5DNCA

Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t19a
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
354
structure length
354
Chain Sequence
b'ERHLLLIYTGGALGMQSKGGVLVPGPGLVTLLRTLPMFHDKEFAQAQGLPDHALALPPASHGPRVLYTVLECQPLLDSSDMTIDDWIRIAKIIERHYEQYQGFVVIHGTDTMASGASMLSFMLENLHKPVILTGAQVPIRVLWNDARENLLGALLVAGQYIIPEVCLFMNSQLFRGNRVTKVDSQKFEAFCSPNLSPLATVGADVTIAWDLVRKVKWKDPLVVHSNMEHDVALLRLYPGIPASLVRAFLQPPLKGVVLETFGSGNGPSKPDLLQELRAAAQRGLIMVNCSQCLRGSVTPGYATSLAGANIVSGLDMTSEAALAKLSYVLGLPELSLERRQELLAKDLRGEMTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-asparaginase
publication title Experimental Data in Support of a Direct Displacement Mechanism for Type I/II l-Asparaginases.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Hydrolase
total genus 117
structure length 354
sequence length 354
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00710 Asparaginase Asparaginase, N-terminal
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
A PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5dncA02
3.40.50.1170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold L-asparaginase, N-terminal domain 5dncA01
2OCDA 1JSLA 5DNCA 1WSAA 3NTXA 5I48A 1JSRA 4ECAA 2WLTA 5DNEA 3ECAA 4RA9A 1HO3A 1HFJA 5K4HA 2GVNA 1NNSA 4Q0MA 5CBPA 2D6FA 3PGA1 4R8KA 1IHDA 1HG1A 3NXKA 5K4GA 1O7JA 1WNFA 4NJEB 2HIMA 5K45A 1DJPA 5I4BA 1JAZA 1HFKA 4RA6B 2P2NA 4R8LA 1HG0A 1ZQ1A 2JK0A 1AGXA 5K3OA 5DNDA 1HFWA 4PGAA 2WT4A 1DJOA 4RA9B 2HLNA 2P2DA 1WLSA 5F52A 4NJEA 1JJAA 5I3ZA 4RA6A 1ZCFA 5HW0A 5CBPB
chains in the Genus database with same CATH superfamily
3PWSA 1D04A 4KGZA 3X1KA 6CHYA 5A5EA 3T3EA 4RTRA 2UXDB 3EOAI 3O1JC 4KOAA 4U0KA 5ADUS 2IHUA 3NIDB 2UVPA 1SKYE 1XP8A 3PYLA 2BHRA 2OHHA 4BLRA 3B51X 4K8OA 2P41A 1HDGO 3JQ8A 4L9SA 1U1IA 4O2LA 5SYNA 1CXZA 5DF1A 2VF8A 2QVCA 3LGSA 5IDQA 2QRKA 1KJJA 3WJ1A 2NPOA 1V47A 3W2HA 1A9ZA 3H86A 2Q6OA 5B6IA 2PWZA 1NFRA 2HT1A 2V7QD 4C03A 4E31A 4NQRA 2JIPA 5BNZA 1T15A 3M2TA 3PFFA 1UK6A 1O6CA 3DZKA 1QKJA 2IUYA 5UKDA 1IPEA 3HNOA 1NBME 1WHTA 2TSYB 4H7FA 3D8HA 1OY1A 3H5NA 4MPPA 2ZCJA 2J0QA 2G4VA 1TYBE 3VPHA 4D5GA 1G9SA 4EUEA 1CUFA 1HC7A 3EF3A 4QHYA 2WDZA 5IBPA 3AKYA 2ZW9A 4PTZA 3OESA 2B1RA 4LZJA 2I4NA 2J32A 1R9GA 2CWDA 2VQ6A 2QI9F 2WVGA 1NLYA 2WTXA 4OHCA 4YDRA 3T9BA 1B3RA 1VXRA 2MHCA 3QTTA 1QP7A 5AI4A 4GOKA 5K05A 2C7OA 2XBUA 4UVEA 2ONCA 1M2WA 2Z83A 1FTGA 4Z4HA 1E64A 2BFWA 2C92A 5EZQA 3CVJA 3I39X 4FGSA 1WETA 5I7VA 4LZLA 1E59A 4Y2XA 1OV6A 3KVYA 5KZMB 2OG2A 4KUGA 4OHKA 2MJLA 1ZK4A 3ILVA 1TL7C 3STVA 4DDVA 2FUKA 4KMMA 5AW0A 1EA7A 3HJHA 4XWKA 3U3JA 5BVGA 3P8ZA 1RWBA 2FOXA 2JZCA 1VCOA 1CUDA 1XTIA 4JGGA 3D3KA 2XCLA 3AT1A 1LBHA 1Y34E 1AUQA 1MTOA 2D3WA 3AEZA 3IBYA 3PVCA 3AJDA 1WUTA 3PUKA 3WLLA 2GZ2A 3G8BA 1YBAA 3LXRA 4IM7A 2JZOA 1NI4A 2WE8A 2YNMC 4Q3DA 3V4SA 2BGWA 2OC4A 1F5NA 4C5AA 2IPOA 3M4XA 4NFSA 2XTMA 3RU7A 3MQ2A 4WECA 1K3FA 4DCNA 4N49A 2Y1CA 1PHPA 4ZT7A 2H4HA 3CBQA 1KQFA 5TF0A 3W5JA 5BXYA 3G7SA 4Q9DA 2GVNA 4R2WA 5IJ9A 2EWMA 5BR1A 4G89A 2QJRA 3QEKA 2APJA 3CZQA 2C98A 4GXTA 2OM2A 1QQ6A 3KWMA 1WSWA 1X7GA 3LP8A 3MAAC 1RXSA 4TWRA 2FG5A 3ADPA 4DCSA 2GRUA 5DNAA 3C24A 2ES4A 4X1KA 4MKGA 3EC7A 3PJRA 4NCBA 2P9JA 4MR9B 5CLHA 2WJ6A 2J3EA 1ZU4A 1LBQA 4D9JA 1Q95A 1W52X 5IYZB 1YKGA 4N0MA 2NYRA 3SBOA 4BNJA 4B74A 3KKOA 2XLBA 2XMZA 4XIYA 1QR6A 3OPMA 4KHZA 1L7XA 2OGUA 4OXNA 4MLDA 3ZY2A 2WHQA 1VLMA 5KNDD 4ZYXA 2J48A 3G88A 4ZQGA 5L3VA 2E4UA 4C6SA 3QIAA 5AI6A 1VCIA 2V4ZA 3A58B 1DC8A 4IDDA 2XYGA 3U39A 1T8RA 3JCZA 4YRTA 1GZUA 1NUHA 4MAMA 4QBIA 4X71A 1H6DA 3ZGNA 1B14A 4F6RA 4KPEC 1R9JA 1KZ9A 3QXHA 1QHFA 2CLEB 3KVOA 3V2HA 3KOWA 3U3DA 3K9GA 2XV1A 2JVKA 5DH9A 3UOWA 1JN0A 5KSOA 3L7AA 1UBRS 3SXUB 4O1IA 1P74A 4WGFA 3U09A 2O7RA 5DFAA 3RJTA 1XJWA 1X74A 3ZHQA 3ZLVA 3V8MA 2VF7A 3CF2A 4IDAA 3UA4A 1EK0A 1JR6A 2CB9A 1QZUA 1ZG3A 3EA0A 1KI4A 3ETEA 3O4RA 3UMBA 3R0ZA 1H5UA 1MVOA 3DFUA 4RTKA 3OBBA 1G7SA 1YTLA 3HBAA 4AJHA 2Y1WA 4JLBA 2ZROA 4G26A 3ZGLA 2OCBA 2HA5A 3E84A 4MR8B 5BURA 1GDHA 4I1SA 3GLGA 3ZU3A 1PZGA 1YFJA 2AMFA 2CNWD 3RBXA 5H16A 2ZULA 2IYZA 3H2ZA 2FJPA 1I7LA 3KAPA 4IVRA 1QHHB 2EHJA 1L7EA 2JGDB 5JZBA 5A4IS 5AK0A 4XOUA 5F21A 2BGRA 2ISCA 2A88A 3WYFA 5FHRA 5JD6A 1D2CA 2QSZA 3WMRA 1U0FA 1GUAA 2HHLA 1NXWA 1XZQA 1SR8A 5IBQA 2B61A 1T4MA 4KGXA 2I67A 3NBMA 1L5FA 4XSVA 4DMHA 4BLSA 4Q6WA 3A6GA 4QGSA 4PPFA 4A9AA 4A10A 4IUDS 3QVMA 1U0OC 4ZICA 1G41A 1HY3A 3WDKA 1P1BA 2RB5A 3JD3A 3VBEA 1WB4A 2AWNA 3H1PA 5CB8A 1CUWA 4PGMA 4QTZA 3WGQA 1N5IA 2ZWVA 4P4UA 4X94A 4ZD6A 3B20A 1GPAA 5CVCA 2I29A 3DE4X 1JZQA 2C9ZA 1IY0A 3KXIA 5CVJA 5SYAA 1U8UA 4DIEA 2Z5LA 2FK8A 4MQEB 1V16B 4Q01A 4D79A 4EHNA 1RPZA 5G0VA 3W5IA 3GZTB 1EVKA 4RV9A 1XV5A 1E2BA 3RTGA 3L4EA 3UMMA 1BE8A 1F6DA 2XWQA 3DEZA 3DKIA 3FSRA 3PRYA 4O4IA 3LK7A 3NWBA 3M3DA 2CLMB 1V1MB 1CLUA 2YXNA 1KTVA 1BX1A 2DBZA 4PC2A 5LWQA 4XJXA 1RHMA 3MN1A 2AJLI 3QQPA 3CN7A 1A9XB 1ZN7A 4TMKA 2N42A 4WLUA 5DTRA 1PSZA 4NPAA 5AI5A 4M1SA 3ENKA 4NK4A 4XA8A 4A0SA 5BW4A 1QLJA 1QANA 2ZUCA 2AR7A 4P93A 4ZGBA 1RXEA 1D4AA 4OHVA 2HY7A 4EYSA 1O03A 2W6JA 3V1MA 2WW8A 1K2VN 1D2HA 3GVHA 3WJ2A 4FKBA 8OHMA 3HKCA 3FRIA 2GEBA 2HCBA 1ECGA 3A9VA 4TTRA 