5DN2A

Human nrp2 b1 domain in complex with the peptide corresponding to the c-terminus of vegf-a
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
b'MFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural studies of neuropilin-2 reveal a zinc ion binding site remote from the vascular endothelial growth factor binding pocket.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 5dn2A00
4OMCA 4KMQA 3LEIA 3T2OA 3DYMA 5C71A 4A6OA 1CIYA 1JZ6A 1GOHA 2JDAA 1H6XA 4GWJA 4GZ9A 2QQLA 4JHZA 4CUCA 2W1QA 4P5YA 1JU3A 1P8JA 1UYYA 3I2FA 1OF4A 1UYZA 2J1UA 2J1EA 2WN2A 3EYPA 2WZ8A 3K4DA 3OEBA 4HG6B 1HN1A 1UMIA 1O8SA 2BBAA 2VMCA 3GDBA 2L9LA 5A1AA 2VZ1A 2WAAA 3F2ZA 2OKXA 4E8DA 3ETPA 2XHNA 2VZVA 2DDUA 3T08A 2XONA 3I2KA 3ACIA 4JKLA 2JE8A 2VMEA 4W50A 2VL4A 1UMHA 4KI5M 3LEKA 4LQRA 2KD7A 5HXMA 2QQNA 5JMOA 1J83A 2W47A 1JZ4A 3NQHA 5LA0A 1UWWA 4OZOA 3C7OA 3SEEA 1O8PA 4QX2A 1K45A 1UXZA 2J1AA 3I2GA 3C8XA 2BERA 1W9SA 3FN9A 3WEZA 3WNPA 3P1IA 3K4AA 4W8JA 4AAXA 1UXXX 1W9WA 4CVUA 5IFTA 4CUBA 5C7GA 1D7PM 3MUY1 4QDQA 4XUTA 1BHGA 3T0BA 3WF1A 2YFZA 4MADA 2YG0A 2WAOA 3FL7A 4QX3A 1XC6A 1UZ0A 3EB7A 4PQQA 3LPFA 3ZM8A 3DYOA 1WCQA 2VZUA 5LA1A 3WNMA 3VD4A 5EIYB 1CX1A 5B4NA 1SHWB 2ZEZA 2EIEA 1US3A 1US2A 3CQOA 2QQJA 2J1RA 2J7MA 3IIIA 5JR2A 4CU7A 1W8OA 4QX1A 2J1TA 2VZRA 5DQ0A 1UY1A 4E8CA 2QQIA 2Y6GA 2YFUA 4PF1A 4QDRA 3OG2A 2ZXQA 3K4ZA 1GMMA 5JXGA 2B4KA 2BGPA 2J1VA 2VCAA 1SDDB 4MOAA 5G05L 2VCCA 2VZOA 3MV11 3PUHA 2BGOA 2QQKA 3DYPA 1PX3A 1DP0A 2WO3A 1XNAA 1OD3A 3IDAA 4D0QA 2QBXA 4DXRA 1JYWA 2YC2A 4BK4A 1XNTA 3A22A 3C7HA 3NJVA 3LPGA 3OGSA 1EUUA 3FHAA 2R7EB 1F4AA 1F4HA 2E26A 2RV9A 4XVHA 2ZEYA 1GU3A 1OH4A 2WYSA 3OBAA 3OEAA 1W0NA 3WNNA 2CDPA 3I3EA 2QQOA 3SKJE 5DPNA 1JZ8A 2VTFA 2VC9A 1NAEA 3SEPA 2EICA 1NKGA 3OB8A 4MO3M 3WF3A 2VR4A 1KEXA 2VOTA 2RVAA 4W4ZA 1PX4A 2J1SA 1NUKA 3T2PA 4CU6A 1K12A 2W94A 3DECA 1MPXA 2VZSA 4A44A 1XPWA 2WBKA 1W8NA 2W91A 2Y6KA 1L7RA 1TG7A 4XZUG 1H6YA 3VDCA 2V72A 2W1SA 2JD9A 2X09A 4ET7A 4XURA 2DCJA 4M4RA 3I3DA 3IB3A 3WNOA 2Y6HA 1WKYA 2Z4FA 2W1UA 4DEQA 1CZSA 3JXSA 2VZQA 5J1XA 3GM8A 2QQMA 2E31A 5IJRA 3HEIA 4BDVB 1UX7A 1EUTA 1ULOA 4L0PA 2YB7A 1OT5A 3WNLA 2VM9A 2E32A 3IAPA 4CUAA 4CU9A 4DXSA 4ZZ8A 4ZZ5A 4QDSA 1T2XA 3T2QA 3VD3A 3WSOA 2WO2A 2Y6JA 1JZ5A 4PT6A 3K75B 3UETA 2Y6LA 1PMJX 2LW8A 4A42A 5I0DA 4TTGA 3W5NA 1GOGA 4A4AA 4D8MA 2C4XA 1RYYA 3P6BA 3VD9A 2W3JA 3HPNA 5IHRA 4RYDA 5LCWL 2HLEA 2XQXA 3K46A 3HNMA 5F7UA 4BJ0A 1JZ2A 4QPWA 2V5DA 4LKSA 5G04L 4MGSA 3WF4A 1K42A 3MO4A 5JXHA 1W9TA 4XUPA 4UAPA 1PMHX 3W5MA 3HN3A 2WO1A 3GXUA 3I2IA 3ACHA 5LA2A 1GQPA 3ABZA 4UI9L 3CZUA 4OMDA 2WUHA 2JKXA 2EIBA 1R64A 1L7QA 3GGLA 3I2HA 4A45A 3ACFA 4IUGA 4DXTA 3I2JA 4KWUA 3K77A 2HYXA 2VMDA 1TVGA 1SG3A 2VQUA 3UESA 4DUWA 5HPOA 2LS6A 1ULPA 4JX0A 1UY0A 4AG4A 3PUIA 5C70A 3A23A 3MUZ1 4P08A 1JI6A 3J7HA 2VO5A 4OYUA 3IAQA 1UY3A 2VZ3A 1W99A 2CDOA 3HNBM 3I3BA 2ZEWA 2ID4A 4YPJA 4DEVA 4JKKA 2Y64A 3LQCA 3D3AA 3E1F1 1K3IA 1IQDC 5JUVA 3VDBA 2X05A 2ORZA 3MBWA 5B4XA 4QX0A 3THDA 4ARXA 3SKVA 1UYXA 2X10A 1UY2A 3C7GA 1DYOA 1CZVA 2W92A 4XUOA 4QB6A 4QB2A 4XUNA 1UY4A 1JZ7A 3MV01 2W95A 3CIHA 3T09A 3WF0A 4ARYA 1JZ3A 2W46A 2WZEA 4BK5A 4DUVA 2Y8KA 4ZXEA 4LHSA 4Z2AA 2VZPA 2WQ8A 3THCA 3CMGA 3WQBA 3U37A 4RN5A 3CDZB 3VD5A 4QAWA 2W87A 3NNGA 4OUEA 3BGAA 2PQSA 2W1WA 3BN6A 3VDAA 2VQTA 2VCBA 1JU4A 1LNSA 5CYYA 3C7EA 4A41A 2J22A 2XOMA 3WF2A 4M4PA 1JYVA 2E33A 3ACGA 2BZDA 1O59A 3C7FA 3CZJA 2VMFA 3A7QA 4BXSV 3T0DA 3FHQA 1I5PA 2ORXA 3CKHA 4JKMA 3VD7A 3UNPA 2ZEXA 2C26A 3T0AA 5DMYA 1CZTA 5JXIA 4UOJA 3OGRA 3A21A 5FUIA 1GOFA 2VZTA 2C9KA 1DLCA 3HOBA 2W5FA 3HJRA 3LEGA 1GUIA 2VJXA 2YC4A 1J84A 1NX9A 1JYXA 1KGYA 3I97A 5JXJA 4P00B 4TXWA 4MGQA 4GWIA 1OF3A 3OGVA 2WN3A 2EIDA 1YQ2A 4XUQA 2WDBA 3HNYM 4ZY9A 1JYNA 4LPLA 1JHJA 2B9VA 4A3ZA 4FI9A 4DUXA 5IYYA 5EJ1B 4QB1A 2DCKA 5CZKA 5IFPA 4P02B 3NRUA 2W9XA 1GNYA 5DN2A 4CU8A 2V4VA 3NJXA 3AC0A 2RJ2A 3WNKA 2WABA 3ECQA 5EJZB 3LE0A
chains in the Genus database with same CATH superfamily
2CU5A 1WD4A 5FZ1A 3RG0A 3T4VA 4KWJA 3UL2A 5C3QA 3EJKA 5C71A 2CAUA 1JZ6A 3VLBB 4HKOA 1SZBA 1X33A 4GZ9A 3H8UA 3POEA 2YROA 2VVFA 3ZO0B 2RS32 1RJ8A 5L73A 4YFZA 2AEYA 2W1QA 4C1WA 5C4WC 1JU3A 2QQPA 4GAZA 3EYPA 3VBFB 1H4HA 1LJ7A 5FK7A 4BCUA 2P2KA 3UGHA 1VALA 1AR72 4NIAA 1UMIA 2RS12 3GDBA 2L9LA 3BODA 2MEV3 3VZJA 5JDBA 3WW1A 2VZ1A 3E5UA 2WAAA 4LK6A 2PHXA 2OKXA 4GH4A 4RL7A 4YSFA 3ETPA 4Y22B 1E57A 1TME1 2DUPA 1VBA1 1RMU1 4ORFA 4JRAA 1CD3G 3I2KA 1S2KA 2WA4A 4YW4A 1SACA 4AR2A 1O7FA 2BDRA 4AOCA 1VBC1 2F4PA 2VMEA 4KQ7A 1JMUB 1YRZA 4JTOA 4HANA 5C3OA 4CE8A 1UMHA 4PBPA 4D6RA 2B5HA 2ARXA 2KD7A 4GH4B 1J83A 4B4PA 4JGZC 1JZ4A 2WJSA 3USUA 3KQ4B 5LA0A 4RD7A 1VPHA 2GN3A 5JLVA 3O1RA 5FZ8A 3ZXGA 1XE8A 4QX5A 2JXAA 3J9SA 4FPEA 1ENXA 1XE7A 2OX0A 5JZGA 4RFRB 4INDA 1J1TA 3VL9A 4IV3A 2KR2A 1DFQA 3AP5A 4RGGA 4XIOA 3VBSC 4AFAA 1OFNA 1KD7A 3GHNA 4FAHA 3OPZA 2QQWA 4YZ4A 5F3EA 4W8JA 3TB0A 2ARBA 4V1PA 1YEWA 5T55A 4EROA 3S7IA 2HWF2 1F5JA 1JOPA 1XBFA 2R16A 4WV8A 5FZ9A 1RB8G 3ZYHA 4IXLA 1DLLA 1AR81 4C0BA 2JD4A 1BHGA 4XILA 1T6BX 2HWD2 3PLQA 4IV3B 4G4FA 5FXXA 3KM5A 2QFEA 4X6RB 3MLLA 1H2KA 4QQHA 4IE5A 5CKMA 3IKWA 1D0HA 3RI8A 1DGLA 3M3IA 4QX3A 3X29B 1UCXA 1HRI3 1RUG2 3IDEA 4Y20A 3POYA 3O7OA 4I30A 1E5IA 1JYIA 1WCQA 1GFF2 2BGCA 4Y4YA 1FMD3 4LUMA 1W06A 4Z82A 2BP6A 1GSLA 4XJ8A 1TMF1 3LZZA 5EIYB 1CX1A 5B4NA 3R6SA 2R1BA 3D8CA 3OUHA 4HVQA 1G9AA 3VBFC 3CQOA 2QQJA 2VTXA 2PHTA 2K2SA 4LNVA 4CCOA 5CG8A 4Y20B 2DBIA 5JR2A 1IPKA 3ZSEA 4CU7A 3M1HA 1QJU2 2FCTA 2RS53 2VZRA 3VZMA 1QXPA 1UY1A 4OVEA 4XCAA 1J3QA 1SLIA 2Y6GA 5LWBA 4K9SA 3RWKX 5BNPB 1VJ2A 5FRAA 5A6YA 3JD73 1UX6A 2JDMA 5JSPA 3P5BA 5DDJ3 1ASJ2 5JXGA 3MYXA 2FDFA 2FDIA 3B01A 3TNQA 4A3XA 2ZMLA 2VZOA 2H0BA 3AZWA 1CAUB 3LOBA 1PX3A 4LBOA 4CCMA 5ACA3 1DP0A 5A7QA 5CG9A 1AR61 3TEXA 4Y1ZA 1XNAA 4XFIA 3WINE 1HIXA 3UGGA 1SQ4A 3ZYFA 4AI0A 2DVGA 5E8AA 4MXVA 2JE7A 2RMU2 5B2GB 2YC2A 3AK0A 3R4SA 4HK9A 1C8NA 1XNTA 2EVXA 4IGPA 2RM23 4DQAA 1BMV1 2BW8A 2PLV3 4PIYA 5T54A 2BOIA 2Q8CA 3SH4A 2XHKA 2ZACA 2PHWA 1KJLA 4DIQA 4OHYA 1R1ZA 5FBZA 5GALA 2OIIA 4I0BA 1J3RA 5DG2A 2AGSA 2VBBA 3DV8A 4U2AA 1RUOA 4HVOA 5SV8A 1LHVA 4AI3A 4V2VA 3H3UA 1RUF3 1N47A 3PUQA 3OEAA 4AGRA 1N3OA 4PI0A 4EN9B 5KHGA 5FR3A 5FLHA 2QQOA 5K0UA 3CBNA 5DPNA 3Q9OA 1V6OA 3D0SA 1GLHA 3SH5A 4EN6B 3LGRA 5M0TA 3SEPA 1PNGA 1GBGA 1RUJ1 2UURA 3JZVA 1NLRA 4L99A 2E7QA 2IXLA 1OPMA 4D7SA 1ND3A 2HWC1 4K3UA 5JSRA 1WA4A 2FZ1A 2R49A 4AI1A 4BMBA 5ISLA 4BZ4A 2R062 5J7MA 2DFCA 2RS33 3DECA 1Q3EA 5K0UB 4GALA 1RUI3 3ACLA 3AXDA 1OLRA 2WBKA 2AH2A 1ZNPA 2W91A 3J4UH 4PCRA 3PTRB 1BK1A 5KHIA 4QX8A 1W2TA 1IOAA 1TG7A 4MYEA 5JPNB 1ZRDA 3KT1A 1V9U1 4WBBA 1ND3B 4P9XA 4IQPA 4IETA 3AL5A 2JDUA 4Z2WA 5BNPC 3I49A 5FP3A 5GLVA 4J6GA 2I74A 4YW7A 3KCXA 3UKTA 1HX6A 4NIDA 4CEWA 5E16A 1KRIA 4M0NA 4LR4A 1QOTA 4PBOA 1QMJA 3KZ4C 4AXOA 2VW1A 2GDFA 2VGDA 1JXNA 1XB9A 4P9LA 2QQMA 4HETA 4N90A 5DUXA 4HSLA 5IJRA 5C8WA 3KB5A 2RDSA 3LIHA 1DZRA 3KSCA 1GZ9A 3AKTA 4XABA 5FZIA 5FKBA 1F15A 1NQDA 5FXZA 4AEDA 1PO13 4ZKTB 1ULOA 4CEWB 2MEV1 2ZGSA 4Q4V2 3B93A 3H8OA 4BISA 1O3SA 1RUNA 4QKBA 3OPWA 5CKNA 1LKNA 2WSUA 1Y9QA 2F17A 2Q0AA 1AX1A 1BBT3 4P9YA 4QDSA 3EBRA 4YM1A 5FCCA 1JN2P 4XQDA 2WO2A 5EQUA 3WSOA 1GP5A 5FPAA 1KFUL 3OOXA 1JZ5A 2CGPA 1Z7S3 2XL7A 3BPZA 3VBHA 1VP6A 4GULA 1D4M3 1KDMA 4LULA 4DNYA 1JUHA 4GA9A 4A42A 1GR3A 5F3CA 3W5NA 1VBC2 4A4AA 4GXLA 4GWNA 1ULDA 1RYYA 3P6BA 1TE1B 1PM4A 3FFZA 3U14A 4CP9A 4BLJA 1RUG3 2RR12 5IHRA 5HBAA 4AQTA 1ZX5A 3VBHB 4BJ0A 2WNEA 3ATGA 4QPWA 4R9DA 2D3SA 5F8PA 3FC0A 1VRH3 1DHKB 5AFBA 4K40A 4LE4A 4IDZA 5K0UC 5JXHA 4AHYA 3ZFEC 2ZHMA 4ASLA 2BEOA 4XXAA 4CP9B 3D5OA 1PK6A 5FJKA 2LROA 5FP9A 4C1XA 2BU9A 3NWKA 3GXUA 4LOTA 1ND3C 3I2IA 1VBE1 3ABZA 2ZCWA 2PHUA 4O7XA 3WW4A 4N8MA 1FX5A 3C3VA 3HBKA 4PI2A 1SMVA 3CZUA 2WUHA 4M3CE 2JKXA 2XJRA 1R64A 1TQ5A 1LEDA 5T3NA 4QWNA 3Q8BA 4Q0QA 1AR82 4AK3A 5J09A 1HRI1 3GNEA 1NY71 1IS3A 2JDPA 5DAXA 2RE9A 4DOUA 1CR7A 4MHRA 2W52A 4XTPA 5FREA 3I2JA 5DZGA 3K77A 5FZDA 3RVHA 2RDQA 3RMYA 1FMD1 1QXRA 2VMDA 3O1PA 5FV3A 1Y43B 1SG3A 4COVA 5FYHA 1Y7BA 1ZYBA 2N7GA 3KV5A 1CJPA 4BQ5A 1BCXA 2OPWA 4PF5A 4JX0A 5KHKA 3RJRA 2ZBJA 2WT0A 1OD5A 3AMHA 2UWCA 5C70A 4RGKA 1TMF2 3RZMA 5JOXA 1V6LA 3M7AA 2GC3A 2GP3A 4Q0PA 5EZWA 3ZN5A 3AP4A 2RS51 5A7OA 3W20A 4P08A 5DZEA 2CWSA 1POV0 4NIHA 5J98B 1OUXA 3WP6A 1HW5A 4HMZA 5LY1A 1QJX2 4LKDA 5DAVA 2XKPA 3GYDA 3JD71 1A6CA 5DDJ1 2VPVA 1U5XA 2D5FA 1HQLA 3HNBM 1QXJA 4Z1VA 1OA4A 2WL1A 2LM3A 3WNXA 2ZGPA 4HL0A 4LUKA 2IWGB 5A32A 4YW5A 2DUOA 1O3QA 5ACA1 4XIKA 4QMAA 3VGIA 2ZHKA 3M2MA 3PU3A 2E7TA 2NYYA 1IQDC 5K7PA 4YM0A 5IK5A 2DVBA 4B8EA 3GBWA 3OBTA 2Q8EA 4P9JA 5EXOA 1UYXA 5FZ4A 5F2SA 1FNZA 1W9YA 3VB9A 1O4ZA 1AR62 4EN0A 3J7NA 1CZVA 2VOWA 3T30A 1CONA 4YM2A 1CPNA 2ETEA 4XW3A 3ZYRA 2RM21 4XUOA 2CL2A 3MIDA 4HBNA 1V6NA 1XYNA 1UMZA 2OYZA 4XAAA 2PLV1 5EV7A 4XUNA 4R9CA 3RZGA 1JH5A 1JOJA 5FY5A 4YW3A 2W95A 3WF0A 2CWMA 1VBB2 4KWLA 3BALA 4GMP3 1YCIA 1S0GA 2B46X 1JHNA 3N9NA 3TYJA 1CIWA 4CEYB 3OF1A 1O3TA 4Q2FA 3THCA 3WDXA 2ZX4A 3U37A 1RUF1 2OPKA 5FWJA 2RJKA 1F31A 1W2UA 4KU7A 4QAWA 3ZSLA 4WVVA 1DU3D 5L36A 5DG1A 4MVTA 5F5AA 2DURA 4PHZA 3VDAA 2GNBA 2PA7A 2TBVA 4GKYA 5JIAA 4OFGA 2B8MA 2AZ5A 5FY1A 4CRQA 4A41A 1W6QB 5L19A 2JDKA 2O14A 1WCDJ 2E33A 3IMMA 4CDWA 3ACGA 4NPLA 3ZXDA 2VU9A 1XE0A 3AZXA 5E1RA 1H9WA 1QDOA 2JE9A 2VMFA 2XKOA 2RS31 5DZFA 1OFSA 1RUJ2 2YBPA 5JCTA 5L9BA 4BPZA 3VDDA 1OPOA 1X50A 4P5YA 4U36A 5DMYA 1Y9GA 2HEYF 2HWC2 3D82A 4XJAA 5I0TA 3RZZA 5JXIA 3A21A 1J3PA 5FKCA 5HCAA 1C4RA 3LF7A 1MVEA 1FV3A 1UIJA 3HN1A 1S0JA 1LR5A 1UL9A 2BVBA 2GH8A 5HV0A 4Q4V3 3HOBA 3NKGA 4UXAA 3I2DA 4YVWA 3JB4C 1H2MA 2QTWB 1REEA 5IVBA 1KGYA 3NNJA 4AVSA 2BFUL 4P00B 2FDGA 4GWIA 2HKXA 4Q4W2 3VZNA 4RQPC 4QXBA 1OF3A 5FZOB 3QH7A 1ND2A 3RZLA 2PFWA 1VBD2 3ES4A 1W04A 2RHPA 3SQOA 2EIDA 1VAMA 2YPJA 4KG0A 1N1YA 3MW4A 5KHHA 1WMDA 3V0AB 4QPIB 1WMEA 4OHWA 4Y26A 3USSA 3MIFA 2GN7A 3T3YA 4AZZA 1JYNA 1JHJA 1HJFA 2B9VA 4Q4Y3 5KXCA 2RR13 4KL1A 3NO8A 4E9KA 2D6MA 1PO11 2OUHA 5IYYA 3HBZA 5I0RA 4XOGA 4HZFA 4HOOA 5A3NA 3WG3A 5C5TA 1ND2B 2DCKA 2ZHNA 2XMLA 5T5LA 5FZFA 3NRUA 4P9GA 3DL3A 4YWAA 5A7SA 2YBSA 2G19A 4ZS2A 4IERA 4NVPA 2YV8A 1W2NA 4X6QB 1BBT1 4XEZA 2V4VA 4XHXA 2MEV2 1RVF3 3O1TA 2WABA 4BQ1A 4DMIA 1SBDA 2D97A 1Z7S1 4CEYC 3NNFA 5GZDA 4E27A 2JWPA 4KMQA 3I4IA 1D4M1 2D6KA 5FYCA 3WT3A 1CGPA 5FPZA 3W9AA 3CEWA 4A7KA 3TAYA 3VHPA 4A6OA 1RUE3 4P9IA 4JTNA 3K3NA 5CADA 4NPRA 1F5FA 1GZTA 3E5QA 1NCRA 2QQLA 5KC5A 2OZ6A 3WG2A 1SCRA 4MGYE 3QLQA 4XF0A 1RUG1 5D21A 3N4MA 4HVRA 3WP5A 3SCGA 