5DN6G

Atp synthase from paracoccus denitrificans
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
288
structure length
260
Chain Sequence
b'SLKDLKNRIGSVKNTRKITKAMQMVAAAKLRRAQEAAEAARPYADRMAAVMAGLTAAAAGMAPRLLAGTGHLLVVMTSERGLAGGFNSSIVKLARLRLQELQAVSILTVGKKGREQLKREYGDLFVNHVDLSRIGYDNARAIADEILDRFDNDVATLFYNRFESVISQVPTARQVIPAVIEEPDENAILNDLLPRSVATQVFAALLENAASEQGARMTAMDNATRNAGDMIDRLTTVYNRSRQAAITKELIEIISGAEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chain A
molecule tags Hydrolase
publication title Structure of ATP synthase from Paracoccus denitrificans determined by X-ray crystallography at 4.0 angstrom resolution.
pubmed doi rcsb
total genus 99
structure length 260
sequence length 288
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00231 ATP-synt ATP synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.80 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5dn6G01
3.40.1380.10 Alpha Beta 3-Layer(aba) Sandwich Pyruvate Kinase; Chain: A, domain 1 Pyruvate Kinase; Chain: A, domain 1 5dn6G02
3FKSG 1NBMG 2QE7G 2Z5UA 3ZIAG 4YXWG 4XBFA 4BAYA 5FL7G 1H8HG 5L3EA 1E1QG 5L3GA 5DN6G 2DW4A 2JIZG 4CZZA 2F43G 2R9IA 1EFRG 2CK3G 1H8EG 3ZMSA 4UVAA 3OE7G 5H6RA 1E79G 5L3BA 2W6IG 2XASA 3ZMZA 2X0LA 2Z3YA 4UVBA 4UV9A 2UXXA 2H94A 5L3CA 2JJ2G 1E1RG 2XAFA 5LGNA 1W0JG 1MABG 4Z1MG 2HLDG 2XNDG 2IW5A 5LGTA 3ABUA 2XOKG 2HKOA 2W6JG 4UXNA 4KUMA 5L3DA 5LHHA 4UV8A 4TT3G 2JJ1G 3ABTA 4ASUG 2JDIG 2XAGA 2WSSG 3ZN1A 2Y48A 4UVCA 5LBQA 1W0KG 3OAAG 3OFNG 2V1DA 2V7QG 1FS0G 3OEHG 5H6QA 1OHHG 5LGUA 1BMFG 2UXNA 5L3FA 5LHIA 3ZN0A 4TSFG 2EJRA 3ZMVA 1COWG 2XAJA 3OEEG 5LHGA 3ZMTA 2WPDG 3ZMUA 2XAQA 2XAHA
chains in the Genus database with same CATH superfamily
3JAKA 3U0ZA 1PKLA 3LSSA 1ZSPA 1F3XA 1GKFA 1YJWV 1B6QA 4CS3A 1YEWA 1TUBA 2HEPA 4I4TA 4O2AA 4EFBA 3BABA 1D2DA 1NTMH 2GTSA 4X66B 3AG2B 4JI4B 1QLNA 3QO8A 4P9OA 1EN5A 2JRIA 3DXRB 1L8DA 4O4JB 2QWPB 5CN0A 2CTQA 1XNQO 1DGSA 4RWUA 4MTOA 4WFEA 4MW3A 1XDCA 5CB4B 4YJ2B 1M9NA 2UU9B 4B3TB 5B66Z 3ASOB 5E1AC 3H1IH 3RYFA 1BQZA 3HKBB 4E4EA 3ETGA 5KAFZ 4J7ZA 3QV8A 1CEZA 1K3EA 3CE2A 4LF9O 1SQBH 4YY3O 4FLZA 5AG2A 4LF9B 4X1IA 5LXTA 1PL4A 3E8FA 4H44B 2WLIB 5CA3A 5IY5B 2M6YA 1HNWO 1AJNA 3VQVA 1I7FA 3CXCU 4J9YB 4MSWC 1K73W 3TGUH 1WPXA 2EIMC 2Q7GA 3TJTA 4R7CA 3IC9A 1BMFG 2X6CA 4QGPA 1ZL8A 1PL0A 3QNEA 2QM7A 2Y0PA 4CH5A 2P4VA 2IU0A 1S3JA 1N36O 5CA1A 1NR1A 2EIMB 4UCOA 1QBZA 4BR6A 4B2DA 4IGGA 3BHPA 1DK1A 2LO1A 3H1HH 3HB3B 3D36C 3FD9A 3SPCA 1Y4MA 1GO3F 3APQA 5LA6A 5IJ9B 1YHQV 1PNKA 3E22A 2RJZA 2FL4A 1H8HG 5GW7A 2ZDIA 1WN7A 4GKJB 2Q5ZA 3T05A 3GVMA 1Q81W 2CE4A 1BCCH 2EZOA 4FIPC 3ABLC 4DR6B 5KUKA 3FAVB 2QWOB 4FK5C 3SPGA 2FYUH 4DR3O 1VQLV 3SRFA 1SERA 4UVAA 4R6ZA 4JI3B 3QO7A 1XNQB 1AP5A 2QJ1A 5GTHZ 2M7WA 4OGQB 2UXXA 1W59A 2A0LA 3HR0A 5KHGA 1AR1B 3W7WA 4DUYO 2ZXWC 2HHHB 4ZOLA 4B2DD 4JI0B 1OCRB 3ZHTA 1GTOA 3ABMB 1S77D 3IFXA 4B7EA 3E89A 4QE7A 2ZM6O 3O65A 4B7KA 3CC2V 3JD0A 4JGSA 3VQXA 4PI0A 4JI2B 4MVZA 3UT5A 2JK5C 3QV6A 4KP4A 2BTQA 5IYZA 2R72A 3W7SA 3HKEA 1VQOV 1WB8A 1PKMA 3G4SV 3P30A 5KHJA 4H13B 3A0BZ 1SA0B 1A49A 2QM8A 4IYHA 3W7XA 5JCOC 2ETNA 3ZHQA 2QWRB 2JS5A 1JX9A 4LF4B 3M8AA 4DK0A 5IYDO 1M57B 2XUMA 4X64O 1NJIW 1V54B 1XMOB 2B9ZA 4FZ0A 1XNRO 2VWJA 4OX9O 4LFCB 1RPRA 5KX5B 3JASB 3VOUA 1KKCA 1FD9A 2HG5C 2BE3A 5JVDB 1K92A 1N0JA 5FL7G 4ZIBA 2P22C 1KB9F 3CWBH 4TV9A 5L3GA 5KHIA 4GCZA 4IP7A 3JALA 4UCVA 1FJGB 4PA6A 4RUEA 4JYBA 4YHHB 4NXMB 1VF5B 4TQFA 1IURA 3M99B 4W4KA 3ABKC 1H2KA 1YI2V 1K8AW 4FXJA 4H0LB 1G8MA 2DYSC 3RYIB 2WLNA 3SGIA 2QM4A 2IBZH 1D5AA 5IJ0B 3ZRWB 1GMGA 1W0JG 1JVMA 1DLBA 3GQYA 4OXSA 4X62O 3B8MA 3K79A 3ETDA 3CRAA 3G71V 4DV0O 1R6KA 1X4TA 4YHHO 3UCSC 4ZI7A 4OPAA 3TXSA 1QR9A 4PI2A 2XAGA 1ZWIC 1WP7A 3MDSA 1NR7A 1GN6A 1G4YB 1NVPB 1Y74B 1RM1C 3CCUV 3U10A 5EZYB 2H8PC 1WNSA 3K03A 1QLEB 1FFXA 1VQ4V 5IYCO 4B3TO 1YIJV 2UXNA 2LFSA 5J2TB 5KLVH 1XMQB 2LGWA 3CXHF 4LF5B 1GAXA 1IBLO 3C3SA 3FB5C 3E35A 1M56C 2UXCB 2E3CA 4PA4A 1H2NA 4R8CA 2ILMA 2E5LO 3GB7C 5H9CA 1SQQH 5KHKA 2NNUA 2KB1A 3CHXA 3BFRA 3B40A 5H5NA 2HHHO 4LFBB 4NVPA 5CBHA 5FPOA 1Q3EA 2HFEC 3MHSC 2Z5UA 2NR5A 2BOCC 4XBFA 1U97A 3ICXA 4JI5O 2PTMA 1XMOO 1KQSU 4PDRA 5DN6G 4K3AA 3H01A 5KMGB 2F43G 1M93A 3FB8C 1SC5B 1SKVA 3HQNA 4O4HB 3VQWA 3OGCC 4DV6B 3ZMSA 3SJCC 1VQPV 2JGDB 3UQ8A 1RSOA 4EFEA 2L35A 1YF2A 3L75H 3K9AA 5H6RA 3SYPA 2CTRA 3L72H 1G6UA 1JJ2U 1KD1W 1KMIZ 1A3WA 3MA8A 5FNVA 5K1PA 4X88A 1IBMB 2A9HA 3JCUZ 1A5UA 1DF4A 5LMUB 3OMAB 3LUTB 1GH6A 1MNGA 3SRHA 1BL8A 1GK9A 3AG4B 2LFRA 3ZBHA 3E2EA 3RYHB 4CS2A 1MZFA 3F5WC 4X20A 1Z2GA 1PM9A 2BOBC 2W6JG 1O9GA 4D7TA 4RUFA 3SJQC 4DRXB 5BMVB 1KBHA 3AG4C 3SJAC 4LF6B 3K5OA 4DR7O 1FXHA 3OAAG 3OFNG 4PA7A 2VGBA 3PP7A 3CCLV 4JI4O 1PKYA 3T1YO 1XHZA 4PJ0Z 1AROP 1E0UA 1I08A 3RYCA 5L3FA 1ZTEA 4DR4B 4X8AA 3HPLC 1EZJA 2ZD9A 5B1BC 2QGNA 2ZIOA 3ASOC 4O4IB 1P4RA 3CYOA 2QWQB 1UPGA 1JQ0A 4I4TB 5EBMC 2IJIA 4I5SA 3G2GA 2HR3A 3E8HA 3CC7V 3DGEA 4I55B 4EB6B 4X65O 1ZJHA 4HNAA 1WPBA 1SQPH 1P7GA 3DXRA 2W0FC 2PGGA 4UUJC 2HJDA 4LBEC 2O57A 2DOSA 1BZKA 4MTGA 3ZJZA 4YJ2A 2AZ0A 2IM9A 4P30A 4KFMA 1V55C 2ZE5A 4JASA 5IYBO 5A9GA 1B04A 3K5NA 3OUFA 4JI7B 1EFRG 3D8CA 4XDLA 3ME3A 2N74A 4MVSA 3B2EE 4FXFA 1ZUQA 1HNZB 3K58A 2GSMB 4F6EA 5HFLA 4KCVA 4QE9A 4X1IB 1JCHA 3A2FA 2IJJA 2WLIA 3SDLA 5LGNA 3TCUA 4PDLA 4K8XA 4R50A 3CEIA 4G27B 1SZXA 1AB3A 5EIBC 4XDKA 4JV5B 2CGOA 3N2GA 1ROPA 2CDYA 4ICGA 1Q6IA 3CJHB 4UVCA 1FXKA 1GN3A 1OCZB 4MTFA 4KCTA 2V1DA 4ZHQA 3CB2A 1FS0G 1P49A 2DQ0A 3SYOA 4H37A 3TETA 1KC8W 5H2FZ 4W4LA 3P32A 4DR3B 1AI4A 3ETQA 4MVUA 3RVYA 4UB6Z 2Q9LA 4I50B 2BCCH 1JMKC 3UO3A 4Q6GA 1YVWA 3DTUB 2XAJA 3JD1A 2AHYA 3C3TA 