2YBEA 4OQXA 2GN6A 1QCCA 5JSKA 3C15C 4KRXA 1AH2A 1U9IC 4UEWA 1PEYA 1O77A 3I8SA 3QY9A 1TCUA 1LI4A 1NP3A 4JVSB 4RZSA 4X85A 4D4HA 3T1YB 1AK9A 5E1MA 2Z2JA 2WV7A 4KMRA 5DGDA 2B34A 1FFWA 1K6XA 4P53A 1AZSC 3K9NA 3RV3A 4K26A 1XRLA 4ALIA 1SURA 3IQDB 2GM9A 4GXRA 1BO6A 1ZSVA 4PF1A 4WA8A 4UCFA 4YJ2B 3GFTA 3SXPA 3W2EA 2IHNA 4RJIA 1UBGA 4YRIA 1BMTA 5C8VA 4HMPA 1P5ZB 3MAJA 4LJRA 3ER8A 4FUQA 1H0RA 4FOLA 1DBPA 3C1AA 4NOLA 5BYAA 2UAGA 3TPZA 4ZEWA 1G38A 3AHJA 3SS8A 2YOHA 3B7GA 3MJEA 3VZQA 4JJFA 3K2BA 4K86A 4YAUA 3PUJA 3P2YA 4D6PA 4EUKA 5FLXA 3AUYA 3OFVA 3ZVKA 3H4TA 3OU6A 2XDWA 2D3TA 3VHXA 2IYFA 3TS1A 3LF2A 5B64A 5FNVB 2ZOSA 4ARCA 4G3XA 4EATA 1NJ1A 4OXXA 3NHLA 4R4JA 3NV9A 4TM8A 2XA9A 4V24A 5DLPA 4ENWA 5KS2A 3AVTA 3B2QA 3CN9A 3SHWA 4YXWD 1PLJA 2B1GA 1NW4A 1R00A 2NV6A 2ZJ2A 4DUPA 3IAM1 4B8YA 1W1UA 2AOWA 1KI6A 1OGJA 3E3OA 4OREX 5P8WA 2H0QA 4LY0A 5BORA 2JLSA 1PK7A 1IIRA 3GARA 3G8YA 4WRRA 3T12A 3OUUA 1P2TA 3VR2A 1P1HA 1I32A 2XWSA 4Q00A 5LR6A 1EVJA 3NHSA 2FPPA 2F8LA 5I7RA 2FPUA 1GFIA 5C18A 1Q20A 2FYTA 4PU0A 4XOIA 1M5TA 4KFUA 4UUQA 5GJVC 3OECA 1QZXA 3BD8A 4IF6A 4MWTA 1T36B 1BW9B 2C00A 2JFNA 4RSRA 4DXDA 3PUHA 2CV2A 1N77A 4WOBA 1W36B 1Y3BE 4MQMA 1KMMA 2KWIA 1UXGA 1V1JA 2R4TA 3ZCPA 2H9AA 4FE4A 1Z25A 5EP3A 2E4AA 4OHPA 721PA 3JWHA 3QPUA 4YQFA 1P5FA 3LXMA 1U2GA 3KUCA 5HUQA 1LLQA 2AUTA 2VDJA 5DYTA 1SXGA 2DH5A 1JPUA 3NWOA 1FRZA 4M60A 4BZQA 1WF6A 1GKLA 1GVNB 5HNKA 1QE5A 5FJJA 2C57A 3A1NA 3EZ9A 5G1OA 1WP4A 1L5HB 3QU5A 1M66A 1ZUNA 4W4TA 4HOYA 3QNUA 2IIPA 3AJ9A 1KBOA 4IUYA 4TQUS 2OK7A 4KO8A 4NV0A 5KDOA 4BNZA 1DWUA 3T35A 3JU3A 5JZ9A 1E3EA 1G291 4Y6RA 4ZFNA 1VIAA 1IEXA 3RC9A 4AO8A 2CNBA 3E27A 3RS0A 2WINI 3C5HA 1FXWF 1MEEA 1BZYA 2IXGA 3VYWA 3PHGA 1CVIA 3CUUA 4CMBA 4G0VA 2OT3B 3QYFA 3STXA 2VJYA 3HCWA 1I4LD 1MKYA 1O5TA 4J0FA 1NWHA 2IYAA 1TADA 1CC1S 2YBDA 4IL5A 4UOQA 3I01A 4X41A 3A7EA 4MGEA 3HJRA 5CX1A 2EV9A 2WILA 5ERYA 1PW7A 4G8BA 2G08A 1RYFA 4Z86A 2CDCA 3WB2A 3WICA 4FSXA 5GGXA 4DJDC 3SX0A 3A4VA 2C4NA 2QQGA 2W2VA 3KFLA 2A30A 4O6VA 4WCFA 2FCRA 2HQBA 5F2OA 3KR2A 3KELA 3GDGA 2ZANA 1CUXA 1MC4A 3TB6A 4PO9A 2HQSA 1BCRA 3P0IA 5LP6F 4YP6A 5HF8A 2LCFA 1GNPA 5J58A 3UH0A 1T1EA 2F4NA 2Z3VA 2NO4A 4RVOA 4XQGA 1X15A 2R0QC 4OU5A 4G5RA 1PVOA 5A5FA 4JUCA 2LNDA 1S9DA 4BRWA 4A6DA 5JS8A 1UM9B 1QYIA 3E7WA 1D3AA 4RD4A 5H0IA 1PJAA 3P26A 1XQVA 2WHXA 5JSYA 5GVSA 1WZCA 2GPAA 4F6CA 5TRTA 1VSTA 2AJ8A 3HDJA 1AMNA 3MJ4A 3PEFA 4KYIB 2C2GA 3MCWA 4IHAA 1Z2EA 1YUMA 4ZVMA 1YZYA 2PGAA 3PQ4A 4MV3A 1MOQA 2FPWA 1BU8A 2R8PA 5C8DA 5FOQA 5IDYA 1L4EA 2Y0PA 3KD2A 2CDNA 5BNIA 3VH3A 4H2DA 4MUMA 1KORA 3IR5A 4IFIA 3TNFA 2PUGA 3R77A 3BWBA 1RP1A 3QA3E 1C4OA 3LUKA 2R2AA 2CMGA 1DRWA 4LTNA 5DULA 2CNOA 2WKWA 4W5WA 2QN1A 3NIGB 4KIFA 1L3CA 3T7KA 4WXYB 3CMMA 2OVBA 3MCZA 2OD9A 4GNKA 5AKIA 1UMCB 3SPXA 1AKRA 1D9XA 1X80B 1PG5A 3C3XA 3ND7A 5LYYA 1AS0A 4GP7A 2I4IA 2IU3A 3AEQB 3PF9A 4MW7A 1ZOPA 5HF6A 2YWRA 5CEEA 2A7QA 2VHQA 3H2GA 4PHCA 3LCCA 4LDJA 4Q4HB 4BFVA 1M0WA 2WI8A 3CZMA 1KP9A 3B3AA 2H07A 2VPPA 5B3LA 1GG8A 1U1CA 5K0CA 2ODWA 2G1KA 3K0AA 4OXYA 2P2SA 1WLSA 1GPYA 4CRWB 2BEUA 1TLTA 1XLUA 3I30X 4RK5A 1MAVA 2QY9A 3ZQ6A 4AX8A 3MJVA 4QGBA 1XCLA 4OI4A 3NVMB 1FPQA 2J08A 2B99A 1AUXA 2BM1A 2AV6A 3HSKA 3ORSA 1N2BA 4KIWA 4RK0A 1OBOA 2O2XA 2FP4A 4R6WA 1ZC3A 4IJ5A 4RHUA 4NXMB 1ZCAA 1UFOA 2FR0A 4RULA 3VVMA 3DBIA 3RIEA 1JFSA 4P2BA 4EF4A 4K0KB 3N1UA 4X92A 3V48A 4AJLA 1CULC 2AHOA 2ASVA 4NI5A 1SG9A 4DEXA 2GJSA 1R3DA 3CV3A 5D3QA 1MZPA 1Y81A 2CF6A 1SCIA 1K6EA 5F78A 2HK6A 3IAXA 5BW8A 2ENUA 4QOIA 4RPIA 1QZZA 4BFTA 2ZSUA 3E5RA 2E4YA 3N0XA 1G59A 1KOGA 3QXJA 1M34E 1QF7A 2OB2A 4Q34A 4JKOA 1VPVA 5FNZA 3MB8A 3ZR4B 2GFHA 2BFOA 1A4XA 3WHPA 2BW0A 2PPVA 2L2QA 4GVLA 3OZVA 4ARBA 3U2QA 4E94A 1GCAA 4G09A 3E2IA 2ZXEA 2XT6A 2WRZA 1V8BA 1ZESA 5KBYA 3TQIA 1WQ1R 3K0CC 4B43A 5HKOA 5F4BA 4PZCA 1FOEB 4KFTA 5KOJA 2HK8A 5LIRA 3BE6A 3GPCA 2Z4SA 3GUCA 1W1IA 2EWWA 2AL7A 3D8TA 1CR2A 3Q3JB 3QJYA 1V8ZA 4AT1A 2G9UA 4UVHA 3A6HA 2CXQA 1CIVA 3TLKA 4LV6A 4E5NA 4ED9A 1IXRC 1AMUA 4JBNA 5KQRA 1PLKA 4MKRA 1IHPA 2FEPA 1IN6A 5EHGA 1N78A 3AI2A 1R6UA 3N8NA 1R8JA 4GWKA 4LJYA 2QU8A 4XTRA 3COWA 3MWLA 1MGOA 3JATB 2OMKA 3GXBA 5ER6A 1BE6A 2C5BA 4DLKA 3KSUA 4NH0A 3GNTA 2JLQA 2W6ZA 1AKQA 4MR7B 1QYWA 4DA9A 4DCVA 1MX5A 4HNRA 1RQLA 1CB7A 1Z26A 5CH3A 2GWRA 3MJCA 1MC1A 1VIYA 3C2QA 1IFXA 3RDPA 4DSTA 5C1DA 5AVOA 3U13A 3R4VA 1P45A 1XDBA 3N2ZB 4UARA 5F73A 2ZWAA 2J3HA 3H5TA 2YJ3A 3I3OA 2PPLA 1KOLA 1BNCA 1K8ZB 1GZDA 4L16A 3KPYA 5DGIA 3T7TA 3PTZA 2CVPA 2YR0A 2HV9A 1WPQA 2P2CA 3P4UA 4R9UC 3SMVA 1TPYA 1XXHA 2VK8A 4NMHA 2O0HA 4OB8A 1N9KA 4Y0NA 4MYUA 1U5BA 4PSCA 1YVEI 4LYDA 3FNIA 1ZHFA 1Y6FA 4UE3S 2Z08A 4PGHA 2AFIB 2KI5A 5J63A 1JDSA 2YHIB 2FOIA 4CM6A 3EVZA 4KDCA 2G0NA 4DLVA 5IJAA 4CHTA 5CMLA 2I33A 4AP9A 1MJNA 2DUUA 1T8YA 2FMUA 4BP3A 3GIDA 5DYWA 3RS4A 4ZQIA 3H2KA 1P4SA 1G4UR 1LPSA 2NWQA 4HKTA 4UBNA 5TXGA 2ESRA 4AZTA 2X8LA 5K3OA 1VMKA 2XAAA 4JLOA 3ND6A 3Q2OA 4RVDA 1P7PA 2H57A 2COUA 1VJ1A 3QI2A 2BDUA 4QUIA 4OSEA 2X0FA 2BFCB 4RDIA 1SBQA 5BT9A 3A9WA 4UHJA 5CX4A 3WSTA 5BQ3A 5I7UA 5COQA 4JSYA 2ROQA 1LPAB 2H4FA 4GNRA 4LFCB 1G8SA 1FUKA 1AQNA 1EUCB 1H5NA 4RUKA 3AZPA 2EATA 5HVNA 5FI3A 5LQSA 1DADA 