1A8DA 1VMFA 5DABA 2ZMKA 4OI4A 3KGZA 2Z69A 1QJY3 1O8SA 2BBAA 2VMCA 3BU7A 1VRH1 3B02A 5A1AA 2ZOEB 3AX4A 2HBTA 3KS7A 3ZN4A 2IFWA 4N43B 4BIOA 4EWAA 3VL8A 3H9AA 3M70A 1S2EA 5IVJA 2HWE2 1NCRB 1ZBA3 3K48A 4E8DA 1TZOA 4RHV2 2GAUA 1AF9A 1WGPA 4QGNA 2DDUA 2XONA 1W9FA 1SLCA 1X8MA 2XJTA 4B3NA 5A3UA 2D3RA 3IBMA 4ISQA 4JKLA 2JE8A 3IMNA 3AZVA 3INAA 4W50A 3UKNA 1B35A 2VL4A 3ZYPA 5LW9A 2EALA 2FQPA 1EPWA 2ZJCA 1MR5A 5EWSA 4Q8KA 1QJX3 3LEKA 1Y9MA 2A73B 1RUC3 1COV3 1ASJ1 2ADDA 3LSDA 4GKXA 4Y5TA 3RSJA 1GQGA 1O5UA 4HN1A 3QD6A 3WV6A 2QDNA 2IC1A 4PIXA 3B9CA 3KV9A 5IUQA 3NQHA 4WVMA 1I1EA 5C4WA 3VV1A 4OZOA 1DZQA 3C7OA 3SEEA 3MFCA 4PLMA 1K45A 1UXZA 1UU5A 4UF0A 5GLUA 5FY0A 3I2GA 1B35B 3WOGA 1NY72 2BERA 4H55A 4QPIC 1JUIA 2NN8A 4MSVA 1UU6A 1ACCA 1JS9A 3SCFA 3SHRA 2C24A 5FO7B 1FMD2 4Y1XA 3K4AA 5FWEA 4AAXA 4FAGA 1Z0HA 4D7TA 4CA9A 4LK7A 1YFXA 2NPIA 3GBGA 1D7PM 2JB8A 4QU1A 2VBDA 3ZPYA 2QZ2A 2EIGA 1GZCA 4IE0A 4HKLA 3WF1A 4R52A 5E6HA 2RS52 4KG8A 1NOVA 2XL9A 1BK0A 1AYM3 3GCXA 3LOIA 4Q29A 5FPXA 4JGZA 1ZBE3 1EAH2 5FP8A 5A6QA 4PQQA 5K9YA 2PHDA 4XFGA 3ZM8A 1U12A 2EXHA 5FYIA 3DYOA 4K20A 4QT6A 5ERLA 2VZUA 4EWEA 3UK9A 3Q8EA 1MS3A 1PM7A 1Q8QA 4NHYA 5FP4A 3VD4A 1F2NA 3GF6A 5FY9A 2JECA 2D6NA 2EIEA 2ZEZA 1US2A 2BWCA 4CP2A 5BNNC 2C0ZA 1RXFA 2XJUA 1PVXA 3PNAA 1WCUA 2FHRA 4HT1T 5GZEA 3VBSA 3HR9A 4COYA 3IIIA 2F6BA 2I45A 1EP0A 4NR1A 3EHKA 5JOWA 2J1TA 3RNSA 4N43C 3AKQA 1WD3A 3RDIA 5ABJA 4XF3A 4E8CA 1BEV3 2QQIA 2YFUA 3WCRA 1NCRC 4GMP1 2A3YA 2RM22 1W6PA 4QDRA 4NPMA 4LITA 2PLV2 5A1LA 1TNFA 2GMEA 3C2UA 2Y26A 2J1VA 1AXKA 5FIXA 2HWB3 4CCJA 5G05L 1PIV3 2QUOA 3PUHA 2QQKA 3DYPA 4UBHA 1MVQA 2WO3A 4UW6A 5ABJB 4D7YA 1OD3A 1QF3A 1RUF2 2A6XA 3UKVA 1W6PB 4Q4W3 4AI2A 3ZFFC 5T5PA 4DXRA 1JYWA 4FQZA 1LOBA 3LDKA 2XDVA 2PAMA 3N9MA 1K5MB 4JV4A 5CAZA 3B9IA 3H1MA 1IG0A 3A22A 3MFAA 4JDMA 3THTA 3LPGA 3BUCA 1HN0A 4UFJA 3ZXEA 3H1WA 4LIVA 1OA3A 4N7IA 2WKKA 5LBEA 2Z2SB 1C3HA 2VTXJ 1FI2A 1WMXA 3EMRA 4I01A 3TNPB 2A70A 3PIGA 1YQ8A 4Y22A 3MDPA 2JB4A 2RV9A 2CGNA 2D98A 1YWKA 3HT2A 5A3WA 1RUI2 4Q4V1 5CB7A 3ZYBA 2YU2A 4CDQA 2NQYA 2R32A 2ZEYA 1OH4A 1IKPA 1OHFA 1YI9A 4YRDA 3LB9A 3VKLA 3NAPB 3OBAA 4CUGA 4E2GA 5FO9B 3WNNA 2P4EA 2CDPA 4DY5A 1AXZA 5KBFA 4QQPA 2Y33A 3CHXA 2DBNA 1ZZ9A 1HXS3 5C3RA 1NAEA 5BNOB 5FYZA 5FZBA 2EICA 3OB8A 3WF3A 4MO3M 2VR4A 3WQ0A 2YY1A 4CDQB 1JTZX 2RVAA 2FDKA 1UPSA 4C0HA 4TN7A 1NUKA 4YARA 3H7JA 2W94A 3VN4A 1DQ4A 4MXWA 2ERFA 2VZSA 1GP4A 4Q4Y1 1FOD3 4X8PA 2RR11 4ZU5A 3AJYA 4A44A 1ENRA 2I07B 1XPWA 1C5HA 2D6LX 2HEVF 3QACA 4OCTA 4CPBD 5KWRA 4TWTA 1D2SA 1R093 2ADEA 1ZRIA 4YZ2A 5JI9A 2V72A 3I59A 1RIRA 3FZ3A 1PO12 1XNBA 3H42B 3WHTA 5LBBA 3L9JT 2HWE3 4WM7B 3ZXAC 2O8OA 4L97A 4AHWA 4RHV3 4NHMA 4MXWB 1RVF1 1YJKA 3KVBA 3NMBA 2DCJA 1C1FA 5A3MA 3VHOA 1H8TB 3IIAA 4E4SA 2BJSA 2CTVA 2GNTA 2Z4FA 1BBT2 2A7AA 4IE7A 5LY2A 1RUE1 4LO8A 2CYFA 5CU1A 5FZMA 3DGTA 2ZMNA 3ZYJB 1Z7S2 3I59B 4XJUA 5HI0A 1GNZA 5ABJC 1D4M2 2G9GA 2PHLA 3GM8A 1N3QA 1PO22 1DCSA 4AFBA 4CDUC 4LBQD 1SFYA 2Q30A 2DYCA 3AP6A 4R8HA 1EUTA 1H2NA 1KQRA 1QDCA 1K5MC 3S6PA 4UWDA 1QJY1 3OD4A 5FUPA 4D6SA 1XU1A 1H1IA 4PDWB 1OT5A 3HVDA 3IDBB 1PGL2 3ILFA 1XRUA 2VM9A 4JZRA 3N9LA 1ZBA1 3NV1A 1OVPA 1OQ1A 3RS6A 4CU9A 1C5IA 5FAXA 5BNPA 1VRH2 3BIEA 4NE9A 1UYPA 2YC0A 3WCSA 4DRRA 1T2XA 3ILNA 1GWMA 1XJAA 2A3XA 3MI8A 1KFXL 4UW5A 4UFKA 3SC7X 3VUOA 5FMOS 2Y6LA 3NAPC 1QJX1 4LA3A 3UYJA 1RUC1 4L2NA 4S2GA 2GSYA 4AQ6A 1COV1 1CAUA 2Q5TA 5L9RA 4ASKA 3DXUA 2VBPA 3V65A 3RZJA 5C6CA 4D8MA 5EJ3A 2X5IB 4K21A 1ULEA 2DCZA 1EAH3 3WDYA 3LA7A 3AFGA 4RYDA 5LEKA 4I2OA 5FMCA 2HLEA 5GJ6A 2XQXA 4CDQC 1V70A 4YG3A 3HNMA 5F7UA 3UJQA 1POV3 4Q27A 2XLGA 5F6LB 3WP4A 1WUVA 3ENRA 1YFYA 3M8LA 2ARAA 1C57A 5IAVA 1K42A 1AUYA 5CBLA 3MO4A 2RDRA 4UAPA 4XUPA 4LKEA 4PIZA 4LBLA 3CJIA 3AZYA 3ZMOA 1S0EA 4CCKA 3MPPG 2A6VA 3N9PA 4QHZA 1LGCA 2EAKA 1GZWB 1R1A3 3K3OA 1XSQA 5LB6A 1I3HA 5LA2A 1RC6A 2WLPA 1OQEA 2ES3A 3FHIB 1VBB1 3M3OA 4UI9L 4WM7C 1HB1A 1EPZA 3N35A 1D2QA 3ZOIA 2RJLA 3BI3A 1ZZ7A 1AYM1 4Q8LA 4FOVA 1L7QA 2DF7A 4BQWA 1ZBE1 2WZR3 1H8TC 3GGLA 3CJIB 4FP2A 3I2HA 4CTEA 1LAJA 3B69A 2QZ3A 3PL0A 2XQRA 4DXTA 4KWUA 2HYXA 1TVGA 1E5HA 4S2DA 4DUWA 3UESA 2NLRA 4LO5B 1W0PA 5JWPA 1DGRN 1KDKA 3IDCB 1W03A 4FFHA 4ITCA 1ULPA 3KV6A 5I91A 2EAAA 1X8EA 1ULCA 4CCNA 1LGNA 5JAXA 3MIGA 4QKNA 1M4WA 3ZFEA 1U5ZA 2EA7A 3NKTA 3DUIA 4QQ2A 1VAKA 5AVAA 3A23A 3JUUA 5BXXA 4PDWC 2VQ0A 3DPRA 3LA2A 1BEV1 4D69A 1SBFA 2ILMA 1JI6A 5FMBA 3U11A 3WDWA 3ZPOA 4AGVA 3AZZA 2VO5A 5DUVA 4BIFA 5C3SA 1DQ2A 4BQYA 2PYTA 4C8DA 4JDOA 4JDNA 1W99A 4P5HA 3SNMA 4BWOA 5IATA 5KR7A 4NROA 3DCQA 2ZEWA 2ID4A 4BLIA 2HWB1 3ZFEB 1QWRA 3LSEA 3NVCA 5A33B 4WZFA 1OXCA 3ME2A 4JKKA 2Y64A 1OQDA 4I3PA 5E88A 4IE4A 3DPRB 1H30A 2XVLA 4TLGA 3VDBA 4ASMB 2X05A 4NHKA 5B4XA 1JOBA 1N1VA 4Q4W1 2D3PA 2X5IC 3N7KA 5CEHA 4OI2A 2X10A 4EE2A 3WR0A 4IEYA 1VBD1 3C7GA 4D94A 4YG0A 4TYSA 2VH9A 4NN0A 4PLNA 2YPDA 4QKDA 4R4ZA 3ES1A 4QB6A 1OC1A 4NRMA 4QB2A 2DVAA 3P3NA 5C9AB 2ZGUA 4Y1UA 5L9VA 1BLZA 2Z42A 3PDQA 4MGZE 3CIHA 4E2SA 1JZ3A 1SFPA 2WZEA 4A6SA 3VHNA 2GMPA 2A3WA 4H14A 1HDKA 2Y8KA 4LLFA 3IM0A 3PJQA 1YHFA 1WCSA 2QCSB 4Z2AA 5IK7A 1SLLA 1LULA 5AC93 1YQ5A 3CMGA 2PAKA 4HXCA 2HH9A 3RYPA 1GV9A 2OZJA 1T6GC 1QU0A 2ET7A 3FBMA 1QOSA 1LCLA 1O4YA 1DBNA 1W3XA 3RYKA 1NE6A 1DG6A 2PQSA 1WCKA 2W1WA 2GC0A 3AL6A 1HXS1 1W3VA 3GZTB 4V2WA 5FMOL 3ZXJA 1LNSA 5CYYA 3C7EA 1SLBA 3CJIC 1QOOA 2NZ9A 5IT6A 1W8WA 1S0IA 2OUJA 3IZOA 1RHI2 4M4PA 2HYKA 1SBEA 5BNQA 3ZX7A 2BWAA 1DQ1A 5FZGA 1LHOA 1GYKA 4XDOA 2A6ZA 1PO23 1FOD1 2ORXA 1PMIA 1Q8OA 1CAWA 2Y60A 1BKZA 3CKHA 4YVSC 4ATFA 2C26A 3T0AA 2V73A 1CZTA 1WZXA 1QHDA 3FLPA 4GQ7A 4M3CF 3FX3A 1GOFA 1AZDA 4AFCA 3S57A 4XFBA 1R091 2BRTA 1V6JA 2D43A 4Q4Y2 2VZTA 1OLQA 5J3UA 2C9KA 4W6YA 4D3WA 3OPTA 1Q8VA 2G9ZA 1G7YA 3RZKA 3G7DA 5DAPA 3J7LA 2HWE1 2W5FA 1GUIA 1SEFA 4G9SB 4RHV1 3I2OA 1MS1A 2VJXA 4MGIE 2GU9A 2YC4A 1J84A 3RRDA 3Q8CA 4TZDA 1CAWB 4AEJA 5JXJA 1UAIA 1BZWA 4LE3A 1VR3A 1WLCA 1NYWA 5CVRA 1C8M3 1Q56A 1RVF2 2VG9A 3UJOA 1UIKA 3DPRC 3AYDA 2ZX3A 2GC2A 2D7FA 5C33A 2R043 4CXWA 4WZCA 1POQA 3KWVA 4XUQA 1U0AA 4BXFA 3PUSA 1RUE2 4AAPA 2C1FA 1PZ9A 4DUXA 1WBLA 1UKRA 1R083 5BYNA 2FDHA 3U07A 4BOWA 3ELNA 3CF6E 5F3GA 5CZKA 5IFPA 3AMPA 3MF9A 5C9AC 4DB5A 1GNYA 3AJZA 3MPBA 3L2YA 2NP0A 3QH6A 4W65A 1QJY2 4COUA 2ZS6B 1LESA 3I3QA 1NLSA 5APAA 4FVVA 2EXKA 3WNKA 4B29A 3DKWA 3TN93 3H3LA 1IS5A 1ZBA2 5FQ0A 2XJPA 4L9BA 5FZ0A 4EV0A 3LEIA 4FO9A 2D6PA 4RQPA 3DYMA 2V4AA 4K7JA 4IW3A 4UYBA 4ZONA 1CIYA 1GOHA 2SLIA 1MQTC 2HEWF 2NMOA 4NRPA 4YGBA 4ZU4A 1GP6A 1O5LA 2W2IA 4GWJA 4JHZA 2C6SA 4CUCA 5I0SA 1ZM1A 2W68A 1EAH1 1RUC2 4J1XA 3T1LA 1UYYA 2WZ8A 1COV2 1UYZA 2VOKA 2NM1A 4OI0A 3AKRA 3K4DA 2BV4A 1B09A 2QDRA 1POV1 3OEBA 4IGQA 5FQ0B 5EP9A 2OT7A 4QPYA 4RQPB 1UPIA 3O1SA 5EYYA 1N1TA 1UKGA 5L7OC 1MACA 4X8NA 2PQQA 3POJA 5LEJA 3MIEA 4XJZA 5GKAC 5FYBA 1ODNA 2WIIB 3FLTA 5GLTA 4NIIA 4AHZA 1CJDA 2K9ZA 5I8TA 2XHNA 5A70A 3E6CC 2VZVA 1SPPB 2ZX2A 4KWKA 4W6XA 1MS9A 3HQXA 1R1A1 3WG4A 1WBFA 2WS93 4CPBA 4CEYA 3IWZA 3AXEA 3BCWA 1ZA7A 4KI5M 4AVAA 3TEYA 1HJGA 5I0UA 2HBUA 5HXMA 1G9CA 3N7LA 4UW4A 2WSVA 2W47A 2WZR1 3J8F3 5BNOC 5F3IA 4RS5B 4XF1A 3W58A 4XZPA 1A3KA 3PVNA 1AYM2 1W6QA 5JSOA 2J1AA 3VBOB 3U0ZA 1QY4A 1ZBE2 2R0FA 4OI1A 3WD5A 1IGOA 3AYCA 4XBNA 1LEMA 2KXLA 1W9SA 2Y6FA 2F4LA 1S0FA 2A71A 4B7EA 1CAXA 4CSWA 3WEZA 2X53S 3O0VA 3FFQA 4LBQA 1LRHA 3P1IA 3OD0A 3ZXLA 5C8CA 2ZHLA 4LLOA 3MIBA 4CVUA 1W05A 5IFTA 3FE5A 2H0VA 3POWA 3SMHA 2VE1A 2PTMA 4CYDA 5IWFA 4AI8A 4CUBA 4QGLA 5C7GA 3CL1A 3A0NA 4QDQA 1BVP1 4XUTA 5IVVA 5KXEA 1PZ8A 3T0BA 4COWA 1WLWA 5FY4A 2YFZA 3LDRA 4MADA 1UU4A 5FY7A 1CAXB 1IZ3A 1WWYA 4BU2A 1BEV2 1RUI1 4LBQB 5CFCA 1SFNA 4CP0A 3L2HA 3S5QA 5C8CB 1XC6A 1UZ0A 3EB7A 5FZ6A 2WFF2 3LPFA 2WQZC 5FZOA 1AL23 2ZGMA 3FBYA 3ETQA 4LBNA 1OH3A 2ZABA 3AP7A 4JRLA 2VVEA 4IEXA 5FZ3A 4MHUA 3WW3A 5LA1A 2BQPA 2HWB2 3WNMA 2B42B 1AL0G 1PIV2 5JPMB 2W0XA 2XBO3 4QPIA 3V0AA 1LOAA 4XMAA 1NT0A 1CAVA 1SHWB 5F2WA 4RR3C 4A7YA 2GALA 1EYBA 1US3A 1RHI3 5CFCB 2J7MA 3KHBA 3LA3A 3S7EA 3KCCA 4HFSA 3LEMA 3ON7A 4LO4B 1UN1A 3AYAA 3PMEA 4FOWA 2YDEA 4NHXA 4LEJA 5DQ0A 1CESA 1Z78A 1NCQB 2IZWA 3N7MA 4XACA 1DGWX 2DU1A 3EQEA 4MUVA 4PF1A 1RUH3 1Q8PA 4Q4X2 3OG2A 2ZXQA 3K4ZA 4K8FA 1CAVB 2JG8A 1GMMA 2ZKNA 3EO6A 4JCKA 5AC91 3OUIA 1OMIA 1MEC3 3NV2A 2JG9A 4MOAA 2VNVA 1UW8A 1YIFA 2VCCA 1U5IA 1XYOA 1DZTA 1OUSA 2BGOA 2Y38A 3O5SA 4L8QA 4YGEA 3D6EA 5FXWA 1O3RA 1QJEA 4MG2A 1I5ZA 1RJ7A 1GWKA 3THPA 5CFDC 4XJWA 3NJYA 4FTEA 3IDAA 1TME3 1IS4A 1SDWA 3AFKA 4RS5C 2JG8B 3ORJA 5LRRA 5BNNA 3JBG3 1HXS2 3B00A 3VBOC 3ZYIB 2JG9B 3C7HA 4LHKA 4KH9A 5I93A 3WUCA 1TEIA 3OYWA 2G1MA 3B7MA 3QBQA 4BQ2A 1PO21 3WDVA 2AC1A 1ZZCA 3RPQA 1AR93 2FDJA 1BYHA 2AACA 2JDNA 3ZVXA 1UOFA 1EUUA 4N43A 3FHAA 1PGSA 1F4AA 4NUBA 4HSJA 3D0JA 2PAEA 2WNUC 2ZKLA 3OGJA 3TEWA 1OA2A 5CIRA 3NNLA 3LKJA 4AFDA 2ZGRA 1FOD2 4J25A 1QKQA 4XJ9A 4XVHA 5BNNB 2GZWA 1PGL1 1SLTA 5JOZA 1GU3A 1S2BA 2XJQA 4A2UA 2AEZA 2WYSA 1UNBA 4LHLA 3OYWB 4FQ4A 1R092 2PXJA 2VD7A 2ZX0A 3Q8FA 1JZ8A 1OKQA 3EXUA 2FZ2A 2VTFA 1LGBA 2VC9A 3MW3A 4IEUA 4P14A 3U4SA 5C8CC 2B7YA 3OSDA 2PHFA 5LASA 1DQ5A 1NKGA 3ZFFA 2DTWA 1N3PA 4FPHA 2BVVA 5A3TA 2VOTA 4GD4A 4N9IA 3BTZA 5H9PA 4KGQA 4YGCA 1LODA 3FUOA 4HONA 2BUKA 4BE3A 4M01A 3T2PA 1RUD3 4CU6A 1K12A 1AXYA 2WNVB 1PHMA 1MPXA 3JU9A 1AX2A 1R081 2H6CA 4O9GA 1ENSA 1W8NA 2YU1A 5CFCC 4KBZA 3OUJA 2VCMA 1L7RA 1BQPA 3ZFFB 1MZ6A 2VUJA 2LUWA 4XZUG 1H6YA 2WWJA 1HV0A 4MH0E 2W1SA 5CNAA 3S0MA 2XWBB 1NCQC 2JD9A 4XETA 2X09A 1UD1A 3O1VA 1VB4A 4XHBA 4NAOA 3M3CA 4YLZA 3K51A 3PIJA 2VAUA 3WDTA 4M4RA 3I3DA 3TN91 5FYMA 2FMYA 4R9BA 4COZA 3KD4A 3U75A 1UZYA 3KT4A 2YMZA 1BXHA 1PVC2 4I0WB 3A0KA 3M3QA 4DEQA 1CZSA 1VMJA 2GNDA 4FBFA 3JXSA 2CHHA 5FFOC 3POBA 4FTSA 1W6OA 1DIWA 1UZZA 2E31A 1UOBA 4FFFA 1XU2A 4AEMA 4OZXA 1GANA 4B1MA 1UX7A 2A5ZA 2JG8C 1DDLA 3ZDSA 2P1BA 3VBRB 5KXBA 1W2AX 1G8WA 2OQ7A 4M3CB 2VMIA 2JG9C 4QXKA 4JAAA 4L0PA 2W08A 3MICA 3WNLA 4SLIA 3OY8B 3R4DB 2ZZJA 2AUYA 2P37A 4LORA 3VBUB 5T5JA 2R1DA 1W6OB 3GJBA 4IEOA 4ZZ5A 2GP5A 3POSA 3VD3A 3T2QA 2WS91 1DYKA 3RZHA 2CNAA 5D1IA 3VKOA 4NRQA 4PT6A 1LU2A 3BTYA 5FYSA 3K75B 4XC9A 2JDHA 1DQ6A 4AVTA 4ZU7A 1PMJX 1ULGA 2LW8A 3LWCA 2P3YA 5I0DA 2FBEA 4JGYC 4GB32 4XMIA 2E7AA 1R1A2 5FZAA 4TTGA 1SCSA 3J8F1 4FT8A 4A7ZA 4FTBA 3ALQA 3KT7A 3H8RA 1H8VA 4CDUA 5ANNA 2W3JA 2C5DA 4LTAA 1OOPB 2WFF3 2JDZA 1XNCA 2D93A 3K46A 4BQ4A 1JYTA 2WZR2 3N9OA 1K5MA 1HRV3 5FPVA 2V5DA 4LKSA 5G04L 3GZUC 5T52A 2WNVC 4URAA 2WT2A 5A1FA 1G9DA 1DQ0A 4XBLA 4QGMA 3VHRA 4K8RB 1HB3A 1W28A 2BNNA 4IESA 1NLQA 5FYUA 1A78A 4XQWA 