4BW9A 1XMQO 1QU7A 3OTFA 3G80A 3CCEV 3BVOA 4BW5A 4TUYB 4PELA 1OCRC 3FAVA 2ITCC 5CA0A 3SR2C 4J9ZB 2VQEB 1Q8IA 2UXDB 1GM9A 1BHAA 1VMGA 2YS8A 2QDOA 3LNMB 4J80A 4WBNB 1E1QG 4HYVA 1KU9A 5IY5C 2MW2B 3KCYA 4YJ3A 4UB8Z 3GR4A 4QIWF 1VP7A 4CH3A 1L0LH 2UUBB 1T5AA 2ZDIC 4PA9A 1D5NA 1K9MW 2F4VO 3K0DA 3CP1A 3L9DA 1PKNA 3QG5A 4U3FH 1KUQA 4FM2A 3IAYA 2UU9O 3WB1A 3NR7A 4DV4B 4LNUB 5DECA 1XHXA 4JTAB 4Z1MG 3F7YC 1N34B 3H6OA 3ZHSA 5LP6A 4RPPA 2CH7B 3J80N 4AQYO 4UCTA 1BSMA 1R3JC 2GTAA 5L3DA 1I5YA 5JH7A 2AHZA 4RAIA 3SJBC 1IXBA 1NTZH 1DTOA 4JAUA 2Q73A 2Y48A 5E79Z 3ZHVA 1GRJA 2XTAA 2KSDA 3WU2Z 3OTOB 4IMAA 2EINB 4X1YB 1SESA 3K06A 3BAAA 2Q4PA 4L8JA 2RNBA 3KTXA 4LH7A 1MOFA 3OUSA 3OMNB 3Q4HB 1Q6HA 5D5QA 3T4ZA 3ZMVA 1N36B 1Q6UA 4F4LA 4CH4A 4TV9B 3JYCA 3RFRA 4QG6A 5LYJA 3CS5A 2JEUA 4IHJB 3ABMC 2WLHA 1XOUA 3ZMUA 2V7QG 4CC6A 5KA5A 3BA9A 3H1JH 4WJ8A 1KP3A 2UXBO 1SRYA 2WLJA 1OCOB 4DV3B 2YIDA 3FYEB 1JPXA 4OPHA 3JAWB 1YTFB 1K5QA 4DR1B 5K1XA 4MS2A 3SPJA 2OCCB 4TV8A 2QTSA 4LWSA 1US6A 4JTCB 2G50A 4JPRA 4YJ5A 4DR1O 1IBKO 4KCUA 2X6AA 3SPHA 3G6BA 4O2AB 4QG8A 5L3CA 4K35A 3JAMN 4RQFA 4JI3O 3JARB 4ZKIA 1AILA 4O4JA 1KP2A 2RMKB 4KHPO 1EBOA 3JATA 4X66O 2HP8A 1H2LA 4WFHA 4Z1VA 2EIJC 2JJ1G 1Y67A 5CB4A 3E0VA 3TXQA 5J2TA 3RN4A 3AG3B 4KHPB 2NLJC 2Q7HA 4ABMA 4LFAO 2DWDC 1IDSA 2YSUB 4JI0O 3HKBA 1BHBA 1KKDA 1XUQA 3ZCCA 4GYCB 3BRCA 4FVMA 2ZE7A 2ZCEA 2VGGA 1RFYA 3CPWU 3ABKB 3PN1A 4TSFG 5JQGA 5LXTB 3EVKA 2E74B 4AILC 1Q86W 1WAZA 1Q43A 1HR0O 5LHGA 4F6RB 1XILA 1K5SA 1AVMA 5TISZ 1H2MA 3QO5A 2F93B 3R65A 2PYLA 5LMNB 2ZQMA 4LFCO 2DYRB 2Q7EA 5GONB 3B4SA 2UUCB 1P7BA 1WB7A 1TA8A 3IGAC 3ML0A 3FX7A 1XQ8A 3STLC 1E0TA 1RM1B 5F2VO 2R9IA 1ZAUA 2CK3G 1H8EG 3L74H 5EC1C 4X1KA 1SETA 3RYHA 1I94B 1N8RW 1Q5OA 2Z3YA 1MA1A 4MTXA 4JZ2A 4UV9A 3APOA 1Y76A 2XAFA 3E8BA 2PY5A 1H2GA 2YEVA 2VQEO 1VIBA 2EIKC 4FZ1A 1MABG 1Z5VA 3WB2A 4EKWA 4LR3A 2EILC 4U3JB 4UCSA 1FYJA 5EBLC 3RYCB 2QA4V 3WG7B 4HYOA 2YI8A 2JS3A 1T5EA 3ZRSA 4QNHB 1AR5A 3FFQA 3A0HZ 3GWOA 1HNXO 1W2BU 1GM7A 4B3MO 4JI7O 4J42A 1QVGU 4NTYA 2Q69A 4DR6O 1L0NH 2L6LA 4I55A 4DV7O 3SYQA 2VWKA 1HP8A 2EULA 3WFVA 4LP8A 3HKCA 1F7YA 2ITDC 2D2CB 2EZPA 3A0RA 4MW8A 2A3QA 1TAEA 3LDDA 3FYIB 3OEEG 2FMLA 4WCEV 1SQVH 2F95B 2C2AA 4DRSA 3T07A 1IXMA 4H33A 4FLVA 3OD4A 3KCXA 3K0GA 5KUMA 3K08A 2HJFC 3HKDB 2LP7A 3FB7C 1YDXA 3OTOO 1SQXH 1MSWD 4PA3A 1WP8A 2Y69C 3ZHRA 2X6BA 2YXHA 5L3EA 3B09A 4JI8B 3JCZA 2E76B 5LP6C 3KHDA 3X2QC 3BA8A 3D36A 3S3WA 2WLLA 3OW2U 5JVDA 4CC5A 3QV7A 1FFTB 2WA3A 4B3SB 1NS1A 1FXKB 3NXSA 3KZIZ 5B1AC 4J10A 2XNDG 4BIZA 1FXKC 1Z5WA 1VEWA 5B1AB 4X65B 4I50A 2E75B 4FPPA 3RYIA 2WWWA 2P7TC 3IC7A 1M5IA 2P06A 2WA4A 2R70A 2QKCA 2IH1C 3GWKC 4DUZB 4B3MB 1XREA 2F4VB 2ADQB 1OHHG 4J11A 4TUYA 3IS4A 4I7ZB 5LHIA 2JEXA 1YCIA 4O2BB 3J7AU 1XL6A 1T57A 1VQMV 2V4DA 1O9HA 4WBNA 1P84F 3C90A 3H1KH 1Y74A 4LF5O 3EFFK 2CTWA 2NN4A 3MD0A 4GT1A 5LOVB 1FFXB 3LDCA 4NYKA 1S72V 5C8YB 3ZRVA 4DV2O 1JFFB 1H2SB 2DQ3A 2Q8VA 1HNXB 1NT2B 3ABLB 4IYIA 2WAMA 4ZBMA 5LMNO 4LFAB 3OGIB 4KXRA 3QF7A 4DV7B 2ZE6A 1ZLZA 1B3QA 2IH3C 4LF4O 4A5UB 5L3BA 3T1CA 4E2LA 2XASA 5JH7B 4X9QA 4LF7O 1I5XA 1Y66A 1K4DC 3CRRA 3I5DA 2YDEA 5KMGA 1A3XA 4JI6B 2AGAA 5ITZB 2RCVA 3OR6C 4X1YA 4WF9V 4O4HA 1F23A 3EOEA 2KG7B 2JGDA 1RSOB 5LGTA 2HKOA 5IWAO 5LMUO 2ZIMA 4KL1A 2QR4A 3DC6A 3CC4V 2WSSG 3Q4HA 1WA8B 2UUCO 2ZT9B 2UXDO 1K4CC 1XBLA 5H6QA 1NTKH 3N25A 2Q67A 4DR5O 5LGUA 2P90A 3W7TA 1R6NA 3KKYA 2OCCC 1QR8A 1M57C 5BMVA 4FJCC 3K3WA 1K97A 1MMMA 2QTOA 1PPJH 4CBCA 1JA8A 1LUVA 3F7VC 3SYAA 2FB5A 4BWAA 4QPKA 1COWG 1TUBB 2A79B 2RDCA 1FPOA 3JAWA 1N33B 3OM3B 3VQYA 3G67A 1B06A 1HDJA 1Y6XA 2CUGA 3UO2A 4FLXA 2XAHA 2PYJA 4TV8B 3QTGA 4NXNO 2Z0AA 1YJNV 5B5EZ 4B08A 4O4IA 3OMIB 2ZR2A 2JIZG 1URFA 1ENVA 1SS3A 2AXTZ 4GX1A 2OCHA 2YI9A 1R3LC 4EB6A 4FFKA 4HNAB 4LCUC 1YITV 1LR1A 1AJPA 2ZNJA 4FLYA 3T2MA 4YNGA 2YXLA 1S0VA 2OT5A 1CPYA 2AZ2A 4UVBA 3JD2A 3G6EV 3RW0A 4N23A 1BQ0A 1XNRB 4I0XA 1VF6A 1VQ8V 2A7WA 1PKXA 1E1RG 2B5UA 1A32A 4JI6O 4FLUA 4KRZA 4QJFB 2DYSB 4JAAA 5IT9N 1VQ5V 5JCOA 3MAQA 1R3IC 3CCMV 1PV0A 4KUMA 2YUAA 2CAZC 1F4MA 3H1LH 3SRDA 1ZL8B 4GX2A 1EN4A 2QSAA 4JI5B 1NZ6A 5LBQA 2GBOA 5CA1B 1TVKA 3BCCH 1VARA 2R9AA 4JZGA 4DV6O 2GUZA 4F6RA 5B3SB 2DE0X 3JD4A 3I56V 4DR2B 1WJZA 1OZ0A 5EYPA 4MVOA 3JSNA 4NKGB 3ZN0A 4I9WA 3N2GB 5IJ9A 1AR4A 1FKAO 1IVSA 3E22B 1K33A 4X62B 5GONA 1J95A 4FFBB 1PD3A 4WFBV 1NVPD 4NXNB 3DC5A 5J2UB 2A06H 4TWKA 1XI1A 1M90W 2EILB 3F5TA 4QG9A 2XAQA 1M56B 3ETEA 3E8GA 1N4CA 4X1KB 2EJ7A 3T1HO 3FKSG 1NBMG 1LUWA 4DUYB 1RP3B 4AI8A 2GHYA 2VRZA 4GZRB 2F66C 1V9PA 1R73A 4DV5O 1OCCC 2YEVB 5IDJA 3QVNA 3LDEA 4KCWA 2Q0AA 1VQ6V 4B3RO 3THOA 1AP6A 3KG2A 4P2ZA 2YXYA 3HQPA 2VQFB 3CD6V 2W6IG 4DV4O 2CTPA 4WFGA 3BJTA 2H3OA 1BE3H 3ZS8C 4G28B 5KA6A 4GKKO 4U7NA 4IIJA 3ZHUA 3P3PA 2QKSA 4PV1B 2RQ6A 4J41A 4DYLA 3HKEB 4DK1A 4JF3A 2GV9A 2WLMA 3B8NA 5C93A 4DV1O 3LSQA 3RGBA 3VBBA 3ABUA 1YZBA 4L87A 4UXNA 2QWNB 3CSXA 5LHHA 4UV8A 4TT3G 4JI1O 3P3NA 3ZRXA 2BTOA 1J5EO 2BSKB 2DYRC 4O4LB 2LW7A 2Y69B 1W0KG 3OT7A 4C7UA 4WFFA 3D3IA 2YIBA 4LNUA 3CRQA 5LP6B 1S76D 2EX3A 5B1OA 5B1BB 2G38A 3AG7A 1HNZO 1MSDA 4MVQA 1NQTA 4DO2A 1HNWB 3N2KA 1PNLA 3JASA 3M7MX 2ZR3A 2E28A 3HQOA 2LJ2A 4PD4F 2ZKOA 4GX0A 3JALB 4FMTA 2OTJV 2VGFA 3L70H 2WPDG 2EBOA 1S5LZ 2ZE8A 1VF6C 3WG7C 2ZNIA 1PNMA 2IJKA 4YIPA 2QE7G 3CRMA 4BAYA 2DJVA 2CGNA 3CCJV 3S3XA 1U96A 4LF6O 4J7KA 4HYWA 4CZZA 3CMAV 4JV5O 4DR4O 2ATKC 5DM6V 4DV0B 4JI8O 4IHJA 1R3KC 4LC1A 4TOIA 4RO2A 4JYAB 3JAKB 2OIEA 2DMXA 2GDSA 5CBGA 4J7JA 4DUZO 2LQTA 3OE7G 3ZMZA 1TUEB 2PUSA 4K8ZA 2JGUA 1N32B 1MZEA 3LSUA 1J5EB 2K9PA 3O9OA 4JAVA 5GTIZ 3AK2A 1GM8A 1OJHA 3B77A 2Q0OC 3E83A 2HLDG 1OCZC 4LF8B 4LWSB 2IW5A 