5DNCA

Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t19a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
354
structure length
354
Chain Sequence
b'ERHLLLIYTGGALGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
molecule tags Hydrolase
source organism Cavia porcellus
publication title Experimental Data in Support of a Direct Displacement Mechanism for Type I/II l-Asparaginases.
pubmed doi rcsb
total genus 117
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dncA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 5dncA01
1NNSA 2HLNA 1JJAA 1ZQ1A 1ZCFA 3NXKA 1JSRA 2WLTA 1HG0A 1HFJA 1DJPA 3NTXA 1DJOA 1AGXA 2P2NA 4R8KA 5I3ZA 4NJEB 2WT4A 5K3OA 1HFWA 4PGAA 4RA9A 5K45A 5I4BA 5K4GA 1IHDA 1HG1A 5DNEA 5DNCA 1JSLA 5CBPA 1WSAA 2JK0A 2HIMA 4RA6A 2OCDA 3PGA1 4RA6B 1O7JA 5CBPB 4Q0MA 1HO3A 1WNFA 3ECAA 2D6FA 5I48A 4ECAA 1HFKA 1WLSA 4RA9B 5DNDA 5F52A 4R8LA 5HW0A 1JAZA 5K4HA 4NJEA 2GVNA 2P2DA
chains in the Genus database with same CATH superfamily
3IS3A 1RQLA 3W3AA 4Y6LA 5FHRA 2V9CA 4C7KA 3EC7A 2V74B 4DRZA 2Q29A 3DBRA 5HMLA 1T3TA 2ZIZA 3VR4D 5KYGA 3TEFA 4L5CA 1I9GA 2VIIA 3GDOA 4B76A 2V0GA 2Q1TA 4TL9A 3S68A 1T4DA 1SCUB 3QFSA 4CM5A 1CY7A 5BORA 3KPVA 4D8TA 3K6SA 3PC2A 5FPQA 1YGYA 3U61B 2AI1A 1TF7A 3GGOA 4PZZA 2WJZB 3WZ2A 3NBUA 3Q41A 1U4NA 1A9YA 4CM8B 3DZGA 4KAAA 4NZ9A 3NATA 1MHTA 2EEZA 4MRRA 2IYSA 2OV8A 2W4IA 4Q05A 4EYSA 1R15A 3O9VA 1PWXA 2Q4RA 1SULA 5JFTA 1GNLA 4LJAA 1U1GA 4US1R 1RKUA 2I1QA 3HBLA 1GTRA 1U0EA 2DQ4A 4XD7A 3FOAA 1FFXA 2DLCX 1NXTA 1SHJA 4NZOA 2JFGA 2P35A 2I9PA 4LRYA 2QWXA 4RU1A 4UU1A 2QRJA 3TTVA 1IHPA 5I4BA 1US8B 1EMDA 2PGNA 3TDNA 1PKXA 3WS7A 1XEWX 1X1SA 1MU0A 1JU9A 4D99A 5B4UA 3OTWA 4S0ZA 1FFWA 2QQGA 3JVVA 4OLJA 1L5KA 1ZMOA 1CY4A 1SKAA 1SY7A 3SSNA 2RGDA 4FQ7A 4KRGA 4LYAA 1ENPA 2Z6QA 3Q40A 4O02B 4D26A 3HJGA 1SXPA 4BGEA 4QO8A 4QYIB 4XYLA 1DE0A 5C80A 3D0OA 1YKFA 4RE5A 3BFXA 2WTEA 1H42A 3HCNA 5AUQA 4MI1A 5I7UA 5TE9A 1QVWA 3EQ7A 3H11B 1S2NA 1N5JA 1YI8A 3ZXIA 1WBDA 3HA3A 2GHQA 2V8OA 4CBVA 3CN7A 1LRKA 2FN8A 2IPAB 1XRRA 1Y1KE 2QLMA 3PX2A 4MGHA 2OPHA 2MJLA 1WU8A 3ETNA 2CCKA 2QUAA 1D7AA 4ZT4A 4KITB 3EIQA 4P86A 2QBYB 3F8SA 2PE5A 2XB9A 3TM4A 3SPXA 3C70A 3EQ8A 3REGA 3P96A 2FPIA 5K8IA 2PJRA 1FUEA 2RHBA 4LZJA 1TPZA 2JLVA 1PSWA 1MVOA 2TYSB 1ADCA 3HDVA 5HEKA 4WOKA 1IHUA 5E3HA 4BNDB 3RVOA 1C3EA 2X0EA 5DW3A 3AKYA 4BKQA 1GV0A 5DWVA 3Q0IA 4M9SA 4CIXA 2QPTA 3BKXA 3UH0A 2AZDA 4GOXA 3WO1A 2IFTA 5IK2A 1JDTA 1HG0A 1VXOA 3FDZA 4PQEA 4Q34A 3COSA 3FKSA 1ZITA 1I0LA 2CZCA 2CVPA 1XD8A 2R00C 4QDTA 2PWBA 5REQA 5FOWA 4BBZA 2Q45A 3D3EA 3KK0A 5FIUA 4B75A 5DHRA 4Q9IA 1XA4A 1O4WA 1KSJA 3HCWA 2XMCA 1XXLA 4QYMA 3RFCA 2H3EA 1S3GA 3LWBA 3H5NA 5CB4A 3T61A 1K3TA 2NXJA 1TQHA 4DUYB 3T7RA 5IHPA 2XECA 3LCRA 1EM6A 5JSZB 2FW6A 1US8A 1KK1A 2QP4A 2QX4A 1NFRA 4V3BA 3PJDA 3ZWOA 1T8WA 3FM9A 4C4AA 1ZONA 3L1UA 3SWWA 5J2UA 1E3MA 2GN6A 5AVVA 1E61A 2QTVB 2IVZA 1BHQ1 2DPHA 1VPWA 2IT1A 3TECE 3IEKA 2YQZA 5IS2A 4QLBA 1YR6A 2WU4A 2ERCA 2ETVA 5JLAA 1JT9A 4Y3UA 3UHOA 4B3XA 4C7MA 1XALA 2GXSA 3H2KA 2XRMA 3KV3O 4JVOA 4X95A 2YCBA 1YD7A 1U8FO 5GGYA 4BUZA 3VO9A 5MDHA 5IM4F 3HR7A 2BHTA 4XUGB 1MTOA 3WGZA 4ZRNA 1EG7A 4AL4A 4D4IA 4DNQA 4LSMA 3L82B 2D5IA 4PZDA 3SZLA 4RQUA 1B6RA 2SKCA 3KE8A 5JSYA 3GZ4A 3TS1A 2CXNA 3MS2A 4ZV9A 4HATA 2WM2A 4QOEA 2OVBA 4CKEB 3GP5A 2FR8C 2FLVA 5L45A 1SCBA 2VJNA 4JQCA 1EXWA 3D59A 4FXPA 3OA2A 2L19A 3UCXA 1XQ6A 1QTIA 4X65B 1VMIA 3UMCA 4DEVA 2NVUB 1Y5LA 2H29A 1YZUA 1QHYA 4KYVA 1GGJA 3K9NA 2O7QA 4FMCF 4I55A 4D79A 1GGFA 4NABA 1W6RA 4INAA 2QNBA 3DMGA 5BV7A 2MSEB 5AVRA 4XWGA 4KO8A 2E4YA 3D9QX 2IV3A 1OT3A 4WBNF 4K6KA 3QI7A 2BGKA 1PVVA 1NW8A 4NYMR 4RETA 1N36B 3MJEA 2VHZA 2PFKA 4P53A 4YRFA 5A2QA 1CR0A 2VZEA 4FOSA 3HKEB 1E2IA 4QFCA 3MRTA 2GO7A 2IIQA 4Z49A 1M83A 4I9GA 4WNCA 1JIIA 4N6NA 4P33A 1BQ3A 3GOQA 2B6HA 3HM2A 4MUFA 8ABPA 1X8JA 1SXJC 4XH9B 4LZWA 4OQZA 3WLNA 3UJ9A 5FLYA 1Q95A 4MP3A 4YDSA 5AXAA 3UN1A 3ZLTA 1EUQA 5DI3A 1P5RA 1LS6A 3KQKA 4FYIA 4NFSA 2H65A 4XX0B 3CUVA 4WKCA 1QO0D 4CWAA 2VUHB 2MCFA 5IXYA 3K72B 3LP6A 4KMMA 1QP0A 1O0SA 2RARA 1BQ4A 1XCBA 3G1UA 1JPUA 3CX7A 3LA6A 4HUQA 4Q18A 3BD7A 3ITKA 4GXTA 5C5IA 3P9KA 5CNJA 2V96A 1E3DA 5EEHA 3BCHA 4D0NA 1KDTA 1UJ5A 4PO3X 3B8EA 1EGAA 1N1DA 1P3JA 1UINA 2FH5B 3JAWB 4TROA 5BMVA 1S9DA 2H54A 1ZUHA 2D2FA 5KPDA 5JH7A 2WZCA 4DANA 1Z4IA 3CISA 4EJ0A 2HWKA 1WKBA 1NXXA 4H1VA 5KJ1A 5REQB 3I6IA 4HD8A 3M6AA 1AK2A 2YV4A 1DUSA 1KERA 4H15A 2P5SA 1ES9A 1EDZA 4S1WA 3TB4A 2CFRA 3X3HA 1AG9A 1VYUA 1W1WA 2EKPA 3MMNA 1HQDA 1IY8A 2VA9A 4NICA 2GEJA 4E7PA 3S2SA 5AO9A 3RYIB 1Q0TA 5AP9A 3PRKE 3RS8A 2OR3A 1GNVA 1M10A 4XWOA 8ADHA 4YP0A 4LF7B 5HGXA 4A10A 1FRZA 4HB4A 3BIOA 1DJMA 1SQ0A 3OZIA 4OQDA 2IH4A 1Z0UA 3I6MA 4HN9A 1UKCA 4EJ6A 2JVIA 5DN6A 3FMIA 4REMA 5JS7A 1PG0A 2CBGA 4RLQA 4TKVB 1XWFA 3PK0A 5EXTA 5SZKB 2BF7A 4AZWA 4YACA 2WJGA 2J3QA 2LVBA 1H8HA 2AMVA 2EKZA 4Q01A 1AO0A 2FEKA 4LDQA 4RVDA 1TXGA 1GU0A 2GHIA 5K5EA 2EL7A 2GPSA 2HGSA 2ZR7A 3FUCA 2OP0A 4REQA 1O9BA 3TQFA 1A7AA 1X0VA 1ZI6A 4PBRA 1TI7A 5EA2A 1VZ3A 5JSFA 2AEFA 1YA6A 1JHMA 4US0R 1SG6A 1GNPA 2RHDA 