5FP7A 1PMHX 3E6BA 1ODMA 5FZEA 3TOJA 4CDUB 2QE3A 3O1UA 4FCAA 3HN3A 4FPYA 1H4GA 2ZAAA 1GQPA 5GZGA 2O0OA 4YGDA 5A7NA 3NAPA 3WW2A 1S1AA 2ET1A 2GC1A 4Q4X3 4AW7A 4QKFA 4JC1A 4KBBA 4Q0UA 2AREA 2TEPA 1EV13 4S2FA 2QJVA 3OCPA 2BNOA 4XPVA 1AL21 2X8KA 5GZFA 4XYXA 4A45A 1W0OA 2UYBA 1NZCA 3R4UA 1QJFA 4IUGA 5C5UA 1FXZA 3O1MA 1HB2A 1PGW1 1VB2A 5HPOA 4FOQA 2XBO1 4BYYA 5FZKA 4AE2A 2KA3A 4OHXA 2JIGA 1MZ5A 1RHI1 1UY0A 1YUDA 2X29A 4AG4A 5IAXA 3VBRC 2FCVA 3OJBA 5FUNA 4EQVA 1LOEA 4FP3A 2VW0A 3HT1A 4YZ1A 2P6HA 1UO9A 2V5YA 4DPNA 5F5IA 4QPGA 3SXWA 2UY9A 1OLMA 4TSVA 2AENA 3E5XA 3HAGA 2V09A 1O91A 2P5BA 3H7YA 1AJKA 1RUH1 1Q43A 5IVYA 3VBUC 3IAQA 4WM7A 5FZLA 4QU2A 4Q5OA 4FPKA 3WG1A 2EXJA 1LECA 2Z79A 2OW4A 4QQOA 1MEC1 4B4RA 4NAMA 1LOFA 4YPJA 5A3PA 1H8TA 5GLZA 2JIJA 4GJZA 1OKOA 4DZGA 3KV4A 2VULA 3LQCA 4QPGB 3POIA 3D3AA 3E1F1 1K3IA 5AC92 3B3QE 3E6DA 4OHZA 3WP3A 2ORZA 5FO8B 4QX0A 2R072 4N9HA 5FZHA 1QEXA 4IEPA 1LHNA 2MHFA 5GLWA 4Z92B 2WYFA 1OOPC 1H1MA 1UY2A 2CV6A 3JBG1 4L92A 4UFMA 2Q1MA 3WXPA 1YNAA 3DN7A 3OBRA 4NJ4A 3OBZA 1AR91 2PHRA 4AFMA 4PDWA 3ZYGA 5A6ZA 1JZ7A 3MV01 3QOPA 5A7PA 4FFIA 2YHJA 4E4HA 4JVAA 2DU0A 4DUVA 2QVSB 1O6UA 4O65A 3DF0A 4IGOA 3WHUA 1H2LA 3GALA 3O0WA 2XUMA 1RITA 5KXDA 4GWMA 2XWJB 5F37A 3D4KA 2DWRA 2XXZA 2W87A 4J1WA 4Q1RA 3BGAA 4LO7A 2OXBA 3BN6A 2DTYA 4SBVA 2DCYA 2D40A 2VQTA 2VCBA 5FDBA 3F95A 1JU4A 1W8TA 4LXLA 3USUB 1APNA 3DXTA 2UYAA 2X5IA 2J22A 1PVC3 3WF2A 1FNYA 1JBCA 3AM2A 4ZHNA 4K1ZA 4XFFA 1O59A 1VBE3 1RUD1 4BB3A 2GMMA 1C8M2 3C7FA 2I2SA 5JZGB 1M06G 4WM8A 4AGGA 4YZ3A 3A7QA 4BXSV 4Q1PA 3FHQA 1QQP3 4DRVA 4JKMA 4MX3A 4Y3OA 3VD7A 3UNPA 1XSRA 3J26N 2UU8A 4LBJA 4QD2A 5DUWA 5K4LA 1RTVA 2A1XA 4R4XA 1XQNA 2DFBA 3VKFC 2R042 5FOBB 4UOJA 3OGRA 1J59A 1J1LA 5FUIA 1EY2A 1LU1A 1W8ZA 1RINA 1NXMA 1NXD1 4EJRA 3FLRA 4DY3A 2UWAA 1DLCA 4LOSA 1GZWA 1R082 1W6NA 2WA3A 3HJRA 3CJXA 4DS0A 4CDXA 2B45X 4UT5A 4WM8B 5J37A 5TSWA 4JQRA 3A4UA 3RJ2X 4XBQA 3BKZA 1LOGA 1C28A 1NX9A 1ULFA 2R6QA 3K2OA 3ZIWA 1MS0A 4MGQA 4LMFA 1ST8A 2WC2A 3UT0A 2WRAA 2VOXA 2E51A 4YW6A 3P3PA 2J42A 3OGVA 5J48A 2WN3A 3ZFGA 2BPA2 1H1AA 5FBJA 1JODA 1REDA 4QPGC 3AVSA 3TN92 4NIGA 4GB33 1AJOA 1G6NA 3BOPA 1W6NB 3FJSA 3WVJA 3MLKA 4LHNA 4CDXB 2OQ6A 3VKMA 1KJRA 3HNYM 2K46A 4H2AA 2FMDA 4IEWA 4YVSA 4A3ZA 5C3PA 4FI9A 4B4QA 3GCWA 3KVAA 4Z8BA 3RMXA 5EJ1B 5CISA 1LOFC 4R9AA 3U4XA 2ZGOA 2VQAA 1ZZ6A 4FXKB 3JQWA 3ZFGB 2E53A 3AMNA 1YXWA 1GNHA 4P02B 2BTVC 2WT1A 2OS2A 2W9XA 4B7KA 3I8TA 4GH4C 2VMHA 5DN2A 2JKBA 5GZCA 4OUMA 4CU8A 1AYN3 3AMMA 1JW6A 2XVKA 2XGXA 1VLNA 3KGLA 1E5RA 2RJ2A 3AC0A 2A75A 4HLTA 3ECQA 4YVSB 4LJHA 3Q8AA 2A6WA 3LE0A 2XG3A 4OMCA 1F9KA 4B1LA 2ZA9A 4WVWA 2GNMA 5DUUA 3T2OA 3SH3A 5A33A 2YGMA 3O1OA 2JDAA 2WS92 2YUEA 1H6XA 2WWUA 2QQUA 4F7ZA 4K1YA 1X9PA 1IPJA 1P8JA 1QNWA 2J1UA 1NA1A 1OF4A 2J1EA 2WFF1 2WN2A 2XLAA 2Z5WA 2ZGNA 3I2FA 1QJZA 1XOYA 3J8F2 1HRV1 3G6JB 1FPN3 4Y1YA 5JZGC 3FUQA 4FPFA 4HG6B 1HN1A 1GICA 3HQUA 4ISRA 4IV3C 1PIV1 5GM0A 2LALA 2B9UA 4NWVA 1FATA 1YLLA 2ZPXA 3PU8A 3V56A 3F2ZA 5C9AA 1W8FA 5JOYA 3N9QA 2E63A 1L7LA 2TNFA 4HN0A 4XTMA 4I0AA 5LZ6A 4XQ4A 1Y3TA 3HWJA 5CKQA 3RWNA 2IVIB 3HQRA 1NA1B 3T08A 3TBDA 4E4ZA 3ACIA 3GZEA 4LBKA 4YM3A 1WLDA 5BUVA 4YW2A 1REFA 5FXVA 4WM8C 1NG0A 4LKFA 4LQRA 1XNDA 4Q4X1 2ARCA 3N36A 2DUQA 1MQTA 4OHVA 1K5JA 2QQNA 5JMOA 5JVVA 1EV11 1W90A 2R30A 2WO7A 1WW6A 3LFIA 3KHCA 1AR73 1LB2A 2RS13 2MNGA 1UWWA 5D8AA 3JCIA 2QKDA 1O8PA 4QX2A 4UFHA 3VZLA 5F6KA 3HIFA 4KNCA 1VRBA 1LOCA 3C8XA 2ZTNA 3WQ1A 2Q8DA 3H8XA 4CDXC 3ZMNA 2QQVA 1AL22 3POFA 2R073 4LT5A 1ZA4A 3OTFA 5L7OA 3FN9A 1MQTB 4Y4RA 1HKDA 5T5OA 1J58A 2ZGTA 3B94A 5FY8A 3WNPA 1PGW2 5BPXA 3O14A 2XBO2 1UXXX 1W9WA 3TWIA 5D8AB 4QHBA 1NQJA 3UGFA 3ZFGC 5JIUA 5BY5A 5E89A 2XJVA 4BH9A 2XJSA 3U1XA 1ALYA 3MUY1 4RSUA 1CN1A 5IW0A 4XFHA 3VZKA 4XF4A 1UF2C 4Q26A 2DV9A 5LK5A 4AWDA 4D6QA 2YG0A 2WAOA 3FL7A 4E2QA 5FPUA 5L7OB 4CXYA 3SISA 2JEMA 2H6BA 1V0AA 1VMHA 2OVUA 2RDNA 3PMSA 4IV1A 5BNOA 3RFRA 1RUH2 2E6VA 4L11A 4FPLA 3ZSJA 4HK8A 5IK4A 3WDUA 1FAYA 4QX7A 4UFLA 3T2TA 1MEC2 4MGTA 1LHWA 1YYNA 1DYPA 2HWF3 2RG4A 4AI9A 3T4HB 4ES9A 3J7MA 4AEDB 1QIQA 2J1RA 3CU7A 4IV1B 4W6WA 3TRSB 5FPLA 1W6MA 1OSGA 1YQ6A 1TME2 2A6YA 2VUAA 2VY0A 1VBA2 1RMU2 1Y4WA 4FPOB 2UY8A 3U10A 4CCDA 1W8OA 2HWD3 2CSGA 2IXIA 5HXVA 3LCPA 4QX1A 5FJHA 5LA9A 4BA6A 3KQRA 5ANQA 4YZ5A 3JBG2 1NE4A 4H7MA 2WZPP 4EN7B 2XUEA 1I9RA 4CZSA 2ZX1A 1V6MA 1AR92 1KITA 2JJ6A 5A3LA 1NA1C 2B4KA 1HLCA 1RXGA 2BGPA 2P3JA 3AB0A 2VCAA 4NOTA 2ATFA 1H0BA 1W6MB 5LBCA 2VECA 1SDDB 3ZN6A 4AVVA 1YFWA 1WW5A 3NNMA 3MV11 1STMA 4P9WA 4F8AA 4OUSA 4RGAA 4M0HA 3ST7A 4I02A 4YYOA 5A3OA 1O4TA 1G86A 1GKBA 1QNYA 5LK7B 4E4DX 1MS8A 3JB8A 3FWEA 4MGKE 5EFUA 1PVC1 4D0QA 2QBXA 3MLJA 3S5AA 3PVEA 1UOJA 1V6IA 2BFUS 1L3JA 1QJU3 1UZVA 2IVJA 3ILRA 4RR3A 4BK4A 3ZN6B 3NJVA 2E9QA 2KM2A 1QQP1 1V00A 2WINB 3IN9A 2AYHA 3MEPA 3DKQA 1ASJ3 4META 4Q0SA 5D2AA 5H9QA 4OQ9A 3OGSA 4CP1A 2R7EB 4FPCA 1W2OA 2JICA 1DGRA 1XXNA 4PQ9A 3BB6A 1RUD2 1F4HA 5JR7B 2CAVA 3BVCA 2E26A 1PK6B 3PTYA 3LFMA 3RQ0A 5D8AC 1SPPA 4NMIA 4CCCA 2DVFA 3R05A 4RR3B 2D44A 3WY6A 2W39A 1FV2A 4RA0A 3CLPA 1QGLA 3ZXKA 5HCHA 1W0NA 1KS5A 3I3EA 1BVVA 3SKJE 4YW1A 1MS4A 2RMU3 4CEWC 4XE9A 1Q5OA 5CFDA 2BYVE 2WWSA 2NMNA 2EF6A 3IT8A 1VIWB 1KEXA 3AYEA 4RS5A 5T50A 3ZIXA 4TLFA 1CWPA 1UOGA 4GB31 1PX4A 4W4ZA 4Z07A 4PJYA 3ZKYA 4C91A 2J1SA 1C1LA 5F9TA 2WLQA 3VBOA 4XDPA 2Y0IA 4OULA 1IG3A 2XR4A 3B5LB 4XAEA 1HQNA 4H3WA 4FPGA 2IFRA 5I8YA 5IVFA 4FOYA 4AEDC 4IV1C 2WNUA 5AVPA 5CFDB 2Y6KA 4Y1VA 2ZAHA 2Y34A 5J96B 2YBKA 3FMGA 4BM8A 3AVRA 3VDCA 4AYUA 3N3HA 5HCBA 2Q8OA 2OA2A 3MZHA 1AYN1 1FT9A 2K0GA 1GWLA 4XURA 3M3EA 4ET7A 1ZRFA 2VNOA 3RYRA 1Q8SA 3IB3A 3GJAA 4XCBA 2D6OX 3VZOA 3WNOA 3IPVA 3VBHC 1S0BA 2Y6HA 1S4CA 4GJYA 2WNUB 1WKYA 2WNOA 5A32B 2W1UA 2R063 4AHXA 1VE0A 4NHLA 1ZREA 3ZLIA 1W8HA 2IXCA 5F39A 2VZQA 3QCWA 5J1XA 3V64A 4QXCA 4BDVB 1BMV2 3HEIA 2XPJA 4H7LA 2ZGKA 4K6BA 3E97A 4UBGA 5HCFA 1U5YA 5FOJB 1URXA 3BIWE 3ROUA 2CGOA 1UQXA 1GQHA 1FPN1 3IPVB 3POGA 4HPKA 4WVZA 1ENQA 1IQAA 5A7WA 3CO2A 3GBFA 4N53A 4PLOA 2YB7A 2YGLA 4AF9A 1H9PA 3ITQA 1HV1A 1S0DA 2E32A 1HRV2 3IAPA 3GZAA 5FYYA 3W21A 1NCQA 2PN5A 3O12A 4XFCA 3W59A 4BMEA 4DXSA 4AEKA 4ZZ8A 4EWDA 1A34A 2WFPA 1PK6C 1WMFA 3RGBA 3M4FA 4I3GA 5DXDA 3ZR5A 2Y6JA 4OQ8A 2FD8A 2PMWB 2LTNA 1LENA 1NZIA 3OGGA 3ZXFA 1DF0A 2XH6A 4HPKB 1G9BA 3PURA 3UETA 5BV6A 5A7WB 4N53B 3H0OA 1KS4A 4JQTA 1MZFA 1RGSA 3AKPA 3KCYA 5FMDA 1GOGA 1I6XA 2C4XA 3H3ZA 1OLME 1AR71 2QNKA 4RFT0 2RS11 4YFWA 4IE6A 3ZR6A 3VD9A 3BU0A 1YFUA 2JX9A 5FZ7A 4CDWB 3BTXA 3HPNA 1F8VA 5LCWL 1LTEA 3RI9A 4EZ4A 5J36A 5LRSA 1JYCA 1EV12 1CQ9A 1JZ2A 3R0RA 2UWBA 4CCLA 4JHTA 5EYXA 1UZWA 1F35A 2R071 4MGSA 3VDDB 5JI7A 2Y0OA 1V9U2 2VW2A 1N1SA 4FXGB 5DAQA 3WF4A 4NO4A 4C90A 2VXJA 1ZRCA 2BBVA 2LRPA 1D0GA 4I09A 1W9TA 5FZCA 4EYUA 1YQCA 4GIQA 5I8SA 1ZZBA 1G9FA 1RL3A 1YIPA 2SBAA 3GHMA 3I54A 1VBA3 1RMU3 4MLOA 4XF9A 1XNKA 2WQ4A 1A8MA 4ZXKA 3SCHA 3W5MA 3NL1A 2ZGQA 1VBC3 1X7NA 2WO1A 3H50A 1W39A 3ACHA 4YVWB 4AL9A 3WUDA 3DEMA 4MZUA 2R0HA 5FTTC 4BQXA 1X36A 4CXXA 4JGYA 3ZSKA 5IVEA 4OMDA 4O61A 3ZDVA 2EIBA 1ZZ8A 1WW4A 2FCUA 4BHPA 1OBNA 1WLTA 3WZ1A 5DAWA 2HJIA 4DXZA 4FPJA 4DO0A 2EXIA 2ENRA 2IXHA 3ACFA 1CVNA 3TEZA 3KF3A 4LO6B 4XXPA 5KC6A 2VQUA 2WR9A 3LDBA 2VOVA 4O9EA 1OVSA 2HWF1 3MIHA 2WNVA 2LS6A 4JGYB 4YG6A 2XB6C 3LIGA 3PUIA 1IKQA 3H1YA 2P3IA 3URFA 4QHOA 4Q0VA 1C8M1 2VNGA 2HWD1 4M00A 2Q1FA 3N7JA 3MUZ1 4LIUA 4AVBA 2AR6A 3U78A 1D4VB 2P34A 3J7HA 1AX0A 1AR83 4FFGA 1IS6A 2R041 1HQWA 4XFAA 4OYUA 3WX5A 2TUNA 1UY3A 4QM8A 4LBMA 2VZ3A 2CDOA 1QH7A 3O0XA 3I3BA 4YNIA 4DEVA 1YC61 3HMYA 3MGUA 3BTAA 1FYUA 4N53C 4CCEA 5A6XA 1YO8A 5JUVA 5FPBA 4XDQA 5FYTA 4ES8A 5JMCA 5LATA 4F83A 3MBWA 3THDA 1ONAA 1TMF3 4ARXA 3T1MA 3I7DA 3SKVA 2VNRA 4AQ2A 1YJLA 4FSJA 2IUWA 1QJU1 4CDWC 3WLUA 2XLFA 2XVGA 1DYOA 2VMGA 2ZGLA 3ZSMA 3VBRA 4N7UA 2BNMA 2W92A 2B39A 4M3CA 1WA6X 4EZHA 5KHJA 1VAVA 1UY4A 2C9AA 2DCTA 3VDDC 5IK8A 4Y5Z0 3SITA 2IXKA 1VBE2 3PJYA 3T09A 3OY8A 4ARYA 5F5QA 2W46A 3UV9A 3I3MA 4BK5A 3APBA 3VBUA 1HB4A 1QQP2 3V0BA 3BOWA 4ZXEA 4G3YC 1LHUA 4LHSA 4UW3A 1OURA 4Y33A 3BPSA 2VZPA 2WQ8A 2G9FA 3KMHA 1HRI2 3MF6A 4MV2A 4ZPIA 5A80A 1TNRA 3WQBA 3HD8B 4RN5A 4YVWC 3CDZB 3LD8A 4LA2A 3VD5A 3ASIA 4HKWA 5IVCA 3NNGA 2P17A 5LBFA 1BJQA 2RMU1 4OUEA 5FK8A 1W8UA 1AR63 2JENA 3AP9A 4DFSA 3PVOA 1SLAA 2GH2A 1ZVFA 3NV3A 4WVMB 5FLJA 4S2HA 5C4WB 2Q4SA 1YI7A 1ND2C 3V0BB 4Y5SA 2XOMA 1PZ7A 4QM9A 4KGGA 4UFIA 1OOPA 4UF0B 1JYVA 3PHMA 2BZDA 2IXJA 3AKSA 2VUDA 1VBB3 3CZJA 2YXSA 4IL7A 4QXHA 2ZZQA 3NV4A 2MPFA 5F5CA 3T0DA 1I5PA 2DVDA 1XYPA 5CA6A 4EN8B 2ZEXA 4KU8A 5FYVA 5HV4A 2CY6A 4IEVA 3JD72 3CNAA 5DDJ2 1ZRRA 1QH6A 5EHDA 3MW2A 5K8SA 3S30A 1MS5A 3LAGA 1S55A 2VVDA 4AQSA 4ATEA 3ZKUA 1AHSA 3LEGA 3NJZA 3BYWA 5ACA2 3VKNA 1PNFA 1V6KA 1WW7A 2YZ4A 1E5SA 4ONUA 1JYXA 2O8QA 4NWWA 3I97A 1IHMA 4TXWA 4GMP0 4JGZB 4DINB 3NW4A 1AYN2 4IEZA 1IPSA 2R061 3KF5A 4F3JA 1RUJ3 4BQ3A 1CX4A 4OLLA 3SLIA 2VUCA 1MZEA 2HWC3 3AMQA 1YQ2A 4QQLA 2WDBA 5H9SA 4ZY9A 2YYOA 1CPMA 4LPLA 5EPAA 3VBSB 3PUAA 5F1RA 4Y24A 1OI6A 1DGWA 1X82A 2D5HA 2G4IA 2O1QA 1S0CA 3KLSA 5F32A 4CUAA 4QB1A 2BOJA 2VXRA 4URTA 3JQXA 5FLIA 5SV5A 1V9U3 5AFEA 1FPN2 4AVCA 3NSTA 3MHZA 4ZS3A 1KXGA 1X9TA 2P6CA 2PELA 2Q1ZB 3NJXA 3PVBB 5H9RA 1VBD3 2JDYA 3VBFA 5EJZB 1AVBA 2P3KA 4IEQA 3WQ7A 1B35C
chains in the Genus database with same CATH topology