2YICA 4UCRA 3BJFA 2P67A 1Q90D 4P9PA 2IU3A 1AI6A 3J81N 4NR1A 4O2BA 3E86A 1CXZB 3RYFB 2PZSA 4AHCA 1N0NA 3T0TA 3BEHA 2N05A 3OEHG 3W7UA 3AG2C 3JARA 3UM7A 3CCQV 2FTKA 1LNQA 4I9QA 1SF9A 3X2QB 3SRKA 5LOVA 1N32O 3N27A 3JATB 3L71H 2ARHA 2D3OW 4X64B 1NH2D 4X89A 4PHZA 3UKMA 4JPGA 2XT9A 2UXCO 4D6TH 1YJ9V 2Q68A 3RVZA 2LGQA 4K0KB 1N34O 4N21A 4NTWA 4DV2B 4FLWA 1RPOA 4UFZA 4PDMA 2W0XA 4CS4A 3EHBB 2QEXV 4GKKB 4YIOA 3EXAA 3L73H 1YTFD 5JQGB 1JJOA 3K5MA 1SQGA 1SZTA 3CRCA 4JYAO 4DR7B 2F23A 5B1NA 1YSCA 5FNVB 4BIOA 1KYOF 1TGOA 4JI1B 3T1YB 3K5LA 5IWAB 1I94O 3OR7C 3CCRV 4K0KO 1IZ3A 1VQ9V 5LA6B 3RBZA 2OWOA 1VQNV 1H38A 1SQFA 1I0HA 4DRXA 2X0LA 1BS3A 5CBFA 4LH6A 3JSLA 1FAFA 2KKWA 1WA8A 2H94A 3T1HB 1HR0B 4BIUA 4FM0A 1QVFU 1VP8A 1AQFA 3K57A 2XOKG 4JYCA 4DV5B 3K9SA 5FLXN 1VQ7V 1N33O 4ASUG 2JDIG 4JYYA 3ZN1A 3CCSV 4DV3O 1Y76B 3STZC 2VGIA 5DEDA 4ZOLB 1UFIA 4U3JA 4QGCA 1EN6A 5IE9A 2YIAA 1S5HC 3I55V 4G2KA 2P6JA 1THZA 2EINC 5J9PC 2EJRA 1IBLB 3UT5B 2X7RB 4DV1B 4RQEA 2BTQB 5IYZB 2FKXA 4LFBO 3BY6A 2UUAO 3R66A 2ZXWB 3PJSK 2ODMA 2E5LB 4TQDA 2K1EA 1M4UA 1SA0A 1NI8A 3H9VA 1XEQA 2DWEC 3HKCB 3RT3C 4NB5A 1Q7YW 2B1IA 4MT8A 1GN2A 4JI2O 4G1NA 4I0XB 2DW4A 4HBNA 5JJJB 2ZINA 5BXZA 4D7SA 1QLEC 3E0WA 2HVKC 1OCOC 5EC2C 3D3QA 2HVJC 1R1BA 3GG8A 3HKDA 4Z2WA 3SYCA 5EIBD 5KX5A 1L1FA 1E79G 1IBMO 2AW9A 5CMUA 1JOYA 3CJHA 4KS0A 2YC0A 1F3WA 1TVKB 4B3SO 2JJ2G 1EZVH 5D5PA 4ZHQB 2PI4A 2EIJB 3ZX6A 1QQCA 1FXVA 3AK3A 5BY1A 1V54C 5BR8B 2GUZB 3FB6C 5FPRA 2PI5A 1NU1H 2WLLB 4FM1A 2PF4E 5EYPB 1FJGO 4JTDB 1EM1A 1QNMA 4LF8O 5IJ0A 5JWPA 3ZRWA 2RN9A 4GUNA 1R6TA 4FFBA 5J2UA 1MG1A 1OCCB 2YIBD 3AG3C 4Q20A 1NH2B 1HW7A 5KAIZ 5JJNB 1IBKB 5BZBA 2VS0A 1QHTA 4NTXA 5CA0B 2VQFO 2DN9A 1VQKV 3U11A 4QPJA 4ZI7B 3QTCA 3AG1C 1X59A 5HFMA 3T4DA 4B3RB 3U2ZA 1AI5A 5EK0A 1OV9A 2OYQA 5EZYA 3WB0A 3ZMTA 1BGYH 2ZM6B 4YJ3B 3AG1B 3K04A 3CCVV 3MHHC 3AEIA 3CX5F 4GLXA 4DXWA 2UXBB 1ZX3A 1G1XB 2UUAB 1K34A 2P4KA 3ZIAG 2OIGA 3LNNA 4YXWG 5KHHA 4UCUA 1AJQA 2ADPA 2UUBO 4IIJB 1M1KW 2R9RB 4FLTA 5B3SC 1VF7A 2Y4TA 1NKDA 5C8YA 2Y4UA 3AAGA 5A2QN 1UJWB 2Q6AA 1JFFA 2CH7A 1PP9H 1WLEA 1XL4A 2OTLV 1HWYA 1QCEA 2EIKB 2MK3A 2BSKA 4O4LA 3QV9A 3DSQA 4MVRA 3JD3A 2B1GA 4LF7B 4CH6A 2IJHA 2KQXA 1AI7A 2XHBA 4IL6Z 1Q82W 5EBWC 2LW1A 3ASNB 1YXBA 5BR8O 3A8TA 4DW0A 3CMEV 4YY3B 3IJ4A 3ABTA 4WFAV 4AQYB 4DR2O 3ASNC 3N2KB 3K59A 4U7OA 1IX9A 1V55B 1ORQC 2Y0IA 4GX5A 4IT5A 4MVMA 4DW1A 1JR9A 5ITZA 2P5OA 4HAMA 1CP9A 4OX9B 5JJEB 2KG7A 1DF5A 4GKJO 3RWRD 1S5JA 5LYJB 4X20B 3SPIA 1BT8A 1GN4A 3TK1A 1KECA 3ZEDA 1F51A 4XDJA 4EEQA 3AK1A 5LL6Y 2JVDA 4DR5B 4PDVA 4NXMO 4HZ3A 2QKAA 1F4NA 2WLKA 2N04A 1K7DA 2F1MA 3BPZA
chains in the Genus database with same CATH topology
4UUJC 2W0FC 3WG7C 2LP7A 3FB7C 3LSSA 1PNMA 4LBEC 2IJKA 1GKFA 1YJWV 2QE7G 1B6QA 4MTGA 1MSWD 4PA3A 4BAYA 2Y69C 3ZJZA 4P30A 3CCJV 2X6BA 4KFMA 5L3EA 1V55C 3JCZA 4JASA 4CZZA 5IYBO 3CMAV 3OUFA 2ATKC 3AG2B 5DM6V 1EFRG 3X2QC 1QLNA 1R3KC 3D36A 4LC1A 3QO8A 4RO2A 4P9OA 4XDLA 4MVSA 5CN0A 5CBGA 4MTOA 4WFEA 2WLLA 3OE7G 3OW2U 4MW3A 3ZMZA 1FFTB 2GSMB 1TUEB 5HFLA 1M9NA 4QE9A 1JCHA 3ASOB 5E1AC 1FXKB 3NXSA 2IJJA 2WLIA 4JAVA 5LGNA 3TCUA 4PDLA 3ETGA 1GM8A 5B1AC 3B77A 4R50A 3E83A 2HLDG 2XNDG 1OCZC 4BIZA 2IW5A 1FXKC 1CEZA 1K3EA 4G27B 2P67A 4XDKA 5B1AB 1ROPA 2IU3A 1AI6A 4P9PA 3E86A 4FPPA 2WWWA 2P7TC 3E8FA 1FXKA 1OCZB 4MTFA 4UVCA 3IC7A 2V1DA 2WLIB 1FS0G 5CA3A 2IH1C 3BEHA 5IY5B 2DQ0A 3SYOA 4H37A 3TETA 1KC8W 3OEHG 1AJNA 3AG2C 3W7UA 3UM7A 3CCQV 2FTKA 1LNQA 3P32A 3CXCU 3X2QB 4J9YB 4MSWC 1AI4A 1K73W 1OHHG 1WPXA 4MVUA 2EIMC 3RVYA 4R7CA 2D3OW 1BMFG 2X6CA 5LHIA 1NH2D 2JEXA 1PL0A 3QNEA 4X89A 2QM7A 3UKMA 2IU0A 1XL6A 1S3JA 1YJ9V 1VQMV 1NR1A 2EIMB 2Q68A 3RVZA 1QBZA 4N21A 3DTUB 2XAJA 3JD1A 2AHYA 3EFFK 3HB3B 1RPOA 3MD0A 4GT1A 3CCEV 4PDMA 3LDCA 3EHBB 4BW5A 1S72V 2QEXV 4PELA 1OCRC 3SPCA 1Y4MA 3ZRVA 2ITCC 1GO3F 1YTFD 4J9ZB 1YHQV 1PNKA 2DQ3A 1GM9A 1BHAA 1SZTA 3LNMB 3ABLB 5B1NA 1YSCA 2WAMA 4ZBMA 1H8HG 5GW7A 2ZDIA 1E1QG 5IY5C 1Q81W 4QIWF 2EZOA 4FIPC 3ABLC 3OR7C 3CCRV 5KUKA 2ZDIC 1VQ9V 4PA9A 4FK5C 3SPGA 1VQLV 1K9MW 3K0DA 1SERA 2IH3C 3CP1A 3RBZA 4UVAA 4R6ZA 1VQNV 3QO7A 1H38A 5L3BA 3T1CA 4E2LA 2XASA 2X0LA 5CBFA 1I5XA 2M7WA 1Y66A 1K4DC 2UXXA 2A0LA 2H94A 1AR1B 3W7WA 2ZXWC 3OR6C 4JTAB 4Z1MG 3F7YC 4WF9V 1F23A 4BIUA 1QVFU 1OCRB 1GTOA 3ABMB 1S77D 3IFXA 5LGTA 3E89A 4QE7A 2HKOA 2XOKG 1R3JC 4JYCA 1VQ7V 3CC2V 5L3DA 1I5YA 2AHZA 3JD0A 4RAIA 4ASUG 4JGSA 2JDIG 1DTOA 4JAUA 3CC4V 2WSSG 4MVZA 3ZN1A 3CCSV 2Y48A 2JK5C 4KP4A 3STZC 1K4CC 3W7SA 1VQOV 2EINB 1SESA 3G4SV 5H6QA 3K06A 3P30A 2Q67A 5LGUA 2P90A 3W7TA 1R6NA 1S5HC 2OCCC 1QR8A 2QM8A 1M57C 2P6JA 4G2KA 1THZA 3I55V 4FJCC 1MOFA 2EINC 3K3WA 3W7XA 3OUSA 3OMNB 1K97A 2QTOA 4CBCA 5J9PC 1JX9A 2EJRA 2X7RB 3T4ZA 3ZMVA 3F7VC 3SYAA 4RQEA 4QPKA 1COWG 3BY6A 4F4LA 5IYDO 1M57B 2A79B 3JYCA 2ZXWB 3OM3B 3PJSK 1NJIW 2K1EA 1V54B 2JEUA 3ABMC 2WLHA 3ZMUA 2XAHA 2V7QG 2DWEC 5KA5A 1RPRA 1KP3A 1Q7YW 2B1IA 1YJNV 3VOUA 2HG5C 4MT8A 1K92A 1SRYA 2WLJA 5FL7G 1OCOB 5L3GA 3OMIB 3FYEB 2ZR2A 2DW4A 1JPXA 2JIZG 4GCZA 1ENVA 4PA6A 4RUEA 4GX1A 4JYBA 1YTFB 1R3LC 1K5QA 1QLEC 4LCUC 1YITV 2HVKC 1OCOC 4MS2A 1AJPA 5EC2C 2HVJC 3T2MA 3M99B 3SPJA 2OCCB 3SYCA 1L1FA 3ABKC 1S0VA 1YI2V 1E79G 1K8AW 4JTCB 2OT5A 1CPYA 4JPRA 4UVBA 3JD2A 3G6EV 3RW0A 4N23A 5CMUA 1G8MA 2X6AA 2DYSC 3SPHA 2WLNA 1JOYA 5L3CA 1VQ8V 1PKXA 2JJ2G 1E1RG 3ZRWB 2PI4A 2B5UA 2EIJB 1GMGA 1W0JG 4RQFA 1JVMA 1DLBA 1FXVA 1V54C 4ZKIA 4OXSA 3FB6C 3B8MA 3K79A 4QJFB 2DYSB 1KP2A 3ETDA 3G71V 2PI5A 1EBOA 1VQ5V 2WLLB 1R3IC 1R6KA 4WFHA 4KUMA 3CCMV 2EIJC 2JJ1G 1F4MA 4JTDB 4GX2A 3AG3B 2NLJC 1QR9A 2XAGA 1ZWIC 2DWDC 5LBQA 1NR7A 2YSUB 3ZRWA 1G4YB 1BHBA 1KKDA 