1WHTB 2IU4A 2XUKA 4MVCA 1OH5A 3T4XA 1JILA 2R6JA 1L1EA 1XRMA 1GPYA 4H17A 2JZCA 3MGBA 2J3DA 2HWWA 3NOQA 3D0QA 2UVPB 1HEYA 2CDNA 4KKVA 4TKUB 3ORFA 1JVBA 4GHWA 2ZVQX 1CE8A 4M1OA 5B3AA 4LHSA 5BUQA 4O1IA 1JFRA 2R3SA 1XIVA 4CMHA 4F9TA 2IKSA 1L3CA 5FR2A 5U4XA 4JODA 1PP4A 3E15A 4H4EA 5ES3A 2M1ZA 3E82A 2JANA 3O90A 4FFLA 1RBZA 3RRBA 4FDVA 2DBZA 2O4UX 3OEEA 2R6CA 4FZ3A 2DFPA 1NURA 4I6GA 2JFOA 4LNUA 2JGDB 1Q44A 2BE7A 3UMGA 3LPCA 4HVTA 3ZU4A 1KP3A 3D0RA 2H4JA 2UYOA 3L8HA 4MS1A 1WCV1 2ZTVA 4K0KB 5HOEA 4BKMA 3WISA 3HKCA 2OBMA 1RE1A 1Y7TA 1DC3A 4A8TA 1NFQA 2GARA 3BXOA 3QLVA 4RPCA 4UCWA 3VAZA 3WLRA 5CH3A 3OZAA 1GZ5A 4EY6A 3ESAA 4KLNA 3C3JA 5A05A 1UKVY 1F8FA 1U7ZA 2PKWA 3IQEA 3Q0TA 4JMLA 3S3TA 1KC1A 1CTQA 1S96A 3BE6A 3JWHA 3DBRB 3N6RA 4HNAB 4M1EA 1TQ8A 2OM6A 2WT9A 3SM9A 4CMAA 3SHFA 5EXDA 2SCUB 3QH4A 2NO9A 5CEFA 1M66A 2TMGA 3R2JA 4ZOBA 1KI6A 5COQA 2CE2X 4LHZA 3UF0A 4V2IA 4JBGA 2B3TA 2RGYA 3VX4A 1FP6A 3BSWA 3TRIA 2FPPA 2OO5A 1DAOA 3HB0A 5E0OA 4MV5A 1BGVA 3PHLA 1RHQA 1H85A 5DTIA 3ENNA 3HR4A 4MQLA 4AKTA 3GLGB 5J5AA 1CEXA 3ESQA 3ZV4A 1QQ7A 1QYDA 2D0OB 2X1LA 3IQIX 3TBHA 2MSDB 2QD5A 3CE6A 4MVJM 2V6FA 5CRIA 4HVLA 3SZOA 6NULA 4XJTA 1MB0A 1OXBB 3DA8A 3VYTB 1B8PA 3N86A 1KHTA 2R6R1 1GZ3A 3PE4A 4WK4B 3C7DB 4DLPA 1ZLXA 3W2EA 1GNSA 1U2ZA 3GCGA 4GAEA 4KFCA 2BI8A 3RK1A 4WTOA 1RHMA 2B1IA 1THGA 1V0JA 1NBEA 2R6GA 4BS9A 3T06B 4MULA 3WWZA 3X2FA 4P0QB 4F71A 1XN1A 4RLFA 5JO0A 2NSHA 1Y8QA 3MGCA 4KQCA 4YAJA 2FZLA 4I1RA 4YJ2F 1GILA 4AAYA 3T9CA 5L6LB 2CXSA 3EG9A 1YF3A 2O7NA 4ZANA 4GH5A 4REOA 1HMPA 1V4VA 2PMWB 3O1LA 4MGYR 2W6ID 4NCNA 5G4KA 4ZCIA 3GRKA 2Q6KA 4UUNA 1NXSA 1M8KA 3E1GA 2CWDA 1UWKA 4Q3CA 1Z0JA 2FMHA 4K26A 2XUQA 4Z0NA 1J0DA 4HO1X 5FI5A 1OBVA 4L85A 3R7LA 3N2GA 1ZR4A 1DDOA 1QDLB 2C4UA 1JIVA 3VSCA 3NDIA 4DMMA 3JZAA 4XZ3A 1JL3A 1TJ3A 1YQQA 3AVUA 1U5AA 1J1UA 3NDJA 4WKGA 1Q15A 2WK1A 4EATA 4M0CA 1TEZA 1L7NA 3JASA 1P62B 3PUIA 1EA5A 2YMLA 3M6FA 1VXRA 2G6TA 4CCWA 3NU1A 4S24A 4YV0A 4ZICA 5LXTB 2FHSA 1Y89A 2PSEA 2BMVA 3OSUA 3CRZA 3FKJA 4M98A 4NV1A 1ANKA 8GPBA 3KQPA 3JZMA 2J59A 4W8HA 3WDLA 3ME5A 1INLA 4HBZA 1K8RA 3GT7A 4R9VA 2CXHA 2JGDA 4BO6A 3IUPA 3WIVA 1QTNA 1UM9A 3LTEA 1U1DA 4N1AA 1WXQA 3PD7A 4O4LA 1GKLA 2BJHA 2VCYA 3C4VA 3FJOA 3VXKA 4C06A 1K7SN 1OWLA 2EW8A 3AUTA 3E03A 3SXPA 2HA0A 2AYZA 2PZMA 2VT3A 3BGOS 4C21A 5LQKA 1TTPB 2ACKA 3PC3A 2Z4RA 3B1VA 3DV0B 3F3YA 3GQVA 1COWD 1O5OA 4U8GA 4PGFA 1XNGA 4GSLA 1BEZA 1KEWA 1LY1A 4HQFA 4S1TA 1JN0A 4MHOA 1DMSA 3RLFA 4EG1A 2CBZA 1C7RA 2X4GA 2V7TA 1M6EX 4C88A 5KYYA 4IBOA 4CMEA 1HYQA 4PR0A 3K9CA 4Y2SA 1N5IA 3L0ZA 3MS4A 3U26A 3TIIA 2JJ2D 2HXGA 1TU3A 1ZK1A 4NU8X 3VR2A 2HHLA 3ULKA 5DP1A 1C7FA 1OV4A 1DAMA 2H00A 1E7QA 3OU7A 3RSOA 4IXDA 1JXAA 2O52A 1Q1ZA 4QTUB 3UC5A 4PIVA 1G63A 4FMDB 1NUTA 3N2NA 1T5SA 2A0WA 2LP4Y 1UBMS 1D6NA 1E9CA 4YASA 5E6SA 5BN1A 1MUUA 5LR6A 5KDDA 4J2OA 4K6MA 2X9LA 1OFVA 4JSRA 4MEBA 4TN5A 1E4EB 3WQSB 2JAWA 3PYMA 3FMFA 3WLEA 3A9VA 4GBGA 1JHYA 3WJ7A 4ARUA 2RGXA 3ZCUA 4EB6B 3QOXA 3QSGA 2ZQYA 5I4CA 1K0FA 1Y4UA 1OX5A 2X13A 5ER6A 3R7SA 4XVCA 1QHIA 2KLHA 4H7KA 1UJMA 4ANFA 5A5DA 4KPFC 5FQOA 3WJ1A 5HTOA 3OBIA 1E2QA 4GMFA 5C2JB 2R1ZA 2XNSA 4KWEA 1X6VA 1T5TA 3LECA 4QZVA 4UUMA 3AEXA 5TVKA 5K05A 2IEGA 2VPXA 3C15C 2D1RA 1ZXXA 1EGHA 1RZVA 5CK5A 4BCCA 2O54A 3TI7A 3T1NA 4KJXA 1KMHA 3PLAE 3R77A 1LC3A 1SVNA 1SC4A 4B73A 3BQMB 5ILQA 2IITA 3USZA 5JISA 1BEUB 1FLNA 5K0FA 2XYRA 1TM7E 1RRMA 1T0BA 4MWOA 3UXHA 3VPGA 1LPMA 5A6VA 5TEVA 2H51A 2REOA 1Y6GA 5EWMA 3H0EA 3CNHA 3FETA 2B1RA 4WWHA 1CQJA 5EE5B 4CIVA 3VR5H 4GBJA 4D0SA 4MMXB 3OE4A 4YCDA 1U2GC 3H5VA 3KX2A 2VFAA 1KQ3A 5F33A 1KYXA 3NFYA 3AW9A 3SVZA 4ACBA 1L8XA 4QJBA 2C5GA 1BW9B 1VLMA 1WCYA 4FYVA 4ZZ0A 4C7VA 5DLEA 4GPBA 2ON6A 3IMKA 1TZKA 2X4LA 3N39C 4IHKA 1QHXA 2HJSA 1GR1A 1E2PA 2Q5IA 3JVDA 5AW9A 2VH2A 2I3ZA 5MGBA 4D96A 2P4EA 3KO8A 4WZAB 4GR9A 5DASA 3UUFA 2VAXA 4DT1A 3VH3A 3UJ8A 4ZCTA 2J67A 4ZYWA 4CKZA 2YCLA 3GUHA 3CLUC 2D5AA 4N54A 1SVLA 2FSVC 2J3LA 4LJSA 5TQ0A 1F17A 3GV0A 3MJCA 5CJPA 5BO5A 2E3JA 1POXA 2BH2A 1TVEA 4PHTA 5TPWA 4U39A 3C97A 3JSAA 3NDPA 5C9ZA 5FDFA 4LHYA 2VQSA 2YXEA 4OP3A 1IMJA 1T3GA 2VHJA 3FZNA 4FZ5A 3Q3HA 2NTJA 4MAMA 5EPOA 4EW1A 2EJBA 3D7LA 2Q0QA 4IDDA 4JUAA 2XVAA 2IY7A 2PU7A 4NJMA 1HYEA 1Z5VA 2BGIA 2WJWA 1EEHA 2WSIA 3EUWA 4BVBA 5CAEA 4DR5B 4BMCA 4MV6A 2P2LA 1EFRD 3OECA 3UMMA 4TV8B 3PQ4A 1PUIA 1NIPA 1IQUA 1P8AA 2AJTA 3CSSA 5BQPA 4ERXA 5AVKA 2W7TA 2O3SA 1IN5A 4R8LA 1FY2A 3DEHA 4WA7A 1PFWA 4WLFA 5KHOC 2HSEA 2VH1A 3GGDA 4KX3A 2HQBA 3W7BA 1LPOA 4QUDA 1CUDA 3ZHVA 2GLXA 4N7BA 4RQTA 2PR2A 2EBFX 4CIDA 4OGFA 1EUDA 4CLXA 2QS9A 3B89A 3IA2A 4NH0A 5L4SA 5JOQA 5HX7A 1YXMA 2PX5A 3MWKA 3MHPA 3NUQA 4JCOA 1VG9B 4ND6A 4V0MA 1DWQA 2RHCA 3D6FA 3PGXA 2AF3C 3RFUA 5IP5A 1F2TB 2XUJA 3CONA 521PA 3TQOA 3V33A 4H3SA 1WUTA 5DHAA 1RWVA 4EI7A 3A9RA 3N8KA 5EL0A 3W0LB 3T52A 1JEOA 2R5FA 1EVJA 2OGZA 3PXXA 2AL7A 1R3UA 2QEQA 1J99A 2EZUA 1A2OA 2WV9A 1P0CA 5JAUA 1E7WA 3QEAZ 3CIFA 1HYBA 4LBZA 1U99A 1G16A 3STVA 4G8JA 3WGOA 5MFZA 2AG8A 1ILEA 2ZJ6A 2Q3CA 2DQZA 3O0TA 4QU9A 1V2HE 3D8BA 5TEWA 2GPJA 4Q4HB 4YWHA 5BWCA 4DA8A 3RTDA 3O8NA 