4OMCA 4KMQA 3LEIA 3T2OA 3DYMA 5C71A 4A6OA 1CIYA 1JZ6A 1GOHA 2JDAA 1H6XA 4GWJA 4GZ9A 2QQLA 4JHZA 4CUCA 2W1QA 4P5YA 1JU3A 1P8JA 1UYYA 3I2FA 1OF4A 1UYZA 2J1UA 2J1EA 2WN2A 3EYPA 2WZ8A 3K4DA 3OEBA 4HG6B 1HN1A 1UMIA 1O8SA 2BBAA 2VMCA 3GDBA 2L9LA 5A1AA 2VZ1A 2WAAA 3F2ZA 2OKXA 4E8DA 3ETPA 2XHNA 2VZVA 2DDUA 3T08A 2XONA 3I2KA 3ACIA 4JKLA 2JE8A 2VMEA 4W50A 2VL4A 1UMHA 4KI5M 3LEKA 4LQRA 2KD7A 5HXMA 2QQNA 5JMOA 1J83A 2W47A 1JZ4A 3NQHA 5LA0A 1UWWA 4OZOA 3C7OA 3SEEA 1O8PA 4QX2A 1K45A 1UXZA 2J1AA 3I2GA 3C8XA 2BERA 1W9SA 3FN9A 3WEZA 3WNPA 3P1IA 3K4AA 4W8JA 4AAXA 1UXXX 1W9WA 4CVUA 5IFTA 4CUBA 5C7GA 1D7PM 3MUY1 4QDQA 4XUTA 1BHGA 3T0BA 3WF1A 2YFZA 4MADA 2YG0A 2WAOA 3FL7A 4QX3A 1XC6A 1UZ0A 3EB7A 4PQQA 3LPFA 3ZM8A 3DYOA 1WCQA 2VZUA 5LA1A 3WNMA 3VD4A 5EIYB 1CX1A 5B4NA 1SHWB 2ZEZA 2EIEA 1US3A 1US2A 3CQOA 2QQJA 2J1RA 2J7MA 3IIIA 5JR2A 4CU7A 1W8OA 4QX1A 2J1TA 2VZRA 5DQ0A 1UY1A 4E8CA 2QQIA 2Y6GA 2YFUA 4PF1A 4QDRA 3OG2A 2ZXQA 3K4ZA 1GMMA 5JXGA 2B4KA 2BGPA 2J1VA 2VCAA 1SDDB 4MOAA 5G05L 2VCCA 2VZOA 3MV11 3PUHA 2BGOA 2QQKA 3DYPA 1PX3A 1DP0A 2WO3A 1XNAA 1OD3A 3IDAA 4D0QA 2QBXA 4DXRA 1JYWA 2YC2A 4BK4A 1XNTA 3A22A 3C7HA 3NJVA 3LPGA 3OGSA 1EUUA 3FHAA 2R7EB 1F4AA 1F4HA 2E26A 2RV9A 4XVHA 2ZEYA 1GU3A 1OH4A 2WYSA 3OBAA 3OEAA 1W0NA 3WNNA 2CDPA 3I3EA 2QQOA 3SKJE 5DPNA 1JZ8A 2VTFA 2VC9A 1NAEA 3SEPA 2EICA 1NKGA 3OB8A 4MO3M 3WF3A 2VR4A 1KEXA 2VOTA 2RVAA 4W4ZA 1PX4A 2J1SA 1NUKA 3T2PA 4CU6A 1K12A 2W94A 3DECA 1MPXA 2VZSA 4A44A 1XPWA 2WBKA 1W8NA 2W91A 2Y6KA 1L7RA 1TG7A 4XZUG 1H6YA 3VDCA 2V72A 2W1SA 2JD9A 2X09A 4ET7A 4XURA 2DCJA 4M4RA 3I3DA 3IB3A 3WNOA 2Y6HA 1WKYA 2Z4FA 2W1UA 4DEQA 1CZSA 3JXSA 2VZQA 5J1XA 3GM8A 2QQMA 2E31A 5IJRA 3HEIA 4BDVB 1UX7A 1EUTA 1ULOA 4L0PA 2YB7A 1OT5A 3WNLA 2VM9A 2E32A 3IAPA 4CUAA 4CU9A 4DXSA 4ZZ8A 4ZZ5A 4QDSA 1T2XA 3T2QA 3VD3A 3WSOA 2WO2A 2Y6JA 1JZ5A 4PT6A 3K75B 3UETA 2Y6LA 1PMJX 2LW8A 4A42A 5I0DA 4TTGA 3W5NA 1GOGA 4A4AA 4D8MA 2C4XA 1RYYA 3P6BA 3VD9A 2W3JA 3HPNA 5IHRA 4RYDA 5LCWL 2HLEA 2XQXA 3K46A 3HNMA 5F7UA 4BJ0A 1JZ2A 4QPWA 2V5DA 4LKSA 5G04L 4MGSA 3WF4A 1K42A 3MO4A 5JXHA 1W9TA 4XUPA 4UAPA 1PMHX 3W5MA 3HN3A 2WO1A 3GXUA 3I2IA 3ACHA 5LA2A 1GQPA 3ABZA 4UI9L 3CZUA 4OMDA 2WUHA 2JKXA 2EIBA 1R64A 1L7QA 3GGLA 3I2HA 4A45A 3ACFA 4IUGA 4DXTA 3I2JA 4KWUA 3K77A 2HYXA 2VMDA 1TVGA 1SG3A 2VQUA 3UESA 4DUWA 5HPOA 2LS6A 1ULPA 4JX0A 1UY0A 4AG4A 3PUIA 5C70A 3A23A 3MUZ1 4P08A 1JI6A 3J7HA 2VO5A 4OYUA 3IAQA 1UY3A 2VZ3A 1W99A 2CDOA 3HNBM 3I3BA 2ZEWA 2ID4A 4YPJA 4DEVA 4JKKA 2Y64A 3LQCA 3D3AA 3E1F1 1K3IA 1IQDC 5JUVA 3VDBA 2X05A 2ORZA 3MBWA 5B4XA 4QX0A 3THDA 4ARXA 3SKVA 1UYXA 2X10A 1UY2A 3C7GA 1DYOA 1CZVA 2W92A 4XUOA 4QB6A 4QB2A 4XUNA 1UY4A 1JZ7A 3MV01 2W95A 3CIHA 3T09A 3WF0A 4ARYA 1JZ3A 2W46A 2WZEA 4BK5A 4DUVA 2Y8KA 4ZXEA 4LHSA 4Z2AA 2VZPA 2WQ8A 3THCA 3CMGA 3WQBA 3U37A 4RN5A 3CDZB 3VD5A 4QAWA 2W87A 3NNGA 4OUEA 3BGAA 2PQSA 2W1WA 3BN6A 3VDAA 2VQTA 2VCBA 1JU4A 1LNSA 5CYYA 3C7EA 4A41A 2J22A 2XOMA 3WF2A 4M4PA 1JYVA 2E33A 3ACGA 2BZDA 1O59A 3C7FA 3CZJA 2VMFA 3A7QA 4BXSV 3T0DA 3FHQA 1I5PA 2ORXA 3CKHA 4JKMA 3VD7A 3UNPA 2ZEXA 2C26A 3T0AA 5DMYA 1CZTA 5JXIA 4UOJA 3OGRA 3A21A 5FUIA 1GOFA 2VZTA 2C9KA 1DLCA 3HOBA 2W5FA 3HJRA 3LEGA 1GUIA 2VJXA 2YC4A 1J84A 1NX9A 1JYXA 1KGYA 3I97A 5JXJA 4P00B 4TXWA 4MGQA 4GWIA 1OF3A 3OGVA 2WN3A 2EIDA 1YQ2A 4XUQA 2WDBA 3HNYM 4ZY9A 1JYNA 4LPLA 1JHJA 2B9VA 4A3ZA 4FI9A 4DUXA 5IYYA 5EJ1B 4QB1A 2DCKA 5CZKA 5IFPA 4P02B 3NRUA 2W9XA 1GNYA 5DN2A 4CU8A 2V4VA 3NJXA 3AC0A 2RJ2A 3WNKA 2WABA 3ECQA 5EJZB 3LE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMC A;  4KMQ A;  3LEI A;  3T2O A;  3DYM A;  5C71 A;  4A6O A;  1CIY A;  1JZ6 A;  1GOH A;  2JDA A;  1H6X A;  4GWJ A;  4GZ9 A;  2QQL A;  4JHZ A;  4CUC A;  2W1Q A;  4P5Y A;  1JU3 A;  1P8J A;  1UYY A;  3I2F A;  1OF4 A;  1UYZ A;  2J1U A;  2J1E A;  2WN2 A;  3EYP A;  2WZ8 A;  3K4D A;  3OEB A;  4HG6 B;  1HN1 A;  1UMI A;  1O8S A;  2BBA A;  2VMC A;  3GDB A;  2L9L A;  5A1A A;  2VZ1 A;  2WAA A;  3F2Z A;  2OKX A;  4E8D A;  3ETP A;  2XHN A;  2VZV A;  2DDU A;  3T08 A;  2XON A;  3I2K A;  3ACI A;  4JKL A;  2JE8 A;  2VME A;  4W50 A;  2VL4 A;  1UMH A;  4KI5 M;  3LEK A;  4LQR A;  2KD7 A;  5HXM A;  2QQN A;  5JMO A;  1J83 A;  2W47 A;  1JZ4 A;  3NQH A;  5LA0 A;  1UWW A;  4OZO A;  3C7O A;  3SEE A;  1O8P A;  4QX2 A;  1K45 A;  1UXZ A;  2J1A A;  3I2G A;  3C8X A;  2BER A;  1W9S A;  3FN9 A;  3WEZ A;  3WNP A;  3P1I A;  3K4A A;  4W8J A;  4AAX A;  1UXX X;  1W9W A;  4CVU A;  5IFT A;  4CUB A;  5C7G A;  1D7P M;  3MUY 1;  4QDQ A;  4XUT A;  1BHG A;  3T0B A;  3WF1 A;  2YFZ A;  4MAD A;  2YG0 A;  2WAO A;  3FL7 A;  4QX3 A;  1XC6 A;  1UZ0 A;  3EB7 A;  4PQQ A;  3LPF A;  3ZM8 A;  3DYO A;  1WCQ A;  2VZU A;  5LA1 A;  3WNM A;  3VD4 A;  5EIY B;  1CX1 A;  5B4N A;  1SHW B;  2ZEZ A;  2EIE A;  1US3 A;  1US2 A;  3CQO A;  2QQJ A;  2J1R A;  2J7M A;  3III A;  5JR2 A;  4CU7 A;  1W8O A;  4QX1 A;  2J1T A;  2VZR A;  5DQ0 A;  1UY1 A;  4E8C A;  2QQI A;  2Y6G A;  2YFU A;  4PF1 A;  4QDR A;  3OG2 A;  2ZXQ A;  3K4Z A;  1GMM A;  5JXG A;  2B4K A;  2BGP A;  2J1V A;  2VCA A;  1SDD B;  4MOA A;  5G05 L;  2VCC A;  2VZO A;  3MV1 1;  3PUH A;  2BGO A;  2QQK A;  3DYP A;  1PX3 A;  1DP0 A;  2WO3 A;  1XNA A;  1OD3 A;  3IDA A;  4D0Q A;  2QBX A;  4DXR A;  1JYW A;  2YC2 A;  4BK4 A;  1XNT A;  3A22 A;  3C7H A;  3NJV A;  3LPG A;  3OGS A;  1EUU A;  3FHA A;  2R7E B;  1F4A A;  1F4H A;  2E26 A;  2RV9 A;  4XVH A;  2ZEY A;  1GU3 A;  1OH4 A;  2WYS A;  3OBA A;  3OEA A;  1W0N A;  3WNN A;  2CDP A;  3I3E A;  2QQO A;  3SKJ E;  5DPN A;  1JZ8 A;  2VTF A;  2VC9 A;  1NAE A;  3SEP A;  2EIC A;  1NKG A;  3OB8 A;  4MO3 M;  3WF3 A;  2VR4 A;  1KEX A;  2VOT A;  2RVA A;  4W4Z A;  1PX4 A;  2J1S A;  1NUK A;  3T2P A;  4CU6 A;  1K12 A;  2W94 A;  3DEC A;  1MPX A;  2VZS A;  4A44 A;  1XPW A;  2WBK A;  1W8N A;  2W91 A;  2Y6K A;  1L7R A;  1TG7 A;  4XZU G;  1H6Y A;  3VDC A;  2V72 A;  2W1S A;  2JD9 A;  2X09 A;  4ET7 A;  4XUR A;  2DCJ A;  4M4R A;  3I3D A;  3IB3 A;  3WNO A;  2Y6H A;  1WKY A;  2Z4F A;  2W1U A;  4DEQ A;  1CZS A;  3JXS A;  2VZQ A;  5J1X A;  3GM8 A;  2QQM A;  2E31 A;  5IJR A;  3HEI A;  4BDV B;  1UX7 A;  1EUT A;  1ULO A;  4L0P A;  2YB7 A;  1OT5 A;  3WNL A;  2VM9 A;  2E32 A;  3IAP A;  4CUA A;  4CU9 A;  4DXS A;  4ZZ8 A;  4ZZ5 A;  4QDS A;  1T2X A;  3T2Q A;  3VD3 A;  3WSO A;  2WO2 A;  2Y6J A;  1JZ5 A;  4PT6 A;  3K75 B;  3UET A;  2Y6L A;  1PMJ X;  2LW8 A;  4A42 A;  5I0D A;  4TTG A;  3W5N A;  1GOG A;  4A4A A;  4D8M A;  2C4X A;  1RYY A;  3P6B A;  3VD9 A;  2W3J A;  3HPN A;  5IHR A;  4RYD A;  5LCW L;  2HLE A;  2XQX A;  3K46 A;  3HNM A;  5F7U A;  4BJ0 A;  1JZ2 A;  4QPW A;  2V5D A;  4LKS A;  5G04 L;  4MGS A;  3WF4 A;  1K42 A;  3MO4 A;  5JXH A;  1W9T A;  4XUP A;  4UAP A;  1PMH X;  3W5M A;  3HN3 A;  2WO1 A;  3GXU A;  3I2I A;  3ACH A;  5LA2 A;  1GQP A;  3ABZ A;  4UI9 L;  3CZU A;  4OMD A;  2WUH A;  2JKX A;  2EIB A;  1R64 A;  1L7Q A;  3GGL A;  3I2H A;  4A45 A;  3ACF A;  4IUG A;  4DXT A;  3I2J A;  4KWU A;  3K77 A;  2HYX A;  2VMD A;  1TVG A;  1SG3 A;  2VQU A;  3UES A;  4DUW A;  5HPO A;  2LS6 A;  1ULP A;  4JX0 A;  1UY0 A;  4AG4 A;  3PUI A;  5C70 A;  3A23 A;  3MUZ 1;  4P08 A;  1JI6 A;  3J7H A;  2VO5 A;  4OYU A;  3IAQ A;  1UY3 A;  2VZ3 A;  1W99 A;  2CDO A;  3HNB M;  3I3B A;  2ZEW A;  2ID4 A;  4YPJ A;  4DEV A;  4JKK A;  2Y64 A;  3LQC A;  3D3A A;  3E1F 1;  1K3I A;  1IQD C;  5JUV A;  3VDB A;  2X05 A;  2ORZ A;  3MBW A;  5B4X A;  4QX0 A;  3THD A;  4ARX A;  3SKV A;  1UYX A;  2X10 A;  1UY2 A;  3C7G A;  1DYO A;  1CZV A;  2W92 A;  4XUO A;  4QB6 A;  4QB2 A;  4XUN A;  1UY4 A;  1JZ7 A;  3MV0 1;  2W95 A;  3CIH A;  3T09 A;  3WF0 A;  4ARY A;  1JZ3 A;  2W46 A;  2WZE A;  4BK5 A;  4DUV A;  2Y8K A;  4ZXE A;  4LHS A;  4Z2A A;  2VZP A;  2WQ8 A;  3THC A;  3CMG A;  3WQB A;  3U37 A;  4RN5 A;  3CDZ B;  3VD5 A;  4QAW A;  2W87 A;  3NNG A;  4OUE A;  3BGA A;  2PQS A;  2W1W A;  3BN6 A;  3VDA A;  2VQT A;  2VCB A;  1JU4 A;  1LNS A;  5CYY A;  3C7E A;  4A41 A;  2J22 A;  2XOM A;  3WF2 A;  4M4P A;  1JYV A;  2E33 A;  3ACG A;  2BZD A;  1O59 A;  3C7F A;  3CZJ A;  2VMF A;  3A7Q A;  4BXS V;  3T0D A;  3FHQ A;  1I5P A;  2ORX A;  3CKH A;  4JKM A;  3VD7 A;  3UNP A;  2ZEX A;  2C26 A;  3T0A A;  5DMY A;  1CZT A;  5JXI A;  4UOJ A;  3OGR A;  3A21 A;  5FUI A;  1GOF A;  2VZT A;  2C9K A;  1DLC A;  3HOB A;  2W5F A;  3HJR A;  3LEG A;  1GUI A;  2VJX A;  2YC4 A;  1J84 A;  1NX9 A;  1JYX A;  1KGY A;  3I97 A;  5JXJ A;  4P00 B;  4TXW A;  4MGQ A;  4GWI A;  1OF3 A;  3OGV A;  2WN3 A;  2EID A;  1YQ2 A;  4XUQ A;  2WDB A;  3HNY M;  4ZY9 A;  1JYN A;  4LPL A;  1JHJ A;  2B9V A;  4A3Z A;  4FI9 A;  4DUX A;  5IYY A;  5EJ1 B;  4QB1 A;  2DCK A;  5CZK A;  5IFP A;  4P02 B;  3NRU A;  2W9X A;  1GNY A;  5DN2 A;  4CU8 A;  2V4V A;  3NJX A;  3AC0 A;  2RJ2 A;  3WNK A;  2WAB A;  3ECQ A;  5EJZ B;  3LE0 A; 
#chains in the Genus database with same CATH topology
 2CU5 A;  1WD4 A;  5FZ1 A;  3RG0 A;  3T4V A;  4KWJ A;  3UL2 A;  5C3Q A;  3EJK A;  5C71 A;  2CAU A;  1JZ6 A;  3VLB B;  4HKO A;  1SZB A;  1X33 A;  4GZ9 A;  3H8U A;  3POE A;  2YRO A;  2VVF A;  3ZO0 B;  2RS3 2;  1RJ8 A;  5L73 A;  4YFZ A;  2AEY A;  2W1Q A;  4C1W A;  5C4W C;  1JU3 A;  2QQP A;  4GAZ A;  3EYP A;  3VBF B;  1H4H A;  1LJ7 A;  5FK7 A;  4BCU A;  2P2K A;  3UGH A;  1VAL A;  1AR7 2;  4NIA A;  1UMI A;  2RS1 2;  3GDB A;  2L9L A;  3BOD A;  2MEV 3;  3VZJ A;  5JDB A;  3WW1 A;  2VZ1 A;  3E5U A;  2WAA A;  4LK6 A;  2PHX A;  2OKX A;  4GH4 A;  4RL7 A;  4YSF A;  3ETP A;  4Y22 B;  1E57 A;  1TME 1;  2DUP A;  1VBA 1;  1RMU 1;  4ORF A;  4JRA A;  1CD3 G;  3I2K A;  1S2K A;  2WA4 A;  4YW4 A;  1SAC A;  4AR2 A;  1O7F A;  2BDR A;  4AOC A;  1VBC 1;  2F4P A;  2VME A;  4KQ7 A;  1JMU B;  1YRZ A;  4JTO A;  4HAN A;  5C3O A;  4CE8 A;  1UMH A;  4PBP A;  4D6R A;  2B5H A;  2ARX A;  2KD7 A;  4GH4 B;  1J83 A;  4B4P A;  4JGZ C;  1JZ4 A;  2WJS A;  3USU A;  3KQ4 B;  5LA0 A;  4RD7 A;  1VPH A;  2GN3 A;  5JLV A;  3O1R A;  5FZ8 A;  3ZXG A;  1XE8 A;  4QX5 A;  2JXA A;  3J9S A;  4FPE A;  1ENX A;  1XE7 A;  2OX0 A;  5JZG A;  4RFR B;  4IND A;  1J1T A;  3VL9 A;  4IV3 A;  2KR2 A;  1DFQ A;  3AP5 A;  4RGG A;  4XIO A;  3VBS C;  4AFA A;  1OFN A;  1KD7 A;  3GHN A;  4FAH A;  3OPZ A;  2QQW A;  4YZ4 A;  5F3E A;  4W8J A;  3TB0 A;  2ARB A;  4V1P A;  1YEW A;  5T55 A;  4ERO A;  3S7I A;  2HWF 2;  1F5J A;  1JOP A;  1XBF A;  2R16 A;  4WV8 A;  5FZ9 A;  1RB8 G;  3ZYH A;  4IXL A;  1DLL A;  1AR8 1;  4C0B A;  2JD4 A;  1BHG A;  4XIL A;  1T6B X;  2HWD 2;  3PLQ A;  4IV3 B;  4G4F A;  5FXX A;  3KM5 A;  2QFE A;  4X6R B;  3MLL A;  1H2K A;  4QQH A;  4IE5 A;  5CKM A;  3IKW A;  1D0H A;  3RI8 A;  1DGL A;  3M3I A;  4QX3 A;  3X29 B;  1UCX A;  1HRI 3;  1RUG 2;  3IDE A;  4Y20 A;  3POY A;  3O7O A;  4I30 A;  1E5I A;  1JYI A;  1WCQ A;  1GFF 2;  2BGC A;  4Y4Y A;  1FMD 3;  4LUM A;  1W06 A;  4Z82 A;  2BP6 A;  1GSL A;  4XJ8 A;  1TMF 1;  3LZZ A;  5EIY B;  1CX1 A;  5B4N A;  3R6S A;  2R1B A;  3D8C A;  3OUH A;  4HVQ A;  1G9A A;  3VBF C;  3CQO A;  2QQJ A;  2VTX A;  2PHT A;  2K2S A;  4LNV A;  4CCO A;  5CG8 A;  4Y20 B;  2DBI A;  5JR2 A;  1IPK A;  3ZSE A;  4CU7 A;  3M1H A;  1QJU 2;  2FCT A;  2RS5 3;  2VZR A;  3VZM A;  1QXP A;  1UY1 A;  4OVE A;  4XCA A;  1J3Q A;  1SLI A;  2Y6G A;  5LWB A;  4K9S A;  3RWK X;  5BNP B;  1VJ2 A;  5FRA A;  5A6Y A;  3JD7 3;  1UX6 A;  2JDM A;  5JSP A;  3P5B A;  5DDJ 3;  1ASJ 2;  5JXG A;  3MYX A;  2FDF A;  2FDI A;  3B01 A;  3TNQ A;  4A3X A;  2ZML A;  2VZO A;  2H0B A;  3AZW A;  1CAU B;  3LOB A;  1PX3 A;  4LBO A;  4CCM A;  5ACA 3;  1DP0 A;  5A7Q A;  5CG9 A;  1AR6 1;  3TEX A;  4Y1Z A;  1XNA A;  4XFI A;  3WIN E;  1HIX A;  3UGG A;  1SQ4 A;  3ZYF A;  4AI0 A;  