1NVPB 1RM1C 3CCUV 1MG1A 1OCCB 3AG3C 4Q20A 3ZCCA 2H8PC 5B3SB 3JD4A 3I56V 1NH2B 3K03A 1QLEB 1VQ4V 5IYCO 5BZBA 1OZ0A 1YIJV 2UXNA 2LFSA 4MVOA 3CPWU 3ZN0A 3ABKB 1VQKV 4I9WA 4QPJA 4TSFG 3AG1C 1K33A 5HFMA 3T4DA 1AI5A 5EK0A 1J95A 1Q86W 3FB5C 3E35A 1M56C 1PD3A 4WFBV 1NVPD 4PA4A 4R8CA 5LHGA 4TWKA 1K5SA 3GB7C 3ZMTA 5H9CA 2NNUA 3QO5A 1M90W 3AG1B 2EILB 3R65A 3K04A 3CCVV 2KB1A 3MHHC 3AEIA 2XAQA 1M56B 3ETEA 3E8GA 4DXWA 3FKSG 1NBMG 2ZQMA 5CBHA 1K34A 2HFEC 2DYRB 3MHSC 2Z5UA 3ZIAG 4YXWG 2BOCC 4XBFA 1P7BA 3IGAC 3ML0A 2GHYA 1KQSU 1AJQA 4PDRA 5DN6G 3STLC 3H01A 1M1KW 2R9RB 2F43G 1R73A 1RM1B 1OCCC 5B3SC 2R9IA 2YEVB 3FB8C 1NKDA 5IDJA 3AAGA 2CK3G 3LDEA 1H8EG 1UJWB 1VQ6V 5EC1C 3OGCC 1SETA 2Q6AA 3KG2A 3ZMSA 4P2ZA 1VQPV 1WLEA 1XL4A 1N8RW 5H6RA 3K9AA 3CD6V 2OTLV 1HWYA 1QCEA 3SYPA 2W6IG 1JJ2U 2EIKB 2MK3A 2Z3YA 4WFGA 1KD1W 4MTXA 4UV9A 4X88A 4G28B 2A9HA 4MVRA 5KA6A 4U7NA 3JD3A 2B1GA 2QKSA 2XAFA 1DF4A 3E8BA 1H2GA 2YEVA 2IJHA 3OMAB 3LUTB 2WLMA 2EIKC 1AI7A 1MABG 4JF3A 4EKWA 1BL8A 1GK9A 3AG4B 3B8NA 5EBWC 2LFRA 5C93A 2EILC 1Q82W 3ASNB 3LSQA 3E2EA 3F5WC 3VBBA 2BOBC 3ABUA 5EBLC 2W6JG 4L87A 4UXNA 3CMEV 2QA4V 4RUFA 3WG7B 5LHHA 4HYOA 4TT3G 4UV8A 3SJQC 3ZRXA 3ABTA 4WFAV 2DYRC 3AG4C 3ZRSA 4QNHB 3ASNC 2Y69B 4U7OA 1W0KG 3GWOA 1FXHA 3OAAG 3OFNG 4WFFA 1V55B 3D3IA 4PA7A 1ORQC 4GX5A 4MVMA 1W2BU 1GM7A 3CCLV 4HAMA 1CP9A 1QVGU 1S76D 1DF5A 5B1OA 5B1BB 1AROP 2Q69A 3SPIA 3SYQA 5L3FA 3TK1A 3WFVA 1KECA 1F51A 4LP8A 4X8AA 4XDJA 4MVQA 1NQTA 2ITDC 4DO2A 3HPLC 3A0RA 2ZD9A 1EZJA 1PNLA 2EZPA 5B1BC 4MW8A 2ZR3A 4PDVA 3LDDA 3FYIB 3ASOC 4HZ3A 1P4RA 3CYOA 3OEEG 1JQ0A 4GX0A 2IJIA 5EBMC 4FMTA 2C2AA 4WCEV 4I5SA 2OTJV 1F4NA 1IXMA 2WLKA 2HR3A 3E8HA 4H33A 1K7DA 2WPDG 5KUMA 3DGEA 3K0GA 3K08A 3CC7V 2HJFC 2EBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKS G;  1NBM G;  2QE7 G;  2Z5U A;  3ZIA G;  4YXW G;  4XBF A;  4BAY A;  5FL7 G;  1H8H G;  5L3E A;  1E1Q G;  5L3G A;  5DN6 G;  2DW4 A;  2JIZ G;  4CZZ A;  2F43 G;  2R9I A;  1EFR G;  2CK3 G;  1H8E G;  3ZMS A;  4UVA A;  3OE7 G;  5H6R A;  1E79 G;  5L3B A;  2W6I G;  2XAS A;  3ZMZ A;  2X0L A;  2Z3Y A;  4UVB A;  4UV9 A;  2UXX A;  2H94 A;  5L3C A;  2JJ2 G;  1E1R G;  2XAF A;  5LGN A;  1W0J G;  1MAB G;  4Z1M G;  2HLD G;  2XND G;  2IW5 A;  5LGT A;  3ABU A;  2XOK G;  2HKO A;  2W6J G;  4UXN A;  4KUM A;  5L3D A;  5LHH A;  4UV8 A;  4TT3 G;  2JJ1 G;  3ABT A;  4ASU G;  2JDI G;  2XAG A;  2WSS G;  3ZN1 A;  2Y48 A;  4UVC A;  5LBQ A;  1W0K G;  3OAA G;  3OFN G;  2V1D A;  2V7Q G;  1FS0 G;  3OEH G;  5H6Q A;  1OHH G;  5LGU A;  1BMF G;  2UXN A;  5L3F A;  5LHI A;  3ZN0 A;  4TSF G;  2EJR A;  3ZMV A;  1COW G;  2XAJ A;  3OEE G;  5LHG A;  3ZMT A;  2WPD G;  3ZMU A;  2XAQ A;  2XAH A; 
#chains in the Genus database with same CATH topology
 3JAK A;  3U0Z A;  1PKL A;  3LSS A;  1ZSP A;  1F3X A;  1GKF A;  1YJW V;  1B6Q A;  4CS3 A;  1YEW A;  1TUB A;  2HEP A;  4I4T A;  4O2A A;  4EFB A;  3BAB A;  1D2D A;  1NTM H;  2GTS A;  4X66 B;  3AG2 B;  4JI4 B;  1QLN A;  3QO8 A;  4P9O A;  1EN5 A;  2JRI A;  3DXR B;  1L8D A;  4O4J B;  2QWP B;  5CN0 A;  2CTQ A;  1XNQ O;  1DGS A;  4RWU A;  4MTO A;  4WFE A;  4MW3 A;  1XDC A;  5CB4 B;  4YJ2 B;  1M9N A;  2UU9 B;  4B3T B;  5B66 Z;  3ASO B;  5E1A C;  3H1I H;  3RYF A;  1BQZ A;  3HKB B;  4E4E A;  3ETG A;  5KAF Z;  4J7Z A;  3QV8 A;  1CEZ A;  1K3E A;  3CE2 A;  4LF9 O;  1SQB H;  4YY3 O;  4FLZ A;  5AG2 A;  4LF9 B;  4X1I A;  5LXT A;  1PL4 A;  3E8F A;  4H44 B;  2WLI B;  5CA3 A;  5IY5 B;  2M6Y A;  1HNW O;  1AJN A;  3VQV A;  1I7F A;  3CXC U;  4J9Y B;  4MSW C;  1K73 W;  3TGU H;  1WPX A;  2EIM C;  2Q7G A;  3TJT A;  4R7C A;  3IC9 A;  1BMF G;  2X6C A;  4QGP A;  1ZL8 A;  1PL0 A;  3QNE A;  2QM7 A;  2Y0P A;  4CH5 A;  2P4V A;  2IU0 A;  1S3J A;  1N36 O;  5CA1 A;  1NR1 A;  2EIM B;  4UCO A;  1QBZ A;  4BR6 A;  4B2D A;  4IGG A;  3BHP A;  1DK1 A;  2LO1 A;  3H1H H;  3HB3 B;  3D36 C;  3FD9 A;  3SPC A;  1Y4M A;  1GO3 F;  3APQ A;  5LA6 A;  5IJ9 B;  1YHQ V;  1PNK A;  3E22 A;  2RJZ A;  2FL4 A;  1H8H G;  5GW7 A;  2ZDI A;  1WN7 A;  4GKJ B;  2Q5Z A;  3T05 A;  3GVM A;  1Q81 W;  2CE4 A;  1BCC H;  2EZO A;  4FIP C;  3ABL C;  4DR6 B;  5KUK A;  3FAV B;  2QWO B;  4FK5 C;  3SPG A;  2FYU H;  4DR3 O;  1VQL V;  3SRF A;  1SER A;  4UVA A;  4R6Z A;  4JI3 B;  3QO7 A;  1XNQ B;  1AP5 A;  2QJ1 A;  5GTH Z;  2M7W A;  4OGQ B;  2UXX A;  1W59 A;  2A0L A;  3HR0 A;  5KHG A;  1AR1 B;  3W7W A;  4DUY O;  2ZXW C;  2HHH B;  4ZOL A;  4B2D D;  4JI0 B;  1OCR B;  3ZHT A;  1GTO A;  3ABM B;  1S77 D;  3IFX A;  4B7E A;  3E89 A;  4QE7 A;  2ZM6 O;  3O65 A;  4B7K A;  3CC2 V;  3JD0 A;  4JGS A;  3VQX A;  4PI0 A;  4JI2 B;  4MVZ A;  3UT5 A;  2JK5 C;  3QV6 A;  4KP4 A;  2BTQ A;  5IYZ A;  2R72 A;  3W7S A;  3HKE A;  1VQO V;  1WB8 A;  1PKM A;  3G4S V;  3P30 A;  5KHJ A;  4H13 B;  3A0B Z;  1SA0 B;  1A49 A;  2QM8 A;  4IYH A;  3W7X A;  5JCO C;  2ETN A;  3ZHQ A;  2QWR B;  2JS5 A;  1JX9 A;  4LF4 B;  3M8A A;  4DK0 A;  5IYD O;  1M57 B;  2XUM A;  4X64 O;  1NJI W;  1V54 B;  1XMO B;  2B9Z A;  4FZ0 A;  1XNR O;  2VWJ A;  4OX9 O;  4LFC B;  1RPR A;  5KX5 B;  3JAS B;  3VOU A;  1KKC A;  1FD9 A;  2HG5 C;  2BE3 A;  5JVD B;  1K92 A;  1N0J A;  5FL7 G;  4ZIB A;  2P22 C;  1KB9 F;  3CWB H;  4TV9 A;  5L3G A;  5KHI A;  4GCZ A;  4IP7 A;  3JAL A;  4UCV A;  1FJG B;  4PA6 A;  4RUE A;  4JYB A;  4YHH B;  4NXM B;  1VF5 B;  4TQF A;  1IUR A;  3M99 B;  4W4K A;  3ABK C;  1H2K A;  1YI2 V;  1K8A W;  4FXJ A;  4H0L B;  1G8M A;  2DYS C;  3RYI B;  2WLN A;  3SGI A;  2QM4 A;  2IBZ H;  1D5A A;  5IJ0 B;  3ZRW B;  1GMG A;  1W0J G;  1JVM A;  1DLB A;  3GQY A;  4OXS A;  4X62 O;  3B8M A;  3K79 A;  3ETD A;  