4XLZA 1MNQA 4RVOA 4KC0A 2E55A 4F0JA 2E4ZA 2QQFA 4KQGA 3WMEA 5CX1A 4E46A 4YN3A 1UK7A 3KTDA 4ZXPA 2DWUA 2C7OA 1LI4A 1SC1A 2EFCB 3H3FA 3IP3A 4CKCB 4DWJA 3BPSA 3M1IA 5FA5A 5ALDA 4BKOA 1B43A 4FGZA 1E2EA 3GXOA 2CVOA 4OQLA 4HLQB 1FL9A 4RKQA 4EHKA 1RPAA 3P2EA 3I42A 1TJPB 4F38A 1AKRA 3N0VA 4GG1A 1TO1E 2PBRA 3ILYA 3H84A 2X22A 2ZE8A 3K96A 3BMCB 3B3AA 3OP1A 1QYCA 5DK6A 5BN3B 4F91B 1IWOA 1YMVA 3DC7A 3K8YA 3TG8A 4QXRA 3RTBA 4C4SA 1MF7A 1N6RA 2WFLA 1V8BA 2PY6A 4KGVA 5CT4A 1PR5A 5IJ9A 3K15A 1X7GA 5LQRA 1FUIA 1OLUB 2AOVA 4DV4B 3NV7A 3RIMA 4CRWB 3KS9A 5C46F 1YVPA 4ETNA 1WV0A 2VT6A 1FYWA 1GU7A 4OJKA 4RV4A 1YZHA 4JX9A 1PEAA 1NMEA 2W6JA 4H7HA 2OGUA 1VOTA 2YVUA 4N49A 2VDPB 5AHWA 5I51A 1JE1A 5LYJF 4B9AA 5GM1A 5FTWA 4EW2A 3AUYA 1XZQA 3KXKA 2OKGA 4LDZA 4BHTA 5JALA 1P4HA 3SXJA 3FDXA 1DWUA 1PFVA 1M8FA 3LXRA 4DA7A 4MKIA 4C0AC 4N76A 4Z7NB 621PA 2C2HA 2HN9A 4TQ9A 5HJ5A 1G5RA 1OFUX 2P6PA 1B6TA 4KXUA 2FZCA 2ASVA 2CXOA 2Q07A 3TVYA 3AOGA 3LRXA 2I9KA 1XYYA 4IVRA 1N6LA 1MVLA 3D4LA 5CPBA 1LTHR 3WV5A 4Z4IA 1WB9A 4RTQA 1H2AS 4E22A 4CXMA 2IYOA 3AW8A 4MV3A 3D6MA 1NG9A 5JXIA 4D25A 1RPNA 3FIUA 1Q50A 3L4BC 1D03A 4OK6A 4CV2A 2ZIWB 3NAMA 5EIFA 4D80A 2FWPA 1RI3A 3B3QA 3HYRA 1H8ED 4ZO4A 3RARA 2VNIA 5TT0A 3JWEA 5F9HA 3VJRA 4U7TB 3S1AA 3HN6A 4ITVA 4YMSA 4YT2A 3H2HA 3G2HA 3JQFA 1V11B 4OB7A 3WLHA 4WZZA 4XUDA 1RNLA 1N1EA 2JD1A 5ERGB 5H4GA 3USCS 3ZZNA 5ELLA 5KC8A 1QX3A 4IFTA 5CYPA 3DTVA 5ENVA 3RVSA 2NSDA 4AN0A 1EFPA 2DP4E 3P9QA 2Q5EA 5H02A 2I62A 3ZDEA 1YDMA 2BP7A 4BV2A 2PVCA 1VC2A 3I04M 4LZLA 1W5EA 4HVCA 2C3UA 1XXHA 3GEDA 4II2A 4O8CA 1FP1D 4CR8A 1JQJC 1NAHA 2AE2A 3DVRX 2O8FA 1L4BA 2YQ4A 3IUBA 1RMQA 5LMZA 4OGKA 1I7QB 5LKRA 1M8GA 4CN9A 1PJ3A 1FJ2A 3PP8A 1OB2A 3KPJA 5K51A 5LMNB 4B3RB 1TTHA 3C24A 3LQ4A 2VYVA 4C4TA 1Y81A 4JWTA 4U2BA 3LTNC 4CCAA 5A5EA 2GQ0A 1XVIA 1R0YA 1ZO8A 3EOAI 1ULTA 3NH9A 4M9RA 4WXEA 5JD6A 1ONPA 1X7ZB 2I3BA 2PYZA 1NY5A 3KZNA 1Z4LA 2ZRGA 4B40A 2GSWA 4PLFA 4XGQA 3NTXA 3OLWA 1ZUNA 1FNBA 4EB0A 3HS3A 4LHWA 3QKUA 4IIUA 3T3OA 3DF7A 1EINA 3ZIDA 4GP7A 5EWMB 3W77A 3IEVA 1CNFA 4EVSA 3QUBA 2BI7A 1Z5ZA 4I4CA 1VKJA 3BB3A 4TMZA 4FNAA 2I6GA 4PNHA 1PYOA 1LSJA 4PWZA 4PNZA 1U0JA 1VHWA 1NBIA 3UEOA 1C3XA 4C0KA 4D43A 4G1CA 4GKBA 1TYZA 2HV8A 1R8YA 1Y37A 2NACA 3E4DA 1IAVA 3OX1A 3Q7EA 2Z8XA 5JCPA 4JXKA 2IV2X 3OOEA 2FMTA 2KPOA 1ZH8A 1EB8A 2XYPA 1VCIA 1KI6B 1IQ0A 4V0ME 3RF7A 4YYEA 1TLFA 3WP0A 1U9YA 2IZ7A 4IXMA 2C29D 4AQDA 2ARKA 4F4IA 4EB3A 4CM9A 2G76A 4G5QA 4LEIA 3TRHA 1Z6ZA 2AKAB 3QIVA 2JCSA 4R8RA 2J0UA 4YPOA 5B5SA 2ANCA 3BH0A 2G06A 1NSYA 3I2HA 3PC8C 3QKRA 5K3DA 4F4UA 1RM5A 3SBDA 2J4DA 5A9SA 2GBLC 2W8BB 2QAGC 5EJ8A 1NMZA 4WCVA 2PZLA 2OD2A 1PJ8A 2XHZA 3H2YA 4KB5A 4B4VA 3GFRA 1TM1E 4EEZA 5AVZA 2UZ4A 3SKXA 2P6MA 5DNVA 3PGVA 1NF2A 1NRIA 3E3OA 3LL4A 4JENA 4LX8A 2RHOA 1KAQA 3K5PA 3KOOA 2ST1A 1XV5A 3LDUA 3UA4A 4NU5A 4G37A 3IR5A 2J5KA 2IXBA 2YZNA 4IGAA 2XUDA 1FRVA 4JQSA 2OXFA 3KXDA 5LB4A 1UBTS 3QPBA 4L4RA 2WNSA 2N42A 3LBHA 4KV9A 2BFDB 2F1IA 3U0VA 3IIEA 1V1MB 1CQXA 2DCMA 5IEBA 5MN6A 3OU2A 2CEKA 1Q91A 4ILEA 3OOHA 4ZIRB 5FNVA 3OVMA 1CFZA 1SK9A 4IINA 2CLHB 3NHPA 2ZPUA 2ZK7A 3AIKA 3S4YA 4DUGD 2YZKA 4L51A 2DLNA 1GGMA 3W1VA 3K5WA 4Y2QA 2XTAA 5FTLA 1VDMA 4KO2S 3VI3B 3GLIB 4PZYA 4X1OA 1ABEA 4LXXA 1CP3A 1R0BA 4IEFB 4RZIA 3FX2A 3ES9A 821PA 2QPOA 5DCLA 2Z43A 2H4HA 5HIIA 5KNDA 3SQXA 1JIQA 2QDXA 2HLNA 1A4XA 2FPGA 3C0KA 3CH4B 5JDIC 3QEMB 3RVNA 4XTRA 3A7EA 5SYNA 2OECA 2Q5CA 3VV3A 4MJ7A 3ET5A 5AK0A 3M1YA 1J5EB 3HXPA 1PV1A 2ZYHA 2DJIA 3E3LA 4FD3A 3QJYA 4AYTA 1V9LA 2BEWB 4JVNA 4YP6A 1Y5NA 1OKKA 1YK0A 1TC2A 3RIYA 1B6SA 3O38A 2X7XA 4L72A 5ALWA 3SQNA 5L3QB 5LLSA 1XTUA 3KKPA 2ORED 4N18A 3K35A 1U5BA 5LD2B 3PCXA 1GRRA 3ZQJA 4DWWA 1CUCA 1FDSA 1I9CA 2FN7A 4J49A 4YT5A 4GKKB 1K75A 3E48A 4YY3B 1SC9A 4XVUA 3BM5A 4MKGA 4RGQA 3ZHRA 3AI3A 4W82A 1IBCA 3ZH2A 3SX0A 4WI1A 1E0AA 1IH8A 2PWAA 4WDQA 4C14A 1QAMA 4ZU6X 5KTTA 1N78A 1YZVA 3JVEA 2IGBA 2OPBA 3KHUA 2CDBA 3F96A 3NG1A 3OPXA 3EG9B 4N82A 1PZGA 3KR2A 4XGIA 1E6KA 1U8EA 1G20B 4H16A 4OATA 3DE0X 4GRAA 3FZGA 1P1CA 4Q1EA 5LBIA 4L4XA 4ARVA 1F60A 2LBPA 2VBFA 2WKRA 2YC4C 4GQBA 4HFRA 1IJKA 1WMBA 2GCGA 2OXTA 2Q4TA 3DMHA 1O96B 3GEEA 1E2DA 4M0PA 2CNLA 4JLMA 2JJ2A 1USGA 4O6VA 3K9LA 4BE7B 5IDXA 1RCUA 2R5WA 3O3MB 4KXLA 2CK3D 5BN5B 2RAPA 2PLWA 3D7MA 5IKOA 4S1VA 5K9ZA 1G9TA 1Q0SA 4LDRA 3DOJA 3FYDA 5IDYA 4AJNA 4YBRA 1JH9A 2V0CA 3QPWA 1WE2A 1QGAA 5IVDA 5HYVA 2Q3MA 4Y1RB 1ZVMA 3L0PA 4CM1A 2JFFA 4BOYA 4HDQB 4K6HA 2GHRA 2IXDA 2PMKA 5GONF 3H6HA 3NHJA 1DTWB 4BO1A 1T8SA 4ZQGA 5AHKA 3Q7TA 5JXGA 3ZTYA 1BDHA 2H5LA 1E94E 1YJ5A 4PF1A 3K0CA 4F46A 3CXRA 1VJRA 3O73A 2PXHA 4P5EA 1G19A 5EIEA 1TYEB 3TD9A 2HLDD 3TQCA 1S1MA 3GEMA 3K1YA 3Q5EA 1GN8A 3HU2A 4QSHA 3RH0A 2R8YA 5ECYA 2O8EA 1TCUA 4NK4A 4X20B 2RH9B 3FCCA 3EDOA 1RWOA 2Y8EA 1NJ8A 4I5GA 4AMYA 5HRUA 221PA 5SZIA 3ADDA 5AW2A 2BH9A 3PD0A 5KYVA 1FK8A 3IULA 4BY9E 3BL8A 3K9WA 4CKEA 3KKMA 3G3EA 2EF0A 4HGNA 4OQQA 5AJUA 1J6UA 1W5FA 2IEDA 3T9EA 1I7NA 4A0FA 1AQNA 3LBIA 1UDBA 4L4UA 4QASA 5DVZA 1VKOA 2XGJA 1Q92A 3DLBA 3D6TB 3G9XA 1VIDA 4FS3A 2D6FA 2J07A 3OH8A 5KJCA 5TB5A 