2DVG A;  5E8A A;  4MXV A;  2JE7 A;  2RMU 2;  5B2G B;  2YC2 A;  3AK0 A;  3R4S A;  4HK9 A;  1C8N A;  1XNT A;  2EVX A;  4IGP A;  2RM2 3;  4DQA A;  1BMV 1;  2BW8 A;  2PLV 3;  4PIY A;  5T54 A;  2BOI A;  2Q8C A;  3SH4 A;  2XHK A;  2ZAC A;  2PHW A;  1KJL A;  4DIQ A;  4OHY A;  1R1Z A;  5FBZ A;  5GAL A;  2OII A;  4I0B A;  1J3R A;  5DG2 A;  2AGS A;  2VBB A;  3DV8 A;  4U2A A;  1RUO A;  4HVO A;  5SV8 A;  1LHV A;  4AI3 A;  4V2V A;  3H3U A;  1RUF 3;  1N47 A;  3PUQ A;  3OEA A;  4AGR A;  1N3O A;  4PI0 A;  4EN9 B;  5KHG A;  5FR3 A;  5FLH A;  2QQO A;  5K0U A;  3CBN A;  5DPN A;  3Q9O A;  1V6O A;  3D0S A;  1GLH A;  3SH5 A;  4EN6 B;  3LGR A;  5M0T A;  3SEP A;  1PNG A;  1GBG A;  1RUJ 1;  2UUR A;  3JZV A;  1NLR A;  4L99 A;  2E7Q A;  2IXL A;  1OPM A;  4D7S A;  1ND3 A;  2HWC 1;  4K3U A;  5JSR A;  1WA4 A;  2FZ1 A;  2R49 A;  4AI1 A;  4BMB A;  5ISL A;  4BZ4 A;  2R06 2;  5J7M A;  2DFC A;  2RS3 3;  3DEC A;  1Q3E A;  5K0U B;  4GAL A;  1RUI 3;  3ACL A;  3AXD A;  1OLR A;  2WBK A;  2AH2 A;  1ZNP A;  2W91 A;  3J4U H;  4PCR A;  3PTR B;  1BK1 A;  5KHI A;  4QX8 A;  1W2T A;  1IOA A;  1TG7 A;  4MYE A;  5JPN B;  1ZRD A;  3KT1 A;  1V9U 1;  4WBB A;  1ND3 B;  4P9X A;  4IQP A;  4IET A;  3AL5 A;  2JDU A;  4Z2W A;  5BNP C;  3I49 A;  5FP3 A;  5GLV A;  4J6G A;  2I74 A;  4YW7 A;  3KCX A;  3UKT A;  1HX6 A;  4NID A;  4CEW A;  5E16 A;  1KRI A;  4M0N A;  4LR4 A;  1QOT A;  4PBO A;  1QMJ A;  3KZ4 C;  4AXO A;  2VW1 A;  2GDF A;  2VGD A;  1JXN A;  1XB9 A;  4P9L A;  2QQM A;  4HET A;  4N90 A;  5DUX A;  4HSL A;  5IJR A;  5C8W A;  3KB5 A;  2RDS A;  3LIH A;  1DZR A;  3KSC A;  1GZ9 A;  3AKT A;  4XAB A;  5FZI A;  5FKB A;  1F15 A;  1NQD A;  5FXZ A;  4AED A;  1PO1 3;  4ZKT B;  1ULO A;  4CEW B;  2MEV 1;  2ZGS A;  4Q4V 2;  3B93 A;  3H8O A;  4BIS A;  1O3S A;  1RUN A;  4QKB A;  3OPW A;  5CKN A;  1LKN A;  2WSU A;  1Y9Q A;  2F17 A;  2Q0A A;  1AX1 A;  1BBT 3;  4P9Y A;  4QDS A;  3EBR A;  4YM1 A;  5FCC A;  1JN2 P;  4XQD A;  2WO2 A;  5EQU A;  3WSO A;  1GP5 A;  5FPA A;  1KFU L;  3OOX A;  1JZ5 A;  2CGP A;  1Z7S 3;  2XL7 A;  3BPZ A;  3VBH A;  1VP6 A;  4GUL A;  1D4M 3;  1KDM A;  4LUL A;  4DNY A;  1JUH A;  4GA9 A;  4A42 A;  1GR3 A;  5F3C A;  3W5N A;  1VBC 2;  4A4A A;  4GXL A;  4GWN A;  1ULD A;  1RYY A;  3P6B A;  1TE1 B;  1PM4 A;  3FFZ A;  3U14 A;  4CP9 A;  4BLJ A;  1RUG 3;  2RR1 2;  5IHR A;  5HBA A;  4AQT A;  1ZX5 A;  3VBH B;  4BJ0 A;  2WNE A;  3ATG A;  4QPW A;  4R9D A;  2D3S A;  5F8P A;  3FC0 A;  1VRH 3;  1DHK B;  5AFB A;  4K40 A;  4LE4 A;  4IDZ A;  5K0U C;  5JXH A;  4AHY A;  3ZFE C;  2ZHM A;  4ASL A;  2BEO A;  4XXA A;  4CP9 B;  3D5O A;  1PK6 A;  5FJK A;  2LRO A;  5FP9 A;  4C1X A;  2BU9 A;  3NWK A;  3GXU A;  4LOT A;  1ND3 C;  3I2I A;  1VBE 1;  3ABZ A;  2ZCW A;  2PHU A;  4O7X A;  3WW4 A;  4N8M A;  1FX5 A;  3C3V A;  3HBK A;  4PI2 A;  1SMV A;  3CZU A;  2WUH A;  4M3C E;  2JKX A;  2XJR A;  1R64 A;  1TQ5 A;  1LED A;  5T3N A;  4QWN A;  3Q8B A;  4Q0Q A;  1AR8 2;  4AK3 A;  5J09 A;  1HRI 1;  3GNE A;  1NY7 1;  1IS3 A;  2JDP A;  5DAX A;  2RE9 A;  4DOU A;  1CR7 A;  4MHR A;  2W52 A;  4XTP A;  5FRE A;  3I2J A;  5DZG A;  3K77 A;  5FZD A;  3RVH A;  2RDQ A;  3RMY A;  1FMD 1;  1QXR A;  2VMD A;  3O1P A;  5FV3 A;  1Y43 B;  1SG3 A;  4COV A;  5FYH A;  1Y7B A;  1ZYB A;  2N7G A;  3KV5 A;  1CJP A;  4BQ5 A;  1BCX A;  2OPW A;  4PF5 A;  4JX0 A;  5KHK A;  3RJR A;  2ZBJ A;  2WT0 A;  1OD5 A;  3AMH A;  2UWC A;  5C70 A;  4RGK A;  1TMF 2;  3RZM A;  5JOX A;  1V6L A;  3M7A A;  2GC3 A;  2GP3 A;  4Q0P A;  5EZW A;  3ZN5 A;  3AP4 A;  2RS5 1;  5A7O A;  3W20 A;  4P08 A;  5DZE A;  2CWS A;  1POV 0;  4NIH A;  5J98 B;  1OUX A;  3WP6 A;  1HW5 A;  4HMZ A;  5LY1 A;  1QJX 2;  4LKD A;  5DAV A;  2XKP A;  3GYD A;  3JD7 1;  1A6C A;  5DDJ 1;  2VPV A;  1U5X A;  2D5F A;  1HQL A;  3HNB M;  1QXJ A;  4Z1V A;  1OA4 A;  2WL1 A;  2LM3 A;  3WNX A;  2ZGP A;  4HL0 A;  4LUK A;  2IWG B;  5A32 A;  4YW5 A;  2DUO A;  1O3Q A;  5ACA 1;  4XIK A;  4QMA A;  3VGI A;  2ZHK A;  3M2M A;  3PU3 A;  2E7T A;  2NYY A;  1IQD C;  5K7P A;  4YM0 A;  5IK5 A;  2DVB A;  4B8E A;  3GBW A;  3OBT A;  2Q8E A;  4P9J A;  5EXO A;  1UYX A;  5FZ4 A;  5F2S A;  1FNZ A;  1W9Y A;  3VB9 A;  1O4Z A;  1AR6 2;  4EN0 A;  3J7N A;  1CZV A;  2VOW A;  3T30 A;  1CON A;  4YM2 A;  1CPN A;  2ETE A;  4XW3 A;  3ZYR A;  2RM2 1;  4XUO A;  2CL2 A;  3MID A;  4HBN A;  1V6N A;  1XYN A;  1UMZ A;  2OYZ A;  4XAA A;  2PLV 1;  5EV7 A;  4XUN A;  4R9C A;  3RZG A;  1JH5 A;  1JOJ A;  5FY5 A;  4YW3 A;  2W95 A;  3WF0 A;  2CWM A;  1VBB 2;  4KWL A;  3BAL A;  4GMP 3;  1YCI A;  1S0G A;  2B46 X;  1JHN A;  3N9N A;  3TYJ A;  1CIW A;  4CEY B;  3OF1 A;  1O3T A;  4Q2F A;  3THC A;  3WDX A;  2ZX4 A;  3U37 A;  1RUF 1;  2OPK A;  5FWJ A;  2RJK A;  1F31 A;  1W2U A;  4KU7 A;  4QAW A;  3ZSL A;  4WVV A;  1DU3 D;  5L36 A;  5DG1 A;  4MVT A;  5F5A A;  2DUR A;  4PHZ A;  3VDA A;  2GNB A;  2PA7 A;  2TBV A;  4GKY A;  5JIA A;  4OFG A;  2B8M A;  2AZ5 A;  5FY1 A;  4CRQ A;  4A41 A;  1W6Q B;  5L19 A;  2JDK A;  2O14 A;  1WCD J;  2E33 A;  3IMM A;  4CDW A;  3ACG A;  4NPL A;  3ZXD A;  2VU9 A;  1XE0 A;  3AZX A;  5E1R A;  1H9W A;  1QDO A;  2JE9 A;  2VMF A;  2XKO A;  2RS3 1;  5DZF A;  1OFS A;  1RUJ 2;  2YBP A;  5JCT A;  5L9B A;  4BPZ A;  3VDD A;  1OPO A;  1X50 A;  4P5Y A;  4U36 A;  5DMY A;  1Y9G A;  2HEY F;  2HWC 2;  3D82 A;  4XJA A;  5I0T A;  3RZZ A;  5JXI A;  3A21 A;  1J3P A;  5FKC A;  5HCA A;  1C4R A;  3LF7 A;  1MVE A;  1FV3 A;  1UIJ A;  3HN1 A;  1S0J A;  1LR5 A;  1UL9 A;  2BVB A;  2GH8 A;  5HV0 A;  4Q4V 3;  3HOB A;  3NKG A;  4UXA A;  3I2D A;  4YVW A;  3JB4 C;  1H2M A;  2QTW B;  1REE A;  5IVB A;  1KGY A;  3NNJ A;  4AVS A;  2BFU L;  4P00 B;  2FDG A;  4GWI A;  2HKX A;  4Q4W 2;  3VZN A;  4RQP C;  4QXB A;  1OF3 A;  5FZO B;  3QH7 A;  1ND2 A;  3RZL A;  2PFW A;  1VBD 2;  3ES4 A;  1W04 A;  2RHP A;  3SQO A;  2EID A;  1VAM A;  2YPJ A;  4KG0 A;  1N1Y A;  3MW4 A;  5KHH A;  1WMD A;  3V0A B;  4QPI B;  1WME A;  4OHW A;  4Y26 A;  3USS A;  3MIF A;  2GN7 A;  3T3Y A;  4AZZ A;  1JYN A;  1JHJ A;  1HJF A;  2B9V A;  4Q4Y 3;  5KXC A;  2RR1 3;  4KL1 A;  3NO8 A;  4E9K A;  2D6M A;  1PO1 1;  2OUH A;  5IYY A;  3HBZ A;  5I0R A;  4XOG A;  4HZF A;  4HOO A;  5A3N A;  3WG3 A;  5C5T A;  1ND2 B;  2DCK A;  2ZHN A;  2XML A;  5T5L A;  5FZF A;  3NRU A;  4P9G A;  3DL3 A;  4YWA A;  5A7S A;  2YBS A;  2G19 A;  4ZS2 A;  4IER A;  4NVP A;  2YV8 A;  1W2N A;  4X6Q B;  1BBT 1;  4XEZ A;  2V4V A;  4XHX A;  2MEV 2;  1RVF 3;  3O1T A;  2WAB A;  4BQ1 A;  4DMI A;  1SBD A;  2D97 A;  1Z7S 1;  4CEY C;  3NNF A;  5GZD A;  4E27 A;  2JWP A;  4KMQ A;  3I4I A;  1D4M 1;  2D6K A;  5FYC A;  3WT3 A;  1CGP A;  5FPZ A;  3W9A A;  3CEW A;  4A7K A;  3TAY A;  3VHP A;  4A6O A;  1RUE 3;  4P9I A;  4JTN A;  3K3N A;  5CAD A;  4NPR A;  1F5F A;  1GZT A;  3E5Q A;  1NCR A;  2QQL A;  5KC5 A;  2OZ6 A;  3WG2 A;  1SCR A;  4MGY E;  3QLQ A;  4XF0 A;  1RUG 1;  5D21 A;  3N4M A;  4HVR A;  3WP5 A;  3SCG A;  1A8D A;  1VMF A;  5DAB A;  2ZMK A;  4OI4 A;  3KGZ A;  2Z69 A;  1QJY 3;  1O8S A;  2BBA A;  2VMC A;  3BU7 A;  1VRH 1;  3B02 A;  5A1A A;  2ZOE B;  3AX4 A;  2HBT A;  3KS7 A;  3ZN4 A;  2IFW A;  4N43 B;  4BIO A;  4EWA A;  3VL8 A;  3H9A A;  3M70 A;  1S2E A;  5IVJ A;  2HWE 2;  1NCR B;  1ZBA 3;  3K48 A;  4E8D A;  1TZO A;  4RHV 2;  2GAU A;  1AF9 A;  1WGP A;  4QGN A;  2DDU A;  2XON A;  1W9F A;  1SLC A;  1X8M A;  2XJT A;  4B3N A;  5A3U A;  2D3R A;  3IBM A;  4ISQ A;  4JKL A;  2JE8 A;  3IMN A;  3AZV A;  3INA A;  4W50 A;  3UKN A;  1B35 A;  2VL4 A;  3ZYP A;  5LW9 A;  2EAL A;  2FQP A;  1EPW A;  2ZJC A;  1MR5 A;  5EWS A;  4Q8K A;  1QJX 3;  3LEK A;  1Y9M A;  2A73 B;  1RUC 3;  1COV 3;  1ASJ 1;  2ADD A;  3LSD A;  4GKX A;  4Y5T A;  3RSJ A;  1GQG A;  1O5U A;  4HN1 A;  3QD6 A;  3WV6 A;  2QDN A;  2IC1 A;  4PIX A;  3B9C A;  3KV9 A;  5IUQ A;  3NQH A;  4WVM A;  1I1E A;  5C4W A;  3VV1 A;  4OZO A;  1DZQ A;  3C7O A;  3SEE A;  3MFC A;  4PLM A;  1K45 A;  1UXZ A;  1UU5 A;  4UF0 A;  5GLU A;  5FY0 A;  3I2G A;  1B35 B;  3WOG A;  1NY7 2;  2BER A;  4H55 A;  4QPI C;  1JUI A;  2NN8 A;  4MSV A;  1UU6 A;  1ACC A;  1JS9 A;  3SCF A;  3SHR A;  2C24 A;  5FO7 B;  1FMD 2;  4Y1X A;  3K4A A;  5FWE A;  4AAX A;  4FAG A;  1Z0H A;  4D7T A;  4CA9 A;  4LK7 A;  1YFX A;  2NPI A;  3GBG A;  1D7P M;  2JB8 A;  4QU1 A;  2VBD A;  3ZPY A;  2QZ2 A;  2EIG A;  1GZC A;  4IE0 A;  4HKL A;  3WF1 A;  4R52 A;  5E6H A;  2RS5 2;  4KG8 A;  1NOV A;  2XL9 A;  1BK0 A;  1AYM 3;  3GCX A;  3LOI A;  4Q29 A;  5FPX A;  4JGZ A;  1ZBE 3;  1EAH 2;  5FP8 A;  5A6Q A;  4PQQ A;  5K9Y A;  2PHD A;  4XFG A;  3ZM8 A;  1U12 A;  2EXH A;  5FYI A;  3DYO A;  4K20 A;  4QT6 A;  5ERL A;  2VZU A;  4EWE A;  3UK9 A;  3Q8E A;  1MS3 A;  1PM7 A;  1Q8Q A;  4NHY A;  5FP4 A;  3VD4 A;  1F2N A;  3GF6 A;  5FY9 A;  2JEC A;  2D6N A;  2EIE A;  2ZEZ A;  1US2 A;  2BWC A;  4CP2 A;  5BNN C;  2C0Z A;  1RXF A;  2XJU A;  1PVX A;  3PNA A;  1WCU A;  2FHR A;  4HT1 T;  5GZE A;  3VBS A;  3HR9 A;  4COY A;  3III A;  2F6B A;  2I45 A;  1EP0 A;  4NR1 A;  3EHK A;  5JOW A;  2J1T A;  3RNS A;  4N43 C;  3AKQ A;  1WD3 A;  3RDI A;  5ABJ A;  4XF3 A;  4E8C A;  1BEV 3;  2QQI A;  2YFU A;  3WCR A;  1NCR C;  4GMP 1;  2A3Y A;  2RM2 2;  1W6P A;  4QDR A;  4NPM A;  4LIT A;  2PLV 2;  5A1L A;  1TNF A;  2GME A;  3C2U A;  2Y26 A;  2J1V A;  1AXK A;  5FIX A;  2HWB 3;  4CCJ A;  5G05 L;  1PIV 3;  2QUO A;  3PUH A;  2QQK A;  3DYP A;  4UBH A;  1MVQ A;  2WO3 A;  4UW6 A;  5ABJ B;  4D7Y A;  1OD3 A;  1QF3 A;  1RUF 2;  2A6X A;  3UKV A;  1W6P B;  4Q4W 3;  4AI2 A;  3ZFF C;  5T5P A;  4DXR A;  1JYW A;  4FQZ A;  1LOB A;  3LDK A;  2XDV A;  2PAM A;  3N9M A;  1K5M B;  4JV4 A;  5CAZ A;  3B9I A;  3H1M A;  1IG0 A;  3A22 A;  3MFA A;  4JDM A;  3THT A;  3LPG A;  3BUC A;  1HN0 A;  4UFJ A;  3ZXE A;  3H1W A;  4LIV A;  1OA3 A;  4N7I A;  2WKK A;  5LBE A;  2Z2S B;  1C3H A;  2VTX J;  1FI2 A;  1WMX A;  3EMR A;  4I01 A;  3TNP B;  2A70 A;  3PIG A;  1YQ8 A;  4Y22 A;  3MDP A;  2JB4 A;  2RV9 A;  2CGN A;  2D98 A;  1YWK A;  3HT2 A;  5A3W A;  1RUI 2;  4Q4V 1;  5CB7 A;  3ZYB A;  2YU2 A;  4CDQ A;  2NQY A;  2R32 A;  2ZEY A;  1OH4 A;  1IKP A;  1OHF A;  1YI9 A;  4YRD A;  3LB9 A;  3VKL A;  3NAP B;  3OBA A;  4CUG A;  4E2G A;  5FO9 B;  3WNN A;  2P4E A;  2CDP A;  4DY5 A;  1AXZ A;  5KBF A;  4QQP A;  2Y33 A;  3CHX A;  2DBN A;  1ZZ9 A;  1HXS 3;  5C3R A;  1NAE A;  5BNO B;  5FYZ A;  5FZB A;  2EIC A;  3OB8 A;  3WF3 A;  4MO3 M;  2VR4 A;  3WQ0 A;  2YY1 A;  4CDQ B;  1JTZ X;  2RVA A;  