3CRA A;  3G71 V;  4DV0 O;  1R6K A;  1X4T A;  4YHH O;  3UCS C;  4ZI7 A;  4OPA A;  3TXS A;  1QR9 A;  4PI2 A;  2XAG A;  1ZWI C;  1WP7 A;  3MDS A;  1NR7 A;  1GN6 A;  1G4Y B;  1NVP B;  1Y74 B;  1RM1 C;  3CCU V;  3U10 A;  5EZY B;  2H8P C;  1WNS A;  3K03 A;  1QLE B;  1FFX A;  1VQ4 V;  5IYC O;  4B3T O;  1YIJ V;  2UXN A;  2LFS A;  5J2T B;  5KLV H;  1XMQ B;  2LGW A;  3CXH F;  4LF5 B;  1GAX A;  1IBL O;  3C3S A;  3FB5 C;  3E35 A;  1M56 C;  2UXC B;  2E3C A;  4PA4 A;  1H2N A;  4R8C A;  2ILM A;  2E5L O;  3GB7 C;  5H9C A;  1SQQ H;  5KHK A;  2NNU A;  2KB1 A;  3CHX A;  3BFR A;  3B40 A;  5H5N A;  2HHH O;  4LFB B;  4NVP A;  5CBH A;  5FPO A;  1Q3E A;  2HFE C;  3MHS C;  2Z5U A;  2NR5 A;  2BOC C;  4XBF A;  1U97 A;  3ICX A;  4JI5 O;  2PTM A;  1XMO O;  1KQS U;  4PDR A;  5DN6 G;  4K3A A;  3H01 A;  5KMG B;  2F43 G;  1M93 A;  3FB8 C;  1SC5 B;  1SKV A;  3HQN A;  4O4H B;  3VQW A;  3OGC C;  4DV6 B;  3ZMS A;  3SJC C;  1VQP V;  2JGD B;  3UQ8 A;  1RSO A;  4EFE A;  2L35 A;  1YF2 A;  3L75 H;  3K9A A;  5H6R A;  3SYP A;  2CTR A;  3L72 H;  1G6U A;  1JJ2 U;  1KD1 W;  1KMI Z;  1A3W A;  3MA8 A;  5FNV A;  5K1P A;  4X88 A;  1IBM B;  2A9H A;  3JCU Z;  1A5U A;  1DF4 A;  5LMU B;  3OMA B;  3LUT B;  1GH6 A;  1MNG A;  3SRH A;  1BL8 A;  1GK9 A;  3AG4 B;  2LFR A;  3ZBH A;  3E2E A;  3RYH B;  4CS2 A;  1MZF A;  3F5W C;  4X20 A;  1Z2G A;  1PM9 A;  2BOB C;  2W6J G;  1O9G A;  4D7T A;  4RUF A;  3SJQ C;  4DRX B;  5BMV B;  1KBH A;  3AG4 C;  3SJA C;  4LF6 B;  3K5O A;  4DR7 O;  1FXH A;  3OAA G;  3OFN G;  4PA7 A;  2VGB A;  3PP7 A;  3CCL V;  4JI4 O;  1PKY A;  3T1Y O;  1XHZ A;  4PJ0 Z;  1ARO P;  1E0U A;  1I08 A;  3RYC A;  5L3F A;  1ZTE A;  4DR4 B;  4X8A A;  3HPL C;  1EZJ A;  2ZD9 A;  5B1B C;  2QGN A;  2ZIO A;  3ASO C;  4O4I B;  1P4R A;  3CYO A;  2QWQ B;  1UPG A;  1JQ0 A;  4I4T B;  5EBM C;  2IJI A;  4I5S A;  3G2G A;  2HR3 A;  3E8H A;  3CC7 V;  3DGE A;  4I55 B;  4EB6 B;  4X65 O;  1ZJH A;  4HNA A;  1WPB A;  1SQP H;  1P7G A;  3DXR A;  2W0F C;  2PGG A;  4UUJ C;  2HJD A;  4LBE C;  2O57 A;  2DOS A;  1BZK A;  4MTG A;  3ZJZ A;  4YJ2 A;  2AZ0 A;  2IM9 A;  4P30 A;  4KFM A;  1V55 C;  2ZE5 A;  4JAS A;  5IYB O;  5A9G A;  1B04 A;  3K5N A;  3OUF A;  4JI7 B;  1EFR G;  3D8C A;  4XDL A;  3ME3 A;  2N74 A;  4MVS A;  3B2E E;  4FXF A;  1ZUQ A;  1HNZ B;  3K58 A;  2GSM B;  4F6E A;  5HFL A;  4KCV A;  4QE9 A;  4X1I B;  1JCH A;  3A2F A;  2IJJ A;  2WLI A;  3SDL A;  5LGN A;  3TCU A;  4PDL A;  4K8X A;  4R50 A;  3CEI A;  4G27 B;  1SZX A;  1AB3 A;  5EIB C;  4XDK A;  4JV5 B;  2CGO A;  3N2G A;  1ROP A;  2CDY A;  4ICG A;  1Q6I A;  3CJH B;  4UVC A;  1FXK A;  1GN3 A;  1OCZ B;  4MTF A;  4KCT A;  2V1D A;  4ZHQ A;  3CB2 A;  1FS0 G;  1P49 A;  2DQ0 A;  3SYO A;  4H37 A;  3TET A;  1KC8 W;  5H2F Z;  4W4L A;  3P32 A;  4DR3 B;  1AI4 A;  3ETQ A;  4MVU A;  3RVY A;  4UB6 Z;  2Q9L A;  4I50 B;  2BCC H;  1JMK C;  3UO3 A;  4Q6G A;  1YVW A;  3DTU B;  2XAJ A;  3JD1 A;  2AHY A;  3C3T A;  4BW9 A;  1XMQ O;  1QU7 A;  3OTF A;  3G80 A;  3CCE V;  3BVO A;  4BW5 A;  4TUY B;  4PEL A;  1OCR C;  3FAV A;  2ITC C;  5CA0 A;  3SR2 C;  4J9Z B;  2VQE B;  1Q8I A;  2UXD B;  1GM9 A;  1BHA A;  1VMG A;  2YS8 A;  2QDO A;  3LNM B;  4J80 A;  4WBN B;  1E1Q G;  4HYV A;  1KU9 A;  5IY5 C;  2MW2 B;  3KCY A;  4YJ3 A;  4UB8 Z;  3GR4 A;  4QIW F;  1VP7 A;  4CH3 A;  1L0L H;  2UUB B;  1T5A A;  2ZDI C;  4PA9 A;  1D5N A;  1K9M W;  2F4V O;  3K0D A;  3CP1 A;  3L9D A;  1PKN A;  3QG5 A;  4U3F H;  1KUQ A;  4FM2 A;  3IAY A;  2UU9 O;  3WB1 A;  3NR7 A;  4DV4 B;  4LNU B;  5DEC A;  1XHX A;  4JTA B;  4Z1M G;  3F7Y C;  1N34 B;  3H6O A;  3ZHS A;  5LP6 A;  4RPP A;  2CH7 B;  3J80 N;  4AQY O;  4UCT A;  1BSM A;  1R3J C;  2GTA A;  5L3D A;  1I5Y A;  5JH7 A;  2AHZ A;  4RAI A;  3SJB C;  1IXB A;  1NTZ H;  1DTO A;  4JAU A;  2Q73 A;  2Y48 A;  5E79 Z;  3ZHV A;  1GRJ A;  2XTA A;  2KSD A;  3WU2 Z;  3OTO B;  4IMA A;  2EIN B;  4X1Y B;  1SES A;  3K06 A;  3BAA A;  2Q4P A;  4L8J A;  2RNB A;  3KTX A;  4LH7 A;  1MOF A;  3OUS A;  3OMN B;  3Q4H B;  1Q6H A;  5D5Q A;  3T4Z A;  3ZMV A;  1N36 B;  1Q6U A;  4F4L A;  4CH4 A;  4TV9 B;  3JYC A;  3RFR A;  4QG6 A;  5LYJ A;  3CS5 A;  2JEU A;  4IHJ B;  3ABM C;  2WLH A;  1XOU A;  3ZMU A;  2V7Q G;  4CC6 A;  5KA5 A;  3BA9 A;  3H1J H;  4WJ8 A;  1KP3 A;  2UXB O;  1SRY A;  2WLJ A;  1OCO B;  4DV3 B;  2YID A;  3FYE B;  1JPX A;  4OPH A;  3JAW B;  1YTF B;  1K5Q A;  4DR1 B;  5K1X A;  4MS2 A;  3SPJ A;  2OCC B;  4TV8 A;  2QTS A;  4LWS A;  1US6 A;  4JTC B;  2G50 A;  4JPR A;  4YJ5 A;  4DR1 O;  1IBK O;  4KCU A;  2X6A A;  3SPH A;  3G6B A;  4O2A B;  4QG8 A;  5L3C A;  4K35 A;  3JAM N;  4RQF A;  4JI3 O;  3JAR B;  4ZKI A;  1AIL A;  4O4J A;  1KP2 A;  2RMK B;  4KHP O;  1EBO A;  3JAT A;  4X66 O;  2HP8 A;  1H2L A;  4WFH A;  4Z1V A;  2EIJ C;  2JJ1 G;  1Y67 A;  5CB4 A;  3E0V A;  3TXQ A;  5J2T A;  3RN4 A;  3AG3 B;  4KHP B;  2NLJ C;  2Q7H A;  4ABM A;  4LFA O;  2DWD C;  1IDS A;  2YSU B;  4JI0 O;  3HKB A;  1BHB A;  1KKD A;  1XUQ A;  3ZCC A;  4GYC B;  3BRC A;  4FVM A;  2ZE7 A;  2ZCE A;  2VGG A;  1RFY A;  3CPW U;  3ABK B;  3PN1 A;  4TSF G;  5JQG A;  5LXT B;  3EVK A;  2E74 B;  4AIL C;  1Q86 W;  1WAZ A;  1Q43 A;  1HR0 O;  5LHG A;  4F6R B;  1XIL A;  1K5S A;  1AVM A;  5TIS Z;  1H2M A;  3QO5 A;  2F93 B;  3R65 A;  2PYL A;  5LMN B;  2ZQM A;  4LFC O;  2DYR B;  2Q7E A;  5GON B;  3B4S A;  2UUC B;  1P7B A;  1WB7 A;  1TA8 A;  3IGA C;  3ML0 A;  3FX7 A;  1XQ8 A;  3STL C;  1E0T A;  1RM1 B;  5F2V O;  2R9I A;  1ZAU A;  2CK3 G;  1H8E G;  3L74 H;  5EC1 C;  4X1K A;  1SET A;  3RYH A;  1I94 B;  1N8R W;  1Q5O A;  2Z3Y A;  1MA1 A;  4MTX A;  4JZ2 A;  