1LF0A 3OM0A 4YXWA 3VJLA 1WEKA 3OKCA 1H6CA 2QTRA 1Z63A 2EG5A 4KWHA 4LIPD 1G0NA 1K5PA 1XZHA 4NBSA 4TQ9A 3SJZA 1XBTA 2V98A 2ZVDA 1SZPA 5FEMA 4UTPA 1QX3A 4LY6A 1IN1A 4MULA 1SAYA 2NT4A 2AX3A 2ZBRA 3ANYB 3D1JA 3PEEA 3RYFA 4JI0B 1L5KA 4JR0A 3WRWA 1GTSA 4FC6A 2V6GA 1UBKS 1I36A 1KGSA 2QD3A 2DTEA 2QAJA 1BJKA 1FLVA 2P9TA 2YMMA 3O4IA 1SBHA 2NO5A 1F6WA 2A1UA 3MINB 4HFJA 4DCCA 5MHTA 4HPWA 4NXNB 1EHCA 2XTZA 4YRPA 2OBLA 2ZPUA 5DCLA 5YASA 2B78A 4PSAA 2ORIA 2I2WA 3BS4A 5T4FA 1QRUA 4R8LA 4PZAA 5EIOA 4D25A 2J1LA 2VJAA 2Z30A 1P75A 4FT4A 1RABA 3JX9A 1H2WA 2LPMA 3NM4A 2YRFA 3ZI4A 1GCIA 1EI9A 2R8ZA 4BEJA 3TG8A 5LU8A 2CZQA 1PT5A 4OYLA 1I8TA 4GMHA 5C80A 1QYDA 5AJYA 2YIVX 4XE5A 4BMPB 5BN3A 3HCAA 3B3JA 2RHJA 1SHJA 4C87A 3LHKA 4BKMA 5KTKA 1DBIA 2CZGA 3G2QA 3KXDA 4PYQA 5JXGA 2QF7A 3G9UA 2DQ4A 2WAAA 3GDFA 5DN6D 3EWNA 1E9DA 4Y67A 1UBJS 3Q6MA 3NWJA 1C8KA 1W88A 3SLKA 1IVYA 2VT2A 2X13A 4MGIR 4KJXA 4EP1A 2IV3A 3EG9B 3EXHB 4ADSG 1R6DA 2J9FB 4BC0A 3ESXA 2J41A 3CH7A 4B48A 3WBKA 1XQ1A 5ALRA 1EFAA 1NF8A 1UPTA 1EXDA 1NYLA 3C3MA 2G5CA 5HRCA 4CM9A 1JR3A 821PA 2JGKA 3RVQA 2ADOA 3O7WA 3KIPA 2W8BA 1P29A 2A0KA 4I9HA 4PIPA 4REOA 1SJ9A 1EUDA 3E9ZA 1NVTA 1Q22A 2YWCA 1K3UB 2CHGA 2DFVA 3TMAA 3UWMA 2GAJA 1EP2B 1SBIA 5DGXA 5ADVA 2OQ2A 3EVDA 4X24A 5EXTA 4U02A 4IV0A 2C0QA 1NIPA 1PJZA 3CKLA 3OJ0A 5AKJA 1TW3A 2VOEA 3H2SA 3PDHA 3UHAA 4BKUA 1RMQA 4KXUA 4ZOLB 2BVNA 4OY3A 3PLAE 4G4SO 4Y6PA 2J0UB 3IQIX 3T3MB 1QIMA 1MDFA 1ZD5A 3A27A 4HWPA 4NZZA 4UAJA 3BOSA 4PCLA 4DCJA 1FFXB 1UOEA 3F5MA 1OTXA 3TPCA 4F85A 1GPKA 3AILA 3I01M 1U3CA 1SC4A 4GRAA 4B1FA 2OYSA 1BXGB 2BN4A 2Z5FA 5CB0A 5HCIA 3R8FA 1AURA 4CIVA 1RSZA 2MDTA 3EXIA 5GZ3A 3BXPA 3IT2A 3SEAA 1XAGA 4EY5A 1KJQA 1BVRA 1LLFA 1TW2A 2QW1A 3ST7A 4DCOA 1AO3A 1E1KA 2W9XA 1DEXA 2GBIA 1WVGA 3LX8A 4HAUA 4O4JA 1KYTA 2R97A 3R7WA 3T3IA 3WVNA 1CJUC 1K92A 1Z28A 1P1IA 3AEUB 2JZNA 2XOXA 4QBTA 2H9IA 4B3IA 4RQBA 3BHMA 1ZN2A 5BV0A 1G9TA 2JAOA 1N2JA 4DCPA 1IBRA 1OX4A 5EKDA 1HNZB 4G5FA 1I6LA 1X6VA 1I2AA 3WP0A 2IIVA 4YAFA 2JJYA 3IEPA 4DMCA 4LNHA 3I0MA 2CXSA 1BGWA 4NCAA 1X7WB 1OU0A 4LJAA 1GKYA 1QKKA 5BT8A 4QOFA 2A0WA 5FPQA 1U7XA 2GVZC 4GPAA 4G5XA 1EWTA 3O2SB 1X1QA 1MT3A 4X1YB 1TJ3A 4LVUA 5AP9A 5EPEA 3RVNA 1Y7IA 4JLUA 5DX8A 1KPHA 3EVEA 3G6KA 3WLOA 4J16C 1P6UA 2WJGA 4WNAB 5LMNB 2BMFA 1DAPA 3RRNA 3B52X 3WK4A 2MYNA 3GJQA 4XDYA 1PJSA 4F1WA 5EJ7A 1QHXA 3JS5A 4LZAA 3G8CA 2PMFA 2BJVA 4JELA 4MHOA 3VHLB 2WICA 4XPIB 1W2GA 5BVHB 4Q82A 1JU9A 3QSYA 5CJ2A 1ID8A 1NRIA 1JHAA 5HIMA 3BZWA 3C8HA 3D8UA 4I6GA 4M8SA 5DDIP 3UPTA 4RE6A 2VDNB 1RXUA 2G1UA 4UU7A 1E77A 3B1FA 2V4MA 1T9KA 4IBOA 4NYIQ 4MV9A 2YVLA 3S70A 4JC8A 1X1SA 5C1OA 1GQRA 2IH5A 2IY9A 5I7OA 2VJDA 4C3ZA 3T9EA 4D97A 3H1GA 1CUVA 4CMIB 1JL3A 5CGQB 3T5DA 2YV1A 4FCVA 5CK4A 3UY4A 1ML3A 1RBQA 5I9IA 2BDTA 4CHGA 4FDAA 1PK8A 3PUWA 4N3GA 5KNCD 2JAPA 1GQYA 1E62A 1QFYA 2JW5A 4ECEA 3UGJA 2XNKA 1M5UA 2ADMA 1YRWA 3MTQA 4P33A 1TYEB 3MVEA 1Z5VA 2ONKA 4FXOA 2DY1A 2J7KA 5CVTA 3AFIA 3FHLA 5CD9A 1NOKA 3IURA 1YFZA 4GUAA 2YC2C 2ZATA 1L7AA 2JH3A 4P81A 5K09A 2HUPA 5F51A 1QTIA 1TYCA 3OEHA 4HZIA 2B9VA 1UPUA 1P4HA 1NKVA 1YRLA 3FX2A 3QBDA 1Y5NA 5BV7A 1JKJA 1VJDA 3DOCA 2VR1A 2VTEA 3U6KA 3QF4A 2QD4A 1IZ0A 7ADHA 1FS6A 1K0FA 1C3OA 3QHAA 2VHCA 1AGYA 2FEOA 3RTDA 3UHOA 2QVGA 3PGVA 4RVNA 2PGJA 4DIMA 4R1TA 1XR3A 4J2HA 4HDMA 1A8PA 3L1KA 2BKVA 1VG8A 1Z0IA 4BO6A 4KX5A 1UBCA 1QDLB 3LRTA 1UK9A 2QL7A 4JEIA 1QVRA 4RORA 3IFSA 1N6HA 2Q6VA 1TVCA 4IGFA 4AJOA 3RUCA 2DWPA 1ZWKA 2FVYA 2IIQA 1Q0HA 3CCFA 4Q3AA 5JWRA 2O59A 1OGIA 2FEMA 2VEDA 5AT1A 4RDXA 3D6VA 1S02A 1ZYUA 5DLYA 5DLQC 5KCMA 4DQVA 1E2HA 3L4KA 1NG1A 2IC5A 3R7DA 4KB5A 2BR5A 2Q7XA 3T15A 1OH7A 3A1TA 4OEHA 1CQPA 1D03A 5FL7D 4MS4B 3OF3A 3UYKA 1JKMA 2ZTVA 5FKJA 2IHBA 4KQ9A 4Q7KA 5DM1A 3RWBA 5LQNA 2CVOA 1KTIA 4HAXA 1QGYA 1QVAA 2P4UA 4Q4AB 1ZBQA 5ALKA 1RPAA 4YP5A 1LK0A 4TVKA 3ZU6A 3NUGA 1JFFB 1FDTA 2HIMA 2HYDA 3AUSA 4DXHA 1EHYA 5EIAA 4HADA 1E3DA 1N4DA 3HDGA 4Y0VA 1KYQA 4PR3A 1QQ7A 1GPLA 4ZMRA 1UWKA 2ZVQX 4EHLA 2GS9A 5FUQA 1N5JA 2YZKA 4J0EA 1UJ2A 3WHIA 4TTQA 3ROTA 1PJTA 3KB2A 5KYXA 4C07A 2OMEA 4XWGA 4W5QA 2VN8A 4PLWA 5LZ9A 2WU1A 1FP1D 1R1DA 1EU1A 4GI7A 3T1QA 5BPHA 4HQOA 1EAYA 1W5AA 2E4XA 2GBPA 1FQOA 2A4MA 1RLJA 2ZYSA 2X3FA 3HLYA 1Q6YA 3DOHA 4UULA 1YRHA 1J8VA 4GX1A 3HH8A 5BYKA 3FGOA 3ESCA 1ZAKA 2GCOA 4TUYB 5TR9A 4UNPA 1QGED 5LKAA 1DKRA 2PJUA 3PNQA 1SU7A 4ZIRB 2RB4A 4ZI7F 2VSNA 5H80A 3TVTA 3VTFA 3UJCA 3QTBA 3N8GA 1JDVA 4HBZA 5AI9A 2DWQA 2QTWB 2ONJA 3SYTA 4YRCA 5DGCA 4CQLA 4NPHA 4HGRA 2QN9A 3ENVA 3MJDA 5LQRA 4DBZA 5B57C 2VPYA 1JA0A 1X7XA 3OBIA 3SF0A 2IH4A 3NNSA 1RFLA 1AK2A 3OT1A 1XVIA 4X8HA 2H06A 1N3BA 3PTAA 4V3CA 1VHTA 1ZVJA 3CUYA 4ERXA 1JJFA 2NVOA 5C7IO 4O33A 2CCJA 1U2ZA 1JPVA 4OHRA 1FB5A 1K7EB 1MFZA 2ALJA 5IP5A 3WMFA 2ODPA 2CFRA 1HFEL 1BA3A 1MIOA 4PSDA 2V0GA 4P1ZA 4ACBA 5BWOA 1QFJA 1TJ4A 4FI3F 1N2OA 3MW8A 4FBMA 3DAHA 4MGZR 3HYTA 3VQTA 3OZFA 2Q5QA 2CHFA 1CUYA 2YWDA 3WK5A 4KQMA 2WUEA 3U1BA 4W7IA 1CE8B 1YR8A 2H8GA 3BBPA 3X1ZA 1Y4SA 1GG5A 1YQUA 1KJIA 2REBA 3GFVA 3D6TB 3DWGA 4AZ0A 3AJRA 2X5KO 2Y8EA 4PR0A 3HCPA 4EDHA 1ESEA 5A3SA 1KJ9A 3SQXA 1VB3A 1D5CA 4DLSA 2XZTA 1ZRSA 1WY5A 3VXKA 4BMXA 4IMJB 4U2BA 1TTHA 