2GWHA 3RSLA 1YC5A 3CWCA 3LFTA 4MARA 1D9ZA 2GXUA 3KETA 4LAFA 4A92A 1Q17A 1TJNA 2QTVA 4BYMA 1H2RS 3IRUA 2ZVDA 3W8FA 2DRIA 2Z9CA 4COKA 5KPJA 4NXMB 1AV7A 1FXSA 3ROXA 1B4DA 2OT3B 2OD7A 4JB2A 5EKDA 1FNSA 2P2CA 1V7CA 4I8XA 1C1DA 2X9GA 4S3MA 5CM2Z 1LC0A 1C0IA 5BRNA 1W4LA 2HT6A 3PT9A 1RRVA 1EUZA 3MQ2A 4MUGA 4BFYA 1EBBA 4WMLA 5LZ2A 3BRWD 5GGXA 2VNAA 2YNMD 4RZSA 1I7LA 3NEAA 4RVUA 3FHCB 1WXIA 2Z3ZA 4Z99A 1K5DA 2CW5A 5HA5A 1UMBA 1CRQA 2ZSHA 3WL4A 4C6TA 5E8JA 3N1UA 3W5HA 3PEYA 5JPCA 4CF7A 4L7VA 1L5VA 2C2BA 1W36B 2ODAA 3QKIA 3W9YA 1OXTA 4EPXA 2UXCB 2JGRA 5T5QA 2Z08A 5LOVB 4BQEA 3O31A 4RPHA 1Q3TA 3DFIA 2AX3A 3RNLA 4DMRA 2OWDA 3RYHB 1VE6A 3HVKA 2V7PA 3QPAA 4RY0A 4U6QA 3TLYA 5JS1A 1QC5A 2F90A 2I34A 5JPIA 4MAFA 4AKGA 4YMLA 4U6NA 3R41A 5DTEA 2EBWA 3D7RA 3DZIA 3KPUA 4G07A 2WWYA 1GVNB 1SOAA 2AG1A 2BRUA 1I6LA 4M89A 2B5OA 4RENA 3UT0A 4OJNA 5FOUA 1ADBA 5IYZB 2NNWB 3KXPA 3T7IA 2PUAA 3C39A 3WI7A 3FFAA 2GZ2A 1UQTA 4GE3A 1GNRA 2GF9A 5ESDA 4UFPA 2CLSA 2QE7D 2VO1A 2QG9A 1KYQA 1BIFA 4KIFA 3JQCA 2GN9A 2LZ0A 1YKGA 1F38A 3BVPA 1FFEA 3L6RA 3RS5A 3QWHA 13PKA 2RH4A 4YUXA 5J4HA 4X7MA 5CHYA 3PFNA 4UUOA 1A8UA 5T4HA 4HNUA 2J32A 4OI2A 4DAOA 4FJ2A 3PNQA 4F5WA 2I3AA 2VSQA 4KLRA 4OUDA 1LK7A 1RYBA 3JAWA 5HP4A 3EMVA 2QORA 2XQGA 1P73A 4TV8F 3ZI4A 4DA6A 5HKOA 4X8HA 1NA5A 4EGAA 4S2EA 1V2GA 1H0RA 1Z2PX 2PO5A 3S2UA 1GJRA 1VGQA 3HNOA 4IHJB 4KO4S 4AJKA 3TGLA 3DV2A 1QBGA 5T8KC 2Y0DA 1Q14A 1YS9A 4CKBA 2BZ1A 3Q3VA 2YWHA 4UCXA 3LY5A 3J81A 1B15A 3BREA 5DO9A 2D62A 3FLBA 1OI4A 3NTRA 2GK4A 1A7UA 3E84A 4EG8A 4KVGA 5KSYA 4GMDA 2NQTA 4TTAA 3ZZUA 4GNRA 4IDOA 4NCXA 2AWNA 3UO8B 1KDVA 1SCAA 2GTPA 4DKXA 3CZRA 4J2HA 1KI9A 1YRBA 3FXAA 2YWXA 4DQVA 3EXHB 3IDSA 3EAFA 1XMIA 1S01A 3FPAA 4PLHA 1CF2O 3WICA 2DETA 2VUUA 4EYKA 3FUWA 1SZDA 4CM8A 4KTVE 3EQ2A 2CF5A 1V8DA 4IIJF 4QTTB 2XVYA 4D44A 1SOVA 2XDWA 3D4BA 4M9ZA 1HZZC 3B3JA 3B5JA 3DAFA 2QZZA 4HJRA 4ZYYA 1A82A 1TUBA 1YBHA 1TJ4A 3AVPA 2Z98A 2FR1A 3KWMA 1K8XB 3ACBA 4EYQA 3HZZA 3MHTA 2JHPA 1TADA 2ZAMA 1NU8A 2ZTLA 2GBIA 4KAFA 5DGIA 2QE6A 4PYRA 3LDHA 3W7VA 3OICA 6Q21A 3YASA 5IT5A 2XEDA 3MOGA 4ND3A 2N47A 4XCXA 3O8RA 4EO7A 1LH0A 2CL0X 2A5GA 5AVXA 2P4HX 3OLZA 4FCCA 3W6UA 2DT8A 4COOA 3EW7A 4P82A 1VA4A 3W6PA 3ZGNA 2EG9A 3H1GA 4KE9A 4PSUA 3RC7A 4F3TA 2Q9BA 4BATA 1YJQA 3OIGA 3OX2A 2JFHA 4J1NA 4O1MA 4Q4AB 3RS0A 3WDSA 3WR5A 3WWOA 4AO8A 4GI5A 5AKXA 4A0RA 2E85A 3J7AC 3A70A 1HQCA 5GOTA 3DXYA 3PIRA 2WMYA 5CDSA 1IBMB 3N8HA 4TMVA 3VAYA 3W8RA 3PJFA 1XQXA 3UJPA 1Y1SA 1ZOOA 4N03A 3V2IA 5DULA 1S2LA 2BW0A 3UK6A 1X8LA 1ZIDA 2LD4A 1CT9A 2ZUBA 1YAHA 1E7YA 2O05A 3O2QB 1QF9A 4ZDJA 4O25A 4XM2A 4EQ6A 4JBXA 1VLLA 3FPSA 2PGAA 4QATA 1LSOA 2W48A 4XM1A 4ZCPA 3UJHA 1TFRA 4RA9A 3OCJA 1DXHA 3DDWA 4E30A 3VDQA 3TLGA 3FB1A 3LC7O 1ZC3A 1E2GA 3REQA 1I30A 1WDWB 1Q0LA 2AR0A 2HFKA 1H2EA 4XB6B 3V8MA 1SUBA 3SEZA 4UZFA 4ZOAA 4INJA 4BFXA 1ZJ5A 4UVGA 3SDBA 1KGDA 4IZIA 3DMTA 1MFZA 4AZTA 3L02A 1S02A 1XD2A 3O3NB 3R7DA 2XMQA 4YRJA 3VDMA 4BC0A 5A4JA 3QWAA 3HH8A 2ZROA 4HNAA 3ZTWA 1BYUA 1RYMA 3JQ8B 3KAPA 1R0LA 1N9KA 3CZAA 2I71A 4BP8A 3FY4A 4KDEA 3EWNA 1FS6A 1A0OA 4ZQHA 2QM3A 4QPDA 3FRHA 1IUKA 1CYDA 2GUWA 2GZ1A 3T4UA 4UE3S 3UAOA 3L46A 4P9NA 3ZX5A 1U3VA 3TZEA 3GPLA 3H83A 3OFSA 2L17A 3K71B 2BHSA 3GR6A 3WFIA 3HVRA 1TMKA 2NM0A 1GY8A 1M2WA 1TJ5A 3IILA 3O4HA 1WZNA 4TTJA 1IM5A 5DHPA 3ZW9A 1ESNA 2JJQA 4NOMA 3H5IA 3TKAA 3L7YA 5E4TA 3T3IA 3TOXA 3I8XA 3ETGA 2VQ6A 2FV8A 4TWJA 1PGJA 1IZZA 4C6TB 2OD9A 4LPSA 3KDSE 1UMBB 3H1FA 3IAM6 5FI1B 1U9IC 3X2EA 1EP9A 2IY8A 1GNTA 1I6MA 4YROA 1XDSA 2Q7OE 4K3UA 4Y7DA 4BKPA 2HWUA 1CS4C 1IUOA 1X87A 3OFKA 4IGFA 2AEMA 4ZDIA 1NUAA 2HBYA 5JE8A 5LP6A 1CXZA 3DL0A 1EH5A 1CUYA 3WB9A 4LFCB 1JKMA 4RKEA 4RSMA 4GMXA 4ZI7F 2C9MA 1KBQA 2BUCA 2QL5A 2OMKA 1ZIPA 2QRGA 4I6EA 5AKGA 5EIWA 4R8MA 4MQUA 4WLNA 3OM1A 2XI4A 4FKBA 1L3IA 1Q1EA 2OSBA 4X71A 5FPPA 4YX9A 4FDUA 3AEUA 5B3JA 4DDWA 4RJTA 2X6RA 5HZHA 1LKZA 1IZYA 1EFUA 3IX7A 4KUHA 2PBZA 4Y2PA 1CUBA 4POAA 4C0XA 5L95A 3GELA 3MJTA 2C8VA 1OTYA 4G5FA 1LPNA 4PLVA 4ZC1A 4UE6A 1V16A 2R68A 2A33A 3AUSA 4WKOA 5LP1A 5I9LA 3JYLA 1U6KA 4JLKA 2VDOB 1F3LA 2RKWA 1T15A 3AESA 4LF4B 2OCYC 1L8LA 5LXTA 3T4PA 3TPZA 4P3PA 2G6BA 4HUJA 4TL8A 3HYLA 3CW2A 2G8LA 2IL1A 2QMEA 3T5GA 1EBFA 1PJQA 3DMPA 1HLDA 4FMCB 1FA9A 4J6EA 4MVJA 4OA5A 4RMNA 5EI5A 3VMFA 4A91A 1NX9A 5BYAA 2JFNA 4G5HA 4HB0A 4C0SA 5K4HA 1EWRA 1DC7A 3QLEA 1OTHA 1QE3A 4JMPA 1NXQA 3EOZA 3ASVA 3I5AA 4QGHA 2OBXA 3B6JA 2ZBDA 4HAYA 3A6KA 3AH8A 3FMOB 1OXSC 4RDCA 4AECA 5K8UA 1QHHB 2AFRA 3CRMA 3QK7A 2EWMA 5IAEA 1L7VC 2F43A 3UGKA 1AMUA 1XMQB 3B1XA 3WGIA 1CUAA 1L7XA 1SBNE 3CX4A 4FFOA 2ZIFA 4GX0A 4LXGA 4R51A 5DBIA 3B9RA 5LJIA 1BVRA 3AJDA 1NKTA 5DM0A 1L5WA 1RRKA 1M1YB 4IH9A 5TGZA 4KR7A 3F0TA 4FP9A 4DJEC 2VTEA 1IZ8A 4B5KA 5ESWA 1X9IA 2OORA 3LV8A 4E1BA 1XPRA 4TMTA 3EAGA 5EJ6A 3RADC 1DVRA 2QW0X 4IWXA 4LYHA 2VZ8A 1ZSVA 1BFKA 2Q1YA 2VDJA 1DG1G 2YVKA 3HB9A 1BROA 1XEXB 2JNWA 4MR7B 4YRQA 3RBXA 5K0SA 4D4LA 2GZRA 1G8SA 4X1IA 3B60A 4FN5A 3WLOA 1QYVA 4KVAA 3ZLJA 3ZJ5A 3WBBA 2EGUA 1EWVA 4UHDA 2WRZA 3CNQS 5I7HA 4AQ7A 5IVHA 1JEYB 2VH5R 3LGSA 3K9HA 1W35A 2ZQZA 