4UV9 A;  3APO A;  1Y76 A;  2XAF A;  3E8B A;  2PY5 A;  1H2G A;  2YEV A;  2VQE O;  1VIB A;  2EIK C;  4FZ1 A;  1MAB G;  1Z5V A;  3WB2 A;  4EKW A;  4LR3 A;  2EIL C;  4U3J B;  4UCS A;  1FYJ A;  5EBL C;  3RYC B;  2QA4 V;  3WG7 B;  4HYO A;  2YI8 A;  2JS3 A;  1T5E A;  3ZRS A;  4QNH B;  1AR5 A;  3FFQ A;  3A0H Z;  3GWO A;  1HNX O;  1W2B U;  1GM7 A;  4B3M O;  4JI7 O;  4J42 A;  1QVG U;  4NTY A;  2Q69 A;  4DR6 O;  1L0N H;  2L6L A;  4I55 A;  4DV7 O;  3SYQ A;  2VWK A;  1HP8 A;  2EUL A;  3WFV A;  4LP8 A;  3HKC A;  1F7Y A;  2ITD C;  2D2C B;  2EZP A;  3A0R A;  4MW8 A;  2A3Q A;  1TAE A;  3LDD A;  3FYI B;  3OEE G;  2FML A;  4WCE V;  1SQV H;  2F95 B;  2C2A A;  4DRS A;  3T07 A;  1IXM A;  4H33 A;  4FLV A;  3OD4 A;  3KCX A;  3K0G A;  5KUM A;  3K08 A;  2HJF C;  3HKD B;  2LP7 A;  3FB7 C;  1YDX A;  3OTO O;  1SQX H;  1MSW D;  4PA3 A;  1WP8 A;  2Y69 C;  3ZHR A;  2X6B A;  2YXH A;  5L3E A;  3B09 A;  4JI8 B;  3JCZ A;  2E76 B;  5LP6 C;  3KHD A;  3X2Q C;  3BA8 A;  3D36 A;  3S3W A;  2WLL A;  3OW2 U;  5JVD A;  4CC5 A;  3QV7 A;  1FFT B;  2WA3 A;  4B3S B;  1NS1 A;  1FXK B;  3NXS A;  3KZI Z;  5B1A C;  4J10 A;  2XND G;  4BIZ A;  1FXK C;  1Z5W A;  1VEW A;  5B1A B;  4X65 B;  4I50 A;  2E75 B;  4FPP A;  3RYI A;  2WWW A;  2P7T C;  3IC7 A;  1M5I A;  2P06 A;  2WA4 A;  2R70 A;  2QKC A;  2IH1 C;  3GWK C;  4DUZ B;  4B3M B;  1XRE A;  2F4V B;  2ADQ B;  1OHH G;  4J11 A;  4TUY A;  3IS4 A;  4I7Z B;  5LHI A;  2JEX A;  1YCI A;  4O2B B;  3J7A U;  1XL6 A;  1T57 A;  1VQM V;  2V4D A;  1O9H A;  4WBN A;  1P84 F;  3C90 A;  3H1K H;  1Y74 A;  4LF5 O;  3EFF K;  2CTW A;  2NN4 A;  3MD0 A;  4GT1 A;  5LOV B;  1FFX B;  3LDC A;  4NYK A;  1S72 V;  5C8Y B;  3ZRV A;  4DV2 O;  1JFF B;  1H2S B;  2DQ3 A;  2Q8V A;  1HNX B;  1NT2 B;  3ABL B;  4IYI A;  2WAM A;  4ZBM A;  5LMN O;  4LFA B;  3OGI B;  4KXR A;  3QF7 A;  4DV7 B;  2ZE6 A;  1ZLZ A;  1B3Q A;  2IH3 C;  4LF4 O;  4A5U B;  5L3B A;  3T1C A;  4E2L A;  2XAS A;  5JH7 B;  4X9Q A;  4LF7 O;  1I5X A;  1Y66 A;  1K4D C;  3CRR A;  3I5D A;  2YDE A;  5KMG A;  1A3X A;  4JI6 B;  2AGA A;  5ITZ B;  2RCV A;  3OR6 C;  4X1Y A;  4WF9 V;  4O4H A;  1F23 A;  3EOE A;  2KG7 B;  2JGD A;  1RSO B;  5LGT A;  2HKO A;  5IWA O;  5LMU O;  2ZIM A;  4KL1 A;  2QR4 A;  3DC6 A;  3CC4 V;  2WSS G;  3Q4H A;  1WA8 B;  2UUC O;  2ZT9 B;  2UXD O;  1K4C C;  1XBL A;  5H6Q A;  1NTK H;  3N25 A;  2Q67 A;  4DR5 O;  5LGU A;  2P90 A;  3W7T A;  1R6N A;  3KKY A;  2OCC C;  1QR8 A;  1M57 C;  5BMV A;  4FJC C;  3K3W A;  1K97 A;  1MMM A;  2QTO A;  1PPJ H;  4CBC A;  1JA8 A;  1LUV A;  3F7V C;  3SYA A;  2FB5 A;  4BWA A;  4QPK A;  1COW G;  1TUB B;  2A79 B;  2RDC A;  1FPO A;  3JAW A;  1N33 B;  3OM3 B;  3VQY A;  3G67 A;  1B06 A;  1HDJ A;  1Y6X A;  2CUG A;  3UO2 A;  4FLX A;  2XAH A;  2PYJ A;  4TV8 B;  3QTG A;  4NXN O;  2Z0A A;  1YJN V;  5B5E Z;  4B08 A;  4O4I A;  3OMI B;  2ZR2 A;  2JIZ G;  1URF A;  1ENV A;  1SS3 A;  2AXT Z;  4GX1 A;  2OCH A;  2YI9 A;  1R3L C;  4EB6 A;  4FFK A;  4HNA B;  4LCU C;  1YIT V;  1LR1 A;  1AJP A;  2ZNJ A;  4FLY A;  3T2M A;  4YNG A;  2YXL A;  1S0V A;  2OT5 A;  1CPY A;  2AZ2 A;  4UVB A;  3JD2 A;  3G6E V;  3RW0 A;  4N23 A;  1BQ0 A;  1XNR B;  4I0X A;  1VF6 A;  1VQ8 V;  2A7W A;  1PKX A;  1E1R G;  2B5U A;  1A32 A;  4JI6 O;  4FLU A;  4KRZ A;  4QJF B;  2DYS B;  4JAA A;  5IT9 N;  1VQ5 V;  5JCO A;  3MAQ A;  1R3I C;  3CCM V;  1PV0 A;  4KUM A;  2YUA A;  2CAZ C;  1F4M A;  3H1L H;  3SRD A;  1ZL8 B;  4GX2 A;  1EN4 A;  2QSA A;  4JI5 B;  1NZ6 A;  5LBQ A;  2GBO A;  5CA1 B;  1TVK A;  3BCC H;  1VAR A;  2R9A A;  4JZG A;  4DV6 O;  2GUZ A;  4F6R A;  5B3S B;  2DE0 X;  3JD4 A;  3I56 V;  4DR2 B;  1WJZ A;  1OZ0 A;  5EYP A;  4MVO A;  3JSN A;  4NKG B;  3ZN0 A;  4I9W A;  3N2G B;  5IJ9 A;  1AR4 A;  1FKA O;  1IVS A;  3E22 B;  1K33 A;  4X62 B;  5GON A;  1J95 A;  4FFB B;  1PD3 A;  4WFB V;  1NVP D;  4NXN B;  3DC5 A;  5J2U B;  2A06 H;  4TWK A;  1XI1 A;  1M90 W;  2EIL B;  3F5T A;  4QG9 A;  2XAQ A;  1M56 B;  3ETE A;  3E8G A;  1N4C A;  4X1K B;  2EJ7 A;  3T1H O;  3FKS G;  1NBM G;  1LUW A;  4DUY B;  1RP3 B;  4AI8 A;  2GHY A;  2VRZ A;  4GZR B;  2F66 C;  1V9P A;  1R73 A;  4DV5 O;  1OCC C;  2YEV B;  5IDJ A;  3QVN A;  3LDE A;  4KCW A;  2Q0A A;  1VQ6 V;  4B3R O;  3THO A;  1AP6 A;  3KG2 A;  4P2Z A;  2YXY A;  3HQP A;  2VQF B;  3CD6 V;  2W6I G;  4DV4 O;  2CTP A;  4WFG A;  3BJT A;  2H3O A;  1BE3 H;  3ZS8 C;  4G28 B;  5KA6 A;  4GKK O;  4U7N A;  4IIJ A;  3ZHU A;  3P3P A;  2QKS A;  4PV1 B;  2RQ6 A;  4J41 A;  4DYL A;  3HKE B;  4DK1 A;  4JF3 A;  2GV9 A;  2WLM A;  3B8N A;  5C93 A;  4DV1 O;  3LSQ A;  3RGB A;  3VBB A;  3ABU A;  1YZB A;  4L87 A;  4UXN A;  2QWN B;  3CSX A;  5LHH A;  4UV8 A;  4TT3 G;  4JI1 O;  3P3N A;  3ZRX A;  2BTO A;  1J5E O;  2BSK B;  2DYR C;  4O4L B;  2LW7 A;  2Y69 B;  1W0K G;  3OT7 A;  4C7U A;  4WFF A;  3D3I A;  2YIB A;  4LNU A;  3CRQ A;  5LP6 B;  1S76 D;  2EX3 A;  5B1O A;  5B1B B;  2G38 A;  3AG7 A;  1HNZ O;  1MSD A;  4MVQ A;  1NQT A;  4DO2 A;  1HNW B;  3N2K A;  1PNL A;  3JAS A;  3M7M X;  2ZR3 A;  2E28 A;  3HQO A;  2LJ2 A;  4PD4 F;  2ZKO A;  4GX0 A;  3JAL B;  4FMT A;  2OTJ V;  2VGF A;  3L70 H;  2WPD G;  2EBO A;  1S5L Z;  2ZE8 A;  1VF6 C;  3WG7 C;  2ZNI A;  1PNM A;  2IJK A;  4YIP A;  2QE7 G;  3CRM A;  4BAY A;  2DJV A;  2CGN A;  3CCJ V;  3S3X A;  1U96 A;  4LF6 O;  4J7K A;  4HYW A;  4CZZ A;  3CMA V;  4JV5 O;  4DR4 O;  2ATK C;  5DM6 V;  4DV0 B;  4JI8 O;  4IHJ A;  1R3K C;  4LC1 A;  4TOI A;  4RO2 A;  4JYA B;  3JAK B;  2OIE A;  2DMX A;  2GDS A;  5CBG A;  4J7J A;  4DUZ O;  2LQT A;  3OE7 G;  3ZMZ A;  1TUE B;  2PUS A;  4K8Z A;  2JGU A;  1N32 B;  1MZE A;  