3PIDA 4QBHA 3ZVNA 2D59A 2QGNA 4UMEA 1A8IA 2G4LA 4JVMA 2QR3A 2AOXA 4MYSA 1XDSA 2WTUA 1XVVA 4RKEA 4D9KA 1FFCA 1RRVA 1N2ZA 4R83A 4OFXA 4ZT3A 1AG9A 4M0KA 1JHQA 1OZAA 2OCXA 1SD5A 3GGJA 4FCTA 2EZ4A 3GPDG 4DLNA 3BE8A 4LWQA 3WLPA 5IT5A 2ZRPA 2XIJA 3HM2A 4XWTA 1GGFA 1L7VC 4LXQA 2VDVE 3L8ZA 4BMVA 1FRQA 2WSSA 3LO5A 4WMLA 4F9GA 4IKPA 4CLXA 4Q4DA 5EJAA 3K0BA 1JG6A 5ICFA 2ZIEA 2OK8A 4LXTA 5CIQA 3FI9A 4MHTA 1YI8A 3TLXA 2VAWA 3GLFB 4GZ6A 1P5RA 4CMEC 1CCWA 5BN5A 4O3MA 4MAFA 1MMFB 2Q4DA 3EQ9A 3ZI7A 4DJTA 3JVIA 4M6WB 4LN1A 2NMVA 3KTFA 3MMNA 3K9HA 2X9LA 2X9GA 2R1ZA 1Q7BA 1ST2A 3F74A 3K1AB 4EUSA 1B26A 4KR0A 2X19A 4LRQA 3O83A 3DNPA 3GHHA 1V6CA 1W19A 1R4NA 4LPKA 2NZUG 1BVYF 3HDYA 3ZH2A 5CT6A 4F5YA 3F7TA 1KI7A 1QH0A 2FF7A 1US8B 2VZLA 2ZB4A 2BGNA 1EGVB 3I34X 4MV8A 2GXQA 2QRUA 3UOGA 2XTAA 4CMEA 5HR5A 4FOSA 4Y2YA 2C29D 3SJBA 1GZSA 2IL1A 3E2PA 4JI7B 1LRKA 4IXWA 4DR1B 4AURA 3FDIA 2R25B 5DBHX 1NOJA 2E89A 2GK3A 4MVJH 1NR1A 1TMGE 4ZQFA 1RHUA 4KPYA 3FFAA 1VHDA 3SXJA 4EUNA 1VMDA 5L3SB 1CQIB 1R0BA 1Y89A 2AWOA 1PDVA 2DPXA 2XADA 4ZCLA 1BH2A 1U5AA 4N76A 2G4CA 2OE2A 2WUVA 4JBYA 4IJVA 2HQOA 3IA7A 2ZAGA 3R3YA 1MJGA 4V3BA 1M75A 5JS1A 1EUYA 3C7TA 2HD4A 3IO5A 4GLLA 4MQBA 4RWEA 3TIGA 3ZYZA 5KC9A 5SY9A 1CU1A 2Q9CA 4G86A 1EZ1A 2BPOA 3EY9A 5F52A 4HNTA 1W8IA 1SVMA 2FMXA 3U26A 2IT1A 2WD9A 4TSRA 4C6TB 2WUWE 3D2CA 3HZOA 3OQIA 4DDWA 4YV1A 1KYVA 4ISCA 1C1YA 1J0BA 1NQAO 2OAP1 4RK7A 3GPBA 1XTBA 2VHEA 3VPSA 3WK6A 5KQMA 1EUZA 5ALJA 3EGXA 2WUFA 2Y3IA 3GLKA 1V6AA 4MKIA 4MTCA 1KC3A 2V7BA 1XDZA 4QYMA 3QUSA 2J0VA 5L51A 2XYRA 3ZXSA 5BQPA 4LDNA 1S7GA 4DNFA 3SZ3A 1VKJA 3WV4A 3OZIA 2R5WA 2QZPA 3HCEA 4IQ0A 1HZZA 3T7CA 3ZDYB 4F93B 1ONPA 4KOEC 2A5LA 1FYVA 4B6JA 1ZW1A 2C77A 1L8QA 1QG4A 5CDTA 1N36B 5EY5B 1UPBA 1VECA 2AFHB 3EIOA 4CF7A 2C95A 5AM3A 5CURA 3EGDA 2Z9BA 5EG5A 5JZOA 3ZVMA 3L0CA 2KX7A 4FGWA 2HLDD 2O5RA 1Z29A 4MCAA 1B0AA 4DRYA 4Z9FA 3QPVA 2Q5EA 3M3HA 3K9LA 3RQIA 3HK2A 4BMOB 1ZW6A 2QMUA 5CXSA 1DP4A 4PX9A 1OXKB 3HBMA 4Z7NB 3U3KA 1P3DA 4TRNA 2FUCA 2DFLA 1FRFS 5AM0A 2BHSA 2OPHA 2P2NA 3PNSA 2IJGX 2EWVA 1FDSA 2FPKA 4FMPA 7REQA 2HIHA 1N0HA 3GT4A 3TQQA 3ZHZA 5CD1A 1EBUA 1S7CA 4QZVA 2Q1WA 2WTNA 2V1UA 3HUEA 4GKAA 1Z88A 3SAJA 4D3XA 1DO0A 1Y5MA 4HVCA 2VF5X 2H31A 1X94A 2RJ3A 4RHEA 3U4MA 3A9SA 1T0PA 3I9NA 4YJ3B 3EEBA 4ZT2A 4IKOA 3AQ4A 5F1OA 4OK3A 4OVKA 2ACKA 3GGPA 3IO3A 2ZYGA 1JLLB 3BE5A 1Y80A 2JK0A 3ZNNA 2LTAA 4NAHA 3S7ZA 4BAGA 5BR7A 1VHQA 4J0QA 4FYYA 3I5AA 3R5TA 4CV3A 1VJRA 2QSJA 2O2CA 2AI1A 5EQTA 1X42A 2HK9A 4XSGA 1LSJA 5JCJA 4URZR 1R8XA 1STOA 3TINA 3T3GA 4Z7JA 5BOSA 5L40A 5AXBA 2WIBA 3DBOB 5LZ7A 1UL1X 3HA5A 2Q9UA 4CF5A 1Z45A 3PWZA 3VYRB 1MOPA 2QKYA 2HO4A 4S24A 4DLWA 3LUDA 2XRYA 3FOBA 4EEXA 4JT4A 3CKMA 5KJ1A 1MA3A 5JSZA 3NXKA 1XNRB 1WDWB 1BXKA 2B98A 2RHWA 4IDPA 3EIFA 1RYDA 3VO2A 1M5RA 4M38A 3U80A 5KTPA 1M7HA 3BFPA 1G8KA 1HNNA 1G5QA 5CA1B 2WJ4A 3RRYA 3MWJA 3DZCA 4RKRA 2B30A 3N05A 4EPYA 3ITKA 4IWXA 2O8CA 1NRWA 4J1TC 5FLEX 3IAM6 3OH8A 3BB3A 4LHZA 2PMEA 3OT5A 1ULHA 3OZXA 1B4DA 2ZVJA 1JSLA 1PJBA 2L69A 1E9CA 3M4ZA 4QTXA 3VR3A 4CUJA 4DQLA 3G0HA 5BYBA 1Q7RA 1Y1QA 4L3VA 2E82A 2GAAA 2LZ0A 5HILA 2PUBA 1SK9A 1N25A 3GGCA 3TTTA 3X44A 1WDMA 3GLGE 1I9CA 4RLSA 1JLMA 4ZJPA 1DXYA 4EYQA 3MS4A 3FHCB 1YRQA 2PLWA 1OLXB 3LT5A 2P0YA 5JDIA 2VJNA 2WYUA 3JARB 3WWEA 3OIVA 4U39A 5DSTA 3BHJA 3O8RA 1OT3A 2PX2A 2H4YA 3N6RA 4KVFA 4OO3A 1LPMA 3AV0B 4QOSA 1C9EA 4FFSA 3VMMA 4CF6A 2QENA 4MRMA 4EBBA 2LIVA 3HSYA 5COAA 1RI1A 4L50A 3STTA 2HA6A 4I50A 4JLVA 2I2DA 3ZJUA 2E18A 5THXA 4M49A 5JUWA 2ZKLA 3H3XA 1JU4A 3O8LA 5JJKA 3H4IA 5FA8A 3SFVA 1P33A 1BROA 1F48A 2JFUA 1FPMA 4Z9YA 1JQLB 2HCJB 2SECE 3QM1A 1YZQA 2G7ZA 4H77A 4YJKA 4DMRA 5AKZA 1ABFA 4PG4A 3WZMA 1C4KA 2RBKA 2VK4A 4QJIA 4EZIA 5BQFA 3PNKA 4GOLD 3DAGA 2NTJA 4PLYA 2YIMA 4PAMA 5C34B 2BFBA 2PSFA 1N6KA 1JA1A 1DWQA 1DV1A 3F8SA 4L5BA 1J25A 2GJAA 4GU5A 3R9KA 1VJTA 3MTGA 1Z8HA 4CNBA 5LDHA 3GGGA 3WNZA 2O0KA 3HCNA 1EVZA 4GRDA 4O4LA 2YXPX 1MA0A 3UW3A 3HB9A 5A7GA 1YZTA 2GN1A 4F4FA 2Y0EA 1RIFA 3QE0A 1I3NA 1OE0A 4MYRA 4QX6A 3VOSA 4R1NA 4CM4A 4KWEA 4J0GA 5IH7A 4FOPA 1RP7A 2IOFK 4QIHA 4I46A 2FPPB 4ROSA 4ZAGA 4UOZA 1L4YA 2EW1A 1VE5A 1IE3A 2F9FA 1M1UA 3KE9A 2LWIA 3FMVA 2ZJZA 5E3JA 1BSVA 5FPYA 1DDOA 3AF6A 2OHJA 1Z2CA 4YFYA 3FCYA 3TOZA 2WU8A 5DJ5A 3ILHA 4D0LB 1IQ0A 1YB2A 2GBGA 3A0UA 3UJ6A 5KNBH 1HT0A 3HDQA 1O0CA 5HP4A 1AQ6A 1XMPA 2YY6A 4I55A 2QG6A 3DLTA 4C7XA 3V42A 4ZEXA 4WI1A 4HX5A 5HBRA 4PYKA 4AY5A 6AT1A 2RGAA 1H3FA 4UATA 1IH8A 4XM1A 4ZREA 1AVTA 2JA1A 1YZUA 1GUYA 2AF4C 2GT1A 2OEPA 1RRKA 3E9MA 1CUZA 4JVOA 4NZNA 1UQTA 3ZWBA 4QG3A 1RLIA 3HC7A 1KE2A 1OXTA 3A6DA 4JQCA 3LQYA 4QJBA 1HMYA 1FZQA 4JI8B 1OTYA 3X1YA 4QXQA 4QRIA 1U65A 2W6PA 5KSPA 4G5SA 1RAFA 5HOEA 4CFZA 4ITRC 1YRAA 3THRA 1ILWA 3VDXA 4QDXA 4BNKA 3EDCA 5DN9A 4BQRA 4CKBA 2XTJA 3HKDB 4FS8A 3QYPA 1LFDB 3OEEA 4LTDA 2F62A 1A71A 2PT9A 1HSOA 2WFLB 5IM4F 2AJDA 2NSLA 4BPRA 1PQUA 3U1VA 4HX2A 3S5UA 4BN0A 4HV4A 4CQNA 5ALHA 3OQJA 1DINA 1CB0A 3QFCA 1CJTC 4UTOA 2QVXX 4J49A 4OCZA 4Q1BA 1KC1A 3NP7A 3JPYA 3ZXXA 1THTA 3GMDA 3TLMA 2IZZA 3ZWVA 1L4MA 3K6KA 4G67A 5JSHA 3P0JA 3PA6A 1QUFA 2JCVA 1BX3A 3DTNA 1NSYA 4D2IA 4ND8B 5TY0A 1KZGB 4N5LA 1WUJS 