4JELA 4DGQA 1ZD3A 3IHWA 4R68A 3V1MA 4K03A 1Q6YA 3G6WA 2RHJA 4X3OA 3SVTA 4ZOEA 1MZVA 4DMLA 3B2QA 3E58A 2M32A 2HJHA 4NONA 3TQRA 2PMBA 2FFRA 1C7EA 1P9WA 1BHSA 1CJVC 2D06A 2JIQA 4PFQA 4ZVTA 4DAEA 5B4TA 2VPTA 2O8FB 4N3BA 4PG5A 2JHCA 3M5DA 5DX0A 1UPXA 3BHJA 3BBLA 5DXFA 1GWNA 4DLSA 1E1CA 4G41A 2X0NA 1QF6A 3EHEA 2RGNC 1B8OA 1ZM2A 3ZZ1A 3PUJA 1UIMA 4KP7A 3OQIA 3AF0A 2WLTA 2I6SA 3I76A 3LT0A 4WBNA 3ZD8A 5L9AA 1K7CA 4IDAA 2KE5A 2BR4A 2JA1A 1NYQA 1IY2A 1T24A 4XPZA 5IAGA 4H31A 1QGYA 1YZGA 1JQEA 1U5BB 3L6CA 3M6XA 3SLGA 3OT1B 1KOGA 1MRNA 2C2WA 3AHDA 4MDFA 1YU6A 3NRCA 3SKYA 4LJLA 2HK8A 4ZVPA 3JALB 1MT0A 2HTEA 3JXEA 3QA3E 2R2GA 1B3BA 1VBKA 2VTVA 2DKOA 2I78A 3HADA 3MAAC 3PDIA 3C4JA 1RTTA 4UREA 4JJZA 4LDJA 2IXAA 2QF7A 4M1ZA 4RAOA 1YBAA 4TUYF 3QRWA 3ODPA 3T5TA 2AC4A 4XYGA 2APJA 4CF4A 2J31A 3EVAA 3IDQA 1W2GA 1G6OA 2RC5A 5AW1A 1QRUA 1NBHA 1Y9EA 3RIEA 1OY1A 3ZY6A 4XJSA 5J2UB 1YH3A 4R2WA 4ER0A 1N75A 1W9HA 3O2NA 1KEEA 3ED5A 2QGNA 4R2HA 4B82A 4ZQIA 2ZWMA 4JI8B 2HIGA 4M0KA 4X93A 3PE3A 1N5MA 4GZ5A 1MB2A 5H3LA 5FULA 3G0OA 3ABSB 2R84A 3DAYA 3G0CA 4A0HA 1PQ4A 4JDPA 4CTNA 1SZJG 5EKUA 4FKZA 1CQPA 1QZXA 2IHBA 3OZXA 1DIGA 3ZGLA 4WZ6A 1VI5A 3PGLA 4O08A 3ESBA 1DCMA 4IDEA 1HDXA 3KLOA 3QPUA 4LIPD 1BD4A 1RHJA 1XKTA 2CYAA 4N4AA 3MD0A 3L1JA 3V7FA 1EFCA 2H16A 5CGZA 4B3FX 2VRWA 1UM8A 3FGNA 1SIOA 1TW3A 2YHSA 1NLMA 4ZT7A 2W70A 4J0FA 4K28A 2GD1O 2I1VB 5AVUA 2J9XB 5EPEA 2W37A 4B84A 1YVUA 2QRHA 3VNRA 1PIWA 2OCPA 1YU9A 1V4NA 1XL0A 2ATIA 3OQHA 4YRZA 5LP6F 3KB6A 4LDPA 5BSMA 3DO5A 3L0SA 4PLCA 3ZU5A 4MQFA 5HUJA 5K0EA 5KYXA 3WSVA 3ZV6A 4RTSA 4J1SA 1VPEA 5FYDA 2HCRA 1DZIA 1D7OA 4PSAA 1UZAA 3GRRA 4MICA 4P7BA 2RK6A 4ZCMA 2I65A 4EITA 1WXGA 2FNAA 3BEDA 3OZVA 3WFJA 2JHFA 4JLJA 3V8BA 4F06A 4L8FA 3HXLA 2ECKA 5L53A 3P45A 1UJ2A 3QKRB 4QGGA 5GTDA 1ORHA 1DLIA 3K2IA 1QK5A 1G7CA 2I1LA 4X1YA 4AY5A 1Z4OA 4O5AA 2DG2A 2DSTA 2WDPA 4TRRA 2PKYX 3D81A 4TWZA 1JFFB 3WL3A 5J47A 4YO7A 1O1YA 1T8UA 1SD2A 4DV0B 3LBAA 4YFYA 1XNQB 1OU0A 4TWRA 3RUCA 1DGQA 2IHTA 4FLFA 1ZIYA 1Q1AA 3GMSA 3I8OA 3W2TA 3ZIUA 1N57A 2GVZC 1J0XO 4BO4A 1G7RA 4K2HA 4DR2B 3UBTA 4Q5IA 3Q3JB 1E1MA 1MIOB 5DNAA 2JLSA 3T35A 2ONYA 1N2CA 3SYTA 4EECA 2X15A 4PYOA 1B7GO 1XZFA 1YCGA 4MVJH 5AUOB 3CF6R 4OL9A 1CUEA 4LYYA 2Q0HA 1LQTA 3ZDDA 2X5JO 4J0EA 2GFIA 5ALIA 5B2FA 2I2AA 3RI3A 4XYEA 2HGZA 4JSTA 1MEEA 5KU1A 5SZHB 2G0NA 1SXJD 2OV3A 3A9UA 1WEKA 3FE2A 1QVVA 1UOOA 1T8TA 1G20E 1PL7A 2X8LA 4PO9A 3OETA 3RFTA 5ICSA 1Y1PA 1F8YA 4ARZA 1NP3A 1T25A 4O4JA 1N7HA 4CQJA 3HJCA 4QGAA 5IJZA 5JI2E 3BWEA 3TW8A 1DO8A 4OMUA 3LO5A 2ZAOA 3C5CA 3FTCA 1RVV1 3ID6C 1PJ2A 4R31A 3G8YA 4P36A 2CK3A 4LOHA 2IW3A 3V1NA 1A9XB 3AM5A 3ZNQA 3K6JA 5PNTA 4BPRA 2OZLB 2OFPA 3D8HA 1YL5A 2O3TA 3UWPA 3DEAA 5CLHA 2EW1A 1N6PA 1U90A 5FTJA 1UDXA 4JB8A 1SIBE 2CLLB 3SR3A 5C1BA 5KMGA 3A25A 1UMCA 2XKJE 3L41A 4DT1B 5AW4A 1T35A 2Q0SA 2NU6B 3F9CA 3OIUA 4FYHA 5CK4A 3SE7A 3AUKA 3R8XA 2JATA 3PVSA 3MFYA 3O26A 1G64A 1IG3A 1U2EA 1V3UA 3LHIA 1OI2A 4Q9HA 4RSHA 1H4TA 4HYTA 1FJHA 2Z2IA 1R10A 4ZO7A 2VP2A 1SELA 4HSGA 2GO1A 5J4KA 5AK5A 3G1WA 1R7RA 1Z63A 3D1VA 3KV1A 3PHCA 2JIMA 4QXQA 2IXTA 3BD6A 4WVFA 5CVUA 4NY1A 3FLAA 3OA0A 4KV7A 1XZLA 2ABWA 2IHNA 1E8NA 2ECQA 5FTNA 4EUEA 3IH5A 3CWQA 2PUJA 4RCZA 5DPMA 3LRTA 4YAWA 3RGGA 1D8AA 3A6GA 4OHFA 5TX7A 3G5UA 2YL2A 4AY2A 2CUZA 2VYFA 2G17A 3D7SA 2VJBA 5P21A 2PN1A 1JYFA 1V96A 3ZUPA 3K3PA 5HQ3A 5HZMA 2CV1A 3TSOA 2DAPA 3BRCA 1PLKA 2A9PA 4UVEA 4QTYA 3G0DA 3IUEA 2PANA 2E18A 4G1UC 5E4JA 4R40A 3KQNA 1U8AA 1TL7C 4NAUA 1CRWG 3MTDA 2H4WA 4ZYTA 3N59A 4YJKA 3WIEA 4IHJF 3VNAA 4KVFA 2OGWA 1G41A 3RSCA 1XFDA 4DMUB 2HT1A 1K66A 2ERYA 4Z4FA 1RI4A 1XP8A 1D2RA 2HSZA 2XX3A 2VZ9A 3NBAA 3GA0A 4DC9A 4CEJA 3QVWA 1JZQA 1OA1A 1Y7HA 4RHEA 3V1UA 2A14A 3EAQA 5CBPA 3GRUA 4DLKA 1RLUA 1NI4A 1G59A 2J48A 2FUEA 2GN4A 3TEMA 3I61A 3A1SA 1WHSA 3RVKA 1JG7A 3LLVA 1YR2A 3P0FA 5CIWA 1L3BA 2VF4X 1QIJA 1U2DC 4HDMA 5E7MA 5E6SB 1EP2B 1X3SA 4OEHA 4DMHA 4G0YA 2G72A 1YDEA 2RIRA 3GEGA 3H18A 4MV4A 5KREA 1EUCA 1EYZA 4CM7A 3C8UA 3D43A 3HZRA 3WBJA 2AMYA 2UVQA 2Z8YA 3JU3A 2XITA 4BQRA 2IEZA 3I05A 2IYUA 1P91A 2O2YA 3K1TA 5KKAA 2P27A 5C8DA 5G40A 3HPRA 5GMOA 4Z4HA 2DFNA 2B36A 1MA0A 4B3MB 1Q7CA 2NU9A 1ZGJA 4TYQA 3KVVA 3ER8A 3SHOA 4Y6OA 1VCHA 5BVGA 1MB3A 2QN6A 4TLEA 3OCUA 4W1RA 1GL9B 2JI6A 3EWAA 5CCEA 3ZGXA 4GVLA 4I1UA 2PZAA 4EKYA 5EHZA 2QQEA 3A32A 4AY6A 4KLCA 1ZD5A 4D82A 3J7TA 4E12A 4D6XA 2Q3FA 1Z15A 2YWGA 4R1QA 3K8ZA 3VO2A 1Z0FA 1ZCFA 1CCWA 2EFEB 1P1HA 2C2XA 2YJZA 3JRNA 3PXGA 5CVTA 5EUMA 1Z5WA 1BX1A 1XA0A 1E4OA 1R0XA 4QTZA 1L5YA 4A0QA 1QFJA 4EMUA 1IRIA 1G2OA 4I4IA 3KR1A 3LIIA 3D3WB 3VISA 4EVRA 1GA6A 4LBYA 3FFTA 3CF2A 2DPLA 1EDEA 2A67A 4RJJA 4CT0A 5F1KA 2CUTA 4QXPA 4JP5A 4GX2A 4UJ3A 3ZI0A 1SBHA 3TSCA 1I51A 3KB8A 5TGTA 3OLXA 2AN5A 3GCZA 4UNSA 2D2VA 2O8VA 1UDCA 4F9GA 2QI9C 2ZSBA 3UWSA 2VPPA 1BFDA 3WWDA 4A6DA 3WMWA 2IXEA 1I2DA 3JWIA 1Z2OX 3MMXA 5JBQA 4XQEA 5THQA 4XB2A 2VSYA 4KYUA 2CL5A 4TTTS 1NP7A 2IUUA 4X20A 2GRAA 4Y0NA 1FJGB 3THSA 2DF8A 1R12A 3LYHA 3HDQA 3DD5A 1PTKA 5I7OA 2EC5A 3IAHA 1ZD2P 4EHAA 5TPZA 5C37A 2IYYA 3HCBA 4MITA 5FUBA 5DYTA 1U1EA 