2FDK A;  1UPS A;  4C0H A;  4TN7 A;  1NUK A;  4YAR A;  3H7J A;  2W94 A;  3VN4 A;  1DQ4 A;  4MXW A;  2ERF A;  2VZS A;  1GP4 A;  4Q4Y 1;  1FOD 3;  4X8P A;  2RR1 1;  4ZU5 A;  3AJY A;  4A44 A;  1ENR A;  2I07 B;  1XPW A;  1C5H A;  2D6L X;  2HEV F;  3QAC A;  4OCT A;  4CPB D;  5KWR A;  4TWT A;  1D2S A;  1R09 3;  2ADE A;  1ZRI A;  4YZ2 A;  5JI9 A;  2V72 A;  3I59 A;  1RIR A;  3FZ3 A;  1PO1 2;  1XNB A;  3H42 B;  3WHT A;  5LBB A;  3L9J T;  2HWE 3;  4WM7 B;  3ZXA C;  2O8O A;  4L97 A;  4AHW A;  4RHV 3;  4NHM A;  4MXW B;  1RVF 1;  1YJK A;  3KVB A;  3NMB A;  2DCJ A;  1C1F A;  5A3M A;  3VHO A;  1H8T B;  3IIA A;  4E4S A;  2BJS A;  2CTV A;  2GNT A;  2Z4F A;  1BBT 2;  2A7A A;  4IE7 A;  5LY2 A;  1RUE 1;  4LO8 A;  2CYF A;  5CU1 A;  5FZM A;  3DGT A;  2ZMN A;  3ZYJ B;  1Z7S 2;  3I59 B;  4XJU A;  5HI0 A;  1GNZ A;  5ABJ C;  1D4M 2;  2G9G A;  2PHL A;  3GM8 A;  1N3Q A;  1PO2 2;  1DCS A;  4AFB A;  4CDU C;  4LBQ D;  1SFY A;  2Q30 A;  2DYC A;  3AP6 A;  4R8H A;  1EUT A;  1H2N A;  1KQR A;  1QDC A;  1K5M C;  3S6P A;  4UWD A;  1QJY 1;  3OD4 A;  5FUP A;  4D6S A;  1XU1 A;  1H1I A;  4PDW B;  1OT5 A;  3HVD A;  3IDB B;  1PGL 2;  3ILF A;  1XRU A;  2VM9 A;  4JZR A;  3N9L A;  1ZBA 1;  3NV1 A;  1OVP A;  1OQ1 A;  3RS6 A;  4CU9 A;  1C5I A;  5FAX A;  5BNP A;  1VRH 2;  3BIE A;  4NE9 A;  1UYP A;  2YC0 A;  3WCS A;  4DRR A;  1T2X A;  3ILN A;  1GWM A;  1XJA A;  2A3X A;  3MI8 A;  1KFX L;  4UW5 A;  4UFK A;  3SC7 X;  3VUO A;  5FMO S;  2Y6L A;  3NAP C;  1QJX 1;  4LA3 A;  3UYJ A;  1RUC 1;  4L2N A;  4S2G A;  2GSY A;  4AQ6 A;  1COV 1;  1CAU A;  2Q5T A;  5L9R A;  4ASK A;  3DXU A;  2VBP A;  3V65 A;  3RZJ A;  5C6C A;  4D8M A;  5EJ3 A;  2X5I B;  4K21 A;  1ULE A;  2DCZ A;  1EAH 3;  3WDY A;  3LA7 A;  3AFG A;  4RYD A;  5LEK A;  4I2O A;  5FMC A;  2HLE A;  5GJ6 A;  2XQX A;  4CDQ C;  1V70 A;  4YG3 A;  3HNM A;  5F7U A;  3UJQ A;  1POV 3;  4Q27 A;  2XLG A;  5F6L B;  3WP4 A;  1WUV A;  3ENR A;  1YFY A;  3M8L A;  2ARA A;  1C57 A;  5IAV A;  1K42 A;  1AUY A;  5CBL A;  3MO4 A;  2RDR A;  4UAP A;  4XUP A;  4LKE A;  4PIZ A;  4LBL A;  3CJI A;  3AZY A;  3ZMO A;  1S0E A;  4CCK A;  3MPP G;  2A6V A;  3N9P A;  4QHZ A;  1LGC A;  2EAK A;  1GZW B;  1R1A 3;  3K3O A;  1XSQ A;  5LB6 A;  1I3H A;  5LA2 A;  1RC6 A;  2WLP A;  1OQE A;  2ES3 A;  3FHI B;  1VBB 1;  3M3O A;  4UI9 L;  4WM7 C;  1HB1 A;  1EPZ A;  3N35 A;  1D2Q A;  3ZOI A;  2RJL A;  3BI3 A;  1ZZ7 A;  1AYM 1;  4Q8L A;  4FOV A;  1L7Q A;  2DF7 A;  4BQW A;  1ZBE 1;  2WZR 3;  1H8T C;  3GGL A;  3CJI B;  4FP2 A;  3I2H A;  4CTE A;  1LAJ A;  3B69 A;  2QZ3 A;  3PL0 A;  2XQR A;  4DXT A;  4KWU A;  2HYX A;  1TVG A;  1E5H A;  4S2D A;  4DUW A;  3UES A;  2NLR A;  4LO5 B;  1W0P A;  5JWP A;  1DGR N;  1KDK A;  3IDC B;  1W03 A;  4FFH A;  4ITC A;  1ULP A;  3KV6 A;  5I91 A;  2EAA A;  1X8E A;  1ULC A;  4CCN A;  1LGN A;  5JAX A;  3MIG A;  4QKN A;  1M4W A;  3ZFE A;  1U5Z A;  2EA7 A;  3NKT A;  3DUI A;  4QQ2 A;  1VAK A;  5AVA A;  3A23 A;  3JUU A;  5BXX A;  4PDW C;  2VQ0 A;  3DPR A;  3LA2 A;  1BEV 1;  4D69 A;  1SBF A;  2ILM A;  1JI6 A;  5FMB A;  3U11 A;  3WDW A;  3ZPO A;  4AGV A;  3AZZ A;  2VO5 A;  5DUV A;  4BIF A;  5C3S A;  1DQ2 A;  4BQY A;  2PYT A;  4C8D A;  4JDO A;  4JDN A;  1W99 A;  4P5H A;  3SNM A;  4BWO A;  5IAT A;  5KR7 A;  4NRO A;  3DCQ A;  2ZEW A;  2ID4 A;  4BLI A;  2HWB 1;  3ZFE B;  1QWR A;  3LSE A;  3NVC A;  5A33 B;  4WZF A;  1OXC A;  3ME2 A;  4JKK A;  2Y64 A;  1OQD A;  4I3P A;  5E88 A;  4IE4 A;  3DPR B;  1H30 A;  2XVL A;  4TLG A;  3VDB A;  4ASM B;  2X05 A;  4NHK A;  5B4X A;  1JOB A;  1N1V A;  4Q4W 1;  2D3P A;  2X5I C;  3N7K A;  5CEH A;  4OI2 A;  2X10 A;  4EE2 A;  3WR0 A;  4IEY A;  1VBD 1;  3C7G A;  4D94 A;  4YG0 A;  4TYS A;  2VH9 A;  4NN0 A;  4PLN A;  2YPD A;  4QKD A;  4R4Z A;  3ES1 A;  4QB6 A;  1OC1 A;  4NRM A;  4QB2 A;  2DVA A;  3P3N A;  5C9A B;  2ZGU A;  4Y1U A;  5L9V A;  1BLZ A;  2Z42 A;  3PDQ A;  4MGZ E;  3CIH A;  4E2S A;  1JZ3 A;  1SFP A;  2WZE A;  4A6S A;  3VHN A;  2GMP A;  2A3W A;  4H14 A;  1HDK A;  2Y8K A;  4LLF A;  3IM0 A;  3PJQ A;  1YHF A;  1WCS A;  2QCS B;  4Z2A A;  5IK7 A;  1SLL A;  1LUL A;  5AC9 3;  1YQ5 A;  3CMG A;  2PAK A;  4HXC A;  2HH9 A;  3RYP A;  1GV9 A;  2OZJ A;  1T6G C;  1QU0 A;  2ET7 A;  3FBM A;  1QOS A;  1LCL A;  1O4Y A;  1DBN A;  1W3X A;  3RYK A;  1NE6 A;  1DG6 A;  2PQS A;  1WCK A;  2W1W A;  2GC0 A;  3AL6 A;  1HXS 1;  1W3V A;  3GZT B;  4V2W A;  5FMO L;  3ZXJ A;  1LNS A;  5CYY A;  3C7E A;  1SLB A;  3CJI C;  1QOO A;  2NZ9 A;  5IT6 A;  1W8W A;  1S0I A;  2OUJ A;  3IZO A;  1RHI 2;  4M4P A;  2HYK A;  1SBE A;  5BNQ A;  3ZX7 A;  2BWA A;  1DQ1 A;  5FZG A;  1LHO A;  1GYK A;  4XDO A;  2A6Z A;  1PO2 3;  1FOD 1;  2ORX A;  1PMI A;  1Q8O A;  1CAW A;  2Y60 A;  1BKZ A;  3CKH A;  4YVS C;  4ATF A;  2C26 A;  3T0A A;  2V73 A;  1CZT A;  1WZX A;  1QHD A;  3FLP A;  4GQ7 A;  4M3C F;  3FX3 A;  1GOF A;  1AZD A;  4AFC A;  3S57 A;  4XFB A;  1R09 1;  2BRT A;  1V6J A;  2D43 A;  4Q4Y 2;  2VZT A;  1OLQ A;  5J3U A;  2C9K A;  4W6Y A;  4D3W A;  3OPT A;  1Q8V A;  2G9Z A;  1G7Y A;  3RZK A;  3G7D A;  5DAP A;  3J7L A;  2HWE 1;  2W5F A;  1GUI A;  1SEF A;  4G9S B;  4RHV 1;  3I2O A;  1MS1 A;  2VJX A;  4MGI E;  2GU9 A;  2YC4 A;  1J84 A;  3RRD A;  3Q8C A;  4TZD A;  1CAW B;  4AEJ A;  5JXJ A;  1UAI A;  1BZW A;  4LE3 A;  1VR3 A;  1WLC A;  1NYW A;  5CVR A;  1C8M 3;  1Q56 A;  1RVF 2;  2VG9 A;  3UJO A;  1UIK A;  3DPR C;  3AYD A;  2ZX3 A;  2GC2 A;  2D7F A;  5C33 A;  2R04 3;  4CXW A;  4WZC A;  1POQ A;  3KWV A;  4XUQ A;  1U0A A;  4BXF A;  3PUS A;  1RUE 2;  4AAP A;  2C1F A;  1PZ9 A;  4DUX A;  1WBL A;  1UKR A;  1R08 3;  5BYN A;  2FDH A;  3U07 A;  4BOW A;  3ELN A;  3CF6 E;  5F3G A;  5CZK A;  5IFP A;  3AMP A;  3MF9 A;  5C9A C;  4DB5 A;  1GNY A;  3AJZ A;  3MPB A;  3L2Y A;  2NP0 A;  3QH6 A;  4W65 A;  1QJY 2;  4COU A;  2ZS6 B;  1LES A;  3I3Q A;  1NLS A;  5APA A;  4FVV A;  2EXK A;  3WNK A;  4B29 A;  3DKW A;  3TN9 3;  3H3L A;  1IS5 A;  1ZBA 2;  5FQ0 A;  2XJP A;  4L9B A;  5FZ0 A;  4EV0 A;  3LEI A;  4FO9 A;  2D6P A;  4RQP A;  3DYM A;  2V4A A;  4K7J A;  4IW3 A;  4UYB A;  4ZON A;  1CIY A;  1GOH A;  2SLI A;  1MQT C;  2HEW F;  2NMO A;  4NRP A;  4YGB A;  4ZU4 A;  1GP6 A;  1O5L A;  2W2I A;  4GWJ A;  4JHZ A;  2C6S A;  4CUC A;  5I0S A;  1ZM1 A;  2W68 A;  1EAH 1;  1RUC 2;  4J1X A;  3T1L A;  1UYY A;  2WZ8 A;  1COV 2;  1UYZ A;  2VOK A;  2NM1 A;  4OI0 A;  3AKR A;  3K4D A;  2BV4 A;  1B09 A;  2QDR A;  1POV 1;  3OEB A;  4IGQ A;  5FQ0 B;  5EP9 A;  2OT7 A;  4QPY A;  4RQP B;  1UPI A;  3O1S A;  5EYY A;  1N1T A;  1UKG A;  5L7O C;  1MAC A;  4X8N A;  2PQQ A;  3POJ A;  5LEJ A;  3MIE A;  4XJZ A;  5GKA C;  5FYB A;  1ODN A;  2WII B;  3FLT A;  5GLT A;  4NII A;  4AHZ A;  1CJD A;  2K9Z A;  5I8T A;  2XHN A;  5A70 A;  3E6C C;  2VZV A;  1SPP B;  2ZX2 A;  4KWK A;  4W6X A;  1MS9 A;  3HQX A;  1R1A 1;  3WG4 A;  1WBF A;  2WS9 3;  4CPB A;  4CEY A;  3IWZ A;  3AXE A;  3BCW A;  1ZA7 A;  4KI5 M;  4AVA A;  3TEY A;  1HJG A;  5I0U A;  2HBU A;  5HXM A;  1G9C A;  3N7L A;  4UW4 A;  2WSV A;  2W47 A;  2WZR 1;  3J8F 3;  5BNO C;  5F3I A;  4RS5 B;  4XF1 A;  3W58 A;  4XZP A;  1A3K A;  3PVN A;  1AYM 2;  1W6Q A;  5JSO A;  2J1A A;  3VBO B;  3U0Z A;  1QY4 A;  1ZBE 2;  2R0F A;  4OI1 A;  3WD5 A;  1IGO A;  3AYC A;  4XBN A;  1LEM A;  2KXL A;  1W9S A;  2Y6F A;  2F4L A;  1S0F A;  2A71 A;  4B7E A;  1CAX A;  4CSW A;  3WEZ A;  2X53 S;  3O0V A;  3FFQ A;  4LBQ A;  1LRH A;  3P1I A;  3OD0 A;  3ZXL A;  5C8C A;  2ZHL A;  4LLO A;  3MIB A;  4CVU A;  1W05 A;  5IFT A;  3FE5 A;  2H0V A;  3POW A;  3SMH A;  2VE1 A;  2PTM A;  4CYD A;  5IWF A;  4AI8 A;  4CUB A;  4QGL A;  5C7G A;  3CL1 A;  3A0N A;  4QDQ A;  1BVP 1;  4XUT A;  5IVV A;  5KXE A;  1PZ8 A;  3T0B A;  4COW A;  1WLW A;  5FY4 A;  2YFZ A;  3LDR A;  4MAD A;  1UU4 A;  5FY7 A;  1CAX B;  1IZ3 A;  1WWY A;  4BU2 A;  1BEV 2;  1RUI 1;  4LBQ B;  5CFC A;  1SFN A;  4CP0 A;  3L2H A;  3S5Q A;  5C8C B;  1XC6 A;  1UZ0 A;  3EB7 A;  5FZ6 A;  2WFF 2;  3LPF A;  2WQZ C;  5FZO A;  1AL2 3;  2ZGM A;  3FBY A;  3ETQ A;  4LBN A;  1OH3 A;  2ZAB A;  3AP7 A;  4JRL A;  2VVE A;  4IEX A;  5FZ3 A;  4MHU A;  3WW3 A;  5LA1 A;  2BQP A;  2HWB 2;  3WNM A;  2B42 B;  1AL0 G;  1PIV 2;  5JPM B;  2W0X A;  2XBO 3;  4QPI A;  3V0A A;  1LOA A;  4XMA A;  1NT0 A;  1CAV A;  1SHW B;  5F2W A;  4RR3 C;  4A7Y A;  2GAL A;  1EYB A;  1US3 A;  1RHI 3;  5CFC B;  2J7M A;  3KHB A;  3LA3 A;  3S7E A;  3KCC A;  4HFS A;  3LEM A;  3ON7 A;  4LO4 B;  1UN1 A;  3AYA A;  3PME A;  4FOW A;  2YDE A;  4NHX A;  4LEJ A;  5DQ0 A;  1CES A;  1Z78 A;  1NCQ B;  2IZW A;  3N7M A;  4XAC A;  1DGW X;  2DU1 A;  3EQE A;  4MUV A;  4PF1 A;  1RUH 3;  1Q8P A;  4Q4X 2;  3OG2 A;  2ZXQ A;  3K4Z A;  4K8F A;  1CAV B;  2JG8 A;  1GMM A;  2ZKN A;  3EO6 A;  4JCK A;  5AC9 1;  3OUI A;  1OMI A;  1MEC 3;  3NV2 A;  2JG9 A;  4MOA A;  2VNV A;  1UW8 A;  1YIF A;  2VCC A;  1U5I A;  1XYO A;  1DZT A;  1OUS A;  2BGO A;  2Y38 A;  3O5S A;  4L8Q A;  4YGE A;  3D6E A;  5FXW A;  1O3R A;  1QJE A;  4MG2 A;  1I5Z A;  1RJ7 A;  1GWK A;  3THP A;  5CFD C;  4XJW A;  3NJY A;  4FTE A;  3IDA A;  1TME 3;  1IS4 A;  1SDW A;  3AFK A;  4RS5 C;  2JG8 B;  3ORJ A;  5LRR A;  5BNN A;  3JBG 3;  1HXS 2;  3B00 A;  3VBO C;  3ZYI B;  2JG9 B;  3C7H A;  4LHK A;  4KH9 A;  5I93 A;  3WUC A;  1TEI A;  3OYW A;  2G1M A;  3B7M A;  3QBQ A;  4BQ2 A;  1PO2 1;  3WDV A;  2AC1 A;  1ZZC A;  3RPQ A;  1AR9 3;  2FDJ A;  1BYH A;  2AAC A;  2JDN A;  3ZVX A;  1UOF A;  1EUU A;  4N43 A;  3FHA A;  1PGS A;  1F4A A;  4NUB A;  4HSJ A;  3D0J A;  2PAE A;  2WNU C;  2ZKL A;  3OGJ A;  3TEW A;  1OA2 A;  5CIR A;  3NNL A;  3LKJ A;  4AFD A;  2ZGR A;  1FOD 2;  4J25 A;  1QKQ A;  4XJ9 A;  4XVH A;  5BNN B;  2GZW A;  1PGL 1;  1SLT A;  5JOZ A;  1GU3 A;  1S2B A;  2XJQ A;  4A2U A;  2AEZ A;  2WYS A;  1UNB A;  4LHL A;  3OYW B;  4FQ4 A;  1R09 2;  2PXJ A;  2VD7 A;  2ZX0 A;  3Q8F A;  1JZ8 A;  1OKQ A;  3EXU A;  2FZ2 A;  2VTF A;  1LGB A;  2VC9 A;  3MW3 A;  4IEU A;  4P14 A;  3U4S A;  5C8C C;  2B7Y A;  3OSD A;  2PHF A;  5LAS A;  1DQ5 A;  1NKG A;  3ZFF A;  2DTW A;  1N3P A;  4FPH A;  2BVV A;  5A3T A;  2VOT A;  4GD4 A;  4N9I A;  3BTZ A;  5H9P A;  4KGQ A;  4YGC A;  1LOD A;  3FUO A;  4HON A;  2BUK A;  4BE3 A;  4M01 A;  3T2P A;  1RUD 3;  4CU6 A;  1K12 A;  1AXY A;  2WNV B;  1PHM A;  1MPX A;  3JU9 A;  1AX2 A;  1R08 1;  2H6C A;  4O9G A;  1ENS A;  1W8N A;  2YU1 A;  5CFC C;  4KBZ A;  3OUJ A;  2VCM A;  1L7R A;  1BQP A;  3ZFF B;  1MZ6 A;  2VUJ A;  2LUW A;  