1DBVO 1BH6A 3PPYA 3SHFA 4DSUA 5CBPB 1M2HA 1EK1A 2A0UA 3NG1A 3UWSA 2XKBA 2I3GA 3EW7A 1DXQA 4B9EA 1Q7TA 3QX9A 3SYNA 4ZV4A 4G5YA 3TAHA 2WM2A 5JAPA 1GPH1 2C88A 1Q77A 2WJPA 1VI2A 4ALMA 4HHEA 4YQZA 4KR7A 4E6EA 4ZRDA 1SWVA 4AY6A 2CLLB 3KSMA 2OLEA 1NXTA 1ES9A 1YBMA 2FSSA 4QYIA 1OBHA 3NDRA 4PRLA 3LY9A 4L27A 3WDSA 1K66A 4JJEA 1QLWA 1Z17A 3E61A 2IZ0A 2C03A 4PQYA 5EIFA 1XEAA 1GFSA 1M67A 3WP1B 2J4DA 1CLEA 3GZ4A 3DPSA 4QBFA 3WDMA 2J07A 1XPUA 1QHYA 1SUEA 4IPTA 4ZV9A 3UKDA 3VM6A 2O07A 3DVAA 4WZZA 4EYKA 3ZY5A 4GZMA 3F7OA 4F9EA 4KK4A 5HOQA 3KOXA 1MJGM 4NJMA 5A6SA 2YHAA 2FFHA 3A2NA 3MCTA 4OHBA 3E9NA 4C0HA 2HMWA 4W8HA 5I7AA 5KDDA 5JPIA 2X8JA 3CIFA 3OX1A 3DMYA 1J07A 3FUTA 3OIGA 3HBLA 2IU4A 2B4YA 4RM3A 1C50A 3DV0B 2B4AA 5H02A 3UK7A 4P3KA 4RMNA 1CD5A 1H4TA 2QP9X 4B9AA 3QPCA 1AXGA 3GROA 4UZEA 2OBYA 2JCBA 4F1KA 4OLBA 2GBLA 4BLOA 2C2BA 3D6MA 4O8ZA 3T3DA 4BGVA 3QK7A 3AIOA 3BMOA 4PG5A 3ROZA 4DZZA 3U1TA 3W7VA 4DQUA 2HLDA 2CKDA 4BFWA 3HCBA 1YQTA 3AU9A 1J9EA 2E85A 4KBFA 3ZW9A 1P77A 1ZCBA 2WKSA 5BSVA 3B6KA 5CJPA 2G1JA 4KSCA 4IIJA 3F5QA 1FP4A 3SC2A 1E5DA 1T24A 3BK2A 1OVMA 2F1JA 1U9ZA 4P5PA 3HXOA 4CLHA 5CXUA 1U0TA 4HQKA 3IE1A 3DM9B 3QU2A 3KZMA 1MVLA 1H9AA 1E1DA 5DTEA 4IJQA 3Q9UA 4PINA 4DJ5X 2XQGA 1FNMA 4FFWA 3VDQA 1R27A 4UPEA 4QGGA 3DVLA 1Z12A 2G82A 4R0MA 3I5MA 3OU7A 4OMDA 1FFBA 4EHFA 1EE9A 2VH2A 2IBTA 1U6JA 3FJ1A 3G59A 4YA6A 2P6PA 4TQAA 3RGGA 5BWBA 3UMGA 2OGZA 1PR6A 4H7PA 4ENVA 5JQWA 1H1LA 3MOGA 2BMDA 3HR8A 5LMZA 2XRZA 1QX4A 3K32A 4EI9A 3CX8A 1E2LA 4RKQA 2F2TA 3ND8A 3RVMA 4V1CB 3MILA 4RACA 5KCZA 4MVJD 4CT5A 1M1YA 2PXCA 4EPXA 5JJ5A 2NV0A 4BL5A 2ZI6A 3RT9A 1HE8B 3PFHA 1I1NA 3OAAD 4O2BA 1QGZA 3ZBPA 1Y5IA 4IX1A 2G83A 1NV9A 4YI3A 5BSUA 3Q7EA 3DEAA 1BX0A 1IVNA 1V8DA 3TRDA 5HSGA 3JR7A 3WGTA 2VZ9A 2P2LA 3E2MA 3FMGA 4F12A 4DLBA 2EBUA 4GGOA 2CMHA 5FV7A 1SOAA 1T2VA 3TK1A 3PDWA 5LU9A 1FDVA 2HPVA 4C1NA 1WIWA 5JOQA 1FSGA 3KUXA 3ZIUA 4JAVC 4LNUA 5E7QA 4HR7A 3GEHA 2IYOA 2JFXA 4C0BA 2G6TA 1Z06A 3F96A 1VPDA 4GE3A 2ZDHA 5BQOA 4X7RA 3DBLB 2BMAA 4R9RA 4DADA 1A4UA 2ZBEA 3O84A 2WP8J 2I34A 5AIBA 4RTOA 3N5CA 4WNCA 1VBMA 3JR3A 3PXDA 3K09A 2O3SA 3DE6X 4X9XA 5BW5A 2DXIA 5CNMA 3MXTA 2ARKA 2JFGA 4LE0A 1C0LA 3S2GA 1XK6A 1CRLA 4P4SA 1UDAA 2D7DA 3UK6A 1A5SB 2E37A 3Q2IA 1F4LA 3KVNA 3G79A 3ZZ1A 1BWPA 1U2RA 3KKQA 1PT9A 4H35A 3UFXA 8MHTA 4IHJF 3DOOA 2I7XA 1GGJA 3TW0A 2IOQA 5EINA 1ZSNA 1MAHA 1P2UA 1KO1A 2H08A 4ECAA 3W2TA 3F9CA 3KKKA 3LQKA 4M9SA 4N8SA 3X1DA 5B12A 5KOIA 1J0DA 1FLAA 2VZEA 1VXOA 4NE7A 3SS7X 4QAQA 4C0XA 5IF9A 2X1HA 2HQRA 3CX4A 3M2PA 5F35A 1OFUX 1KBZA 2JANA 4OTZA 3KT3A 2QRMA 3UOAB 3VYVA 4B34A 1L5VA 1V3QE 4HGZA 2B8WA 2PUWA 3IVAA 5LMCA 2AEMA 1BTOA 1VCHA 2PE5A 1J2RA 3P5SA 3RS8A 1BKYA 1POWA 4JUAA 4C9BA 5FPKA 2BYTA 3ENQA 3UJ3X 2IYXA 2XUGA 5MN4A 4F45A 3EB9A 1A2KC 1UC5B 1ZINA 2Z3WA 4GLOA 1DPGA 5LKRA 4ARSA 1Q2UA 3QMWA 3R3UA 4M2LA 2QZJA 3L06A 1OTHA 2E0IA 4LBZA 3VO1A 1XNQB 2FTKE 5KOHB 4IHKA 4MGYR 3NNDA 2PUJA 3L3BA 3IUJA 2JGEA 3C6ZA 5DNWA 4NYJQ 1MIHA 2C7PA 1YO6A 4CF3A 4D6XA 3V80A 2AN1A 2BZ0A 3L0SA 1M3SA 3TL2A 3FOAA 1YE8A 4JUFA 3MA0A 4FMCB 3EY4A 3L7YA 1B41A 2C42A 2P6OA 1YB4A 2H2FA 4JP2A 4ZARA 1TUBA 1RRGA 2R79A 3N8DA 5G40A 4CR6A 4F11A 2IHVA 2GLUA 1W1WA 3MQFA 4BU0A 3D4PA 1I3LA 3WKAA 5IVPA 4OQFA 5EKUA 1QUEA 1KDVA 1GD1O 5KSWB 5LXTB 3DMDA 3L4BC 3CUSA 4KXQA 4H7HA 1BE0A 5JSFA 1W9MA 1NTRA 1RJGA 2OCDA 4PX5A 3D3NA 3NBZC 4D8WA 1H42A 1YIAA 5C81A 3FVVA 4QYSA 4KUHA 4P34A 2FPOA 4JASB 3PLRA 2DMRA 1GJRA 1T5HX 2HZ7A 1YBVA 3FGNA 3IP8A 2Y0CA 3PNYA 2QY6A 5A4DA 3ZDCA 4URVR 1U3FA 5JQGB 5AQEA 2VHWA 3M6MD 1F0KA 2F1RA 1V8FA 2IPNA 4BFSA 2QT9A 5CLQA 1R7RA 1LDBA 3JYOA 5C52B 3THWA 1XRJA 1S2MA 2IOFA 3B2EA 2H4XA 2CHVA 4G8JA 3DUWA 4EF5A 5AFSA 4HAZA 1L4LA 3B1VA 1JEDA 2BC9A 4OIFA 2ZWPA 1CZUA 1Z8NA 1GR0A 2CT8A 2J6HA 4YREA 1N7GA 1SA0B 2HU2A 4WOPA 3I4CA 4HJRA 4MS3B 3KJEA 1CW2B 3DGEC 5FUVA 4CLRB 1MABB 2E6UX 4KG7A 3A28A 4LRSB 1U3UA 1YL7A 1LU9A 2IYVA 3DCNA 4Q47A 3S1AB 1UMBA 2WB4A 1WZ2A 4C6RA 1YVUA 4WCDA 3H4MA 2FETA 2XCRB 1FSPA 1PR1A 4ZT6A 3MTBA 4RTMA 3EFHA 2P1RA 2D2VA 2C4UA 1MXFA 2AVDA 4O2AB 3BREA 4EHIA 1TJNA 3RVBA 1ESDA 4ZZ0A 2GBCA 3L5OA 4Q03A 4W7SA 3ADCA 1WCIA 4AK9A 3ZHUA 4O63O 1KARA 2Y0BA 4RY2A 4BU1A 1KH3A 3G0CA 2B35A 1X0VA 4X60A 1CDZA 1NY5A 1AV6A 2RG7A 3O93A 4M9XA 3WGNA 1VFNA 5AR1A 3GFGA 3X1MA 3D8BA 1WA5A 2HQ1A 1V25A 1YVRA 1QIDA 1LSUA 4XB2A 4IXDA 1JH9A 5DHPA 1GA1A 1T9HA 1JIQA 1PJ2A 1R4ZA 4UCXA 5FOTA 5DPMA 5SZHB 5EYPB 3A6PC 1U63A 3TCKA 4PZLA 2PGNA 1J9ZA 3MLAA 5I4CA 4BO4A 2FZEA 3UWOA 5JW6A 5JYEA 1Z6YA 3TLEA 1TQ2A 4CGZA 1W34A 4B2YA 3B53X 4W82A 1KYWA 4UNIA 1NJ6A 4WK6A 5ECYA 3W3AH 1CF9A 3VU8A 1GPWB 1I94B 4XASA 2OAGA 1GN8A 3UPUA 2EF0A 1BHO1 4TMZA 1EG2A 1YOBA 2AOTB 2MSEB 2RHHA 3NH9A 4NCJA 3UUWA 4BQEA 2XEXA 1TEZA 3K35A 3DOIA 3AF2A 2X42A 3RSFA 4D3SA 2QDXA 3L6OO 1HL3A 3UT5B 5DBOA 1BS2A 1LI7A 4WY2A 5D5QA 2W4MA 2IUTA 4U5XA 2FLVA 4CFSA 4EECA 2EZTA 4MOWA 6REQA 3SR3A 1LPBB 2PZKA 3OUTA 2ENWA 4HGNA 4N03A 4MLZA 4O1HA 3VSAA 4A8TA 2VP6A 4DYHA 4QFDA 3Q8KA 2OHOA 1LK5A 5ALVA 1JR3E 3M5DA 2OKGA 5ALIA 1XVAA 3BHNA 3TZKA 5A06A 3SQWA 2EX1A 3C7DB 4P98A 3UV3A 4AZWA 1NN1A 2WSBA 4PBSA 2AJTA 3WB9A 3EFOB 4YBZA 5KNBD 1EFTA 3PEYA 1D8TA 