3LSU A;  1J5E B;  2K9P A;  3O9O A;  4JAV A;  5GTI Z;  3AK2 A;  1GM8 A;  1OJH A;  3B77 A;  2Q0O C;  3E83 A;  2HLD G;  1OCZ C;  4LF8 B;  4LWS B;  2IW5 A;  2YIC A;  4UCR A;  3BJF A;  2P67 A;  1Q90 D;  4P9P A;  2IU3 A;  1AI6 A;  3J81 N;  4NR1 A;  4O2B A;  3E86 A;  1CXZ B;  3RYF B;  2PZS A;  4AHC A;  1N0N A;  3T0T A;  3BEH A;  2N05 A;  3OEH G;  3W7U A;  3AG2 C;  3JAR A;  3UM7 A;  3CCQ V;  2FTK A;  1LNQ A;  4I9Q A;  1SF9 A;  3X2Q B;  3SRK A;  5LOV A;  1N32 O;  3N27 A;  3JAT B;  3L71 H;  2ARH A;  2D3O W;  4X64 B;  1NH2 D;  4X89 A;  4PHZ A;  3UKM A;  4JPG A;  2XT9 A;  2UXC O;  4D6T H;  1YJ9 V;  2Q68 A;  3RVZ A;  2LGQ A;  4K0K B;  1N34 O;  4N21 A;  4NTW A;  4DV2 B;  4FLW A;  1RPO A;  4UFZ A;  4PDM A;  2W0X A;  4CS4 A;  3EHB B;  2QEX V;  4GKK B;  4YIO A;  3EXA A;  3L73 H;  1YTF D;  5JQG B;  1JJO A;  3K5M A;  1SQG A;  1SZT A;  3CRC A;  4JYA O;  4DR7 B;  2F23 A;  5B1N A;  1YSC A;  5FNV B;  4BIO A;  1KYO F;  1TGO A;  4JI1 B;  3T1Y B;  3K5L A;  5IWA B;  1I94 O;  3OR7 C;  3CCR V;  4K0K O;  1IZ3 A;  1VQ9 V;  5LA6 B;  3RBZ A;  2OWO A;  1VQN V;  1H38 A;  1SQF A;  1I0H A;  4DRX A;  2X0L A;  1BS3 A;  5CBF A;  4LH6 A;  3JSL A;  1FAF A;  2KKW A;  1WA8 A;  2H94 A;  3T1H B;  1HR0 B;  4BIU A;  4FM0 A;  1QVF U;  1VP8 A;  1AQF A;  3K57 A;  2XOK G;  4JYC A;  4DV5 B;  3K9S A;  5FLX N;  1VQ7 V;  1N33 O;  4ASU G;  2JDI G;  4JYY A;  3ZN1 A;  3CCS V;  4DV3 O;  1Y76 B;  3STZ C;  2VGI A;  5DED A;  4ZOL B;  1UFI A;  4U3J A;  4QGC A;  1EN6 A;  5IE9 A;  2YIA A;  1S5H C;  3I55 V;  4G2K A;  2P6J A;  1THZ A;  2EIN C;  5J9P C;  2EJR A;  1IBL B;  3UT5 B;  2X7R B;  4DV1 B;  4RQE A;  2BTQ B;  5IYZ B;  2FKX A;  4LFB O;  3BY6 A;  2UUA O;  3R66 A;  2ZXW B;  3PJS K;  2ODM A;  2E5L B;  4TQD A;  2K1E A;  1M4U A;  1SA0 A;  1NI8 A;  3H9V A;  1XEQ A;  2DWE C;  3HKC B;  3RT3 C;  4NB5 A;  1Q7Y W;  2B1I A;  4MT8 A;  1GN2 A;  4JI2 O;  4G1N A;  4I0X B;  2DW4 A;  4HBN A;  5JJJ B;  2ZIN A;  5BXZ A;  4D7S A;  1QLE C;  3E0W A;  2HVK C;  1OCO C;  5EC2 C;  3D3Q A;  2HVJ C;  1R1B A;  3GG8 A;  3HKD A;  4Z2W A;  3SYC A;  5EIB D;  5KX5 A;  1L1F A;  1E79 G;  1IBM O;  2AW9 A;  5CMU A;  1JOY A;  3CJH A;  4KS0 A;  2YC0 A;  1F3W A;  1TVK B;  4B3S O;  2JJ2 G;  1EZV H;  5D5P A;  4ZHQ B;  2PI4 A;  2EIJ B;  3ZX6 A;  1QQC A;  1FXV A;  3AK3 A;  5BY1 A;  1V54 C;  5BR8 B;  2GUZ B;  3FB6 C;  5FPR A;  2PI5 A;  1NU1 H;  2WLL B;  4FM1 A;  2PF4 E;  5EYP B;  1FJG O;  4JTD B;  1EM1 A;  1QNM A;  4LF8 O;  5IJ0 A;  5JWP A;  3ZRW A;  2RN9 A;  4GUN A;  1R6T A;  4FFB A;  5J2U A;  1MG1 A;  1OCC B;  2YIB D;  3AG3 C;  4Q20 A;  1NH2 B;  1HW7 A;  5KAI Z;  5JJN B;  1IBK B;  5BZB A;  2VS0 A;  1QHT A;  4NTX A;  5CA0 B;  2VQF O;  2DN9 A;  1VQK V;  3U11 A;  4QPJ A;  4ZI7 B;  3QTC A;  3AG1 C;  1X59 A;  5HFM A;  3T4D A;  4B3R B;  3U2Z A;  1AI5 A;  5EK0 A;  1OV9 A;  2OYQ A;  5EZY A;  3WB0 A;  3ZMT A;  1BGY H;  2ZM6 B;  4YJ3 B;  3AG1 B;  3K04 A;  3CCV V;  3MHH C;  3AEI A;  3CX5 F;  4GLX A;  4DXW A;  2UXB B;  1ZX3 A;  1G1X B;  2UUA B;  1K34 A;  2P4K A;  3ZIA G;  2OIG A;  3LNN A;  4YXW G;  5KHH A;  4UCU A;  1AJQ A;  2ADP A;  2UUB O;  4IIJ B;  1M1K W;  2R9R B;  4FLT A;  5B3S C;  1VF7 A;  2Y4T A;  1NKD A;  5C8Y A;  2Y4U A;  3AAG A;  5A2Q N;  1UJW B;  2Q6A A;  1JFF A;  2CH7 A;  1PP9 H;  1WLE A;  1XL4 A;  2OTL V;  1HWY A;  1QCE A;  2EIK B;  2MK3 A;  2BSK A;  4O4L A;  3QV9 A;  3DSQ A;  4MVR A;  3JD3 A;  2B1G A;  4LF7 B;  4CH6 A;  2IJH A;  2KQX A;  1AI7 A;  2XHB A;  4IL6 Z;  1Q82 W;  5EBW C;  2LW1 A;  3ASN B;  1YXB A;  5BR8 O;  3A8T A;  4DW0 A;  3CME V;  4YY3 B;  3IJ4 A;  3ABT A;  4WFA V;  4AQY B;  4DR2 O;  3ASN C;  3N2K B;  3K59 A;  4U7O A;  1IX9 A;  1V55 B;  1ORQ C;  2Y0I A;  4GX5 A;  4IT5 A;  4MVM A;  4DW1 A;  1JR9 A;  5ITZ A;  2P5O A;  4HAM A;  1CP9 A;  4OX9 B;  5JJE B;  2KG7 A;  1DF5 A;  4GKJ O;  3RWR D;  1S5J A;  5LYJ B;  4X20 B;  3SPI A;  1BT8 A;  1GN4 A;  3TK1 A;  1KEC A;  3ZED A;  1F51 A;  4XDJ A;  4EEQ A;  3AK1 A;  5LL6 Y;  2JVD A;  4DR5 B;  4PDV A;  4NXM O;  4HZ3 A;  2QKA A;  1F4N A;  2WLK A;  2N04 A;  1K7D A;  2F1M A;  3BPZ A; 
#chains in the Genus database with same CATH homology
 4UUJ C;  2W0F C;  3WG7 C;  2LP7 A;  3FB7 C;  3LSS A;  1PNM A;  4LBE C;  2IJK A;  1GKF A;  1YJW V;  2QE7 G;  1B6Q A;  4MTG A;  1MSW D;  4PA3 A;  4BAY A;  2Y69 C;  3ZJZ A;  4P30 A;  3CCJ V;  2X6B A;  4KFM A;  5L3E A;  1V55 C;  3JCZ A;  4JAS A;  4CZZ A;  5IYB O;  3CMA V;  3OUF A;  2ATK C;  3AG2 B;  5DM6 V;  1EFR G;  3X2Q C;  1QLN A;  1R3K C;  3D36 A;  4LC1 A;  3QO8 A;  4RO2 A;  4P9O A;  4XDL A;  4MVS A;  5CN0 A;  5CBG A;  4MTO A;  4WFE A;  2WLL A;  3OE7 G;  3OW2 U;  4MW3 A;  3ZMZ A;  1FFT B;  2GSM B;  1TUE B;  5HFL A;  1M9N A;  4QE9 A;  1JCH A;  3ASO B;  5E1A C;  1FXK B;  3NXS A;  2IJJ A;  2WLI A;  4JAV A;  5LGN A;  3TCU A;  4PDL A;  3ETG A;  1GM8 A;  5B1A C;  3B77 A;  4R50 A;  3E83 A;  2HLD G;  2XND G;  1OCZ C;  4BIZ A;  2IW5 A;  1FXK C;  1CEZ A;  1K3E A;  4G27 B;  2P67 A;  4XDK A;  5B1A B;  1ROP A;  2IU3 A;  1AI6 A;  4P9P A;  3E86 A;  4FPP A;  2WWW A;  2P7T C;  3E8F A;  1FXK A;  1OCZ B;  4MTF A;  4UVC A;  3IC7 A;  2V1D A;  2WLI B;  1FS0 G;  5CA3 A;  2IH1 C;  3BEH A;  5IY5 B;  2DQ0 A;  3SYO A;  4H37 A;  3TET A;  1KC8 W;  3OEH G;  1AJN A;  3AG2 C;  3W7U A;  3UM7 A;  3CCQ V;  2FTK A;  1LNQ A;  3P32 A;  3CXC U;  3X2Q B;  4J9Y B;  4MSW C;  1AI4 A;  1K73 W;  1OHH G;  1WPX A;  4MVU A;  2EIM C;  3RVY A;  4R7C A;  2D3O W;  1BMF G;  2X6C A;  5LHI A;  1NH2 D;  2JEX A;  1PL0 A;  3QNE A;  4X89 A;  2QM7 A;  3UKM A;  2IU0 A;  1XL6 A;  1S3J A;  1YJ9 V;  1VQM V;  1NR1 A;  2EIM