4XZU G;  1H6Y A;  2WWJ A;  1HV0 A;  4MH0 E;  2W1S A;  5CNA A;  3S0M A;  2XWB B;  1NCQ C;  2JD9 A;  4XET A;  2X09 A;  1UD1 A;  3O1V A;  1VB4 A;  4XHB A;  4NAO A;  3M3C A;  4YLZ A;  3K51 A;  3PIJ A;  2VAU A;  3WDT A;  4M4R A;  3I3D A;  3TN9 1;  5FYM A;  2FMY A;  4R9B A;  4COZ A;  3KD4 A;  3U75 A;  1UZY A;  3KT4 A;  2YMZ A;  1BXH A;  1PVC 2;  4I0W B;  3A0K A;  3M3Q A;  4DEQ A;  1CZS A;  1VMJ A;  2GND A;  4FBF A;  3JXS A;  2CHH A;  5FFO C;  3POB A;  4FTS A;  1W6O A;  1DIW A;  1UZZ A;  2E31 A;  1UOB A;  4FFF A;  1XU2 A;  4AEM A;  4OZX A;  1GAN A;  4B1M A;  1UX7 A;  2A5Z A;  2JG8 C;  1DDL A;  3ZDS A;  2P1B A;  3VBR B;  5KXB A;  1W2A X;  1G8W A;  2OQ7 A;  4M3C B;  2VMI A;  2JG9 C;  4QXK A;  4JAA A;  4L0P A;  2W08 A;  3MIC A;  3WNL A;  4SLI A;  3OY8 B;  3R4D B;  2ZZJ A;  2AUY A;  2P37 A;  4LOR A;  3VBU B;  5T5J A;  2R1D A;  1W6O B;  3GJB A;  4IEO A;  4ZZ5 A;  2GP5 A;  3POS A;  3VD3 A;  3T2Q A;  2WS9 1;  1DYK A;  3RZH A;  2CNA A;  5D1I A;  3VKO A;  4NRQ A;  4PT6 A;  1LU2 A;  3BTY A;  5FYS A;  3K75 B;  4XC9 A;  2JDH A;  1DQ6 A;  4AVT A;  4ZU7 A;  1PMJ X;  1ULG A;  2LW8 A;  3LWC A;  2P3Y A;  5I0D A;  2FBE A;  4JGY C;  4GB3 2;  4XMI A;  2E7A A;  1R1A 2;  5FZA A;  4TTG A;  1SCS A;  3J8F 1;  4FT8 A;  4A7Z A;  4FTB A;  3ALQ A;  3KT7 A;  3H8R A;  1H8V A;  4CDU A;  5ANN A;  2W3J A;  2C5D A;  4LTA A;  1OOP B;  2WFF 3;  2JDZ A;  1XNC A;  2D93 A;  3K46 A;  4BQ4 A;  1JYT A;  2WZR 2;  3N9O A;  1K5M A;  1HRV 3;  5FPV A;  2V5D A;  4LKS A;  5G04 L;  3GZU C;  5T52 A;  2WNV C;  4URA A;  2WT2 A;  5A1F A;  1G9D A;  1DQ0 A;  4XBL A;  4QGM A;  3VHR A;  4K8R B;  1HB3 A;  1W28 A;  2BNN A;  4IES A;  1NLQ A;  5FYU A;  1A78 A;  4XQW A;  5FP7 A;  1PMH X;  3E6B A;  1ODM A;  5FZE A;  3TOJ A;  4CDU B;  2QE3 A;  3O1U A;  4FCA A;  3HN3 A;  4FPY A;  1H4G A;  2ZAA A;  1GQP A;  5GZG A;  2O0O A;  4YGD A;  5A7N A;  3NAP A;  3WW2 A;  1S1A A;  2ET1 A;  2GC1 A;  4Q4X 3;  4AW7 A;  4QKF A;  4JC1 A;  4KBB A;  4Q0U A;  2ARE A;  2TEP A;  1EV1 3;  4S2F A;  2QJV A;  3OCP A;  2BNO A;  4XPV A;  1AL2 1;  2X8K A;  5GZF A;  4XYX A;  4A45 A;  1W0O A;  2UYB A;  1NZC A;  3R4U A;  1QJF A;  4IUG A;  5C5U A;  1FXZ A;  3O1M A;  1HB2 A;  1PGW 1;  1VB2 A;  5HPO A;  4FOQ A;  2XBO 1;  4BYY A;  5FZK A;  4AE2 A;  2KA3 A;  4OHX A;  2JIG A;  1MZ5 A;  1RHI 1;  1UY0 A;  1YUD A;  2X29 A;  4AG4 A;  5IAX A;  3VBR C;  2FCV A;  3OJB A;  5FUN A;  4EQV A;  1LOE A;  4FP3 A;  2VW0 A;  3HT1 A;  4YZ1 A;  2P6H A;  1UO9 A;  2V5Y A;  4DPN A;  5F5I A;  4QPG A;  3SXW A;  2UY9 A;  1OLM A;  4TSV A;  2AEN A;  3E5X A;  3HAG A;  2V09 A;  1O91 A;  2P5B A;  3H7Y A;  1AJK A;  1RUH 1;  1Q43 A;  5IVY A;  3VBU C;  3IAQ A;  4WM7 A;  5FZL A;  4QU2 A;  4Q5O A;  4FPK A;  3WG1 A;  2EXJ A;  1LEC A;  2Z79 A;  2OW4 A;  4QQO A;  1MEC 1;  4B4R A;  4NAM A;  1LOF A;  4YPJ A;  5A3P A;  1H8T A;  5GLZ A;  2JIJ A;  4GJZ A;  1OKO A;  4DZG A;  3KV4 A;  2VUL A;  3LQC A;  4QPG B;  3POI A;  3D3A A;  3E1F 1;  1K3I A;  5AC9 2;  3B3Q E;  3E6D A;  4OHZ A;  3WP3 A;  2ORZ A;  5FO8 B;  4QX0 A;  2R07 2;  4N9H A;  5FZH A;  1QEX A;  4IEP A;  1LHN A;  2MHF A;  5GLW A;  4Z92 B;  2WYF A;  1OOP C;  1H1M A;  1UY2 A;  2CV6 A;  3JBG 1;  4L92 A;  4UFM A;  2Q1M A;  3WXP A;  1YNA A;  3DN7 A;  3OBR A;  4NJ4 A;  3OBZ A;  1AR9 1;  2PHR A;  4AFM A;  4PDW A;  3ZYG A;  5A6Z A;  1JZ7 A;  3MV0 1;  3QOP A;  5A7P A;  4FFI A;  2YHJ A;  4E4H A;  4JVA A;  2DU0 A;  4DUV A;  2QVS B;  1O6U A;  4O65 A;  3DF0 A;  4IGO A;  3WHU A;  1H2L A;  3GAL A;  3O0W A;  2XUM A;  1RIT A;  5KXD A;  4GWM A;  2XWJ B;  5F37 A;  3D4K A;  2DWR A;  2XXZ A;  2W87 A;  4J1W A;  4Q1R A;  3BGA A;  4LO7 A;  2OXB A;  3BN6 A;  2DTY A;  4SBV A;  2DCY A;  2D40 A;  2VQT A;  2VCB A;  5FDB A;  3F95 A;  1JU4 A;  1W8T A;  4LXL A;  3USU B;  1APN A;  3DXT A;  2UYA A;  2X5I A;  2J22 A;  1PVC 3;  3WF2 A;  1FNY A;  1JBC A;  3AM2 A;  4ZHN A;  4K1Z A;  4XFF A;  1O59 A;  1VBE 3;  1RUD 1;  4BB3 A;  2GMM A;  1C8M 2;  3C7F A;  2I2S A;  5JZG B;  1M06 G;  4WM8 A;  4AGG A;  4YZ3 A;  3A7Q A;  4BXS V;  4Q1P A;  3FHQ A;  1QQP 3;  4DRV A;  4JKM A;  4MX3 A;  4Y3O A;  3VD7 A;  3UNP A;  1XSR A;  3J26 N;  2UU8 A;  4LBJ A;  4QD2 A;  5DUW A;  5K4L A;  1RTV A;  2A1X A;  4R4X A;  1XQN A;  2DFB A;  3VKF C;  2R04 2;  5FOB B;  4UOJ A;  3OGR A;  1J59 A;  1J1L A;  5FUI A;  1EY2 A;  1LU1 A;  1W8Z A;  1RIN A;  1NXM A;  1NXD 1;  4EJR A;  3FLR A;  4DY3 A;  2UWA A;  1DLC A;  4LOS A;  1GZW A;  1R08 2;  1W6N A;  2WA3 A;  3HJR A;  3CJX A;  4DS0 A;  4CDX A;  2B45 X;  4UT5 A;  4WM8 B;  5J37 A;  5TSW A;  4JQR A;  3A4U A;  3RJ2 X;  4XBQ A;  3BKZ A;  1LOG A;  1C28 A;  1NX9 A;  1ULF A;  2R6Q A;  3K2O A;  3ZIW A;  1MS0 A;  4MGQ A;  4LMF A;  1ST8 A;  2WC2 A;  3UT0 A;  2WRA A;  2VOX A;  2E51 A;  4YW6 A;  3P3P A;  2J42 A;  3OGV A;  5J48 A;  2WN3 A;  3ZFG A;  2BPA 2;  1H1A A;  5FBJ A;  1JOD A;  1RED A;  4QPG C;  3AVS A;  3TN9 2;  4NIG A;  4GB3 3;  1AJO A;  1G6N A;  3BOP A;  1W6N B;  3FJS A;  3WVJ A;  3MLK A;  4LHN A;  4CDX B;  2OQ6 A;  3VKM A;  1KJR A;  3HNY M;  2K46 A;  4H2A A;  2FMD A;  4IEW A;  4YVS A;  4A3Z A;  5C3P A;  4FI9 A;  4B4Q A;  3GCW A;  3KVA A;  4Z8B A;  3RMX A;  5EJ1 B;  5CIS A;  1LOF C;  4R9A A;  3U4X A;  2ZGO A;  2VQA A;  1ZZ6 A;  4FXK B;  3JQW A;  3ZFG B;  2E53 A;  3AMN A;  1YXW A;  1GNH A;  4P02 B;  2BTV C;  2WT1 A;  2OS2 A;  2W9X A;  4B7K A;  3I8T A;  4GH4 C;  2VMH A;  5DN2 A;  2JKB A;  5GZC A;  4OUM A;  4CU8 A;  1AYN 3;  3AMM A;  1JW6 A;  2XVK A;  2XGX A;  1VLN A;  3KGL A;  1E5R A;  2RJ2 A;  3AC0 A;  2A75 A;  4HLT A;  3ECQ A;  4YVS B;  4LJH A;  3Q8A A;  2A6W A;  3LE0 A;  2XG3 A;  4OMC A;  1F9K A;  4B1L A;  2ZA9 A;  4WVW A;  2GNM A;  5DUU A;  3T2O A;  3SH3 A;  5A33 A;  2YGM A;  3O1O A;  2JDA A;  2WS9 2;  2YUE A;  1H6X A;  2WWU A;  2QQU A;  4F7Z A;  4K1Y A;  1X9P A;  1IPJ A;  1P8J A;  1QNW A;  2J1U A;  1NA1 A;  1OF4 A;  2J1E A;  2WFF 1;  2WN2 A;  2XLA A;  2Z5W A;  2ZGN A;  3I2F A;  1QJZ A;  1XOY A;  3J8F 2;  1HRV 1;  3G6J B;  1FPN 3;  4Y1Y A;  5JZG C;  3FUQ A;  4FPF A;  4HG6 B;  1HN1 A;  1GIC A;  3HQU A;  4ISR A;  4IV3 C;  1PIV 1;  5GM0 A;  2LAL A;  2B9U A;  4NWV A;  1FAT A;  1YLL A;  2ZPX A;  3PU8 A;  3V56 A;  3F2Z A;  5C9A A;  1W8F A;  5JOY A;  3N9Q A;  2E63 A;  1L7L A;  2TNF A;  4HN0 A;  4XTM A;  4I0A A;  5LZ6 A;  4XQ4 A;  1Y3T A;  3HWJ A;  5CKQ A;  3RWN A;  2IVI B;  3HQR A;  1NA1 B;  3T08 A;  3TBD A;  4E4Z A;  3ACI A;  3GZE A;  4LBK A;  4YM3 A;  1WLD A;  5BUV A;  4YW2 A;  1REF A;  5FXV A;  4WM8 C;  1NG0 A;  4LKF A;  4LQR A;  1XND A;  4Q4X 1;  2ARC A;  3N36 A;  2DUQ A;  1MQT A;  4OHV A;  1K5J A;  2QQN A;  5JMO A;  5JVV A;  1EV1 1;  1W90 A;  2R30 A;  2WO7 A;  1WW6 A;  3LFI A;  3KHC A;  1AR7 3;  1LB2 A;  2RS1 3;  2MNG A;  1UWW A;  5D8A A;  3JCI A;  2QKD A;  1O8P A;  4QX2 A;  4UFH A;  3VZL A;  5F6K A;  3HIF A;  4KNC A;  1VRB A;  1LOC A;  3C8X A;  2ZTN A;  3WQ1 A;  2Q8D A;  3H8X A;  4CDX C;  3ZMN A;  2QQV A;  1AL2 2;  3POF A;  2R07 3;  4LT5 A;  1ZA4 A;  3OTF A;  5L7O A;  3FN9 A;  1MQT B;  4Y4R A;  1HKD A;  5T5O A;  1J58 A;  2ZGT A;  3B94 A;  5FY8 A;  3WNP A;  1PGW 2;  5BPX A;  3O14 A;  2XBO 2;  1UXX X;  1W9W A;  3TWI A;  5D8A B;  4QHB A;  1NQJ A;  3UGF A;  3ZFG C;  5JIU A;  5BY5 A;  5E89 A;  2XJV A;  4BH9 A;  2XJS A;  3U1X A;  1ALY A;  3MUY 1;  4RSU A;  1CN1 A;  5IW0 A;  4XFH A;  3VZK A;  4XF4 A;  1UF2 C;  4Q26 A;  2DV9 A;  5LK5 A;  4AWD A;  4D6Q A;  2YG0 A;  2WAO A;  3FL7 A;  4E2Q A;  5FPU A;  5L7O B;  4CXY A;  3SIS A;  2JEM A;  2H6B A;  1V0A A;  1VMH A;  2OVU A;  2RDN A;  3PMS A;  4IV1 A;  5BNO A;  3RFR A;  1RUH 2;  2E6V A;  4L11 A;  4FPL A;  3ZSJ A;  4HK8 A;  5IK4 A;  3WDU A;  1FAY A;  4QX7 A;  4UFL A;  3T2T A;  1MEC 2;  4MGT A;  1LHW A;  1YYN A;  1DYP A;  2HWF 3;  2RG4 A;  4AI9 A;  3T4H B;  4ES9 A;  3J7M A;  4AED B;  1QIQ A;  2J1R A;  3CU7 A;  4IV1 B;  4W6W A;  3TRS B;  5FPL A;  1W6M A;  1OSG A;  1YQ6 A;  1TME 2;  2A6Y A;  2VUA A;  2VY0 A;  1VBA 2;  1RMU 2;  1Y4W A;  4FPO B;  2UY8 A;  3U10 A;  4CCD A;  1W8O A;  2HWD 3;  2CSG A;  2IXI A;  5HXV A;  3LCP A;  4QX1 A;  5FJH A;  5LA9 A;  4BA6 A;  3KQR A;  5ANQ A;  4YZ5 A;  3JBG 2;  1NE4 A;  4H7M A;  2WZP P;  4EN7 B;  2XUE A;  1I9R A;  4CZS A;  2ZX1 A;  1V6M A;  1AR9 2;  1KIT A;  2JJ6 A;  5A3L A;  1NA1 C;  2B4K A;  1HLC A;  1RXG A;  2BGP A;  2P3J A;  3AB0 A;  2VCA A;  4NOT A;  2ATF A;  1H0B A;  1W6M B;  5LBC A;  2VEC A;  1SDD B;  3ZN6 A;  4AVV A;  1YFW A;  1WW5 A;  3NNM A;  3MV1 1;  1STM A;  4P9W A;  4F8A A;  4OUS A;  4RGA A;  4M0H A;  3ST7 A;  4I02 A;  4YYO A;  5A3O A;  1O4T A;  1G86 A;  1GKB A;  1QNY A;  5LK7 B;  4E4D X;  1MS8 A;  3JB8 A;  3FWE A;  4MGK E;  5EFU A;  1PVC 1;  4D0Q A;  2QBX A;  3MLJ A;  3S5A A;  3PVE A;  1UOJ A;  1V6I A;  2BFU S;  1L3J A;  1QJU 3;  1UZV A;  2IVJ A;  3ILR A;  4RR3 A;  4BK4 A;  3ZN6 B;  3NJV A;  2E9Q A;  2KM2 A;  1QQP 1;  1V00 A;  2WIN B;  3IN9 A;  2AYH A;  3MEP A;  3DKQ A;  1ASJ 3;  4MET A;  4Q0S A;  5D2A A;  5H9Q A;  4OQ9 A;  3OGS A;  4CP1 A;  2R7E B;  4FPC A;  1W2O A;  2JIC A;  1DGR A;  1XXN A;  4PQ9 A;  3BB6 A;  1RUD 2;  1F4H A;  5JR7 B;  2CAV A;  3BVC A;  2E26 A;  1PK6 B;  3PTY A;  3LFM A;  3RQ0 A;  5D8A C;  1SPP A;  4NMI A;  4CCC A;  2DVF A;  3R05 A;  4RR3 B;  2D44 A;  3WY6 A;  2W39 A;  1FV2 A;  4RA0 A;  3CLP A;  1QGL A;  3ZXK A;  5HCH A;  1W0N A;  1KS5 A;  3I3E A;  1BVV A;  3SKJ E;  4YW1 A;  1MS4 A;  2RMU 3;  4CEW C;  4XE9 A;  1Q5O A;  5CFD A;  2BYV E;  2WWS A;  2NMN A;  2EF6 A;  3IT8 A;  1VIW B;  1KEX A;  3AYE A;  4RS5 A;  5T50 A;  3ZIX A;  4TLF A;  1CWP A;  1UOG A;  4GB3 1;  1PX4 A;  4W4Z A;  4Z07 A;  4PJY A;  3ZKY A;  4C91 A;  2J1S A;  1C1L A;  5F9T A;  2WLQ A;  3VBO A;  4XDP A;  2Y0I A;  4OUL A;  1IG3 A;  2XR4 A;  3B5L B;  4XAE A;  1HQN A;  4H3W A;  4FPG A;  2IFR A;  5I8Y A;  5IVF A;  4FOY A;  4AED C;  4IV1 C;  2WNU A;  5AVP A;  5CFD B;  2Y6K A;  4Y1V A;  2ZAH A;  2Y34 A;  5J96 B;  2YBK A;  3FMG A;  4BM8 A;  3AVR A;  3VDC A;  4AYU A;  3N3H A;  5HCB A;  2Q8O A;  2OA2 A;  3MZH A;  1AYN 1;  1FT9 A;  2K0G A;  1GWL A;  4XUR A;  3M3E A;  4ET7 A;  1ZRF A;  2VNO A;  3RYR A;  1Q8S A;  3IB3 A;  3GJA A;  4XCB A;  2D6O X;  3VZO A;  3WNO A;  3IPV A;  3VBH C;  1S0B A;  2Y6H A;  1S4C A;  4GJY A;  2WNU B;  1WKY A;  2WNO A;  5A32 B;  2W1U A;  2R06 3;  4AHX A;  1VE0 A;  4NHL A;  1ZRE A;  3ZLI A;  1W8H A;  2IXC A;  5F39 A;  2VZQ A;  3QCW A;  5J1X A;  3V64 A;  4QXC A;  4BDV B;  1BMV 2;  3HEI