4R6XA 4BWVA 5JCZA 1E6MA 2QT0A 4XYMA 3KYDB 4YP0A 4A7PA 5DXFA 4AYWA 2IXFA 4BRUA 4QWWA 2GGSA 1QH1A 5J4HA 2ZRNA 2BFDA 1BVHA 2NTNA 1WMAA 2P2ZA 2IHYA 2QEQA 2X58A 3BSYA 3T5MA 4CEIB 5AMXA 1KGDA 1Q6ZA 3T5GA 1D9ZA 1KXZA 2QLJA 3KHSA 2OV1A 3HWX1 3ELBA 4KW7A 5HBGA 5C9ZA 1KO5A 3HRIA 3K31A 1XKXA 1F8FA 2FMKA 1NAIA 3KV3O 1X9IA 3NT5A 1XLTC 2W2KA 3LZDA 1J5PA 5TJHA 3RB8A 2F55A 2ZYUX 3IHWA 1P8JA 3R41A 4F2DA 3ESQA 1QHNA 5IK2A 3QKSA 4QASA 4BVEA 4C89A 4DANA 1I14A 3N9IA 3H99A 3LBAA 4WZAB 3ZE2B 3NJRA 4KNVA 2QTGA 3VR6H 5E6SA 5HQ3A 3DG9A 1JNXX 5FOXA 3B1YA 1NJ5A 4PWYA 3D8SA 3OZAA 5LLTA 3SC6A 1NR7A 2PZEA 4GRIA 3SZGA 4BNDB 4DB2A 3GEPA 3SQNA 1CTQA 4H7EA 4I1RA 1A8UA 5CW2A 3BK1A 4BVJA 3B9BA 4JMPA 4DSZA 3NPMA 4E5VA 4FONA 1ICIA 5C1PA 2O6LA 4WCFC 4EMUA 1CEXA 4IJUA 4MVJA 4X44A 5B1SA 1Y8QB 1X7YA 3AF0A 2XHZA 2E3JA 3Q3IA 4Y9RA 4OJYA 1G16A 1S2GA 2ZIXA 3ZS8A 3DMTC 5FUWA 1P6XA 4B82A 5IKMA 5BMVF 3F6EX 2O7SA 4ESHA 1XQWA 1YCDA 2E87A 3NHBA 1QDEA 2ZCUA 2I3BA 3OPVA 3VOBA 3OIUA 2Q4RA 3WLSA 4KNYA 1I5OA 3KOOA 4TKVA 1K63A 2VDKB 4HEHA 5LOVA 1MTZA 1TM7E 2FMFA 2X0JA 1KEPA 5EGNA 1YCGA 4X97A 2J0EA 4DY4A 1ZI6A 2VKQA 1U0EA 1LUAA 3L46A 4EA8A 1Z5OA 2QAGA 3E9DA 4Y2QA 1GRVA 1HORA 1UF9A 2JIRA 3HZHA 4HGQA 5CNKA 3F4KA 2VBIA 1L5LA 1JP7A 5H3HA 1YDEA 2YJ5A 5A2QA 4U1RA 4WBNF 4C0KA 3HV2A 2GPWA 4FFBA 4R3NA 1MT0A 4TS3A 1SXJD 3JAWB 1ESZA 1UJ4A 3ONVA 4QNNA 4D81A 3TKAA 1FDWA 5C4MA 3PDIB 1SCUB 4FE3A 4D82A 5I7WA 4MYCA 1XROA 3NKFA 4QOJA 3L7CA 1TZCA 2EHDA 4BQNA 5E95A 1QE3A 3HJUA 3NBAA 1N0WA 1ZJ4A 4U4AA 2X8AA 2AR0A 2W98A 4RD3A 4EM6A 1RPNA 1FRNA 1MB0A 1J8MF 5LQKA 5AVQA 3B1WA 4H17A 1GAJA 1CUGA 3HJBA 1C1DB 3OWOA 3GAZA 3IP3A 3AQIA 4BN4A 3JWPA 1T3HA 2PKCA 2EJCA 4YUXA 5DVZA 5HFJA 1DV2A 1PX2A 1L5SA 3CW8X 4QEDA 4EF6A 1I3KA 4P8RA 5FUYA 1P2FA 3L04A 1YZHA 3L6BA 3G68A 5EWJA 4OQQA 3H2BA 2FV8A 3NHRA 4TWAA 4ZVUA 5E2AA 3MCUA 4N7BA 1FP6A 1YS7A 2MSWA 3UB4A 1OYVA 2OZEA 1UBEA 2C2KA 2GCNA 3GEDA 3QLVC 5FFMA 1QLHA 1K6IA 1NMZA 1Y4UA 1ZJZA 4NEHB 5AJZA 3CUWA 1Y5LA 1GCOA 2QL9A 3L7BA 4J7CA 4OSPA 1OU4A 3HVHA 3EDMA 3LLCA 4LBVA 1SH7A 3KAJA 2X41A 5EZYA 3C5CA 3VUEA 2I4TA 2XECA 4KYTA 1XKLA 1AUVA 4X1IB 1XMSA 1K98A 2DY0A 3HL4A 3S68A 4CVNA 4YMGA 2PX6A 3E5MA 2C82A 3I42A 3OZSA 1NONA 3NEJA 1KZ6A 4QUJA 4B5LA 4A6EA 3CLHA 3MTJA 4JXJA 3PR2B 2OV4A 2VYVD 5J2TF 2CXOA 4FKMA 5JI3E 4X8OA 4FFDA 3R9WA 4XLTA 4U9UA 5B1EA 1LPOA 1ZHHA 3TW4A 5EIWA 3M5WA 5DXAA 5TE9A 3V46A 5KQGA 1PJ3A 2ZXUA 3BD7A 2D1RA 3GJ5A 3HM9A 1A9RA 1S3IA 4W5OA 1MAUA 4FTWA 4HD8A 4W1PA 4EFDA 2OBFA 1AN0A 3PEVA 2UUAB 3NHPA 3DT8A 1LX7A 3EEIA 1VKNA 3LA6A 3NWEA 3QLTA 4BBPA 2P9YA 4OX9B 3U9TA 1A88A 3ZHTA 2I3AA 3GWZA 3OLWA 4HB2A 4KLAA 2QTMA 4JNCA 4PZDA 4ARUA 2DUJA 3NEPX 4PQRA 5M5BA 1INLA 2PAFA 3CNOA 3GC6A 1BMQA 1U80A 1YDFA 4EVQA 7AT1A 1M54A 3RAEC 4TV9B 1Z74A 1U3WA 1E9EA 1ETUA 3AETA 2P1DA 3D6JA 5K6RA 2ZM6B 2FEAA 4C14A 4D9FA 3WYBA 3DNFA 4C0QC 2BEVA 4Y6LA 3HR7A 1ITZA 3OOWA 5F2KA 2UZ4A 2HYIC 1J0XO 1KVUA 4D8TA 1BMFD 2HPAA 2IP4A 3W2IA 1QP0A 2E7ZA 4FFPA 3DVRX 1JYEA 4OXQA 3U4AA 3R3WA 3VYTB 2VAMA 1DTWB 2FFJA 4HP8A 4KBYA 4CKYA 8LDHA 4ENTA 4MI3A 1N4AA 3ZWKA 3THXB 4MAAA 5CLIA 2PYDA 4AY2A 4I1IA 1SU6A 2QTAA 1UIMA 2NTEA 2DHCA 3PHJA 3WGMA 3BIXA 2P5YA 1FTNA 3SIXA 5JAHA 1SD2A 3V2GA 3LDUA 4B3SB 2BZ1A 1VMAA 2NXNA 2O57A 4MA5A 3EXAA 1RHQA 3BN3A 1FMJA 3FHTA 4HZUB 3LPMA 2ZS7A 1VCNA 2OZKA 3ESAA 3IUYA 1NVVR 1KQOA 1OWMA 2PWAA 4RENA 1TU3A 4CDNA 1ULZA 1YUNA 2F6RA 3FTDA 3QP9A 4YQEA 4DM3A 3E35A 3H1AA 1WLYA 3F0TA 3V1NA 1WCV1 3NDIA 5GV8A 4EGQA 2OORC 3ZDEA 4BZZA 1F8GA 3GAAA 3OC0A 2QR5A 4GMDA 4RV4A 4RESA 1L9XA 1H4SA 2ZUWA 3NTQA 1G21B 1J1UA 2AN5A 2WR8A 4PCUA 4YPVA 5D01A 1Z73A 1W0KD 1IXKA 3SHTA 1XTPA 1T3TA 2QM3A 3IXMA 1RWPA 1OXUA 1SPXA 3R9XB 5EHQA 3P7MA 1A72A 3A4LA 1G19A 1GPDG 1KSHA 4M0FA 3H2YA 4KVZA 1C30B 5AOBA 4LC9A 1FBTA 3H18A 3P9QA 2OORA 4GDFA 4E30A 4OHUA 3OSUA 3A9RA 4CEHB 2WAMA 4CIBA 2VXOA 3W9BA 2AW5A 3ESDA 3P5BA 1Y8AA 2GERA 4IZIA 3AX6A 5EKSA 3VR4H 2RGBA 3U7FB 3JQFA 1Q0QA 1LW6E 4Y7CA 2Q4TA 1TZJA 3C5WP 4E2ZA 2ICAA 4XYBA 3WKDA 2HEIA 2R66A 3HJTA 1EEHA 1NE2A 1MX1A 4GI5A 3KB8A 3LL7A 3RFVA 3S2UA 4D8XA 4X3CA 1WV1A 5BSTA 2F1IA 4NG5A 3FWNA 4QEKA 1E7MA 4UDOA 4DMFA 1NUQA 1HNWB 1X1CA 3B5IA 3EC2A 3JQ6A 4KL8S 1AGXA 5EEHA 3F90A 2ZI3A 1BXZA 1T3ZA 4LRYA 3G2MA 3IIIA 3I2IA 3KUDA 3CVUA 2ZE6A 4Y8VA 1UQUA 4O5AA 3GYGA 3AEYA 4UW9A 3OFJA 4K1LA 3C0KA 2WQ6A 4KGDA 1RRFA 1FK8A 2NG1A 1DKOA 1P2GA 4OGKA 5C2JB 1J2TA 4A92A 3E9YA 3OJXA 3L4JA 1M2FA 1I4OA 2DKNA 1IWOA 2AOUB 1NJ2A 4JFRA 3M82A 3OPYA 4XVRA 1PJ8A 3B8HA 1P44A 2BGGA 1KIFA 2O7NA 2YWJA 2Z2ZA 1IB6A 1SQFA 1M2OA 1W59A 4KIGA 1JSZA 5KX5B 2CL6X 4NBKA 1R8QA 1DEOA 1Y8RB 2DETA 2XMSA 3Q5DA 4J0JA 2LR0A 5KNBA 3GZNA 3BRSA 3B70A 2EFJA 2PG3A 1GWNA 1IWPB 1VIMA 4W6QA 4F46A 4HDKA 1RXWA 4ZAVA 4UM5A 1N5LA 1XUOA 4ETWA 1K27A 3FBWA 3B6EA 5FV4A 4HCJA 1QO0A 4MS1B 3CQ9A 4KH1A 3B5JA 3EAQA 1GHTA 4IGEA 3UGKA 1JBQA 3TD2A 3DL4A 5EL0A 1LXCA 3U7HB 5KU1A 3SR4A 4BJ1A 1KEKA 3BULA 3F1LA 4JMLA 1Q74A 3H65A 2ZIGA 3TZCA 1M6VA 2AXQA 1Z6ZA 1EB8A 3KPVA 3OCWA 3O7MA 4JBXA 1CJMA 3CRRA 1VIVA 1OLSA 4K3VA 1UKAA 3KTOA 5AW9A 2IUUA 2XUQA 2DQSA 3JRXA 3NBYC 3DDSA 4GM4A 4LOLA 3TPFA 4MV7A 4XYGA 1UBMS 1H05A 2KQUA 5KMGB 4MARA 3CF4G 5B1YA 