4V3CA 2XWBF 2Y1WA 2FEWB 3W34A 1GCGA 2HNBA 3NW9A 1NULA 3RKRA 3BX1A 4MJLA 3A9CA 4EF5A 2Q5JA 2CWWA 1PGQA 3U9TA 1IBLB 4BO8A 3VYVA 4MHTA 1R5JA 1ZOPA 1T1SA 1EVEA 3CA8A 5JT1A 3F2IA 3PNLA 2WVJA 3VC3A 3W1WA 2NU7B 4L95C 2GBFA 2EWWA 2XQFA 2CUKA 3A4YA 2FPOA 1BDMA 4K05A 2AGVA 2R8RA 1E1QD 2X9QA 4QUKA 4CG2A 5ARDA 3VTZA 4E2WA 3SHTA 3H5RA 4Q15A 3E35A 5AM1A 2E6KA 2DEUA 1CY2A 1NASA 1OLSB 3IQHX 1CUJA 3DH0A 2O0HA 4KWTA 2ZBQA 5FEMA 1GUZA 1H22A 3C87A 1J8FA 2HPHA 1I1HA 3MILA 3I83A 3BWCA 4Q24A 1C8VB 1XTZA 3KD2A 3H7AA 2OV1A 1DC5A 3LBFA 4PGHA 4PWYA 2AOTA 2NPOA 2VSNA 4B4DA 4G0PA 1Z29A 2WR8A 2XOKA 4NYJR 3WG9A 1QQAA 4ZRMA 4G9GA 1G21E 2YS7A 1A8PA 2WYVA 1RADA 3LCJA 3DKKA 1A95A 5DEIA 4F8JA 1J90A 1G9XA 2ZRPA 4MW9A 4RPGA 5EESA 5JV5A 1TNDA 3EDCA 4JU9A 5IUJC 3M6MD 1QQ6A 2G5PA 1ZI9A 4TUYB 1CZKA 2RAVA 1K8QA 4MGEA 3U17A 5AW0A 1Z35A 4FWBA 2PVPA 3L8GA 1WVIA 3WSWA 4DABA 1EAMA 1SXJE 3CEHA 4PG6A 3W2GA 4ND7A 3STXA 3WLIA 4EGJA 4GPTA 4RABA 4HT3B 4DRXA 2OORC 2OAGA 3AETB 3MBOA 2Y0CA 3K0FB 1RAIA 1I2BA 4UDNA 3W6ZA 2NZJA 2BL4A 1HE2A 3ZGZA 3VR0A 2NXEA 3L93A 3NKLA 3IQFA 3Q5GA 4BEVA 3RRMA 1IN4A 1TX4B 3RHZA 3ZE1B 4YRMA 4O4HA 3QVTA 2XE8A 3VMMA 4HVAA 4JN6B 1Z7EA 2D3WA 1Z75A 2VQEB 2GTIA 4NNOA 3SBXA 3AHFA 4LA4A 3V7UA 5EIBC 1KS2A 2ADMA 2JDID 2YINC 3NNNA 4J03A 4D9CA 1K1EA 3CLUD 1FFGA 4BV9A 1PNVA 2XNKA 5K0NA 3TNJA 3ETJA 4JSYA 3C6QA 3ZCXA 3IXQA 3DNMA 5EJ2A 3SZ3A 1NQWA 1WCWA 5BSHA 3AUFA 3BK7A 1RMTA 1GUBA 2ADFA 5LQNA 2IWRA 5KZMB 4LMAA 1NW9B 3H99A 2CNNA 5GZ6A 4FCTA 4NMMA 5DNYB 4E03A 4O33A 1H05A 1M74A 2GF2A 4LE1A 1RXVA 2EATA 4YYZA 3MFQA 2M6LA 3BICA 1TC1A 4BFLA 4DCMA 5A7FA 3VYUB 4C5BA 2OWEA 2XUPA 4JJEA 1HFKA 4JNKA 4NMLA 4PLYA 2Z6UA 2I7CA 1YZKA 2D1FA 2QXYA 1O97D 1MJ5A 2QTNA 1H9BA 3D8UA 3NWOA 4FGKA 4IIJA 1DAHA 1U7OA 3N6VA 1I1OA 4H35A 4TXLA 4KN5A 4ZZ2A 4DCSA 4H08A 4DQLA 4EJSC 2FFQA 1EJBA 4EGQA 4F11A 1TIBA 4CEHB 1WB5A 2H18A 4US2R 1MQSA 2CNOA 3ADBA 3A4VA 3KWJA 5EIOA 4KTTE 3QXHA 4AZ3A 5DNCA 2DLDA 3A2LA 3HY6A 3PF9A 2E9SA 4BGUA 4DQXA 1V43A 3T0IA 4PHGA 2Y1KA 1P77A 4EFKA 2FLKA 2RBKA 4LE0A 3RVMA 3ZZMA 1DBQA 4GOOD 5DISB 3P7MA 1IULA 2AE1A 3JD3A 1RBQA 4GPD1 4H1UA 4FONA 1N2GA 1VIVA 1ZEJA 1M2EA 4H3HB 1IUNA 1J0CA 2P3OA 3G7SA 1RAHA 1GSIA 1H1DA 1MP0A 2JA2A 3K7EA 4MGIR 3W3AH 4G0WA 5KWEA 4OHOA 9ABPA 1HQKA 4BFCA 1YQGA 3PTAA 3PFFA 2VUTA 4ESVA 2ZBGA 1XU7A 2HSWA 3G6KA 4IIYA 3Q6IA 5GJVC 3CG4A 1V5IA 1UKEA 3UHFA 4ALKA 3F6RA 5C32A 2EJCA 1U8TA 4M8KA 1R9JA 4IG9A 4A23A 3KSBC 4INOA 4TYWA 1IUPA 5J3JA 1PG5A 4ZC8A 3ER6A 4XSHA 3MD9A 4FOLA 2OQIA 1VJTA 5KQRA 3O8QA 2G9VA 4JR2A 2VXOA 1FDRA 2GKOA 2K6GA 3C1OA 4DDHA 4HAZA 4OHYA 3QMPA 2NNLD 2WOOA 1DAGA 2A3RA 3CJRA 2JDIA 2CEAA 3OJXA 1SPBS 3RRXA 5KQPA 4ML3A 2P2SA 1I4LD 1N32B 1UFVA 2WM3A 4M9QA 3W5CA 5I01A 1SWVA 1VB5A 1JEAA 3NCTA 4MQBA 5JPDA 2OHOA 5AR1A 1WVGA 4B31A 1WRBA 2PLNA 3KWLA 3NAQA 1I7DA 2H85A 4EKGA 3NH6A 3FDIA 1AZSC 3WRXA 4R83A 4XLLA 2HA7A 1RJGA 3JZDA 4C03A 1MX9A 1CZLA 3R3YA 2ZJZA 3ZE9A 1WZ2A 2C1XA 2HIMA 2OXEA 1UP7A 2J9FB 3VVLA 2FPUA 1O97C 1ONNA 1J0BA 1PUXA 4RSRA 1FFAA 1W19A 4KLZA 5DYYA 1P0IA 3CWZA 4CT4B 2Q7XA 4FZRA 5LBTA 1QU2A 4MGZR 1A9ZA 3UWMA 3FYUB 3QMVA 1H5NA 1Y8CA 2SCUA 3WAGA 1THMA 1SNYA 2P75A 1RPTA 2AOUB 5JQWA 2SECE 4ISBA 3LX6A 5LPNA 4E2YA 4LTMA 3RVRA 1QUEA 3GO4A 1WPRA 1VHLA 2UZ3A 1N5KA 1PZMA 3E5NA 5FPTA 4DNOA 3H97A 421PA 3D8RA 4F5ZA 5A0TA 3A3KA 2QMOA 1V6AA 4JI3B 4Q9NA 2I3GA 4PAOA 3UIEA 1UAGA 4O4LF 4G4IA 5DP2A 1QRTA 2YY6A 1G8FA 1N4DA 4HYQA 3WHKA 4E70A 2W4MA 5ETJA 3U44B 4I19A 3U4QA 4KR2A 2PT9A 2QSUA 1XRSB 4DUPA 1R0ZA 3SC2A 2F8SA 1HTBA 2EBHX 4HNQA 2GYYA 2IC5A 4BUCA 3ZHUA 4DOMA 5KKCA 3OOWA 1AF7A 5TPWB 1MA3A 2CVHA 2ZANA 2JGMA 2C31A 1OIVA 1XRPA 1G2IA 2R751 4MQMA 4UM9D 2XJ4A 3K9QO 1PG2A 3GJ0A 3ITNA 3BD9A 3ZDFA 3KUXA 5A7GA 3S2IA 1HDOA 4B80A 2C2MA 1PEKE 5K3AA 1NRXA 1JA1A 1SZCA 3D6AA 3QMMA 3ADOA 2B30A 4ISCA 4DZRA 2ONJA 4B0OA 1T9HA 1UBCA 3GGCA 9LDBA 1C3LA 2PBFA 4UFNA 2ZAGA 4K6OA 4MVJP 5DJ5A 1JFSA 5FF9A 3TAXA 4DCPA 1QRDA 4R6XA 1Y42X 1TD9A 3NT2A 5DBGA 2GBLA 5G1PA 1CV2A 5BSUA 4RD6A 3E7FA 3SJCA 2V7QD 5JZ9A 3LLCA 1MT3A 3ITEA 4MINA 3ZWWA 2C2ZA 2ONZA 3H6KA 1KZ7B 3VTAA 1TF2A 4FSXA 4JZKA 3W4JA 3WXBA 5K8LA 1EGMB 3VR6H 4HQ6A 1DUVG 2FSIA 2G4VA 1ZCAA 4UOEA 1MV8A 5KTNA 2ZYVX 3DVLA 1JQDA 3KLNA 1ESMA 4IMIB 1L7RA 2GB4A 2G5GX 1P4JA 4N65A 4ND8B 4Q7MB 1EGQA 4BVEA 1CEYA 1MH9A 1Z68A 2XMSA 5HS4A 2ACEA 3PQ6A 3WIBA 4MUXA 5CYOA 3TX6A 3ZNNA 4H3KB 3DEKA 4LK3A 2GEVA 1M6VA 4MVJF 3O4VA 3I9OA 5KYXB 3E1KA 5LN1A 3BXZA 4WUVA 5JLJA 2AOXA 3R0JA 1VFNA 2DOKA 2EBUA 5IDQA 3HA7A 3K0KA 2YR0A 4RF5A 4JLVA 2QY9A 4Q4HA 1PNRA 5M7EA 3TLAA 1LPSA 2GZ3A 4PZUA 1RI5A 5CLFA 3H11A 2M9MA 3FF4A 2COUA 3ZN2A 4A4DA 1TMYA 1EXVA 2PH1A 2FZWA 1R4NB 3GUUA 4JBWA 1DP4A 1T43A 1U2DA 2GVDC 2I33A 3JQ9C 4MK4A 4JP2A 2BEUB 2W2KB 3JZIA 4TT3D 2WB2A 3IQGX 1BU5A 1JU3A 2EZ9A 1LVUA 1RLOA 1XAJA 2W5UA 2Y6VA 4K9LA 1GQRA 1I5EA 4PAWA 4XB1A 2IZ5A 5FR1A 4DHWA 1G66A 4QRIA 3U49A 4JWKA 1R0SA 1XRQA 2E4XA 4GKAA 3JARB 2WIDA 4TN1A 2IZ1A 4UU8A 1W0KD 1BMDA 2HADA 3CPEA 3TM5A 4Y30A 3PX7A 1P3Y1 1S4MA 4MR8B 2BDEA 4KQKA 2C94A 2B4QA 2CNWA 3EFEA 1HYGA 2QGZA 3EIEA 3QE0A 4OHKA 3NIFB 