  4TTG A;  3SEP A;  1UYY A;  5CYY A;  4LHS A;  3T0B A;  2E32 A;  1UXX X;  2BBA A;  2ORZ A;  3A23 A;  3OEA A;  1D7P M;  2VZO A;  1UY4 A;  5FUI A;  4Z2A A;  1JZ6 A;  3CZJ A;  2VR4 A;  4PQQ A;  1UWW A;  4QB2 A;  1US3 A;  2QBX A;  3DYP A;  2ZXQ A;  2C26 A;  3I3E A;  2YB7 A;  2VO5 A;  3WNP A;  4ARX A;  2VMF A;  2L9L A;  2RV9 A;  2WDB A;  3HNM A;  1XPW A;  4P5Y A;  2VQU A;  3T0D A;  1W8O A;  2WZ8 A;  1W9W A;  4OMD A;  5G05 L;  1JZ2 A;  3P6B A;  3C7H A;  2EIB A;  3VD7 A;  2Y6G A;  2YFU A;  2YG0 A;  3CMG A;  3IAP A;  2XQX A;  1JU4 A;  4A6O A;  3VDB A;  3K4D A;  2WBK A;  4GZ9 A;  4ZXE A;  4A44 A;  1F4A A;  1GU3 A;  1JHJ A;  4OUE A;  2B9V A;  2Y6L A;  5IYY A;  3FN9 A;  5DQ0 A;  3I3B A;  5JXI A;  4D8M A;  4QDQ A;  3K46 A;  1DP0 A;  2WAA A;  1H6Y A;  2EIC A;  2YFZ A;  4M4P A;  4QAW A;  3WQB A;  3WNN A;  3A22 A;  3HNB M;  2VMD A;  5HXM A;  2W1U A;  2J22 A;  1JYV A;  5LA2 A;  2PQS A;  3CKH A;  1OF3 A;  3WF4 A;  2BER A;  1MPX A;  3ACI A;  3K4A A;  4ET7 A;  1GOG A;  5B4N A;  4QPW A;  1JYW A;  5JUV A;  2VC9 A;  3WNM A;  1UY0 A;  4XUR A;  2VZQ A;  2QQJ A;  2X10 A;  3LE0 A;  3LEI A;  1NUK A;  3C7E A;  5IFP A;  4BDV B;  3K4Z A;  2X05 A;  1UMI A;  3T2O A;  1I5P A;  4XUP A;  4KMQ A;  3FHA A;  4RYD A;  3A7Q A;  4QDS A;  3HEI A;  3NQH A;  4QDR A;  4ZZ8 A;  3CDZ B;  2CDO A;  2QQI A;  4UI9 L;  2ZEX A;  3LPF A;  1CX1 A;  1O8P A;  4A42 A;  3GM8 A;  5G04 L;  3DYM A;  1L7R A;  1DLC A;  1NKG A;  1K45 A;  3K77 A;  1XNA A;  3HPN A;  3I2I A;  3PUI A;  1CZS A;  2WQ8 A;  2JDA A;  3VDA A;  4MGS A;  4QB6 A;  2E31 A;  3GXU A;  1JZ5 A;  1O59 A;  3OB8 A;  3MUY 1;  3SEE A;  5C71 A;  2W94 A;  1ULO A;  3SKJ E;  5HPO A;  1GOH A;  3T2Q A;  1GOF A;  1LNS A;  3VDC A;  2WO3 A;  4AG4 A;  1H6X A;  4CU6 A;  3CQO A;  4OYU A;  4W8J A;  1UZ0 A;  1XC6 A;  1JYX A;  1NAE A;  3UES A;  4DXT A;  1GQP A;  1OF4 A;  2YC2 A;  3WSO A;  2X09 A;  4FI9 A;  1YQ2 A;  3OGS A;  3T09 A;  1GUI A;  2VZR A;  4XZU G;  4ZY9 A;  1JYN A;  2J7M A;  2DDU A;  2VZU A;  2HLE A;  3W5N A;  5DPN A;  3IAQ A;  2J1R A;  3GDB A;  3I2H A;  2ORX A;  2E33 A;  5JXH A;  2WAO A;  3K75 B;  1CZT A;  3ZM8 A;  2VZS A;  5JMO A;  1R64 A;  3ETP A;  4GWJ A;  3CZU A;  1OD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...