1E7QA 4YLEA 2GFIA 4RZ3A 3BMQA 3FLBA 3GL9A 3WHLA 1ULSA 3MNFA 3W4JA 1F51E 1YJAA 5E9AA 3SIPA 4NICA 4LI0A 1AS2A 2XDYA 2CNKA 4I1OA 2CMKA 4MZDA 3GYBA 2A9VA 1Y4ZA 1PZMA 2DT5A 2HPHA 2PRJA 2J3MA 2XNCA 3IILA 4ODIA 5AKGA 2WWVD 2GXAA 1UUFA 1WS6A 4ZC8A 5IM4A 3OTIA 3P9PA 4KHPB 4UNRA 1YZ3A 3H42B 2PSHA 3JD1A 5F12A 1RHJA 1ZL2A 3LKZA 1P2VA 2Q9AA 3MUFA 3UWKA 5BSWA 5GM2A 1DQRA 1SXJC 2AD5A 3M4YA 1DXOA 2JHGA 1KPGA 1SOWA 5LP6B 1R50A 1WHSB 2JFVA 1E8DA 2GYVA 1ZMTA 3ISVA 3MGAA 4MW6A 3W3AD 1FS4A 1SVIA 2VPIA 1ZMBA 3L79A 3TEFA 2MOKA 3AHGA 3BEOA 1V7QA 2F3SA 4MVJM 3LL4A 5FPTA 3ZHOA 1I4DD 4DY6A 4X65B 4GF5A 1OKKD 2Q21A 1X9GA 4R8KA 5F3RA 5GPBA 3AUKA 1HG1A 2ZI4A 3N7AA 1CDDA 3G8DA 3GZJA 1SXJA 3LW8A 1FFDA 1YZVA 1H85A 2CHUA 3O82A 3P9KA 1TQDA 5FL3A 1AHPA 2PX3A 3TLZA 2CFTA 4J0KA 1GPUA 4JV5B 5SV2A 1O57A 3FYDA 3NO4A 4HRAA 4YX9A 3U37A 1BDIA 3WRXC 4TMYA 1T6XA 2YVUA 4A3SA 1E6KA 4XX0B 4I1PA 2VSOA 3EQ2A 1UT6A 2BP7B 1G9XA 3BJZA 3PX3A 3ROPA 2P7HA 2R4QA 4DR6B 1FNSA 1YBFA 1M8FA 2FUG1 1OPXA 3BE4A 1G3IA 1LK7A 2J4FA 3CC8A 1JSRA 2PZMA 3COYA 1G8HA 3LQQA 1G8YA 3UXYA 1CVRA 1H2HA 2R4UA 3SWWA 4M0CA 1DG1G 3W77A 1S89A 2CLCX 3ASVA 1JGTA 1ZN8A 2VWQA 4YMIA 4E15A 5D1NA 2WIGA 1YWGO 1IHDA 1WO8A 3VGJA 4GQBA 4R5HA 4CQMB 4KR3A 2UZ1A 5CA0A 4WN3A 3N0VA 4G1FA 1JILA 1GAWA 2WBLC 4OHMA 3UJDA 1O0SA 3OZGA 1CNMA 1B0ZA 1QS0A 3ABZA 3FPGA 4J07A 4M83A 4OKIA 3BJMA 1I3OA 1TUIA 1QSGA 3IL2A 4Z53A 4PPGA 3RVLA 1APBA 5LA6A 1UBFA 3C1OA 2K7ZA 4IFEA 4UEKA 2VXYA 3GVCA 3T61A 4UXJA 5JR3A 2GCEA 2W58A 3PFBA 1EFRD 4FNAA 5TQJA 2EJUA 2PRZA 3A25A 4KWIA 1KZYC 2C9OA 3KZXA 1N92A 1REQA 3B1ZA 1E1RA 1TLLA 3R5JA 4PRKA 5C8YF 4L9AA 2NU7A 1I1HA 1T26A 2Z6QA 2PMCA 4LJ4A 4UZFA 5DCUA 4OJQA 4Q7MB 4TYMA 2DX7A 3LZCA 1ZOSA 4U63A 1KYYA 2XDQB 3NTLA 3SNHA 4E7OA 3U7IA 1TLFA 1EZ4A 2XE7A 3JPWA 4B0PA 3MWKA 1T0BA 3JALB 3MUOA 4QULA 4GFDA 4C7VA 5JH7F 2JATA 4R1MA 2QR2A 4UMVA 1CZLA 2MINA 2V8BA 2ONZA 4WEOA 4ESOA 3IMKA 5HS4A 3T1NA 1A98A 1M83A 5EXEA 3V3KA 3RASA 2BV3A 3ON5A 2J3JA 2ZIZA 4N1AA 4NHOA 4MI6A 3UGQA 1ZGHA 2Q99A 4NDAA 4PYJA 1NNLA 2HMYB 2NZ8A 4G0MA 3JQBC 3RPEA 1ZL0A 3JAMA 4DRXA 1E6EA 1GARA 1Z18A 2DBRA 2D00A 1T1SA 2VYNA 2ISQA 4R3WA 5DTMA 1YR7A 2Y1FA 3BQNB 3KU4A 5FWAA 3DULA 5F9FA 4MXDA 2AYYA 2VLIA 4JN6B 3DMPA 5A05A 4AMGA 3GH1A 2BJHA 2AFRA 2OYRA 2OTCA 3L41A 3I62A 4D96A 3DE5X 4GOND 3CX3A 3TR0A 1JFRA 3V55A 4NLLA 4YCJA 2VHTA 3SSOA 2H5LA 2JIBA 2WIJA 3IUEA 1KQGA 3ER9A 3JQBA 4P08A 2ZWOA 3HU1A 3NTUA 4TZKA 1LSSA 1DQNA 2D5BA 1KDZA 1WCXA 5EJ5A 3FWYA 1QGUA 3TTWA 3W5UA 3CONA 2P7IA 2EX0A 1OHHD 2HTFA 2YV4A 2XZLA 5CP8A 3CKKA 4F04A 5A04A 1K0UA 1U0NA 3F6RA 4PVCA 2FFBA 1KF0A 3EUFA 2B25A 2A78A 3N2NA 4UE6A 4TN5A 4ITUA 1GRNA 5EMMA 3VSCA 4NULA 5DW3A 2J0SA 2ZBUA 2NU8B 3CW2A 3TBKA 3P9ZA 1U7HA 3GUHA 3X1XA 5BO5A 4B3BA 2Q28A 5REQA 4ZMBA 1E94E 1FYXA 4ZTZB 4BO2A 1Z4JA 2C3YA 4HYEA 3AI3A 2QGFA 3S27A 2HSJA 4TOIA 4S1VA 4F4DA 1U6IA 1XZJA 1EVLA 2QZZA 2XDAA 4I2VA 3SZLA 3LYLA 1GT6A 1GV0A 4CQMD 3EPJA 1B8OA 1COZA 1EJBA 3E4CA 1XTSA 1NSFA 2AB0A 3KO8A 3LDAA 4IO1A 5LBIA 3LCJA 3ZZTA 5IU6A 1D6NA 5FBZA 2X3YA 3L0BA 3M9WA 3FPHA 3NORA 1CQWA 4C30A 4YJDA 4L74A 4CTMA 3BXFA 2WA1A 5E6UB 2Q5FA 1CY1A 3DFZA 1N5KA 3S2FA 4BXOA 2Y2VA 3THOA 3JQRA 2I99A 4QRDA 4PHGA 3B1XA 3U7EB 1QVZA 4AXBA 1W0JD 1J21A 2ANCA 4C3OB 3U4QB 3C3PA 4KRGA 5DWQA 4QLAA 3U40A 2BAGA 2LGJA 4U3JB 3Q6NA 2C3UA 5HFNA 1F4PA 1IPHA 3RVKA 1YD7A 2HF2A 1K4KA 1H0HA 2UYCA 1ZK0A 5CG1A 1T10A 4NECA 1XN4A 3TQFA 3WGJA 4Q02A 2Z1MA 3KT6A 2CE2X 4DBLC 1C3VA 5CIYA 1EWYA 4EFKA 2NAPA 4H6VA 4DMMA 2ZTSA 1USIA 3WWOA 4KGVA 1ISFA 4S04A 4AKIA 3TDKA 4R31A 1KDPA 3LHDA 4KR2A 1R12A 5C31A 3WL7A 1L4GA 1HOTA 4NX2A 4XRRA 1BKSB 3WA7A 4LF8B 4K9PA 5CT4A 2R1UA 2QM8A 4U2GA 3A1DA 1A9QA 1OVGA 4URWR 3MMPA 5IAOA 3K9CA 4KLRA 3NLLA 2I1LA 1NPTO 3BFKA 1JV2B 4QT4A 2NYVA 4QTYA 1RYMA 1E8NA 4Y9UA 3CT4A 4BAZA 5K8TA 4UUNA 3KWJA 3FMFA 4KTTE 2A7XA 4HUJA 3UA3A 4G0PA 3WK7A 1QTQA 4R1UA 1EFPA 2M1ZA 2R00C 1H6AA 4DRZA 3FPBA 1NU8A 4XR9A 4FYJA 5AHXA 2F4VB 1TF2A 3HFJA 4NNJA 1ONBA 4EENA 2AX4A 1LX6A 2CSUA 1II8B 2OBXA 3OTHA 5K0NA 1T9GS 3LBHA 4K28A 3R74A 3RBZA 1ZIXA 2BKAA 2R44A 4NMMA 2F8TA 4LXUA 2Q1TA 4DREA 1QIJA 4V0SA 2YZ2A 3A32A 2V5VA 1IDN1 2H4ZA 3SC2B 5EESA 1VJ5A 1WDKA 1ZD9A 4L5CA 2R00A 1JEQA 4II3A 2M6LA 5GIPE 3ICWA 5CH8A 3QBVA 4LYHA 5TS3A 4LF9B 4K8RB 4EGAA 3KC2A 2HIAA 3V8NA 1J9GA 1P60A 3DTVD 2ACVA 1W4RA 3A1SA 4IH9A 1GTG1 4KPUB 5C37A 4BV3A 5IUNC 1USWA 4R84A 1H9BA 3QG5A 4CL2A 1YRBA 2OXTA 1F12A 1WOMA 1XAHA 2B8EA 1FTSA 3MWDA 1D4FA 5BQ5A 3C3BA 4WFQA 3ZUPA 1I1QB 2A5YB 3GRVA 1FNBA 1JAZA 2VJMB 1V6SA 3DXFA 3GP3A 1XD9A 4FHCA 2QROA 2Z57A 1SG6A 1G3RA 2YASA 1ULUA 4PXAA 3ABIA 2F48A 4FYPA 5CNIA 4ASUD 4MA0A 4EGSA 1LC0A 2VBFA 2H00A 3D7KA 1K89A 1OWPA 4I1VA 4JBHA 5G1NA 4IOKA 3O3CA 1O0BA 1SHTX 3FN4A 3UMSA 1JG2A 3VR4D 2ZR7A 1HL7A 2JLYA 2HFJA 2Z0MA 1XRQA 4JSTA 3NHUA 3MUNA 3IBSA 3TEJA 3IKTA 2Z58A 2ZAIA 3W3AA 1XZ8A 2A9OA 3N5KA 2MSNA 1O2DA 1R66A 4ZKEA 4DDHA 4TSKA 4HMOA 4F2GA 5GTDA 5CM2Z 5K0JA 3STUA 2ZP1A 1XLWA 2ZS9A 3GJYA 1XK7A 1P7CA 1RKUA 2GPSA 1O8BA 1R4MB 1BXRA 1OKKA 1YMUA 2ZBQA 2DCMA 4R8MA 4I3FA 3WIUA 2R8RA 5JFTA 4LOKA 1Q19A 1ZD8A 3KXLA 3ZWMA 2I91A 2YJTD 4UD2A 3AESA 4G4SP 1JALA 3PCXA 1OAKA 2VZ8A 3QBJA 