3P0JA 3FSGA 3NIWA 1H6CA 4O1HA 1VL8A 2NT4A 4B2PA 5HWSA 3RT1A 2O8DB 3QTLA 2PGDA 3WYFA 1B8UA 2VJCA 4M7RA 4EPVA 4UOZA 2G36A 2RGEA 3U4QB 3LLSA 4ZGBA 4A15A 1JWBB 1MEJA 3JS5A 4L28A 1SU8A 1O89A 4HN4B 1IEQA 4A0GA 1F2DA 4LGYA 5B1EA 2XGSA 2H63A 1Z2CA 4EVIA 3JALA 3FGOA 4PLPA 2QOEA 3H1TA 1BE8A 2UZIR 1IVNA 4D97A 1M67A 5K01A 5JYEA 3QENA 3GNSA 5I7WA 5F9FA 5JWHA 1YB4A 1JLKA 1L7DA 2XTMA 4QD3A 4UBNA 1KJ9A 1BHJA 4JB0A 3T1TA 2G63A 4MVJI 1N9GB 3CCBA 2DWOA 3M0EA 1HZZA 4YRGA 1OTXA 1W75A 2FXVA 1UBEA 1ZPDA 2I2XB 2WF8A 2AOUA 3EXIA 3I30X 3TNDA 3OQIB 4CZ2A 4O2RA 2GXQA 4M3NA 2CV0A 4A6PA 3GJSA 1CJCA 2AVNA 2BHNA 2E89A 2J6BA 3C2QA 5AVOA 3D8TA 2O20A 1QWSA 3ND8A 4YREA 1SEVA 1EK1A 4I08A 1CUUA 3Q85A 1ZWKA 1Z4NA 4Q3NA 4LVNA 1C2TA 1ESDA 3NETA 1VMEA 5E9QA 1XZ8A 5EHGA 1E59A 5JC8A 2J3KA 4GZLA 4MHSA 4QYSA 1KOJA 2BMWA 5ALTA 1K7FB 3RG2A 4CQLA 2F48A 2O3QA 1P6QA 4RMJA 1HX7A 1JXMA 1U0GA 2HF9A 3DS8A 4LNHA 1PR1A 3MTQA 5CW1A 3TL3A 3VAAA 3ZJ4A 1T4MA 2Y1DA 5JZBA 2FEXA 3WSTA 3CUTA 3OF5A 2RHRA 4GICA 5K7SA 4X54A 5EKSA 4JOBA 3G2PA 4MSUA 4PX9A 5FPHA 1X38A 4G4SP 1CQIB 4PN7A 2GA8A 3I9JA 4ZFNA 1RXWA 3O7MA 4TXNA 1JECA 4LC9A 5FPSA 1QKJA 4L8WB 4Y2JA 4PTZA 1U7WA 3QVOA 5JSZA 2AG0A 4MUNA 3M3PA 2BFPA 2VHCA 1XKQA 3E8SA 4G1MB 5EMMA 5FRDA 3ENKA 4OVKA 2PSSA 2K7FA 1RRPA 2CJFA 5AI8A 2XTNA 3F1KA 3DUFB 3TZCA 2DHEA 2GJSA 2HRQA 2J0EA 2WJIA 5ICMA 1Y3DE 3JY6A 1W1IA 4FB4A 3FYHA 4KSCA 4MIKA 4AZ0B 1R0CA 3GIWA 5ELMA 5EWJA 1T2FA 3N28A 3SSOA 4ERNA 3VU9A 5DGTA 3NWEA 4GRDA 1J2UA 5DV9A 2G4LA 2YDYA 1SM4A 2WC1A 2CMKA 2WAXA 1QHFA 5LQAA 2FQYA 1LVHA 1NQUA 1URPA 1JHXA 3DO6A 2WF7A 1T36A 3IA7A 5TQ2A 5DM60 1DCTA 2GCEA 5TMBA 1UBJS 1ZW1A 4BNDA 1UOPA 4IJQA 2RGRA 1BS2A 3C6ZA 2IEYA 2ZFUA 4B3HA 5ARBA 3QHPA 3AU9A 3ORSA 2FUG1 5IT9A 5EZQA 1KU6A 5CFPA 4RHUA 3LUDA 2H0RA 2QSZA 5DGDA 2V97A 1SVUA 5D87A 4W9MC 2VF5X 4PC1A 4CQMB 1MORA 1U11A 4AUKA 1EAYA 5CFMA 1AT1A 1YRQA 3ZHQA 3R9XA 1XKLA 3K73O 4PZCA 1JWAB 1OGJA 1HURA 4FX5A 1BA3A 3WRWA 1ENYA 1KQGA 2J7PD 4LBWA 4D4MA 1PJAA 3KEGA 1LQUA 3PF8A 2H2GA 2V6JA 1U0NA 3WIDA 4HTAA 3AO0B 2VWHA 3A3YA 3OT5A 2LNDA 3HL0A 2G5TA 3TQQA 3OESA 4EGCB 3B9BA 1L8QA 1J5PA 2YXDA 4RPLA 4E5KA 3GLIA 1P1IA 2NV2B 2HSGA 3LOPA 4NH4A 1C0EA 3ZWYA 4M1TA 1I24A 2ZXUA 1C9MA 3K6RA 4GOND 4MR9B 3K1JA 3PFHA 4Q1AA 2I8LA 4I4TF 4Z7JA 2YWDA 1B16A 2NO1A 1Z5PA 3NYWA 4DGSA 2FDCA 5KYWA 4B17A 1KEEB 5H9VA 4UTOA 1AKVA 4UOQA 4P08A 1JLRA 4TLCA 3BG5A 5K0GA 4U0JA 2XR1A 4DNPA 3NNSA 3S29A 3NM6B 3R9XB 5LQUA 1R0WA 2FMUA 1F4LA 1IOZA 3MRVA 4PICA 4CQMA 3EQZA 2PL9A 2R87A 4K9MA 3UC9A 5JHGB 2PEYA 5T3YA 1XAHA 3PC7A 2YFYA 3NT5A 3FPFA 2PWPA 1FFDA 3PFGA 4C4PA 1FU4A 3LOUA 3EPKA 2XQJA 3AK4A 2QN3A 4JLDA 1SXJA 3FKQA 1T5HX 2VJPA 3KQOA 3MYYA 4W5WA 4C0WA 3T3PB 5FUQA 5NLLA 1SCIA 2QGFA 5BSGA 4BNMA 7ABPA 4NE7A 5BWMA 2O23A 1ZA2A 1USKA 4Y6GB 4MIEA 4F5EA 4LKRA 4RIGA 1II8A 3PUXA 1TEHA 1IY1A 3DE1X 1OKKD 3HUTA 3MWGA 3COJA 3VH1A 5EAIA 3RQIA 4IQ8A 3Q8KA 2WPDD 4F1KA 4ADSG 3IOCA 4LY0A 3X1JA 1SC3A 3VNQA 1KMIY 3F71A 5G1NA 3X1KA 2ZRHA 1OB5A 4BBPA 5J1SB 1YB2A 3VOBA 1WCIA 1Z73A 4YV7A 2ZYTX 1RW4A 1HE8B 4AWBA 4XFKA 4FEYA 3L4JA 3RG8A 2PRZA 4RA9B 1XTJA 1Q20A 2PUDA 3Q15C 2GEDA 2G1JA 1ACLA 1RHUA 4WESA 3I6QA 2RGBA 5LZ5A 2AMLA 1FUKA 2R2AA 1SRRA 1T2AA 1UBNA 5H82A 1JZSA 1MAVA 1KFCB 1WG8A 1G5TA 4RD1A 2YHIA 4QECA 3DPIA 3MUNA 4RKRA 4M76B 2FB9A 3LSYA 1FXUA 2QVBA 5F2EA 1FMFA 1HLPA 2GRUA 3E2MA 4GC9A 5D6OA 2UYGA 4NULA 4A8JA 1WXXA 4RGVA 1Z4JA 4LTNA 1JE0A 5ADHA 3UGJA 4BN5A 3F46A 4HQNA 1QGUA 1NJGA 1E60A 4RF4A 3LP8A 3ZR4B 1IJFA 5EWLB 2OYRA 1C3JA 1V71A 1Y7IA 3VZBA 3WDMA 4WJLA 4Q7LA 3BMQA 2HJGA 3DGFC 3IP5A 3M6IA 1UK9A 4HH1A 4KPUB 4XVQA 3V8PA 4DJFC 1AUVA 3P5SA 2X0FA 4YDRA 5J5VA 1DADA 4DMFA 3DOEA 2V7GA 4KBFA 5ECDA 3VDRA 2RK4A 4BQPA 4MPPA 2ZULA 2CHVA 3O1HB 4N5MA 4B71A 3N74A 5KQGA 4ODIA 3R7AA 3RRYA 3LF2A 5DHQA 2BYTA 1NVEA 5E6RA 2JJ8A 3EXIB 2JLQA 3UUEA 3H4VA 1SXQA 1UDRA 3GZTB 3OI7A 2BWJA 2JGKA 2QNIA 4IEEA 1RCFA 4QUAA 4BE4A 5CG2A 4W6ZA 4P92A 1LK5A 3Q11A 3KZMA 3A10A 2C5SA 2BUAA 3MT8A 5CM8B 3EPRA 3WMXA 5JS2A 4TLMB 4UPDA 3RC9A 1F7UA 3TLKA 1MJHA 2W2LD 2BZ0A 2YX1A 3JATB 3DJFA 3K5HA 5I3CA 2AUNA 1X13A 2NUAA 4RL6A 3TBKA 4CMCA 3IVGA 4HL6A 3REOA 1A72A 5JARA 2J30A 2NO5A 3LVRE 4CPDA 2Z9DA 1V5EA 5JRZA 4Z8YA 4F92B 3LPDA 5AI9A 3CU5A 1UADA 1NVMB 5LDDC 3DVQX 1VL2A 3WGMA 1HR0B 3TZQA 2CL7X 2OOKA 3ETDA 3EZXA 2BMFA 2VWQA 4RFSB 2QPAA 4WUTA 2X1HA 3HY4A 2VYCA 2A9VA 5EHQA 5F7OA 5IANA 4V0OA 5C51B 3C6BA 1P5JA 1NFFA 4CLHA 5J43A 2AD5A 2Q2OA 3TZLA 3GCXA 4YMHA 1TYAE 1X80B 5F9MA 5AKLA 1KH2A 4BZQA 4E5PA 1Y6ZA 3KYCA 1RPJA 2ZSFA 4BX0A 4PZPA 3H1BA 4UAGA 2Q5LA 3UAXA 4BVFA 5JXJA 2FZ4A 5DKFA 5FTMA 3GLIE 4OHRA 4J7CA 1RKXA 2RMKA 2PM8A 4PO1A 1S2MA 4YRLA 1GCUA 3WO0A 1ML3A 1UMDA 2QM0A 1BGWA 1Z3CA 4AJJA 2EYQA 5HCIA 3WAJA 2XCOA 3QY9A 3U0BA 4O3MA 4KN6A 1CETA 3CRVA 1YSCA 4O2AF 1XJQA 4P2GA 4Q39A 3V1LA 5FWXB 1LDNA 2B0JA 3RF6A 2R1TA 3VR3A 3NTVA 5T4BA 4LMPA 3IUYA 5TIIA 3TINA 3HY3A 4ZGGA 4DKJA 4ZVRA 2I29A 5HHTA 5LZ4A 1CDZA 1QKKA 3QIAA 4DNXA 5KTMA 2HA3A 4X7RA 5I7FA 5EP2A 4IIXA 3WIOA 1QDEA 3GAAA 1RRFA 1YOVB 2FPIB 1NW5A 1GOTA 1ZN9A 1YB7A 4Q19A 1J1ZA 3ZE8A 2XF2A 4NOJA 