A;  2XPJ A;  4H7L A;  2ZGK A;  4K6B A;  3E97 A;  4UBG A;  5HCF A;  1U5Y A;  5FOJ B;  1URX A;  3BIW E;  3ROU A;  2CGO A;  1UQX A;  1GQH A;  1FPN 1;  3IPV B;  3POG A;  4HPK A;  4WVZ A;  1ENQ A;  1IQA A;  5A7W A;  3CO2 A;  3GBF A;  4N53 A;  4PLO A;  2YB7 A;  2YGL A;  4AF9 A;  1H9P A;  3ITQ A;  1HV1 A;  1S0D A;  2E32 A;  1HRV 2;  3IAP A;  3GZA A;  5FYY A;  3W21 A;  1NCQ A;  2PN5 A;  3O12 A;  4XFC A;  3W59 A;  4BME A;  4DXS A;  4AEK A;  4ZZ8 A;  4EWD A;  1A34 A;  2WFP A;  1PK6 C;  1WMF A;  3RGB A;  3M4F A;  4I3G A;  5DXD A;  3ZR5 A;  2Y6J A;  4OQ8 A;  2FD8 A;  2PMW B;  2LTN A;  1LEN A;  1NZI A;  3OGG A;  3ZXF A;  1DF0 A;  2XH6 A;  4HPK B;  1G9B A;  3PUR A;  3UET A;  5BV6 A;  5A7W B;  4N53 B;  3H0O A;  1KS4 A;  4JQT A;  1MZF A;  1RGS A;  3AKP A;  3KCY A;  5FMD A;  1GOG A;  1I6X A;  2C4X A;  3H3Z A;  1OLM E;  1AR7 1;  2QNK A;  4RFT 0;  2RS1 1;  4YFW A;  4IE6 A;  3ZR6 A;  3VD9 A;  3BU0 A;  1YFU A;  2JX9 A;  5FZ7 A;  4CDW B;  3BTX A;  3HPN A;  1F8V A;  5LCW L;  1LTE A;  3RI9 A;  4EZ4 A;  5J36 A;  5LRS A;  1JYC A;  1EV1 2;  1CQ9 A;  1JZ2 A;  3R0R A;  2UWB A;  4CCL A;  4JHT A;  5EYX A;  1UZW A;  1F35 A;  2R07 1;  4MGS A;  3VDD B;  5JI7 A;  2Y0O A;  1V9U 2;  2VW2 A;  1N1S A;  4FXG B;  5DAQ A;  3WF4 A;  4NO4 A;  4C90 A;  2VXJ A;  1ZRC A;  2BBV A;  2LRP A;  1D0G A;  4I09 A;  1W9T A;  5FZC A;  4EYU A;  1YQC A;  4GIQ A;  5I8S A;  1ZZB A;  1G9F A;  1RL3 A;  1YIP A;  2SBA A;  3GHM A;  3I54 A;  1VBA 3;  1RMU 3;  4MLO A;  4XF9 A;  1XNK A;  2WQ4 A;  1A8M A;  4ZXK A;  3SCH A;  3W5M A;  3NL1 A;  2ZGQ A;  1VBC 3;  1X7N A;  2WO1 A;  3H50 A;  1W39 A;  3ACH A;  4YVW B;  4AL9 A;  3WUD A;  3DEM A;  4MZU A;  2R0H A;  5FTT C;  4BQX A;  1X36 A;  4CXX A;  4JGY A;  3ZSK A;  5IVE A;  4OMD A;  4O61 A;  3ZDV A;  2EIB A;  1ZZ8 A;  1WW4 A;  2FCU A;  4BHP A;  1OBN A;  1WLT A;  3WZ1 A;  5DAW A;  2HJI A;  4DXZ A;  4FPJ A;  4DO0 A;  2EXI A;  2ENR A;  2IXH A;  3ACF A;  1CVN A;  3TEZ A;  3KF3 A;  4LO6 B;  4XXP A;  5KC6 A;  2VQU A;  2WR9 A;  3LDB A;  2VOV A;  4O9E A;  1OVS A;  2HWF 1;  3MIH A;  2WNV A;  2LS6 A;  4JGY B;  4YG6 A;  2XB6 C;  3LIG A;  3PUI A;  1IKQ A;  3H1Y A;  2P3I A;  3URF A;  4QHO A;  4Q0V A;  1C8M 1;  2VNG A;  2HWD 1;  4M00 A;  2Q1F A;  3N7J A;  3MUZ 1;  4LIU A;  4AVB A;  2AR6 A;  3U78 A;  1D4V B;  2P34 A;  3J7H A;  1AX0 A;  1AR8 3;  4FFG A;  1IS6 A;  2R04 1;  1HQW A;  4XFA A;  4OYU A;  3WX5 A;  2TUN A;  1UY3 A;  4QM8 A;  4LBM A;  2VZ3 A;  2CDO A;  1QH7 A;  3O0X A;  3I3B A;  4YNI A;  4DEV A;  1YC6 1;  3HMY A;  3MGU A;  3BTA A;  1FYU A;  4N53 C;  4CCE A;  5A6X A;  1YO8 A;  5JUV A;  5FPB A;  4XDQ A;  5FYT A;  4ES8 A;  5JMC A;  5LAT A;  4F83 A;  3MBW A;  3THD A;  1ONA A;  1TMF 3;  4ARX A;  3T1M A;  3I7D A;  3SKV A;  2VNR A;  4AQ2 A;  1YJL A;  4FSJ A;  2IUW A;  1QJU 1;  4CDW C;  3WLU A;  2XLF A;  2XVG A;  1DYO A;  2VMG A;  2ZGL A;  3ZSM A;  3VBR A;  4N7U A;  2BNM A;  2W92 A;  2B39 A;  4M3C A;  1WA6 X;  4EZH A;  5KHJ A;  1VAV A;  1UY4 A;  2C9A A;  2DCT A;  3VDD C;  5IK8 A;  4Y5Z 0;  3SIT A;  2IXK A;  1VBE 2;  3PJY A;  3T09 A;  3OY8 A;  4ARY A;  5F5Q A;  2W46 A;  3UV9 A;  3I3M A;  4BK5 A;  3APB A;  3VBU A;  1HB4 A;  1QQP 2;  3V0B A;  3BOW A;  4ZXE A;  4G3Y C;  1LHU A;  4LHS A;  4UW3 A;  1OUR A;  4Y33 A;  3BPS A;  2VZP A;  2WQ8 A;  2G9F A;  3KMH A;  1HRI 2;  3MF6 A;  4MV2 A;  4ZPI A;  5A80 A;  1TNR A;  3WQB A;  3HD8 B;  4RN5 A;  4YVW C;  3CDZ B;  3LD8 A;  4LA2 A;  3VD5 A;  3ASI A;  4HKW A;  5IVC A;  3NNG A;  2P17 A;  5LBF A;  1BJQ A;  2RMU 1;  4OUE A;  5FK8 A;  1W8U A;  1AR6 3;  2JEN A;  3AP9 A;  4DFS A;  3PVO A;  1SLA A;  2GH2 A;  1ZVF A;  3NV3 A;  4WVM B;  5FLJ A;  4S2H A;  5C4W B;  2Q4S A;  1YI7 A;  1ND2 C;  3V0B B;  4Y5S A;  2XOM A;  1PZ7 A;  4QM9 A;  4KGG A;  4UFI A;  1OOP A;  4UF0 B;  1JYV A;  3PHM A;  2BZD A;  2IXJ A;  3AKS A;  2VUD A;  1VBB 3;  3CZJ A;  2YXS A;  4IL7 A;  4QXH A;  2ZZQ A;  3NV4 A;  2MPF A;  5F5C A;  3T0D A;  1I5P A;  2DVD A;  1XYP A;  5CA6 A;  4EN8 B;  2ZEX A;  4KU8 A;  5FYV A;  5HV4 A;  2CY6 A;  4IEV A;  3JD7 2;  3CNA A;  5DDJ 2;  1ZRR A;  1QH6 A;  5EHD A;  3MW2 A;  5K8S A;  3S30 A;  1MS5 A;  3LAG A;  1S55 A;  2VVD A;  4AQS A;  4ATE A;  3ZKU A;  1AHS A;  3LEG A;  3NJZ A;  3BYW A;  5ACA 2;  3VKN A;  1PNF A;  1V6K A;  1WW7 A;  2YZ4 A;  1E5S A;  4ONU A;  1JYX A;  2O8Q A;  4NWW A;  3I97 A;  1IHM A;  4TXW A;  4GMP 0;  4JGZ B;  4DIN B;  3NW4 A;  1AYN 2;  4IEZ A;  1IPS A;  2R06 1;  3KF5 A;  4F3J A;  1RUJ 3;  4BQ3 A;  1CX4 A;  4OLL A;  3SLI A;  2VUC A;  1MZE A;  2HWC 3;  3AMQ A;  1YQ2 A;  4QQL A;  2WDB A;  5H9S A;  4ZY9 A;  2YYO A;  1CPM A;  4LPL A;  5EPA A;  3VBS B;  3PUA A;  5F1R A;  4Y24 A;  1OI6 A;  1DGW A;  1X82 A;  2D5H A;  2G4I A;  2O1Q A;  1S0C A;  3KLS A;  5F32 A;  4CUA A;  4QB1 A;  2BOJ A;  2VXR A;  4URT A;  3JQX A;  5FLI A;  5SV5 A;  1V9U 3;  5AFE A;  1FPN 2;  4AVC A;  3NST A;  3MHZ A;  4ZS3 A;  1KXG A;  1X9T A;  2P6C A;  2PEL A;  2Q1Z B;  3NJX A;  3PVB B;  5H9R A;  1VBD 3;  2JDY A;  3VBF A;  5EJZ B;  1AVB A;  2P3K A;  4IEQ A;  3WQ7 A;  1B35 C; 
#chains in the Genus database with same CATH homology
 4OMC A;  4KMQ A;  3LEI A;  3T2O A;  3DYM A;  5C71 A;  4A6O A;  1CIY A;  1JZ6 A;  1GOH A;  2JDA A;  1H6X A;  4GWJ A;  4GZ9 A;  2QQL A;  4JHZ A;  4CUC A;  2W1Q A;  4P5Y A;  1JU3 A;  1P8J A;  1UYY A;  3I2F A;  1OF4 A;  1UYZ A;  2J1U A;  2J1E A;  2WN2 A;  3EYP A;  2WZ8 A;  3K4D A;  3OEB A;  4HG6 B;  1HN1 A;  1UMI A;  1O8S A;  2BBA A;  2VMC A;  3GDB A;  2L9L A;  5A1A A;  2VZ1 A;  2WAA A;  3F2Z A;  2OKX A;  4E8D A;  3ETP A;  2XHN A;  2VZV A;  2DDU A;  3T08 A;  2XON A;  3I2K A;  3ACI A;  4JKL A;  2JE8 A;  2VME A;  4W50 A;  2VL4 A;  1UMH A;  4KI5 M;  3LEK A;  4LQR A;  2KD7 A;  5HXM A;  2QQN A;  5JMO A;  1J83 A;  2W47 A;  1JZ4 A;  3NQH A;  5LA0 A;  1UWW A;  4OZO A;  3C7O A;  3SEE A;  1O8P A;  4QX2 A;  1K45 A;  1UXZ A;  2J1A A;  3I2G A;  3C8X A;  2BER A;  1W9S A;  3FN9 A;  3WEZ A;  3WNP A;  3P1I A;  3K4A A;  4W8J A;  4AAX A;  1UXX X;  1W9W A;  4CVU A;  5IFT A;  4CUB A;  5C7G A;  1D7P M;  3MUY 1;  4QDQ A;  4XUT A;  1BHG A;  3T0B A;  3WF1 A;  2YFZ A;  4MAD A;  2YG0 A;  2WAO A;  3FL7 A;  4QX3 A;  1XC6 A;  1UZ0 A;  3EB7 A;  4PQQ A;  3LPF A;  3ZM8 A;  3DYO A;  1WCQ A;  2VZU A;  5LA1 A;  3WNM A;  3VD4 A;  5EIY B;  1CX1 A;  5B4N A;  1SHW B;  2ZEZ A;  2EIE A;  1US3 A;  1US2 A;  3CQO A;  2QQJ A;  2J1R A;  2J7M A;  3III A;  5JR2 A;  4CU7 A;  1W8O A;  4QX1 A;  2J1T A;  2VZR A;  5DQ0 A;  1UY1 A;  4E8C A;  2QQI A;  2Y6G A;  2YFU A;  4PF1 A;  4QDR A;  3OG2 A;  2ZXQ A;  3K4Z A;  1GMM A;  5JXG A;  2B4K A;  2BGP A;  2J1V A;  2VCA A;  1SDD B;  4MOA A;  5G05 L;  2VCC A;  2VZO A;  3MV1 1;  3PUH A;  2BGO A;  2QQK A;  3DYP A;  1PX3 A;  1DP0 A;  2WO3 A;  1XNA A;  1OD3 A;  3IDA A;  4D0Q A;  2QBX A;  4DXR A;  1JYW A;  2YC2 A;  4BK4 A;  1XNT A;  3A22 A;  3C7H A;  3NJV A;  3LPG A;  3OGS A;  1EUU A;  3FHA A;  2R7E B;  1F4A A;  1F4H A;  2E26 A;  2RV9 A;  4XVH A;  2ZEY A;  1GU3 A;  1OH4 A;  2WYS A;  3OBA A;  3OEA A;  1W0N A;  3WNN A;  2CDP A;  3I3E A;  2QQO A;  3SKJ E;  5DPN A;  1JZ8 A;  2VTF A;  2VC9 A;  1NAE A;  3SEP A;  2EIC A;  1NKG A;  3OB8 A;  4MO3 M;  3WF3 A;  2VR4 A;  1KEX A;  2VOT A;  2RVA A;  4W4Z A;  1PX4 A;  2J1S A;  1NUK A;  3T2P A;  4CU6 A;  1K12 A;  2W94 A;  3DEC A;  1MPX A;  2VZS A;  4A44 A;  1XPW A;  2WBK A;  1W8N A;  2W91 A;  2Y6K A;  1L7R A;  1TG7 A;  4XZU G;  1H6Y A;  3VDC A;  2V72 A;  2W1S A;  2JD9 A;  2X09 A;  4ET7 A;  4XUR A;  2DCJ A;  4M4R A;  3I3D A;  3IB3 A;  3WNO A;  2Y6H A;  1WKY A;  2Z4F A;  2W1U A;  4DEQ A;  1CZS A;  3JXS A;  2VZQ A;  5J1X A;  3GM8 A;  2QQM A;  2E31 A;  5IJR A;  3HEI A;  4BDV B;  1UX7 A;  1EUT A;  1ULO A;  4L0P A;  2YB7 A;  1OT5 A;  3WNL A;  2VM9 A;  2E32 A;  3IAP A;  4CUA A;  4CU9 A;  4DXS A;  4ZZ8 A;  4ZZ5 A;  4QDS A;  1T2X A;  3T2Q A;  3VD3 A;  3WSO A;  2WO2 A;  2Y6J A;  1JZ5 A;  4PT6 A;  3K75 B;  3UET A;  2Y6L A;  1PMJ X;  2LW8 A;  4A42 A;  5I0D A;  4TTG A;  3W5N A;  1GOG A;  4A4A A;  4D8M A;  2C4X A;  1RYY A;  3P6B A;  3VD9 A;  2W3J A;  3HPN A;  5IHR A;  4RYD A;  5LCW L;  2HLE A;  2XQX A;  3K46 A;  3HNM A;  5F7U A;  4BJ0 A;  1JZ2 A;  4QPW A;  2V5D A;  4LKS A;  5G04 L;  4MGS A;  3WF4 A;  1K42 A;  3MO4 A;  5JXH A;  1W9T A;  4XUP A;  4UAP A;  1PMH X;  3W5M A;  3HN3 A;  2WO1 A;  3GXU A;  3I2I A;  3ACH A;  5LA2 A;  1GQP A;  3ABZ A;  4UI9 L;  3CZU A;  4OMD A;  2WUH A;  2JKX A;  2EIB A;  1R64 A;  1L7Q A;  3GGL A;  3I2H A;  4A45 A;  3ACF A;  4IUG A;  4DXT A;  3I2J A;  4KWU A;  3K77 A;  2HYX A;  2VMD A;  1TVG A;  1SG3 A;  2VQU A;  3UES A;  4DUW A;  5HPO A;  2LS6 A;  1ULP A;  4JX0 A;  1UY0 A;  4AG4 A;  3PUI A;  5C70 A;  3A23 A;  3MUZ 1;  4P08 A;  1JI6 A;  3J7H A;  2VO5 A;  4OYU A;  3IAQ A;  1UY3 A;  2VZ3 A;  1W99 A;  2CDO A;  3HNB M;  3I3B A;  2ZEW A;  2ID4 A;  4YPJ A;  4DEV A;  4JKK A;  2Y64 A;  3LQC A;  3D3A A;  3E1F 1;  1K3I A;  1IQD C;  5JUV A;  3VDB A;  2X05 A;  2ORZ A;  3MBW A;  5B4X A;  4QX0 A;  3THD A;  4ARX A;  3SKV A;  1UYX A;  2X10 A;  1UY2 A;  3C7G A;  1DYO A;  1CZV A;  2W92 A;  4XUO A;  4QB6 A;  4QB2 A;  4XUN A;  1UY4 A;  1JZ7 A;  3MV0 1;  2W95 A;  3CIH A;  3T09 A;  3WF0 A;  4ARY A;  1JZ3 A;  2W46 A;  2WZE A;  4BK5 A;  4DUV A;  2Y8K A;  4ZXE A;  4LHS A;  4Z2A A;  2VZP A;  2WQ8 A;  3THC A;  3CMG A;  3WQB A;  3U37 A;  4RN5 A;  3CDZ B;  3VD5 A;  4QAW A;  2W87 A;  3NNG A;  4OUE A;  3BGA A;  2PQS A;  2W1W A;  3BN6 A;  3VDA A;  2VQT A;  2VCB A;  1JU4 A;  1LNS A;  5CYY A;  3C7E A;  4A41 A;  2J22 A;  2XOM A;  3WF2 A;  4M4P A;  1JYV A;  2E33 A;  3ACG A;  2BZD A;  1O59 A;  3C7F A;  3CZJ A;  2VMF A;  3A7Q A;  4BXS V;  3T0D A;  3FHQ A;  1I5P A;  2ORX A;  3CKH A;  4JKM A;  3VD7 A;  3UNP A;  2ZEX A;  2C26 A;  3T0A A;  5DMY A;  1CZT A;  5JXI A;  4UOJ A;  3OGR A;  3A21 A;  5FUI A;  1GOF A;  2VZT A;  2C9K A;  1DLC A;  3HOB A;  2W5F A;  3HJR A;  3LEG A;  1GUI A;  2VJX A;  2YC4 A;  1J84 A;  1NX9 A;  1JYX A;  1KGY A;  3I97 A;  5JXJ A;  4P00 B;  4TXW A;  4MGQ A;  4GWI A;  1OF3 A;  3OGV A;  2WN3 A;  2EID A;  1YQ2 A;  4XUQ A;  2WDB A;  3HNY M;  4ZY9 A;  1JYN A;  4LPL A;  1JHJ A;  2B9V A;  4A3Z A;  4FI9 A;  4DUX A;  5IYY A;  5EJ1 B;  4QB1 A;  2DCK A;  5CZK A;  5IFP A;  4P02 B;  3NRU A;  2W9X A;  1GNY A;  5DN2 A;  4CU8 A;  2V4V A;  3NJX A;  3AC0 A;  2RJ2 A;  3WNK A;  2WAB A;  3ECQ A;  5EJZ B;  3LE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...