B;  2Q68 A;  3RVZ A;  1QBZ A;  4N21 A;  3DTU B;  2XAJ A;  3JD1 A;  2AHY A;  3EFF K;  3HB3 B;  1RPO A;  3MD0 A;  4GT1 A;  3CCE V;  4PDM A;  3LDC A;  3EHB B;  4BW5 A;  1S72 V;  2QEX V;  4PEL A;  1OCR C;  3SPC A;  1Y4M A;  3ZRV A;  2ITC C;  1GO3 F;  1YTF D;  4J9Z B;  1YHQ V;  1PNK A;  2DQ3 A;  1GM9 A;  1BHA A;  1SZT A;  3LNM B;  3ABL B;  5B1N A;  1YSC A;  2WAM A;  4ZBM A;  1H8H G;  5GW7 A;  2ZDI A;  1E1Q G;  5IY5 C;  1Q81 W;  4QIW F;  2EZO A;  4FIP C;  3ABL C;  3OR7 C;  3CCR V;  5KUK A;  2ZDI C;  1VQ9 V;  4PA9 A;  4FK5 C;  3SPG A;  1VQL V;  1K9M W;  3K0D A;  1SER A;  2IH3 C;  3CP1 A;  3RBZ A;  4UVA A;  4R6Z A;  1VQN V;  3QO7 A;  1H38 A;  5L3B A;  3T1C A;  4E2L A;  2XAS A;  2X0L A;  5CBF A;  1I5X A;  2M7W A;  1Y66 A;  1K4D C;  2UXX A;  2A0L A;  2H94 A;  1AR1 B;  3W7W A;  2ZXW C;  3OR6 C;  4JTA B;  4Z1M G;  3F7Y C;  4WF9 V;  1F23 A;  4BIU A;  1QVF U;  1OCR B;  1GTO A;  3ABM B;  1S77 D;  3IFX A;  5LGT A;  3E89 A;  4QE7 A;  2HKO A;  2XOK G;  1R3J C;  4JYC A;  1VQ7 V;  3CC2 V;  5L3D A;  1I5Y A;  2AHZ A;  3JD0 A;  4RAI A;  4ASU G;  4JGS A;  2JDI G;  1DTO A;  4JAU A;  3CC4 V;  2WSS G;  4MVZ A;  3ZN1 A;  3CCS V;  2Y48 A;  2JK5 C;  4KP4 A;  3STZ C;  1K4C C;  3W7S A;  1VQO V;  2EIN B;  1SES A;  3G4S V;  5H6Q A;  3K06 A;  3P30 A;  2Q67 A;  5LGU A;  2P90 A;  3W7T A;  1R6N A;  1S5H C;  2OCC C;  1QR8 A;  2QM8 A;  1M57 C;  2P6J A;  4G2K A;  1THZ A;  3I55 V;  4FJC C;  1MOF A;  2EIN C;  3K3W A;  3W7X A;  3OUS A;  3OMN B;  1K97 A;  2QTO A;  4CBC A;  5J9P C;  1JX9 A;  2EJR A;  2X7R B;  3T4Z A;  3ZMV A;  3F7V C;  3SYA A;  4RQE A;  4QPK A;  1COW G;  3BY6 A;  4F4L A;  5IYD O;  1M57 B;  2A79 B;  3JYC A;  2ZXW B;  3OM3 B;  3PJS K;  1NJI W;  2K1E A;  1V54 B;  2JEU A;  3ABM C;  2WLH A;  3ZMU A;  2XAH A;  2V7Q G;  2DWE C;  5KA5 A;  1RPR A;  1KP3 A;  1Q7Y W;  2B1I A;  1YJN V;  3VOU A;  2HG5 C;  4MT8 A;  1K92 A;  1SRY A;  2WLJ A;  5FL7 G;  1OCO B;  5L3G A;  3OMI B;  3FYE B;  2ZR2 A;  2DW4 A;  1JPX A;  2JIZ G;  4GCZ A;  1ENV A;  4PA6 A;  4RUE A;  4GX1 A;  4JYB A;  1YTF B;  1R3L C;  1K5Q A;  1QLE C;  4LCU C;  1YIT V;  2HVK C;  1OCO C;  4MS2 A;  1AJP A;  5EC2 C;  2HVJ C;  3T2M A;  3M99 B;  3SPJ A;  2OCC B;  3SYC A;  1L1F A;  3ABK C;  1S0V A;  1YI2 V;  1E79 G;  1K8A W;  4JTC B;  2OT5 A;  1CPY A;  4JPR A;  4UVB A;  3JD2 A;  3G6E V;  3RW0 A;  4N23 A;  5CMU A;  1G8M A;  2X6A A;  2DYS C;  3SPH A;  2WLN A;  1JOY A;  5L3C A;  1VQ8 V;  1PKX A;  2JJ2 G;  1E1R G;  3ZRW B;  2PI4 A;  2B5U A;  2EIJ B;  1GMG A;  1W0J G;  4RQF A;  1JVM A;  1DLB A;  1FXV A;  1V54 C;  4ZKI A;  4OXS A;  3FB6 C;  3B8M A;  3K79 A;  4QJF B;  2DYS B;  1KP2 A;  3ETD A;  3G71 V;  2PI5 A;  1EBO A;  1VQ5 V;  2WLL B;  1R3I C;  1R6K A;  4WFH A;  4KUM A;  3CCM V;  2EIJ C;  2JJ1 G;  1F4M A;  4JTD B;  4GX2 A;  3AG3 B;  2NLJ C;  1QR9 A;  2XAG A;  1ZWI C;  2DWD C;  5LBQ A;  1NR7 A;  2YSU B;  3ZRW A;  1G4Y B;  1BHB A;  1KKD A;  1NVP B;  1RM1 C;  3CCU V;  1MG1 A;  1OCC B;  3AG3 C;  4Q20 A;  3ZCC A;  2H8P C;  5B3S B;  3JD4 A;  3I56 V;  1NH2 B;  3K03 A;  1QLE B;  1VQ4 V;  5IYC O;  5BZB A;  1OZ0 A;  1YIJ V;  2UXN A;  2LFS A;  4MVO A;  3CPW U;  3ZN0 A;  3ABK B;  1VQK V;  4I9W A;  4QPJ A;  4TSF G;  3AG1 C;  1K33 A;  5HFM A;  3T4D A;  1AI5 A;  5EK0 A;  1J95 A;  1Q86 W;  3FB5 C;  3E35 A;  1M56 C;  1PD3 A;  4WFB V;  1NVP D;  4PA4 A;  4R8C A;  5LHG A;  4TWK A;  1K5S A;  3GB7 C;  3ZMT A;  5H9C A;  2NNU A;  3QO5 A;  1M90 W;  3AG1 B;  2EIL B;  3R65 A;  3K04 A;  3CCV V;  2KB1 A;  3MHH C;  3AEI A;  2XAQ A;  1M56 B;  3ETE A;  3E8G A;  4DXW A;  3FKS G;  1NBM G;  2ZQM A;  5CBH A;  1K34 A;  2HFE C;  2DYR B;  3MHS C;  2Z5U A;  3ZIA G;  4YXW G;  2BOC C;  4XBF A;  1P7B A;  3IGA C;  3ML0 A;  2GHY A;  1KQS U;  1AJQ A;  4PDR A;  5DN6 G;  3STL C;  3H01 A;  1M1K W;  2R9R B;  2F43 G;  1R73 A;  1RM1 B;  1OCC C;  5B3S C;  2R9I A;  2YEV B;  3FB8 C;  1NKD A;  5IDJ A;  3AAG A;  2CK3 G;  3LDE A;  1H8E G;  1UJW B;  1VQ6 V;  5EC1 C;  3OGC C;  1SET A;  2Q6A A;  3KG2 A;  3ZMS A;  4P2Z A;  1VQP V;  1WLE A;  1XL4 A;  1N8R W;  5H6R A;  3K9A A;  3CD6 V;  2OTL V;  1HWY A;  1QCE A;  3SYP A;  2W6I G;  1JJ2 U;  2EIK B;  2MK3 A;  2Z3Y A;  4WFG A;  1KD1 W;  4MTX A;  4UV9 A;  4X88 A;  4G28 B;  2A9H A;  4MVR A;  5KA6 A;  4U7N A;  3JD3 A;  2B1G A;  2QKS A;  2XAF A;  1DF4 A;  3E8B A;  1H2G A;  2YEV A;  2IJH A;  3OMA B;  3LUT B;  2WLM A;  2EIK C;  1AI7 A;  1MAB G;  4JF3 A;  4EKW A;  1BL8 A;  1GK9 A;  3AG4 B;  3B8N A;  5EBW C;  2LFR A;  5C93 A;  2EIL C;  1Q82 W;  3ASN B;  3LSQ A;  3E2E A;  3F5W C;  3VBB A;  2BOB C;  3ABU A;  5EBL C;  2W6J G;  4L87 A;  4UXN A;  3CME V;  2QA4 V;  4RUF A;  3WG7 B;  5LHH A;  4HYO A;  4TT3 G;  4UV8 A;  3SJQ C;  3ZRX A;  3ABT A;  4WFA V;  2DYR C;  3AG4 C;  3ZRS A;  4QNH B;  3ASN C;  2Y69 B;  4U7O A;  1W0K G;  3GWO A;  1FXH A;  3OAA G;  3OFN G;  4WFF A;  1V55 B;  3D3I A;  4PA7 A;  1ORQ C;  4GX5 A;  4MVM A;  1W2B U;  1GM7 A;  3CCL V;  4HAM A;  1CP9 A;  1QVG U;  1S76 D;  1DF5 A;  5B1O A;  5B1B B;  1ARO P;  2Q69 A;  3SPI A;  3SYQ A;  5L3F A;  3TK1 A;  3WFV A;  1KEC A;  1F51 A;  4LP8 A;  4X8A A;  4XDJ A;  4MVQ A;  1NQT A;  2ITD C;  4DO2 A;  3HPL C;  3A0R A;  2ZD9 A;  1EZJ A;  1PNL A;  2EZP A;  5B1B C;  4MW8 A;  2ZR3 A;  4PDV A;  3LDD A;  3FYI B;  3ASO C;  4HZ3 A;  1P4R A;  3CYO A;  3OEE G;  1JQ0 A;  4GX0 A;  2IJI A;  5EBM C;  4FMT A;  2C2A A;  4WCE V;  4I5S A;  2OTJ V;  1F4N A;  1IXM A;  2WLK A;  2HR3 A;  3E8H A;  4H33 A;  1K7D A;  2WPD G;  5KUM A;  3DGE A;  3K0G A;  3K08 A;  3CC7 V;  2HJF C;  2EBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...