3O3MB 1DWOA 3DAPA 2I3ZA 3P27A 3ZE6A 1VQ1A 1IJBA 2VYFA 3AW9A 2EZUA 2VNHA 2ZRFA 3QJ5A 3QKWA 4QLOA 4R0VA 4HB0A 4ML3A 2WFAA 2YHBA 3CINA 2IYTA 4KMOA 4MI9A 5FAKA 2P77A 2PT7A 4H60A 5GOTA 1X3SA 5J5VA 2VTDA 1RAEA 3WA6A 1GQQA 4OBEA 3STYA 3I6YA 3RQSA 1F17A 1K88A 5BNFA 1FA9A 2UUOA 2YXBA 1L4FA 4FFNA 4FFMA 1BGVA 2NTVA 4PYNA 1M2KA 4UU1A 3VI4B 4BLVA 4BQIA 5ALGA 3G5MA 5JLJA 5BSHA 4M1ZA 3JSAA 5LQDA 3R20A 2VNSA 4P36A 4RA6A 1Y7TA 4RIFA 3SDBA 2Z2XA 2Y76A 1EDOA 1M1YE 3HUFA 4WZBA 3UB2A 1A5AB 3GRZA 1D8AA 4M98A 4MPRA 3VNQA 2QZ4A 5E6RA 3ZYCA 1IRIA 1JFVA 1SCQA 1Q0PA 2QE7D 2OOSA 3AHFA 1D6SA 3O8QA 3IOYA 4IH4A 1QZTA 4TMWA 3ZY4A 5JSQA 3KBOA 3F67A 1E3WA 1WTAA 1YHYA 2NNWB 2RGGA 4PXSA 4XDZA 3H5AA 3DUFB 3TR5A 2BFFA 5KYKA 2BSXA 1U3VA 3BH0A 3DBHA 2J9ZB 3GY0A 3O4HA 1EFRA 2YZMA 3FRJA 3ICCA 4IS3A 3D7RA 2UUPA 4TLDA 4V2IA 2JIZD 3JAKB 2V9ZA 3OE4A 6ABPA 3VR6A 4Q6BA 4HDNB 1OPRA 1PSDA 1PHRA 4I9NA 4LXXA 3N0WA 4TTAA 1L1QA 3NYQA 2Q1UA 3E03A 2ZUUA 3HG7A 3IRVA 4MRPA 1CY8A 1GTMA 1KMCA 3RODA 4E32A 3LPAA 3KZNA 2NUAA 3B82A 4XYLA 1PIWA 3SJUA 2IIBA 1R37A 3JVUA 4EKNB 3S2YA 3CA8A 5FA6A 1GQSA 1NT2A 1P91A 3AF1A 2O1XA 4BDTA 3QE9Y 2IS2A 1CUEA 1QPZA 3IT3A 5EWMB 3SX2A 3Q3HA 1WSBA 4ZDKA 2XX3A 2A1IA 2CCGA 2G07A 5L3QA 3MCVA 2ODBA 2IXEA 1RYBA 2VDLB 4OMUA 4WVLA 1RBZA 5IWAB 3HKBA 3VRHA 4JS0A 3B6JA 2VQFB 3WSVA 1TKRA 4I08A 1WNTA 4CTNA 2GK7A 4PGAA 1N8SA 4L28A 2UZ0A 1LV7A 1U2DC 1QPGA 2H2GA 3HCCA 4X95A 3WO0A 4DT1A 5B4UA 4RADA 1PGNA 3DBVO 4ZAZA 5IDWA 4RQTA 3PTLA 4E2WA 5BMVA 1UBSB 3FSGD 3KLMX 3MOIA 3PQ8A 3ORHA 4G41A 4O8CA 5CU7A 3UHPA 2QPOA 4OP3A 4O29A 3TYXA 1C7EA 2PKXA 1SC3A 3ESZA 4EB0A 1HM5A 3WMXA 4GPD1 1DIGA 2A6PA 1H2RS 1XU9A 3GIWA 1QF6A 1XPOA 1CY0A 2H1CA 2NUTB 1KS2A 5K9ZA 1SOMA 3TI7A 3HJNA 3TFOA 3DMFA 3DDZX 4XCVA 3DV9A 1PL7A 3RIGA 5CFRA 4I4TA 3KCQA 4HB4A 2W4QA 1BRTA 3FCOA 4UU0A 1U2SA 4ZANA 1T4CA 1ZVMA 1WB6A 2CUZA 3MD0A 2ZUSA 4KAFA 4C6HA 4TKUB 4DA6A 4Z99A 5F1YA 2GO1A 2H4WA 2HOQA 1LSOA 2ODNA 2YCLA 4L0QA 2AZMA 4IEIA 3WI7A 1UK7A 4KFRA 2OV6A 4ILEA 4QUEA 3UCEA 1MEOA 4DLRA 5KYUB 4DUZB 2G09A 3RSHA 4F97A 1O7JA 4MJ7A 2C9MA 3I1IA 1I0ZA 4ZQEA 2J5QA 5ITZA 5KQPA 3C98A 4KO2S 1E32A 1ETHA 5KI6A 2K87A 4A27A 2JC3A 2CKMA 2GCGA 3E82A 2J4CA 4UHBA 1R8YA 2WWFA 5FWXA 3TIXB 4AWAA 3TGLA 5DOZA 5K8VA 4UXHA 1MO2A 4X54A 4BVGA 4L57A 4NU0A 2F1OA 3OC6A 1WXQA 4JOBA 5EE0A 3SOPA 1ZNWA 4DNXA 5JHHB 4R54A 4BVAA 2AZ4A 3GNQA 2XE6A 4OK5A 3SM9A 3V4ZA 7YASA 2V7VA 4DLXA 1KJZA 2QL6A 4DDTA 5IABA 2YZGA 4MKXA 3QKRA 2OHXA 3HLKA 3PPXA 2I9PA 3N76A 3WWCA 4ZI7B 2I6XA 1HBJA 3ELYA 13PKA 2NUPB 4D9CA 3E9EA 3G85A 3OEYA 3IP1A 4Q9AA 2C07A 5ED4A 3ED1A 3O73A 2R96A 4DHWA 5JALA 1M6WA 4I5GA 4K7JA 1Q5PA 3MGCA 3U3OA 2ZI5A 3VDMA 5JANA 2VQ3A 3BX1A 4YBRA 3C5EA 4TLBA 2OILA 5JASA 5J2TA 4KE8A 4UAVA 4C0LA 4RNCA 4A82A 1PGQA 1TK3A 5TLSA 4BYMA 3TD9A 4A26A 4F5ZA 4P5EA 3M0EA 3CNNA 4EQ6B 1U7WA 4F38A 1FJGB 2PH7A 3HKEA 1BD3A 4HN2A 5AM4A 3WOVA 4XVCA 2Y1LA 4LSZA 1CQXA 2DBQA 1J0EA 1F3LA 4QBKA 4D41A 2WWHA 3OD5A 3B48A 3CRVA 4NBLA 1EEXB 5KVVA 1MPTA 4WGGA 4Z2YA 3F97A 1K5DA 3L7JA 5TGDA 4EJFA 3AGQA 3OLYA 3ISJA 4EKGA 4EYEA 4LHYA 4WFKA 3O1HB 5M04A 5EE3A 3AYZB 5ALFA 3V2UA 1HKHA 5HJEA 2XMRA 7MHTA 3V34A 5BXQC 3AVPA 3QVLA 2OOKA 2LKCA 3LGAA 1E92A 3KKZA 5G0WA 3N0TA 2DTDA 3F4LA 1Z13A 1NUUA 1NF9A 1MU0A 3I2YX 3TOSA 3LG2A 4CIWA 1SK8A 4F4CA 2VC2B 4A73A 4A8HA 4QICA 2H1FA 3VYUB 1ISPA 1YQEA 1LNZA 3LLMA 4KX3A 5GOZA 5HEKA 2G9NA 1HNXB 1WBBA 3TLAA 4OFZA 1G42A 2ZR9A 1VRVA 2IF0A 4LE1A 1K68A 3A6ZA 1GSHA 3DTVA 3K0HA 4TLAA 1PJCA 1JR2A 4QWMA 1P62B 1W25A 4H4DA 4TXJA 3F8WA 3E58A 1F4VA 1L3IA 1JXAA 2Q4OA 4MWCA 4DMGA 3NDBB 1N5DA 4X20B 4RZ2A 1CX9B 4DCTA 1O08A 5FYDA 1DUSA 3VU9A 1NYQA 5SZJA 4LOHA 2BOVA 4GPTA 1D09A 3AVQA 4LF5B 1KYIA 1N0UA 3BGWA 4GP6A 2W4IA 1ADYA 2J46A 4DS3A 4OJTA 3IP6A 4Y1GA 1RVV1 4ASUA 4CU5A 4IX9A 2O0JA 2R1TA 1J2JA 3VNAA 3WRYC 5TMDA 4ICIA 1SM4A 2X0DA 4LX8A 4Z4EA 1WMEA 3IXQA 1Q91A 4ZHQA 1QMPA 4MDYA 3O2QB 1DIAA 5ARDA 5JTUA 1JYFA 1U7DA 3N2LA 4UMDA 4B2PA 2L17A 2HK7A 3D0QA 3VR4A 4IDQA 4Q18A 1ODLA 1T5TA 4HSEA 3MT7A 5E3HA 2V97A 3G0BA 4ENUA 3I9OA 4B6QA 1JVSA 2VK2A 5JBIA 2PUVA 3UKJA 1RAHA 2C2WA 3GCXA 4RDCA 5BSKA 3KYCB 2FW7A 2RG1A 3AUFA 1NUPA 3WMWA 5HJ7A 1K86A 2FR8A 3OHMA 4AMBA 3WRYA 2ZEJA 3N8HA 3ZJVA 1DIHA 1K4MA 3ZDFA 4IJ6A 1HT2E 1NFFA 3GA5A 5D5PA 4X45A 4MRNA 2Q4EA 1UPXA 4GSKA 1S8NA 3JVDA 4HVAA 4CT4B 5KSZA 1LTQA 4RKFA 4MQFA 3QLUC 4JVNA 1PF7E 2PX5A 3FFWA 5FADA 3P9YA 2ZUTA 2XT9A 3W1WA 4DHEA 4G4GA 1JKIA 1WU8A 3QMPA 2QX9A 1PKEA 1ULBA 1YR6A 4M7OA 4MV0A 3N59A 2NZYA 4L8YA 1S6YA 2J9GA 2QJWA 3SMQA 4P9NA 4XB1A 3I4LA 2I6QA 4XH9B 4GMFA 1PNOA 1XHEA 4FM9A 4N47A 2OV8A 3U49A 1KMHB 2WJIA 4GPIB 3HCOA 5JEDA 3BMNB 4MA4A 4RABA 4EIWA 1ADBA 1E6WA 4DYVA 2G80A 2O1SA 3LH5A 3RAGA 3ZBQA 2OCKA 1UANA 3P9CA 3A3OA 5AJWA 1G8MA 3ZV3A 1AQYA 1CS0B 2A14A 4HTAA 3PX7A 1ZISA 1FJHA 3GT3A 3N53A 2Q49A 2Y4OA 4G8CA 4CW7A 4HPJB 1Z0SA 2O0MA 4LY3A 3U0VA 3ZX4A 4MVJE 4LTMA 1RQGA 1TIBA 4PC6A 3QTLA 5AK5A 3RR2A 1Q84A 4FLFA 4DB4A 1HE4A 1VJ0A 2PFKA 4GR9A 4WX2B 3RU2A 1QTRA 1TGYA 9GPBA 1NN5A 3OQMA 4F5EA 5EIEA 4EB6A 3GLVA 3QVSA 2DRIA 2Y05A 1XG5A 2D5IA 3EEFA 5CVDA 4F4HA 4YMUA 1N3LA 4HFRA 1P0MA 3QHPA 2DQZA 2C9CA 3B12A 3PPVA 5JFOA 4CTKA 1PZNA