4ZVOA 3ENQA 3R6GA 4YONB 1NC1A 1Q1NA 3TD2A 3T5PA 2ZXFA 1V25A 2XYHA 1S4QA 2QIOA 3RTGA 4D3SA 2GK6A 1GAEO 1PDOA 4H18A 1BXKA 5J2TF 3LC2O 3G8CA 5BSVA 1K06A 1JPNA 4AJ4A 4LZAA 4ZGWA 2XE4A 5JI3E 2PGJA 1AN9A 4R5HA 1QH9A 1JKXA 1FTYA 4IVPA 5EWJB 2X8AA 4WXYB 1E3EA 2JD0A 5FFMA 1LQ2A 3TZBA 5E6UB 4AZ0A 1UR5A 4G86A 1XD9A 4PY2A 1EHIA 2VJMA 4IQFA 1DXYA 2JEYA 2KS6A 1VGVA 2OGSA 4RY9A 3ZLBA 1PKEA 2IYFA 3LD9A 1F2TA 4IDNA 1RLTA 3OC6A 1N0WA 1N7GA 3OIVA 1KDOA 2FWAA 3LYAA 1T91A 4PYKA 1GQ2A 4RK0A 5TSDA 3GWGA 4FFWA 2BMJA 4WLEA 2RGAA 4Y6RA 3RREA 1AIPA 4ZEXA 4MJ3A 2BTQB 2C4VA 2GLTA 4AJEA 1F0YA 1NY6A 2W4QA 1UJBA 4IDHA 2CJYA 4HAUA 2ZYSA 2BFBA 4LOAA 3TN7A 4IWYA 2Q6VA 1G4UR 4XIGS 1M1ZA 1DIAA 4FNGA 5G3ZA 1RYEA 2O0LA 3QF4A 2WJVA 3NHYA 3AIOA 3E5RA 3KU1A 5DCUA 3DDZX 2OCKA 3R6TA 7ADHA 1AQIA 3K1ZA 1LWNA 1VE5A 2VYND 1ZD4A 2ZRQA 1H69A 1UBLS 1ZM3A 4PXSA 5M5BA 3B1WA 2BBOA 3NRJA 1LK0A 4MPDA 1EBUA 3DL2A 4HQ0A 2AG6A 3A1UA 1LTKA 2P30A 4OQMA 3A26A 1T5BA 3CUSA 2YY5A 3AINA 4I55B 2CYBA 1RD4A 1S9HA 5CEJA 5IRCD 4P3OA 5K8JB 3F7NA 3SJUA 1Y9AA 4LSGA 2JI8A 4HN2A 2ZSKA 2H1CA 4PZEA 5B1YA 4D46A 4W1QA 4PQRA 1R8QA 5A04A 1N1MA 1XNRB 1GZUA 2EFHB 2OC4A 2Z5LA 4M8LA 1KEVA 3RGWS 5B3KA 4WCFC 1L7QA 2P9ZA 4ZALA 1JU4A 3MUEA 5CG1A 4E13A 2BKEA 2N75A 1V5GA 1KRXA 1QGUB 3OD5A 4F4JA 2C5BA 5IMBA 3DCNA 4Q3BA 1R6TA 1YE8A 2BBSA 4F84A 2W90A 4C0LA 2V1XA 5T6MA 3KQUA 1TKAA 4KQHA 4ZXFA 2JLUA 4ZU3A 4MA0A 3ER9A 5EYPB 1C9KA 2VATA 1KK2A 2GZSA 2DXIA 3UTDA 1RYZA 4AG3A 5KNCA 2M6KA 4LVOA 3DLTA 3SKVA 1VDZA 3DHWC 4X6XA 4CT5A 4KSBA 2DKNA 5E7QA 2RI0A 1K7YA 2HV9A 4C5AA 1PL6A 2BLLA 4OHPA 1CQJB 2VPIA 3LOQA 4Q82A 3UAZA 1QV6A 3WYEA 4IIEA 2ODBA 1IATA 3HDYA 3OZRA 3U3OA 3ZDQA 4DCNA 4DR3B 5HKKD 3NBXX 2PFSA 3Q12A 3RC2A 4MCHA 3H8SA 1PTJC 1XCMA 4MW7A 3T5CA 4C7OA 2ZJ7A 1PR9A 3DXXA 1MC1A 2VT7A 1F2VA 1XXHE 2GJ4A 4HY3A 4W5TA 1EJ0A 1A97A 1E1RA 2FOXA 3IV9A 4I46A 2HJ9A 3SCZA 4EUKA 2R1UA 4DIFA 4DMCA 1PQYA 2W2XA 2I91A 4HB2A 4U02A 1KS9A 4PS0A 5DX8A 5A0FA 3U19A 1Y34E 1E32A 2V45A 2ZRJA 1U1CA 5CIQA 3D1LA 4G5GA 5ESXA 2A78A 4BL5A 2WA2A 2XF8A 1QGED 2FCAA 4JKYA 1TGVA 3FHOA 2C61A 3GRZA 3OT4A 3OTOB 2A5DA 3MCAA 4R7ZA 5EJ4A 1REQB 4CL0A 3SJBA 4R9SA 5LIPA 1U3CA 3B2NA 3C7AA 4WLUA 1E2NA 4HSEA 4EH1A 3GEPA 1GPAA 1YJ8A 4ZHQF 1P39A 4UBLA 4CM3A 1J00A 2IHZA 3DDNA 3O21A 4F86A 5SICE 1TYDE 2D00A 4BQIA 5B7NA 3U5TA 4I14A 3EZYA 4KHPB 4DBLE 1YQUA 2QJTA 3KYDB 1SCQA 2FI1A 1SURA 3QKSA 3MCVA 2JRLA 3FA2A 5ITZA 1O8BA 3WP1B 3QG5A 3V8RA 2YS6A 1HKHA 3ZQUA 4C08A 2A8YA 5DHUA 4PNEA 3U6KA 3DEYX 3PQDA 3JQGB 4K5QA 3MCUA 1GP2A 3EZ2A 2XYVA 5DMXA 4HADA 2QMUA 1RSZA 4M53A 4C30A 5KNBD 1BOOA 1OH7A 5F3DA 2VK8A 3NTQA 2AWOA 3IAS1 3KEMA 1MDFA 3F97A 5ALFA 4CLOB 3FKSD 4EHLA 3VKFA 5EIBD 4HF7A 1TA4A 1XZNA 2PL5A 4R1MA 4DS3A 1F3OA 3L4SO 5C4GB 1JHRA 1GSHA 1QJCA 2HDWA 2RB5A 3OJFA 3S8YA 3TRKA 2R25B 3AFMA 3IUJA 2Z4TA 4ZT6A 2ZAYA 2G0TA 1DBSA 2VTBB 3SEQA 2Q46A 1K4KA 1VPVA 4RK7A 3STHA 4CI0B 4XUEA 5D86A 3H5OA 5HRAA 4FYPA 4JLBA 5F4BA 1V26A 4MGKR 3SYKA 4CEIA 3HGMA 3DVSX 4EY8A 2HWYA 3C3MA 3GB9A 3JR7A 2FYTA 1XDZA 1MW9X 4YJGB 4R01A 1OLOA 2VI5A 4IIGA 2FJUA 4N3NA 5TXGA 4ZJYA 2J6IA 3LUAA 3BF8A 2JFPA 1KAEA 2Y27A 3IB6A 1YZTA 4WHMA 5TLSA 4QT4A 2RONA 2OCAA 1BA2A 2V7QA 3DFKA 2WJHA 4LYEA 3M9LA 3TSZA 1A2BA 4QQKA 4PAQA 3AZOA 3AERB 2Y2UA 3H4MA 1PAUA 2BEVB 2PUBA 1KI4A 1K2WA 2N1MA 4BO5A 1R2QA 3G9UA 3WYGA 3AEKB 3EXG1 1AKNA 4QUHA 2YV3A 4OFZA 1CVRA 1R0RE 5FAKA 4KXFB 3A2KA 2AHRA 3DKPA 1L4MA 3SYMA 4X24A 5BSWA 1FU8A 3KKEA 3I1FA 1B8VA 2VRBA 5IJ0B 2XNCA 1QRAA 4XVHA 5LU9A 2GCOB 2Q1UA 4YAOA 1TK3A 4EBFA 3GYGA 3A28A 5LM3A 1UOQA 2BR3A 2CJWB 4H1WA 1YE3A 3G1TA 3BMQB 1LA2A 1AKQA 4H7PA 4ZQBA 4AX4A 2GPYA 3VHLB 4URWR 3IBSA 2X9NA 4JEUA 1DAIA 2GWRA 2VKQA 2JGJA 1GAXA 3DCYA 4AULA 5CA0F 4EJ2A 1AUQA 1JEYA 2O0JA 3H3JA 1E6MA 3V80A 3VV2A 2B82A 2HMWA 3H5LA 3WLAA 4E88A 5F35A 4R8SA 1CQIA 1W4BA 3IUMA 2GZAA 1PJZA 1XZAA 3R5HA 4K8OA 3EQ9A 5GVSA 3AJRA 1AZLA 3HGTA 3L1IA 1JLMA 1M2VA 3LO8A 1GQYA 4FILA 4ENUA 4RE6A 4WFJA 5HM8A 3OQMA 4TOIA 4NATA 4EL0A 1J23A 1GTVA 1VCMA 2HOQA 4BLOA 4RPJA 5TS3A 1G20A 3ED1A 4D0GA 4FYKA 4B3DA 5CB6A 2ZS8A 3PRJA 3KLMX 4B44A 3IALA 2CVZA 2GM4A 4ZRDA 2XB6A 5FUWA 2FPPB 1YZQA 1NVAA 3I6YA 1MX3A 4QGBA 1AK9A 9LDTA 2ORVA 5J2TA 4H6WA 1A4RA 1C7IA 2QW8A 1MO4A 5JQGA 3C6XA 4WNAB 1ZW6A 3AT1A 3FN4A 5AHRA 2IEIA 2QTFA 4MKFA 3WKDA 4LHXA 2HLDA 1UJCA 5H83A 1YBFA 3GC6A 3HBAA 3KXIA 4OX9B 3PC4A 4IDQA 1BDBA 3DOUA 3RAJA 1ADGA 1ZOSA 3AY0A 4N5HX 2AMJA 2HIHA 3FAZA 1WX1A 2P9FA 4PU0A 5JRDS 2LPMA 4JXJA 4IH1A 2G82A 5AKJA 4AWAA 5BMOA 1WDMA 3PDUA 5IABA 1VP3A 1I4TD 1FZQA 2NYAA 4PQYA 2XQKA 4CU5A 4FK8A 3QQPA 2OFOA 2QUKA 3BMXA 4QDUA 3DAGA 3LX8A 1VZ2A 2GPBA 3ILSA 4V1CA 4C0JA 3DJYA 3AR4A 1L7MA 2W43A 1UK6A 5KAMA 2JCBA 2VP4A 4AJHA 3C3BA 2QRPA 1HDYA 1GRNA 3CB2A 3HBMA 3P32A 4LBVA 2B1GA 3RRFA 2NYUA 4WASA 4DLVA 1BCRB 4UTVA 3S2GA 5A5FA 4X91A 1Y9DA 3AMVA 3M4JA 3VFDA 2DTDA 2GEUA 4Q3EA 2XUHA 3D7KA 1XNJA 2A1UA 4PX3A 2C7QA 1XZPA 3UJ6A 1KR5A 1R66A 2XMPA 1K8ZB 3DDOA 1I3NA 2X3UA 3O7WA 3UNXA 3NKVA 4AKIA 1NQAO 4PR3A 3V32A 5T8KA 3EFBA 2PMDA 2GEKA 4FBGA 3F4KA 3FAKA 5AD1A 3MINB 2EJWA 1HDIA 2IZ6A 3PWSA